1CN4A

Erythropoietin complexed with extracellular domains of erythropoietin receptor
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
217
structure length
217
Chain Sequence
PDPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGQYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGQGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSEWSEPVSLLTPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hematopoietic cytokine
molecule keywords PROTEIN (ERYTHROPOIETIN RECEPTOR)
publication title Efficiency of signalling through cytokine receptors depends critically on receptor orientation.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
A PF09067 EpoR_lig-bind Erythropoietin receptor, ligand binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cn4A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cn4A01
4MJIA 1SYSB 1JPFB 4YNYA 3SKNB 2DM4A 4M7LH 4L8CB 3ISWA 3B9KC 1YN6A 5C6TH 5FUZH 1OGAB 1UA6H 1IJ9A 4C57C 3QHZH 2VXVH 5T1KB 3M8OH 4E5XA 3QRFM 4LNVA 3ZL4L 1TMCB 2XKUA 3BD3A 4U1IA 1CIUA 1EFXD 4P2OD 3V5HA 3N9GH 3RVUD 1INQB 3VH8A 1UWXK 3E6FB 1QBBA 1I9RH 3C08H 3CC5B 3VFPB 4HIHB 2VITB 5JW5A 1A7OL 4KI5C 4XMKL 3C6LD 3REWB 1CVSC 1NBZA 3QFDB 1D5BA 4EEEA 1DBJL 4RIRB 2PTVA 1JI1A 3T0EE 4NNYA 2EDNA 4M1GL 4GG6A 1JHTB 5E5MB 3MX0A 4YXLH 4X98B 2B5IB 3U36A 3UDWA 4OV5B 5CINL 3KPNA 2G2RA 4NKQB 5IEKB 3TH4T 1FO0L 2XQYG 3CVHH 1FP5A 4EOWH 4F8QA 2X89A 3HI5L 3BSZL 4ALAL 3DGGA 4TTDC 5HJ3B 4JHWH 5GS0H 2MHAB 2WUCH 4CU6A 3G5VB 4J8RA 1FJ1B 5C9JB 1MCEA 1FFOA 2Z31A 2Q8AL 4KHXH 3STBA 5CHNA 5H35A 1KIQA 3Q3GA 4PJBA 1OTUD 2FX7L 4XB8A 2C4FT 3HZMA 2ZSVB 3I6KA 2WP3O 3CFCH 3CJJA 5FYKL 1MIMH 4R4ND 1QHOA 5DI8B 3FQRA 2H8PA 5HGDA 3MV01 3I6GB 1A3RH 3DJ9A 4I1NB 4MAUH 4JZNB 3N50A 4PRHB 4RZCA 5HBBA 2BCKB 3BZ4B 2P49B 4PS4H 1ZLUK 3KPSE 5C0BE 1DLHA 2CDGB 3ARTA 4WTWA 5F7KC 4ZPTB 5MEOB 3S9DB 5IROA 3DOSA 1V3LA 1CL7H 4OLWH 5CZKA 1WVZA 1DSFH 4F7PA 1YQ2A 1U2HA 2EDRA 3OWEA 3RL2A 3WNLA 4MJ5A 4K7PH 3HNVL 3SDAB 1EVTC 3T0WA 3SJVB 1UKTA 2R0ZL 3EOYG 3QQ3A 3RI5F 2NTFB 2JK5B 3QCVH 5JW4Q 3P0YL 4U0RB 4LHUD 1JV5B 2Z35A 1HH9A 3U83A 4HDIA 3LAFA 4J3SA 5IMKB 5I76B 3VXQA 5F3BA 1IE5A 4G7VL 3BKJH 4R90L 1KOAA 3GFUA 1IBGH 4NQXA 4HG4J 5JW3L 1LO0H 4UOW0 3S96A 5CP7B 2NNAB 1ZXQA 4EBQH 2FD6L 3B5HA 3NMEA 2HFEB 1SM3L 5FCSH 1T4KB 2VDOH 3MXVL 3VXNB 5IR1A 4PYGA 5DD3L 1I75A 5CSZA 1P84K 3OF6A 5CAYB 2VH5H 4OD1H 4WWKC 5IFHL 3CSYB 4KJWD 4Y5YA 2NMSA 5MENB 4K94L 1ZVSB 3OAYK 4DN3L 3FB5A 2DOCA 1JPST 2AVGA 1U0QA 3NFSL 4WCYH 2YPLD 3MJ9H 2X9XA 4HPOH 1ED3A 3OKEB 4G8FA 4JR9H 3QJHA 5JPMB 4FQHA 4XC3H 2PR4L 2D7QA 2NY1D 1TQCC 2OJEB 4OCYL 1CBVL 3LS4L 2VYRE 1V7MH 2XN9A 1NCDL 5DJYA 5B3JE 4Q9RL 5B21A 3LEVH 4UTBH 2AABH 2I5YH 4ONHB 1EVUA 3FO0H 3CCHB 4PRDA 2IADB 3PP3K 3STLB 1RUPH 5DUPH 3C8DA 1MCOL 4S1DC 3LCYA 5GISL 1U8IA 2DQEH 3S6CA 2OZ4L 5EOCJ 3C60B 1I8LA 1E4XH 4GKNB 3BH9A 3IVKB 1QLEL 5D7SL 4X8XA 3V52H 2ICWI 3G04B 3P4NA 5HHNA 5D7JB 2DIAA 1RMFH 5GGVY 2R2BB 1QR1A 4IEFB 4LSRH 5IM7A 3NH7H 3MQIA 4BUHA 1A7QH 2G9HA 2VLKA 4E41B 3KPQB 2VXQH 3QUML 3HE6B 2NW2A 2FZ3A 2HLAB 5EZLB 4R0LA 3QHFL 1NFKA 2HLFC 2XQBH 1SVCP 1XH3B 4BSVB 2OL3A 2DKSA 5IJVA 4XNXL 5JOEA 3E1F1 1I8MB 5ESAB 1PY9A 2ADJA 5GZND 4CMHB 4LVHB 1BZQK 4G9FA 1LK2B 5D96C 1EK3A 4AEIH 3SDAC 4Y1AE 4GBXB 5DMKA 2B4CL 4GUPB 2PYEE 4FNLL 4JFOA 1FV1B 3PWUB 3GHEH 5F72S 5I1JH 4V1DA 4XNQB 1EDQA 1RZ8A 4XC1H 1UZ6F 1LP9A 4H20L 5IV2A 1DDHA 4ONFL 4ZFGH 4Y4FD 2RJMA 4EVNA 4XWOC 3BN3B 3VI4F 1UT9A 4DUWA 3GI9L 1O7VA 3EOAB 4HV8B 1IGTA 5KSAB 4QHLA 3GBNL 1CFTB 2QSVA 5IB4B 1DBBH 4WWID 5CSGA 3WIHA 3B9AA 1NCBL 1KB5L 4NJ9L 1SJXA 3BRGC 5SWZA 1CD1A 3KPMB 4XVTL 5C0EA 1V7NH 1FGVL 4XP5H 1OM3L 3HCVB 3MRJA 3PP4L 3QNZA 4DQOH 2DQCH 5FA3A 2JJUA 4MXWH 3MNWB 3KYMB 2P5EE 4PJAF 3HE7D 3GMOB 3RTQC 4F33A 1CFSB 2AXFB 5IHUH 1Z9SA 4FFZL 1XF2B 4Z7WE 3G08B 1QZ1A 5DYOB 5FCUL 5KSUA 1UM4L 3HG1A 3LQZA 4N0UB 4JN1L 1ZHBB 2ZJSH 3S37X 1WIUA 4Y88A 2CDFB 3KYOA 2DJSA 5KN5A 4ENED 4BFBD 5C9KA 1NC4A 4YQXL 2W92A 2VAAA 4U6VL 4KKAC 5EO0A 1JGLL 1BVLB 4XBPB 1B0GB 3ARFC 1WC7A 4FFVC 1K3IA 4P0DA 1HHIA 5INCB 1ZHLB 5DD1H 4C56B 3BH8B 3BAEL 1Z3GH 5T5FH 2G5BB 4AENB 5KVFH 1MQKH 3DMMC 3WHE1 1KUMA 3CDFA 1JGUH 5BV7C 1G84A 4HIEB 5FYKE 2XOTA 1KACB 4MMXC 1UJTA 3T1WA 5HVHB 2PXYD 3ZE1E 4U6XB 3B3IB 2VZ1A 3FO9A 1X9QA 2D03L 4JFPA 1OW0A 4Z7UB 1DVFB 5TF0A 2F5BL 3BDYH 4F7EB 1PFCA 4OFIA 3O3UN 3D39A 1S9VA 2F53A 3IRPX 4DEPB 3C6SB 3ZHKA 4FZEL 4KVCH 2AS5M 4Q2ZA 2YSSB 3KPOA 1M6OA 1SJVA 4U3HA 2OR7A 3UTSA 1T03H 3HZKA 1LGVA 1LO4L 2W07A 4ODSH 5GS1A 1DN0B 1TETL 4U1GC 3I50H 5CJOH 5GRJL 1U6AH 1UH3A 1AO7B 1S7SB 3CFIC 3OAUH 4ODWB 2MOVA 2EE3A 3MRPA 2VLME 3UROR 1QFPA 1F45A 4FQ2H 4XMLH 1YPZE 1NBYB 4IMKA 3NFNB 1T7XA 1I7RA 3HUJA 1A21A 4IOSD 3NA4A 1SY6L 4NO2B 4Z76A 3VRJB 4ELMF 3M07A 2DLTA 4CNIA 4KZDL 4PJAB 4YDJB 1U3ZA 2XRAL 3P4OB 3PQYE 3LN9A 4A6YH 5FO7A 1LVEA 4YPJA 3W11D 1JZ6A 1C5BH 2CPCA 3BN9C 1KB9J 4WEBH 5DD6A 1RZGA 2AW2A 2V7NB 2XT1B 3DSFH 1CGSH 2ZUUA 5IB3B 4UBDC 3IXAA 5ERWA 3S3PA 5L8JB 5C0RL 1SYSA 2AJ3A 3SKNA 1U91B 2FH6A 4PREB 5ANME 1OAZL 3EYQD 1QFWI 4PJEF 4P5TC 3BP6B 4NM8L 5D1ZA 3O2WH 2BY1A 2WIMA 5LG1A 3ROLA 4HBCL 1MCFA 4OQTA 4OUOA 2I9TA 1RULL 1R0AH 1TZGL 4LEOA 3T2OA 2DMBA 3PXJA 4M4RA 3QDGB 3ARDD 1D5IH 1NGYB 4P46C 1KYOJ 1ZSDB 1B2WL 3ZMRA 1XGRA 2UY7A 1H0DB 4HIIB 1DN2A 3CC5A 4G42B 2VITA 4K2UH 3UTPD 1BVZA 5FGBA 4RIRA 1MPAH 2NY3D 3GMNB 3OX8B 5J0BA 1VB9A 2UWEE 1JHTA 4WFFD 1IGFL 1QNZL 1YEGL 4MXVE 3V5KA 1YEEL 1M7IB 5IEKA 4HFUH 3U4BH 5GJSH 5DJZA 2ED8A 4DEPC 4DZ8A 4L3EE 2FBOJ 4ZAKC 3RAJL 3R8BB 3I85A 5HJ3A 1D6EB 4NM4L 3RX7A 3G5VA 2CKBL 4AMKH 2VZVA 3BISA 4BZ1L 5BVPH 4U1KB 4DOHE 5FEBA 3NVQA 4X6BB 4QOKE 5D70H 3UJIL 3NCJH 4P9ML 5IOPB 5D8JL 1T20A 5IW6A 3MRGB 1IAKA 4HJ0C 2ZSVA 1I3GH 1R6VA 4ELMB 3P11H 1T0NB 1A1MB 1F6LL 2H2PC 4DTGL 3AY4C 4IJ3B 4XP4H 3S37L 1N5AB 2FEDC 4Q6IA 4PRHA 3MRIB 2G60L 1T1YA 1T0MA 1YJDL 2CH8A 5BRZB 2ZG1A 3V7AG 2DQIH 1KPRA 2CDGA 5F9AC 3BQUB 3LHPH 2HP4A 1DBAH 4KK8C 1KJ2A 2ZG3A 3ARXA 1J1OH 3CFDB 4PJEB 4X6CE 4EI5B 1VGEH 1TENA 3LEXB 4YLQT 1U3JA 1X5JA 2Z92B 5AD0B 3NIDE 1JV5A 5IMKA 3B8YA 5HYSG 2VO5A 5DSCA 4OI8A 1G7IB 1AY1L 3U4EA 2B1AH 4OF8A 4R4BB 1KCUL 2YZ8A 4U1HB 1YYML 3B43A 5F1IA 1HCVA 3DVFA 4Y4KB 1CYGA 4R9HA 5K9JH 5GRWA 1RHHB 1Z0MA 1T4KA 3MRBB 4NGHH 4CBPA 3VGBA 5C2BL 4DGYH 2GJ6E 3CSYA 4WJ5B 1F58H 5CJXC 5TGBB 4QHKI 1ZVSA 4JO3L 1RJZB 2A77L 4APQB 3BMVA 1BIHA 5A43C 1XGUB 1NLDL 3O9WD 3OKEA 3IF1B 2EYSB 1X6LA 2VDLH 1AGCA 4JFDE 1P4BH 2P45B 2VDNH 2DL2A 1IGMH 2ZUVA 1HSBB 1HCFX 1MY5A 3EYVB 3GNMH 5IVZB 2GKIA 2IADA 4G80A 4QRUA 4AIZA 2YRZA 4PLKD 4K23H 3ILQD 1AIFA 1N6VA 4TNVF 3C60A 5EOQH 1JGVL 3OZ9H 5BS0E 3IVKA 2V9TA 3SCMB 4OGAD 3WHXA 5LKNA 4NT6A 5D7JA 5EA0L 4XVUD 5I8EA 3LV3B 3OJVC 4CJ1A 2R2BA 2A73B 4CU8A 4CU7A 4G9DB 3T2NL 5KVGH 1ULVA 5B39A 1FZOA 2OXHA 3KPQA 3O4LD 3HE6A 2A2QT 4G6MH 3U48A 3MBEB 2CR3A 1QBML 2HLAA 5LGHL 5EZLA 1ZEAL 1I7UA 1NBVH 2XZQH 3GSQB 4BSVA 5E0QA 3TZVB 1MHPL 3GMRA 1I8MA 5ESAA 4LRNL 1XR9A 5DVNA 4M43L 3D2UB 1LK2A 1KSRA 2VDMH 1CTNA 3QDMB 4OSUH 4EI5C 3GSVA 4GBXA 4YHKH 4OZFH 4C59B 4GUPA 4JPVH 5E6ID 2NY7L 3IXTB 3SN6N 3PWUA 4IDJH 3UZQA 4H8WC 4O00A 1UM6H 1KELL 2BC4B 3DROB 4HGKC 4XNQA 2E5EA 1ZTXL 4NIKB 1XF3B 5IQ9B 3F7YB 2QSQA 4M7JH 4YAQB 1IZJA 2AK4A 4TVSa 3L3JB 1CTOA 4GMTL 2X40A 3EOAA 2CMRH 5F7EL 1J1PL 1BWMA 1QHPA 1CFTA 2AKRB 2Y25A 5IB4A 3U9UB 1NGPH 3FOLB 5F8QC 4U6HB 1PEWA 4AT6B 5L88L 1MCHA 2RCSH 3DVIA 4JKPH 3RA7L 4XAWL 3LS5L 3D85D 3CLEH 4NWTH 4KJPD 4PJHA 2F19H 2XA3A 3PE9A 1IFHH 3MNWA 4N0YH 1KBGL 1U95A 3GMOA 5HYJD 2AXFA 3AGVA 3SDDC 4GAJH 4LEXH 3SGJC 3G08A 5DYOA 3RRQA 4N8VA 4HK3J 1R3LA 2CK2A 1MJ7L 5E70A 1ZHBA 4OIIL 4R4FL 4BKLA 3RY5A 4PJFE 2CDFA 5T3XL 1G6RA 1ZT4B 5EU6B 5F9WB 4PRPE 5AZ2L 2OMNA 3JZ7A 4N90E 4MX7B 3MLTA 3I3BA 4YEFA 1BVLA 1RFDH 4LSUH 4XBPA 4QRQB 1F4WL 2GK0B 1QSEB 2JB5L 5HHQB 4POYA 1MCCA 4KUCD 5L6YH 5INCA 3V4UH 1ZHLA 1Y18B 1LD9A 4C56A 3BH8A 1EJOL 3EBAA 1RK1B 4AENA 3BHBB 1QFWH 5IBUG 3TO2B 3K4AA 1QA9B 3D9AL 5T3ZH 3AREA 2IPKB 2P44B 4S0SD 4ZUVB 3QUYB 4HIEA 3T3PF 1G7JB 1UWGL 1N7MH 4QHNA 4IRSA 5E03A 1NL0H 4K7PX 3B3IA 1K5NB 3RWDB 5BV7H 4NNPH 4Q0XH 1DQDL 4Z7UA 1DVFA 3DLQR 1JWSB 5B38G 4MCYB 5J8OA 4JO2L 1DEDA 4M93B 3S88H 3QFJE 4DAGH 1HHHB 3C6SA 4ERSL 5BMFL 3KPRD 2YSSA 4Q58C 1NEUA 2X70B 4HJJH 3IDXL 3LB6D 2DLFL 5F88B 3IFOB 3RJQB 3TBYA 5FF6B 1DN0A 3ARBA 2AEQL 1MFEH 1WT5C 1VEMA 2DTSA 1AO7A 1MHHA 3QCUH 5GHWH 4S1RH 5JZ7D 4IS6A 4Y4HB 4ZUUB 3KWWB 5LAXB 2MCPH 2IWGA 3ULVD 1NBYA 5EU4B 4Y8AA 1J5OL 1JN6B 2CD0A 2VABB 4PIRF 4NRYA 1CD8A 5CLWA 4NO2A 2P42B 1YNLH 3VRJA 32C2A 3QUXD 4YDJA 3CLFH 4HUXB 3RWFB 1MFAL 2JKXA 4W4OA 4ZFFB 1CGUA 4PRIE 1VFBB 5CJ5A 3EJZD 2OJZL 4WGWB 2KUTA 1AC0A 1TCMA 1NGQH 2ZUQC 3WKMH 3QUZD 4Y5XB 2X44D 1CD9B 2WIIB 5JW4M 4R26L 4S10A 1BOGB 4L8SB 4OGXH 4OLZH 3QIBD 4TQEL 2R1XA 5EBLB 1JK8B 1T1WB 5F9WC 3BP6A 1WWAX 2FJFB 1UVQB 2ORBL 2Q8BH 4XTRC 2YRPA 1JMZA 4AH2B 4O2CB 4L3AA 4M7LL 1J0YA 1GIGH 2HG5B 5C6TL 5FUZL 1UA6L 3ULUD 4AIXA 4UI2A 3M8OL 3NPSC 1U36A 2IH3B 4KTEL 3QDGA 5HHMD 2ZPKL 1NGYA 3QDJB 4NNXB 4WO4C 4AYFA 4G8GB 3C9NA 1P9MA 1ZGLB 3BP5A 5C08A 2PN5A 4JRYD 1CGWA 3N9GL 2IFGA 1KULA 1T89A 5JXAH 3GMNA 2I9LA 5SX4I 1LE5B 4NQCB 5TQ2H 4XT1C 1RK0B 1I9RL 3C08L 4UV7H 1FFRA 5HYSB 1M7IA 5FHBL 2BVUA 1XGPB 2HTKD 4OB5H 5E8EB 1BFVL 3G9AB 1OP3K 4BH7A 4YXLL 3T0VA 5A3ID 2V2WB 3CD4A 3IFPB 4QRRE 3RVTD 4HUUB 3QISA 2H3NB 3CVHL 4U1KA 3ARGC 2A83B 5E6ZA 4DVBB 3HPLB 5KW9L 2YPVH 5IOPA 4MQXC 2WUCL 5FFLA 2ITDA 4ODUB 5F9DC 5JHDE 3KDMB 4KHXL 3DTXA 4ELMA 1T0NA 4QGYA 1A1MA 1CDGA 5I71C 1CICB 5HI4C 2KPNA 2FECL 3IDGB 1WCBB 3BI9X 3V0AC 4OLXH 1NC2A 3MRIA 5DZOA 4I0PD 1OSPH 3IS1X 4PV8B 3CFCL 1IGYA 4O4YL 1WAAE 4O5LL 4U05A 5KSBF 2NTSP 4JFHD 1FL3B 1RI8A 1S7WA 2QQKL 3DNKA 4GKSB 5J6HB 5BRZA 4MAUL 5HHXH 3QO0B 3FFCD 3BQUA 1QOKA 1XGQA 1H3XA 2R1WB 4LGRB 1JPTH 4CL7A 5D7IF 4OLUH 2VXSH 4D3CL 5HHOD 2ICES 3C8KB 5IJKA 4Y5XC 2BNQE 3CFDA 3RWEA 7FABL 3CXHK 4PJEA 2VTFA 4CAGA 3WFDH 4HMDA 2ZSWA 3WFCH 1CL7L 2VL5B 4OLWL 5DGRA 3K2MC 1DSFL 3H0TB 4HWZB 4L8SC 1MCPL 3F7QA 2F54D 3U7AA 1EFQA 2FH8A 4O9HH 4K7PL 3GB7A 3QPQC 4P3CH 4LMQE 5F3HB 1G7IA 4ZTPH 5F7LB 4YDIH 4QXWA 2DIJA 4XRCB 4MHHI 4R4BA 1UB5B 5BZWB 4YHOH 4U1HA 1UB6B 3OKDB 3RGVD 4MA3A 4Y4KA 4GAYB 2R4RL 1IQDB 3GMPA 4KDWA 3QDAA 1RHHA 4Q6YA 1IBGL 1C1EH 3MRBA 4GKZB 1LO0L 1IT9H 3U2SB 1YMHA 3DGCR 3U46B 4WJ5A 3P73B 5TGBA 4ELKA 3H9SA 1CZ8H 5E8PB 2OS7A 3BWUC 2VDOL 2IPTL 4APQA 3BIKA 1QKZL 3UYRL 1OARH 35C8H 2VH5L 2VXUL 4OD1L 1XGUA 4PG2A 1QR4A 4Y2DD 4LP4A 2EYSA 3VFGH 2CLZB 2YA2A 2B1HH 4G6JL 4CN1A 2F8VA 5CS7A 5F7YC 1J8HE 4PBVC 3VXSE 4Q9QH 4K71B 3EYVA 4RRPA 3MJ9L 4NQED 4XXDA 5IVZA 3MRCA 4JR9L 2HKHL 2W59A 4TVPD 4XC3L 3K4DA 4HS6B 5ID1B 2CRMA 5AYUH 1V7ML 2BSRA 2HN7A 2KDGA 4PJDB 2BRRH 3CX2A 4UTBL 2AABL 2I5YL 1V5JA 4RISL 5EU7E 1KCSH 1RUPL 5DUPL 5HGHB 5DR5L 3MUZ1 3CFKA 3SCMA 2DQEL 2DQUH 5DTFB 1C7TA 3QAZC 2AJSL 1WQVT 4NQVA 3LV3A 1E4XL 5KSBB 2A73A 4G9DA 3EHBD 4P2YA 2J88H 1SBSH 1B4JL 3ARQA 3MBEA 1C12A 4QY8B 3KR3H 1RMFL 2LU3A 5MERA 1P5UA 5D7IB 1NFDE 1A22B 5ESVB 3NH7L 2BXZA 2Y72A 1RJYB 1U8HA 3GSQA 4XPTH 3TPUA 5EDXA 1H3UA 2APTA 3C5JA 3I3EA 3PDOB 3TZVA 2VXQL 2AJVL 4LU5H 1IQWL 3GI8H 1N8ZA 5D7KD 1TVDA 3B6SB 4N9GB 2L0DA 3QSKB 1JNJA 4KKCD 2XQBL 5C0GB 3GK8H 4M62H 5CFHA 2IALB 5D1QD 4R7DB 4WI5A 5TE4H 3QPXH 2EE6A 2MTPA 2IG2H 3DUUB 3IXTA 1ONQB 4G6AC 1CU4L 4OZHE 1CFNA 4AEIL 2EDHA 3DROA 3A0OA 4KK5D 5IQ9A 4F7MB 3FB8A 3F7YA 5DQ9A 5D7LD 5F6HJ 4H8WH 3MRLB 3TN0B 1ZGLM 4YAQA 2XKNA 3GHEL 2W0KA 5KOMC 1SJEB 4XC1L 1T83A 2LTQC 2AKRA 3U9UA 3UTTE 3FOLA 3DI3B 4ZFGL 5B38B 3T1FB 5DEZA 4U6HA 1HYSC 3HR5B 3VRIB 1X5IA 3T0EB 5GQBA 3U6RB 1DE4B 2GEEA 1AGBB 1FG2B 1DBBL 1IAIH 2A6KB 2APVA 2VAJA 5J6GB 1NPUA 4P57B 1V7NL 1CF8L 4XP5L 5HDBE 3TFKC 1A6ZB 3GDBA 1T0PB 3ZZ1A 2DQCL 4MXWL 5T1MA 4JY6A 3BIBX 5B3JF 3GJFH 4KK6D 5KVEH 3EW3B 1ZT4A 4XZUA 4XPBL 4R2GB 5EU6A 1F4YH 3VFWA 2VQTA 1UYWH 2ZJSL 4OZGE 3LKOA 4QRQA 3HS0B 3MTRA 1QSEA 1UACL 2GT9B 3BUTA 3P0GB 2YD4A 5HHQA 2V5MA 1Y18A 3WDIA 4MXQD 3GBMH 3TO2A 1Q9WB 3KPSB 1QA9A 5C0BB 3PV7A 5EBWB 4QHUB 5TE6H 1OAKL 4MVBD 1OQOA 4WENB 3QUYA 3OXSA 5DD1L 5SWSD 5T5FL 4YUEH 4RAUB 3KS0H 5T5NG 1MQKL 2PO6B 4WUUD 1VA9A 4RGNC 4PGDB 1K5NA 3RWDA 2A6IB 5TDPB 1JGUL 2GSGA 2V6HA 1YMMD 2C3XA 4HUNB 1JWSA 1EAJA 2CIIB 4WI8A 3S5LA 4OCRH 3PHQA 4FQXD 1C5CH 4MCYA 3ROOB 1G7LB 1CLCA 4CMMB 1HHHA 3HI6H 4OQ1A 3TP4A 4TRPH 2WNGA 5FYJL 1EGJA 5SX4H 3R06B 1S5IL 4KKLC 5F88A 3ZE0E 5FECB 2ARJB 1VERA 1ADQH 4KVCL 3IDJB 1T03L 4L4TD 4ODSL 1MI5A 4Y4HA 4JJ5B 3TN0C 4MJID 3KWWA 5LAXA 3ZKND 1Y0LB 3MO1A 1R24B 5IG7B 3I50L 3LKSA 3WIFB 4OM0H 1YY9C 1JN6A 4JY5H 3BZFB 2LV4A 1TJHH 4ZQKB 3QUKB 5CKAA 1CXEA 1B4RA 3T0EC 3JV4B 3TV3L 4KMQA 1NDGB 4HUXA 3ZTJG 3MRRB 1G1YA 2WBWB 4ZFFA 2ENYA 1K85A 4IDLA 2L7UA 4R97C 5FXCH 5IK3B 2CRIA 4WHTB 2VLJA 2XYCA 1CXKA 3WIHL 4JG0L 3L5IA 3MCG1 1U92B 4Z7WF 1QYGH 4JFEE 1BIIA 2A6DA 4WEBL 1F42A 2WIIA 1WBYB 1BOGA 1G1CA 2XTJD 4QXTA 4EN3D 3L5WB 4XPHH 3DSFL 3PDGA 4HKJB 1CGSL 2H6PA 1I1YB 5EBLA 5E2WL 1KTDB 1JHKH 3MZTA 2FJFA 1UVQA 4P4KB 5LJYH 3X11B 4AH2A 1UCBH 2X89D 4HBQA 3H2WA 1WBXB 1J8KA 1OTSC 4NUJB 2Z31D 2R4SH 4M6OL 2NXZC 2AEIT 3QDJA 1E27B 3U9PH 1VENA 1H3PH 3HC3L 5FYLD 1ZGLA 3MA9H 1BAFH 3WO3B 4LDEB 1SMOA 2EDWA 1RZ7H 2AJYH 3ZE1F 1G9NC 2E9IA 2YD3A 5E2TL 1KCKA 4MNHB 3MLRH 4NQCA 4P4RB 1RK0A 4M7LT 1MCWW 1MEXH 2ADFH 3HRZB 4Y1AB 2YK1H 4WV1C 1XGPA 1BJ1J 3DO3A 1KG0B 2FGWH 2PYEB 4ZMAT 5E8EA 2R29H 5B22A 1ZHKB 1PZ5A 1ORSB 4HKBA 1N2RA 5ADOH 4XVJH 1JHLH 4C54A 4D8PB 2V2WA 1UH4A 4R96B 1NKRA 4HFUL 4KV5E 4CVUA 3FO2A 5AUMB 1EEYB 2A83A 2EEDA 4DVBA 3KPPA 3HPLA 5E4IA 1G0DA 3MGOB 3GO1L 4P9HC 1VFOA 1A9BA 1IM9B 3TVMC 5BVPL 3ARUA 3KDMA 2LFGA 3PNWA 5FGRA 1FZJB 4KFZC 5D70L 4GW5B 1CICA 1YPZF 2DQJH 25C8H 3LKNB 1TTGA 3NCJL 5FHAH 3O2DA 4PP2B 5IESH 1UXWB 3IDGA 1WCBA 5IW1A 3T4AB 1CI5A 2B2XL 4UINH 1I3GL 4PV8A 4F9PA 5EB9A 3P11L 4OLYL 4LHJB 2CXGA 1XIWA 2P5EB 2OXGA 3DHMA 5CZXD 1X6NA 4XP4L 5DD0H 4Z7WB 3QO0A 1F6AB 2OQJB 2R1WA 1FNGA 3I9GH 4FS0A 5I66B 1EXUB 1F4AA 2P43B 4PLJD 4XPFH 3C8KA 1FO0B 2V2TB 2FO4B 5EIIB 3VMNA 1TVBA 2VL5A 3GMLB 3LHPL 1VESA 3EGSA 1DBAL 4L1HA 3RGHA 5I18H 1PX3A 1XF1A 2X1QA 3ESVF 1FN4B 2EDLA 2NY4B 4ODXB 5EG6C 4NCC1 2PF6A 4P2QE 1LMKA 5HVWA 2IFFH 3FRPG 3H9HB 2XN9D 4WI4A 4XRCA 1LDPL 1UB5A 5BZWA 1ZLSH 3L5HA 4LIQH 3OKDA 3GRWL 5DQJB 4IOIA 1CN4A 2P4AB 4FFYH 5BO1H 2WQ8A 4GAYA 1IQDA 3V95A 3RVXD 2B1AL 4QNPE 1QRNE 4GKZA 3FZUD 3OKNB 5FAAA 5DWUH 4YXKH 2DWEB 5E95B 2DKMA 3U2SA 3U46A 3TO4B 4J6RL 2PW2B 5IQ7H 5MHSD 5K9JL 5I74B 2NY2B 1CGXA 4R6UA 1JVKA 3L3HB 2VDRH 4N8PA 5L2KE 4DGYL 2C3VB 2H41A 1HE7A 1WJ3A 4I9WE 5L8LB 4UQ2A 1F58L 1FFNB 2FX9H 4HUVB 1HI6B 5E4EB 3SDCB 5MEQB 2UWEF 2VLKD 4NQTA 5BZDB 4YPGB 4MXVF 3DURA 4MQTB 1TLKA 5E9DE 5FYJD 5BVJB 1A9EB 4HQQH 4ZUSB 3WS6A 2QSCH 1YYLH 3CK0L 1ZLVH 5D2NC 5FYJU 4HK0B 2VDLL 4Z8FH 1P4BL 2VDNL 1FLRH 2QTEA 2ADIA 1P84J 4PJDA 4BK5A 3MLWL 4HLZG 1IGML 2CIKA 2NPLX 3GNML 4G9FD 1S9XA 1YPZB 3BESR 5I1EH 4BH8B 1YC8A 1EUUA 2ERJB 4K23L 5HGHA 1OL0A 2X4NB 1IKFL 1HDMA 1RUAH 5DTFA 5EOQL 3TA3A 2H32H 3HZVB 1NCAH 2FBJH 5ICZB 3PQYB 4QRTA 3ZKSD 5E08L 1JMXA 4QY8A 3MYZA 4OZIE 4OCSH 5D7IA 4XCCL 2ZWLT 5ESVA 2FYYB 1KEMH 1OPGH 1UQSB 3PDOA 4G6ML 5I1GH 2WUBL 2BVQB 4N9GA 4PJ7E 2OMBA 5SWZD 5C0GA 1TZHB 4LSPL 5ANMB 4BELD 3OKLB 1IC4H 4R7DA 1FNLA 3BEWB 5DLMH 1BLNB 1ES0B 3DUUA 1FNFA 1ONQA 4XHJD 5ESQA 2CGRH 5H8DA 3G5YB 3NIDF 3MNZB 4YHKL 3HG1D 4F7MA 4BFEA 2HFFB 3QEUB 4XVSH 5GRZA 3TYFB 4JQXC 3MRLA 4IDJL 5FO8B 2HT3C 2G5RA 3X12B 1UM6L 3U82B 1AQDA 2VLLA 4H1LH 1SJEA 1NC4D 3MOAH 4DN4L 5TDOB 4ETQA 3T1FA 5DURB 2HTLC 4M7JL 3JTSB 1I4FB 3VRIA 1PVHA 4U31A 4MCZA 1BQSA 4H5SB 3U6RA 2CMRL 5I74C 1AGBA 2UWEB 2NY2C 1FG2A 4HC1A 1NGPL 4OCNC 2D31A 5C71A 1BZ9B 4ODHH 2IC2A 2RCSL 2Z8SA 5AYQA 1A0QH 5J6GA 2AEPL 4L3EB 2NY6B 4JKPL 4P57A 5H2BB 1PKQE 4CVZB 3LH2H 3CLEL 1A6ZA 1XF4A 4WFFE 2F19L 4LGPB 4N0YL 3V8OA 5J57B 4DOHB 3FFDB 1UG9A 4GAJL 4LEXL 4HG4K 1A5FH 4M48H 4Y0GA 5HY9B 2CO7B 2O5XL 3D39D 2F53D 4KI5E 2C3GA 2BERA 2X10A 3GIZH 4PJCA 2EDBA 3VFRB 1BMGA 3LN4B 2ERJC 2B39A 3UTSD 2VR5A 1OD7A 1R3JA 1EO7A 1MCQA 1AHWB 1RFDL 1Q9WA 3KPSA 2F8XC 3QNXA 5EBWA 4QHUA 3ZSSA 4X6DE 3K8KA 1AC6A 5L7XH 5L6YL 3OKOA 3V4UL 2P46B 1KB5B 3PWJA 4QTIH 3RJDA 4JFQB 3MV7E 4JZOA 4RAUA 3X14B 2PO6A 2A6IA 2A9MH 5TDPA 4NKMB 1BBJB 2CIIA 1TIUA 3AB0C 4HULB 2X4UB 4YDVB 3ROOA 3V0WH 1Q0YH 1NL0L 4M3KB 4JO4L 1W72H 4CMMA 2EDDA 5IWLA 3IDMB 4OZ4B 4Q0XL 2R0WH 4R3SB 1OD9A 2YN3A 1A6AB 3R06A 1V8HA 3TBSB 5F6IB 3S88L 1PGRB 2ARJA 4NJAH 1EHLL 1JZ2A 4LQFH 4YHLH 4HJJL 1U2CA 4IHOB 5D1XC 1F2QA 2DDQH 3MBXH 1GGCH 3K2UH 4YFLF 3O3AB 1R24A 5IG7A 4OQTH 2FEEL 5M7QA 3QCUL 2GJ6B 2OI9C 3BZFA 4S1RL 1IAMA 3DBXB 3GSWB 2DQFB 4X7SH 2QQNH 4ZQKA 4QLRA 3QUKA 5D1ZD 4XWGH 4FP8H 1QPPA 4ZO7A 5ALBH 1BX2B 3QI9B 2J5LB 4K9EL 1MVUB 3JV4A 2KH2B 1JTPA 4X9BA 3LQAC 4Z7VE 3J7HA 4U1SB 3R8QA 1JI2A 2X4PB 2X4SB 4WHTA 1CS6A 3GJEB 4RMRA 1MFBL 5EBGA 3T65B 2XNAB 4JFYB 1TITA 1C16B 1JGDB 4G5ZL 3MR9A 4CRPA 4PYHA 5L8KB 3RU8L 4K7FB 2RR3A 5CMAB 5EU3B 1DQQA 3CU1A 5JORA 4M7KH 1RHFA 4LPYA 3L5WA 3ZT6A 1NGQL 5AAMA 4K8RD 2VDPH 4CGTA 4PJFF 2VZ3A 2CUHA 5D72H 2YWZA 2APWA 1KTDA 2DICA 2I60H 2BJML 4KROB 3EOBB 3QCTL 4P4KA 1R5VB 2FHBA 4FFWC 4QCIB 4NQSA 4OLZL 1Q9OA 4C4KT 4PJ8B 1AHWC 1I3UA 2Q8BL 3T3ME 2UUDH 3VG9C 4AQ1B 3MXWL 4PTTB 1MCIA 3WUWG 1GJIA 2QEJA 1FHGA 3TNNB 3WV0A 4LLAA 4PD4K 5GGTA 2VC2L 4N8CL 4UILH 3HMXA 5C0AA 2R2HB 2JJWA 4LQ1A 3WJLA 4ZS7L 4PGCB 1U3HA 1UFUA 2DMKA 4P4RA 3HRZA 4Y1AA 4PRHD 5F9JB 1YN7B 3SE4C 2WBJB 1I1CA 4CKVX 1G9NH 4FG6D 1KG0A 4J4PA 4RMSA 1JGEB 1KJ2H 1NMBH 1GHFL 3D5OF 3TBVB 3MROB 4X5WA 1ZHKA 4FQLL 4MNQE 4D8PA 4UV7L 4R96A 4JHAH 2ARWA 4MZ3A 2J6EH 5AUMA 5GZOC 3CUPA 3K1DA 2BNUB 2EXWD 2OSLB 4KK9D 3UZEA 3MGOA 1ZV5A 3KGRA 5KG9B 2DJ4A 1D5XB 3SDAD 2JCCE 3THMH 4PJIE 4LFHD 4WVRA 4F8TA 3X13B 1A6VL 1IM9A 4IIQC 4MJ6B 4WFGD 4HGWB 4CUCA 3LKNA 1ZOXA 4LBEA 5BQ7A 4PP2A 3NFPB 2P7TA 1WISA 5JOPE 4XCYB 1MRDH 3QI9C 2J5LC 5J12C 3SE3C 5AZEH 3V4VH 2P5EA 2X5PA 4J3VA 4YEEA 3QQ4B 2PCPB 1I85A 1FVDB 5E1AB 4ZO9A 5BW7C 1S7QB 2FR4A 1G7MA 1WFNA 1OSPL 1F6AA 3BRDA 1I1RA 2OQJA 2X4QA 4QT5A 4FQIL 3PGCA 5HI3C 5HYJE 2EE9A 1FO0A 4PJFB 5HHXL 5EIIA 2A74B 3JSSA 5C0IB 4LPVA 3GMLA 4PRPB 4OLUL 2VXSL 4HZAA 2CKBB 4MWFB 3VWKB 4LVNB 4L9LC 4UDUB 4ODXA 4D94A 5IBLD 1LILA 1H8NA 3WFDL 3H9HA 5AG9A 3WFCL 4HEME 4ZFZB 3TIEB 1P7KA 2MQCA 4JFFB 5DQJA 4NZRH 4O9HL 2Y4SA 1RIUH 4P3CL 1QPXA 4BZYA 4PJ8C 4OCWH 1BBDH 4S2SB 3NIFF 1FYTA 3C60D 3OKNA 4KGJA 5JXEC 3EDKA 3VXRE 1KB9K 1H15B 4TSAL 3TO4A 4ZXBC 3LRSB 5EIQA 4OCMC 4WU7B 5GSRB 3W0WA 3QWRA 3MUJA 1RUQH 1R3IH 3EDDA 5D7JD 3RX5A 5K9QG 3QFJB 5MI0B 4L8BA 3O41A 2C3VA 1GYAA 3SDCA 3VWJC 2GTZB 5T3ZE 1CZ8L 4E41D 4YPGA 1JWUB 3HE6D 5I1HH 4XP9H 5BVJA 1IC7H 1A9EA 1BQLH 4RWYH 1I9JH 1SBBA 3VXME 2FATH 5E99H 4HH9B 4ZUSA 4FQ1H 1KCRH 1XF5B 1XR8B 4HK0A 4RFEA 3VFGL 2B1HL 3HB3D 1Y6NR 4FABH 4OFYD 2J8OA 3F5WB 1EO8H 1O5DT 3BKYL 1YPZA 4BH8A 1EZVX 4GBXD 2FB4H 5C1MB 1V05A 1KYOK 5AYUL 4HPYH 2X4NA 3M17B 4YO0B 4W6YB 1MIEL 2BRRL 5J3HD 3HZVA 1H8SA 4OBSA 1AFVL 1FC1A 2EIEA 4AEHH 15C8H 3ULVE 1A7PH 4F3FB 4GS7B 1K4DA 5DDHB 5DJDB 2APXA 5IT2H 2Q7NA 1A6UH 1JUFB 5EO9B 2W1NA 4O2FA 1WAAF 2FYYA 3WJJC 3GSUB 5KSAD 1SBSL 2ICCA 3MFFA 1UZ8B 5IP4A 1PAMA 3KR3L 5GSVB 4JGJA 2BVQA 1PKOA 5IHZB 3EYOB 1W0VB 1AR1C 3I6LD 4M8VA 4YHPB 4PP1D 1E4JA 1VPOH 3UO1H 4M5YH 4LU5L 3P9MA 3GI8L 4GFTB 1BLNA 1ES0A 3BN9D 1AJ7H 3VWKC 4LVNC 3FT4B 3GK8L 4U2ZA 5ALCH 3P3YA 4M62L 2OR8A 4DUXA 3HZYB 1N59A 2DBLH 5TE4L 2IG2L 3P40A 3ZT7A 1EEQA 2OCFD 1H5BC 3QXAA 3LN5B 3X12A 4OFKA 1NGZA 4YDLB 4LF3B 4LHUG 3UBXG 1T66D 3ULUE 2DJUA 3WXVL 1EHAA 5DF0A 3R1GL 1QRKA 4NRXB 2HT2D 1KPVA 3KXFE 1QBLL 2NZ9D 1I4FA 2BHYA 3O11B 2H26A 3OKKB 4B53A 4H5SA 3QUMA 1EBPA 1MQ8A 1VACB 2UWEA 4C56D 3BZEB 5KS9E 3L7EB 4FRWA 3DYPA 4XNYH 2NCMA 3OR7B 5DMGC 5MI0C 1HXYB 2HMIC 1FIEA 4LOUC 1ACYH 5CGTA 4JRYE 4WI2A 4L3EA 1RZIA 3ARED 5JIIA 4PJ5E 3INUL 3IAQA 2VWEE 1WTLA 1IAIL 1N6QL 1KJMB 5JUEH 3WKNA 3LKQA 3GSXA 1IRAY 4I18A 3HTLX 5FM5M 5HHVL 4LVOC 2R69L 4ZOAA 2VLRB 4MB3A 4OF5A 4F58L 1DVFD 3REVA 1INEH 1KPUB 3JWOC 1KIUA 1KFAH 1U8QB 5HY9A 5DJ8B 5JHDB 1I3RA 5KVEL 1K8DB 3PDDA 1KN4H 5JPNB 1F4YL 3FHQA 1AXTH 1UYWL 1I3VA 1BGXH 3ARBD 4Y16A 3CGTA 5C92A 3HLAB 3VXUE 1AO7D 2QADD 4ODBD 4EZMA 5TFSH 1QP1A 3PIQA 1KB5A 4JFQA 3O0RL 3X14A 4XNMB 3GBML 1EA9C 3IDNA 1NFDF 4IMLB 4BZ2H 1BBJA 3MV9E 2BNQB 1DQLH 4YUEL 3T0BA 3IDIA 4MA7H 1CQYA 1QSFE 1E4KA 4HXBH 4DK3A 4GW4A 3RFZC 3IDMA 4OZ4A 2NX5E 3C5ZB 5CP3A 4YHMH 1MCLA 2AGJL 4OCRL 2HWZH 3CFJA 1C5CL 4D0CB 5J1AB 2WAHA 3NAAL 3TBSA 3L3DB 3IAPA 5E8NB 4JQVC 3GSRB 3HI6L 4OZHF 4HFWB 2F54E 2GYSA 3KYNB 4IHOA 3WUWB 4PJGE 1QO3B 1AH1A 4F57H 1P4IH 3JVGA 4ZNEE 5B3NA 1ADQL 4NP4H 5GS2D 3O3AA 3RKDD 4TOYH 4YH6A 4KKNA 3RY6C 3DIFA 4YDLC 4X99B 4JB9H 3DBXA 3GSWA 3JTTA 1NEZG 1QFHA 3L3OA 1IGJA 2OLDA 2BVOB 4OM0L 4PUBH 4JY5L 2LE9A 4O2EB 2EEAA 4U1SA 4NC0B 4UDTB 3EYFB 3GJEA 3QDGD 4X80L 5AWNL 4M6NH 3LQAH 1RZFH 3DV6A 3PL6B 2BOCB 2XNAA 3WFEH 2O61B 4JFYA 1C16A 1JGDA 1PYWB 2ITCB 5HDBF 5C08D 4K7FA 1X5AA 3DUSA 3MLXH 3TLRA 5I1KL 1LE9A 1A1NB 3GMMB 1A4JA 4Z0XB 5D4QA 3CDGA 4G6KH 5EC2B 1Q94B 3RNQA 3EOBA 1KN2H 1R5VA 4MB4A 1L6ZA 4OZGF 4XPHL 4PGBB 1CLYH 5JA9A 2R2EB 2DQGL 1JHKL 2BRQA 2NY0D 4KDVA 3TBTB 3WLWC 5LWYH 4YDKH 1BQUA 1OQXA 3QQNA 4JAMA 1NFDB 1SY6A 4G3YH 1HOCA 2WV3A 3RZCB 1BQHG 3EO9H 5LVEA 3TNNA 3JUZA 3VA6A 2R4SL 1KCVH 3RZWA 1X5GA 3O4LA 3WNPA 3U9PL 4GRLB 3IKCB 4S11A 4PGCA 1H3PL 5EZOH 4WFHD 5EN2A 5F9JA 4XP1H 5SX5H 2O26U 2WBJA 3PWPA 3VFUB 1J05A 1RZ7L 2HRLA 4X7FC 2AJYL 1YEJH 3C5ZC 1FE8H 3TBVA 3MLRL 3MROA 5JDJA 4HWBH 4OZHB 4AJ0A 5BRZD 2ADFL 2ZOLB 43C9A 2YK1L 1EAPB 1FNHA 3BQUD 1E4WH 2YUXA 3ZE0F 4G43B 2FGWL 1NUNB 3RKPA 3ZKMC 5CD5D 2BNUA 2R29L 4JM2A 2MQ0A 1C08B 3RDTB 1A7NH 4WI7A 4OIAA 2VB5A 4XVJL 1JHLL 5FUOH 1D5XA 4AIOA 4DCQB 1WZKA 4N0CC 3TT1H 3X13A 3UTTB 1EFXB 1A8JH 4HGWA 1UH2A 4JCLA 5D7LE 4KWUA 1Q1JL 3UP1A 1K6QH 2FWOB 3NFPA 3BMWA 4E0RB 1PG7W 3HN3A 4Z5RB 1D9KC 2EYTB 1GRWA 2DQJL 25C8L 3L6FB 5FHAL 4C58B 1YQVL 1WEJH 3OKMB 2R1YA 2A6JB 1FZMB 3QQ4A 4Y4KD 2PCPA 1FVDA 5E1AA 3C2AL 5F1NB 5KJRH 1S7QA 3VXTB 3BDXA 4I3SH 4QRSA 4UINL 5C07A 3I75B 3LD8B 1TQBB 4LRIC 4JPKL 1D5ZB 3VG0H 4PJFA 4APQD 3DX9A 3K8MA 3I9GL 4KC3B 5F21B 2J8HA 5CJQH 3MODH 4JDVB 3UYPA 2CKBA 5DC4B 4MWFA 2EDQA 4OZGB 4UDUA 3WEXB 2YBRB 1IL1B 3CVHB 2GSIB 4XCEA 5F9OL 1FDLH 3NCEB 3EFDL 5FGCE 4ZFZA 4K3DH 5EU5B 3TIEA 4DUVA 1W8OA 2XQYK 4YIQB 5FDWB 4JFFA 4WW1B 1ACZA 2IFFL 2EO1A 4P2CG 1J9CT 5IIEA 1SEBB 1ZLSL 4LIQL 3VFTB 3NABL 1H15A 3CXHJ 5J13C 4FFYL 3KLHD 5BO1L 3LRSA 4ZSOB 3WFBH 4WU7A 5GRXG 3LSOA 5GSRA 2GAZB 3SCMD 2AJXL 3BW9B 5GGRB 3OB0K 5DJ6A 2AXJA 2VISA 4IRJC 4GRLC 5GGVH 3QFJA 3ES6B 3WUZA 4FQQB 2OM5A 3RUGE 5KBNC 1G6VK 1JWUA 3MBED 1BFOB 1J0IA 2ZUSA 2J1KA 2VDRL 3GBLA 5A2JH 1XR8A 1FBIL 3JXAA 3ZO0A 2FX9L 3K0WA 4X6EB 3P9LB 5DJ0A 2EDOA 3T0XA 3U7WH 3TZVD 1KENH 3MOBL 5H37H 2YD6A 4LHUB 1AXSB 8CGTA 2IQAB 3TM6A 4KV5F 3F5WA 4HQQL 4MAYA 3UBXB 4JRXA 5T1LB 4E42B 1NCWH 4UT9L 3CPLB 2J8UE 3QDMD 3LEYH 4HIJB 3LDBB 5B8CB 4RA3A 5CEZL 2F74A 4PBXA 2QR0A 1FLRL 3M17A 4P2OC 5I17A 4YBQD 1FSKC 2A9NL 4L4TE 1U8NA 4HKZB 1RUMH 3GM0A 3RVUC 4FXGB 3D3VA 4XCFL 5EULV 5I1EL 3BWAB 4P2RB 4JQIL 1B88A 5HXMA 1YEDA 1D5MB 3N1MC 5LGKA 1RUAL 3QIUB 3C6LC 1JYVA 1NCAL 3P77B 1JUFA 5EO9A 4CW1B 2UYLB 1B6UA 1MNUH 2FBJL 1WWCA 3GSUA 5DT1H 4JN2A 1UZ8A 3TJEH 4U0QB 4JFEB 6CGTA 2AV1B 5F70A 3O2DL 2P24A 5GSVA 5I8CA 4OCSL 1S7UB 5IHZA 3EYOA 1KEML 1W0VA 5JQ6H 3OHXB 3RNKB 3SDYH 1BJ8A 2YC1B 4HLZH 1NAMH 4RNRB 5HYEA 1PSKL 3RBGA 3BGFB 3FQUB 2W0FB 3FT4A 4ZO6A 1JZ7A 3N1FC 2GFBB 1SMAA 1AQKH 3VFVB 2XTJE 1OTUC 1IC4L 3T4YB 3HZYA 3GSNH 5GS0C 4EQ3A 3JV5A 1A1OA 4U49A 2CGRL 3LN5A 1HQRB 3VFOA 4R4NC 4R7NA 4LF3A 1JWMB 4U1NB 2APFA 1MREH 3IFLH 5DJAA 5EU6D 3X3FH 2Z93B 5KTEH 4M6ML 2FX8L 4XVSL 1BHGA 4QNPF 2BVTA 4RFOH 3OKKA 4JCMA 5E8DL 5GPRA 1QSED 3MRMB 3H6JA 3MCKB 4H0GA 4IBLT 1V3KA 4Z7NE 3MOAL 2ATPB 3BZEA 3L7EA 2V5TA 1HXYA 4LASL 1NFIB 5DVLA 2DI9A 1GOFA 3RP1A 1TTUA 3MLVH 4KKBD 4N1CA 5A2KH 3QUYD 4MDIB 1JCKA 3MYJB 1YNTA 1KJMA 4EDXB 4UIMB 1JTOA 3MUHL 4LLUB 2IAMB 1E6JH 2VLRA 3P0VL 3LH2L 1YC7A 3BE1H 1J1XH 5JQHC 3QIWB 2XG4A 5EOTB 5KSVB 1Z5LB 5DJ8A 5JHDA 3O3DB 1NEZB 2D2OA 4Y5VC 3C2SA 5B8CC 1OAYH 4CADB 4Y4FB 3WNNA 3JWOH 1K8DA 4M48L 2CRZA 4K55A 5JPNA 3PABB 3O6FB 5FO9B 3HNSH 3HLAA 5FV1L 1NANI 2Q7YB 3GJFK 4KJWC 4Y4HD 3CFEB 3PWNA 4I0PA 4XNMA 1WV7T 3ME0A 4OZIF 4IMLA 5L7XL 3IS0X 4HXAH 5F89B 2BNQA 4QTIL 2C7UB 4JDZA 4PJ9A 2NY1C 4JZJB 2A1WL 3FFCA 4OM1H 5IVOA 3FO1B 2BSTB 2A9ML 4PJ7F 2C1OB 4KRPB 1MCBA 3CVIL 3EZ8A 5A16A 3UPAA 4P2QB 1V3JA 5FGSA 2D0FA 2OTUB 4JO1H 2OP4H 1HILA 1Q0YL 2VLJD 5J1AA 4D0CA 4H0HB 3L3DA 3VCLB 5DEGB 2DQDH 2SEBB 2R0WL 5LCVH 3SGKA 3KYNA 3PGFH 3WUWA 1J12A 4HCRL 5TPWH 1QO3A 1FL5B 1BQHB 4I77L 3V6OA 1TJGH 3CNKA 1OAXL 2XN9E 1IZKA 1QRNB 4NJAL 2X7LB 4EIGB 2IBZX 4Z7OF 2DS4A 4YHLL 1Q9LB 4P23B 2DDQL 3MBXL 4X99A 3TBWB 4ZG1A 3K2UL 3F58L 2Q76A 4OZFG 2X1XR 1Q8MA 4KGLA 2RFXB 1HHJB 3W2DL 5L2KB 2XY1A 4O2EA 1TNMA 2EKSB 5I9QC 1M71B 5FDYA 4X7SL 4LIQE 2QKIB 4FP8L 4RFNB 5ALBL 5MHSE 4OJFH 5L9DH 5E9DB 3QDJD 1HH6B 3PL6A 4G8GD 5GZNC 2O61A 5AG8A 4Z0BH 1PYWA 2ITCA 4Y2DA 2GK2A 1ROWA 1PG7H 5IHLB 2CK0H 3MV8E 2FRGP 3L9RB 4LNRB 3VD5A 1LO5A 4LCCB 5TQ0H 4NQCD 2UVFA 2OR9L 1A1NA 2Y5TB 4PTUB 3GMMA 1L7IH 1FFPA 3MACH 5EC2A 1Q94A 2WW8A 1NMAH 4M7KL 4KI5F 2W9DH 4Y4FC 1UWXH 2VDPL 1X4XA 2H1PH 4G9FE 5D72L 1BF2A 1MFCH 1MHCB 3TBTA 2WWMD 4ZO8A 3IFNH 1WZLA 4NSKB 4OZIB 3IDUA 4GLRH 3RZCA 1AGEA 3A67L 3L3GB 2WBKA 2EIBA 4X6DF 3E6HB 1TTFA 2HVKB 2XZCL 3SQBA 4V1DE 5GXBB 3JUYA 3O8XA 5FOJA 1LP9E 2WLZA 4TNVK 2ICEB 3M1BB 3SY0B 1YUHB 1CICD 3NGBC 3HE7C 2XPGB 3IKCA 3OXRB 3QG6A 4JZJC 4WTZA 4Y19A 4C83B 5IMOB 4UILL 3VFUA 4NZTH 1XIWD 4A6YB 5HSFA 4OZHA 2GTWB 3MRQA 3F7VB 5SWZE 4X9IA 2ZOLA 1K2DB 4ENEC 3FRUB 1EAPA 4NKDB 1G9NL 1GGBH 4OKVA 4G43A 3HI1A 2N56A 1N64L 4AEEA 1NMBL 4EDWH 3RDTA 2IGFH 1I1AB 1AGFB 1LQSR 2C4FU 5E00B 4DCQA 3CFBA 5L0QB 3V9FA 4RDQG 4JG1H 1MF2H 4JHZA 5DJ2B 5JTWA 5FKPB 2HJLB 3HG1E 3UTTA 4WI6A 5HDQH 1ZLUH 3WFHB 1U8MB 3U7YH 1GVIA 4G7YH 1OB1A 1A3LH 1GGYA 3MREB 4JREB 4P23C 1JRHL 2FWOA 4E0RA 3B9KB 4Z5RA 2X1WL 1HINH 4I5BB 3ZKXC 2GITB 2K1MA 5D6DA 4MS8D 1CDHA 2PXYC 4RSVA 4TPRH 3RWGB 3MSPA 4P9HL 2A6JA 2NY3B 4Z7VF 2P48B 4RFNC 3LVEA 3BUYB 3GM8A 3VXTA 1MH5B 3K4ZA 2FHFA 3VGAC 3V4VL 4NO0B 1CFVH 4BQCA 4NWUL 5CIPH 1D5ZA 2QJDA 1BOYA 3KYKL 5C0DB 5J9PA 5CWSA 2C3HA 4JLRB 4NZUL 1RV6X 1X5XA 5HPMB 1ORQB 2YBRA 3CVHA 2GSIA 4FQPA 1JBJA 4UUJB 3L3KA 4M00A 3NA9H 1KJ3L 1JPSH 2ESVE 5FDWA 2ZCLH 5EC1B 3D39E 4WEUD 2F53E 4BJLA 4WW1A 1HN1A 4X6DB 3F62A 3MRNB 1OGTB 3DUHA 3VD7A 3UTSE 5A2IH 4HF5H 3MV7B 1X5ZA 3T3MF 3V6FB 3A6BH 5KAQG 4RWHA 3VFTA 4NZRL 4OF7A 4WHDA 4ZSOA 4OCWL 1BBDL 4YHYB 4I4WB 3BW9A 5GGRA 1J18A 3W11C 3ZSTA 3TA3D 1OSZB 3ES6A 4JPWH 2X6MA 4NFDA 5DFVD 1BVKB 3UTQB 4M1DH 3EFFA 1LDSA 2ICWB 2F9BT 5DQDH 3BPCB 3HUJE 1RUQL 1R3IL 3OPZH 2JJTA 1A02N 1Q38A 1P6FA 3DETD 3P9LA 4X6EA 3HMXL 4X9GA 9CGTA 3EYQC 2IQAA 5MEPB 1IC7L 3P9WB 4GQPH 1HNGA 1I9JL 1LWRA 2NW3A 5T1LA 3UBXA 2FATL 5E99L 5K9OB 2AXGA 1OWRM 4FQ1L 3G5ZB 3PWVB 1RUKL 2OX5A 4MD4A 4FABL 2EICA 4OTXH 2JCCF 3ECBB 3WXWH 1WWWX 1U42A 2X2YA 4JREC 3ARDC 1EPFA 3RY4A 3H9YA 1BJMA 4P2RA 1IC5H 4Z7VB 5H94A 4H25B 4J1UA 5DA4A 1D5MA 3BP7B 4RQQB 1JNLL 1NUFA 3QIUA 3B8SA 1FZKA 4P5MA 5TE7H 4RX4D 15C8L 2NY3C 4CW1A 1HXMB 1A7PL 2LABA 5C86A 3O6LH 5J11B 1NANH 4JFEA 4M8QB 3VRLE 5F7DA 3TESA 2V9QA 1OCWH 4P49A 1IKNA 1AD0B 4L29B 4WWKB 3R0MA 2W65B 3MJ9A 4OLEA 1LK3H 1YY8B 1F90H 4HWNA 2W91A 1OT1A 2DB8A 3FQUA 1SEQH 4ZYKB 2GFBA 4EN3A 3UO1L 1IGCL 3KNBB 1KIRB 1X3DA 1UJ3B 5I1IH 1TQCB 3QWQB 1AJ7L 1CXLA 3G6DH 5IB2B 2GCYB 1QEWB 1QFUL 5ALCL 1SJHB 1JWMA 4U1NA 4R2GD 1HHGB 2DBLL 3HPJA 5I1AB 3TNMA 4KUCF 1JE6A 1NGXB 4TN9A 3D1MC 3MRMA 3MCKA 4YHYC 3PHOA 4X4ME 4MQ7A 5I15H 2ATPA 3L1OH 1F00I 2W0LA 3Q6FB 4GMSH 1PD6A 3FOMB 3BX7C 1NMCC 5JO5B 3KPSD 3NTCL 3HC4H 4JFXB 4B7IA 4G8EA 2VZSA 4RGMC 4MNQB 3MYJA 1AGDB 4JEGB 4EDXA 4XNYL 4NCC2 1VGKA 2PO6D 3KJ6L 4JY4B 2IAMA 5CBEB 3G6AB 1YECH 3QIWA 3GHBH 5CJBA 1MAML 5EOTA 1Q72H 2JCCB 5KSVA 5JUEL 3RWHB 1Z5LA 2WQRA 3TH2T 4RDQF 4IM8A 1MHEB 2R56H 3FN0L 4YHIA 4OZFB 3VFNB 5BJTB 4CADA 4L8DB 1T5XB 1INEL 4UV4H 1FNSH 1KFAL 3BO8B 5D96B 3PABA 3ESUF 3VI3E 3O6FA 5FO9A 3TJHD 1IM3A 2O5YL 1F02I 2CR6A 2Q7YA 4WFGE 4YX2H 4YWGL 3ULVF 1KN4L 5LXGH 5JLZB 3CFEA 1AXTL 1YEKH 1GGIH 3WYRA 3U0PB 3SE8H 2R23B 2DTMH 3O9WC 5J11C 5HYJB 5TFSL 1WCQA 5F89A 1H3GA 2C7UA 5TF1H 4LKXB 3W9EA 3VMOA 2DLGA 3FO1A 1S7RB 4XGZB 2C1OA 1HIMH 3PV6A 3AM8C 3KLAA 2R8SL 4LLYB 4P2QA 3QYCA 1PZUB 2OTUA 5T33H 4MA7L 4PLKC 4KDTC 4JE4B 5EZJB 3VCLA 1RU9H 2PTTB 1HEZA 5DEGA 3SPVB 3S35H 2SEBA 3RTQB 4F9LC 3G6JF 1UJ3C 1FL5A 1ZK9A 1BQHA 1N4XH 1RZJC 2ID5A 4V2BA 2D7TH 4HHAA 4OGAC 1QRNA 2BHUA 2X7LA 4KAQH 2EC8A 3NCYS 5KAQF 4XVUC 3DX8B 3VXRB 1CCZA 4RA0C 3RL1B 4F57L 1P4IL 2HA1A 5F93C 4P4KD 2CLRB 4NP4L 2NY5C 1OLLA 2RFXA 4L4VE 4TOYL 3S8WA 3DX6B 5L2KA 5GGTH 2EKSA 2B0SH 4JB9L 1M71A 4KTDL 1GPOH 2YEZB 2QKIA 3LZFL 3ARFB 4IOFD 5KS9F 2IJ0C 4P3DB 1VCAA 5E9DA 3VXMB 5I6XC 4PUBL 3MCLH 3DMMB 5HVGB 1XCQA 4K3EH 5GRVL 5BV7B 3SBWA 1NDMA 3H3PH 5C0AD 4M6NL 1CE6A 1RZFL 3LQAL 4LCIL 4LNRA 1EX0A 4LCCA 5E6IC 3WFEL 5KANI 4TYUA 1U3HD 2Y5TA 2AQ2A 4Y1AD 3MLXL 3QQ9D 4WI9A 4J4PD 1F11A 3DWTA 3EJYD 3U0TB 3QXWA 1VKXB 1KXQE 5I0ZA 2MMXA 3ZL4H 4G6KL 1MHCA 3UPCA 1MCWM 1KN2L 5HYFA 1A2YA 3NBNA 4NSKA 1T6WA 5KOVC 4OZIA 5HTSA 1L7TH 3F12B 4POZD 3L3GA 4U1GB 5DHYB 4D9RE 3Q5OA 5D2NE 2ZKHL 1IM9D 1P4LB 3WN5A 2IEPA 5LWYL 5IVNA 4KJPC 2ICEA 3M1BA 3RQ3A 1EHXA 3SY0A 1YUHA 5D9SB 3OAZK 3OXRA 1T1ZB 2AK4E 2HVJB 4GQ9H 1S8DB 3EO9L 3B5TA 4BQ8A 1KCVL 4M1GH 1WF5A 5IMOA 4WIQA 3WO4B 3QUZB 2P5ED 3QULA 4F37F 2P8PB 1BZ7B 2HJKB 3TCLB 4WW2C 5DO2D 3F7VA 3G6JB 3HI5H 1N0XH 3I6LE 1K2DA 2CXKA 3FRUA 4EUPH 2BDNL 4PJHE 4UU9B 1B6DA 2Q8AH 1FE8L 1RVFH 2Y07H 4PD4J 1I1AA 5E00A 3TEUA 2K7QA 4M61B 4PJGF 1E4WL 5DJ2A 2FX7H 2P5WE 3VFSA 5ABDE 1XZ0A 5FKPA 1QVOA 4RAVB 1JNHB 1U8MA 1FVEB 3KXFB 2XXCB 2NY4D 3MREA 5FUOL 3MJ7B 3TT1L 3B9KA 1DQTA 2FIRT 5KS9B 3C8HA 4P5TB 3AXLA 1R5IB 2X1OA 4JRYB 2HT3D 4U6YB 4RAHA 1K6QL 1U8JB 4NQDE 1T1XB 4PJ5B 3BUYA 5FYKD 1MH5A 2FO1A 4JPIA 1FYTD 4X8JB 4C56E 3OKYA 5FYKU 1WEJL 4HIXH 3TO4D 5JOFB 1FNEA 4NN6C 1JP5A 2DIBA 4P46B 1DQJA 1QSVA 4L3CB 3IU4H 4I3SL 4JDTH 3QWRD 3W0WD 3RWCB 4UB0L 1L9NA 3LB6C 3E2HB 2ZOKB 1ORQA 5FV2A 2FJHB 3VH8G 2MPAH 1RQ5A 1DUZA 3SDCD 4KHTH 3P0YH 4Z7UE 4HWEH 1QG3A 4UUJA 5JZ7C 4I2XA 3BVNB 5CJQL 3MODL 3IGAB 4XAKD 3VXUB 3ULVC 4ZAKB 3W82A 4X6DA 1FDLL 3MRNA 1OGTA 4CN4A 1S9WB 1J0HA 4K3DL 4TUKL 2VLMD 3MV7A 3I2CH 3V6FA 3D0VB 3FB6B 3QUXC 1II4E 5JA8B 3MXVH 3HC0A 1DANU 5EFIB 1FH5H 1AO7E 3MV9B 4QWWD 1INDH 3FQNB 1F3DH 3EJZC 4LLVA 4JHBA 1QSFB 2BNRE 2VR9A 2ICWJ 3UC0H 1J0JA 2NX5B 3DX7A 4JANB 3WFBL 3PQYD 3UTQA 2Q1EA 2Q6WB 2Y06L 2ICWA 3ARPA 4TULH 4DGVH 3WO4C 3BPCA 3QUZC 1PDKA 5GGVL 2QHLA 3WE6A 1F4HA 3LS4H 1G7PB 5C09A 5A2LH 4LPUA 2WM0A 1NCDH 1QBAA 3VGFA 5C0CB 2F54B 1U93A 3AU1A 3QIBC 2BOBB 4MHHG 5GGUA 5MEPA 5C0JB 1MCOH 1NSNH 4KQ4H 3G5ZA 3PWVA 3NIGE 3NCBB 4FHBD 1MRFH 2OZ4H 4YE4H 5DMYA 3UPRA 4NDMA 4ZFOB 3U7WL 3ULUC 4PB0L 1MOEA 3GRWA 3BEVA 3BT2H 1NCWL 1FIGH 5E8OB 1JPFA 4NN7B 2Q3AA 1CFQB 1TCRB 5C0ND 4L8CA 4OF3A 5GIRB 4H25A 1OGAA 4RQQA 4X4YB 5T1KA 4POUB 4PBWD 3VXOB 1J0KA 4NPYB 1HXMA 2OTWB 1TPXB 3EDFA 2VWEC 5IVXE 3VFMB 4X7CC 1PW3A 3F7PC 5DURD 5FK9B 1INQA 2HTKC 5AAWA 1MNUL 3E6FA 2F5AH 1AD0A 3ZE2E 4L29A 4WWKA 3S3SA 5A3IC 2W65A 1S9YB 3VFPA 4NO3B 3AS2A 2AQ3A 4HIHA 5C08E 3E2HC 4I3RH 3RVTC 3REWA 3QFDA 1S7XB 4L3ED 2NY6D 4FNLH 1T6VN 3DI2B 4ZYKA 5JQ6L 2K7PA 5E5MA 4X98A 4OV5A 3ELAT 1KIRA 1NAML 1T7VA 1IEAB 2EIZB 4H20H 3S4SG 2GCYA 1QEWA 4ONFH 4TNWF 4GXVH 5IKCB 1AQKL 3LRHA 1HHGA 2CUMA 2MHAA 3GSNL 5C9JA 5I1AA 1FJ1A 2HYMA 2BVPB 1NGXA 3GBNH 5D5MF 3IAGC 2ENSA 2IBGA 3IFLL 3QO1B 5KTEL 3Q6FA 4NHUB 3FOMA 1FGVH 4RFOL 4Y16D 1OM3H 5JO5A 3PP4H 3MOQA 1LNUB 3RUGF 3UJTL 5DI8A 4PV9B 1DZBA 4MNQA 3FN3A 2GW5A 1AGDA 4HS8H 4FFZH 3I6GA 1BECA 4JZNA 4WFHE 4GSDL 5FCUH 2BCKA 3BZ4A 3NPZB 5D1QB 1UM4H 5I2IB 4QRPE 3QT2A 3MLVL 4JN1H 5BRZE 3FL7A 4ZPTA 5MEOA 1MHEA 2CUIA 1B90A 4OZFA 2FHCA 5M94B 1BPVA 5D7LB 3WFZA 1J1XL 4L8DA 2J8UF 3RGVC 3BO8A 3B9DA 3SDAA 4ZS6D 5GS3A 4Z95H 3SJVA 3U0WL 4YJZL 4NN7C 4Z7QE 5D93B 1OAYL 2NTFA 2JK5A 3JWOL 4OUUB 5I1LB 1C7SA 5I76A 2ZUTA 3HNSL 5DMJB 4FA8A 4B7LA 3ALWA 3IYLW 3O3BB 2R23A 1TPXC 5CP7A 3CZFB 2NNAA 5FOBB 1S7TB 3WIIH 2AJZB 4UT6H 2D03H 1T04B 5F7HA 2W60B 2HFEA 2AI0H 4YK4C 3VXNA 2N4IA 1RD6A 4LLYA 4HXAL 2JJSC 5MENA 1LO2L 3QP3A 3RIFF 3H9SE 1DANT 5EZJA 5FGCB 2PTTA 2EDEA 1LO4H 1TETH 3CAFA 3RTQA 4LSQH 1L0XA 5JPMA 4JO1L 3SDDB 3GJFB 2OJEA 2DWDB 1UGNA 5HYIA 1EEUA 5D5MB 5DD5H 2DQDL 3NZ8B 3OJMB 5LCVL 3VXRA 2GQHA 4ONHA 4X4XB 1M7XA 1MJ8H 3CCHA 4L4JA 3RL1A 1RZJH 2BHZA 3EHBC 3STLA 4KROD 4PGJA 3DYMA 3DX6A 1L0YA 3WNMA 3RUGB 4KZDH 5I30H 4GKNA 4WHCA 4Z7NF 2ADGB 2RIKA 2NY5H 3ARFA 3LPGA 5C3TA 2BXYA 1JZ5A 2M8XA 3IETB 3G04A 3VW3L 4FQXB 3WBDA 3VXMA 3S36H 3GGWB 3DMMA 4KKCC 3BKCH 4UNUA 2UZYB 1HZHL 3QG7H 4MDJB 3MRHB 4OJFL 1HHKB 4H1LG 5D1QC 5F44A 3WDHA 4E41A 3ZDXE 3HAEH 3HFMH 5C0RH 2J8UB 5C3LD 5I19H 1XH3A 2WBJD 1BEYH 1XGYH 3PWPD 4OFYA 4KK5C 5GRVK 2CK0L 3DXAB 1D6VH 3JBG7 5FUCE 3STZB 4PFEA 5TQ0L 3VD4A 3Q48A 4YNYB 1CGVA 3U0TA 1VKXA 1QLRB 1L7IL 5DMIH 3MACL 1YN6B 4LLWB 4OF6A 2W9DL 5D93C 4U33A 4JM2D 3MLUH 4E5XB 4JJHA 1RJLB 2E7LC 1FV1A 1MCJA 2XACC 1U8PB 2H1PL 5DHYA 4Z6AT 1MFCL 3RX8A 1CDYA 4U1IB 5CGYD 2UZXB 3V5HB 5E56A 4FTVB 2MNUA 1T1ZA 3R0NA 1UADC 3VH8B 4FZ8H 5FM8A 1BD2E 3QXUA 4HV8A 5KSAA 2UVEA 5JW5B 4ZUWB 1Z9LA 4M7ZB 5CUSL 2P8PA 1BZ7A 4KJQD 3TCLA 4KK6C 2QBWA 4NNYB 3RAJH 3KPMA 3G6JA 2H9GB 2K9UA 3HCVA 4O51B 5C07D 4MA1B 3KPNB 3KYMA 4UU9A 3OTTA 1BWWA 2R9HD 4BZ1H 1CFSA 1E0OB 4LCWE 1XF2A 2VMFA 2ARJQ 3UJIH 3HHRB 2ZUQB 1GGBL 4ISVB 4J8RB 4F2MB 1JNHA 4MXQC 1FFOB 2Z31B 3H7BB 4EDWL 4N0UA 4DZBB 1JIBA 1FVEA 3KXFA 1A7RH 5CHNB 1KIQB 4JG1L 4MVBC 1MF2L 1SQ2N 3EDJA 1GL4B 5EU6E 5HDQL 4P5TA 3QXTA 4G7YL 4JFFD 1A3LL 4ZDHB 1MWAH 1U8JA 1B0GA 2Z8VC 1YJDH 1HSAB 2WSKA 1QSEE 3FQRB 1H3WM 4PJ5A 1FLTX 2H8PB 5HGDB 4KUZL 4FQXC 4KY1H 4X8JA 1LEIB 3SDXE 2G5BA 3NPSB 2QSTA 1B0RB 5ISZB 2XWBB 4WO4B 4P46A 1DLHB 3FQWB 2Y1VA 4CN6A 2Y36H 3RWCA 3VU2A 3QFJD 4N0FB 2EH7L 4QHKJ 1CFVL 4PRBB 4U6XA 2FJHA 4UOW1 2VJXA 1PLGH 4MZ2A 4F7PB 3RL2B 2E9JA 4CJ0A 4P59H 4MJ5B 4U3XA 1NLBH 4UQ3B 1WFOA 4F7EA 5FB8B 3BVNA 3ZKNC 3VXUA 1KCUH 2BY2A 2YKLH 3BYYA 4ZAKA 2VIRB 1YYMH 1MJUH 3ARRA 1ND0B 1FVCB 4MAYD 3NA9L 1RSFA 4JRXD 1JPSL 2ZCLL 3D0VA 3FB6A 3ULVH 3ARGB 5IF0B 4K3JH 5EFIA 1S7SA 3EIFA 4ODWA 2AK1L 1IAIM 2F58H 4HF5L 3FCTB 3FQNA 1MI5E 1QSFA 4OT1H 2A77H 3D3VD 5EIVA 3BP4B 5I71B 2NX5A 5CSZB 3KJ4B 3NFNA 1OTTD 4QTHB 3EYUH 2E9WA 4OFPA 3AY4A 4M7ZC 3V7MA 1NAKH 1G7PA 4PJAA 3H3BC 2O5ZL 2XTJC 3S4SB 3F8UB 5C0CA 1ED3B 3P4OA 4LAQL 3UDWC 3QJHB 4MA1C 2BOBA 4D9LH 5C0JA 3OPZL 2VLJE 1MELA 1XFPA 2QQLH 5EWIL 1I7ZB 2V7NA 1CK0H 1JGVH 5DHVH 5IB3A 2HRPH 2C26A 2Z31C 5EUOE 3WLBB 2EDFA 4IRZH 5E8OA 1U8IB 3AS3A 4BSJA 3JV0A 1TCRA 1U91A 4PREA 5EA0H 3ULUH 4NFBA 4LFHG 2L7JA 2Y9RT 3WXWL 4BUGA 4M9PA 2KZ1B 2Y6SD 1F2XK 1I9IH 3VXOA 3P4NB 4NPYA 1QBMH 1IC5L 2OTWA 4TSCH 1QR1B 5IM7B 3QHZL 2VXVL 1CL7I 1HNFA 2G9HB 3IJHB 5TE7L 1MHPH 1A6PA 2HT4D 3MV8B 3QDJE 1P6AB 2FZ3B 1DP0A 1ZSDA 5CZVH 4R0LB 1H0DA 4M43H 4HIIA 4OD2B 1S9YA 3EOTH 5CJXA 4G42A 4GXUN 2RAMA 2OL3B 5IROC 1S7XA 3DPBA 1OCWL 3OX8A 5CEXB 2ZZUT 1Z0NA 1ZKAA 2NY7H 4G9FB 5D2LF 1ZHNB 1LK3L 5DMKB 1F90L 1S3KH 2EIZA 2VLRD 2EH8H 4JFOB 1D6EA 2NXYD 4KH2A 5JHDD 2DYPB 4V1DB 4NOFA 5I1IL 2NYYD 4ZTOH 2BVPA 3G6DL 4EOWL 1DDHB 4X6BA 2WP3T 2XWTB 3NZHH 4JHWL 5CZXC 5GS0L 3QR2A 4PJXE 3MRGA 2H32B 2JB6B 4NHUA 1IGTB 3LS5H 3QEQB 1LNUA 3KJ4C 3QAZB 5GGSY 4PLJC 4X5XB 4PV9A 3L1OL 4Y5YC 3VDCA 5SWZB 1CLOH 1N5AA 1CD1B 4GMSL 3HUJF 3QNZB 5FA3B 3HC4L 4QHMB 1W8NA 1MIML 3AVEA 2V7HB 4F33B 5J1TC 4OIIH 2BNQD 4HW6A 4FN0A 4PJ9D 1A3RL 2I07B 5B39G 5J56B 4PS4L 2EE2A 3TGXA 5EO1B 2JELH 3V5DB 3GHBL 1BM3H 1Q72L 4M3JA 4N5ED 3SOBH 4EI5A 5KN5B 2HFGH 2JB5H 3LEXA 3RVXC 1VFUA 1KC5H 5T3XD 2VAAB 5DZNA 3ZKMD 3SO3C 3D18B 3FZUC 2Z92A 5EO0B 1I8LC 5AD0A 3NN8B 4UV4L 4MSWB 5I1LA 1WC7B 4F7TB 5KVDH 4H1LB 1CFBA 3L95B 5CD3B 3O3BA 2V9RA 3QCVL 4YX2L 1CXIA 3CZFA 3RHWF 5DJXB 1S7TA 5LXGL 4Z18A 2AV7B 2AJZA 3RWIB 1YEKL 3BKJL 1GGIL 2W60A 1FL6B 2LTQB 4JGUA 1JYXA 3VRLF 5TDNB 4NN5C 1W0YT 4R0LC 1MFNA 3BDBA 4EBQL 4JFPB 5D2LB 1AKJB 3RBSA 1RJZA 3MJGX 3IDXH 4F7CB 2E6JA 3PL6D 2ESVB 3QH3B 4MNGE 3O4OC 2IANE 1HIML 3QWOB 4KMLB 4TVPH 1M1SA 1S9VB 2F53B 3FMGH 2AEQH 3IF1A 5T33L 1JZ4A 3SDDA 1A14H 3GJFA 1M6OB 3SGJA 2DWDA 4KMTH 1N3NB 5C0FB 3HZKB 3HA0A 5D5MA 5GS1B 3S35L 4WCYL 1HSBA 4HPOL 1A6TB 1TXKA 3O6KH 1KLFA 4X4XA 5CCKH 2N7AA 4XBEH 1J5OH 1T2JA 2P8MB 3S34H 3CSGA 4N8VG 2D7TL 4WFED 5J1SC 3MRPB 4PJDE 4WDIB 4X7TB 3LEVL 4W81A 1K8IB 1N5YH 3FO0L 3V4PH 2VN4A 5C70A 4PG9B 2AJUH 3UX9B 1I7RB 3IETA 3HUJB 1WFUA 1NGWB 4M1CD 2X41A 4Z76B 3Q2CA 5EPMB 7CGTA 3GGWA 2WINB 3RZCD 4CNIB 2B0SL 3N85H 3O8XD 3V52L 4MDJA 3MRHA 1HHKA 1VEPA 5FO7B 5EZIH 3MCLL 4GRLD 5DD6B 4UAOC 4XHJC 2BY3A 4LSRL 4RGNB 1RZGB 4R26H 3FAWA 1W72B 1A7QL 4FOMA 3E0GA 5ELIA 4Y19D 4I0CC 4UNVA 4O02H 4TQEH 3H3PL 3DXAA 3IXAB 5ERWB 5J06A 3D2UA 2AJ3B 1AR2A 4TTGA 1QLRA 2PYFB 3QDMA 1ADQA 4PLNC 3FT2B 4LLWA 4XPGH 2DQTH 3VI3F 2YA1A 3VGDA 2VR4A 5D1ZB 3RDTD 1RJLA 1R3KB 4KTEH 2OYPA 1U8PA 3ROLB 2ZPKH 3EKCA 1WT5A 4KU1A 2BC4A 2I9TB 3P30H 1XF3A 3UTTD 2VDKH 4LEOB 3NCYP 5K33A 4HGMA 4LSVH 4FTVA 1L7TL 2A0LD 3L3JA 4FMKA 4GRWH 4YFEA 5I1JL 1XGRB 4XI5D 3VD9A 1NUDA 3IJYB 4ZUWA 4AT6A 4MD5B 5FHBH 4GQ9L 3VMPA 1IARB 4GO6B 5DK3A 1BFVH 1OW0C 4U1MB 2H9GA 4O51A 4QXGH 2H2SD 3V5KB 3QEHB 4R97B 3W5MA 1F6FB 3EJJX 2ED9A 3UTZB 5A2FA 5DJZB 4DZ8B 5FM5O 2V2XB 1N0XL 3G9VA 5KW9H 4DQOL 4ISVA 5GS1C 4F2MA 3H7BA 4DZBA 1RVFL 3LMJH 2Y07L 5IHUL 4EI6B 3OGCB 3AC0A 1T20B 2LVCA 3MUY1 1F13A 5IW6B 2Z9TA 5GS0D 5K9KB 1IAKB 1G9EA 1MAJA 1T7ZA 2NQCA 4MX7A 1Q9KB 4IMKC 4ZDHA 4PJCE 4O4YH 1ZMYA 3DO7B 2GK0A 1HSAA 4O5LH 2CQVA 2QQKH 1LEIA 1RK1A 2XWJB 4Q6IB 3BHBA 1T1YB 1YEFH 2VRAA 4KRLB 3U79A 1B0RA 2NXZB 1T0MB 5ISZA 2XWBA 2IPKA 4WO4A 4DGIH 4D3CH 3FQWA 4ZUVA 4HSQA 2DM7A 1Z3GL 1G7JA 1KPRB 1WZ1H 7FABH 4N0FA 3ZHDA 5KVFL 4PRBA 2D7OA 2DQHH 4HIXL 1I8KB 1MCPH 2YD5A 1KJ2B 3IU4L 4JDTL 3PGDB 4LARH 4UQ3A 5FB8A 2Y23A 5CKGA 4WV1B 2MPAL 2QV2A 5I8KH 4KHTL 2X70A 5GRUH 2VIRA 2IQ9H 4HWEL 1ND0A 1FVCA 2IF7A 5GJTH 3BDYL 5T1LD 5DSCB 3IFOA 5D1ZC 1S5HB 5FF6A 2R4RH 3JWDC 1X5KA 4XNUH 3U4EB 4PRNB 3ARGA 5I8OH 5IF0A 4HEPG 4YHZH 3EDEA 5F1IB 3OMZA 4D9QD 3V8CA 3SQOH 1TVHB 4XXCA 3FCTA 3I2CL 4ZUUA 3MRDB 2C1PB 3EYSH 3OG4B 3TVMB 3CSBA 1AD9B 3B2UD 5DC9B 2IPTH 3BP4A 5CJOL 5EU4A 4P2RD 5K93A 1U6AL 1QKZH 3VXPB 12E8H 3UYRH 2VABA 1FH5L 3OAUL 4OBRA 2VXUH 4QTHA 1INDL 2FCBA 3QIUD 4G6JH 2EDYA 4B5EA 5FGBC 4EQ2A 4FQ2L 4XMLL 3TIDB 3UC0L 3O2VH 3RWFA 3S4SA 1KTLB 4K8RC 1J0ZA 2B5IC 4TULL 5CJ8A 4DGVL 2HKHH 4JFED 2M1KA 1VFBA 4WY7H 1AGCB 1J10A 4PJHF 4UIKH 2EZ0D 3WNOA 1I7ZA 2ATKB 4RISH 2YPLE 4A6YL 2WMPA 4G80B 4LPCA 4Y5XA 4QRUB 2R0KH 4AIZB 1C5BL 3WLBA 1ZLWK 1ZGLP 5HHPB 5DR5H 1NSNL 4KQ4L 1OP5K 4L4VB 2E3VA 1AIFB 4PY8J 1MRFL 4L8SA 4YE4L 2AJSH 3FJTA 2RB8A 1K3ZA 3S36X 1JK8A 1T1WA 1VDGA 1EH9A 3BT2L 4BK4A 3QZWG 1FIGL 1B4JH 2YD1A 4O2CA 5HD8D 3LY6A 3WHXB 4NT6B 2HG5A 5I8EB 5FYLH 2COQA 4Q6IC 3O2WL 3IJHA 5B39B 2IH3A 1WBZB 1FZOB 4FG6C 2AJVH 1IQWH 3L7FB 3MV8A 4NNXA 4G8GA 2FNBA 1CDUA 4AZ8A 1XGTB 4XX1E 1R0AL 5FA4B 1I7UB 4OD2A 1WUNT 1GC1C 1FG9C 4BYHA 1D5IL 3GMRB 5C0AE 4Y89A 2EXWC 5CEXA 4KK9C 1LE5A 2F5AL 1XR9B 1FAIH 1CU4H 4Z7UF 1ZHNA 2YUWA 3GSVB 4I3RL 4K2UL 5HYSA 2IAMD 1MPAL 4OF0A 2QQQA 3TWCH 3QIWD 4U0RC 2CLVB 5D2NB 4GAGH 3PWLB 2DYPA 3IFPA 3U4BL 4HUUA 2NR6D 1IGIH 5GJSL 2H3NA 3MLYH 4GXVL 4RRPG 2XWTA 4OAWB 4X6FB 2YN5A 2AK4B 1EMTH 2H32A 2JB6A 4AMKL 3ARZA 3RVVD 3O6FD 4ODUA 1W0WB 4J12A 5HI5D 2FGZA 4OKDA 3QEQA 2DRUA 2IPUK 4X5XA 4BFIB 4W6XB 1WLHA 2D4DA 1JF1B 2BP3A 1CF8H 5F7FA 3C09B 4PJHB 4QHMA 1U95B 2V7HA 1FL3A 4GKSA 4UT7H 5J6HA 5IBLC 4HS8L 2I07A 2YWYA 1CGTA 2P5WB 3BGMB 4XPBH 4N8VB 1R3LB 5ADPH 5EO1A 3OQ3B 4KRPD 3V5DA 3NIGF 4P2QD 4BKLB 2DQIL 1UXSB 4XMPH 2N1KA 2J12B 1UACH 1G6RB 2XTLA 1Y6MR 3H0TA 4HWZA 3C60C 5CLTA 3D18A 3MLTB 3NN8A 3QRGH 4NQDB 1J1OL 4MSWA 5F3HA 1VGEL 1OAKH 4F7TA 4Z95L 1QRND 5H37G 1LD9B 1S78D 4H1LA 3L95A 5CD3A 5D7JC 2EO9A 4JGMA 1UB6A 4P23D 5EOCH 3WDJA 5KZCB 5DJXA 1E6OH 3AREB 3X3GH 5IEHB 2AV7A 5IVXF 3RWIA 1FL6A 3HE6C 1FYTE 4QHNB 5TDNA 4IRSB 3M45A 5L2KD 2J2ZA 4I9WD 1IEBB 3P73A 3WIIL 4LSDA 3ZE2F 4UT6L 3HB3C 5D2LA 1AKJA 2D4FA 5FYJH 5E8PA 5E9DD 2AI0L 3W0WE 1U8LB 4F7CA 1AE6H 4NGHL 1S5IH 2ESVA 3QH3A 4CMHC 3QWOA 4LVHC 2BSSB 4UOJA 2OL3H 1CG9B 2CLZA 4GBXC 3W5NA 1N3NA 5C0FA 2UV3A 3TBYB 5J3HC 4P48A 3U4AA 1A6TA 3ARBB 4LSQL 4XAKE 3UAJD 4K9EC 4AK1A 4HS6A 1MHHB 2P8MA 5ID1A 4M5ZH 2QADB 5BXFB 4IS6B 3BGAA 5DD5L 4WDIA 4X7TA 2BNRB 1K8IA 3TV3H 1MJ8L 1AP2B 3HKFA 1RZJL 2X1PA 4PG9A 5KSAC 5ACLA 3LRGA 2BK8A 1NCCH 4LGSB 3O81A 2AEWA 4NRYB 1NGWA 5EPMA 32C2B 2WINA 3OZ9L 2BVEA 5I30L 5KSBA 3NOIA 4GRMB 4O58H 3VDAA 4PP1C 3C09C 2NY5L 3WIHH 4JG0H 1G7QB 4Q9CA 1CXHA 3S36L 3O3EB 3BKCL 4DKEH 4I3GA 5KVGL 3C87A 1W72A 1RJYA 3KPTA 3QG7L 5DRXB 3AB0B 3BOVA 5E2WH 3B6SA 3HFML 4HCRA 4LSSH 3ALXA 2Z91B 1NBVL 2PYFA 2XZQL 3ARSA 5B4MD 1OOAA 3S5LG 2E7CA 5I19L 1BEYL 1XGYL 2IALA 3FT2A 2R1XB 4X6CF 3Q6GH 1D6VL 1T66C 3AMLA 5F7WC 1FRGH 2JLLA 4Z7QF 2HT2C 4M6OH 2GHWB 3T0AA 1R3KA 2NZ9C 1I1AD 3KLDA 2VDML 5DMIL 4OSUL 3JV6B 1UEMA 5D1XB 5IVXB 4LP5A 3HC3H 4JPVL</