1RVFL

Fab complexed with intact human rhinovirus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
110
Chain Sequence
QIVLTQSPAIMSAFPGEKVTITCSATSSVNYMHWFQQKPGTSPKLWIYSSSNLASGVPARFSGSGSGTSYSLTISRMEAEDAATYYCQQRSSYPITFGSGTKLEIKRADA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN
publication title Neutralizing antibody to human rhinovirus 14 penetrates the receptor-binding canyon.
pubmed doi rcsb
molecule tags Virus/immune system
total genus 19
structure length 110
sequence length 110
ec nomenclature
pdb deposition date 1996-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1rvfL00
4YNYB 4RAHA 2BERA 1WK0A 3BHBA 3PWVB 1A7QH 3QFJA 4FFZL 3I6KB 2R8SH 1ZLUH 4EZMA 4ZUUB 1LE5A 3MCG1 3MBED 1CGSL 3KPPA 4ODUA 2YPKA 1QR1B 5KN5B 5EU6D 1YYML 4XVTH 1PYWA 4F9PC 1BZ9B 1JNLL 4HLJA 2NZ9C 2YUXA 3RHWK 3G5XB 2P42B 1MVFA 4L8BB 1IQWL 2M2DA 1MHEB 4HXAL 1RK0A 4H5SB 3RUGE 1NMBH 2D7TL 3ARDC 3WLWD 3UX9B 3A67L 3PIQA 3MRMB 4HK0A 3HC0B 1P84K 3T3MF 1L6XA 3TFKD 1ZT4A 4H88L 3WIHL 1XGQA 2R1XA 2V2XB 1A1NB 1AIFA 3OKLA 2VDOL 4URTB 4XHQA 1AJ7L 1FORL 4NQXB 3LS4L 4RRPG 1OSZA 2YPLD 1F6FB 1G6VK 3BYTA 1G1CA 3HAEG 3D39B 1VB9A 3I6LE 4XMPH 3SE9L 2FIKB 3UJIL 4JY6B 1T2QH 3ZDYE 1W2KT 3CZJA 5I15L 2X4NA 1G6RL 4TSCL 3HC3H 2IGFH 2VXQL 3KPTA 4XGZA 4NQDE 2BHUA 3DMMD 3RGVA 1LP9E 1ZHBA 4LAQL 1LO5A 5BRZE 3TBTA 4PJ8A 3LN4A 1VGEH 3QNYB 1WFNA 3LPWA 3OGOE 1IJ9A 1ONQB 3QNZB 1VFAA 3KPMB 4JFFA 4HIJB 4NKMB 1A8JH 4NQSA 4Z7VF 2FZ3B 1GZPB 2JK5B 1XH3A 3VFWA 3P0GB 2AJ3A 2VXVH 3U1SH 1FFPB 4ALAL 3NPSB 2DLTA 4YHPA 4XXDB 2PO6A 4XP5L 3WNPA 5MEQB 4GRMA 5T5NG 5DSCB 1JPSH 1QVOB 5I0ZA 5L8KB 4FQCL 4O00A 3RWGA 1UM6L 5D7IF 3MUJA 5DVLA 2NXZC 2FJGA 1FZJA 3WFBH 2NR6C 4KDVA 4QTIH 3V6FB 1PAMA 4I0CC 1S9WA 4WFFE 1J1PL 3OXRB 2BNQE 5FGRA 1U8KA 2P5WB 1JJUA 3KAAA 1WTLA 1FYTD 1NCCH 2CK0H 3LY6A 1M6OB 3HMXA 1ZLSH 4IDJH 1ZGLB 1K4DA 5DJXB 4NBXB 4XCNB 3QFDB 3V6OA 3KPSE 4DN4H 4WU7A 5TFSH 1D7FA 2OSLB 2CIKA 3NABH 4LSVL 3RWIA 3MGTB 5FOBB 3SN6N 2VR5A 1DQQA 3BX7C 3LSOA 1PJ9A 1VGKB 1GYAA 3OKEB 2DQJH 1DFBL 4E41D 4WJ5A 5TDOA 1IAIL 1T04B 1U42A 4X4YA 5DHXB 3DPBA 4IRZH 3O6KL 4PJ9A 1AGBA 1F8TL 3OL2A 2HG5B 4PG9A 4BK5A 3MR9A 3NGBB 4GUPB 4WHCA 4M5ZH 1RVFL 1AC6A 4EDXB 3S37X 1OAXL 3QEQB 4P5KB 5FGCB 5F9OL 5JNYB 3VFGH 3ILQC 3UJJH 3S34L 4PR5B 1CFNB 4PJXA 1QBML 4L5FL 3BO8A 2QLVB 3TIDB 3S6CA 4CVXA 5HHNB 4NKDA 4XAWL 4YX2L 5EUKA 1BF8A 2AJXH 2E9BA 4ONHA 4YK4C 1WC7A 3VXQA 4PRAB 1IGML 3VFMB 1C12A 5GGRY 4GLRI 2DM3A 3PGCB 3Q3GB 4FABH 3OGCA 2ZCLL 1WBXA 4YWGH 1UZ6F 3X14B 5EA0H 1S9VB 5KSAD 4YFLF 1UCBH 4HIXH 3RL2A 1FGNL 2A9ML 2KZ1B 2PO6D 1PX3A 2WK2A 2YK1L 4JRYE 4M6NL 4Y8AA 5HHOB 4KDWA 4OKVB 5KS9A 2F19H 3LRGA 3WKMH 2VZVA 2J6EL 3W0WA 3FOMA 2WBKA 3HAEB 5DEGB 1F3DH 1E0OB 3TJHD 3CCHB 1N5AB 1HINH 1G7PB 1JV5A 4OQTA 5LJYH 1J8HB 5E2TL 5EC1A 3RQ3A 2BCKB 3V6ZB 1SEBA 4QCIA 2I9TB 1SVCP 1CK0L 4BQ8A 3ULUD 5TE4H 4ZQKA 5FYJE 1UM5L 4S2SA 4S1QL 2H3NB 1JTPA 5I18H 5JDSA 12E8L 4UDUB 5E1AB 1AGFA 1A14L 4WI7A 3GGWB 3VD4A 1XFPA 4MQ7A 4NQED 1U8MA 3QI9A 1XGRA 1IT9H 5I1LA 5D1XA 3NIFF 5T3XH 5LQBH 5FFLA 3WE6B 3WN5B 5FOJA 5GGTL 2H8PB 4JZJC 1OAQH 5GS1B 1YQVH 2A6IA 2XNAB 4JQXC 5CZXC 3MOAL 5DJ0A 1NBVL 1AXTH 3JWOH 1OAKH 5DHYA 3EOAB 3O2WL 4PRPA 4PJBB 1F4YL 4I2XA 4P59L 1OTSC 2Z4QA 2EDYA 1SJEB 3G6AB 4LLYA 1B4JL 3ROLB 2X4RB 4PTUA 1MAML 1J0ZA 2PW1A 3N0PB 2BRQA 2XTJE 3LPGA 3AUVA 4M3KB 4UINH 4C55A 4EXKA 3RX8A 2BSED 5I0DA 5SV4A 2HJLB 2HFGL 1CGSH 3D9AL 4GH7B 5FAAA 2ADJA 5FB8A 3GJEB 3QDGB 4I18B 4D0BA 4KK8D 2AERT 1A4JA 2P47B 2PR4L 1MCEA 1CT8A 4R7DB 1G6RB 4HXAH 3FB6A 2CK2A 1JPGB 5GRXG 4IDLA 2X2YA 4XBPB 4OM0L 3A67H 2HAZA 4MQTB 3X11B 4X5XA 4KDTC 2H2PD 4H88H 5GS3A 4H1LG 5D93C 2CKNA 2CDGB 4PJAB 1SY6L 3SE4C 4PS4L 5BOPA 2VDOH 4IRJA 1CIDA 1AJ7H 1FORH 3LS4H 4R0LB 1Q8MA 4LVNB 4YUEH 3QHZL 3QUZB 4LLMB 2ZZUT 2EXYD 4IRSA 3PHQA 3SE9H 3UJIH 5DMGC 1CLCA 5E99L 4TSCH 2VXQH 2CIIA 1QLRB 3IFLL 4X80H 1GCFA 4LAQH 4XAKD 3IAPA 3RWHB 5JIPA 1BJ1J 3IS0X 5ESQA 3O3AB 3CK0L 3I3EA 2DQFB 4RA3A 1JBJA 4RISL 5KG9A 1XR9A 5HYIA 4XWOC 5E5UB 1OLZA 3JV6B 4WEMB 1F11B 1RJZA 3WFEH 3BUYA 2NYYC 4HJJL 1MF2L 5F7FA 1HI6A 2NZIA 4OLXL 2C3HA 3T4YA 3IDUA 2J8UB 1FPTH 4LFHG 4Z7WF 4XP5H 1FL5B 2GUOA 1S7UA 5TQ2H 1UXSB 4K94L 1JWUA 2CDEA 3DX6A 2WWKT 3SDXF 5DFVD 5FV2A 3EFFA 4DK6A 1UM6H 1K8DA 4U0RB 3QA3A 1XF5B 1F3JA 4L4VE 5EPMA 3K8LA 4LLAA 1J1PH 1UYWL 4D0DA 3T04D 1OAZL 1S7SB 1FNSH 2EEAA 1N5YH 2R56H 5DMYA 3SQOH 1GRWA 3GIVA 1U8HB 4V1DA 3G6JE 4ZFZA 4LHJB 2CLZB 2OP4L 4XNQB 2A9NH 2K7QA 3MV7D 3QNXB 4Y4KB 1DFBH 4U7MA 4HS3A 3CH1B 4F3FB 1IAIH 4FQ2L 3DIFA 5ILTL 3C9NB 2BP3A 5D5MA 4ZODA 1UJ3C 4WWKA 2CLRB 3K8MA 4TUJB 3O6KH 5BOZG 1RZGA 4ZNEE 3VH8A 3H3PL 4HXBL 4WUUE 4MA7H 2DQTL 2JE8A 1NDMB 1RVFH 1RV6X 1OAXH 5I17A 1ZGLP 1HH6A 5D7IB 1XCQA 3JV4B 3QJFB 2VUYA 3TVMD 1QBMH 1TZGH 4LQFH 5I71C 1AI1L 4WO4D 4UTAL 4HFUL 4PRID 3D85D 4XB8A 5IKCB 3BDBA 3RNQA 5ITBL 1EFQA 4HC1A 1OM3L 2IC2A 4YX2H 5E94A 5CMAA 5DJYB 5TJWK 1T89C 1IGMH 4MD0A 2ZCLH 3ULSB 5CJQH 4PJCA 2Q87A 4EJ1C 5IK3A 3IXTB 3SKOB 5CP3A 3C2AH 1TZHA 5EOQL 1FGNH 4HWUA 5IBLD 4P2RB 3UPAA 2A9MH 5FYKH 4M6NH 1OAUH 1A4KB 4HUXB 1TLKA 1B2WH 2NXYD 1OTTD 3FQXB 5F88A 4OF7A 3IJHA 1FFRA 1Z5LA 4RMSA 2P44B 2J6EH 1IM3B 4BQ6A 2IALA 4FFVC 1CL7I 4HJGB 1BIHA 1EO8H 1S7TA 4ZO6A 3HMXH 4KJYB 5ACZA 3IDJB 1DLHA 2NY4B 3PQYA 3RTQD 1A6ZB 1RZKC 4YXKL 3D39E 4OUUB 2EDLA 5IB5A 5LVEA 2GJZB 3DGGB 4KXZH 3VXUA 5JHLH 3DHJA 1CK0H 5F6HI 1L7TL 1UM5H 5MHSE 1C1EL 1G7MB 4ZD3L 3DYOA 5D1QA 12E8H 2HTLC 1A14H 5BCAA 5C0AB 2GK0A 1FNEA 2MOVA 1TPXC 3IAGC 4YZFE 5F3BA 2DI7A 4ODBD 3HFMH 1V05A 1CXEA 2H1PH 4RZCB 3LV3A 2BMKA 3AM8C 4TVPD 4GSDH 3WKNA 4ODTH 1JK8A 4XCCL 1J0HA 2VTFA 2BNRB 2D4FA 1W0VB 5DQ9B 3TO4D 1YYLL 4R3SA 3DYMA 5INCA 3A6CL 3ZKMC 5JOFA 3O2WH 1F4YH 2RCSL 4P59H 5IMKB 1T4KA 1EV2E 1B4JH 3RGHA 5GZND 1D5XB 3U4EA 2A74B 4J3OC 3FT2B 4KRNA 4J1UA 1JPFA 4QRSA 1ZHKA 4FTVD 4MDJA 4OF6A 4HKJA 5ISZB 1EGJL 3AS1A 3RY6A 2P5WE 4XP6L 3MJ9A 2HFGH 4U6XA 5AUMA 3D87B 5C9JB 2PTTA 4BJLA 2EYRA 3RIFK 2BC4B 2ERJC 4OCMC 2I5YL 2PR4H 5ADPH 5IFJA 4MJ6A 1B0GA 3ES6A 3LKSA 3PABA 2CJUL 3EYOA 3PWLB 3B9KC 5F89A 1UM4L 1CICC 2X44D 1Y0LA 5AEAA 3EUUA 4ZUVB 1K6QL 3C8KB 1OTUD 5JA8B 1SM3L 1GIGL 3FB5A 2YS4A 4P2OB 3VDAA 3C5ZA 4NOBA 5F7DB 3TV3L 4HH9A 4WDIA 5DURB 4XRCA 2PCPB 1SY6H 4PS4H 4U7SA 3QEQE 5FKPB 4Z7NF 1A9EB 5FGCE 2EDQA 4O2CB 3FQWA 2IPKB 4G6AD 5IOPA 1T7ZA 3B5GA 1EK3A 1ZLUK 3EZ8A 2JTDA 3MFFB 4MSWA 5FO8A 5D1QD 5E99H 2NY2C 3X3GL 1HSAA 2P8LB 1PFCA 1FVEA 4FZ8H 1EH9A 2YN3A 4LCCA 3RZWA 3B8YA 3E6FA 5E6ID 1NPUA 1L0XA 2XZZA 1I9EA 3BWAA 3SDCC 3DX7B 4RISH 2A2QT 5A2IH 1VFBA 5E2JA 3SEPA 1XGUA 4GKNA 1HSBB 4EOWH 1BREA 3MYZA 4WUKH 4HJJH 1MF2H 3VI3E 2ZUSA 4OT1H 5E9DB 5IBTH 5JUEL 5SWZB 5DD3H 1NCDL 5HHOE 3MCKA 1VKXA 4OLXH 1OP5H 4PTTA 5HD8D 3C08H 3TBSB 4HDIA 4U1GC 5HHQA 5DQJB 5T3XE 2V7NA 2IADA 4XNZB 4K7FA 3W5NA 1MFBL 4GW1B 2HFEB 4MJ2A 4DQOL 1I1YB 3E6HB 2CRYA 2YKLL 3C6LD 5GRVL 2ZG1A 4G8EB 2XKNB 4U1MA 1J8HE 5J11C 1P4BH 2VZOA 2VXSL 4K3GA 4EDWL 3WDJA 3PJSB 5DZNA 4X8XA 2XG5A 3B6SA 3GSRA 1E4KC 1UYWH 2V17L 1QSZA 4PJ7E 4NWTH 3IDNB 1SJVA 5EFIA 1EFXB 4MGXA 1CLYL 2A83A 2XA3A 3OX8B 4G3YL 3ARFB 5EUOA 1T66D 4K23L 1F4HA 2VE6A 2OP4H 4XCEB 3H7BB 3MRQA 4NPYA 4G9DB 4WU5A 1BOYA 4KK9C 5DLML 1J7VR 3CXHK 1XIWD 4U3HA 5M95B 3O0RL 4LPXA 4XZUB 3GMPB 2Z8WC 4ERSL 3MJ7B 4MA1B 1I1FB 1T22A 4LVOC 5I1KL 2QSCL 2YMXL 4JN2A 1FIGL 1JRHI 3NFPB 3KYNB 5D72L 4Z7WB 1TITA 1PZ5B 4J23A 5ENWA 2QADB 4CW1A 5A43C 4F7CB 1KULA 3QIWC 4M61B 3JWDL 1MHCA 1YMMA 3D0LB 3BQUC 3VU2A 4DEPC 4NT6B 3U7YL 2NY7L 2VLLB 2VXUL 3P4MA 1Q38A 4LPVA 4UI2A 5F1NB 4UTAH 4HFUH 3ULVD 5C0BA 5ITBH 4NKOA 4JFQA 4H0GA 1KYOK 1OM3H 3FHAA 4FQXC 2A77H 3O4OB 3SDAB 3QDGE 1Z0MA 3WS6A 1NBYA 1B3JA 5CEZH 3D69A 4JKWA 3MXVL 2Y1VA 5ECJE 1YEFL 2A1WH 3WSQL 2WBJC 3F62A 4L3CA 2WQRA 4XTRD 4CVWA 3H2WA 1QQDB 4OCLC 5D7KE 3GFUA 1NBQA 2V9RA 2XTJC 1NGPL 2ZPKL 4JM2A 2W38A 3IDMB 2H32A 3UTQA 5F6HJ 1T1WB 4U6YA 5E8NA 1F58L 5EORL 3CDYA 5KJRL 4XC3L 3MACH 2JJVA 4PJAE 5TQ0H 2MCPL 4MQXC 5T3ZH 3HE7C 5F6IB 5JQHC 2H26A 4X99A 4E0RB 3IDYC 4J3VA 5HGDA 4JPKL 3C60B 3PWPB 4QWWC 3S36H 2VL5B 3QEHB 1DQLL 5ESVA 3NTCL 1MFEL 2X1QA 5BQ7B 3TZVC 3L3IB 4ZD3H 4YQXL 4V2CB 1RHFA 1WCBA 4AM0B 1JMZA 4P0DA 1I75A 5LG1A 2EKSB 3QDAA 3O9WC 4J3TA 5E8EB 2CLVB 3EJYC 2QSVA 5JPNB 3RKDD 2HP4A 1MLBA 1YYLH 2J8UE 2X09A 1SMAA 5LXGL 4Y5XA 3T3ME 3DVNB 3A6CH 3RVUC 3JTTB 1TFHA 2VR9A 3DX8B 4PP2A 4K3DL 3LEXA 1IEBA 5E00A 3CNKA 4HC1H 5ID0B 1OGAB 2PXYC 4MYWB 3N85L 5B4MD 1M7IB 3DVFA 2BFVL 1BM3L 2EIDA 4WI2A 5D7LA 2J4WL 3GSWA 4YHYB 2APFA 5GIRA 2VXTH 1NLBL 3HRZA 4P46B 5ICXB 1IGTA 5JXEA 4AENB 5CP3H 4N8VG 4R26L 4PRBB 1I8MA 1G7LA 3UAJD 1MREL 5E03A 1INQA 2CH8A 1AE6L 5GS0H 2X7LA 3KPNB 4MAYB 1KNOA 1R3KA 1ORQB 4QHLB 1K6QH 1KCRL 1GIGH 2MPAL 2D7PA 4XVJL 1EEYA 2P5EA 1Q9KB 3GK8L 5L6YL 1BBDH 2RIKA 3LRSB 1RK1A 1ZKAA 1YJDL 4LK4A 6CGTA 5I1EL 4X0KB 3KYOB 2Y6SC 5EDXA 2BVEA 4DZBA 1U8PB 1S9KC 3LD8C 4ELKA 3MGAA 1MOEA 1Q9LA 1JHTB 2E7HA 4XPBH 3QCUL 5EZJB 4B7LA 3OSKA 1MAKA 4EI5C 3X3GH 1EX0A 3QISA 2C3WA 2ZUWA 4OCXL 1U3HB 1RIVL 5DEFB 3QUXB 4PJEA 2X41A 1JNNL 5C0GA 3TPUA 1XF2B 2DQDL 1BFOB 5HVHC 1F6AB 4C4KT 5DJ6B 3FT3B 3P0VL 1KXQE 4U1LA 2HA1A 4BQBA 1BLNA 1T21A 3MJ9H 3BT2L 1MFBH 4DQOH 1S7WA 2YKLH 1XCTA 1CE6B 2AJYH 2FGWL 3U46B 5JXED 4ONGH 1ZSDB 2DDQH 1ZWIB 4XPTL 2QHRL 1N3NA 3PXHA 1JGLL 3ARED 2V17H 4CN6A 3DTXA 5DK0B 1A22B 2X9YA 4OAWB 4PJFF 2C7UA 5C0AE 4UU9A 4G3YH 1FVDA 1R3LA 1YEJL 3WXVL 1UVQB 3GSQA 4QYOB 5JHDB 4JN1L 2Q3ZA 3KYKH 4YO0A 1JN6B 1RSFA 2BNRE 5IHUL 3D0VA 4KJQC 5E4EC 4JO3L 2GQHA 1SBSL 5KS9E 8CGTA 4ERSH 1JGVL 5DFTA 3DRQA 4EUPB 2Y06L 4O5LL 2QSCH 1NUDA 1DBKH 1LNUB 1BJ1H 1Q9WB 5D72H 4R2GD 4D8PA 3RVTC 4JFDD 1F00I 4MA8L 5EO1B 5CKGA 3JWDH 4AY0A 2GFBB 1YDPA 3PHSA 3BP7A 3BMVA 3U7YH 2BVYA 5ISZE 2W0PA 4N8VB 3PGFL 2ZSWB 4LSQH 4MB5A 4OGAD 1CXFA 3QUYA 2J8OA 4HWBL 1I8KB 5F96H 3NPSC 2WP3O 1BD2A 2QKIA 3RDTA 1VENA 5C0CB 4NHUB 1Q94B 1CXIA 3MLSH 4EUPH 3MXVH 1YEFH 3B2UC 3WSQH 3M1BA 3NIFE 2GSIA 3QXVA 2R2EB 1NCWL 1NQBA 4XNMB 2GTZA 2VKWA 3QT2A 4Y4FD 1NGPH 1UGNA 3G5YB 5FO9B 1LK2A 3OB0H 4PRPE 5EORH 4I2XE 3MRNA 5KJRH 4XC3H 2MCPH 5JOPE 3QIBA 4JRXD 4WFHD 3KLHC 5I9QB 1CGTA 4KAQL 3UDWA 4X6CA 1CFVL 4NQVA 4JPKH 1CFTB 1A7NL 1T20B 4OZIA 2AJVH 1NC4B 5KSBB 5ACMA 3KDMA 1OW0C 43CAB 4Y16A 2CUMA 2BVQB 4YE4H 3AY4C 1IBGH 2F58L 4G80A 4CVUA 2D7OA 1ZT7A 2HN7A 1QSFB 1QLFB 3IU4H 1CD8A 4HHAA 2DLGA 4P23D 3C8HA 1ERNA 4YQXH 5J56B 4FXKB 5D8JH 2APVA 2RGSA 1QFWI 1IL1B 4TPRL 3WIFA 3NGBC 4ZNCD 1RU9L 2GJ6A 3T8XB 3U7WL 3KPOB 4F33A 5E9DE 3GB7A 4NM4L 5SWZE 2WIMA 5CIPA 1AKJD 5TE7L 4NNXB 4GRLD 1EAJA 3DV4A 2PYFA 3WUWB 1CD9B 4S10A 2WIIA 2NY1B 4OZHA 4KI5D 4ELMF 2EIZA 3L3GB 4LCWA 4NFCA 4Y2DB 2J4WH 2A38A 2Z8VC 1LO2L 1R5WB 1AXSA 3TM6A 1MQKL 2HWZL 3TT1L 3L3KA 4MD5B 2L7UA 3VRJA 4JCLA 3O2VL 1U6AH 1TJIL 1QZ1A 1KPVB 3T1FA 5HGHB 5CJOH 4JVWA 4R26H 5INDA 1PY4A 1HOCA 2QTEA 4HAFA 2H32H 4RBPH 5IFAH 1MREH 5HHVL 1DVFC 4H25B 3SKJL 1AE6H 1P2CA 4Z7UB 3RZCB 5DQDL 3ZE2F 2MKWA 3QO1B 4G42A 2HLFD 1KCRH 3INUH 5IEKB 2Q6WA 4RGND 1EEZA 1DUYA 3M07A 4GFTB 4DW2L 1HEZB 1BWWA 4JFEA 3WFDH 4Z7WE 2DM4A 2W91A 4X6DF 3BD3A 5JZ7D 4OFKA 1FN4A 1YJDH 3QDMD 4R4BA 5C0JB 3CUPA 1CLOL 1AC0A 3O3DB 4JAMB 2R23B 5BXFB 4NWUH 3D18A 3TA3B 1AD9A 1KT2A 4OF8A 4O2FA 1HHJA 2AI0H 3OKNA 1LHZA 1HHIB 1R3HB 4QHKI 1K4CA 1MEXL 1EBAA 2BOBB 4TSBL 3WN5C 4U1SB 1GZQA 4UDTA 5CZVL 1DTUA 4BYHA 5L2KD 5GS1C 3BN9D 1N8ZA 4EN3A 4HKBA 4KKLD 4DKEL 1OCWL 1TCRA 2C1OB 3DVIA 3ZDXE 2KDGA 3QBTB 5ITFA 2DQDH 4FQQB 4OM1L 3TCLA 5HY9B 5KW9L 15C8H 3U82B 5AZEL 4AT6A 1ND0A 1R3JA 5DT1L 5EU5B 1G7QB 4DVBB 5FO7A 2CR6A 3P0VH 3S4SA 3HG1A 2P7TB 3ARUA 1VERA 2NX5D 4DZ8A 4J4PC 2VLRB 4OZFG 4OCRL 2NY6D 2VZ1A 1MHHB 1OL0A 5J4MA 4HUVA 3RWFA 4Y4HB 3BT2H 2FL5B 2XQYG 1XMWA 4I18C 9CGTA 2V2TB 2UVFA 4L8CA 5FYLH 4Q0XH 3ULUF 1HDMB 2FGWH 3BGMA 3L7FB 3PWPE 4XPTH 4C56A 2QHRH 2PYEA 2BOCB 4X6FA 3MRKB 3VWKB 1RZIA 4IHOA 3KXFA 4G6FD 1QHOA 4YBHA 2ZCKH 5DRNB 5IGXL 3EHBD 2GCYA 5EIIB 1DEEA 4GT7A 3SGDH 4RMWA 3DXAB 5GRUL 4GOSA 1YY8A 3FO9A 4K7PL 4MHHG 3TNMA 3DOSA 4LEOA 4Y19D 4R0LC 1OP5K 4UV7L 4LVNC 4KKBD 3QUZC 1SBSH 3ZTJG 1JGVH 3G5ZB 5D1ZB 5D7JD 2Y06H 5IJVB 4O5LH 3SE3C 2R1WA 5CJ5A 4X8JA 4LDEB 1OGAE 4ODHL 5FCSH 4WI6A 4MA8H 1X7QA 3WLBA 1LEIA 1IGJA 5I16A 1FZKA 1R24A 3VXTB 1IC1A 2GSGA 4QF1B 5J8OA 4NSKB 1TZIB 4XP9L 4B0MM 1MI5A 4ONFH 1D9KD 3UTPD 1MCQA 1WFOA 4WEBL 4F8QA 3QDJD 5F7EL 1A6VH 3LKRB 1KJMA 3QZWG 4QRTB 4I0PA 4PJFB 5KSUB 3PL6D 2Q7YA 2Y4SA 4X7CC 2WV3A 4K2UH 3QR2A 1FZOA 5FK9A 3OQ3B 4UT7L 3O45B 3O6FB 4ZOCA 5C0EA 5DC4B 1VADA 1NCWH 3ROOA 3L95A 4U0RC 3HG1D 2CMRH 2ICES 5IVOA 4JZOA 3OJ2C 2UUDH 3M17B 3OZ9L 1SYVB 2ORBL 1WVZA 2B2XH 1RIHL 3UTSB 3ULUL 2FH8A 4JPVH 3SO3B 4LVHB 1A3RL 1EAPA 3VXMA 3C5SA 5C6PB 3PP4H 5TE6L 2OQJA 4OCSL 2B1AL 2VNCA 4KAQH 3VDBA 3D48R 4M00A 1CFVH 5GHWL 3MBEB 2AJZA 3U0PA 2GAZA 1HILB 5EU6B 4Y4KC 1OQXA 2F58H 3T65B 1NDGB 4HULB 3GSNA 1KXTB 5CEXA 3UPCA 2D9CA 1NMAH 2VZUA 3SDDA 4FFYL 3JTSA 2F8VA 4F2MB 2K3TA 1C08A 1N2RB 4KRMB 4TTDC 4TPRH 4GRWF 4S0SD 1IKNC 1RU9H 3U7WH 4NM4H 4OZFB 4RQQB 1E28B 4YFLI 4YXLL 2FB4L 5IVXA 1D6VL 3JVGA 3MGOB 5CD5D 3MRGA 2E8ZA 3CU7A 3OKDA 5EBLB 2A6KA 3CFEB 3VRIB 2YPLB 4U1NB 4F7EB 5MEOA 1ZS8B 4JHBA 5IT2L 1KB5A 3WFHA 5EZIL 4N90D 1WAAE 3D2UA 4LBEB 3X12A 4HMCA 5LAXB 3O4LA 1JF6A 4PJGA 2FLBT 32C2A 2HWZH 3TT1H 3DMMB 2W9DL 3S96A 4QRRA 4GMTL 1ZANL 3GMLB 4D9RD 1CD1A 3MC0A 3O2VH 5DUMH 5H2BA 1JMXA 1TJIH 1RUPL 3VGAB 3FZUC 1QD0A 5GGSB 3I84A 4G43B 4WY7L 3HI1A 3L3JA 5HHVH 4BH8B 3SKJH 2P49B 3NFSL 4WFGE 5DQDH 5CILH 5JHDE 5EO0A 1P9MA 5CSZB 1EHLL 3QULB 2NY4C 2QQNL 5IROA 1GH7A 1TNMA 4GG8A 4NKQB 4YIQA 4UQ3B 1RJLA 4QHKJ 1MIEL 1T5WB 4LASL 4HG4J 3PV7A 4EQ3A 5DVOA 1QEWA 1LD9B 2IBBA 4PGEA 3GUTB 3TBYB 4HEPG 5ICZB 1UA6H 3MRRA 4R7NB 5EG6C 4ELMB 1DDHB 4J12A 4N5ED 3W39B 1FYTB 1RZFL 3QZWB 4P2CG 5F7MC 2EH7L 4XH2B 3UJTH 1MEXH 2Z31D 4TSBH 5SV3A 2IWGA 4QHNA 4MCYA 4AH2B 5GGUA 1WISA 1P7QA 2BSRB 3KLAA 2VLJA 3W11C 1JNHB 2JELL 3HUJA 4E41B 3ZT5A 4OB5L 4OM1H 5KVEL 5KW9H 1BVKA 5DYOA 5AZEH 4JFXB 2XRAL 5A2LH 3GMOA 4M43L 4MCZA 5DT1H 4EXPX 1DE4A 5L0QB 1NCTA 4N0UA 4P48A 2SEBA 4APQA 3FOLA 1OD7A 1MCBA 2QQKL 2HH0L 5DDHB 4G8IA 4AZ8A 4RAUB 5AG8A 2IH1B 2X4TB 4X6DB 4ZUWB 3BVNB 3HE6A 1LDSA 1QPPA 1I1RA 5GZOD 4XGZB 5IFHL 1HKFA 4QRRD 2I9LB 4WI3A 3S8WA 2G5BB 2X70A 3IU3A 5KSBE 3EO0B 1WEJL 1E27A 2XG4A 2FX8L 3DURA 1QSFE 4F57H 2CGRL 2OTWA 4YC2B 2K9UA 4P2OC 2YEZA 1KTLA 4BH7A 2F15A 5IGXH 5KSAB 1KELL 2X05A 1TVHA 3RPIA 4YLQT 1OB1A 4EQ2A 1OT1A 5GRUH 1NC2A 1F4XL 4K7PH 1QNZL 2DLIA 1TJHL 5ERWB 4TRPL 3SJVD 3SKUD 1N4XL 5KOMC 3VXRA 4I4WA 3DO7B 3MROA 1F2QA 2F54A 5C07D 3TBVA 5HXMA 4UV4L 3PNWA 4K94C 4Z76A 4ZFFB 3FO1B 4YXHL 5JPMB 5GRVK 4F9PA 2HLAB 1HNGA 2UZIL 1FL3B 1ADQA 1I7ZB 4QXTA 5J12B 2W60A 3DWTA 3CX2A 1NMCB 5FCUH 2AQ3A 5IMMB 3ARDA 2VABA 2MCG1 3MRJA 5SWQB 1S78C 2BXYA 2ZKHL 4NQEB 5F7EH 3WNOA 5FUZH 2E9WA 1RULL 2DD8L 3QYCA 3O8XB 2C3VA 2Z92B 3HZYA 4MXWH 1ITCA 4XNZC 4Z7UE 1CTOA 3QG7L 2H9GA 4ZSOB 4JLRA 3AAZB 3BP4A 5GSRB 2HFFA 4LARL 3DUSB 5IB2A 5A16B 1DP0A 3ZKXB 2ORBH 3P30L 5CWSA 1JGUL 5DD6A 3NCFB 2YR3A 3H8NA 2YWYA 3D3VB 1ZAGA 2KKQA 1A3RH 3P9MB 1IARB 4YAQB 2VC2H 2OI9C 4JKMA 3WNMA 4GG6A 1I1AD 3G08B 4EI6A 4OCSH 1CFQA 5IB3A 2B1AH 1G9ML 3GSOA 3ARFC 1KSRA 5EO9B 3LEYH 3QQ3A 2B4CH 2BSSA 4TVPL 1MCOH 5MEPB 3VMNA 4P4RB 5L2JA 1PLGL 5KANI 3EDEA 1BOGB 3CVHA 4N0CC 3RI5F 1Z3GL 4M9PA 3C5JA 4MA1C 5EBMB 4FFYH 1VEOA 2F5AH 2FH6A 1JGEA 4L3EB 3UP1A 2XZAL 4ORGB 4PGDB 4POUB 2QADC 5KOVC 3GSXB 2BZDA 3PV6B 3VXRD 1UWXK 2EICA 3U36A 3LN5A 3C2SA 5DI8B 2R0ZH 4YXLH 2FB4H 4S11A 3TT3L 3OB0K 3D25A 1MCPL 1D6VH 3I50L 1MVUA 3S35H 3ET9F 3QRFM 2JB6A 2GT9A 4M5YH 2VLRE 4NN5B 1PG7X 3ECBB 3LHPL 4I77L 3NN8A 1U2HA 4F7MA 4LSTL 1DQJA 3O4OC 3SDAC 2P8MA 5IT2H 4F7TA 5EZIH 3IXAB 4NQCD 4AMKL 3TNNB 5I1HH 2FSEA 2W9DH 4R9HA 3TEUA 4GMTH 1ZANH 5K59F 1L7IH 3HZMA 2YA2A 5MP6L 1U8LB 1H0DB 2YC1A 3TCXA 5T1KD 1KCVL 1B4RA 4LOUC 4HUKB 1EIBA 3VI4E 4WY7H 2IANA 4JPIB 3DXAE 1BFTA 2E27L 2ICWI 1N0XH 5F6IC 4Q9RL 5CSGA 3W5MA 1EHLH 2QQNH 3S37L 3UCRA 1F4WL 5EU7E 1NJ9B 5LGJA 3VH8G 2FX7H 2C1PA 1MIEH 2NW2A 3QCVH 4N1CA 4ZUSB 3HPJB 4LASH 3SE8L 1I7UA 4DCQB 4HD9A 4HKZA 2AEQL 3GHEL 5FEBA 3WO3B 4KRLB 5D9SB 1JWMA 5AD0B 1JUFA 1VACA 3RBSA 1F4AA 2E5EA 5F72S 3P4NB 3LIZL 3JSSA 4KK5C 4QT5B 2UYLB 4HWNA 2X1XR 3FQTA 1RZFH 4OQ1A 4ZFOA 2EH7H 2EIBA 3IAQA 1UKTA 1PEZA 1BGXL 4Q7DA 2VAAA 4XI5C 4MXQC 5ANMB 5F7NC 5IVNA 3WUZA 1T1YA 1KIPA 4LCYA 4RBPK 4PJFE 4MJIB 1LO3L 4Z95L 2JELH 4OZ4A 3MV7B 1YC7A 5JIIA 4KROD 4LIQL 4OB5H 5F9JA 4G9FA 5KVEH 2YD6A 3MRLB 4XHJC 1AY1L 1AO7A 1BWMA 1NL0H 2JIXA 4M43H 3WD5L 1KTDA 1RUML 2IH3B 4O51A 3BXNB 4OSUL 2EDHA 4R96B 1YN7A 4YHYC 1CGUA 1DQDH 4ODXA 3CFDA 1AP2B 1XF3B 4P46C 3UTSE 5E1HB 2JJSC 2UWEF 1NANH 1MUJA 3FFCA 3IFOA 5TGBB 2Y07L 2ITCA 3IKCA 4ODSL 4PLKD 3TVMB 5BJTB 1J0JA 3X13B 4WO4B 4PRIB 2BXZA 1CU4L 3D85B 2MSPA 3VXSD 2VDMH 1HH9B 2ARJQ 3OR7B 1PZUB 5B39A 5EU6E 4MAYC 4K07A 4JZJA 4MA3A 4MMZC 4OF5A 5IM7B 4JQXA 2FX8H 4K8RD 4FP8H 5D2NB 3SGEI 2F53A 3KYAA 2QR0A 1JWSA 2D0FA 2BSTA 4BUHA 1KELH 1KCLA 1M71B 2ITDB 5MEND 4OF3A 3BP5B 3MSPA 5GRJL 2V2WA 1F4XH 1QNZH 4M48L 2NXYB 5I76B 2FJFA 3W9DB 4PV9A 1TJHH 4TRPH 3BMWA 1N4XH 2V5RA 3ULVL 3QA3B 1INEL 4UV4H 4X6EB 3F58L 2RFXA 4NQTA 2YPLE 1CDYA 1KCKA 3RTQB 4XBGA 4YXHH 1TMCB 1QRNA 1U3HC 5FF6B 3QG6A 4NRYB 3QUXC 5MERA 3V7AG 1H3WM 3CFJA 3IFPA 1JGDA 3MLTA 3H42L 4LSSL 4HW6A 5EU3B 1HYSC 5BV7L 1OARL 1X5JA 4KDTA 2ZKHH 3FN3A 2IPTL 4L8DA 3H9ZA 4HFWB 1UEYA 3EZJB 3BAEH 1RULH 3ALPA 1A6WL 5GQBA 3SE4A 1AGCB 2JIXD 1E6JH 3MLVL 1HE7A 3QG7H 3DV6A 4P4KD 3TYFB 3TO4B 4F15B 2E6QA 5DD0H 4K71B 4LKXB 3RWCA 3ZT6A 2H2SC 3FRPA 4OCYH 5GGQH 3KJ4B 1LK3L 3I6GB 4PY7A 2XTLA 4KKCC 3JWDC 2LAAA 3O6ML 4FTVB 4LCCC 1YA5A 3HPLA 4NRZA 3GKZA 1G9MH 4ELME 4JY5L 3VFPA 1FYTE 5IESH 5K33A 3C8DA 3P77A 5TDPB 4MZ3A 4H20L 5E2UL 4QEGA 4LSUH 2O5XH 3MNZB 4JJ5A 1PLGH 3CZFB 5T33L 2YD7A 2EDBA 2ADGA 2WSKA 3LKOA 4OI7A 1NFKA 3UBXI 4NNPL 4XVUC 5ETUA 1UACL 1KIQB 1KG0B 2ATPA 4MNQD 4C83B 4E41E 4NUJA 2HJKA 1JNJA 2WLZA 1CN4A 2KL6A 4MX7A 2EDXA 5DRZA 4OGZA 1T7WA 2YD5A 1IFHH 4NO0A 3BGFB 2UUDK 4GMSL 4AJ0A 5IB4B 4LLQA 1W8OA 4ZYKA 1ADQH 2I25N 1MCPH 1C5DB 1UC6A 3I50H 5DO2C 2HRPL 4TQEL 3L5IA 1EXUA 2BHZA 3LHPH 2CKBL 1EERB 4G8GA 4MD4B 3VXOA 1OSPL 4X6DE 3VFRA 2AK4D 1XR8A 4PJIF 4D0CB 3U9UA 2CO6B 5IF0B 4BFIA 1ZA3A 5HJ3A 1VFUA 2ICWJ 3MLXH 4AMKH 4C59B 4LF3B 3LKPA 3MLPA 3H6JA 3H9SD 1Y6KR 4HQQH 35C8L 5I1IH 3PWUA 1QKZL 3I9GL 4HT1L 4HIIB 1UJ3A 5E6IB 3FO0L 4UQ2A 5MP6H 4NBYB 4R4NC 1I9JL 2EZ0D 4QRQA 1KCVH 3WHXA 5ID1A 3QWRA 2OK0L 1INDH 1UCTA 5EBWA 2VQ1B 5E8OA 4XP1H 1C5BL 2EXWC 2NW3B 2PTUA 3QHFL 5EZLA 1HXYA 4ENEC 5I9QC 3EDJA 2HKFL 3UROR 4Q9RH 2CQVA 2J88H 5I2IB 4LL9A 5TDNA 1F4WH 2HJFA 1U3ZA 1ODAA 4ZXBB 5GRYA 1S7QA 2IMMA 1T03L 3SE8H 3C6LB 2AEQH 3GHEH 1T89A 4NYLB 4FXLA 4KY1L 1ED3A 3Q48A 4X83A 2AJUH 3EOTL 2XN9A 4U7KA 3TN0D 4U1IB 4PJDB 1YEHH 5C0IA 1IKFL 1YN6A 3S3SA 1V3KA 3ULUE 3DVGB 1UZ8B 3G5VB 1QFOA 3VA6A 1F97A 1D6EA 1P1ZA 3CC5B 3GEWB 3PABB 2ZOLA 3HCVA 1BGXH 1IGYA 4NQEE 4MAUL 4Z0BL 2D31A 1V7NL 2HT3D 4KJWC 3CLFL 5GSVA 4Z95H 1LO3H 3QSKB 1KJ2A 1GGYA 2Z8RA 4LIQH 5DJAB 1MJUL 3C09B 4ZPTB 3REVA 4FMKA 3E1F1 2WUCL 3MYJA 4ZSOE 4AIXA 1AY1H 1XIWB 3BP6B 2NY1C 3FT4A 3RVWC 5HSFA 4X98A 1QBBA 4XVSH 4OSUH 4TNVF 1A5FL 5E8PA 4Y2DC 4LSRL 4MS8D 3EYSL 1JCKA 3R8BB 3RUGA 4HUNB 4Z78A 4HGWB 3D3VE 2X4SB 3SCMD 2WINA 1DLFH 1YJDC 2Y07H 3MMEB 2R2BA 3Q6FB 3GJFB 3VFNA 4ODSH 4QRPD 4UUJB 2IQAB 1JZ7A 1YEKL 4YPGB 1GGCH 3MV9B 4OIBA 3AM8A 5J9PB 1KCUL 3RZCC 3GHBH 4OLYH 1XGUB 1A1MA 5BZDA 3SKNA 1D5ZA 1MJJB 3MRDB 4CN1A 5H37H 4M62H 1HQ4A 4XNXH 1P53A 1T0NA 4NQDA 4HIHA 4L3EE 5BV7B 2XQBL 3L6FB 5BRZA 4M93B 4M48H 3OKOB 3P3YA 4XPAL 1NFIB 4LRNL 3U2SA 5IEHA 1DBJH 1YEDA 2OTUB 3ULVH 1INEH 1G7JB 5GRZA 4LHQB 1L6ZA 2XICA 5C7XL 2FATL 4DFHA 4G8FB 3STLA 1RZ7H 2HMID 5HHPB 2UWEB 3VXME 5CINL 3B6SB 1LQSR 4RGMB 3DNKA 2AV1B 2ATKA 3IF1B 1NUFA 5DJDA 5JORA 4CJ1A 1WLHA 4FQLL 3PWJA 4O58H 2B1HL 5IW1A 3B9KA 3MRHA 2V7HA 4LSSH 3IDGB 5H94A 4ZTOH 1CICA 3CSYA 3MV8D 4XAKE 1L4IA 3B2VH 1XF4B 2BNQA 5E56A 2O61A 1LEKA 5HYSA 4WNQB 1NEZB 2FHFA 1A6WH 4HBCH 4OLVL 2DQCL 3LVEA 3GMRA 2E7MA 3MLVH 1P5VA 2XWTA 4LNVA 5DTFA 1JYVA 1JIBA 1NCNA 4Y4HC 3KPSA 1KLGA 5E6ZA 4QXUH 4HF5H 1T5XB 1WICA 4PB0L 4RIRB 3CLEH 4G6ML 3MOBL 3TESA 2HTLD 2FR4A 2HVJB 3F5WA 1ETZB 4OZIF 3VWKC 4PG2C 3UPRA 1NEUA 3O6MH 5HYEA 4HBQA 5I30H 4G7YL 3SDCA 1W72A 3IJSA 3KWWA 4JY5H 4OD2B 1M7DA 4M4RA 1CDCA 4LSPH 4M6AA 1B0RB 2CKBB 3VXNB 1D5MB 1TETL 3MJ8B 2D2OA 4H20H 3EIFA 5E2UH 4UZGA 3W81A 4QGTA 3QUKA 1AGDA 2I07B 5E8DL 5EU7C 2E9IA 4NQDD 4GBXD 1GSMA 2GKIA 2P1YA 4G7VH 4MJIE 3H7LA 4QY8B 5D1ZC 1QSVA 4V2BA 4NNPH 3BEVB 3MV7E 1DJSA 1U8QA 1UACH 1YPZF 2VZTA 4JM4H 2E8YA 1GGIL 1EEUA 1MH5B 4GAGL 3HR5B 4XWGL 3K2MC 1DBML 1CL7L 1M05A 1BECA 4P5MA 3GSVA 4PLJD 1BJMA 2OJEB 1E4KA 4QNPF 4XXCC 4BSVA 3FCTA 4JR9H 4JRYA 4PRHD 3I2CL 2DI9A 1HK6A 1BX2A 1UJTA 4GAYB 2DJUA 2ICWA 2VDQL 5F9DC 5CLTA 5HGBB 5LCVH 3T09A 1FP5A 3QEUA 1EMTL 3VMOA 5GS2H 2CO7B 4PRIE 2FWOB 4LLDB 2D0GA 5E7FA 1ZGLM 3RA7L 1ZE3C 3RAJL 1ZXQA 35C8H 3O6FC 4WHYH 1QKZH 1BHGA 2OJZL 3PHOB 3I9GH 3MO1A 4TSAL 3FO0H 5D2NE 1C7SA 1U91B 2NTFB 5K9KA 2XWBA 1I9JH 2OZ4L 2RHEA 1CFSA 3ME0A 1ZK9A 5HYQB 4P3DA 4U6HA 2FYYA 1U8NB 4EVNA 1D5IH 3DBXA 5F7YC 4MHHI 4L4TD 4LVHC 3SO3C 3OWEA 1C5BH 5A3IC 5SWSD 1R3IH 3VFTA 3MLYH 3QIWA 5TF0A 3BQUA 3V5HB 4DJMA 2R2CA 4UIKL 3MA7A 3U4BH 4CADB 3HLAB 4XCYB 3MBEC 1V7ML 3CSBA 4POZC 1RUAL 2E7LC 3IB4A 4FQXA 4QTHB 3SDCD 1SQ2N 3V52L 4KJPD 3KNBB 2HRLA 4MNGB 3RL1A 3TO2A 4KY1H 1A2YB 3L9RB 4X4ZA 4PJIB 4YHNB 5C08D 2CRIA 2MWCA 25C8L 1FFOB 3AREB 3EFDL 4ZDHA 3MNWB 1S7RA 2WBJA 3O3UN 1H3UA 4FQ1L 4X5WB 3T0AA 4UT6L 3WLWC 3KYMA 4P3WA 3TBWB 4XC1L 1Z0NA 4C54A 1SJHA 4NM8H 3TFKC 4OZGF 3U6RA 4Z0BH 1PSKL 1V7NH 2NY0D 3EGSA 5IG7B 4KHXL 1W8NA 4H26A 4TVPE 3OAZH 1LO0L 3T0WA 1UXWB 3HE7A 4JDTL 1MJUH 2Z93A 4W70A 4YBQD 1H8NA 2VL4A 2WUCH 4KRPC 2ZCHH 1G7HB 1UWGH 4HWEH 2DMCA 1LILA 4MJ5B 2CD0A 1TNNA 4YHML 3IYLW 3TIEB 2YD4A 3LB6D 1A5FH 4LSRH 4HPYL 5AG9A 4RX4A 1IAII 4R2GB 4LEXL 3DMMC 1PY9A 1DL7L 1P7KB 4JFDB 5IP4A 3EYUL 3L3DB 3TZVA 4LPCA 1G9NL 4JANA 5C6WH 1MCIA 4J8RA 5DF0A 4FTVE 3KHQA 3VGAC 2Y9RT 2D0HA 3NVQA 5HTSA 5I66A 1MJ8L 2XWJA 3O9WA 5HYJD 5DVKA 1F90H 1KCUH 4ONOA 3EOBA 3MV01 4GKZA 3FQUB 1RZ8A 3QPQD 4HMDA 1A47A 4GKOA 1N59B 3O11B 5FGBC 3ILPB 4OLUL 4KV5F 4LKCA 4MWFB 3R06B 3BKML 2D03L 2PXYA 2XQBH 1AD0B 4Y4FB 1RUKL 4KKAD 3GNML 2G75A 1OGTA 4O02H 4S1RL 4XPAH 2LTQB 4LLWB 4BZ1L 4LRNH 4BSWB 4PLOB 3VCLB 1DN2A 1KGCE 5IWLC 4RAVB 1A21A 4YDJB 1K8IA 4JRXB 5B3JF 4HPOL 5C7XH 5JW5B 5DD5L 2FATH 4NZTH 3CXDL 3BPOB 4AIOA 4JGUA 4GG6E 5FECA 1XGYL 3FQRB 3QJHA 3QIUD 3DTXB 4NUGH 4TTGA 1NAMA 1OAYH 2M8XA 5IV2A 1KJ2H 4UU9B 3BPCA 1DBBL 4L4VA 4PRNB 2MJWA 3ISWA 3P2TA 4P23B 4KXZI 4M7KL 5C0FA 5L0QC 2APXA 4GAJH 4PP1D 5I8EA 1TENA 2AXJA 5DMKA 2UZYB 4OLVH 4EKXA 1B88A 2DQCH 4MDIB 3F12B 1ZHLB 4QWWD 3FB8A 1AKJB 4GRLB 5C9KA 2AV7B 1I8IB 4PB0H 4QOKD 2NNAA 5F7WC 5IHZA 1LEGB 3JV5A 1I9IL 4LIQE 5DJZA 4EI5A 5F71A 5I1DB 2QQLL 5J0BA 3H0TB 1KACB 1KIRB 4JY4A 3ARBD 1WZMA 3K3QA 1R6VA 1UQSA 4M7JL 4YC2C 4ZNEA 4G7YH 5H8DA 4WUUA 5SX4H 3PDOB 5EOCL 4PJDE 2BNUA 5KSAC 3AB0B 5T1LB 4PREA 4YNYA 4F37F 1UB5B 2OBGA 3RVUD 3OHXB 1GJIA 5C8JB 3PWVA 4PB9L 4Y89A 3I6KA 5E8DH 2W0KA 4ZUUA 4P99A 2IANE 3TJHC 5A40E 5DRXB 1QR1A 2IFFL 5KN5A 2ZP0T 1GGIH 3IVKB 4KUCD 4GAGH 1BZ9A 4P57B 3D1MC 1IM9D 4RGNB 1I3UA 3G5XA 4B53A 4L8BA 5J12C 3T77B 3GRWL 1CL7H 1MHEA 2VDKL 5H35B 3ULUC 43C9B 4H5SA 1NMCC 4CMHB 5J6HB 5A2KH 2XOTA 1G7IB 4PJGF 5JXAL 2OR8A 3I2CH 3QDMB 1CXHA 3MRMA 2A6DB 2VDQH 3HC0A 4I9WD 3L5JA 2DYPD 1EMTH 4YPJA 2V2XA 5T1MB 1QR4A 1YY9D 1A1NA 3O8XC 4NZUL 3ULVE 5C09B 3VW3L 6FABH 3Q1SH 3L7EB 3MV9E 3MRFB 2G2RB 3RA7H 1RJCA 4NQXA 4LLUB 4U6VH 5L2KB 5DVMA 4NJAL 4HCRL 3D39A 4TSAH 5DJ8B 5EH1A 1MFAL 2FIKA 4JY6A 2WNGA 3E3QC 2OZ4H 5GGVY 4ZUTB 5CBEB 3ZKXC 4MXVF 4TULL 1B9ZA 3RWJB 4MB3A 5DXWA 2RR3A 3UZEA 1P69B 4WTZG 2X1PA 1YPZB 3QNYA 1JZ5A 1AO7E 3VWJD 3L3OB 4Q58C 1KTRL 3V5DB 3LZFL 1ONQA 3QNZA 3KPMA 3RJDA 4HIJA 2NX5B 4NKMA 2NY6B 2FZ3A 5F3HB 1GZPA 2JK5A 2QHLA 3FFCE 1FFPA 3EYVB 4UAOB 3V52H 4KK8C 2DQUL 2UWEE 4S1DD 4UIMB 2YD8A 5IR1B 1KENL 4OGXH 2V9QA 3UTTD 4XXDA 2MNUA 3V9FA 3MLUL 5MEQA 3OXSB 5DSCA 1QVOA 25C8H 3EFDH 2XFXB 2OMBA 1QLEL 3O3EB 3HUJF 3O2DL 1U3JA 4UT6H 3X3FL 3E2HB 4JHAH 2Y23A 3T4AB 1T7XA 3ARGB 3IKKA 4XC1H 2Q20A 5E6YA 3HI6L 3V6FA 4G6FB 2H2PC 1U8IB 4O2EB 4OLZL 3EAKA 3OXRA 1PSKH 4KTEL 4N8CH 1BQHB 2P5WA 4KHXH 1WZ1L 2EYTB 1ZGLA 1WUNT 1M6OA 5DJXA 1LO0H 4Z6AT 4XCNA 3QFDA 4M9OA 4Y19B 3V5KB 3MREB 1Q72L 3HNVL 2G60L 2EXYC 2OSLA 4BUGA 4CUCA 1P7HL 1S7VB 3MGTA 5FOBA 5D7JB 1XT5A 5C0ND 3BZFB 4MNHB 1OW0A 1VGKA 2NY5L 3OKEA 1ZMYA 3AY4A 1NGXB 4LEXH 1CZ8H 1T04A 3EYUH 2ESVD 5HGGS 1OWRM 1QP1A 3AFLA 3P73B 4Y1AD 1C5CH 1CG9B 5DR5L 1PQZB 3HKFA 2HG5A 1MJ8H 1XGTB 4M1DH 4GUPA 1D9KB 1JZ6A 4EDXA 1R0AL 5FYJH 3QEQA 1TCRB 3QDJB 3GI8L 4WWID 1QYGL 1A6UL 5JNYA 3R1GH 4WCYL 3D6GA 4OFYD 4PR5A 1CFNA 1NKOA 3PL6B 2VDPL 1CVSC 2F9BT 4OZGB 3TIDA 1AR2A 5MHSD 5HHNA 1ZLWH 1CDIA 5DFVC 3BKMH 3SOBL 3HG1B 4PRAA 3VFMA 2BRRL 3GNMH 5JO5B 3PGCA 4L8SB 3Q3GA 5KSVB 1CTNA 1GAFL 2KH2B 4S1RH 4BZ1H 3X14A 2F8XC 1S9VA 8FABB 3RY4A 3SPVB 5GJSL 2WLYA 5DD5H 4DWHA 5HHOA 4IIQB 2VQTA 4OKVA 1WQVT 4DKFH 1I7RB 1XGYH 1RJYA 3IGAB 5LKNA 4RRPA 5E2WH 3D5OF 4ZTPH 1FZMA 5C3TA 2YXMA 3HAEA 3S5LB 5DEGA 3BKJH 1NKRA 3CCHA 1N5AA 1T1ZB 3LQAL 4WVRA 1G7PA 5EWIL 3BRDA 1UEMA 2NLJB 1ES0B 1WZKA 4CVZB 1JTTA 5B8CB 4IMLB 1DBBH 1J8HA 2P5WD 3FO2B 2BCKA 3V6ZA 4HG4K 2DLHA 3FO9B 3PF2A 2Y7QB 3BESR 4JVUA 3KLHD 2I9TA 3U83A 3SDYL 3STZB 2H3NA 4UDUA 5E1AA 2CRZA 1KN2L 3GGWA 3TVMC 4WO4C 3ARVA 4WGVB 3FRUB 1U95B 1ROWA 4N9GB 3MRIB 3WE6A 3WN5A 2R0WH 1JPTH 3VDCA 2H8PA 2QQLH 1UH4A 5GS1A 2XNAA 4IOFD 2AEIT 5D2NC 5GRWA 2IAMD 4UBDD 5LWYL 1HWHB 4PJIE 3EOAA 3NPZB 4PJBA 3Q0HA 3K1KC 5EOCH 2Y5EA 1SJEA 3G6AA 3ROLA 1ZHNB 2X4RA 2YD9A 5IBLC 3NCEB 1P5UA 1GGBL 1DSFH 1J05B 3BPLB 4Q9QH 3LEVL 1D5BB 5FK9B 1CI5A 2NXYC 1OTTC 3AXLB 4X7SL 3WIHA 4LLVB 1KUMA 3GKWL 3QXTA 4CAGA 4J4PA 2HJLA 1VESA 2YXFA 1M1SA 2DWEB 3P9LB 1P4LB 1J9CT 2DIBA 4NGHL 2V5TA 1EO7A 5D6CB 3GDBA 3GJEA 2CDFB 3O81A 3QDGA 4I18A 1IEAB 1SHMA 5TPWH 4RA0C 4QLRA 3F6LA 4G6KL 4Z5RB 4X4ME 4R7DA 1HIML 3WFZA 1G6RA 3GRWH 2BJMH 2VDKH 5HHOD 3T0EB 1U8JB 1JPGA 1NAMH 4JFDE 4JB9H 4RMVA 4WW1B 4XBPA 5JXAH 4F7PB 1KBGL 1DVFD 2N7AA 2RB8A 3X11A 4JKPL 5K9OB 3BW9B 1ORSB 1BVLB 1G9MC 4KK6C 5IMLB 2CDGA 2P8PB 2VN4A 4NZUH 3DUUB 4PJAA 3VW3H 2Z31B 4Z77B 1CIUA 3BPNB 2FBJL 3A6BL 3QWQB 4JO4H 4XPFL 4R0LA 1BPVA 1EUTA 2RAMA 3TO4C 4F15C 2J1KA 4NJAH 1QFWL 3QUZA 4LLMA 4K71C 1XAUA 5FA4B 3U48A 3KLDA 4XNUL 3SE3A 4TULH 5I1AB 5J57B 3KJ4C 4Z18A 2AXHA 5GZNC 1QLRA 4Z7QF 3RWHA 1OD9A 3ZO0A 4KZEL 4FQIL 3O3AA 2DQFA 1TXKA 4PJHF 2OYPA 2YPVL 3LZFH 1JHKL 3JV6A 1ZLVH 1F11A 2EE3A 3B5HA 2DMBA 1Q9OB 1UFUA 1A6PA 4JRXE 4WFHE 5JR1H 1KJVB 4U1KB 5DJCB 3TGXA 2DQUH 4YHKL 2ENYA 1KENH 2J8UA 3I02B 3RIAK 3MLWL 1FL5A 2CUIA 3MLUH 1MWAL 4N1EA 3MRCB 1UXSA 1ZTXL 1QLEH 3O2DH 2JF1A 4Q9BA 1OTUC 1XF5A 4P2QD 4ZAKD 3BGFC 3T0XA 3DI2B 3S36X 3GMQB 2WQ8A 4OLZH 2EIEA 4KTEH 5BS0D 1WZ1H 5CJ8A 1S7SA 4YDVB 2Y5TB 4UB0H 1Q72H 3WFCL 3SJVB 3EJJX 3T3PF 1KB9J 1CWVA 3K4DA 1U8HA 2G60H 3OKKB 2EDWA 5C07B 4F8TA 2CLZA 4XNQA 3QUML 5F44A 3Q2CA 4KQ4H 3QNXA 1RZJL 4JKKA 2NY5H 4Y4KA 4F3FA 3C9NA 1IZKA 4K8RL 2ED8A 5E6IC 4KI5E 2CLRA 4TUJA 4BZ2L 2V6HA 3IJYB 1BFVL 2APTA 1NCBL 4OBRA 1F2XK 3ARZA 2DF3A 5JIKA 5DR5H 1RHHB 4TUOB 3DROB 4POYA 3W82A 2BK8A 1IKNA 1H3GA 5CCKL 3QFJD 3GI8H 1QYGH 1A6UH 5D7IA 3JV4A 1T6VN 4WCYH 3QJFA 5HHXL 5CZKA 5HD8C 2GHWB 2VDPH 5IKCA 2J6EA 1I3VA 3OAZK 4ZXBC 2J5LB 5DJYA 2WW8A 4IMKC 3SOBH 3C6LC 4KVNH 5FM4A 1RY7B 5L9DH 4KHTL 1C16B 2BRRH 1QHPA 4M1CD 5DK2B 1J1OL 3H3BC 4PIRF 4RGNE 4YR6B 3ULSA 3H9YA 3IXTA 3BIAX 3SKOA 2JCCB 3RHWF 4ORZC 2EDFA 4IOIB 3ZDZF 4JHWH 4LNRB 4FRWA 4HZLB 4P2RA 5BVPL 3QDME 3SY0B 2OR7A 5JQ6L 1A4KA 1I1AB 4HUXA 4ZS6D 4KWUA 3BOVA 3FQXA 1I85C 1H15B 1CD0A 1T66C 5JW4Q 5FUCE 2EC9U 3DECA 3FTGB 4OV5B 1IM3A 5DFWH 1S5HB 5C09E 5GGTA 4HJGA 2X4QB 5DHVB 3C09C 5EWIH 4KJYA 3IDJA 1XIWC 5L2KE 1A6ZA 1L9NA 2ZUXA 4OUUA 1G0DA 5D71H 4R8WL 2GJZA 3RGVD 2X9XA 3DGGA 5L88H 4PJ8D 1T83C 2AXFB 3SDYH 3CD4A 2OCFD 1MCWW 1HHKB 2OX5A 1G7MA 4H0HB 4JFFD 3ZTNL 2X5PA 1YPZE 4ESKA 4BM7A 1KN2H 1Q1JL 5C0AA 1ZEAL 3B9VA 4M6ML 4LQ1A 2NX5E 3ULVC 4RZCA 4GXUN 4AG4H 2IPUG 1OP3H 1CF8H 4LCIL 4KQ3L 2V5MA 1GGTA 4U1HB 2BNRA 3DLQR 1W0VA 5DQ9A 1CCZA 4L1DA 1UKQA 2ADIB 5IB1B 4I13B 5LWYH 5KVGH 4NQCB 5FYKD 1DQML 2KUTA 3W9EB 5IMKA 2NY3D 4WI9A 4JFHD 4XTRC 1HZHH 1YQ2A 3PGDB 5BV7C 1D5XA 2ZSVB 5T5FL 2MMXA 1CGYA 4U31A 2A74A 2DL2A 4M93C 3FT2A 3RWEB 4LCUB 5T1KB 2V5SA 5ISZA 2R1YB 4LPYA 3CPLB 4RMQA 3VJ6A 3GMNB 3GKWH 1SY6A 4RNRB 1MNUH 5C1MB 4X6BB 1X44A 2YZ1A 5C9JA 2MQ3A 4E9LA 4Y19E 2BC4A 4ODWB 3VG0H 4RGMC 2V9TA 2CUHA 4LRIC 4G6KH 4OD3L 1G84A 3PWLA 2VB5A 3RWDB 1JZ4A 3HAEH 4PJ9D 3FZUD 4JEGB 3S3JA 1FRGL 3EO9H 4ZUVA 5F9AC 3C8KA 1GHFL 1A6TB 3NIGF 4JKPH 4P2OA 5F7DA 2GY5A 1YNLL 2PCPA 5B39G 5DC0A 5FKPA 1A9EA 2FBJH 3QDJE 4GJTB 4O2CA 2NPLX 3J8F7 2IPKA 3RKDC 4W4NA 1BQLL 1JHLL 1WJ3A 3MFFA 4FFZH 4OZGE 2HYMA 1MWAB 4ZFGL 4KROB 1MFCL 3RVVC 3LH2L 4XNUH 1EHNA 2P8LA 3EJZD 4LU5L 4AQOA 5B4MC 1YYMH 1IGIL 5IW6B 4KZEH 1JNLH 3DX7A 2YPVH 1JHKH 1IQWH 1H8SA 1HSBA 5BO1L 3DJ9A 1B90A 4UNUA 5E5MB 1FO0L 1ZVSB 3W11D 2D7TH 3GO1L 5E9DA 4UMGA 5E08L 5SWZA 3W0WD 5LBSL 4HGMA 1M4KA 5DJ2B 3UAJC 3CDGB 3TBSA 3VXSB 3WIHH 5DQJA 3QUMB 1RPQA 4NNYB 3ARYA 4GW1A 4PUBL 2HFEA 2W65B 1I1YA 1ZTXH 3E6HA 1XGPB 4YGVB 3REWB 3LDBB 4G8EA 2XKNA 5L8JB 3MX0A 3PJSA 3UC0L 5CHNB 5I15H 1G6RH 5MENB 2IG2L 2VITB 2YBRB 5GGRB 3QI9D 2C3GA 3IDNA 3OMZA 4HIEB 5D1XD 1EFXA 1HWGB 2V5YA 3WFCH 4Q6IB 5T1DL 3OPZL 3OX8A 1FFNB 2XPGB 1U2CA 5IJKC 3ARFA 3FRPG 1HYRC 4PJHB 2WWMD 5HHMD 4XCEA 3H7BA 4LAJH 3QUMH 4Y5VB 3OKMB 4G9DA 1KPRB 1RZJH 4CU6A 2PUQT 5EU4B 1VCAA 3RVXD 5B3JE 4PRPD 4K8RH 4ALAH 3I85A 3W2DL 4XZUA 4BZ2H 3GMPA 3U0TB 3MJ7A 1NCBH 1KTKE 1I1FA 3VGDA 3VE0B 2VDNL 4WHDA 2EYSB 4Z7WA 3NFPA 5CGYC 1I4FA 3KYNA 4X4XB 4FQCH 4F58L 1YEIL 1PZ5A 2BVOB 1U93B 4F7CA 3LMJL 4M61A 1LP9F 1LWRA 1RURL 3D0LA 4HGKC 4NT6A 4TOYL 2FECL 2DLFL 2VLLA 2Q86B 5JA9A 5F1NA 3CJJA 4RFEB 3ZSSA 1BP3B 3LKQB 3NFNB 2Z91B 1DUZB 2NMSA 4P4KB 3F7VB 3V4UL 1IRAY 3SDAA 4KHTH 1UWEL 3ZKQD 1PG7L 2DQGL 2GYSA 4ZOBA 1J1OH 4LSVH 3AREC 2XKUA 3T0EE 4M8VA 4Z7VB 4FS0A 4OF0A 4OD1L 1QG3A 1QQDA 5BVPH 3IT8D 5JQ6H 3WEXB 2R0KL 3IDMA 1T1WA 4IRJD 1F8TH 4JDVB 2AP2A 4Q2ZB 1JFQL 5F7HA 1TTFA 3PP3H 1OVZA 2FEEL 2EDJA 1VA9A 1T6WA 4IRSD 4NOFA 5F9OH 1PKQB 4GQ9L 4E0RA 1OPGL 3S34H 5D7SL 1WBYB 2FGZA 3C60A 1F02I 2C5DC 3PWPA 4L5FH 4R8WH 1NLDL 2VL5A 4MNQB 3QEHA 4XAWH 4R2GC 4P9HL 4OIIL 4ODVL 3MCLL 5BQ7A 3ARFD 1R5IB 3L3IA 3STBA 3ZTNH 5CP7B 3ZYJA 4Z9KB 1ZEAH 1EGJA 3SGJC 4M6MH 4YHZL 5D70L 4AM0A 5HDLA 1JZ2A 2EKSA 3OJDB 4OGAC 5E8EA 2CLVA 4LCIH 4KQ3H 4H1LB 5CKAA 3GIZL 2AK4B 5CD3B 1FNGB 5CEZD 1UH2A 2YK1H 3ZLQC 4NFDA 5JPNA 4WENB 4NHCL 1EHXA 1FG2B 2DBLL 2AJSL 3DVNA 4PBVC 3JTTA 3DX8A 1DQMH 5IMOB 1LGVA 3H9SB 3ZYIA 5ESAB 5ID0A 1OGAA 4RMUA 4A2MA 1M7IA 4Y4FC 4ZPVB 5ALCL 5E2TH 2AEPL 3GBLA 3FFDB 2LTQC 3JZ7A 5T3ZD 3KS0J 5IW3A 4DVRL 4P46A 4N0FB 3ZKSD 4M8QB 4F9LC 5ICXA 3SKMB 3TP4A 2JJSA 4AENA 4MXVE 4RGOL 4S1QH 3PWNB 4V1DD 4X9GA 4N1HB 3NZ8B 4H1LH 4PYHA 2F8OA 5DZLA 3BPOC 1FE8L 3JWNC 4PRBA 2W0FB 3SJVE 1FSKB 2ADFL 2B39A 3BZ4B 4EIZC 4JFPB 4K3JL 4QHUB 3QQ4B 1YC8A 4WWKD 2R69L 3KPNA 1G0XA 4MAYA 5GGTH 1A7RL 1FRGH 1ORQA 4QHLA 4P23C 1ZVYA 3MOAH 1NBVH 4RDQF 3TN0B 1T0MB 3T0BA 4IS6B 3OR6B 4NJ9L 3P40A 1KJ3L 1Q9KA 4GW5B 1YNLH 3RJQB 2VIRB 3LRSA 5D96B 1OY3B 3GZKA 1FO0B 1UENA 5D2LF 3ZL4L 1REIA 1R5VB 4XMKL 1LDPL 1MAMH 4HWZB 1N6QL 4F80A 4X0KA 5CUSL 3KYOA 4GRLC 3BIKB 3HZKB 1U8PA 4HLZG 1U8OB 1O7VA 5F1IB 1JHTA 2YD3A 4ZFGH 5EZJA 4HS6B 3LH2H 3D9AH 2KQMA 5MI0B 4EEEA 4LU5H 2COQA 3QXWA 1U3HA 4KI5C 1IGIH 2MTPA 1NCAL 5DEFA 3QUXA 1S9YB 5FYKU 3VD3A 3EO1B 1XF2A 1DEDA 2JCCE 3AB0C 1QO3B 1BFOA 5BO1H 4HUUB 3SCMB 1F6AA 1FO0H 3GO1H 5HJ3B 1OLLA 5EIVA 3ABZA 5DJ6A 5GS0D 3BRFA 4OM0H 4QRPB 3FT3A 4MQSB 5LBSH 3CAFA 5IBUG 4KTDL 3MXWL 4W81A 2DJSA 2KQNA 5K9QI 3QP3A 4XHJD 3EYFB 2CR3A 3PQYD 3WBDA 1CE6A 4RFOL 3VXUD 2FNBA 3ZE1E 2EEDA 2HLFC 1WAAA 3U46A 3QHZH 3I75B 4RGNC 4Z0XB 1ZSDA 1ZWIA 2YUVA 3UC0H 2AXGB 5ALBL 3OAUL 1FHGA 2IG2H 4CMHC 1BVZA 5JZ7C 1X5KA 4HKXB 1P6FA 3IFLH 4JPWL 2ZNXA 4FG6D 2X4PB 4FFWD 5DK0A 1VHPA 3BZEB 4OAWA 5L8LB 5T1DH 5KANG 3CK0H 5FUCC 4FQHB 1ZLVK 4B41A 4MLIA 4QYOA 4WRLA 5JHDA 4JFZL 5EOTB 1JN6A 5DEZA 3BN9C 1J8KA 3PG2A 2XACC 4KKLC 3W2DH 4EUPA 4NQCE 1VFMA 1ZT1B 1WT5C 1LNUA 1Q9WA 4K94H 3MV8B 4F58H 1YEIH 1MFDL 5EO1A 5FKAB 3L5WB 3LMJH 3UYOD 2DWDB 4JO1L 2GFBA 4Y2OA 3O41B 4TOYH 3TF7C 1HCFX 2DLFH 4N8VA 3VRLF 4DUVA 2ZSWA 5J6GB 2NY6C 4Z7OE 4KUCF 1EDQA 2BVPB 2EDOA 3NCCB 1OAZH 4JQVC 4J6RL 4UAOC 1EJOL 1WWWX 3V4UH 1I8KA 4FXGB 2R39A 3RIFF 4KFZC 1QFUL 1UWEH 1HYSD 1U0QA 4KZDL 4NHUA 3Q6GL 1Q94A 3IDIB 3FQNB 2R2EA 3E2HC 1G9NC 4OD1H 4XNMA 4FNLL 3C5ZD 3ARGC 4FQ2H 5ILTH 2UY6A 3ZHLA 3G5YA 4NN6B 5FO9A 1AGEB 5EN2B 3EHBC 1Y18B 1S9XB 1YMHB 1YNTB 3H3PH 4PJBE 4NZRL 4HXBH 3B9DA 4ZOEA 2DQTH 1OT2A 1L9MA 2YSSB 3MUGB 3SDXB 4RDQG 1HHGB 5LGHL 2X9WA 2X4OB 2OL3B 1I3RB 2DQIL 4GBXB 1LP9B 1OPGH 3WXWL 1CFTA 4IEFB 4WW2F 1T20A 2AAVA 1AI1H 5D7JC 1IMHC 1NC4A 3G6JF 5KSBA 4L29B 43CAA 2ILLA 2BVQA 2JLLA 2DJ4A 4D94A 3BJLA 4NC2B 5FA3B 3HS0B 4P9HH 3VD5A 5EZOL 4NDMB 1YEDB 1QSFA 1QLFA 3CFBB 2H41A 2EDNA 4FXKA 4YHZH 5D70H 1IL1A 4NCDA 1D9KC 2LE9A 4PRHB 3DUHA 2M1KA 5EOQH 4YFEA 4KGLA 3T8XA 3GIZH 4HLZH 2HFTA 1QA9A 2VQUA 4UILL 4NHCH 4NNXA 2DBLH 2AJSH 3WUWA 3VXSE 4A6YL 1MCDA 1MIML 2IQ9L 5DA4A 1KIUA 5HVFB 7FABL 3VFOB 2QSQA 3HB3D 4UNTA 4I8DA 3PUCA 2MHAB 1IQDB 4JFYB 4L8SC 5I8KL 2AEPH 2WBWB 3L3GA 1XF1A 4YXKH 2G9HB 4Y2DA 1R5WA 3HZVB 4L4TB 4MD5A 1L7TH 5SWSB 3KR3L 4YJZL 1FL6B 3H9HB 1C1EH 4HUWB 4IIQC 3QXAB 1KPVA 3QXDB 1FE8H 4Y0GA 5HGHA 4Z7QE 2N56A 3GBML 2X89A 4MVBD 4NZJA 3VFVB 4K3JH 1A9BB 1OP3K 4H25A 3BEWB 4Z7UA 3RZCA 2EE6A 1J18A 1NGWB 4K7PX 5EBGA 3EBAA 4XCCH 1W0WB 3U30B 1A7RH 5B8CC 3I3BA 3QO1A 1IC5L 5IHLB 4WHTB 5C08B 5IEKA 1WBZB 3K2UL 4NJ9H 5K93A 1KJ3H 2RCSH 1YMMD 1NFDF 3CSGA 2Q76B 4OTXL 3ZL4H 3ARPA 4XMKH 1LDPH 3QEGL 3FAXA 5C0JA 5C0BD 5CUSH 4YHIB 2NY0B 3O3DA 4JAMA 4NZDA 4XVTL 3L3HB 2R23A 5CD5C 1EGJH 2OMNA 1CYGA 5BXFA 3TA3A 5J11B 4XP6H 3ZHDA 1HHIA 1R3HA 1UB6B 2BOBA 5J1AB 5EC2B 4U1SA 5KVFL 5BVJB 1NMBL 4E42B 2I5YH 4ZS7L 2C1OA 3T3PE 3O3BB 1B6DA 2FHCA 4FQQA 2E6PA 5HY9A 1B6UA 2ICEB 2CJUH 3MLZL 4JM2D 4Z7VE 4C4KO 3HHRB 2HVKB 5EU5A 1UM4H 3BPLC 1G7QA 4DVBA 1SM3H 4KTDH 4J3XA 3MXWH 3AU1B 4TUKL 2P7TA 1IGFL 1AFVL 3TV3H 5HYJB 4YBLC 1MCSA 2VLRA 2DAVA 1MHHA 3BYYA 4X9BA 1T2QL 4Y4HA 2FL5A 4UNVA 5D2LB 2IGFL 2V2TA 4LPUA 5D7IE 1HDMA 3L7FA 1VGEL 1KEGL 1S7XB 4CMMB 4ZO7A 4RWYL 4MNQE 2ZG3A 4DEPB 5ALBH 3T0EC 2P46B 4D9QD 1OWWA 4J2XA 3OAUH 2BOCA 3MRKA 3VWKA 4PG2A 5IUSA 4AIZB 2X89D 3A0OA 3C6SB 4LP4A 4K55A 3QDHA 2NQCA 1MPAL 5DRNA 1L0YA 3ZZ1A 4N5EC 5EIIA 4LPTA 3K46A 5E5RB 3UBXG 3DXAA 2Z31C 3BPNC 2H6PB 4XX1G 1BIIB 2AK4E 1JPSL 2Z35B 4HWBA 4P2RE 4JFZH 4NRXB 5JUEH 3ESVF 1NCDH 5JLZB 2HT4D 3N1GC 3QIUB 7CGTA 1KEML 3S35X 3G5ZA 5D1ZA 4QTIL 5IJVA 3H9SE 2HT2D 4AQ1B 2BY1A 3RKPA 5D7LD 4XMLL 1MFDH 1NCCL 4JO1H 1ZLSL 1J12A 1FIEA 1HXMB 5ADOL 4IOSD 4K9EL 4NO2B 1O7SA 3VXPB 3VXTA 4ZOAA 5ICYB 3T2PA 2VXSH 3LS5L 4QF1A 4EDWH 4NSKA 5TFSL 1TZIA 3DX9B 3OF6A 4XXCA 5FYLD 1Z2KA 3NABL 5FIEA 3RPKA 1BF2A 3VI3F 3BH8B 1X5LA 4J6RH 3LKRA 2DQJL 5GZOC 4QRTA 2X6MA 3HR6A 1CLYH 3UTZB 4QOKB 4PJFA 5KSUA 1FJ1B 4TNWK 4KZDH 4K23H 2C4FU 4IRZL 3Q6GH 1QSEB 3ZYZA 1Z9OA 2NY5C 1UZ6E 1IGCL 3O45A 4BK4A 3O6FA 4NO5B 1S8DB 5DLMH 1AQKL 3ARBB 1CLZL 4FNLH 2XY2A 2P5ED 3O0RH 4RSVA 3M17A 2W07A 4U05A 4OFPA 1SYVA 3VFGL 3UTSA 3BE1L 3UJJL 5I1KH 2YMXH 4U1JB 3LQZB 1FIGH 4HV8B 3FB7B 1BJ8A 2DM2A 1UADC 4CBPA 3RNKB 4PJ7F 5LGHH 4X7TB 2AJXL 4OV6F 1BZ7B 4CDGC 2DQIH 3MBEA 2NY7H 2VXUH 3WXWH 4CKVX 1A6AB 1Q0XL 4A6YB 4JFOB 3IETB 4FABL 3QQ9D 2E7LA 1HILA 5EU6A 2J3SA 2GK2A 3T65A 1NDGA 1UCBL 4HIXL 4Y8DC 1IM9B 3AC0A 4WV1B 5FDWB 4F2MA 3UZVB 1N2RA 2VISB 4QHMB 4PBWD 4OUOA 2WUBL 4OZFA 4RQQA 1E28A 4QRPE 2ZPKH 1HINL 2DYPB 2AKRB 4YEFA 3DO3A 1NSNL 3MGOA 1F58H 3NIGE 5EBLA 3DYPA 3KPRB 1MIMH 1BZQK 1A7PL 4YDLB 3CFEA 3VRIA 4E5XB 3LQAC 2J5LC 4QXGL 2YPLA 4U1NA 4F7EA 1ZS8A 1P6AB 1QBAA 4TN9A 3MPCA 5I8KH 2EE9A 4W68A 4LBEA 5LAXA 4WW2B 4PV8B 1DQLH 2X4UB 3DMMA 3G6JB 3NTCH 1MFEH 3OG4B 5FUOL 3GMLA 3KR3H 3LKNB 3VWJB 1I1AC 3UBXB 1I7TB 3ZKND 5GGSA 4G43A 1II4E 3GBMH 5EB9A 3FONB 2DS4A 1AXTL 4IM8A 4BH8A 4NN7B 3B4NA 3JWOL 1SYSB 4PJAF 3CU1A 2W9LA 4JZNB 2YA1A 5CSZA 3QULA 4HJ0D 3UTTB 3UTSD 3VFSB 4UQ3A 5FGBA 5A3ID 1MY5A 4I48B 3K2UH 1T5WA 5LXGH 5FV1L 4K3DH 4UINL 2EH8L 3MV8E 1LD9A 2R2HB 5IVZB 3GUTA 4OTXH 3TBYA 5C70A 3N85H 3QEGH 5ICZA 2BY2A 4NO3B 4POZD 2BFVH 1KLUB 1X6NA 4R7NA 1BM3H 4ELMA 2HTKC 5F1KC 4PGBB 1DDHA 5IWLA 1MFNA 3W39A 1NLBH 1FYTA 5DRWB 3QZWA 5F97E 3KPQB 3QUYD 2WM0A 4XH2A 5J1TC 1BD2D 5TH2B 5E70A 3RDTD 2A73B 4AH2A 4LGPB 1DR9A 5KVFH 2BSRA 1IILE 1URLA 1JNHA 4ZS7H 1FAIL 2J8UF 4E41A 5B38G 4HMEA 1K5NB 3MLZH 4JFXA 2ESVB 2CRMA 2XKSA 3V4VL 3KS0H 2GTWB 5IIEB 4Y1AB 1TVBB 5DMIL 2MPAH 3QIBD 2H45A 3EW3B 4TUKH 2LQRA 5F8QC 4YUEL 1IGFH 1AFVH 5E4EB 4XVJH 5KTEL 3GSUB 4KRPD 5DDHA 1QBLL 3GK8H 1WFTA 5L6YH 4RAUA 4DKDC 4QXWA 2IH1A 2X4TA 4X6DA 5F21B 4ZUWA 3BVNA 1NFDB 5FM8A 4P5TB 3SDXE 4PLNC 1H5BB 4U2YA 3B3IB 5I1EH 4Y16D 4X80L 1I1CA 2I9LA 5GJTL 1ACZA 4OIAA 1KEGH 2AQ2A 2G5BA 4RWYH 3DRTB 4KH2A 3EO0A 3QCUH 1FCGA 3P4LA 2A6JB 3PDDA 5KZCD 3WFEL 2VLMD 1FC1A 4OCXH 1RIVH 1HQRB 5BZWB 5HDQL 2N1KA 3P4OB 3EOYG 4K3HA 3CFKB 1JNNH 1MPAH 5KSAA 2GJ6D 3QAZB 1LE9B 1FPTL 2LVCA 2OXGA 4PRHE 3MRPB 3T0VA 1WWAX 4NCC1 5TQ2L 5ERWA 3M45A 1T3FB 1U36A 3NZHL 3DO7A 3GMMB 4GKSB 1KEMH 4KROC 4ZFFA 3FO1A 3I3DA 1C7TA 2DBJA 4LCWD 1FVCB 5JPMA 2VSCA 2ZOKB 3O6LL 2HLAA 1XZ0B 4XMLH 1FV1B 1IAOB 1T1XB 1WSST 1FL3A 1EA9C 5C0DB 1I7ZA 1FNSL 5ADOH 4K9EH 1MCRA 3V95A 3J7HA 2R56L 1N5YL 3CGTA 2EC8A 2ARJB 3SQOL 3LS5H 5HPMB 2PW2B 2APWA 2GIYA 5IMMA 4L4TE 1JGLH 2GITB 5SWSE 4XP4L 2A9NL 5SWQA 4PJ5B 4PLKC 3MRBB 4NQEA 2FJHB 3BD5A 1H8OA 3O8XA 3FN0L 2L0DA 4P9ML 3BKCL 1OF2B 3ARWA 2Z92A 1RZJC 1YEJH 3WXVH 5ACLA 2P24B 1IGCH 4ZSOA 2AVGA 2E6JA 3AAZA 4JN1H 4MA7L 5D6DC 5GSRA 5C86A 4K8RC 1AQKH 3LDBC 2F74B 4Y5YB 1CLZH 2IAMB 3GBNL 5DS8B 5IHUH 3V8CA 3DUSA 4JFED 4JO3H 1AHWB 1DN0B 2FEDC 5C08E 2JJTC 5A16A 4PJXF 3BE1H 3LOWA 3DARA 3WJJC 1TZGL 4LQFL 3D3VA 3P9MA 2GEEA 4Q74A 3QH3B 3VFUA 4YAQA 4WFED 3G08A 2VLKB 4Q6IC 1BBJB 3ARQA 5EO9A 1HCVA 1Q0XH 2FIRT 2DRUA 3PGFH 4PRDB 4Y5VC 3V0AC 5MEPA 5CJQL 4P4RA 4EN3D 4KTYA 4BKLB 4L9LB 5J3HD 4I5BB 3C2AL 5B38B 4HWBH 1BOGA 3FMGL 5EBMA 5FYKL 1OAUL 4HS8L 1MLCB 5KS9F 1B2WL 2IMNA 4L3EA 4P2YA 3F6IA 2MQ0A 1NBZB 1RJYB 4ORGA 5CBAB 4PGDA 3GSXA 1DVFB 2WUBH 3PV6A 3RX7A 2N4IA 1FZMB 3SHSA 4ETQB 1EO8L 5DI8A 3HMXL 3KPLB 1H3PL 4CNIB 1NSNH 4ISVB 5HYJE 3V0VB 3K0WA 3ECBA 1A7PH 1KB9K 1T2JA 1J0IA 5JHLL 4QXGH 4P4KC 3S88L 5D2LE 1HHHB 4OGYL 2DN7A 4C56D 4PJ7B 2PYED 1B0WA 3IXAA 1A7NH 2B0SL 5I8CB 3KXFD 3TNNA 1MCFA 1U58B 3HFML 5FUOH 2QEJA 2H1PL 4JDZB 1RQ5A 3O8XD 5FHAL 4GSDL 4ODTL 5DZOA 1U8LA 1H0DA 5DUBB 1KPUB 5CEYB 1AQDB 4JPIA 2EO9A 2O5YL 3BH9B 3QO0B 4Q9CA 1IAKB 3QWOB 3WS3B 2ZJSL 3UO1L 4HX1B 1NJ9A 4GW4B 3WL9B 2DICA 5TE7H 1A1OB 3D3VD 4ZUSA 4L1HA 5E95B 3HPJA 4DCQA 1X5IA 2EH8H 5D9SA 4P2QB 5AD0A 2QQQA 4ZAKB 2B5IB 4Z7NE 1YUHB 5HGAB 1LMKA 1MI5D 3F7YB 4WI8A 3P4NA 5BS0B 4QT5A 4PGCB 1LO2H 2UYLA 4M02A 1CVRA 3G04B 2A0LD 1P4IL 1MQKH 2Y25A 5ADPL 1JI2A 4I0PD 4L4JA 1K2DB 3VD9A 3L1OL 1F13A 5ANMA 4L3ED 4OZFH 4QOKE 4MJIA 1ZA6B 2WMPA 3MV7A 1FAIH 4OQTL 1QSEE 5HI5D 5IQ9B 4QRUB 3MRLA 4TYUA 3V4VH 4OKDA 2IH3A 2IEPA 3BXNA 2EZ0C 3R4DA 5DMIH 3MNVB 4R96A 4ZFZB 3NBNA 3NOIA 1K3IA 3VXMD 1AP2A 1XF3A 5KTEH 4DW2H 3BHBB 3QFJB 2VUOA 1QBLH 5TGBA 1LE5B 3K1DA 4NQUA 3R8QA 3KPPB 4ODUB 3TVMA 5BJTA 2YPKB 4FZ8L 1FSKC 3KLSA 3X13A 4WO4A 1CLOH 4PRIA 3D85A 2I60L 1PYWB 5GJTH 1HH9A 3FL7A 3OR7A 3VRLE 5J06A 3K80A 1X5GA 1RAMA 1T2XA 3SDDD 3ZTJH 5IM7A 1RK0B 5CZVH 4EOWL 2W9EL 5D2NA 2FO4A 4WUKL 1EUUA 5HDQH 4OT1L 3TN0C 5IBTL 2HKHL 4QO1A 4DKEH 1OCWH 5DD3L 5C0CE 3PIQB 4HK0B 1UH3A 1X5FA 1M71A 2ITDA 4FMFA 5DUPL 3C08L 2EECA 1ZT4B 3BP5A 4U3XA 5D96C 1XGQB 2R1XB 2LU7A 1AIFB 3OKLB 5I76A 4OFIA 4I9WE 3W9DA 2HT3C 3OB8A 3NZHH 3NCJL 1OSZB 3NMEA 5GPRA 4XNYL 3BJ91 2LABA 4X6EA 3KPRE 1P4BL 4OCRH 5DK3A 5MI0C 3V0WL 3RTQA 3DETC 3KG5A 2X4NB 3D2UD 3O6LH 5FF6A 3O4LD 4GS7B 4I0KA 4NRYA 4N9OB 1MHPL 3RGVB 4NWTL 1ZHBB 1LO5B 3TBTB 4PJ8B 4MS8C 3LN4B 5D4QA 5EU3A 3ZDXF 1FNHA 1N6UA 3SCMC 1VFAB 4JFFB 1A3QA 4XP4H 2WZPD 4MJID 1AH1A 4NQSB 5HI4D 1XH3B 3VFWB 2D7NA 2M26A 4HFWA 5D5MF 4DUXA 2AJ3B 4XX1E 3FN0H 1AGCA 4P9MH 3BKCH 1FG9C 3Q5TA 4YHPB 1VEMA 4HZAA 2PO6B 4YHOL 4JREB 1EVTC 1WWBX 4GRMB 3TYFA 3TO4A 3UTTE 3GBNH 4UV7H 3ZT7A 4LKXA 3RWGB 2W92A 4NC1E 3M8OL 2NY3B 2FJGB 1FZJB 4WGWB 5CJXC 1S9WB 4NKIL 3I6GA 3X17A 4ZO9A 1U8KB 2C4FT 2CXGA 4FTVA 4ODHH 3SBWC 5SX4I 1JZ8A 2A77L 1K4DB 5HPOA 4WU7B 1J10A 1E4XL 3U7AA 4XP9H 1P7QD 4PJCF 2HMIC 2CIKB 5TDPA 2VLJD 3RWIB 5CEZL 4WEBH 1DQQB 3MNZA 2A1WL 1I3GL 3LSOB 4HK3N 3AGVA 3CZFA 4AEIL 4WJ5B 3FMGH 5TDOB 4X4YB 1GC1L 3NACL 4HS8H 1KIQA 1KG0A 4C83A 4PJ9B 1AGBB 3T08A 3LPFA 3WV0A 3E8UL 4AEHL 1KFAL 4UT7H 5LGKA 2ESVE 3MACL