1RVFL

Fab complexed with intact human rhinovirus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
110
Chain Sequence
QIVLTQSPAIMSAFPGEKVTITCSATSSVNYMHWFQQKPGTSPKLWIYSSSNLASGVPARFSGSGSGTSYSLTISRMEAEDAATYYCQQRSSYPITFGSGTKLEIKRADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN
publication title Neutralizing antibody to human rhinovirus 14 penetrates the receptor-binding canyon.
pubmed doi rcsb
molecule tags Virus/immune system
total genus 19
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 1996-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rvfL00
1JF1B 5CEZE 1EFXA 4U7KA 1FV1B 2JJTA 4OLWL 3DIFB 5K9QI 3V5KB 4ZG1A 3H6JA 5IJVA 4IRJC 3U30B 2X4QA 3RWHA 4PGEB 3SE4C 5BZDA 5C0RL 4U33A 3EYVA 3LRHA 4ISVA 4LASH 4F15C 2OP4H 5KSAD 3BJLA 2QQNH 5CD3A 4KMTL 1Q9OB 5SWZD 1I4FB 1IGFL 4JE4B 1S7RA 4YFDB 5C0BE 4ZFFB 3VFRA 2CLRB 4CMMA 3OJDA 4PS4L 2OXHA 4PJXE 2UWEE 3HMXA 5JHDD 3N9GH 3LKSA 3T09A 1RZGA 1RZ7L 3MRQB 1HHKB 1BF8A 3ZE0E 1K4CB 5IHLB 5F71A 2DQCL 3VRIB 5AUMB 5DVLA 4JHBA 2JJWA 4LQ1A 1FNFA 3HAEA 1NBYA 1VFBB 3S4SB 3JV6A 2AJZA 1WBYB 5FV2A 5IVZB 1I8MA 1LD9A 4S1RH 1N6QL 1T66D 3NCJL 5F7EH 2Z93A 4OF6A 1DLHA 2ENYA 5E6ID 3T1FA 5SWZE 3A0OA 3QWOB 3HAEG 4DGIH 1G7HB 3MA9L 3DX8B 5DHXB 3D2UB 1LO4L 1PYWB 4ZNEA 4HZLB 5JHDE 4Z7VB 5TFSL 1OGTA 1HHJA 5EU5A 1YEHL 1DE4B 2BC4A 3EYQC 3FCTA 1C7TA 1FE8L 1KTDB 3R06B 5HGDB 4M7LL 1FG2A 4UUJB 3TN0A 3BDBA 2IADB 3U30C 1AIFA 2P8MA 5K9JH 5GIRA 3F58L 1IM9A 5KW9L 2IALA 3FFDA 4YDIH 3QBTB 1Q0YL 2DLTA 5E94B 1SYSA 1U2HA 3BP6B 4J8RB 5HHOE 3JWOL 1TETH 1INQB 2BVEA 3CMOL 3BGMB 4L4VB 4XXCA 1JZ6A 3TO4B 1C5BH 4W4NA 4RGNB 3ZKND 2GYSA 4C54A 3UBXG 4OB5H 3S8WA 3X3FL 3BKCL 2JJSA 5BW7C 1N59A 2F9BT 3L7FA 4X4YB 5FYKH 1A6VL 3BSZH 5DFTA 3LQAH 4DEPB 3UTZB 3BUYB 2IPUG 4WHTB 3BKMH 1FYTB 4HUVA 4UT7L 3UTSA 4WEBH 1KFAH 3ARDB 5JLZB 1FO0A 1AP2A 1MIEH 5E4EB 3PP3H 3E6FA 4X6BB 1ZANH 4TUOB 3LKPA 1G9NC 3THML 3ZKNC 3CVHL 5IMMB 1JGEB 3QP3A 3C08L 2VLKD 3OB0K 1LDPH 5J6HA 4OZ4A 5T1KD 2UVFA 2VDNL 4P5KB 4OZFB 1YNKL 3JWDL 4DQOL 5JOFA 5DHVB 3CDYA 4M6NL 4AT6B 1G7IA 2APXA 3TIDA 5DWUL 2ADFL 2YSSA 4MS8D 2RB8A 5GS0C 4JN2B 5FECB 4G8GA 1QLEH 1A9BB 1OTUC 4JFQB 3UTQA 3QQ4A 4KK5D 4Q6IC 1CVRA 4O58L 1WAAF 2VLKE 2WBJD 3SDAB 2ZPKL 2QQLL 4YHNA 1D5MA 1NJ9B 3LV3A 3RWEB 5BRZB 4LEXL 1ZSDB 5CJOH 1SBSL 2MCPH 3QJHB 1MCDA 4UNTA 3DHMA 3E2HB 1AGEB 1U91B 1JV5A 2BVPB 4KPHH 3V7AE 3ZDZF 1JYVA 3OV6A 3BO8A 5JO5B 2ZJSH 3ARDC 1CD0A 3B8YA 4M7LT 5DD6B 1CICB 1MVFA 5MERA 5HY9A 1R24B 2P7TA 1MAKA 1KXVC 4KGLA 1G7JB 4XVUD 1JNLH 4HX1A 5D6CB 2BDNH 3TJHC 1WFOA 4KRLB 4O2CB 3T3ME 4J3VA 4P5MA 5ANMB 2AAVA 4WRLA 3TLRA 4TULH 2R1XB 5GXBB 5DFWH 5ADPH 1SY6H 5I1JL 1I9RL 4XPBH 4PG9A 4J2XA 5FO8B 1G7PB 3O6KL 3O9WD 4Y19A 2CLVB 5FKAA 3VXPA 1OF2A 4H0HB 4GW1A 1I1AA 4K3EH 3EKCA 1S3KH 4XHJC 5DRXA 4IHOB 4WHYH 4F9LA 3HR5B 5F96L 2GTWA 4M1DL 4RIRB 4LCCC 2YD4A 2ZUVA 3H9SB 3GHEH 2W60B 1X5GA 2GJZB 3GO1L 4MJ6A 3NCFB 5E8EA 4UTAL 1FVEB 1FVDB 1P6FA 2F5AH 2BJMH 1S5HB 2AGJH 2ZSWA 3HNSL 5DJ6A 1UH4A 3HZYA 4ZXBD 2PW2B 1XZ0A 2IF7A 1A9EB 4Z0XB 4W70A 3RVUD 5TE4L 1R3HB 1HXMA 1HYSC 4N8PA 4P4KD 2EC9T 1ZHNA 4PRNB 4NNPL 4HUMB 4ZSOE 4WFEE 3L7EA 3QUKA 3MFFA 2ICWA 1HHHA 4MQ7A 4EUPH 2QEJA 4JKPH 1UM5L 4H25B 4YR6B 5E70A 1ES0A 3IDJA 1I8KB 2XI9A 1J5OH 2VAAB 5CILL 3WSQH 5TPWH 3QH3A 4Z7WF 5DSCA 2C1PB 5ICXA 1QRKA 3QHZL 3NH7L 4JJ5A 3H3PL 3TC9A 5I18H 3L3DB 4F80A 4NN5B 3FQNA 4XMKH 5BXFB 2R23B 3EDJA 3L3HB 4WI7A 4HCRL 3RHWF 4OV5A 2DQFA 4GAYA 2A77L 2IWGA 5E1HB 5C07D 3VD9A 4U6TA 4HH9A 2DWEB 3BP5A 4UIMA 4BH7A 4RAHA 3QDJA 1FSKC 3T4YA 1NCAH 2D03L 2YBRA 3JV0A 3MA7B 2Z35A 3L6FA 3IB4A 1NANH 1ORSB 4U2ZA 1NFIA 3C2AH 4M7ZC 1VFAB 5ILTL 5E8DH 4Z7QE 2OL3L 4EI5A 5HBBA 4LMQI 1NGQL 3VFMB 1HQRB 3FT2B 4LEOA 3SE9H 5HGAB 5HXMA 3TYFB 1CGUA 4MNHB 5I1EH 3GMRA 4X8JB 5C07E 1ZLVK 1F4WH 2Y6SC 3ZT6A 3DROA 3MOAL 2GUOA 2R0WL 4IOSD 4ZQKA 3UJJL 2YZ8A 3O2WH 4PRPD 2W9DH 5JW3H 4PJIF 4HFUL 2V17L 2X4NA 4TPRH 5KVDH 5IF0B 4GQ9H 3SN6N 4AH2A 3V4PL 3ARWA 3P11H 1RHFA 5KANG 3GIVB 2ED8A 3HUJF 3RGHA 1NEUA 4MAYB 1OARL 3NIDF 1U6AH 3IXAB 3KYKH 3CUPA 2EDHA 1I1FA 3J8F7 2AK4B 3BUTA 2FZ3A 2XPGB 1T04B 4JHWH 4Z7UB 1J0IA 3UYRL 3N1PC 5KN5A 5FGSA 4TSAL 5LWYL 4PRPE 2R8SH 3QDMD 5TH2B 2CRIA 1B90A 1WBXA 3O3EA 1GC1L 5C0JA 2JCCA 4IS6B 5CS7A 4YC2B 1KN2H 5DJ2A 1CL7H 5AZEL 1UCBH 2DM3A 1KEML 3KLSA 4WU5B 1X6LA 5DURD 4RFOH 2AEIT 4LOUD 2YD1A 3S88H 4U6YB 5HHVH 5I1DB 1FGVL 1DBKH 1P69B 2IEPA 4E41A 5EA0H 3WIIH 1AGCB 1BGXL 5DUML 4XPTH 5FB8A 3BGFB 2CRYA 4JFPB 4WI6A 4UV4L 4K3HA 1JF5A 4GRWB 5ENWB 3WYRA 4M5ZL 4Z6AT 3QDME 4YE4L 1UGNA 3QRGH 1LWRA 2H6PB 4CJ0A 4MQXC 1G7LB 3QXVA 4FTVD 1RZKC 4LPYA 1B2WL 4WJ5A 4NPYB 1CFQB 2X5PA 4XCNA 2WUCL 1R5IA 5AYUL 3CSBA 1P6AB 4MD5B 4L5FH 2HVJA 1WZKA 1HCFX 4PRHE 3MV9B 1UB5A 5IB1A 1HXYA 4NM8H 3JSSA 3SGKC 3W0WD 4JQXA 4GXVL 4N8VB 5EZLA 1MFEH 1VADB 3FO1A 3QQ3A 4MA7H 4X5LA 1BBJB 3PNWA 5CAYB 3IDXL 5DJ0B 3S7GA 2PNDA 1R0AH 3RWJB 5TQ0H 4YC2C 3KPMB 5ECJE 2LVCA 2QQKL 3WXWL 4FTVE 3JUZA 3KS0H 4JM2D 5GGTA 1DR9A 2VDQL 1LP9B 4WI9A 4BFBD 3IXTA 1JMXA 1Z2KA 3QRFM 4LARH 3BIKA 3PGFH 4XVTH 4TNWF 3T0EE 3T0EC 5LGHL 2GT9A 5GGVH 4M93B 1MRCL 1RU9H 4NJ9L 3BGFC 3SDXF 4ZUSA 4ZYKA 3DVNA 4K8RL 4MNGE 2UUDK 5C0IA 1DQQB 2HG5A 1EEUA 2J8UB 4K7PX 1XIWA 3MNZB 1S7UA 3RAJL 1I7ZB 1TJHH 4OZGB 3G6JF 5I15H 2Q76B 4KTEL 3EYUL 4PV9A 3EO1A 3RUGB 4HK0A 5E8OA 4L8SA 2C4FT 4BH8B 1Q94B 5HVWA 1BOGA 2GHWB 5ACMA 4TRPL 2AJXH 4KDWA 3FMGH 2KZ1B 4GAGH 2ARJA 2FHCA 2P46B 1YEGH 4HDIB 1MUJA 3L5IA 5BJTB 2DM2A 3GSNB 3PXHA 1QO3B 1YEKL 3MGOA 1U8HB 1UG9A 3FJTA 3D18B 1A6TA 1EAPA 5BMFL 1VGEH 4GFTB 2JKXA 4WUKL 4KK8D 1YDPB 3MNWB 5KG9B 2B1AH 1GRWA 1ONQA 2BSRA 1OSZA 4XB8A 1IMHC 3TT1H 5F7LB 4W6YB 4KH2A 3QG7H 4FN0A 3HC0A 2CDGB 4YFEA 4M4PA 2H3NA 1NSNH 1B0GA 4K7PH 5GGQL 3SKUD 4PB9L 1DQLL 4X9FA 3S34L 1PEWA 1UXSB 2F54B 4GG6B 3ZTNL 1QRND 4Y4FB 5E2JA 4TSBH 3RGVC 1QVOA 4M93C 4XP6L 2KDGA 4PJEF 4KJPD 5DJAB 4KDTA 4EIGB 3UTTA 5EN2A 4OLWH 1KULA 1JFQH 1OT2A 4OKDA 1F4YH 1J12A 2IPTH 3UDWA 2C9AA 4MD4A 5K9OB 4U7MA 1FLRH 3ARQA 3VDCA 1KSRA 1BPVA 3BRDA 3IFOB 4ONHB 3ARGA 4MJIB 2G60H 1C5DA 3D48R 2BOCB 4WU7B 5EUOA 4PG2C 2XTJD 2HKFH 5F1OB 5K59F 4WNQA 3NCEB 4BA8A 3FL7A 4NSKB 3CPLB 4QT5B 1MCEA 3GMMB 3MRDA 3QEHA 1T2XA 3V0WH 4KGJA 5C71A 2DL9A 1WBZA 3EFFA 3K81A 4M8VA 4GW5A 4LCUB 1S7XB 3UPAA 4CVXB 1UENA 3EBAA 1QFUH 1GZPB 2B8OT 3F65A 3O3AB 2IAND 4PLKD 5DZLA 5IBLD 2FCBA 1N6QH 2BHZA 4K55A 3IDNA 4PJBF 5F7KC 5FOBA 3ARFB 5EBMA 1A1OB 1F97A 1IGJA 4JCLA 4XCFH 1S9YB 1V8HA 4RFNB 5I0ZA 2X4PA 2XTJE 3GRWA 4L1HA 1BZQK 4X6CB 4Y4FC 5D6DA 3SPVB 5TFSH 4LKXA 2XRAH 3E3QE 2CR3A 3MREB 2CGRH 1DL7H 3GBNH 3F5WA 3RDTD 3KPSD 4MWFA 3FOMA 1B4JH 3TBTA 4NUJA 3RVVC 4P2YA 2NY7L 4LRIA 1S78C 1QYGL 4NQVB 1J8HD 4Y2DB 4MDJB 3G5ZA 5MEQB 4LAQH 1ZHLA 1A2YA 3ARRA 1RMFH 2R15A 4DZBA 4Y0GA 4HF5H 4YXHL 1DUZA 5JORA 4PJAE 3MXVH 1Y0LA 4JVUA 4MZ2A 4XAWH 3SKJH 4U49A 1YJDH 3OGCB 1NGYA 4FQLL 2YPKB 1KJMA 5E9DD 2ESVA 2YRLA 3HE7B 1TZIB 3QUYB 4HIXL 3OGOE 4L3CB 1U8JB 3RDTC 4F3FB 1OP9A 2FSEB 3QIUA 3KPSE 2C3GA 4PJHA 3ZYIA 3KLDA 4U0RB 3D9AL 1MHEB 1WSST 3X3GH 4MX7A 3ARBD 4QOKA 3BPLB 3BP4B 5E5UB 3ORJA 1EBPA 2NZIA 4PBXA 4YLQT 4KZDH 3SDCD 4U7SA 3L3OB 1NCWH 2ZUXA 1KC5L 2UZXB 1CTNA 2P4AB 3SCMC 1GXEA 1PLGH 5IVXF 1U8IB 1T3FB 4PJXF 1M71A 5F8RC 3PL6B 4I3SL 5HYEA 5IMLA 3PQYD 1CFBA 1D9KD 2ED7A 3SQOL 4C83A 3CVHH 5IB4B 3VXUD 1QTYT 1KPUB 2DQUL 4MJ5B 1XF1A 1YPZA 1G9MC 3KYNB 3TZVD 3U48A 2PW1B 2VDNH 2NY2D 3ARBC 3DPBA 3QZWA 4LNRA 4Y2DC 3C8KB 2DRUA 5KSBE 3VG0H 3B3IA 2EDBA 3K2MC 2IMMA 1U8KB 1WITA 2O61B 3RX5A 3V6OE 5DWUH 2A38A 4PJ9A 1UEMA 5CBAB 5HYQB 1S5IH 5GZOC 1BFOA 2BX5A 1WCBA 2AERT 3QZWG 4XPAH 3KR3L 2RCSH 4Y1AE 1CK0L 1G1YA 1S7WB 1Z9MA 4WGVB 3ARVA 5JW4N 1E4XH 4ENED 3IFPA 3HE7C 2J7LA 3L3IB 4I8DA 4O58H 4LSPH 3VXUE 4X7FC 3MJ6A 1QKZL 2IAMB 2GJ6D 4HIEB 4QXTB 2VH5L 1XR9B 4X0KA 3DO3A 2AXHA 3BPLC 4MA3B 1NBVH 4ODVL 2YRZA 3QDGE 4CADB 2VDPL 1Q9WA 4JANB 1J1XL 3VXNB 4NJAL 4Q97A 1UKTA 3TP4A 4F8TA 3QR2A 5C0DB 5DK3A 5CEXA 2X1QA 3WNPA 3LRSA 4OGAC 3PL6C 4YDVA 2MMXA 3WJLA 4HULB 5C08B 5FGBC 5IW3A 3KVQA 5D9SA 4FNLL 1T5XA 4JFDB 4NQDB 4G8EB 4QRRA 2GJ6E 4WW1A 3V7MA 1QSFA 2EDFA 1F4AA 4J7RA 4PJFB 1MCNA 1OP3H 3REWA 2BVQA 2P49B 1F11B 5MI0B 5KSVA 4OZIB 3PGCA 2AABL 4P2RA 5L7XL 4QNPF 3U36A 5FFLA 1IAIM 4JO3H 3ZKQD 4MLIA 5F96H 3D85D 4D9RD 1SEQH 2X7LA 5J9PA 2IPKB 1LHZA 4JRXD 3TBVB 1J1PH 4WWKA 4RQQB 3GO1H 3KYMB 4N0FA 5IVOA 3UC0H 4TNVK 5DTFA 1JZ8A 5GRJL 4UTAH 4QF1A 1HIMH 2BSSB 3AAZA 4RBPH 1A7PL 2QQQA 3RZCA 3TT3L 4A6YL 2YKLL 4UQ3B 2I26N 5EO0B 4EOWH 3QFJA 5D96C 1AGDB 2I9LA 1UWEH 4WUUD 3R0NA 3BWAB 4LLUB 4O2FB 1BHGA 3U7AA 3HE6B 1T83A 3HPJA 1PG7W 3CFDB 1EO8L 1MF2L 4D9RE 3GI9L 5EBWA 3EJZD 5BVPL 4GH7B 4NZRH 3RNKB 2DQJH 5SWQB 1C16A 4BZ1H 2DQHH 3GSRB 3HR6A 3VGGA 4UV7L 4V2CB 4ZFOL 5CILH 1NL0L 4MNQD 1TQBC 2XN9D 2J12B 2MKLC 2Y07H 3NFPB 3WMSA 1KLGA 3OZ9H 1C12A 1WC7A 4Y4KA 5CHNB 3VXSD 3WFBH 3MO1A 1D3CA 3RVWD 3REVA 2Q7NA 4PGDB 3MRGA 1I1CA 4RNRB 4WW2C 1NAKL 1EA9C 5MI0C 2FGZA 1UKQA 3DNKA 4HCRH 3RKPA 3QIBB 4XMLL 4PUBL 3NCYP 3QDHA 3BEVA 4BELD 1IGMH 5MEND 3EJZC 4DKAA 2HTLD 5KJRH 3GM8A 4GLRH 1JNNL 5FV1L 2PCPB 4DOHE 5D7LB 5DQ9B 4AG4H 3NABH 5J4MA 4U1LA 3BYTA 1NMBL 2V2WA 4M43H 2XN9E 3W2DL 3HLAB 4MHHI 2NY6D 4CKVX 1NGQH 3EO0B 2V7HA 3D6GA 2WINA 1MHPL 3T65B 3IDUA 4OBRA 3Q5YA 5F9DC 2M1KA 1SQ2N 5KS9F 4JG0L 4HIJA 3P40A 5MENE 3MOAH 4I77H 4ELMF 2MTPA 4ODXA 3G5XB 2APBA 2D4DA 5HYJA 2GCYB 4XPGL 1IGYA 2V17H 4XXDB 5FKPA 1NFDE 4QRPB 5EU7C 1P7HL 2H45A 2GK0A 1S9VA 1DP0A 3UPRA 1X5AA 5GHWH 4JZNA 4OZHA 3RY6C 3R4DA 2NY6C 5DR5H 5EOCH 3K7UA 1JPTL 4F7PA 5D7IB 3EDKA 5IV2B 3MROA 3BOVA 2E9WA 2W07A 3C6LD 2CDEB 3WFCH 2OI9C 4JN1L 3S6CA 2VRAA 4KMQA 1FZJB 1XH3B 3VXRB 1EVTC 1HSAB 4Y5VB 2OZ4L 3EYFA 1F90H 5LQBH 3B83A 4WENB 4JFZH 4FQJH 3MRCA 5HPOA 4BQBA 2WANA 1FZKB 3JWNC 1UQSA 3EZJB 4JO1L 3B9EA 3PWVA 5CKAA 1SYVA 4PTUA 4J3TA 1KEMH 4ODUB 4FQ1L 1I8LA 5CWSA 5H94B 2NXZD 3W5MA 1SMAA 5F1NB 4R3SB 1YQVL 2HVKA 1WZ1L 5EU6A 4D8PA 3BKJL 1S8DB 3D69A 4J3SA 2Z0BA 4JAMA 4KQ4H 1AR2A 4JRWA 4R4NC 4WEMB 5GSVA 5EO9B 2L7UA 1IAII 4GMSL 3T2QA 3VI3E 5JXED 1G9NL 3DVGB 3BXNA 4LSVL 1CFNB 1DVFD 5IFAL 1QFWL 2PTVA 5F7YC 2PTUA 3HPLA 5SX4H 2AEPL 1ZHKA 5J3HC 2HT2D 1O7VA 5LGJB 3DXAA 1U92B 1H8SA 1J86A 1SY6A 4PJ5D 3BE1L 4I2XE 1MIMH 3P4MA 4ERSL 5GS0L 1ZGLB 3FTGA 5HVGB 4EEEA 2NY4C 1T03L 2LU7A 4R0LA 5DQDL 2GY5A 1LE5B 3IDXH 2OBGA 5I1GH 4FXGB 4PJ8D 1T5WB 4XP9H 3DVIA 1U3HB 3DRTA 3WNNA 5DD5L 4ONGH 1AXTH 4XNZC 5HGBA 1YY8A 3WXWH 3LS4L 2CDFA 3TBYB 4OCRH 2HT2C 2G5BB 1QPXA 2JIXD 2VDQH 3QUMA 4M6ML 5JNYB 3FO9A 4LIQL 3L3JB 1PDKA 3H7BB 3VRLE 4N0UB 4PJ5E 4TVPL 5B21A 3SDDA 3KPRE 1U93B 3MRRA 3GJEA 1QFOA 2BRRL 1JGVH 3LHPL 3ULUC 1WT5C 3ULUE 1MRCH 4G7YL 3X12A 4NJ9H 3BZEB 5DA4A 1KB5B 2VLJA 1BJ1J 2OTWB 2Z8RA 4MDIB 4YHZL 1F3DH 1RAMA 2GFBB 4HKXA 4G43B 1WV7T 5CP7A 1HQ4B 2AXGB 3CZFB 2AW2A 5DJCA 5IFJA 3WBDA 3RU8H 3RAJH 3MV8D 4PJ7F 1FZMB 3MLSL 3MJ9L 4M1CD 3I6GB 4CVZA 1J7VR 5HHPA 1EGJL 4JDZB 4LVHB 2DIAA 4NQEA 5FEBA 1XF3B 4KC3B 2A6JA 3OJ2C 4U0QB 3F12B 1DBJH 3ZYOA 3E6HA 2HMID 3BWUC 1CFSA 4L4JA 3LDBC 4DJMA 5HYSB 4JY5L 1YEKH 1NGWA 1SVZA 3UAJC 4RMUA 4ZOBA 4XCEB 5T1MB 4BFEA 4WUKH 4WY7H 4YWGH 1OB1B 3QEUB 1T1ZA 4ZUVB 2HFFA 3FB7A 3MV8E 5I1LB 3U46A 2DLGA 3OG6B 3FHAA 2WBWB 4M1CC 1HH6B 2VDOH 4KZEL 1YMHB 3MBEA 2XFXA 2CMRH 5TE6L 2ADJA 3D25A 4MYWB 3S34H 3CFJA 1YYLL 1J1OH 2OTUB 2HMIC 1D6VL 4FQQA 4XP6H 2R2HA 2ORBL 3QCVH 1J05A 2D7PA 3LCYA 4L29B 3DX6A 3T08A 1YYMH 3IDIB 1WUNT 4H1LH 5C09B 2R0LL 4L8DB 1R3IH 3TA3B 5EO1B 3DV4A 4ODSH 2BK8A 2EIZB 3HG1B 4JPIB 5LAXB 3SKOB 5F3BA 4ZFOA 4Z76A 1KENL 2P8LB 1JYWA 5FUZH 1RZFH 5CFHA 4G6JH 4KFZC 4IRJA 5A2IH 3SE4A 4LVHC 4N8CL 1BFTA 1IC5H 1BZ7B 1QEWB 3U2SB 1I8IB 2V5TA 5TDNB 3ARTA 3GMPB 1CGTA 3LQMA 4XP4H 5C0BA 1INDL 3H0TB 3TNMB 4OLUL 2UWEA 2ARJQ 2CKBH 4JPVL 4JFHD 3S96B 3SGEI 4D0CA 3CLFL 2Y23A 5K93A 3VFSA 5FDYA 2GSGB 1MCOH 1NKOA 2R39A 4EVNA 4JZOB 3MRNA 3FQWA 3VWKB 4WFGD 3P9LB 3AU1A 3TO4D 3LN4B 4MXVE 3GSOA 4G9FB 1BQLL 5KSAA 4RGND 3E0GA 3L5XL 1N26A 3MRIA 3PP4H 4LSTL 4OCXH 3NZ8A 4WFHD 5SWZA 1IC7H 2AV1A 2JELL 1LK3L 3PE9A 1MFCH 2XWBB 4PJDB 1FIGH 5M95B 1P53A 2ZOKA 1QQDB 2NY7H 2P5WB 3UBXI 5JHDA 3VXOA 4GS7B 4ODTL 4JFHE 1ZTXL 4R8WH 4J3XA 3IDYC 4GKNA 1YNLH 3W9EB 1G6RB 5F7UA 3QULB 3DGGA 1RUPH 5F6HJ 2HT4D 1FL3B 2HN7A 4WFGE 2OJZL 4OKVB 1XGPA 2K3TA 3BHBA 5DD0H 3BEWB 1URLA 2Q1EA 1QD0A 2VWEE 2VWEC 3FQTB 3S3SA 2NY0D 3TIEA 1I7UB 1PSKH 1E4WL 5F6IB 3ZDXF 3IU4L 5HHOA 4OF7A 2DDQH 2FX9L 2VDLH 4G8IB 4HJ0D 2HRPL 1JK8B 1N0XH 4ZDHB 4Y4HB 4R4FL 1F8TH 1X4XA 5ESVA 1BQSA 1Y18A 5BW7A 4PY8J 3P77B 1KC5H 2CLZB 5C0EA 1RJZB 2FECI 1H3PL 5EC1B 2XWTA 1MFAL 1N2RA 3LKOA 3MJ7A 4NZTL 4UILL 5IIEA 1N5YL 4RFEB 1KBGL 1A3LH 3SDAD 5C0CB 2CK0L 1Z0MA 1QNZH 1L7IL 3H42L 3RVTD 1UA6L 3OR6B 3I9GL 2GTZA 4PGCB 3LN5A 3O4LB 1MOEA 4HJ0C 2DQUH 4HGWA 3MRPB 4HK3N 1RZKL 2EDEA 5ISZE 4YHOH 1K5NA 4JO4H 3ZTJG 2CPCA 1CDGA 5HGDA 3TVMB 2P44B 1BIIB 4S1DD 1B0WA 5IHZA 4HZAA 4HJGA 2FGWL 3KDMA 3IDMB 3LPWA 4YO0A 1CICD 3HZMB 1YC8A 1IEAB 1NLBL 1RJYB 4RWHA 1L9MA 1DQTA 3GM0A 4XTRD 4Q9BA 1I9JL 2FBJH 2MOVA 4LCWD 3MRFA 2R56H 5D2LB 5EOTB 5C0NC 1QKZH 4KU1A 2VZVA 2G75A 4YX2L 5IW6A 1CN4A 4Q6IA 1I85A 1WK0A 3QDAA 2VLKA 5D5MF 5ERWA 1JWMB 1A6WH 3LB6D 2AKRB 4Q2ZB 5DLML 1PQZB 5T1KA 2QKIA 1U8MB 4CDGC 3MR9A 1U36A 2CKNA 1B0RA 2X05A 1MFNA 4E42B 4HGMA 5FHAL 3VXMD 5D1ZB 3OAUL 4HBCL 4XP1L 4FG6D 4N1EA 3U9UA 1FYTA 5F1IA 4LCWE 3VGEA 4F8QA 5T1LD 2WIIB 3GIZH 3CH8A 1QHPA 4ZTPH 3ARDA 4OM0H 3I3DA 5D7SH 4ZTOH 4AQ1B 1K8IA 1NGXA 4U4BA 4F37F 1U58A 5EORH 3V7AG 5IW1A 5D1XB 5K33A 1XEDA 2V2XA 4KQ3L 1QSEE 2WBJA 4L3EB 4NO0A 4OAWB 1FYHB 1HZHL 4OCSL 2NY3D 3L1OH 1RUAL 3HB3D 2WM0A 4U1KB 4YBLB 4Q7DA 3SHSA 1AGBA 3OAZK 4F9PC 3WNKA 5I16B 1Q1JL 1OAKL 3VXME 1OOAA 4L9LC 2VZOA 1EGJA 1W72A 3CFEA 4FG6C 1OLLA 4HS6A 3UROR 1YC7A 1Q9KA 2F53E 5GRJH 3EHBD 4NQUA 1KJ2L 3EJYD 1T2JA 4DTGH 4LCCA 4GKSA 5FECA 3WCYA 3OKLA 5ESAA 4OGYL 2WMPA 2B4CC 3NCBB 5GSRA 1MH5B 5KSBF 2FWOB 3ZKMD 2ICWI 4JY4B 2A9ML 1D5XB 4PRID 3V4VH 3CSYB 1UB6B 4Q58C 3TF7C 3B5GA 4P2OB 2NY3C 5INCA 5EIIB 3HB3C 3S37L 1MF2H 5C70A 3DV6A 3MRKB 3W39A 1XAUA 4NRZB 2LE9A 4XRCA 3QXWA 3I6LE 4O4YH 3PV6A 3BRGC 4WO4D 5FM8A 4UV7H 4RA3A 2P24B 1T21A 4ZSOA 1P7QA 2BRQA 1LE9B 1OQOA 2IQ9L 3CXDL 3MOQA 4UU9A 3EFDH 4Q9RL 5J06A 1JYNA 2DWDB 5KVGH 1R24A 1R3KA 4DVRL 4LHUB 4F7EA 4JPKH 4AENA 4PRIE 1X5ZA 1XF2B 4UNVA 1HOCA 1NAKH 1GGCH 4LLQB 4POUB 5CMAA 4XNQA 3RL1A 1S7SA 4XMLH 4ZXBA 3MRLA 5HI4D 4G5ZL 3PWUB 2VQ1B 4Y5XB 4LCIH 3LKRA 1TNNA 2A83A 3MCLL 3RIAF 4P4KA 4WO4C 1DEEA 4I5BA 5HDBF 3GSNL 5E00B 4IHOA 3Q6FA 5GRVK 1OD7A 3W2DH 1EFXB 3ZE1F 1E6OH 4MAYD 1F3JA 1KCUL 4PD4J 4HLZH 3FO0H 5IJVB 5JA9A 5I17A 5KANI 2X4QB 1BD2D 3RWHB 1N6UA 5BZDB 5DVNA 4P2OC 4O2EA 3EYVB 3QNYB 4ISVB 3IDGA 5EIQA 5DFVD 4N1HB 5CD3B 2AQ2A 4JG0H 4NHCL 2QSTA 5HHMB 3B4NA 4Z8FH 1S9XA 1CR9H 2HFGH 1S7RB 4JQVC 3VFRB 1I1YA 4CMMB 3OJDB 2R0KL 4PGJA 5AZ2L 5C07A 4W4OA 2IBZY 3LKSB 5DMIH 1LDSA 1RZGB 4RGOL 1BEYL 5DUPH 5CD5C 4HUXA 1OSPH 3QIWD 2VIRA 1JPTH 4KRPD 1DTUA 2VZSA 2YS4A 3HAEB 3O41A 1NBYB 1BD2E 3JV6B 2AJZB 4HUNB 4KK6C 4O00A 1I8MB 3ARXA 1LD9B 5DFVC 1NCUA 2RIKA 3RX8A 4OQTH 1JL8A 2Z93B 1DLHB 3T1FB 4X6DE 2OZ4H 3V6ZA 2C3HA 4PP2A 1GPOH 1MQKL 3BN9D 4WCYH 3QAZB 1OGTB 4UI2A 4EN3D 1HHJB 5EU5B 2BC4B 3FCTB 4QHUA 2V9QA 4HWBL 5ADOL 2A6DA 3ZE2F 4OFVA 4PRPA 4TUJA 1FG2B 3TN0B 4N9OB 2EH8H 1AIFB 2P8MB 4PJCE 4M4RA 1OD9A 5GIRB 1YQVH 1T2QH 1BFSA 2X6MA 2IALB 3FFDB 2VLRD 2VXUH 4M9PA 1HKLH 1PZUB 3AM8C 3N0PB 2NQCA 1SYSB 4JY6A 5DDHB 5J13C 5T3ZD 2NTFA 1AXSA 4H8WL 5CSZA 2Q20A 1ED3A 5IFAH 3BN9C 1OPGH 3VFVA 2I07A 1YEEL 2O26U 3LZFL 5ELIA 1MCIA 4N0RA 1XGUB 2F8XC 2GK2A 4LVNB 1OP5H 3QDMA 1N59B 3L7FB 1KJ3H 3EDEA 5SWSD 4LDEB 2FBOJ 2VLRE 2F5BH 4HUVB 1KEGH 3UTSB 1A3RH 5T3ZE 4PRHA 5I76A 2CUIA 1FO0B 1AP2B 1F6FB 2VL5A 4LFHG 1ZGLP 1JZ5A 3SGKA 2R0ZL 3E6FB 3QAZC 4JFFE 3LKPB 4L9DA 4JQIL 1CBVL 1EPFA 3P4NA 1WWAX 3VRJA 3WE6A 1KYOK 4M6MH 1RURH 2ZWLT 3BGAA 5J6HB 5JIKA 3DMMD 4OZ4B 5IWLA 5JUEH 4CNIA 1SBBA 1TZGH 2BRRH 4FTVA 4RGMB 3W11C 4AL8L 5SWSE 5JOFB 2YUVA 3RTQD 1G7IB 3TIDB 3WL9A 1U8QA 3KLHC 1SMOA 2YSSB 5MP6L 3MV01 8CGTA 4HC1L 4YHZH 2J8UE 4R2GB 4QHKJ 2VC2H 1AGCA 4G8GB 4P9MH 3T0EA 4ZUUA 2N56A 1H3UA 4XXCC 3UTQB 2OK0H 3QQ4B 5F89A 4Z95H 1BF2A 3MJ9H 4FS0A 4MNGA 5GJSL 5FUOL 2AJSH 4OZFH 3SO5A 4YHNB 1D5MB 2ZKHL 3LV3B 2A1WL 4LVNC 3M8OL 3DMMC 1WIOA 2F54D 5I8CB 1C7SA 1CZ8L 3LS5L 4P2QD 4LU5L 4UB0L 1RVFL 1JN6A 4JM2A 5FCUH 1JV5B 4M7JL 3RTQC 4C57C 1F13A 1VEMA 4JY5H 4HPYL 2K9UA 5CZVH 1GGTA 5IBUG 3BO8B 3OAYK 2DBJA 5ALBL 5IUSA 5JW4R 2EKSA 3NOIA 5MERB 5HY9B 3KXFD 2P7TB 4HWNA 4J1UA 4RAUA 1DQMH 5F9OL 4O5LL 4HX1B 3WHE1 1GH7A 1CDCA 4C56D 1RZJC 2P1YA 4Y89A 4YNYA 1KJ2A 4JRYD 3OKDA 3MLXH 3NCMA 4P5MB 5TE6H 4K71B 1K2DA 1YYLH 1IKNC 1JHTA 3AS2A 3KS0J 4P2QE 3S35L 4PG9B 3GK8L 4N8VG 1QBAA 4Y19B 8FABA 5FKAB 1A4JA 3VXPB 1OF2B 4KJWC 4GW1B 5EOQH 1I1AB 5EZJA 4WEUD 4JVPA 5DRXB 4Z7NE 4M5YL 4RX4D 5C2BH 1NAMH 1CFVL 2GTWB 5IB5A 2R0LH 2OR7A 4R2GC 5E8NA 3SBWC 3NTCL 3GSUA 4JGMA 3RGVA 3MJ8A 3A67L 3HZVA 3KXFE 4PB0L 4QKXB 2DMBA 4NUGL 4MJ6B 2PETA 2LVEA 5E8EB 2D2OA 2PR4H 3ARFD 3ROLA 4C56E 5J1AA 5E2VL 1JPSL 3O2VH 2ZSWB 4JRYE 4K7FA 4YZFF 4KAQH 5DJ6B 3HZYB 1ZE3C 1EEZA 1XZ0B 2XKUA 5D72H 2NZ9C 3IAGC 4KHXL 3BD3A 3UJIH 1HXMB 5L2KD 4DGVH 4NOBA 2FB4H 1ZHNB 5F70A 3U82B 3RUGA 3RL2A 5HDQH 1OL0A 4PG2A 4DK3A 2VXQH 3L7EB 3QUKB 3MFFB 2ICWB 3ILQD 1HHHB 4MQ7B 3LIZL 1A1MA 5L6YL 1ES0B 3IDJB 3QUZD 5FHBH 1DBBH 3CLFH 1ZA3A 3GSNA 3QH3B 5DSCB 1IJ9A 5FIEA 1FGNL 2BY2A 5ICXB 2X9XA 4HS8H 4JJ5B 3ME0A 2H26A 1YDPA 3OSKA 1CE1L 1JHLH 1MVUA 3FQNB 5L2KE 3QUYD 1J88A 1CQKA 4P9HH 4OV5B 2DQFB 4GAYB 5EH1A 1ITCA 3NBNA 4YBHA 1LK3H 4F9LC 4GSDH 4HH9B 4ZS7H 3ZL4L 1I75A 2J4WL 2J5LB 32C2A 3VGFA 3BP5B 1FNGA 4UIMB 1Z0NA 4BH7B 3QDJB 3T4YB 4JKMA 1IILE 2YBRB 2Z35B 5KZCB 3L6FB 2MFNA 4O9HH 1U8LA 2KPNA 3B2VL 4OLEA 1NFIB 4LQFH 3BZFA 5T5FL 2DF3A 3C9NA 3VXTA 4EI5B 2H41A 4IMKC 2R2EA 5E03A 4FFZL 4ZFGH 5DA0B 1CCZA 4LEOB 5I2IA 1D5BA 3H8NA 5HHXL 2DBLL 1F2QA 5DD1H 4K94H 1VFOA 1PVHA 1FP5A 3QWQB 3WN5A 1RQ5A 3GMRB 1LO5A 2Q86A 4PJAA 2Y4SA 1JZ2A 4H0IA 1EK3A 2FYYA 3DROB 3OBAA 2GUOB 4LL9A 3TYGL 4ZQKB 1KIRA 1J0KA 3MUY1 1NUFA 4R4FH 1ZT7A 3PWPD 2IH3A 3RDTA 2X4NB 3STZA 1G0XA 3KPSA 1LEGA 4AH2B 3LSOA 4X4ME 3BKYH 1KT2A 4TVSa 4AEIL 1MFAH 2AJVH 4JKKA 3CUPB 4OM1L 4OQ1A 3D3VD 3MYZA 1I1FB 3WDIA 5TE7H 5EG6C 4UILH 5BVJA 4UIKL 2XZAH 3SCMA 4LSSL 1OAZL 4YAQA 2FZ3B 4OCYL 3I9GH 2MQ3A 3EOYG 1I9EA 5KN5B 2YEZA 5DMJB 4ZAKD 3DARA 1LQSR 3I75A 3BDYH 1JPST 1RUKL 3O6LL 5FM5O 1FPTL 3PWPE 2VR4A 1WBXB 1VPOL 3O3EB 5C0JB 2JCCB 4OUUA 5C2UB 4NKQB 1P7KA 5DJ2B 5FO7A 2BNQD 1CXFA 5GISL 2FEEL 3WFDH 4Z7VF 3ARBA 4EI5C 1P5VA 4YHML 1NLBH 2V6HA 5KSBA 2W9EL 3D3VE 3KPNA 5C08D 2GIYA 4FFYL 5T3XD 4P0DA 4E41B 3P73A 1QFPA 1I9JH 3V6OA 5BS0B 1DBMH 4JFDD 5FB8B 4NKIL 4NQDD 4U3CA 3BPCA 1J11A 4Y1AA 5IGXH 1ZVSA 4IDJH 3BMWA 2FSEA 1ZLSL 3VXUA 3Q3GA 2BNQE 4NQCD 3MBXL 5DLMH 4WJ5B 3WEXA 3TZVA 4XCNB 1R5IB 3ULUL 5FHAH 3QDGA 2HVJB 5T3XE 4XP1H 4ONOA 3HC3H 1OAYL 2QSQA 1UB5B 1AD0A 5IB1B 1HXYB 1AJ7H 1WIPA 4GRWH 5H37H 1JTTA 4XWGH 1WJ3A 5F7MC 3F7VA 3C87A 5DO2D 1RUMH 5EZLB 4OIBA 2FJHA 3FO1B 3QQ3B 3U0PA 4OFIA 4PGZA 5JIPA 3PNWB 4HHAA 5IMOA 4R97C 5FGBA 3F8UB 2AI0L 3HE6D 4G6AD 3NACL 4HLJA 1GGIL 1HZHH 2EKJA 3GBLA 3R8BB 1RUAH 4NQCE 2GJ6A 2NCMA 4NRYA 2QSVA 5GRUH 1E4KC 4P4RA 3SQBA 3IXTB 1OAKH 2R4RL 2PYFA 3BIKB 3U1SL 1OVZA 5F7FA 5LG1A 2O61A 1LEIA 2GT9B 4DWHA 5C86A 3UEZA 5HD8C 1U8OA 3ULVL 3UP1A 4ZYKB 4ZUSB 1CD1A 2R4SL 3NCYS 3DVNB 1CGVA 3MQIA 4KKAD 1KELH 5C0IB 2HG5B 2CKBA 1Z5LA 2A9MH 4G6AC 3WKNA 1XIWB 1S7UB 5C6WH 4I13B 1OAXL 2IBBA 2F15A 1MAML 4AK1A 1EDQA 2EO1A 4PV9B 1TVBA 3EO1B 2VABA 1T1YA 4HK0B 5E8OB 3QFDA 4L8SB 5D7LD 3RZWA 1BOGB 5KOMC 1R5WB 1KB5L 5I19L 2D9CA 1F6LL 4PYGA 3INUL 2ARJB 3D85A 4MZ3A 4DW2L 3CXDH 3PWNA 2FLRT 4JQXC 1MUJB 2O5XH 3NZHH 4DN4L 3JV4A 5E5MA 3MGOB 3WJJC 4KROB 1A6TB 1EAPB 1A6UL 3VMOA 4JGJA 1MSPA 2F19H 1O7SA 2CIKA 3ARZA 1ONQB 5D71L 2BSRB 1OSZB 4I9WD 4ACPA 3MSPA 3T04D 5DUBA 4MQSB 3HC0B 4OD2B 3S97C 2G5RA 2KKQA 2P5EE 2H3NB 1B0GB 4K23L 3SO3C 5E08L 3MCLH 2HA1A 4WW2A 2VO5A 2ICEA 3GMLA 3BZ4A 4OGZA 2DQGL 4XC1L 1W0WA 3WLWD 4MCYA 1QVOB 1IEHA 4D9QD 3UTTB 4UT6H 5EN2B 3R8QA 1OW0C 1PBYA 3BVNA 3G6DH 4JFYA 2X1XR 5I73B 1AO7D 4MD4B 1P2CA 1XIWC 3SOBH 3FFCD 4WI8A 2XN9A 4I9WE 4G80A 3QPXL 2IH1A 2VXSH 1SJEA 4HPOH 4DUWA 1C5DB 4L8SC 1ADQH 5EUOB 5J8OA 5HVFB 2FO1A 2AXJA 5KVFH 3FQRA 1HNGA 4WNQB 3KPLA 1MFBL 1D5IL 3FQUA 3I50H 3TBWA 3MRDB 3QEHB 4RGOH 5MENA 5DK0A 4NFBA 2NTSP 2W0PA 3B9KC 1M7XA 1MPAL 1WBZB 3EFFB 5SWQA 1RI8A 4D3CL 1NC2A 4KROC 1HKFA 1NUDA 3DSNA 4GW5B 3QO0A 1NFDA 4J6RL 2H1PL 3CK0H 2I5YL 1AO7E 3FFCE 1MCPL 3B5TA 4B5EA 1IQWH 1VSCA 2J6EH 2ZG3A 3IDNB 2UZIL 1REIA 5FOBB 1UM6H 5EBMB 3U6RA 1IGJB 2EDQA 4YHKH 2NY1D 2X4PB 4IJ3C 5B39A 1MCSA 1DANU 4BQ6A 1GCFA 1MCRA 3PP3K 4GUPA 4O02L 4JO2H 4LKXB 4GBXC 3M45A 3F5WB 2X1WL 5ADOH 5GS3A 2QR0A 1GGBH 4MWFB 3FOMB 5B39G 4KRMB 3TBTB 4NUJB 3PHOA 1G9EA 3UDWC 5I73C 1AE6L 1WICA 3GNMH 3N1GC 5I71B 3OX8A 3WO4C 2YD7A 1K4DA 3G5ZB 5I1IH 1ZHLB 1A2YB 3QQ9D 3QI9C 1UZ6F 2VLMD 4DN3L 4HUKB 1DUZB 3WNOA 5JORB 1Y0LB 1H3WM 1ZLVH 3C6LA 2P48B 4H8WH 3DX9A 1NGYB 5CEYA 2CJUL 1KJMB 4NT6A 1YEEH 1JUFA 2ESVB 3GSXA 4MVBD 4YBQD 4KV5F 2FX8H 3QIUB 5F44A 3VFNA 4PJHB 1XGYH 3TJEH 1BVLA 1G6RL 2NXYD 4QTIH 3PGDA 4MX7B 3BW9A 4QOKB 1JVKA 4GAFB 4DGYH 5E2UL 5EOCJ 4FQ2L 4L3AA 3O4OC 3WHE0 4XP5L 2EC8A 3IYLW 4I2XA 4J4PD 1M71B 4LLVA 5LXGL 4KTDL 4LVEA 5IMLB 2R0ZH 5BV7H 3M1BA 5D6DC 3T3PE 3A6BH 2Z9TA 4C83B 4BJLA 4X7SL 4N0UE 3EOTL 1DVFA 1YPZB 1ZEAH 5EZOL 4QY8A 3O2DL 1KGCD 3ZYJA 1FH5L 4Z7UF 3C8HA 1FJ1A 3QZWB 5E5RB 5I71C 1FN4B 5IG7A 5D1QD 4LNRB 4Q0XL 3B3IB 4ZFZA 4AL8H 3IU3A 4YDLB 3T0BA 1WAAE 2ICCA 5FA4B 4OLZL 5JPMA 3LEXA 4XPFL 4PJ9B 4PJ5A 2A9NL 1BFOB 2UYLB 4J4PC 2ADGA 5CZKA 1WCBB 3KPRA 1RHHA 3F7PC 1ZXQA 2NY5L 5A40E 1WT5A 5ICZA 3KPQA 1MREL 1I3GL 3IFPB 1TJIL 2D7TL 4QHNA 1SEBA 3ZDZE 3QIUC 4OJFL 1AHWA 1FRGL 5C0AD 1N7MH 1MLBB 5GGUA 2MSPA 4B41A 4PJ8A 3M8OH 2HH0L 3HC4L 4HGKC 1DEDA 1KGCE 1R3LA 3RWIA 4X0KB 4NBXB 4LU5H 3QXAA 5D1QC 2WP3T 4GRWF 5EFIA 1KLUA 4P57A 1QFWM 3B5HA 1Q9WB 1RUQL 4TTDC 5J0BA 2EDOA 5CEXB 3RVXD 4KUZL 3LRSB 1PGRB 4YDVB 4AY0A 1ZGLA 2WV3A 4XNXH 4O5LH 2B4CL 3NAAL 5JMOC 1P1ZA 5D9SB 5C0AE 5JXAL 4QWWD 2VUOA 1T5XB 5ESQA 1DZBA 1FFPA 1K8DA 4QRRB 2VISA 4WW1B 4UOJA 2VZ3A 3MCKA 1QSFB 4Q74A 3U7WL 1KCRL 2P8PB 3MV8A 3REWB 2BVQB 3GK8H 3P30L 5KSVB 4B7LA 3PGCB 4P2RB 1OGAD 3U36B 1UJ3C 4ETQA 4PPTA 2ADIA 2X7LB 4UBDC 5T3XH 5J9PB 2O5YL 5IQ7H 2EEAA 4NQXA 4WWKB 1LP9F 4N0FB 2JB5H 3HNVL 4V1DE 1F3DJ 5DTFB 1AR1D 4QF1B 3VWKD 3AAZB 4QWWC 5E2VH 2VSCA 4XI5D 3RZCB 1YQ2A 5CIPA 5DD3H 1MLCA 4MCZA 2AP2A 4IOIA 1LO3H 4KHXH 4Y88A 1C1EH 1B9ZA 3O6FD 3QFJB 3RY5A 2I9LB 2FJGA 5HI5D 2DMKA 1KN4H 3MLTA 4Z5RA 1OGAE 1AFVL 5I1KH 3CH1A 4Z77A 3HPJB 3C60D 4Z7WE 4OQTA 3BRFA 2J8UF 4M48H 1YEIH 4P48A 2GW5A 3F6LA 5EBWB 4XWOD 1OCWH 3DRQA 4OZGF 1C16B 15C8L 1QBLL 1V3MA 3DWTA 4PP1D 5L6YH 3WJLC 1IQDA 1FVCA 2YK1H 3WIHA 5E95B 3U4BL 1CYGA 5E2TL 5F93C 4NWUL 1UCTA 2RGSA 3T0VA 1KLGB 1C12B 1WC7B 4Y4KB 3MO1B 3O6FC 3REVB 5C3TA 4G6ML 1EHAA 3MRGB 1Z3GL 3SJVE 1YEJL 2VUYA 4HWEL 4HIIA 3C60C 2C7UA 1LVEA 1TQCB 3BEVB 4DFIA 5CCKL 2Z8VC 2APTA 5L2JA 4U6VH 4YQXH 4HEPG 1NCDL 4LDOB 4U1LB 5IFHL 2OLDA 3JV5A 4RDQF 2V2WB 3B2VH 4TTGA 3JUYA 4GG6F 1QA9A 3RZCC 5CGYC 1FNLA 1KF9B 2V7HB 3CX5J 1PZ5A 5M7QA 1HWGB 4PJIE 5JR1H 1TTUA 2WINB 2OSLA 4RZCA 4LGSB 1T83C 3JBG7 1NDGA 5T1DH 1VA9A 1FFNA 1OTSD 2W1NA 2ZSVA 4HIJB 1NCBL 3HUJE 2BSTA 2I24N 3CXHJ 1ZLWH 4ODXB 5GRZA 3TYGH 2J8HA 3NIDE 4GQPH 5HYJB 4MGXA 3I2CL 1IGYB 2QHRL 3TVMD 1IFHH 1CDHA 2EYSA 1IEBA 5FKPB 4RMSA 3RFZC 3JTTB 4G8FA 3ALWA 1S9VB 1VACA 3GBML 3PJSA 3WXVL 3UPRB 5IKCA 4UINL 1FAIH 3C2SA 4JZNB 4OZHB 3X17A 4F7PB 1W0VA 2A6IA 1QBML 3MROB 3KNBA 4NCC1 4MA1B 3L3GA 3DO7A 3LEVL 4NCC2 2PYED 4LSSH 4NZJA 2VAJA 4OCYH 3TH4T 2VN4A 5FYJD 4KKBC 5JW4M 3HMXL 4WFFD 3EYFB 1A7OL 3O6LH 1KIUA 3S98A 2EE6A 5E6YA 2HLAA 3AGVA 4POZD 3MRCB 4Y16C 5DJZA 4M1GL 1VPOH 1UQSB 4OI9A 1DN0A 4FQIH 1S7QA 3PWVB 3MODH 1SYVB 4PTUB 2B5IB 4X6CF 2DQEH 3WDHA 2GY7B 3DLQR 3MYJA 4Z78A 2IBGA 2NR6C 4OGXL 4P3DA 2BFVL 3B6SA 5FYKE 2CIIA 5GGSY 1CU4L 5ISZA 3QG6A 2DQIL 3LQAC 4HQQL 5GJTL 1P4IL 2HVKB 2DQDL 5EU6B 4D8PB 4AYFA 4HKBA 3QA3A 3D69B 2PYEE 4LLWA 1LMKA 4RWYL 1GOGA 2APWA 4M3KB 4AM0A 4EJ1C 5J57B 2PN5A 5FYJE 4JAMB 5GSVB 4OKVA 3VW3L 1B6UA 1UACH 4WFFE 3ABZA 3EYOA 5D1XD 3L9RA 1BECA 3BXNB 3C8DA 1HINL 2ICES 3HPLB 2Q87A 1IKFL 4QHMA 1AGFA 1ZHKB 2BP3A 3DXAB 1XCQA 4W6XB 1KXTB 3MOBH 1E6JH 1DBAH 3IJHA 2B1HL 3P4MB 1Q8MA 2CLZA 2GQHA 5A2LH 4GMTH 4NC2B 3FTGB 1CFTA 2ZUYA 5DZNA 4R0LB 2JE8A 5ALCL 4P23D 5ITBH 2AI0H 4LCWA 4OD1L 2JTDA 3DRTB 3GGWA 4PJGE 5HGBB 1YY8B 5GRXG 2M8XA 2CDFB 2B5IC 3IAPA 3UO1H 3SDXE 1C8PA 3QUMB 2R9HC 3FO9B 3QEQD 3BJ91 3WIFA 1QSEA 2Y5EA 3CMGA 3LH2H 3C09B 3DSFL 3H9HA 3SDDB 5I75B 5K9KA 3MRRB 3GJEB 2XIDA 5FM5M 1MFDL 1MNUH 2HP4A 3VGAB 4ODHH 3X12B 4F9PA 1MJ8H 1FO0L 3G6JE 3ULVH 1P4LA 2VLJB 5B22A 1EZVY 5DS8A 3VXMA 4L9LA 3B2UC 3O3DA 5BO1L 5IQ9A 4HKXB 1BM3L 5CP7B 1X5LA 3MXWH 2VL4A 1RZJL 3L3KB 2F53A 5T1LA 4NDMA 2HLFD 3ISWA 1NQBA 4M02A 5DJCB 4N9GA 5IFJB 3P3YA 2WUBH 1BBDL 4TUKL 1MAMH 4OIIH 1FNSL 1XT5A 3DETC 3TGXA 4CVZB 3QEQE 5DJYA 5HHPB 3V52L 1GHFL 4NQEB 2ILLA 5KTEL 5MHSD 3LVEA 2WNGA 2A6JB 3SKMA 1M1SA 3E6HB 1PX3A 2BHUA 1CFSB 4FZEH 1FDLH 4R0LC 1NGWB 4S2SA 3MZGB 3IFNL 3MLRL 2G2RA 3ARED 4X7EC 1MRDL 1T1ZB 2XZCH 3CX2A 2HFFB 3FB7B 3TFKD 1S7VA 3U46B 3HI5L 4PJEE 3O0RH 4KHTH 2XFXB 3MBEB 3KWWA 2ADJB 3D25B 4PRIA 3CFJB 5MHSE 3C09C 3SDDC 4FQQB 4N5EC 2R2HB 4X9BA 3VGAC 1J05B 4PJFF 4X98A 3RA7L 3V0VB 5ICYA 3DX6B 4ZO6A 3VGDA 4JREB 1MJJA 4OZIF 1H3VA 3ARPA 4WO4A 5LCVH 1NDMA 2AVGA 3AREC 5CP3H 3CFIC 3WKMH 2EDYA 1X6NA 3DV4B 5K59E 5DI8A 1NCCH 2DTMH 4NM4L 5F3BB 5JW5A 3TFKC 4FFWC 1YNTA 4ZFOB 4Z76B 1UWXH 4NO5A 3HFMH 3ZHDA 5D7JC 3B43A 4IRJB 3IGAA 3AVEA 3NMEA 1WFTA 1EH9A 1YEFH 1MHCA 1D5IH 2YPVL 1QACA 4I0PC 4HH8A 4KVNL 3RPKA 4LAJH 2VOTA 4RSVA 4PJBE 4HUWA 5C0BB 2X41A 2FH6A 3ES6A 4YDKH 3S36L 4PJXB 2UWEB 1IM9D 4J6RH 4KDVA 3SE8L 1MCPH 4D0CB 1EVUA 3KAAA 3VFSB 1IARB 1LO2L 3GJFA 4OT1L 4Z0BH 2JB6A 4EVNB 4P3CH 3MRNB 3FQWB 3MBEC 3B9VA 1BD2A 2WP3O 4NN6C 5D8JH 3AU1B 2IG2L 2ED9A 3GSOB 5KSAB 4O02H 3MRIB 1WTLA 3OL2A 4GRLC 3NZ8B 4X6DA 5SWZB 2AV1B 3P4LA 4TSCL 1B88A 5GRVL 5HYFA 2ZOKB 4LSQL 5JHDB 5H2BA 2WWMC 3VXOB 4NO3A 1AE6H 3CAFA 4GKNB 2DLEA 2IBZX 2PXYC 2ZCHH 3D0LA 4JZJC 3QIWA 3DGGB 3UTSD 4G9DA 3UTPD 2VXTH 1KG0A 2HN7B 4PJCA 5KVEL 1A0QH 4J23A 1BVKA 5I30L 4R7DA 1XGPB 3BHBB 3QNYA 3ZKXC 3VFUA 5C7XL 1ULVA 5DJDA 3V6FA 2X1PA 3TIEB 3AM8A 3MLWH 5HHOB 5HGHA 5L9DH 25C8H 1H0DB 3G5VA 5IVXE 1J8KA 4K3JL 1G6RH 2EDRA 5HI3D 2FATL 5CZXD 4EN3A 4POYA 1EMTL 2XQBL 1PG7L 5E2UH 5ESVB 5C1MB 1Y18B 3IRPX 1FORH 1WWCA 5C0EB 2QSCL 1VFMA 4ETYA 1NGZA 1IBGH 2XWTB 1UYWH 4JHAL 5KSUA 4M6AA 1N2RB 3LKOB 3MJ7B 5KSAC 5IIEB 2XZQH 1X5FA 5KAQG 1AXIB 2VLRA 5D7IF 4S1QL 1T7YA 4U31A 2GTZB 4X7SH 1GVIA 1CD8A 1MRFH 2X4UA 3LN5B 1OAUH 1EJ6A 3FN9A 2A73A 4OF3A 4HGWB 4MA8H 5EZOH 5HI3C 4JFFA 1TVDA 5T5NG 1FL5A 1CI5A 5IB3A 2A6KA 1OP3K 1K5NB 3D87B 1B4RA 2FHFA 1EXUA 1A5FL 1CQYA 5IHZB 4PRDA 4FZ8H 4HJGB 3KDMB 4K9EL 4HXBL 3OKMB 4F33A 4BK5A 2A0LD 4YO0B 1I9IH 2NY5H 3BQUD 4NHUA 5SWSA 4BFIA 1T66C 1MREH 4J3WA 1TJIH 5E6IC 3MRFB 4KK9D 5DDHA 4U6XA 3BAEL 4EBQL 1JIBA 1BQHA 2G75B 5IW6B 2C1OA 4Q6IB 3CFKA 4M61A 4DKEL 2YC1A 2HFTA 4E0RA 1I1AD 2VLKB 5C9JA 5ERWB 1XGUA 5L88H 3SGJC 3I3BA 4KY1L 1Q0XL 3NIGF 3DMMA 5T1KB 2QKIB 3MR9B 1BQHG 2A0LC 2B2XL 1B0RB 1JCKA 43C9A 1Q72H 2YPLD 3O6ML 2Q8AL 2O5ZL 4F57L 3RTQA 2BCKA 1ZVYA 2E9JA 3U9UB 1KNOA 4U1NA 5F1IB 4YXLH 4QNPE 5FYJH 1RIUH 1X7QA 4ZD3L 4H20H 1K8IB 1NGXB 1G7QA 4OCNC 5I8EA 1U58B 3ZO0A 1KCRH 1IAIH 5IW1B 3VA6A 1A14L 3EOAA 3ZKSD 2V2XB 2H2SD 3GUTA 4TQEL 2WBJB 4NO0B 3ULVF 4JFED 3GHBL 4Y2OA 3LAFA 1AGBB 4OLYL 1IKNA 1ADQA 2EXYD 4ORZC 4P2QA 4R4BA 4G6KH 3T3PF 2YPLE 4JFXA 4N0YL 1N64L 1W72B 3CFEB 4M7KH 5DJ8A 5DMGD 4JFOA 4B53A 2BNRD 4HS6B 5D93C 5FYLD 1Q9KB 3PHQA 2AS5M 3NA4A 3K80A 4LCCB 4GKSB 3SBWA 1XR8A 3OKLB 3QEGL 5ESAB 4P46D 2VR9A 3KXFA 4X80L 5GSRB 5C6PB 2E7LA 1I85C 2H2SC 5GGTL 3ILPA 1OM3L 4C56A 2J6EA 4M6OH 1AFVH 2FX7L 5INCB 4JRYA 1QSVA 3SE3A 1RJCA 4JFEE 1ERNA 2E7MA 3DV6B 3QDJD 3QHFH 5I8CA 3W39B 5E8PA 4JJHA 5KZCD 2APVA 2YWZA 4XRCB 3PV6B 5DMGC 2BNRE 4ZOEA 2PO6D 1T21B 4ZSOB 5FYLE 1P7QB 6FABL 1CLOL 4RX4A 4MS8C 5E2TH 3WS3A 3ZZ1A 4NWUH 5DRZA 4XNYH 1T6VN 4UU9B 2C26A 3VWJD 1MJUL 2VYRE 4P46C 4NFCA 3VD4A 1R3KB 4F7EB 5EZIL 4KK5C 4JPWL 4AENB 1UM4L 1Z3GH 1HOCB 1T0MA 2WBJC 5CMAB 5D70H 4XNQB 4APQD 3RL1B 1S7SB 4UMGA 3TBSA 4ZUWA 3LEYH 4OFYD 4ZXBB 3MRLB 4N5UA 1CVSC 4XBGA 3QCUL 5CCKH 1UWGH 2HTKD 4OCWH 3C6SA 4TNVF 3LKRB 1N4XH 3OHXA 2A83B 3TWCH 5L2KA 1MWAH 4P4KB 1H3XA 1DEEB 3CFCH 4I5BB 2J3SA 2ATKA 2PO6C 3RNQA 3QO1A 3Q6FB 3X14A 1WIUA 1NFKA 1YMMD 2RJMA 3AS1A 4DKFH 3GMQA 5KS9E 1C08A 1FSKB 4PLJD 3VWJC 1NPUA 4ELME 1F3JB 3CLEH 4OIAA 1IC1A 3QUZA 4UTBH 4XPHH 4XVUC 3DUSA 5I17B 2YD5A 4M7ZB 4O2EB 3L5JA 3IDGB 2YD2A 1D6EA 3IVKA 3UJTL 1RSFA 1FQ9C 4XBEL 4ALAH 5FF6A 4IMKA 2ZUWA 4IMLA 1S9XB 1B6DA 3WD5H 2J88L 5EU4A 3O9WC 1I1YB 3I2CH 1IGCH 4I3RL 2AV7A 4MXWH 5C07B 2JJUA 1YMME 1L7TL 1M05A 2CXKA 3O8XD 4FQPA 3OPZL 2J2ZA 5AWNH 3DTXA 1RK0A 4MB5A 4HUXB 5I1AA 4YXKL 2VIRB 4RA0C 2MPAL 4LSUL 3ALPA 1HNFA 3O41B 1Q38A 5B38A 3T77A 4CN1A 5A3ID 1KPVA 4X4MA 4YH6A 4ZXBC 3O45A 1T0NA 4D0BA 1BWWA 4HS3A 3RVUC 2MQ0A 3V6ZB 5IJKC 1A7OH 1YJDC 4PP2B 2X10A 4P4KC 5IBTL 5B38G 4XNMA 1OLZA 1F58L 1RZIA 2E6PA 2RAMA 1CIDA 5IOPA 4QHUB 2ID5A 3HAEH 5I1CH 5I1HL 4NBZB 3NA9L 3PWJA 2A6DB 4PRPB 4TUJB 5C6TL 3ETBF 2WQ8A 1GYAA 1LGVA 1G0YR 3PWPA 1CU4H 1N3NA 2W59A 5CUSH 1G0DA 5GJTH 4XCCH 2FDBP 2DQDH 3CZJA 3OKNA 5A2JH 4PJDF 2ARWA 2XG4A 5SX5H 3TV3L 3QUXD 3GRWL 3SGEH 1CGXA 1EHLH 2VE6A 5FO9A 2DS4A 1JGUH 3D3VA 4JY6B 1AY1H 2P45B 5I8OL 2NTFB 1AXSB 5CSZB 2NLJA 3ZYZA 1ED3B 1HINH 3VFVB 1XGQA 1JHKH 2I07B 4W4OC 4ZAKA 1IGIL 3U4AA 4G3YH 2XXCB 4HFWA 3QDMB 1RZ8A 3GSWA 4DVBA 3LRGA 1A47A 4KRNA 2H9GB 2B1HH 2BNQA 4GXUN 1ZT4A 2F58H 3O11A 1EEYA 2YOCA 5DURB 2Q8BL 2VDKL 3C5ZD 2DKMA 3VXQA 1C5CL 5ALCH 1UH2A 1CG9A 2FHBA 3SGDI 7FABH 4PRHB 5I76B 4L8BA 2VL5B 4QXUL 4AEHH 1A7NH 2DQTL 4JM4H 2DI8A 3D0VA 4FQXD 3P4OA 9CGTA 4PRAA 3ZHKA 1BJ8A 5GRWA 3P4NB 1GAFH 4I3GA 3VRJB 3WE6B 4RMQA 4PY7A 4Z9KB 3M07A 1MI5D 2HWZL 1MCKA 3ESVF 4CNIB 2VKWA 2YZ1A 2O93L 4NQCA 4UAOC 1IT9L 4FTVB 1MFDH 4P99A 5F7NC 4PJ7E 1FO0H 1E4KA 1N8ZA 3SDYL 3WL9B 1U8QB 1KTLA 3MGTA 4X5WA 4WDIA 3T0EB 1DDHA 3GKWL 4A2LA 4ZUUB 5BS0A 3ELAT 4X8XA 1A6ZA 4U1IA 5F89B 1K6QH 2CO6B 4TUKH 2N7BA 1KCSL 4Z18A 1JGLL 4MNGB 4Y5YA 1RULL 4H88L 3G04A 5D7KD 4PGBA 3AUVA 3EIFA 4AZ8A 3JTSA 5ID0A 1MI5E 2C3VA 5D2LF 5IBUB 3BDXA 5L0QB 1LK2A 3O3UN 1JN6B 4JM2B 1KJVB 2CUHA 2V9RA 3CXHK 2NYYD 4LOUC 3HTLX 1SM3H 1YN7A 5BCAA 2D3VA 4LPUA 3IFNH 2BSED 4CVUA 1GOHA 3K74B 5HHQA 2EKSB 3CD4A 4EXPX 5D2NE 4J1UB 4RAUB 4JGUA 1FLTX 1K85A 3LMJH 3ARGD 3WJJA 1NC4A 4YNYB 1KJ2B 3OKDB 4LPCA 1JZ4A 1QLFA 2R1WA 2VXVH 1K2DB 2SEBA 2ZCKL 3QNXA 5IWLC 1JHTB 3S36X 2VDRL 4NN7B 4L1DA 1DJSA 4RISL 8FABB 1A4JB 2NYYC 4IRZH 1GZQA 2EXWD 2XXMB 5EZJB 3WUWA 2P5EA 1CLYL 2WQRA 5F7DA 1GJIA 3MGAA 1PX4A 2A74A 3MLVH 5IB5B 1BQUA 3ULSA 5E8NB 3GSUB 5FGCE 3RGVB 4PJGF 3MJ8B 3W0WE 3HZVB 3CCHA 4P59L 2CR6A 1FC2D 3WUWG 5IT2H 1OW0A 1UFUA 1E0OB 3ROLB 4HXAL 3BT2L 1XF5A 1FL6A 5J1AB 1DLFL 4K7FB 1U95A 1HILA 2ZUUA 2VJXA 1EEZB 4LASL 3VG9C 2OP4L 3UYPA 2ZZUT 5L0QC 1V05A 2JF1A 3IF1A 4JM2C 4U3HA 3N1FC 3PIQA 1HYRC 3RL2B 4OD3H 4HJJH 4QRTA 1R5WA 3S36H 2IGFH 5B8CA 3BP7A 3PHSA 2NW3A 1A1MB 3P0VH 5I8KH 3AC0A 1ZA3B 3B9KA 1OAQH 4PFEA 1LO2H 1HDMA 4X9HA 2Q3AA 4OT1H 2DI7A 1IM3A 3R0MA 2YXFA 2H26B 3L95A 4X6EA 1AO7A 3H3BC 4S1RL 2IFFL 2HJLA 1MVUB 2YRPA 3FFCA 4I18A 2IG2H 5F7EL 2ESVD 4NN7C 3R1GL 1NGPH 4G6FB 1W8NA 1I7TA 4WTWA 1YECH 4JB9H 4OD2A 4DGIL 3CNKA 4HV8A 3CU7A 1WQVT 4K2UH 2XTJB 2EDXA 2WBKA 3DGCR 32C2B 3EO9H 1FNGB 1MAJA 4U1JA 3B9AA 4LSQH 4LK4A 2RFXA 5FYLH 3IAQA 1JWUA 4GBXA 1H8OA 4X7CC 3PABA 5TF1L 1U8LB 3BZFB 3ZDXE 5K9JL 3C9NB 3VFPA 3VXTB 4KK8C 1ODAA 3L5HA 2R2EB 5C0RH 3T8XA 2XWJA 1L0XA 5I2IB 1D5BB 4L8CA 4L4TD 2CD0A 5KVMC 5IEHA 3QI9A 4KMTH 1T0PB 4R9HA 4ZUTA 3WN5B 1IGFH 1LO5B 4PJAB 2Q86B 1TETL 4LLAA 2FYYB 4PS4H 3CSPA 4K3JH 3J7HA 1KIRB 1QRNE 2FATH 3OF6D 4RAVA 1ZT7B 3MNVA 3FT4A 4OB5L 2FEEI 1RZ7H 4G7VL 1EMTH 1PG7H 2IH3B 4KJPC 3RDTB 3STZB 3V0AC 3KPSB 1LEGB 2DQCH 3BSZL 3LSOB 3LQAL 2QSCH 5B3JE 3WNMA 1KB9K 1HE7A 1KCKA 1KT2B 3VGHA 3BKML 4L4TE 5BVJB 1ZVHA 3NCJH 1H5BC 2OR9L 3HMWL 3Q5TA 3HRZA 4WEBL 5F88A 3SCMB 1T7VA 4YAQB 1A8JH 2XTJC 3KLAA 3MA9H 2YEZB 1LO4H 5DXWA 2N4IA 3ZT5A 3I75B 3G5YA 5L8JB 2ZP0T 4PRBA 3E3QC 1YEHH 4MMZC 1LDPL 12E8L 1FE8H 2FR4A 3MLPA 4OUUB 4M7LH 1P7KB 5FO7B 1PKQE 5DEGA 1KCVL 4QXGL 3ARBB 2VTFA 4WWID 3F58H 1SJVA 5IBLC 1EERB 4PLKC 2IANE 5KW9H 5KSBB 3BN3B 3KPNB 1SHMA 5ID1A 3WO3B 3P73B 1WAAA 5D5ME 2W92A 4S0SD 1Q0YH 1QLEL 3WN5C 5TGBA 4YHLL 4J4PA 4NNXA 4QHLA 1KOAA 4EQ3A 3JWOH 4K8RD 3BPCB 4Y1AB 2DYPA 1YY9D 3CMOH 2VZTA 1ZVSB 2VN7A 4M03A 4P2RD 3WS6C 2VNCA 3VA2C 3VXUB 3Q3GB 3X3FH 3BKCH 2MCPL 3WEXB 3TZVB 1A6VH 4PLNC 1WWBX 2MHAA 3UTOA 4LLDA 1J8HE 4WWKD 5D1QA 4KPHL 3TESA 4U05A 3QDGB 2O5ZH 1V7NL 4KKNA 4F57H 1H15A 1AD0B 3WUZA 4UT7H 3DX7A 3PXJA 3OKKA 3TEUA 3F7VB 1JRHI 5FM4A 3HA0A 2FJHB 3U0PB 4ZD3H 3HI6L 4OI7A 1JNLL 4HHAB 2EE3A 5CP3A 5E9DE 5IMOB 1AKJD 5JA8B 3LN9A 3THMH 2VZ1A 2NX5D 3C08H 1T22A 3K0WA 5C0AA 5ADPL 1A02N 2IMNA 1SY6L 3S5LA 3GSQA 2GJ6B 4G42A 4UDTA 4XPBL 4NRYB 3WV0A 2BMKA 2Z8SA 4OLYH 1E4JA 2Z31D 4P4RB 1YNKH 1FN4A 3JWDH 1CT8A 2PYFB 4J3UA 4N0YH 3SDCC 4DQOH 4OF0A 2XACC 4A2MA 4M6NH 1UJ3A 5HJ3A 5FA4A 1LEIB 3V6OC 1DANT 2ADFH 1LNUA 3S5LG 2BOBA 3VFWA 1U8OB 2JLLA 3GHEL 5FA3A 2UYLA 2HFEA 1CD1B 3N1MC 3PQYE 2FJFA 2V7NA 2YA2A 2CKBB 1NMAL 1D9KC 1IAKA 1Z5LB 2BJML 2AGJL 2F5AL 4CW1A 4U3XA 4V1DA 4XVSL 3QUML 1U41A 2NX5E 4GOSA 5I9QB 2ZPKH 2FX7H 2QQLH 1MLBA 3B8SA 4I1NB 4QYOA 3QISA 3MTRA 3DYOA 4LEXH 1TVBB 2FL5A 3TZVC 3MRMA 2VABB 1SBSH 2NY2C 1T1YB 2Z31C 1VENA 3QFDB 5D96B 2YN5A 4IDLA 1OGAA 1QLRA 4Z7WA 5GGRA 1HEZA 4WI5A 3D85B 3DHJA 3PWNB 3BYYA 3JV4B 2E7CA 1VFUA 5IHUL 3FONA 5E5MB 2AEQL 2OX5A 2X44D 3WSQL 5TPWL 4ENEC 1X5KA 4JPWH 2CIKB 5HDBE 2XKSA 1U3ZA 1TQBB 5HGGS 1JBJA 4KTYA 4FP8L 1M6OA 5I18L 5DUBB 5IEKA 5CJ5A 2DL2A 3ZE1E 3D39A 5I1JH 1I9RH 3O6FA 5HYJD 2P8PA 4WW2B 3O6KH 2ICEB 3GMLB 3SJVA 3BZ4B 3U0TA 3C60A 1JZ3A 4JDTL 5IVNA 4YIQA 1W0WB 4MCYB 4M1DH 3U79A 1NCAL 4YEFA 3NFSL 4DOHB 4XX1E 2B20A 3H7LA 3AY4A 3BVNB 4JFYB 3C2AL 3MACL 5E8DL 1P2CB 2EO9A 5I9QC 2XN9B 4MB3A 4G80B 3HNSH 4IOFD 4JHZA 2IH1B 3MV7D 1SJEB 3SE9L 1T4KA 5TE4H 4NGHL 4PJIA 4HK3J 4YEEA 4B7IA 1JF6A 3FQRB 4QRSA 1F4WL 1FIEA 3KPLB 4EXKA 2Z91A 4NNPH 3FQUB 1RIVL 2ZUQC 4NQSA 3TBWB 4BQCA 2ATPA 5DC0A 3HUJA 4ZOCA 5MENB 5DK0B 5JW3L 3IJSA 4JRXE 2H8PA 1NC2B 1UM5H 4TPRL 2QADD 4YXKH 5CEZL 4LSUH 5KVDL 4W68A 1CDYA 2APFA 2XQYG 3QO0B 4GQ9L 1NFDB 3ROOA 3CGTA 5ETUA 1I7RA 4OBSA 5GPRA 4OUOA 3QYCA 1X5JA 2X09A 2W9LA 3QHZH 5BQ7A 3NH7H 4IOFC 4WV1A 5J12B 3GMOA 2LQRA 1CD9B 2NY6B 3KYKL 3MV7E 3H3PH 2VQUA 3ZE2E 1MQ8A 3U6RB 4WUUE 5B39B 2I9TA 4XT1C 5IBTH 2LABA 4JHWL 1M7DA 4GUPB 2A77H 2OI9B 2R8SL 2MWCA 1KIPA 3V9FA 1L6XA 2QR0B 2D03H 5C6TH 3OJVC 3EUUA 4F7MA 4Y16A 1KN2L 3PHOB 1CL7L 4MNQE 3OX8B 5ILTH 5DRWA 1K4DB 4IRSD 4RFOL 3S88L 3ALXA 3G6AA 3TV3H 2OL3H 3GRWH 5HHVL 3VCLA 3HHRB 3VXSE 1DBKL 4ZO7A 2Z92A 3RVWC 5EA0L 3WIIL 3IJYA 4XPTL 3C6LB 3TCLA 2W38A 3DX9B 3MLUL 5JZ7D 1R5VA 1GOFA 4S1SL 2PYEA 5CEYB 2NNAA 3QPQD 4F7TA 1XGRA 2H2PD 5DHYA 4NT6B 1JUFB 3GSXB 2HTLC 2EDJA 2R0WH 3T4AA 1U8NA 3UJJH 2EYTA 4GW4A 3VFNB 4F7CA 1BVLB 4HFUH 2R1YA 4M3JA 3PGDB 3BW9B 1A64A 5HHNA 4ZS6D 2R69L 2Z8WC 3V4PH 1XF4A 3JTTA 2Y06L 5C8JA 5DVKA 1ZK9A 4L5FL 5J12C 1VGKA 4UQ2B 1OARH 2NXZB 3S3JA 3MPCA 4I2XB 4NM8L 3VFOA 4P5TD 4LLVB 4QXUH 1K9TA 2EDLA 2QLVB 2FEDD 1MFEL 3M1BB 2NY4B 4MA7L 3N1QC 3UYRH 5IK3A 3LD8C 4TSAH 5LWYH 2P47B 3TPKA 5TQ0L 3QCTL 1DVFB 4JLRA 1TXKA 1JI1A 1GC1H 4QY8B 5JOEA 3NFNA 4PJGA 4XNZB 1FJ1B 5IG7B 3VI4F 5AZEH 3SDXA 4ZFZB 3IU3B 4NKMA 1CXHA 4LARL 3G9VA 5JPMB 3LEXB 1AC6A 3PGFL 4XVTL 4PJ5B 1FGVH 2JCCF 1QBBA 2Y5TA 3MLZL 1QUNA 2ADGB 3GI8L 3C6LC 3KPRB 4P5TC 1RHHB 5JMRA 1BGXH 5CSBA 2ITCA 5DUMH 5A16A 5ICZB 3KPQB 1EO7A 1MEXL 3G6JA 2X42A 4GO6B 3I02A 5IROA 3MRBA 4QHNB 1SEBB 4UV4H 1IGTB 4P23A 3K1KC 4NC1E 4NC1C 1AHWB 4H88H 2OS7A 3RPIA 4M5ZH 5GGUB 4PJ8B 2I60L 4YE4H 1TJHL 2HAZA 1R3LB 3RWIB 2HJFA 5CSGA 1UKSA 3QXAB 4UZGA 5EFIB 1B2WH 2EZ0D 1KLUB 4P57B 3QEQA 2WUCH 5AYUH 2AJXL 2NXZC 3FMGL 3AROA 1IE5A 4GAGL 1MWAA 1YEGL 1WZLA 5CEZD 2CK2A 4YPGA 4KXZI 3LDBB 4GXVH 1J0ZA 3K4ZA 4X9GA 3AMKA 1BLNA 5JXEC 1P1ZB 2H32H 2B1AL 5ESQB 3OKOA 1EZVX 1WCQA 1FFPB 1K8DB 1DVFC 2VISB 3MCKB 3TT1L 3QG7L 5FK9A 3MV8B 4WHYG 5C0FA 2QQKH 4RISH 4PJEA 2UV3A 4K7PL 1NSNL 5I74C 4D9LL 2EZ0C 2XT1B 2X4OA 4CU7A 4ETQB 4F2MA 3VE0A 3ESUF 3FHQA 4YZFE 2ADIB 3RWFA 5KBNC 5LGHH 4NQXB 5E7BA 2KQNA 5CJQL 1CGSL 3DOSA 1XCTA 4P59H 1PKOA 1JFQL 1GGUA 3CDCA 4K8RH 1F4YL 2IPTL 4LF3A 2A2QT 1AHWC 4HXAH 3BT2H 4EUPA 3AREA 1DLFH 1FLRL 4LCYA 2V2TA 4PJ8C 2ZOLA 5CIPB 3L3KA 1MLCB 1CF8L 4MCZB 4IOIB 2EDKA 1O5DT 2DN7A 2FJGB 4XH2A 1UC6A 2G60L 3MLTB 4KTEH 3EYUH 4Z5RB 5D7JA 3CH1B 4EUPG 4Z77B 2HKFL 3P0YL 4BSWA 1W72L 4TRPH 2BY1A 5DYOA 3DRQB 3EYQD 3V0WL 3KJ6L 1H3GA 4I0PA 3EDFA 1IQDB 1FVCB 5MEOA 3AS0A 3V6BR 1HI6A 1KXQE 4PJBA 3ZSTA 3S9DB 3N06B 4XZUA 5BMFH 1NMCB 2W0KA 4QRUA 1QFUL 3HNTL 2IFFH 1A7QL 3T0AA 3R1GH 3X13A 4XCFL 5HHOD 1I3RA 4HIIB 2VB5A 2C7UB 2PF6A 3OXRA 1ZLUH 4U2YA 5GGQH 2D0HA 4PB9H 1DQLH 2XRAL 2CGRL 3ZTNH 1KTKE 3VGBA 5L2JB 4FXKA 1DL7L 3GBNL 2ZG1A 4GRLA 4YHIA 4DCQA 3V0VA 1B4JL 5TF1H 4U1HA 3T0DA 1QA9B 2EE9A 3IFLL 3GJFK 1X5HA 3QXUA 4LAQL 1XMWA 3IDYB 1PZ5B 1BZ9A 1X5IA 1RMFL 1WZMA 2PXYA 4NNYA 2X70A 2E8YA 3H9ZA 4RMVA 2OSLB 4JZJA 4HF5L 4RZCB 3UBXA 3MXVL 4XAWL 3VFTA 3BIBX 3SKJL 1NDGB 3MFGB 1FFNB 1YJDL 5GZND 3D2UD 2ZSVB 2BSTB 2DJ4A 1U3JA 3V5HA 1TENA 3D1MC 4G7VH 1J0HA 5JPNA 2EYSB 1IEBB 5EUOF 1M4KA 4ZO8A 5DQJA 1TZHA 3X3GL 4G8FB 4M62L 1NMCC 5IVXA 1VACB 3PJSB 4HW6A 4PJXA 5IKCB 4KZDL 4MLSA 1W0VB 2A6IB 5DK2A 1NCWL 4LLYA 4LPVA 3KNBB 4I4WA 2JK5A 4Z7OF 3L3GB 3LKQA 2OR9H 3HMWH 3DO7B 4LNVA 1PLGL 1G7MA 5GS0D 3TCXA 5F9JA 3U0WL 1OTUD 4YGVA 5GZNC 1ACYL 2BXZA 3P9MA 3E1F1 6CGTA 1QR1A 4L4VD 4Z7VE 4NC0B 2X89D 2NY0B 2HLAB 1PY9A 12E8H 5DJZB 3WLBA 1X9QA 2X4SA 1DN0B 4BFGA 4FOMA 1S7QB 1KCVH 3ZMRA 4QXGH 1B3JA 3MYJB 4Z78B 1S7TA 3VG0L 2XYCA 1QYGH 4P3DB 3B6SB 2CIIB 4TVPD 5ISZB 3QG6B 1FYTD 1EUUA 3CU1A 4NFDA 4HKBB 2VERN 1S5IL 3QA3B 4LLWB 1OWWA 3H2WA 3ARDD 4YXHH 4AM0B 4XPAL 4YHLH 2RCSL 4L4VE 1E4XL 3TO4C 1PW3A 3EYOB 4FQLH 4UDUA 3L9RB 4RGNC 4RGNE 3TJHD 2GAZA 4LSPL 4NO0D 3U4EA 4WFHE 5E6IA 2EIDA 4HIXH 3SY0A 3HCVA 1FCCA 4X7TA 3DURA 1H0DA 4QHMB 1AGFB 3D9AH 1TITA 1AH1A 1J18A 1NBVL 3FB5A 4DEPC 4ODWA 4OFDA 4LIQE 1XCQB 1NBZA 4HT1L 4TVPE 5A2FA 4XHJD 3IJHB 1V7NH 4UOW1 1FYTE 4PJHF 5J6GA 3SGJA 2HT4C 5TF0A 5E4EC 1JJUA 4FA8A 1CFTB 1A6AB 1NAMB 2E5EA 3I6KA 4I3SH 1JPFA 3HI6H 4EKXA 3BQUA 3VH8A 5T33L 2NY0C 2V5MA 3SQOH 3MX0A 4LCWB 3RWCA 3GGWB 5BRZD 5B3JF 5CGTA 4DZ8A 1HYSD 5IR1A 3VH8G 4CJ1A 2FD6L 3WIFB 1QSEB 4WFED 1P7QD 2COQA 3H9HB 4JO3L 5E0QA 1SEQL 5K9KB 1YPZF 3OKMA 1J1PL 1P4LB 1F4HA 2VR5A 3LQZA 5DS8B 3VXMB 4L9LB 2YPLA 3KR3H 3O3DB 1CK0H 3UC0L 5EC2A 5IQ9B 2PKDA 1YN6A 1NMAH 2BVYA 1HIML 1JTPA 3SDAC 1W2KT 4HWUA 5E99L 1JNHA 4XVSH 2F53B 5T1LB 4NDMB 3QUMH 3RVTC 4N9GB 5CLWA 3QJFA 5BRZE 2CO7B 4X4XA 4EOWL 1ZT1A 1UWEL 2VH5H 5DJYB 3E2HC 3KGRA 3OJMB 4OTXL 4ODVH 2GI7A 3AS3A 2NY3B 2VDPH 4HUUA 4JFEA 1J1XH 4S1DC 3SKMB 3DVFA 4NJAH 1H9VA 4HWZA 4NZRL 2DQJL 4XCYA 2D31A 3H9SD 2AQ3A 4BZ1L 2DQHL 1CICC 5EPMA 5IHUH 4S2SB 2AEQH 1T6WA 1VKXA 1E27A 2QL1A 5DVMA 2BNRA 2G2RB 4XTRC 2Y07L 1JYXA 1U8PA 3OZ9L 3ARYA 5ANME 5DC4B 4FNLH 4FP8H 3WFBL 3AB0B 1S7VB 4P46A 4QRQA 1L0QA 3MUGA 4WVRA 3KWWB 4PRIB 4LBEA 2AABH 3Q1SL 5L7XH 3C5SA 2Y6SD 1IGML 4KJQD 5E2WL 1HSBA 4JDTH 3LB6C 1KPRA 3RWGA 5KJRL 4X98B 3H9SE 5ICYB 4AG4L 3NFSH 3NABL 2Y72A 1MJJB 2OMBA 3FB8A 4WO4B 1NDMB 3BH9A 4M43L 2PO6A 4HIHA 3MACH 3K8KA 3TO2A 1T20A 3NIFF 5CJ8A 2EDTA 5DI8B 5KS9A 5ACLA 4YFLI 5JW5B 5MEPA 1A7PH 3HI1A 1YNTB 3VWJA 2CRZA 3TT3H 4A6YH 2YKLH 2FRGP 4ELMA 2KH2B 4NO5B 4KVCL 3IGAB 4NGHH 2DI9A 2EIEA 4APQA 1MHCB 4KJQC 3DUUA 4OFYA 4I77L 3RIFF 4WI3A 4P9HC 1EO8H 1RIVH 2EYRA 4XVJL 3GI9H 2FO4A 5BVPH 4HUWB 2DM4A 3UYOD 5JOPD 2VSDA 3ES6B 3O9WA 5C3LD 1ETZA 5CEZH 4DFHA 2NW2A 2Y7QA 4D94A 1NL0H 1YMMA 3EHBC 1RJLA 5GHWL 3EJYC 5DR5L 1U9KA 2DTSA 5EOCL 1YZZA 3AB0C 1HK6A 2VLLB 1EIBA 3GJFB 2JB6B 4NN5C 3ZKMC 3RI5F 2GKIA 1BD2B 2LAAA 1A4KA 3EGSA 2DLHA 3WFCL 4QXWA 1TCRA 5J1SC 4HSQA 4PUBH 4K94C 1HH9A 3KYOA 2X4TA 4KI5F 1F90L 1XFPA 1F6AA 4X6DB 5LQBL 2LTQB 1WTGT 5IJKA 1JNNH 4JFZL 1UZ6E 4FQJL 5JOPE 2DM7A 4LFHD 5H2BB 3FAXA 1NMBH 4MQXD 4NO3B 3RKDD 1HHGA 3O8XA 1CWVA 3K2UL 5GQBA 3D0LB 4KV5E 3QIWB 4G9DB 4KRPB 4PRHD 1KG0B 2AK4D 4PJCB 1BVKB 1MHPH 3KJ4B 3MLUH 4R7DB 4S1SH 3VFUB 4KQ4L 5DJDB 3V6FB 2V5YA 5HI4C 5DC9B 5J13B 3AXLA 2F74A 5HGHB 4XPGH 1DSFL 3G5VB 3WHXA 4LSRL 1BFVL 3RKDC 4EN3B 3CVHA 5CBEA 4BUGA 2R69H 4NWTL 3EJJX 2Y06H 4MAYC 3BD4A 2R2BA 1MIML 2AK4E 3T0ED 1NGZB 1R3JA 5KSUB 4MSWA 5FOJA 3WFHA 4Z7UE 2ZG2A 3QUXA 4OZHF 7CGTA 1SJXA 4JN1H 2W0FA 5E24E 2VLRB 4D0DA 2LTQC