3BAEL

Crystal structure of fab wo2 bound to the n terminal domain of amyloid beta peptide (1-28)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
218
structure length
218
Chain Sequence
DVLMTQTPLSLPVNLGEQASISCRSSQSIVHSNGHTYLEWYLQRPGQSPKLLIYQVSTRFSGVPDRFSGSGSGTDFTLRISRVEAEDLGVYYCFQASLVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WO2 IgG2a Fab fragment Light Chain Kappa
publication title Amyloid-beta-anti-amyloid-beta complex structure reveals an extended conformation in the immunodominant B-cell epitope.
pubmed doi rcsb
molecule tags Immune system
total genus 51
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3baeL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3baeL01
2WZPD 4KVNH 2FO4B 5KOMC 5EU3B 1UZ6F 1GZPB 4UT9L 4XXDA 2FGWH 3AS1A 4MNHB 3TIDA 4L3CB 1D9KC 2MTPA 5AYUL 4JGMA 5GS1B 1ZS8B 3M45A 4C58B 1T7ZA 2NY6D 3V7AG 4KROB 4F7MB 2HT2C 3BX7C 4G9FA 3WFEL 5IEKA 1C16B 1MFDL 2VDML 1VCAA 1WZ1L 5E4EB 4G8FB 5K93A 4S10A 1BVKA 3CH1B 1MY7A 5DVMA 5B39A 1C08A 3VFVA 3HAEA 3X14A 1IGJA 2O93L 4P4KD 5AD0B 2I27N 4XBGB 1R5IA 2UZIH 5A2KH 4OB5L 3T3PF 1L6ZA 3QIWB 5JUEH 3PWNA 4JRYE 4ELMA 4XVUD 3AXLB 2YPVH 1FYTE 4NKOB 4OCYL 1MFAL 3P11H 3W0WD 1HH6B 1ZWIB 3JWDC 3T4YB 3VXSB 4LGRB 2VUOA 2A74A 1JJUA 3O11A 3STZA 1OAZL 1HHGB 3UTQA 1KOAA 5GJSH 3CDFA 3VRJB 3CK0L 2A83B 3QISA 2CDFB 5D1QD 4OI8A 4PLKC 2VE6A 3ZKNC 1MVFA 1JZ4A 2X4RA 3SO3B 1JPTL 1AQKH 1SYVB 2CKNA 5H37H 3HTLX 1CBVL 2YMXH 2A0LC 1I1RA 4LLMA 4NHUB 4BQCA 2X7LB 4YC2B 2BNRD 3CDCA 5J11B 5HHVH 1T21A 2FX8L 3RBGA 2FLRT 3PHQB 5FYKL 4NKDB 3I02A 4JRYA 4K71C 1LK2A 2KH2B 4U6VH 3RWIB 4PP2A 4NJ9L 3KHOA 5A16B 3TO4B 1W72B 3E2HB 1YEGL 2NY7H 4F7CA 5IHZA 4HV8A 1TQCB 3OJDA 1LE5B 5DWUL 2VL5A 5ACZA 4XP9H 1W8OA 1SEQH 4OLWH 4KK5C 4EIZC 2XZCH 5CJQL 3L3KB 3V5HA 2RCSH 2YBRB 1RV6X 4UDTA 2VISB 5IB5B 4FG6C 4M02A 3VI3E 5DJDB 1YEJL 4P46D 1JGDA 4PRPD 3VFUB 3BYTA 5IB1B 3LEYH 3SOBL 1MWAH 1R3LB 1QHPA 4J3XA 3VRIA 3A6CH 3GJFA 1JNLH 3M17A 2VDOH 1CU4H 4Z7WA 4E42B 1BLNB 4IRZL 3PE9A 5EOTB 3VWKC 5GGSA 2I25N 2FHFA 4Y4HC 2EO9A 5EWIL 3F5WB 3LVEA 3MR9B 4WHTA 1F4XH 1GGCH 1I3GH 2E9WA 2HTLC 4G6JL 1RK0B 4LRNH 4ZO9A 3VWKA 4AY0A 4Y4HA 1ZHBA 3IB4A 1QVOB 1MNUL 2KL6A 3HI1A 2ATPB 5KG9A 1JL8A 1A6AB 5INCA 2DBLL 2VLJB 5ACLA 5DF0A 2XWJA 3HNVH 3F7VA 3KR3L 5CJOL 4I3RH 1FNAA 1U8MA 4JRXD 5GGTH 4PY8J 4U3XA 1DEDA 5D71H 3MCLL 3T08A 3MJ9L 4NKMB 4WY7H 5FO7A 1EVUA 3DXAE 3TBVB 5HI5C 4OD2B 3QDJE 3QHFL 1NEUA 4KI1A 3RY6C 3UTPE 4AEIH 5JIPA 3SDDC 5I30L 4G6AD 4TPRH 3V6ZB 2YHGA 3RWCB 3RY6A 3REWB 3QWOA 3B5GA 2HP4A 4FMFA 4U6HB 5GRZA 3SDDA 1CLOH 2Z92A 4HUNB 4CMHC 5J1AA 4DKAA 3WL9A 3D2UD 4K7PX 5EU6D 3V4VL 1M71A 3GDBA 4J3OC 4KJYA 1QR1A 1DQLL 2X9YA 2YZ8A 2PTUA 4XPHL 1VDGA 2EDFA 5SWZB 3WXWL 4AT6A 1WT5C 2FIKB 5EO9B 1BFOB 2DQDL 1UKSA 1B6UA 2P48B 4GW5A 4OF8A 1X5HA 1XZ0A 1DLFL 4G6KL 1E6OH 3FRPA 3SKJH 1WT5A 5JO5B 3RVVC 5IGXL 3FQTB 4HK0A 4OLYH 4ZOAA 3N1MC 5KANI 5T3ZD 2HG5A 4PRNB 3IDIA 3ZE2E 3EO0B 3QDJA 4JM4L 1H9VA 1H0DB 1CR9H 2VJXA 4DZBB 5I1GL 4NRZA 4MNGE 4LLYB 3MGTA 4YH6A 1UVQA 2K7PA 1KIUA 4TNVK 3TWCL 2WUCH 1AXSB 4LIQL 2J4WH 4G6MH 2ENSA 5IB3B 5L8LB 3ARGC 2C4FU 1AJ7H 5DD3L 3PP4L 4G80A 4IMKC 3VCLB 4U2ZA 3ARGA 1TZGL 2GY7B 5DEGB 2HFFB 4IMKA 3RL1A 2PW2B 1I9RL 1OCWL 4QTHA 3WS3A 5EU5A 3V4UH 1LGVA 1X5JA 5E2VH 3H0TB 4DQOL 5C0RL 1EAPB 4JVPA 4TUJB 3QNZB 1P84J 4HIHB 1WWAX 4LSVL 1IGYB 5TDOA 1X44A 1ZT1B 4OCWL 43CAB 3QUZD 4TYUA 4V1DE 3DSNA 1UXWA 3VFGH 4XBPB 4Y2DD 2IWGA 2OK0H 2Y72A 3BFOA 2OR9L 4X9BA 3VDCA 1FO0L 2IH3B 4Z7OE 1F6FB 3OZ9H 1J7VR 5K59F 3BXNA 4EXPX 3BKYH 3FMGL 4OZHE 1XF1A 4I0KA 3DX6A 4HFWB 4KWUA 4Q9QH 2D3VA 4KI5F 5C9JA 3CFIC 3C2SA 3WNMA 1D7FA 4XNZC 1DBJL 4GH7B 3WN5C 3NMEA 4F33B 3HPLB 3SJVE 1NDGB 1W0VA 3GK8H 1MF2L 2F74A 3C8KB 3MJ8B 3WN5A 3WSQL 3DVIA 4LGSB 3U1SH 1G6RL 1BFVH 4BQ8A 3O3AA 4HX1B 5GGRB 1QP1A 5DQDL 5B8CC 3X17A 4OZFG 3OAYK 4U1IB 3HA0A 3QHZL 3I3EA 5F7KC 3BPLB 5IMKA 2YRPA 4PJCB 4HUWA 4Y4FB 1CQYA 3D0LB 3FFDB 5BV7H 2MCPL 5JOFB 3FZUD 4V1DA 4KHTH 4NO2B 1EFXB 3GSXA 4NWTL 3I84A 1U8QB 1UM5L 5EC1A 1BOGA 3FQUB 5CEZH 4PYHA 1Z0NA 4H26B 5D1XC 2QQQA 5E1AB 4L29B 4OZHA 1RZKC 1B4RA 3RL2B 1NCCH 5TQ0L 1JHLL 5D1XA 4ZO7A 1NPUA 2ESVE 3QDMA 4N0YL 4QHMA 4MS8D 4IRSC 4RFEA 1U8HB 1YA5A 2VDQL 5CGMA 2VC2H 3SJVA 2IPKA 1AKJB 4IRSA 3CXDH 5F9WC 4D9QD 1MH5B 3NCCB 3TBYA 2FJGB 2EC9T 2R29L 5KVFH 5LG1A 3SKOB 2FX9H 3WUWA 1OSZB 1OTUC 1UFUA 2GTWB 2HJKB 3MRHA 4RRPG 2XXCB 3EYSL 4OLXL 4HH9B 3OF6D 2WP3O 1WIUA 1S8DB 2HYMA 1RIHH 4HK3N 5E5RB 3MV8B 4LCWB 2BY3A 3VDBA 4S2SA 4EIGB 3DX7B 2ZCKH 1QSEB 3V6FB 4KDWA 3EBAA 4YFEA 3JV4A 3VWJC 1NCAH 4NO3A 2FO1A 5CKGA 2FD6L 3HZMB 2VERN 1R24A 3HZKA 3WXVL 1KJ3L 2VLKE 3VWJA 4KMLB 3TV3H 4ZAKB 3LKOB 2XPGA 4NRXA 3VFPB 5DJAB 3O0RL 5KSVA 1LO4L 5HGHB 1L7IH 4HXAL 2BRRL 2CIKA 1MHHB 4OGXL 4Q6IC 4XHJD 2X4SA 4OLUH 5C0GA 4Z7UF 3JBG7 4K3HA 4K7PL 2R2EB 4I48A 4R4NC 2NY0C 1FZJA 1JGEA 2Y6SC 4ISVB 4PJ9D 1QRND 5GISH 3DETD 3LPFA 4PJXE 1G7MA 3OKYA 4Y8AA 2HMIC 3LRSB 1NLBL 1N5YH 1JV5B 5A1AA 4UV4H 1I1YB 5F7WC 2VTFA 2ICCA 1NAMB 4DKFL 5E7BA 5GSVA 1T20B 1F4HA 5GS2H 3KWWA 4JPKL 1HHJB 2P45B 1KJ2B 3IAPA 4L1HA 3DWTA 4L8CA 4L8BB 2AXGB 3QUMH 3B9VA 12E8L 2NPLX 1QUNA 3LS4L 1N6VA 1TTUA 4H5SA 4LVHB 2EDRA 4X6BB 3RX7A 4L4TD 3D25A 3SCMB 3ZDXE 5L0QB 4Y5YC 4ZUWA 4LKXB 4MA7H 4GG6F 4EUPA 2DIAA 4IM8A 3W82A 3PWUB 1P4IH 1GHFL 4Y5YA 4WWKA 1FZMA 1OLLA 1TCRB 4QHUB 1T89C 5CEZE 3GSVB 3OG6B 3ZL4L 1CFSA 5J9PA 1CK0H 3BWUC 1S7TA 2DM2A 1GXEA 4DJMA 1T89A 3KYKH 5INDB 2CLVB 2NLJA 1I7TB 4XPGL 1LDPL 4L8SC 1GVIA 1OTTC 1U8NA 1DE4B 3HKFA 4OBSA 5EZJA 2AJVH 1HYRC 3HS0B 4L8SA 4F9LA 3EJZD 5JXAL 5DC9B 3L1OH 3TJHC 1VHPA 2R0KL 2J8UF 4KKAD 3PDDA 2Q86A 1RZGB 5I1EH 1FC2D 1S7RA 3T8XB 2Q76B 3QZWA 4LDLB 5E00A 2H2SD 5E9DA 5GSRB 3U46B 4HS6A 2VYRE 4ENED 3HC3L 1DBML 2NCMA 2XTJC 3P77B 4E5XA 3G6JE 1OP9A 5B38G 3RWDA 2R2CA 4OQTH 1HQ4B 4JFPB 5IF0A 4DAGH 3ARZA 5CZVH 4UNTA 3P9MA 4PRIE 1X5FA 5BZWA 5ESVB 2UY7A 4JCLA 1A7OH 1TENA 2MPAH 3QAZB 4U1KB 4K3JL 3NN8A 1B0RA 1T0MB 2V17L 3S34L 3S88L 5IK3A 1XCTB 4XNMB 1GIGH 1FHGA 1BAFH 1FFQA 4W68A 3C6SA 1D9KD 5CBAB 1DSFH 4G43B 4JAMB 1A4KA 4HIIA 3BYYA 4G9FD 7FABL 5SWQB 4J6RL 3PHOA 4Q97A 4OAWA 3V95A 2HT2D 4EOWL 3BD5A 3T0EA 4QRUA 4WI7A 1CXIA 2AJ3B 2RB8A 1YMHB 2R8SH 4CGTA 3IXAB 4K8RD 2H8PB 3C6LB 2NTSP 3BUYB 1JGLL 1OAUL 3PL6B 5D96B 1XR9A 5FO8B 3KAAA 5EBWB 4OI7A 3QJFB 3DIFB 4M1DL 3VGAC 4FTVB 2JJSC 2XZAL 4C56A 2O5YL 4PRIA 4PJFA 4YO0A 5ICXA 1ZAGA 2JJSA 3O9WB 3ALXA 4JLRB 1M6OA 4ZNEA 1D5XB 2FWOA 4JE4B 4JM2C 4YE4L 3T1WA 1T5XB 5DJZA 4NQDB 5T33H 5JLZA 3LHPL 4MCYB 4WUUE 3W2DH 1GJIA 3TBSA 1OW0C 1SBSH 4JM2A 1S7VB 3KYAA 1P4BH 2G60H 1K8IA 4ZFOB 3IDNA 1OW0A 3CFCH 2IPTH 4U1SB 4P2OB 4Z0XB 3ZKND 5BVJA 1RAMA 2ZCLH 1N59B 2GK0A 2NXZB 1N4XL 1N8ZA 3CSBA 3EOYG 4PJAB 3B8SA 4PJ8A 4CN4A 4TVSa 1ND0B 2A1WL 3F12B 4TQEL 1WVZA 4WI5A 1F13A 1NGWA 2A0LD 2ARJB 4JRYD 1JF1A 3RVXC 4R8WH 3U9PL 5F1SA 1OARL 5EZIH 1FYTD 2VUYA 1LK3L 2NY4B 4O02H 2HRPL 3NACH 2ADIB 2EDHA 1GAFH 4IOSD 1VEOA 4WU7A 5CD3B 1CGSL 2XKNA 1SY6L 1NGPH 4ZFGH 2I07A 5DFVD 3LV3B 3VFSA 2LAGB 3BZFB 2FHCA 4H25B 4TULL 1J87A 2D7NA 5F1IB 4X83A 4WUUA 4ZUTB 1T1YA 1QSFE 4AMKL 3UC0L 5CWSA 3VFWA 2SEBA 4WGWB 5FK9B 3G6DL 2V2TA 4YHYB 4MX7B 4FZEL 3RAJH 3HE6B 5AUMB 2ZSVA 1YDPA 4KK5D 1S9VA 1G7LA 2WUBH 4EI5A 4ZPVB 1EXUA 5FM8A 4X5WB 1AR2A 3P73A 4XBEH 2IALA 3ARPA 3HUJE 4FG6D 4IMLB 5E08H 1G7JB 3V6BR 2KQNA 1IKFH 4RAVA 5ADOH 5JPMA 1PZ5B 5DC0A 5DURB 5I8EB 4BFGA 5H35B 5E5MB 4Y0GA 5KOVC 3AM8C 1EJOL 1HOCA 3F7PC 3VWKD 1NCDH 4G6FB 4Y1AB 3L95A 3LCYA 1IAIL 5KVEL 4I77L 1FVEB 3AM8A 3KXFE 4OQTA 2HTLD 3CVIL 3UTZA 2ZSWB 5E8EB 1MAML 1Q9LA 3ZDZE 3MNWB 4GW1A 4GMSH 3RUGB 3P4MA 3OHXB 2OQJB 3QG7L 4DN4H 1B0GA 2DQIH 4XPAH 5D2LF 3RQ3A 1ZK9A 5I19L 4OFYA 1H3PL 1NJ9A 4R90L 5HI5D 5LCVH 3FO2B 2GW5A 2DLFL 2QHLA 1W8NA 3SKMB 3HUJA 5J6GA 3SDDD 4H8WL 2IF7A 3NOIA 2ZZUT 3QQ4B 1MI5A 3STBA 3ZT6A 1IQWH 2FECL 4LCYB 4HW6A 3FQXA 1HXYB 1TQBB 1VEPA 3JXAA 1BVLA 5GGRY 1MQKL 2E7BA 1C1EL 2GJ6B 1D5IL 1NMCB 3IDXH 3BEVA 1UJ3C 4ZUVA 5L9DH 4TVPH 3U82B 1S9WB 4LPVA 2IANB 2EYRA 4KKNA 4NGHL 5K9KA 2P47B 2V5TA 1C5BL 3RVVD 5JHLL 1UJ3A 2J88L 4G3YL 5T1LA 2B5IC 1FDLH 3O6FD 4X7EC 4Y5VC 4PJEA 5SX4I 3DXAD 4YDVB 3QDJD 2AXFB 2HJLB 2DWEB 2UZYB 2P4AB 4JFDB 2E8ZA 3Q3GB 3TFKC 4PGDA 1SJEB 5LVEA 3UTPD 3MX0A 2IAMB 1P7QA 5IOPB 1HSAA 2P5WA 1NGQH 4LCUB 1HHKB 5KS9E 1BPVA 4AENB 5I75C 1CFTB 5JORA 3C5SA 4H1LG 5T3XL 4X6EA 3K7UA 2YR3A 3PGDA 2OTPA 1QFOA 3VFOA 3ARGD 2BSRB 1CGXA 2X4TA 2X09A 3TZVC 1D6EA 3S96B 1PG7H 4KHXH 1A1OA 5BXFB 4K2UH 2ATKA 2BHZA 4WHCA 3BSZL 3TZVA 1RJZA 3KYOB 4FZ8L 3RNQA 1YEEL 3LB6C 1MCSA 4X7FC 3IU4H 5GRUL 2GT9A 1DQDL 4O51A 1Z9OA 4CN1A 2EEBA 2Y7QA 3UP1A 1DVFC 1KIRB 4U1JB 3BZEB 1UXSA 3RIAK 5DT1H 1MJJA 4PG9A 4KRLB 4POZD 2FX7L 2GSGA 1DVFA 4X8JB 1JUFB 1XGYL 1ZLWH 4NNYB 3SHSA 3I6KB 2VDPL 5KS9A 4WNQA 1BOYA 4HIJA 2AJXH 5BMFH 4L4VB 4YIQB 2JTDA 5IESH 1RULL 4RGMC 3KYMA 5EO1B 2FGZA 4P5TB 1MRDL 1KXTB 4H0IA 5EBLB 1U91B 1QTYT 4WRLA 5ACMA 3RA7L 4BZ2H 3ZSTA 1JMXA 1XGRA 4H88L 1NCBL 5D72L 3UZQA 3V5DB 4PV9B 3UO1L 1IJ9A 3L6FB 2LVCA 5JHDB 3WFBH 1V3JA 4XP6L 1F90H 1IAOA 4M62L 4RIRA 2AVGA 1CL7L 1ED3A 2E8YA 3GNML 4JFOA 3ULVF 3B3IB 4APQD 4NT6A 4U7SA 5KAQF 4V1DD 3MXWL 2DQTH 4WW2F 4HKZB 3IAQA 1FCCA 5J13B 4HZAA 4TVPE 3MLSL 3O4LE 5HDOA 3RZWA 4R4BB 4WI4A 5HHXH 4YXLH 1U8PA 3O8XC 4G8IA 3ZKXC 3WHE1 3MGAA 1JGVL 1OHQA 1W2KT 2A9MH 3QUKA 4MHHI 1YQVL 2C4XA 3O8XA 1AP2A 4XNXL 5D1XD 3BWAA 3NABH 5EO0B 4Q9RL 1H3WM 4MVBC 2Q3ZA 4M93B 4UB0H 1FAIH 1WTGT 4OCXH 3QI9C 3SJVD 1GGUA 2OJEB 3R1GH 4Z5RB 3OKDA 4LEXH 1WGOA 2AEPL 1DBKL 1HSBB 1EHLH 4XWGL 3QI9A 4UILL 4YBLB 5CEYB 5DQ9B 2VDKH 2NY6B 1FRGH 3NPSC 5GS0L 5HYSA 3FB5B 5F7DB 4M43H 3SDAB 5HYEA 1NDMA 1NGYA 1KGCE 5KSAB 5L2JB 4HDIA 4S1SL 4P5MA 1OTUD 3RU8L 3TBTB 4LASH 3VXPB 4L9LC 4CU7A 3BKML 4XH2B 1VKXA 3K4DA 1TZHA 3G5YB 2V7NB 3E1F1 1ZGLA 3CX2A 5T1DH 3ARTA 1EEYA 1NFDF 2ESVD 3BI9X 2PTTA 3PJSB 3OXSA 5SWSE 5KSBB 3LDBB 4NUJA 2B39A 3W0WB 5LGJB 4Y7MA 4AEHL 2FYYB 4UTBH 3AS3A 3BPOC 15C8L 4XVSL 2VDLL 5I74B 4RISL 4UQ2A 2J8HA 5I1KH 1AFVL 2NQCA 4M1GH 2H3NA 5CP3H 4JQIL 3I6GB 5DJ2A 5D1QB 4R4ND 4S1DC 2NY0D 4DGYL 2GEEA 2Y6SD 1NMAL 1K2DB 2BVYA 5DJCA 4Z7QE 1F6LL 4ODWA 2DS4A 1YEHH 1FGNH 4KH2A 2HMID 1NCNA 3SEPA 4OM1H 1UZ8B 4RNRA 3MMEA 3SGJA 1I4FA 4B53A 4E41E 3BAEH 4XGZB 1CI5A 5EG6C 4HPYL 5C0EA 2BNRB 4UIMB 1JNHA 4D8PA 3T3MF 1FFPB 2C1PB 3RKPA 4ACPA 3P9WB 4MZ3A 3BO8A 1YEDA 1BZ7B 5KW9L 2EYSB 2FATH 1A3RL 3TP4A 2VLKD 3NCMA 4KJPC 1T66C 5EU7E 1I3VA 2UUDH 1FIEA 5SWSA 3ARFC 3F65A 4FNLH 2OLDA 3QO1B 1W0WA 3KNBB 3QFJE 3MRRB 4FQQA 3ARFA 4J1UA 4YLQT 3SE8H 4FP8H 4U0RC 5EOQH 4HK3J 4AK1A 5LXGL 4PUBH 3UYPA 1P9MC 4JPWL 3QB7C 4R97B 3IDYB 4K9EC 4ZQKA 1OTTD 4FQCH 1P9MA 2IQ9H 1S7SB 3F7QA 4PJDE 5LAXA 4F7TB 5CIPH 3GFUA 1J5OL 1DZBA 2DLGA 4LAJH 1U8IB 4K23H 4P46B 3HRZB 1N3NA 3TJHD 4UT7L 2A77H 4M1CC 2APFA 1JI2A 4YK4C 4WI9A 1J1XH 5J89A 4OGZA 1SEBA 1FBIL 1DBAL 1OM3H 4GAGL 3A6BH 3MOAH 3RVUC 5LQBH 4HGWA 4DVBA 4PJIF 4FQLH 2DWDB 3MV9B 3W9EA 3SE3C 4P59L 1AHWB 5CEZD 3EOTL 1X5IA 4IDJL 1ES0B 1BF2A 4QGTA 4N8CH 5GZOC 3NCYS 3QFJA 5DHXB 1BQHA 1C5CL 3PWJA 2Z91B 4MJ6A 1SM3H 2AJYL 3GMMA 1FYHB 4XHQA 4JRXB 3GBML 4I2XB 1PY4A 4LCCB 3WS6C 3QEUA 5KVDL 4PJDA 1KTLA 3WDJA 2ZUVA 1HINL 3PDGA 3GUTA 4JY4A 4L8DB 2BXZA 2KZ1B 1HZHL 3DURA 5FECA 2AI0H 3WLBA 1WEJL 1QHOA 3M1BA 3ARXA 2WWKT 5MEPA 1EAJA 2OJZL 3FOMB 3FQRA 3TVMC 5L88H 3V0WL 3O6LL 2BJML 2JJVA 2BFVL 5IW1B 5EU6B 3TVMA 3RWEB 4P9HH 4YZFF 3TPUA 4IOIB 5C6TL 5ESQA 2I9LA 1RZFL 4LLWA 5DHYB 1CZ8H 1WC7A 3P9LB 4MWFA 4QLRA 3SGKC 4PRID 4FXLA 5DZLA 3R8BB 3L5IA 4EDXA 1E27B 2HH0L 4RFOH 1NEZG 2GSIB 3SGKA 4JQVC 1TDQA 4CVZB 1H3GA 3T1FB 1QBMH 2L7UA 1WICA 4N5EC 5JTWA 1R5VB 5GXBB 4JQVA 4X7TB 2R4SH 4PS4H 2EXWC 1RUKH 1CG9B 5IWLA 4JM2D 1JPGA 3LRHA 1QKZH 5CP3A 3F7YA 1LO2H 3CZFB 2B1HL 5FHBL 3QXVA 4D9RE 4UAOB 5TE6L 1KT2A 2HLFC 3FO1B 1CXHA 1IC5L 5F21B 2R0ZH 3WIHH 5FM5M 5GS2D 1K4DB 1N2RA 3DECA 3BP6A 1CWVA 1NC4A 4U1HA 4MDIA 3B8YA 4XX1E 3EIFA 4JKWA 2RIKA 3N1GC 5IB4B 1QFWM 2N56A 1KENH 1UB5A 5JNYB 3LD8B 4KZEL 3IU3B 4JO4L 3L3DB 3DROA 3P0VH 3RVXD 1MCOL 2APXA 1U93A 3EYQC 3GMOB 3NAAL 2NTFB 4MQSB 4ZPTA 4FXKA 3VRLF 2X4NB 2CSPA 4ODXA 4IJ3B 4WI3A 1A4JA 1GGBL 4BSWA 3MACL 5JXEC 2YN5A 2ICEB 4D0BA 1LP9B 2R0LL 4WUUD 5C0FA 5HJ3B 3MCKB 5JXEA 5TDPB 3THML 2VR5A 5FUZL 3VFMB 3BIAX 4U3CA 1MRCH 5DMYA 2PXYC 5I1IH 4HMDA 1VA9A 3ARBC 2A6JA 2W9EL 5HHQA 1PKQE 3SE4C 1NCWH 1A6ZA 4F15C 1IGCL 2PXYA 4HQQH 2ICWB 4HFUL 1TJGH 5DLMH 1KLFA 4PBWD 4JHZA 5CIPA 3SE4A 2BRQA 2B4CL 3HNSL 1KJVB 5E8PA 3QUXB 3WHXB 2JCCB 5EC2A 4OCRL 4PV8B 3EYUL 5B38B 5HHMB 4PJHF 1PSKL 2AEQL 2EDNA 5BRZE 1SJHB 2D31A 1T0PB 4OFPA 4OBRA 4YAQA 2XACC 3D0VA 2X5PA 1LNUB 4NHCL 3R0MA 4RMRA 4G7YH 1G9EA 5HI3C 4MCZA 3KLAA 1WZ1H 3X13A 1ZE3C 4N1EA 4MQ7A 3B5HA 3V9FA 3ZE1E 3MRJB 5I1AA 2B2XL 4ONGL 4OF3A 2VITA 3VE0B 2H1PL 4HUKB 4B5EA 4PJ7A 4QNPF 3CNKA 2DTSA 2R1YB 1I3RB 1QSFD 5A2FA 2R2HA 1KFAL 2BHUA 1TCMA 1CGWA 5HVHB 1MHEB 4TRPL 1OL0A 3D39A 4GXVH 2I9TB 1F3JB 1V7NL 1AI1L 1ZVSA 1JYNA 4NYLA 1CTNA 1J88A 4OFYD 4IIQC 2HT4C 4PTTB 4M7KH 2A6KB 1QFWI 3I9GL 5ICZA 5H94B 2UVFA 3VGDA 1C5DA 2B20A 4XPBL 3VXSE 5GS1C 5EU3A 3S4SG 4HF5L 4ESKA 4NIKB 1GZPA 2H32B 4ODSH 4MNHA 4X6DB 3VXNA 4DTGH 1BFSA 3BISA 5CJBA 4DGVH 3E8UL 1I9JL 4P9HC 5KVGH 5KZCB 2KKQA 5GS1A 3QFDB 2MKWA 5F6IC 1YEKH 4BH8B 3S37X 5AG8A 1YPZB 5L2KE 4P23D 3MRFB 1C16A 4JJ5B 1JHTB 2JK5B 3KXFD 2DQGH 4BZYA 3QXWA 1L7TL 3CH1A 5JMOC 1BFTA 1OTSC 4DZ8B 2CRYA 4JPVL 3LN4B 2W92A 5FYKH 1OP3H 4DKDC 2VZVA 5AD0A 2AJSH 4KXZI 4QRQB 1RUMH 5DUPL 3OL2A 1EH9A 3AXLA 4YHOL 4AL8L 4M6OH 3GSNB 4NKOA 3TFKD 4KY1L 1HH6A 1MREH 4KJQC 5D70L 3T4YA 3VXSA 3BH8B 5DWUH 4FMKA 1QEWB 3OAZH 2PR4L 1ZA6B 3MRMB 4YNYB 1HHGA 3E6FB 3WIHA 4HUUA 3VRJA 2E7LC 1BEYH 6FABH 4ZO8A 3IETB 2CDFA 5CJQH 2AV7B 1OT1A 2XOTA 4JGUA 2E7LA 2R4RH 3K2UL 5HGBA 3VGHA 1QRNB 2P1YA 4JZOB 3CFDB 5DK2B 2J6EH 1A6UH 1FH5L 1VGKB 2EIZB 2Y06L 1A7QL 3UZVB 4M6NH 3TZVD 4N0RA 4HWBL 5J11C 4FOMA 5DJ6B 1IAIM 3UAJC 4NHUA 1NUNB 2X7LA 1LP9F 3HI6H 4NBZB 5HYJB 2CH8A 2R2BB 3LB6D 3ES6B 3PHQA 2WW8A 3ZE0E 5I9QC 1O7VA 4NKDA 5EWIH 4JFZH 4Q7DA 3NA4A 4OCMC 5IW6B 3RWIA 4L4TB 1DVFD 4ZFZB 2DF3A 5A16A 4OLVL 4OFIA 5EORL 3MA9H 1W72A 2GY5A 1TQCC 4R3SA 3U4BL 4OZ4B 2P49B 4N8VA 5D2NE 2DBLH 2WK2A 4F57L 5K9JL 4LSSH 5HDQH 3SE9L 4OI9A 1FLRL 3KR3H 3BD3A 3D85A 1FG2A 3HZVB 1LE5A 5BO1H 1AGCB 3MREB 1IT9L 5DA0B 3HNTH 5ALCL 3Q6FB 1IFHL 4TNVF 1TZIB 4Z76B 1CE6A 1R3KB 1NAML 1NFKA 1NBZB 2VISA 5IB5A 1X9QA 5DJDA 2MFNA 3HLAA 3MPCA 2FBJH 3VFUA 5IB1A 2FEDC 2DMCA 4KKBC 3VXME 1DQLH 3HG1B 4J3UA 1BHGA 3K80A 4OM0H 4QHLA 4D0CB 3CIQA 5TQ2H 4AEEA 4HWUA 3OB0H 4AIZB 1BLNA 1QBLL 5EOTA 5D2NC 5DRXB 2DQDH 4LHUG 3F5WA 3BEWB 5SWZE 1I8MB 3MR9A 1NUFA 5AWNL 1RK0A 5D2NA 4HAGA 5FGBC 3O8XD 4XC1L 3E6HB 4NP4L 1A6AA 3TNMB 2EIDA 2WINB 5FGBA 5JR1H 2YEZB 3FN9A 5CP7B 3WNNA 4XCCL 1P84K 1RJLB 4GBXD 4MVBD 3LPGA 4NKMA 1MQ8A 3TBVA 1YPZF 3QI9D 3S3JA 4OD2A 5ALBL 1RY7B 5DJ8B 1YYLH 3TWCH 1D9KB 2GI7A 4HKBB 4NQTA 3RWCA 43C9A 4DFIA 3REWA 3PP4H 4U6HA 3QSKB 1MCPL 1E4XL 4TVPD 1BVKB 4GQPH 3VG0L 3NIDF 3O4LD 1RZ7H 4OV6F 1ZLWK 3KPQB 1IGJB 1MIML 5SWZA 2FIKA 5EO9A 1BFOA 3WLWC 1HN1A 5C0RH 5E99H 5EZLA 3PWNB 2QSTA 5IG7B 4ELMB 4BELD 2WWKO 3CPLB 2YSSB 3FQTA 5M94B 1WTLA 1YN6B 3DPBA 4M00A 5IVNA 4PRNA 1GCFA 4PJBB 3AB0B 3O11B 3UTQB 4XAKE 1YNLL 5ANMB 1H0DA 2XNAB 3BUTA 4FQJL 1N64H 3E3QE 4LLYA 3S37L 1DN2A 1KGCD 1BZ9B 1AXSA 4S1DD 3HHRB 1K6QH 2J6EA 5IB3A 3LPWA 5CSBA 1FJ1B 4YDIL 4M7LH 3I50L 4U3HA 3CFKB 3VCLA 4TSAH 3WSQH 5DEGA 1FQ9C 2HFFA 5EH1A 1T21B 5JMRA 2PW2A 4Z7VF 1FP5A 4JRYB 4LF3B 1MJUH 2E5EA 1LK2B 1FYTB 1KJ2H 2ZG1A 3H0TA 3BGMB 3QCVL 2MCPH 2ADJA 4K71B 3QNZA 4TUJA 4KJPD 2QSQA 1T66D 4HIHA 4NZRH 4HULB 8CGTA 5IHZB 1UM5H 1IGYA 3ARFD 43CAA 1HK6A 3E3QC 4XBPA 3SDCC 4NKIL 2C3GA 1I3UA 2IH3A 4FFWC 5DUBB 3GEWB 3SDCA 5TQ0H 3MRPB 3V5HB 4HIEB 3MSPA 4N0YH 5DC4B 4HFWA 4NN6B 1G0XA 1WK0A 4UDTB 4E41D 4A2LA 5C3TA 3FRUA 3QEGL 1EUTA 1ORQB 5DEFB 1PX3A 3B83A 4F33A 3VRIB 3U0TB 1NDGA 2R29H 4L1DA 1JHKL 1U3ZA 1MIEL 3A0OA 3C8KA 3MJ8A 4M1CD 5CHNB 3BPLC 1QRKA 3MLRL 4PG2C 3S5LG 3S35X 4HX1A 5GGRA 4Y4FC 3REVB 1A0QH 4JN1H 2UWEE 5GGSB 5IVXB 4AM0B 3RVUD 4PJCA 1KCVL 3VW3H 4Y4FA 1S9KC 2XYCA 3D0LA 3FFDA 1BQLH 5IFHL 5JOFA 1RMFL 2WAHA 1EFXA 2BVPB 1XIWB 2W9DL 1SYSB 4TTDD 4XVJH 5GZOD 2XWJB 4QWWD 1U8QA 3MV8E 4LCWE 5JIKA 3AY4C 2ARJQ 1U8MB 3FQUA 2HKHL 1DUZB 2FD6H 4P2QE 5F89B 1QSEE 4H26A 4ZS7H 2Z8RA 5FOBA 1T04A 5E1AA 1HHHB 3AY4A 4L29A 1A6VH 3AC0A 1L0YA 3O0RH 4GXUN 5E6IB 3X11B 1LO4H 1IBGH 4KGJA 1O0VA 4OGXH 2XN9B 4ZUSA 5IMMB 3HPJB 1U8HA 4XZUB 1N7MH 1WWCA 5J1TC 2VQ1B 1AKJA 2VKXA 2X1OA 3SDDB 2Z92B 4TOYL 5C08E 5J1AB 1MH5A 3TVMD 2UUDK 2UYLB 4OIIL 2FJGA 4WTZA 1NLBH 2XWBB 4ELMF 3SKOA 5JA8B 1H3XA 5CKAA 4CADB 2FCBA 4NZJA 2BC4B 3UJTH 2GTWA 2HJKA 2ZOKA 2IPUG 3O6KH 4YHZL 12E8H 4HH9A 3K4ZA 2IBBA 3O2WL 4UOW1 4HK0B 3G5VA 5LKNA 2PNDA 4FXGB 5C0BB 3MV8A 4LCWA 4U6XB 4ZD3L 2XKSA 5E03A 3BRGC 1QSEA 2DKMA 4M7JL 3O6FB 1DQML 1TNNA 3DXAB 2OL3H 4N5ED 4BQBA 4DVRH 1GHFH 3DVGB 5DEZA 5E4IA 4OD3H 1N6QH 2EXWD 4ZAKA 5DJAA 1LDPH 2EDEA 1MHHA 3CX5K 4QXUH 2HLFD 5BQ7B 5C08A 1IILE 3S36X 1NC4D 1VFMA 1UCBL 2R2EA 3DSFL 3SO5A 4ALAL 4G80B 3UDWA 4DN3L 1AGFB 4ISVA 1EX0A 4O00A 4W4OA 4KKLC 3DTXB 5IQ9A 1CDCA 3LRSA 3HC4L 3U79A 1I1YA 1E4JA 1NAMA 5F6HI 5EU5B 5FXCH 1K4CA 2DD8L 3ZT7A 1HHJA 1KJ2A 5DJYA 1QFWH 3DX9A 2CKBH 2AXGA 4LVHC 3SDXE 4NPYB 3EYQD 4U0QB 3SCMC 5L0QC 1MCDA 3N85H 3HC3H 3O3BB 4XCEB 2CGRL 1MHPL 3TH4T 1O7SA 4HT1L 5TDOB 1UWEL 5JXED 1I7ZB 5D4QA 3WIFB 3SCMA 1UXWB 4LKXA 3WD5H 4D9RD 1S7QA 5EB9A 4MNGB 5I17A 3PWUA 1X4ZA 1CF8H 2DL9A 1TCRA 4QHUA 3Q1SH 2PXYD 3GSVA 3BXNB 3ARBD 1WISA 3QCTL 4K3JH 1I9IH 4JJHA 1EZVY 3DX6B 1TTGA 2CLRB 3S88H 5DD6A 1AXTH 1UYWH 5INDA 1I7TA 1HILA 4LQFH 3MUGB 4Z7WF 1P6FA 4N5UA 4KXZH 1MWAB 4S0SD 4LFHD 3HS0A 1TFHA 2OYPA 4I0PD 3TM6A 1E0OB 1FE8L 1W0VB 1OGAB 3D9AL 2YD4A 2F74B 4XPFL 4JFXB 4XWOC 3I2CL 2P5EE 3DI3B 1GC1L 4FQXC 1EK3A 1RZGA 5HI3D 4N0UE 3Q5YA 2ICWJ 2IBZY 2EECA 1JGLH 2BVEA 2XZQL 2Q76A 4FQXA 5B8CB 1BX2B 5DSCB 3WIIH 5GSRA 3U46A 4APQB 3J8F7 3P77A 1K3ZA 3BT2H 2DDQL 4P3CH 3MJ7A 2XZAH 3FFCE 2O5YH 3VI3F 1HQ4A 2XA3A 5GGQL 4JFPA 3BP4B 3BDXA 4XP5H 5EUOE 4OZHB 4QRRB 1A64A 5ESVA 3ARDC 2MNUA 5LGHL 2BVTA 3EOBB 5D1XB 1RD6A 2HT4D 2XWTB 4QHMB 1T0MA 1BD2E 3ARDA 5BRZD 2NY1B 5F8QC 1XCTA 3QP3A 2IPKB 3IT8D 1AY1H 4XNMA 5I8OL 4W6XB 4BM7A 5HVGB 3BKCL 3FO0H 4OFKA 5CBAA 4G43A 5GJTL 4JAMA 1NEZB 5GRVK 3S35L 5MENB 3VD9A 4R0LB 1JP5A 5IVZB 2VLRB 3PWLB 1N4XH 3C6LC 3PL6C 4J3WA 3OKEB 4X4XB 5D96C 5GRWA 2AJ3A 4TUOA 5L7XL 4KDTC 1YMHA 3IXAA 4HUMB 2H8PA 3C6LA 3BUYA 5FB8B 3PL6A 3ZKSD 4OQ1A 2JJTC 4KZDL 1M7XA 1OTSD 4KDTA 3TT1L 1LK3H 4PBXA 4ZS6C 5CUSL 1CFNB 5DTFB 5B39G 3QJFA 3DIFA 4OLEA 5IHBA 2ICWI 4FTVA 1MY5A 3OXRA 4PJGB 2JJTA 3GSRB 2YPLB 3O9WC 5EUOA 2IEPA 2FH6A 2VLLA 4HBQA 5C0CE 3VGFA 2OL3A 4FA8A 5CJ8A 3FHAA 4LSTL 3TH3T 1ZTXL 3SKUD 4XCNA 4JFYB 2ESVB 3O9WA 2NY5H 3VXSD 4GO6B 1BD2A 3IDGB 1IGML 3NA9L 2IQAB 4JLRA 4YDKH 5EFIB 1J0JA 4KJQD 3UC0H 4YHML 3ILPB 1T5XA 2BOBA 4NQDA 5C0GB 1JK8B 3G6DH 4MCYA 3T0BA 2OTUA 4OZIB 4UDUA 2VZ1A 4FZEH 4X9HA 4Q6IB 1S7VA 4P2OC 1JRHL 5L2KD 2NXZC 5BOZG 4KJWC 4ZFOA 1MUJB 2NY0B 4P9ML 5CCKH 1PLGL 1CDHA 5IM7B 4U1SA 4P2OA 4UINL 4Z0XA 1N59A 5HHPB 5DMIL 1BM3H 3FT2B 5GSVB 3KWWB 4DGIH 3ZE2F 4PJAA 1CLZL 4GAYB 1ND0A 2O5ZH 3F12A 3VXUB 3UAJD 2ARJA 1ODAA 5BOPA 1GOGA 2FHBA 1WWWX 3WFCL 1IAIH 2F5AL 2ADIA 1Q9WB 2ZNXA 4XAWL 1LVEA 2G5BB 2VLKB 5CD3A 2VWEE 2DQUL 4MA1C 4XB8A 2XT1B 4BKLA 1MAMH 3D85D 2FB4H 5J4MA 1GOHA 3LV3A 4XTRC 4JFQB 4XT1C 4X4ZA 5F1IA 1GL4B 3V7AE 4ZUTA 2YK1L 3S36L 2NLJB 3KG5A 3HE6C 3HC0B 1PFCA 2ZJSL 3PP3H 1FV1A 3EJYC 3QDGE 4PJXB 1H3PH 4PJ5E 1QFPA 2IC2A 4R90H 4X6FB 3SDYL 2DLFH 3GSOB 2ZPKH 3BPCB 3GHBL 3HE6A 4NNPL 3S6CA 4J2XA 5E8NB 1OAQL 2ZUQC 4ZPVA 5FO9A 3OG4B 4X5WA 4R26L 4IMLA 1UM6H 3MLUH 2Q86B 3MRIB 1JZ5A 1S7RB 1X4XA 2FEDD 5FFLA 1TJHL 2R1WA 5BV7B 4KKBD 4Z7OF 2D03H 2VWEC 5I8EA 5H35A 2C5DC 2WANA 1Z5LA 2EDJA 4KUZH 1QSZA 4OZHF 1HH9B 5IROA 5IV2B 2UVEA 4HIXH 2C3HA 3O2VL 3H7BB 2AV1B 3RWDB 1C5BH 1A22B 2YZ1A 5CGYC 3GIZH 3P9MB 2O5XL 2ZSWA 5E8EA 3C8DA 3QXUA 4ODHH 3MNWA 1B0RB 3QDAA 3FQNB 3FQWB 1MFNA 2MKLC 3QDGA 3RUGA 3M07A 3OHXA 1QBAA 1H5BB 2OQJA 4ZXBB 3MRLB 4D9LL 3RFZC 1QSVA 3IJYB 3VD5A 3QPXL 3C6SB 3Q48A 3FO2A 3SKMA 4RGNB 4MB5A 3VXMD 2FBOJ 4OAWB 2ED7A 1S9XB 4QRUB 2ZNWA 4YBQD 3QQ4A 3DX8A 1TQBC 2OP4H 4U1GB 2ZUYA 4LCYA 4N0CC 5SWZD 1R3IL 1HXYA 1KNOB 3B9EA 5EPMA 3AS0A 3G6JB 1XR9B 3RJQB 3NGBC 1KB5L 3LS5L 2GJ6A 2B0SL 1YEEH 2F8VA 3WLWD 3BN9D 4I8DA 1UWGL 1S9WA 2NY5C 5GRUH 4JO2L 1RK1A 3L3JB 5D7SH 1TETL 1S7XB 1A6WL 4QCIB 3QWRD 1M6OB 2FX7H 2AXFA 2FWOB 2HJLA 4D2NA 1BECA 2DWEA 2AGJL 4JFDA 3Q3GA 1CGVA 1SJEA 3P30L 4YFLF 1N5AA 2J2ZA 5FA3B 3LH2L 4Y16B 4KKCC 5IOPA 4NQVA 3OPZL 4LCUA 1RULH 3GB7B 1HHKA 1G6VK 4AENA 1T1ZA 1CFTA 4L4VE 1OLZA 2XQBL 3B4NA 3S9DB 1YNKL 3RA7H 5BCAA 4HCRL 4JO3L 4FFZH 4MYWB 2DIJA 2P44B 4MXWL 3QUMB 3S96A 4LL9A 1MEXL 4NQXB 5BXFA 2IMMA 4U2YA 2DI8A 4ERSL 5CJXA 5JHDE 4XCFL 2LE9A 5GZND 1WAAE 3KYOA 4O9HL 1NSNL 4ZO6A 2JKXA 4WU7B 1V3KA 2RFXA 3WJLC 2YA0A 3IFNL 4GUPB 1INQA 3B9KD 4XAKD 1KIRA 4U1JA 2HA1A 1EDQA 3WJLA 3CUPB 1U9KA 3LKSB 4C55A 3BZEA 2VAJA 4WUUB 5DMJB 5F7LB 1LDSA 5JW5B 4X8JA 1JUFA 3RWJB 3P0YH 3SDCD 3U4EB 3NH7L 4KRPC 1G84A 2XY1A 2V2TB 4NNYA 3W5NA 3I6KA 4Q9RH 4PB0L 4FFWD 2MQ0A 4P5TC 2Q8BL 4L4VA 4O58H 4XC3H 4YIQA 1FNSL 1S9VB 2V5SA 2V5YA 1G7LB 4JZNA 3GMQB 4OZFH 1EXUB 4LHUB 3H2WA 3EYOB 3AGVA 1JNJA 4P5TA 4HWEH 2VDRL 5EBLA 1U91A 5F7YC 2D7TL 3T04D 3QHTC 3L5JA 1CVRA 2YN3A 2NXYB 2GIYA 1KN4H 3ARVA 5IHUH 1NH6A 4PV9A 5JHDA 5TJWK 1EVTC 3JV0A 2P24B 4S1SH 3L3HB 3DUHA 5CINL 1RUPL 1AD0A 1S3KH 1RUQL 3IVKB 3GO1H 4XMLL 4HKZA 5TF1L 2LV4A 3UTZB 3G9VA 1KEMH 4EBQH 3QRGH 3N06B 1QSFB 1P4LB 5AAMA 2I60H 3QH3B 4NM8H 3P4MB 5FUOL 5F1OB 4YR6B 1LO3L 4I3GA 1NFIB 4XP1L 3BKJL 4X7SH 1NJ9B 5EO0A 4AEHH 2IFGA 5KSBE 3HUJB 4WVRA 2QEJA 15C8H 2F53B 4XVSH 1AKJD 2OJEA 4RISH 4YBLC 5KSUB 1HSBA 4YEFA 5FHAL 4TNWF 3SDAC 5CEYA 4JG0L 5DQ9A 3ZTJG 1MCJA 1T22B 4RA3A 5KSAC 4NC0B 4Q0XH 4DUXA 2W0FB 1YUHB 2X4OA 3L5HA 3FB5A 5F7DA 1Y6NR 3SDAA 1SHMA 1TNMA 4PJFF 4P23B 3ARYA 5KSAA 5L2JA 1T2QL 3MRBB 3KXFB 2RJMA 5JQ6L 2ZOLB 1OQXA 2EYRB 3MV8D 4LCWD 5K9KB 3DVNB 4XH2A 3KYNA 1UJ3B 5KW9H 4U31A 3MLYH 4P2QD 1I85A 1QSED 4OD1L 2V7NA 4AJ0A 4JM2F 2HFEB 3DUUA 3FAWA 3LDBC 4QXWA 2VR9A 5HI4C 1J12A 2B5IB 1DBBL 4Y5VB 3PJSA 4HC1H 2JB5H 5KSBA 1JFQL 1HSAB 4GXUM 1JZ7A 3LIZH 3W0WA 4X7DC 2XQYK 4OGYL 2K9UA 5DVNA 5I74C 2FYYA 5C08D 5LXGH 5JORB 3GBNH 3MLWH 4C4KT 5I6XB 3NCBB 4ZUUA 2FLBT 3I6GA 1JF6A 2BSSB 1CFQB 1RIVH 1J5OH 1QLEH 5HD8D 5B4MC 1D6EB 4XP4L 3HB3C 4CN6A 1PGRB 2E6PA 4URTB 3LQZB 2E9BA 4UT7H 3C2AH 1I1AC 3I85A 1UZ8A 2DQCH 3CFBB 3TZVB 1G0YR 1RJZB 3IDMB 2BY1A 2CDEB 4NO0B 4QXGH 4XGZA 1FORH 4PRDA 1I1AA 4JY5L 4L9DA 1G9ML 4UIMA 2XRAL 1IM9A 2C1PA 4LU5L 4LBEB 4KK9C 4P59H 3GSNL 3RVTC 4QOKD 1BZ7A 4QHNB 2EYSA 3V6OC 5MHSE 4YGVB 5T5NF 3MV9E 1KB9J 5CZKA 3H9HB 1XGUB 4GKOA 2AEIT 1MFBL 3V6OA 1ZVYA 3QO1A 1FVDA 1F4YL 4EUPG 3KNBA 4HIJB 2JELH 3MRRA 2F58L 3KLSA 2AJYH 3S5LB 1NGXB 4WI6A 3FOLB 4MXVF 3CC5A 4LARL 4OT1L 2DYPD 4C54A 1I8KA 3H8NA 3GI9H 4RQQB 1T7XA 5ILTL 4YPGA 1G1YA 4W81A 4DEPB 1OAXH 5F3BB 1S7SA 2V7HA 4P46C 4F7TA 1WEJH 5SV4A 4QRSB 2OJZH 2WIMA 2XFXB 3BJ91 3X3FL 1U8IA 4P46A 3V0WH 5ADPH 3O6LH 3MRCB 3MJ6A 4FQXD 3WUZA 2GCYA 2CXGA 1J8HE 3IYLW 4NT6B 1XGPB 1AHWC 4Z7NF 3ARQA 4Q58C 1N0LA 1MJ8L 1FPTL 3MV9A 3QCUL 1AHWA 1H15A 5DD1L 1F3RB 4G8IB 2VN7A 2HH0H 2FDBP 3G04B 1ES0A 3NCYP 1IC4L 4PB9H 3HUJF 5IHLB 3BVNA 3O8XB 3TT3L 4RBPH 4MMXC 3KPNB 3ARDD 4LCCC 2Z91A 5T3ZE 1M4KA 3PABB 4X4ME 4JRXA 4I2XA 4FFYL 3H9SE 4GBXB 4RRPA 4LCCA 2P5ED 4EVNB 3QI9B 5TE6H 3DRQB 1CICC 1VFBB 4YXKL 3MLPA 1DDHA 4L8DA 4Z9KB 5HYSB 1CICA 2H32H 1WBZA 2C4FT 5CLTA 4CVUA 3ZDZF 3NPSB 4NO5B 3C6LD 4P5MB 5CMAB 5IW1A 3NFNB 4PJEF 1MPAL 5EU6A 4KZEH 1G9NL 1LEGB 2WM0A 3O4LB 4IRJC 1HIMH 3FFCD 4JO4H 3UJJL 4IOIA 2Q6WB 4J3TA 3VD3A 4JO1L 5DHYA 1IEHA 3QEQE 3P9LA 3PWVB 4L9LB 4O4YH 3GMRB 4ZS6D 4KDVA 2DQHH 4WHYG 1EEYB 4O2FB 5LJYH 5IVOA 1H3VA 2GSIA 1BD2D 4HC1A 4ZSOE 5ABDE 4NUJB 3T1FA 4HS8L 3SQBA 3OAYH 4P4RB 5FUZH 4POYA 4X4MA 1R5VA 5I73B 3PGFL 3LRGA 4GQ9L 4X7TA 4B7LA 2W9EH 3CVHH 1NANH 2VXSH 4I4WB 4UAOC 4YUEH 1EUUA 2BZDA 2MQCA 3BPOB 2VL4A 5K59E 4NOBA 3FO1A 2ERJB 4P2OD 5E6ZA 2CRIA 2NXZD 3BIBX 4KJWD 5IFJB 3FN0H 3CMGA 4AH2B 1K4DA 1I8IB 2JCCE 2GQHA 1T0NB 3CCHB 4JG1L 5IB4A 4XMKH 5F1NB 5HHME 1SMOA 3NZHL 1U8LB 4Y5XB 3SQOL 3D87B 5JNYA 3IU3A 3L3DA 4B41A 5C0CD 2IG2H 5F7UA 1YEDB 4IJ3C 2GK2A 1KIPA 3QO0B 5KS9F 3GMOA 2BK8A 5DFWH 2H1PH 2NTFA 2V5MA 3NCJL 4ZSOA 3G5ZB 5FDYA 3K8KA 1KFAH 2ICEA 3JWDL 2DTML 3PQYB 2GJJA 4TRPH 5HJ3A 1Z2KA 4XTRD 5TDPA 2I26N 3VFMA 4KTYA 4P57B 2Y23A 1V05A 1V3MA 3OJMB 3DGCR 2BHYA 1U42A 3QUXC 1PDKA 4GAJL 2ICWA 4NUGL 3EJYD 3TN0D 4Q9CA 3TJEL 3JV5A 2OXHA 3WHXA 3QUXA 1U8OB 2JCCA 4E41B 5IJKC 4BH7A 1F8TL 3GIVB 5B38A 5GPRA 5F9OH 4GRWB 3BGFB 2PYFB 4DW2H 1SJHA 5HGDB 4X6DE 1J0YA 5CEXB 5IJKA 1T7YA 4TSCL 2W0PA 4M5YH 1KIQB 4IBLT 1LNUA 1UENA 4DVBB 4LPYA 4G6FD 25C8L 1NAKL 5JPNB 1NLDL 3MRJA 3FZUC 2VXUL 3ELAT 1UCTA 2VXVH 4OZGB 1KYOJ 1T2XA 4W6YB 1B3JA 2BVOA 5DR5L 1I3RA 1UA6L 1BQHB 4KMTL 5CGYD 2FEEL 5DUPH 2Y36H 4PPTA 1J1OL 1RZ8B 3QDGD 4YHOH 4AL8H 4PJ5D 4BK4A 1F3JA 2CPCA 5EU4B 3KLHC 3PV6B 4KY1H 5GHWL 1ZHNB 3VFTB 3EOAB 4HWNA 4PTTA 2A6KA 4UOJA 4MA8L 5ETUB 3GHEL 3GRWH 5H94A 2F19H 1QLRB 5FCUL 3VJ6A 3DURB 1NUGA 3ETBF 1H8OA 3KPLA 1U0QA 2H32A 5MEPB 3WDHA 4X6DA 1FL3A 2JB6B 4Z7UE 4EI6B 4I3SH 3UYRL 3U7YL 4RAHA 3QFDA 3LZFL 3ZHLA 4LSRH 3IS0X 1Z6JT 4BH8A 1FH5H 3U0WL 3BD4A 3L3IB 1N6UA 5DJ0A 4EDWL 2EH8L 5ENWB 4NFCA 3MRFA 2I9LB 4JJ5A 4N0CD 1JHTA 2JK5A 1WC7B 4JB9L 4MA3B 5C8JB 4Z95L 4LDEB 4PRBB 1WFTA 3HFMH 3QQ3B 4DZ8A 2X4QB 3CLFH 3LN4A 2DL2A 3PP3K 2BXYA 4NQCE 4KU1A 4QRQA 5HYJE 4KVNL 5FKPB 1EMTH 4Q6YA 2FGWL 4H1LH 3WDIA 1QQDB 4U1LA 5CILH 5IFAL 2W07A 1T5WB 4F57H 3AMKA 3CVHA 3GSNA 3QNXA 5K9JH 4GG6E 3MBED 1GPOH 1JPGB 4A6YB 2P43B 3F7YB 4NFDA 1UM4H 4KKCD 3UCRA 3BH8A 5HYQB 1XF5B 4UT6H 4W6WB 3IFOB 3E6FA 5J06A 1IFHH 2D0FA 2DAVA 1FFNB 1IQDA 4MNQE 4QTIL 3IETA 2AV7A 4N90E 2HVJB 1CT8B 5ISZE 2UZIL 1UB5B 2AXHA 1QRNA 4JZOA 3CFDA 4HG4K 5IMLB 1VGKA 2EIZA 3LN5B 2J8UE 1ACZA 3BH9B 3AU1B 3P11L 1G0DA 4C4KO 4ZPTB 3KPRE 3V2AR 1Q72L 5HYJA 2E27H 3KPSE 1QBLH 3RKDC 3TCXA 2R2BA 3HG1E 3ES6A 3BPNB 4BQ9A 5GJSL 3FB7A 5AWNH 5DDHB 5A3IC 4ZFZA 2CK0H 4Z7QF 3ESVF 2ILLA 1D6VH 3FO9B 1X5XA 1A6ZB 4L4VD 2DMKA 1FGVL 4KRPD 1AQKL 4WEUD 3ARBB 2PETA 4XCYB 5CIPB 1AGCA 1JF5A 5E8PB 4F15B 2YMXL 1UH3A 3BHBB 3Q6FA 5ALBH 3PGCB 1AGEB 5ISZA 5HHVL 4Z76A 3MFFB 3RWHB 4I0PB 5JHDD 1NBZA 3D0VB 1EBPA 2ZKHH 4M8QB 1B0WA 3DI2B 5IEHB 1MCPH 3H42H 4UU9A 3NIFF 2NY7L 5I1AB 1R0AH 3HG1A 2VITB 3M8OH 3RWFB 5CBEB 4LHQB 3DLQR 4AIZA 2ARWA 5C2BH 2F9BT 5DRXA 4XP9L 1D5ZB 3D69A 1SEQL 3BEWA 4PJDF 1I8MA 4MB3A 3UMTA 4X0KA 1NBQA 4OLWL 4FQIH 1PKQB 2XZCL 1WBYB 4NYLB 3E6HA 1JYXA 1FFOA 3TNMA 4OF5A 2WINA 4X80H 4PR5B 2CMRH 3LEYL 2YEZA 3GRWA 5CP7A 1C5DB 1RJLA 3WO3B 2VOTA 1YNLH 4IIQB 4KMQA 4JN2B 4PJBE 3A6CL 4K94H 5BRZB 2WP3T 1JNLL 3VXNB 2VDOL 1CU4L 2FL5B 3S37H 5DJ8A 5ANME 3BN3B 3CGTA 3PG2A 1ZANH 3IS1X 1D9KA 1F4XL 4HKBA 1DQTA 4YHNA 3SDAD 4YHKH 1I3GL 4YDIH 4LRNL 5F6IB 5KSAD 3L5WB 1G7IB 3T2NH 4K8RC 3UBXB 2DB8A 5D5MB 5TPWH 1D5BB 1AH1A 1CIUA 4Y4KD 5GGVY 3NPZB 3HNVL 3KPQA 5GS3A 2BVQB 5D71L 4ETYA 3QCVH 4WY7L 2VSCA 3O3DB 3VXRB 4H1LA 2Z4QA 5IG7A 4S1QH 4DK3A 3CPLA 2YSSA 4JQXC 1YN6A 3AB0C 5HI4D 1RZKL 4K3DL 4OFVA 4AEIL 1IC7H 1X3DA 5JA9A 3OR6B 4OLZH 4JQXA 1QR4A 4PJBA 1P7KB 1F11A 1GH7A 2XTLA 2N7AA 1CLOL 4LPTA 2VXTH 4OIAA 5ANMA 4HUUB 2I5YH 2APBA 2XNAA 5F9AC 3T2PA 1CD1B 2ITCB 3BZ4B 1ETZA 4LCIH 5HGBB 5L2KB 1BZ9A 3QEGH 4XVTH 5J57B 1E6OL 5B4MD 3HB3D 1FJ1A 3WO4C 1E28A 1S9YB 3WKMH 4HUVB 1PYWB 1I1AD 3L5XH 2X40A 3CFKA 1MCBA 4XNYH 1IM9D 1DANU 5A43C 1INDH 2EE3A 1MFEL 4LF3A 3WMSA 3JWOH 5D9SA 4YHLH 1FYTA 3P3YA 1CR9L 3BGMA 4KK9D 3RVTD 5I9QB 1KUMA 3C8HA 5IVXE 4F3FB 5T1KB 4R3SB 5DFVC 1WCQA 1TLKA 4N8VB 2W9DH 2F8XC 1P2CA 2WUCL 4DKEH 1JPST 2J4WL 3I6LE 4G6ML 1ZLSH 3D85B 1FG2B 5E2TH 5C0AB 1PZUB 4CL7A 5ITBH 5F70A 4NN6C 4G7VH 5DUBA 5ESAB 1PVHA 4H0GA 4LP4A 1CE6B 2X10A 3F7RA 3MRPA 2DI9A 4HIEA 4YWGL 1UQSB 2DQJL 3V4PL 3T0XA 2DJUA 3V4UL 5F7EH 5E2VL 3HLAB 4V2BA 2OZ4A 2XN9E 1U6AL 1ORQA 4PJ7F 5DEFA 3BP5A 3L9RA 3EAKA 3CLEH 4OIIH 3U0TA 1A2YB 4W70A 3KPOA 1RZJH 4QHLB 1AC0A 5CHNA 3QXDB 2EC8A 3JSSA 3RDTC 3VFGL 5MHSD 4RWYH 4JFFE 2OK0L 3MV9D 3REVA 3KGRA 3CAFA 3TYFB 5IVXA 4AM0A 3RDTA 4KQ4L 3ULVH 3OZ9L 1XIWC 5D2NB 1S7WB 5E5UB 4QRTB 4Q9QL 1WCBA 2BVPA 1XIWA 4QYOB 1SYSA 5C0BE 2P8MA 3C9NB 4K94C 4U1MB 4LOUC 4DUVA 3B5TA 1DUZA 2X1QA 5F89A 2YWYA 4LLUB 2EDOA 5E6IC 1HHHA 3GK8L 4P99A 4NKQB 4AIOA 4V2CB 3U1SL 1BFVL 4GW4B 1F58H 2DQEH 5E6IA 3X11A 1KXQE 1KPRB 2XN9A 1CICD 1UACH 5IMMA 4Y2OA 3HPJA 4XZUA 43C9B 2Y07H 5HHOE 1FNEB 1UCBH 3DSFH 4ALAH 2VQ1A 1J8HD 3VXMB 5C0IA 5CAYB 2ZUSA 4KHTL 2UYLA 1T7VA 2XWBA 5HDBE 4BUGA 4P5KB 2E7MA 5HYIA 3MRKB 1CDJA 5CEZL 4CADA 2BC4A 1KBGH 4IRJD 5GRJL 5EZLB 4LLQB 2D4FA 1NCCL 1I1FB 1KEGH 3LAFA 1KC5H 5GRXG 4FXGA 5C0BA 2DI7A 3O6FC 4U6XA 5DD5H 2X70B 5C07E 3L3OB 3H9SD 2VC2L 1OSPH 3O6FA 3CXDL 3DXAA 1NBYA 3DVGA 3MQIA 3R06B 3EFDL 1HDMB 2ZWLT 5KVFL 3CMOH 3MLZH 1YJDH 2FX9L 4LSPH 2BMKA 5AZ2L 4PY8I 1TJIL 5E1HB 4PGBB 2KDGA 3ABZA 5BQ7A 1V7MH 1QO3B 2HKFH 1AGFA 4RWHA 1JPSL 1ITBB 1FE8H 4MJ2A 3DTXA 3EJJX 3I2CH 5KN5B 3QEQD 3EGSA 1RFDH 3JWOC 2ZCKL 1OGAE 2ED8A 1QD0A 4RBPK 5DRWA 1JCKA 1NCAL 5FV1L 2AABH 1HHIB 5CZXC 1OT2A 3TV3L 4NPYA 2ADJB 4KTEH 3RBSA 2WBKA 4P2RE 4F8TA 3ULVE 5C07A 3TF7C 1L7IL 3O3BA 4XCEA 1IGTB 4OLUL 1I7ZA 1UT9A 3WIFA 1BGXL 3NFSL 4POZC 3KPMA 3MODH 3B9KB 2V6HA 3CZJA 2CUIA 1P7HL 4MNGA 5GISL 2VXQH 3ZHKA 3LKQB 5LGHH 3SDCB 2OSLB 4UV4L 5KJRH 2E7HA 3MV11 1KN2H 4XI5C 4QRRE 3VH8G 4MD5B 5C86A 2Y5TB 2CLRA 4TUKH 3QUXD 1II4E 2NY2C 1AGDA 3FRUB 4FQHB 4ODUB 5HHMD 3ZE0F 4CNIB 3MUGA 3EO9H 2EH7H 3O45A 4LSUH 5TE7H 1RZJC 3VXOB 3ULSB 1MWAA 5J1SC 5GJTH 2FJFA 1OGAA 5DYOA 5BS0B 3UTTB 4JFXA 1UGNA 3DUSB 5MENE 3ULVC 4MA7L 3R8QA 3PWPB 2RHEA 2VLRE 2YA2A 1P4IL 4WW2C 4APQC 4J23A 2JIXB 5B8CA 1XAUA 1XGQB 1BX2A 4KZDH 5DSCA 1J1PH 1CK0L 5ID0B 4APQA 5CUSH 3KYKL 5E94B 1ACYH 4M5ZL 1WITA 4BQ6A 2OBGA 4FQPA 1B90A 2CQVA 2AJVL 4JVWA 5GGTA 4PJGE 3MO1B 5FOBB 1T04B 2L4OA 2YPLE 3BP4A 4QRRA 1RU9H 5DO2C 2V2WA 3HMWH 2CJUH 3KLHD 5DXWA 3NA9H 3ZYZA 2NY1C 3EOBA 2EKSB 2XWTA 1JMZA 4ZUSB 5I1EL 1OVZA 1U8KA 5F7MC 1KJMB 4NSKA 5KZCD 2ADFH 4R0LC 4ELKA 2G5RA 4OZIE 2H26B 1A21A 4WDIA 1NEZA 5MENA 1PLGH 4UINH 1FNHA 2UWEB 4R0LA 4YPJA 5IVZA 2VLRA 3PWLA 5DMIH 5DGRA 1PAMA 4O2EB 4OQTL 3OKEA 4X4XA 2ZOKB 5M95B 3T0VA 2H45A 2APVA 3F8UB 3K1KC 5AZEH 1A7OL 2MPAL 4GSDH 5FB8A 4OV5B 2XA8H 3G5VB 4N9GB 2IH1A 3ZKMD 3G5XB 4R7NB 1CFNA 1I7RA 5DTFA 4UV7H 3VXUE 3ZMRA 3JTTA 2XY2A 4PJGA 1OAYL 4P2QB 3GSRA 2YPLA 3MNZA 1BAFL 5IKCB 4WENB 1YJDC 4E9LA 1DSFL 2YRZA 5TDNA 4JFYA 1YQ2A 2ESVA 4Z78B 5C7XH 2WBWB 1ZMYA 5FYLH 3IDGA 2IQAA 2YK1H 2G75B 3D5OF 3N1QC 3PF2A 5EFIA 4P3DB 3BRDA 3ILPA 2R8SL 2ZJSH 1JK8A 2E3VA 5C08B 1L9NA 4ZMAT 4OZIA 4LLAA 4Q6IA 3GHBH 4LEOB 2YD7A 4GRLB 2M8XA 1OAQH 3A67H 3I3DA 1PG7X 5IQ9B 4Y89A 1MUJA 3ZZ1A 3ORJA 1MVUB 4HBCL 4D3CH 5TFSH 4W4NA 5IM7A 1N26A 1X7QB 5HHPA 3FT2A 3WFDH 1U58B 1K4CB 4NQCD 1TJHH 5DJYB 4GAYA 5HYJD 3DX9B 3OKOB 2BERA 2R56H 3VXUA 2BNQE 4OTXL 1KACB 1Z9SA 2PCPB 5FYJH 1FC1A 3RKDD 1F4WH 1REIA 3WKNA 3W2DL 2BSED 4PJIE 1Q9WA 4QOKB 2NMSA 3MOBH 2G5BA 1S7QB 2VLKA 3QPQC 1F02I 1P4BL 5A3ID 5I17B 3CFCL 4PD4J 4JFQA 1MRFH 2ZCLL 4MNQD 3QJHA 4M7ZC 3MBXH 5DD6B 2EDWA 4N90D 2YKLH 5E6YA 35C8H 1HILB 5ISZD 3HC0A 5FCSH 4YBHA 5D1ZC 2NY3C 3UJIH 2DYPB 4F8QA 4PJXA 3QPXH 3X3GL 2D0HA 2NW2B 4X6FA 2COQA 3BPCA 3GSOA 2WNGA 1RJYA 1RUAH 5EZIL 1PW3A 1FSKB 5E8NA 3DO7A 1E4WH 2YD5A 4PJCF 5D1ZA 3OAUH 1JIBA 1KLUB 3GGWB 3NACL 3MV01 4DFHA 3BRFA 2OM5A 4RGNE 1GAFL 5MI0B 3KPRD 3KPSD 5BV7C 3SDXB 1FL5B 1KV3A 1QNZL 3MRIA 3HG1D 5IIEB 4KVCL 3WHE0 3U0PA 1NGPL 2BNQA 4ZFGL 3LQAH 4FQXB 4RMQA 1JWSB 2X44D 3F62A 1V8HA 2H9GB 5L6YH 3DMMB 3LS5H 2ID5A 3HMXH 4YZFE 4BUHA 2Z93B 1HH9A 1INEH 5C0JA 3MJ7B 5IV2A 3H7BA 2AV1A 5IT2H 4JO2H 3RAJL 4KTDH 5DVLA 1TETH 3CX5J 1F3DJ 2WUBL 4FQ1H 5EOCJ 5DD0L 5EZOH 5A2LH 4WFEE 4XBEL 4F7EB 3O2DH 5E08L 1H5BC 4ZXBC 2AGJH 5E56A 3FQNA 3FQWA 2M1KA 2BX5A 3ARDB 5FYLE 3FONB 1IEAB 1IKFL 1H5BA 4ZXBA 4RGNC 5ADOL 3MRLA 3K74B 3IJYA 2P5EB 4X6CE 1CGYA 2F54E 2XQBH 1ZT4B 1NCDL 1YNKH 4RAUB 4N0UB 4U1GC 2E6QA 4N8PA 3V5KB 1S9XA 1JTOA 4TUOB 4HKJA 1A3QA 4MXWH 1LO0L 3IKCA 4NQEB 4LVNB 1MEXH 1JBJA 4MD0B 4ETQB 1KNOA 3G6JA 3IF1B 4GMSL 3FFCB 1BJMA 4FS0A 2YS4A 3OXRB 4DN4L 5E2UH 1QYGH 5D8JH 2DQIL 5F71A 4XPAL 5FYJE 3V0VB 1IE5A 5EUOB 2VLLB 3B2VL 3FB8B 2OL3B 3QQ9C 5LCVL 3L3JA 2V9TA 4KPHL 4XCNB 2HFGH 3VRLE 4Z0BH 1S7XA 1BD2B 1PX4A 4QCIA 1U2CA 3BE1H 4Y16C 1OY3B 1A7NH 2BOBB 3NH7H 1PBYA 2OTUB 5FA3A 1B6DA 4UDUB 4Y16A 4X6CA 3FN3A 1F6AB 1FNSH 2F54A 4MGXA 3GB7A 2ENYA 2DMBA 1A1MB 3IDXL 1ZHLA 1Q0YH 1FIGH 2D7TH 1OAKH 4TVPL 5L9DL 1AO7B 5CD5C 1DFBH 1F4AA 4XMPL 5KTEH 3Q6GH 1KCUH 4BZ1L 1GZQB 4PJHE 2CKBB 3T65B 2W60B 3QUMA 4MHHG 4JHAL 2VDNH 4WCYL 4NQXA 2APWA 3ROOB 3MUHL 3H3PL 5C0CB 3CH8A 1HKLH 5I1DB 4Z6AT 3VGBA 5F7NC 4ZDHA 3I75B 2RR3A 4I18B 4BKLB 4GUPA 4HJJH 2AW2A 5TH2A 2YUZA 3MZTA 2Q8AH 4KUCF 4MA1B 4XNUH 3CUPA 3LKSA 1E6JL 1XH3B 3DRTB 5FUOH 1LEIB 3Q5TA 5CS7A 5JW5A 1YEIL 3RWJA 4HH8A 4LLVB 3U4EA 3LMJH 4XP1H 3UBXI 1FV1B 1A3LH 5I0DA 3BKJH 1PG7L 4KHXL 2BVUA 5I1JH 3IKKA 4K2UL 1O5DT 3RGHA 3GMQA 1SVCP 3TN0B 5H8DA 3WV0A 2NXYC 4NCC2 5FO9B 4LHUA 3EYOA 3LQAC 2ZUQB 4JPIB 3K2MC 2F53E 2XKUA 3IU4L 5FHAH 2BSTA 2QQKH 2R1WB 4HS3B 3TYGH 4CMMA 2QHRH 5DT1L 5CGTA 5I8KL 2P24A 5BVPH 3MRQB 1Z5LB 3RDTD 1T2QH 1OB1B 2YUXA 1YC7A 3L3HA 5JQ6H 1HEZB 4L4JA 1J86A 3I6LD 3VG9C 1MFCH 2AJXL 1AQDB 5GGVH 5BMFL 3IVKA 1XIWD 1H8NA 5E0QA 2IFFH 4Z18A 1EEQA 3FB6B 1QSFA 3QULB 3O2DA 3IDJB 1P4LA 2YPKB 4BZ2L 3QDGB 4YQXL 3QH3A 4LOUD 4PJ5B 2J7LA 1VPOL 4Y19E 4YR6A 3C60C 1KCLA 4K9EL 4O5LL 4I0CC 5DMGC 5E6ID 4BFBD 2Q3AA 1NFIA 1CLYL 3WFBL 5DZNA 2LVEA 2XN9D 1KB9K 2BNUB 1F00I 3WE6B 3F58L 1PKOA 3GMLB 1VENA 5FKAB 4UTAH 1CIDA 4NDMB 1IGIL 2F53A 5KSUA 2UY6A 3DX8B 4ORZC 4JFFD 4KGLA 3MNVB 1T22A 4P23C 1MLCB 5DQJB 5EUOF 5EPMB 4F37F 2W0FA 1YUHA 4ZODA 1B2WH 4P2YA 4P23A 4PGEB 2A9ML 3MRBA 5D7IE 3KXFA 3U7AA 4MD4A 4O2CB 3EW3B 1A9BA 1V5JA 4JY5H 4NJAH 2ZOLA 3NGBB 4F9PC 3NABL 5C0BD 1RK1B 3UTSB 3DVNA 3ZDYF 1VFUA 4UB0L 1FAIL 4OCXL 5DJXB 3R1GL 4CBPA 5FYJU 1ZHKA 2HFEA 4LEXL 2HN7B 1EHLL 4Y19A 1ZEAH 4Y5VA 1N5AB 2VDKL 3UROR 1FRGL 2A6DB 1CGTA 3MBEB 4NQVB 5HHOD 5CSGA 1BQUA 1LILA 4M43L 1XR8A 5I6XC 4PJAF 1T1ZB 4LARH 1S5HB 5D7JC 1F2XK 2EZ0C 5EIVA 4JZJB 1ZLVH 5ILTH 4LASL 1A6TB 3F6LA 3IRZA 1QLFB 3LKNB 5D7JA 1WFUA 4WUKH 2BSSA 3GSQB 1CFQA 3RTQD 4F58H 5T1DL 1D5MB 4LQ1A 2GYSA 2DKSA 2AQ3A 3LQZA 3QIUC 4Y88A 5D7IA 3NFPA 1TVDA 3CFBA 3IDMA 2CDEA 3FT4B 4NO0A 3V0AC 3QIUA 1B4JH 5J56B 1JYWA 4ZTOH 5CZXD 1IZJA 5C07D 2RFXB 2DM7A 2IMNA 5FA4A 3MA7B 2OCFD 2NX5B 1EGJH 4LBEA 1INQB 1SJVA 2R9HC 4QHNA 4H20L 4PYGA 1IEBB 1R3JB 3GMNB 4ONOA 4YGVA 5I1KL 3H9HA 1XGUA 3G08B 3VD4A 3TT3H 3OKMB 1HYSD 1YEHL 1HXMB 3DV4A 4KRPB 4JZNB 2AK1H 1NGXA 1CXKA 3BAEL 4XI5D 3S5LA 4DEPC 3FOLA 5EDXA 3OSKA 2VAAA 4AQOA 2NY2D 4RQQA 3RZCC 2P8LB 4G8EB 5I15H 4ONHA 1OGAD 1WIPA 3N1PC 5F3BA 4RMUA 3RPIB 1UKQA 4QRSA 1D3CA 3MXVL 2FATL 3N1FC 2PYEE 1EO8H 2XFXA 1A9EB 3MRCA 1TITA 4GRWH 1MCCA 1Z3GH 4ZG1A 4P2RD 3ULVD 4KC3B 4FNLL 3QBTB 3W5MA 1AD0B 3ARRA 5EIIB 1XGPA 4JO1H 5HPOA 3KJ4C 3SE8L 3U48A 4FP8L 4WFGE 3RUGF 5EOQL 3WJJC 3OKNA 1A7RH 5T1MB 1B88A 2J5LC 3MLVH 4ONFH 3G04A 3AREC 3MFGB 4M6MH 4QRRD 3WJJA 2IQ9L 1JGUL 4HS8H 4UQ3A 3FCTB 3KPNA 5HVWA 1IC1A 1G7HB 2DLHA 1NMBH 3N9GH 4GBXC 4K23L 5DO2D 4UIKH 5DK3A 1KELL 2IJ0C 2NY1D 2A77L 3PABA 3RGVC 2ZG3A 4GBXA 3RPKA 5MP6H 1OM3L 4EVNA 3MOAL 3RGVA 5MEND 3DRQA 3KLDA 1VFBA 4F7PB 1VERA 2VLRD 4GKNB 2X4OB 2VSDA 2Z31B 4N8CL 4NO5A 5CMAA 1OPGH 3NFNA 2R23B 3BDYL 5F9JA 4FQ2H 1LEGA 5B21A 2Z8SA 3O4LA 4Y4KB 3KYNB 2Q6WA 1CQKA 1SM3L 3PWVA 2YPLD 4L9LA 3GMRA 1WFNA 4CW1B 1ZT7B 3DUUB 4O2FA 4AQ1B 5I73C 3KPPA 3L7EB 1AC6A 2DTMH 3C09B 4P4RA 1J8KA 2IGFH 3IJSB 4HJGB 1KYOK 3TC9A 1XCQB 3PQYE 1L0QA 4YX2L 4I4WA 4K7PY 4GRMB 2ERJC 4GAJH 3QG6B 4P9HL 5D7LE 4A6YH 1WZLA 4ZUUB 1YY8B 2EYTB 3NBNA 1CZ8L 3D3VE 3O81A 1SJXA 1CDYA 1F8TH 4ZTPH 5IFJA 2FIRT 4F80A 4AH2A 1BWMA 1I8IA 3QT2A 1T0NA 3CCHA 1ZKAA 4Y5XC 5B3JE 1ADQH 2BY0A 1RURH 5F1NA 3VXUD 1U8LA 2HFTA 2Z9TA 1QBML 1I1AB 4GRWE 4PRDB 1YMMB 1WLHA 4Y5XA 1NC2D 1IM9B 3GBLA 1KG0B 1Q0XH 1EGJA 1NAKH 1RUKL 3QO0A 3CXHJ 3RHWF 3TESA 2HLAA 2KBGA 1MHCB 3G5ZA 3K81A 3V52H 3ARUA 1BMGA 1EJ6A 2A38A 2ORBH 3QPQD 1FVDB 4WEBL 4OZGE 2JE8A 3WIHL 1RVFH 1XF4A 3P4NA 3PQYA 2QQNH 4L5FH 4P57A 1KPVB 3CC5B 1IGFH 4OZFB 3K4AA 1I8KB 1KENL 2AERT 4YPGB 2QTEA 3GHEH 3D3VA 5D1ZD 5I1CH 2NY3D 2Y5EA 2V7HB 3P0VL 3LEXB 1K5NB 3BGFC 3TO2B 1U8OA 2OS7A 3PXJA 4UI2A 4E41A 1LEKB 3EZJB 4YHIB 3GIVA 5E8DH 1T03H 5GRVL 1IAKB 2BNQD 2Y25A 2PYFA 3OX8B 5HGDA 4NZUL 5CEXA 3U0WH 2GCYB 1TMCB 5EA0H 1KIQA 5EU7C 1UEMA 2WBJC 4YDLB 5I1HH 1F3DH 3RX5A 4M48H 4LNVA 1T6VN 1U92A 5EOCH 1W72L 1MRCL 5I1IL 2Z8WC 2V2XB 3S3SA 2VH5L 2WBJA 1H15B 5JPNA 1B9ZA 1H8SA 4HQQL 5GIRB 4OZGA 1TJGL 2P42B 3SE3A 4TTDC 5IBLC 5IR1A 4QWWC 3BVNB 4PREB 2MCG1 3BIKA 3ULUH 2D7OA 5IFAH 1RZ8A 3D1MC 4PRAA 2QBWA 5EU4A 4LVEA 4ZXBD 4NWUH 3PV6A 2GJZB 5KAQG 1ZHNA 3VFTA 1Q1JH 3EOAA 2R39A 1ZV5A 4G7YL 4RGND 5ETUA 1DDHB 3WS6A 1QLRA 1ZLUH 4N68A 4R2GB 3R4DA 1CICB 2DIBA 3O41B 1WBZB 4QTIH 4WGVB 2X4UB 2OMNA 5I71C 2CR3A 2XI9A 2JB6A 1LO5B 4EI6A 1J8HB 3AFLA 2QSCL 1CE1H 3ZYOA 4N1HB 3EYFB 3BQUD 3L3IA 5ENWA 4GXVL 4OCSH 3GKWL 3MUZ1 4MA3A 5C8JA 4OSUL 4IRJB 5KSBF 2KZWA 1Q72H 4PRBA 2VMFA 3QQ3A 4M7KL 4WFED 2X4QA 3VA6A 1GGIL 3QQ9D 5FYLD 5FKPA 2X2YA 5FEBA 1AE6H 4ODSL 4DTGL 1JNNH 3H9SB 1QQDA 4DGVL 2QR0A 5KVGL 1T5WA 4Y16D 1C7TA 4NM4H 3QIBD 1YEKL 1CYGA 5AG9A 1FGVH 3MLXH 2F54D 3TEUA 2WWMC 4WU5B 4A6YA 5HYQA 1XF5A 2DQGL 4QF1B 3IFOA 3CDGB 2Y1VA 1FFNA 5F7FA 4ZOEA 3DVFA 3GI8H 3HN3A 1CFVH 4RMWA 4Z7WE 1RIUH 5CD5D 2AJSL 2HVJA 1CT8A 1ADQA 3EHBC 3PIQB 2BOCB 1RUML 3QEQB 1XMWA 4TSBH 5FYJD 5IMLA 3LN5A 5JW3H 2RBLA 4HSQA 4M6OL 3LKRA 2X1XR 2FZ3B 1KIPB 3BH9A 3AU1A 3HZYB 3BPNC 4S1RL 1MREL 1XF3B 4ZSOB 5C70A 2EDDA 5J7CC 3WNLA 4NZTH 2V9RA 2CUHA 3NTCH 3W11C 1VACB 1BEYL 6FABL 5DDHA 5B3NA 1A02N 2VZTA 1L4IA 1HNGA 3ULUE 2ZCHH 1P1ZB 2R4RL 3VI4F 3FO9A 2J6EL 1A6UL 5DRNB 1X5LA 2F5BL 4M6NL 4MAYB 3ARBA 4XCYA 1ROWA 1X5GA 4LHUD 5DRZB 4UT9H 2AJUL 2B8OT 4BH7B 3BHBA 3HI6L 3PGCA 5AYUH 1IL1B 4I0PC 1AGEA 1TPXB 2NXYD 1Q9KB 3UTOA 3MFFA 4JFZL 3RWHA 4I0PA 2XV6B 5D6DC 3WFEH 4PP1C 4M8QA 5C92A 1MFDH 2VDMH 5IEHA 1MLBB 3GZKA 3MA9L 1QOKA 2KPNA 2I24N 1IAMA 5D6DA 4M7LT 4PLOB 1ZSDA 4LSSL 5HDQL 3RWFA 4QY8A 3JTSB 5D5ME 5CBEA 5HPMB 3ULUC 1ZA3B 1AGBA 2LU7A 2BVOB 5BO1L 5I66B 4OB5H 2X4PB 4KRMB 4QT5B 3HR5B 3QNYB 1D5ZA 3HNTL 4X5XB 1PKQA 4OCYH 3EFFB 1RZKH 4K3DH 3VXRE 1MFAH 1WBYA 3OGOE 2MQ3A 3ZTJH 3ZSSA 3C60D 4PR5A 2FBJL 3INUL 1EHNA 5DMGD 4MQTB 5J12B 1OAZH 4LHJB 2F53D 3VJ6B 4IIQA 3CK0H 4JN2A 3JUZA 3KPLB 4KV5F 5BRZA 1A1NB 4OM0L 4PTUB 2FL5A 3AAZB 5TQ2L 1FL3B 4F2MB 1MCRA 4UOW0 3DHMA 1ZGLM 4U05A 4Z77A 4UNUA 1SMAA 2LQRA 1JPTH 4JEGB 5DJ0B 1FG9C 4EKXA 4RGOL 3QUYB 3L5WA 1G7IA 4JCMA 4NCDA 1CBVH 3UBXA 1T4KB 5D5MA 5MERB 3O4OC 1D5BA 3T0WA 2FX8H 2C3VA 3RWGB 5JR1L 1DTUA 1MFEH 4HAFA 2BVQA 4NJ9H 3O3DA 4Y19D 1NQBA 3VXRA 4U1LB 5F7HA 5T5FL 1YYLL 2JJUA 1YEGH 5I0ZA 3CVHB 3QNXB 3K8MA 3OR6A 3RY5A 1P6AB 1KCKA 3PXHA 1P7KA 5HYFA 3P4OB 4D94A 5C0AE 4Z7UB 1IQDB 5D7JD 3MLTB 1X6LA 1RZ7L 4OFDA 2EZ0D 4NOFA 4GS7C 4YWGH 2P8PA 1EEZA 2DQJH 3V4PH 2D0GA 1CD1A 3MRDA 3AROA 2ITCA 1YEJH 3BZ4A 4OKVB 5L2KA 5E99L 4AZ8A 4LSQL 1U6AH 3GJEA 4R4FL 3SOBH 3NZ8B 1S9YA 4NO0D 3QIUD 1J05B 4HUVA 1PYWA 2PO6B 3P0GB 1X5YA 4NQCB 1BJ1J 1T80A 1QFHA 1Z9MA 4IRZH 5I1LB 3O3EB 3ZYJA 4EN3B 4EUPH 1TVHB 3RNKB 4KQ4H 3FB7B 4G8GE 4G6JH 5HHNA 4RFNC 2R9HD 1S7UA 3WFHA 4GG6B 1N64L 4HPOL 4F3FA 1MNUH 5T1KA 2IPUK 1CDIA 2HAZA 3RY4A 1T3FB 1OF2B 2DQFB 2JCCF 5JDSB 3CSPA 3QDME 1K6QL 5CJOH 5C0AA 5HTSA 4M7LL 3MCLH 4MNQB 4X9IA 3MJ9H 4K07A 2B1AL 3WYRA 4TSAL 5ESAA 4P3WA 1NL0L 5ISZB 4MJIB 8FABB 3QHFH 1CXEA 4YDJB 1UQSA 5LGKA 3RZCD 5I30H 1MJUL 1KJ2L 2ITDA 1JWUA 2AK4E 4JR9L 3DNKA 2J8UB 5ERWB 2NYYC 1HNFA 2CO6B 4HWZB 4ZYKB 4UU9B 3V4VH 3KPRB 4NZRL 1U41A 2Y9RT 3KPSB 1A2YA 1L0XA 4MZ2A 4JANB 3UXFA 4XPHH 3IDUA 1BREA 3QXDA 3WXWH 5F3HB 2YD9A 4G8GA 2X89A 5GRJH 2FRGP 2X9WA 3TIEA 5FYKE 3TYFA 4AYFA 1DLFH 3D69B 4G6KH 5IGXH 4PGZA 4X0KB 4MLSA 1UB6B 1S7WA 1ZLVK 2YC1B 4QRTA 1RPQA 2XXMB 3DBXB 3ARED 1FFOB 4LSDA 4QYOA 2DN7A 1FZOB 4X6DF 3P40A 3C9NA 1M05B 1S78C 4U1MA 4XNQA 4JM4H 3EFDH 4LLUA 5FIEA 5I1GH 2OTWB 4HG4J 3RGVD 1J0KA 2AXJA 5AZ2H 2PYED 1IAII 4GW4A 1J18A 4MSWB 1A0QL 2AK4A 4JN1L 5EUKB 1KPRA 3H6JA 1TJIH 3KVQA 4LIQH 4EXKA 3B6SB 2MSPA 4YHNB 4YBQC 3VW3L 1FNEA 2CXKA 5DD3H 3LSOB 3FT3A 1MELA 1JPSH 1BQLL 4WHYH 3VXMA 2H2PD 2AEWA 4WFGD 1TZGH 4XVJL 4K55A 5FDWB 2C26A 4P5KA 1JPFB 1I9RH 1OCWH 3DHJA 3O6ML 4N9OB 3ECBB 3MRKA 2VZ3A 3BN9C 4ZS7L 2HJFB 4DQOH 1IM3B 2NW3A 3KJ6L 3QQNA 4LLQA 1A6VL 4H1LB 2Z4QB 1QBBA 1XGTA 1I1FA 4PRHB 1IBGL 3HI5L 1DQQB 4LSVH 2VNCA 4R6UA 4OCWH 1BGXH 3NFSH 2X70A 1UJTA 1N7ML 3L3OA 2FECI 4LMQE 3PDOB 1ULVA 2OR9H 1F11B 3QWRA 1Y18A 1FO0H 3C87A 5DHVB 2YWZA 3R06A 3QEHA 3OR7A 1RJCA 1HDMA 3FMGH 1PQZA 4WFFE 3VGGA 2YRLA 5IUSA 3UJTL 1ETZB