3BAEL

Crystal structure of fab wo2 bound to the n terminal domain of amyloid beta peptide (1-28)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
218
structure length
218
Chain Sequence
DVLMTQTPLSLPVNLGEQASISCRSSQSIVHSNGHTYLEWYLQRPGQSPKLLIYQVSTRFSGVPDRFSGSGSGTDFTLRISRVEAEDLGVYYCFQASLVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords WO2 IgG2a Fab fragment Light Chain Kappa
publication title Amyloid-beta-anti-amyloid-beta complex structure reveals an extended conformation in the immunodominant B-cell epitope.
pubmed doi rcsb
total genus 51
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3baeL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3baeL01
1TNNA 2EYSB 4J1UA 5I1EH 2RBLA 2J5LC 2APWA 1JFQH 1GC1H 3LN4B 5DURD 2L0DA 4LK4A 2WWKO 5KS9F 3ARGA 1RK1B 3BIKA 5E95B 4ETYA 5C70A 2EEAA 2FSEB 5AZEL 1CCZA 2YXFA 3GSWA 1S7WB 3DRTB 2VXVL 2O5XL 2A6KA 1FFPB 1AD0A 1NGWA 1QQDB 2DTML 4Y7MA 4HD9A 4GG6A 2BY3A 1JPFA 4LCCB 3VXUA 1JF5A 5J1AA 5C0AB 3KPNB 2EDHA 3IU3B 3GSUB 3PXJA 4I3RL 4PGBA 2EYSA 2R0ZL 4ZUWB 4HZLA 3QWOB 3EJYC 2BCKA 4S11A 5MP6H 4NHUB 2P5EA 3SOBH 3OKMA 4O2FA 2XZCH 5FM5M 1J0KA 3A67H 3GI9L 4K9EH 2ESVA 5FFLA 5TE4L 1KTDB 2VDOL 3LSOA 4X8JB 5C0CE 4OAWA 5E4IA 4Z6AT 3C08L 3H8NA 4RMQA 4PG9B 1FZOA 4YE4L 3GSUA 1UVQB 1NDMB 3D3VE 1KXQE 5FO8B 2R1YB 3DI2B 3VXOA 4ZOEA 4FZ8L 3HAEB 1DQLL 1NC4A 2VERN 3U30B 4U1JB 1DANT 4ISVA 1ZMYA 3ECBB 3C8HA 1TENA 3B2VL 4UT6L 5HHME 2ADFL 1O5DT 3Q5TA 3M07A 2VQ1A 3TESA 1IAOA 2P5WB 4HF5H 1IEHA 3RWDA 5I6XC 3CFKB 4YGVA 2PYFB 3BRGC 3IJSB 2AS5M 5HDQH 3F65A 1IGTA 3VXNB 4JPIB 4DJMA 1F3JB 1UVQA 2R8SL 4RMUA 4JDZA 4X6DF 1JYVA 1HOCA 4NKOA 3CMOL 1W72A 1U8HB 5A16B 4G7VH 2X7LB 1DSFH 2PKDA 1JVKA 3ECBA 3QDMB 4L4VE 4JRYA 1T0NA 4LEXH 2VMFA 3FTGA 2J4WL 1RZJC 5I1JH 4I8DA 1RIUL 3FOMA 4OUUB 5CJXA 3TA3B 4HS3B 1RURL 4HBCH 4I1NB 3QUYB 5F89B 4KTYA 5DRZB 4OKDA 3O2DH 4WU7A 1F3JA 1BMGA 4TRPL 5IW1B 5IQ9A 4OLUH 1M4KA 5FDWA 2AJVH 4LLVA 3ZTJG 3VXQB 5KG9B 1B90A 1XF5A 4DOHB 2CIKB 1A7QL 4XCYA 5D72L 4ELKB 5F1NB 1KPUB 1QVOA 3VG9C 5CZVL 2F8OA 5IMLB 1AY1L 2PYED 5SWZE 1PVHA 4KROD 3B2UC 3NPSB 1WT5A 2CR6A 4DEPC 4Z78A 3PUCA 4M6OL 3VXMA 4U1SB 5GGTL 3C5ZA 1D3CA 1WITA 2ORBL 4J4PC 1MI5A 5CP3H 5ESQB 3UMTA 2DQDH 4WY7L 2J88H 2X4TA 4PRPB 1CDHA 3BZDA 3NCEB 1EJOL 3O8XB 1EMTH 2YUXA 3ULUH 3BSZL 4AMKH 2A83B 2RFXA 3T2NL 1LO2H 4HIIA 4ELKA 1A6UH 1C08B 3EDEA 5LCVL 4P4RB 1Z3GL 1DUZA 4LQFH 4Z7OE 1BLNA 1OD9A 4MA7H 4KK6C 3FAXA 1KC5H 2Y07L 4HIJA 4ELMB 1F6AA 5HYIA 3HCVA 1PQZA 4NQED 1AQKL 1ZLWH 3AUVA 3SDAA 4BSWA 1R24B 1RU9H 4LOUD 4OM1H 2Z0BA 5CUSH 5J6GA 4CNIB 5IFAL 1A7PH 4PG2A 4XCFH 1QFOA 1QBMH 3QUKB 3ZHDA 5D96B 5KAQF 1DQQA 1AHWC 2ZJSL 2OQJA 1OAYH 4M7JH 4HKBB 2FX9L 2ZPKL 4WWKD 2ICWI 1NBQA 4N8VA 5EU5A 2BJML 3BYYA 3SE9L 1D9KD 4HKZB 3QG7L 1G0YR 4X6CA 2VZSA 1RHFA 1WCBB 1NEUA 3ARSA 2BY0A 3QI9A 3CFJB 3MJ7A 1YEGL 1I8IB 1H3PH 3DV4A 3SE8L 2XNAB 4NQTA 1Q38A 4KVCL 5FGBA 1VB9A 3QUKA 3BW9A 3LN9A 4UB0H 3KJ4B 5GSRA 1SY6A 3BRDA 1BOGA 3HR5B 3IFLL 5F21B 5CEXA 4ZPTA 5DRXA 2PTVA 4P59H 1A22B 3NIFE 1T21A 2YBRB 4ZFGH 1DLHA 3DTXB 3E0GA 1EAJA 1TVHB 1AQDA 2IADA 1NGZB 2DLFH 5D1QB 3C2SA 1FBIH 2X4PB 5EO0B 4UU9B 4ZO8A 4XC3H 4QRTA 5EOTB 4HG4J 3EYVB 1A9BB 1SYVB 2IG2H 2YR3A 5CD5C 4AG4H 3RP1A 5HGBB 4HMEA 5C2BL 3G6JE 1QZ1A 4JFDB 3GBML 4LCWB 4XBEH 4ERSL 5L2KB 4EN3C 4K8RC 3U0PA 3FQXA 1IGFH 4LLMB 3QDGB 5E2TL 5KVEH 3JUYA 5E8PB 5JXEA 4X83A 3T09A 5AYQA 4WUUD 4N9GA 4W68A 4G8GD 5D7SH 4LIQH 2OP4L 1J0ZA 5C92A 5E1AB 43CAA 1NFDF 4IOSD 2XFXB 1RMFH 2OJZL 3RTQB 5EOTA 4OGZA 4YWGH 3UTOA 4K8RL 3KYKH 1UM4H 5EBWA 1QP1A 2X44D 1I9JH 3HC3H 3QQNA 4F8QA 1ORQB 1HYRC 3VXSE 3SBWC 4YK4C 2PXYC 5GHWH 2NPLX 3MRDB 5DFVC 4JGMA 3FO2A 1LO5B 2FO4A 4OBRA 4GO6B 4WFGD 4XX1G 5LBSL 1X5LA 2PN5A 3O45B 1YPZB 4UV7H 3AREA 4Y4HC 1MFAH 2HJKA 4TQEH 1LHZA 4ZFOL 1KIUA 3GSRA 1DLFL 3QUXD 3MXWH 3GSQA 4IRJC 4DK6A 5E00B 5BQ7A 2X4UA 5C0IA 4LVOB 1B4JH 1RZIB 1WWWX 5TF1L 3QEQA 5J3HC 5DR5H 5K9JL 4KI5E 3VFNB 4ZUSB 3S5LB 1OGAA 1XZ0A 2AW2A 4APQA 5BV7B 4LVHC 3RGVD 5IHZB 2FRGP 3BKML 4BKLB 2XKUA 4LBEB 3WL9A 4ZODA 3T3ME 2Q86B 5SWQB 4G7YH 2M1KA 4MJ4A 4R96A 4P5MB 5IB3B 5EU7E 1A7RL 3SGDI 1OB1B 3TH3T 5L88H 2B4CC 4B0MM 1A3RH 3TIEA 1K6QL 3H3BC 4ONHB 3BP5B 3TZVD 3I02B 3WFDH 4NWTH 4E0RA 2G60L 4M61A 4PB9L 4Y4FD 3FO0H 4GBXD 4X9HA 1JGDA 2VH5H 5E7FA 3PHSA 1G84A 1NCAH 3B9VA 4HGKC 1T2JA 2X41A 4ZTOL 3FB5B 2XIDA 3INUL 4NKMA 1CF8L 3G9AB 4ZUTA 3UJIH 3O4LE 4ZG1A 4JQVA 5BS0A 2W0PA 4U6VH 2B4CL 1E6OL 4NQDB 3QUZD 5ADPH 4XCCH 1F4XL 3WKMH 1M7IA 1X5KA 1OB1A 3FB7B 4DUWA 1FNGA 2QHRL 1QR1B 4U05A 4AEHH 1WZ1L 1MCSA 4HS6A 3WUZA 1TJIL 2VXUL 4X7FC 5A2LH 3I75A 3FFCB 4LASL 4Z7NF 1X5ZA 4WV1B 5C08B 2D0HA 4PJBB 3X3GL 4EOWL 3WFCH 4K71B 3FB5A 3W39A 1WF5A 3QRFM 4LRNL 5C0FA 5CEYB 3ULUF 4NQUA 3VRJB 3WIHL 3RWGB 5JIKA 1RZFL 4NQDA 1ZT7A 2P4AB 1ZEAL 4O9HL 5ANME 5DD3H 4XPTH 5FO7A 1L6XA 1QSEE 3JV4A 4YC2B 2A9NL 5I17A 2X4RB 1T0MA 5I2IA 1GGTA 2HT3D 1K5NB 1RY7B 5LQBH 5DT1H 3QFJB 4IMKC 3O0RH 3MUZ1 4LSUH 2CO6B 3D2UB 4P5TD 5K59E 2FWOA 1MRFH 5FYKH 4S1SL 1C7TA 4DWHA 1RUKH 3BHBA 3S3SA 3MNVA 2E7CA 4FQLL 3U4AA 2ATPB 4HJJL 3VRJA 5FF6B 4OCLC 4EDXB 1NCBH 25C8H 2R0KH 3WCYA 4R3SB 5D2NE 4OV5A 1H5BB 3NACL 2AKRA 4MA1B 2A77H 2YRPA 3EUUA 4KZDL 3I9GH 1HE7A 4MS8C 1IT9H 2AV7B 3BAEL 4PD4J 1YEIH 4PRIA 5TE6H 4QNPE 5C7XL 1QPXA 4JDTL 4U49A 2I5YH 3O6LL 3K3QA 3LEYH 1J87A 2CDGA 1T5WA 5D2LE 4XPHH 2XN9D 1EGJH 4KKNA 4S0SD 2DWEB 5DD6B 4FABL 3TJEH 3PDGA 4F7MB 2P43B 3L1OL 4HGMA 1WQVT 4I0CC 4DTGH 1MPAH 4PJCA 4EDXA 3JZ7A 1MY7A 5D8JH 1KB5A 3KXFB 1RJZB 5CJ8A 1BWWA 4XVUD 5D5MF 1FL6A 1NANH 5IFJA 1H5BA 2NY2C 2X89A 2IPKA 1ZHKB 5JW5B 3MRLA 4U6XB 2GFBB 4H25A 3DIFA 4Y4KB 3QUMB 4X7EC 1EAPB 1UZ6E 2DKMA 2KDGA 3MLTB 3UTZA 5KSUA 4F7PA 4MHHI 3H9SD 1FDLL 2AXGB 2MNUA 4MHHG 3N1MC 4OFIA 3V5HA 2VQUA 3MJ8A 2R2BA 3LHPL 3QNYB 4MJ6A 4FQXC 4MNQE 3PJSB 5D1ZA 2ZG1A 2AXJA 1KXVC 2DKSA 2GJZB 3O41A 3WNMA 4LSSH 1BP3B 1KUMA 1PYWB 5T3XE 3UYRL 4QRSB 4ZQKA 1NAMB 4X5WB 1MVFA 1I9IL 3QO1A 4HULB 3VI4F 4N5EC 4NO3B 3SCMC 3WFBL 4Y4KA 3RZCB 5F3HA 2AK1L 2LV4A 3KG5A 1MFBL 3L3IB 4U0RB 4M1CC 3IF1B 3GB7B 1GYAA 2G5RA 1F3RB 1YY8B 3I6LE 4JFXB 4IHOA 4E5XB 5F9OH 3U9PH 3PWNA 2GJ6A 4ODWA 4G3YH 4BYHA 4P23B 2RCSL 4PRAB 1JPTH 1INEH 2F54A 1I1AD 4I18C 1XGQB 2OI9C 3IJHA 3RZCA 2QQQA 5FHBH 2I60H 4EI5B 5GRJH 1LEGA 4GAJH 5MHSE 3LKOB 1G9NC 1RK0B 2FX8L 4L1HA 1B2WH 4RDQF 5CEZL 2LAGB 3HPJB 1YY8A 4L5FL 1JWUB 4NM8L 1UEMA 1MY5A 2CR3A 4N0UA 5EZLB 3LD8C 5DURB 3VFPA 1Z5LB 3OKEA 5DD0H 5L8LB 5F7UA 3P2TA 4BH8B 2WLZA 4U7SA 1G9NL 1OL0A 2F8VA 5KANI 4M8VA 3FAWA 5KANG 1MCBA 2DMCA 5EC2B 2BHYA 2DRUA 1IGYA 2FJFA 4I9WE 3VGAC 3LKOA 3UX9B 4FXKA 4NC1C 1S5HB 2YMXH 2R69H 4NHCL 1NPUA 4HKJB 5TE7H 5K9OA 5AWNL 1T0PB 3X3FL 4LGRB 4Y19A 5HVWA 1ZGLM 2WWMC 3G5YB 2JJWA 2ADIA 2DQGH 4Z95H 3VE0B 5TPWH 1F4AA 2DLTA 1KCUL 3U7YH 4OD1L 2RHEA 1JPST 1ORSA 4ODHL 1QSFE 1CL7H 4NQXB 2EDOA 2MJWA 2FYYA 4NP4L 2ICCA 3STLB 2VIRB 5T1MB 3MBEC 4M6AA 5IVZA 3CCHA 4GRWB 4HUVB 2F8XC 1G7JA 4X7TB 2LQRA 3TT3L 1I7ZA 2P24A 2WV3A 1UM5L 2E9IA 3AC0A 5ACMA 1FVCB 1BZ9A 2BVPA 2NW2B 1VCAA 2CKBL 4QOKD 2APXA 1SJVA 1KCSH 1F58H 2GUOA 4D9QD 2RQ8A 3NA9L 5K9QI 4NQXA 4QHNA 4GKOA 3OKOB 4TUOA 4LPYA 3B2UD 5D7JD 5BZDA 4QTIH 4ZAKC 3X12A 3RJQB 1S8DA 3I84A 1YMMA 5FXCH 4RISL 4MVBD 4A2LA 2ADGA 4J4PD 1YDPB 3RWIB 3F7PC 1DUYA 2YPLA 4QXUH 1OSPL 4K3HA 3TT1H 3LOWA 1M1SA 4RQQB 4RZCA 3G08B 4GMTH 2Q87A 4Q9QL 2IPUK 3SDYH 5A2JH 3QDHA 1X6NA 1N0XH 3V9FA 1LD9A 5DYOB 2MWCA 2XG5A 1LNUA 1OD7A 2CUMA 4V2BA 1P4IL 1ZWIB 4KK6D 1UB6B 4QHUA 1KIRA 2ZKHH 1T66C 4Z0BL 3RBGA 3LEXA 1T83C 1FL5A 4XXCC 3QIUC 1MCCA 2AI0H 4ZFFA 4YIQA 1WSST 1R3JA 3DGGB 1NMBL 4OZIB 1AXTL 2A38A 5C07A 5EUOA 2FHFA 1YN6A 3GRWA 5T5FL 3DX6B 1CXHA 3GIVB 1UB5A 2PYEB 1N59A 1T1YB 5HXMA 4KROB 4M1GL 3QQ3A 3FQRA 4XMPH 1T89A 2OL3A 4U6HB 3MMEA 4UBDC 2EE3A 3MOQA 3QAZB 2Z92A 3NIGE 3RY5A 5I75C 4JPKH 5GS0H 1QLFB 4FTVD 1LK3L 2BX5A 3OXRA 3UCRA 5J6HA 5JA9A 3RUGB 1NGQH 2YUVA 3HRZB 2JB5L 5EBLA 2IWGA 2IC2A 4XP1L 4Q74A 3HAEH 3Q3GB 3SGEH 3T8XA 4G5ZH 1W72H 3TN0A 1U8NA 5H35A 3RL2B 1A6ZB 4NN5C 4EBQL 2O5YH 2GTZB 3P0VL 3REVB 1D5XA 3HZKA 5ICXB 1YNTB 1W0VB 4NQEB 1BBDH 5CD5D 1FGVH 1UCTA 1U8PA 4Q97A 2ICES 4LFHD 4YUEL 5ID1A 4EN3D 2HN7B 4K8RD 5DVKA 1G7HB 5T33H 1E28A 4MNGE 1F97A 1B6DA 4WEMB 4Q9RH 4J2XA 2MQ0A 3OGOE 1S9WB 15C8H 1KFAL 4WWKB 1WV7T 4HS8H 4XNMB 5IW6A 1TDQA 3FO1A 4IIQC 3NOIA 2HH0H 4HH9A 1D9KB 1C16B 2GTZA 2Y5TB 1CD1B 2Q8AL 2LTQC 1GXEA 2YA0A 1DFBH 1IGJB 1W0VA 3UYOD 5SX4I 5I16A 5M95B 2NNAA 3KR3L 1KBGL 3A6BH 4HC1A 5F7FA 3H42H 2Q8BH 3MRNB 3HA0A 1P6FA 1ZHLA 3TJHC 1G7HA 4YH6A 4G6JL 5DFVD 4ZXBC 1C7SA 5IB1A 1NL0H 5DS8A 2EDLA 2L4OA 1NUNB 4PTTB 1NGYB 4Y4HD 2GAZA 4JJ5B 3JV5A 4M8QA 1NJ9A 2GITA 2C1PB 5FUZH 5CBAA 3C6SA 4IRJD 6FABL 3JWDC 2Y5TA 3QPXL 1YNLH 3DRQB 4NNPL 3GBNL 4GG6E 2CLZA 4OCMC 4XP6H 3LKQA 3O6FA 5J3HD 4PGZA 1ZLVK 3OKKA 3WNKA 2GYSA 3HI6L 1KJVB 4GW1B 3KPQB 1DBKL 4ZS7H 2DDQH 1ZHNA 1A2YB 1D5MA 1NDGB 4DCQB 4OCWH 4JCMA 3EGSB 1UKQA 4WUUB 2P5EE 3LH2L 1P4BH 3JWDL 4G8GB 3G6DL 3QXVA 4JZNB 4PTTA 1OLZA 1NCNA 3LZFH 4M43L 2ESVE 4NFDA 1A14L 1OAUH 5IJVB 4F33A 1ZT4A 3LS4L 3P9MB 1LEKA 4CVZB 1WEJL 2A2QT 3CFDB 2IMNA 1DL7H 3VRLF 4K23L 2DM4A 2AV1B 4GKNB 1KJVA 4OZHB 2X4SA 3NIDE 1CD9B 1GCFA 4FFVC 1H3TA 3QCTL 3BZEB 1P69B 3WN5B 4RGND 3MLRL 1I1FB 4D9RD 4RMRA 4E41A 3PWUB 4Z7WB 1NDGA 5T1KA 1YQ2A 4OD3H 4UILL 5FGCB 4YHYB 2J6EA 3FQUA 2Z31D 4F15C 1VERA 5IB4B 1KNOA 5DEGB 5KW9L 4K7PL 3AM8C 2D0GA 3HPLA 2JTDA 2Z8RA 4XXDB 4JZJA 2YK1H 4R7NB 2F53E 5JHLH 2AJUH 5J9PB 4JFOB 5HYQB 4I0PC 3BESR 2UVFA 4K94C 4BUHA 1PX3A 4HHAB 4NQVA 1AIFB 4G8IB 3RGVB 1ES0A 4Z18A 3QEGL 1LDPH 1I1FA 2UZYB 3PWUA 5JTWA 4KUZL 3TC9A 2DQHL 4YGAB 2DD8H 4TVPE 3GSNL 5EORL 3P4OB 2OBGA 4M7ZC 1JJUA 3CFBB 1U3HA 3JBG7 3QUXA 1RULH 1B3JA 1PG7W 3BKCL 3G5ZA 4QRPA 2J8HA 4K94L 1OM3H 2B2XL 1KT2B 3TZVB 4PRDA 5IB5B 2EC9T 2I9LA 3KPSB 4Y4FB 4GBXB 1MCOH 4G6FD 1N7MH 2FZ3B 5HYQA 1MHPH 1DQDL 2AJZA 2CGRL 5I8OH 2VL5B 5D70H 2QR0A 2XT1B 1BQHB 3ZKXB 4LLQB 3MLZL 4P4KC 5D6DA 4RFNB 4ZTPL 4UAOC 2VDNH 3CVHA 2NLJA 2VLME 3H2WA 4HIXH 4TTDC 1IEAB 4F2MA 3QUZB 4KK9C 3MV8E 5M94B 1ZS8B 3GM0A 3VFGL 2AK4A 1N26A 3CMGA 1CFTA 4MS8D 3T0WA 1H3UA 4QRRD 1KT2A 4G42B 5CFHA 1I1YB 3H7LA 1MI5E 2DQEH 3ABZA 1BEYH 2BSTA 2UVEA 1FC2D 2R2HA 3NH7H 3H6JA 3QXWA 1Y0LA 4LVNB 2CK0H 4YPGA 5KSAC 2NW3B 4G9FE 4YFLF 4TVSa 5IBUB 3GIZL 1CLYH 4CUCA 1GC1C 2AABH 4KPHL 5GGVH 2NY2D 5KJRH 4KK8C 1ZS8A 3QDJA 1CFSA 2QADD 4JQXA 3ZTNH 5DSCB 3PWPA 2PO6A 2IALA 3S7GA 2BRRH 4DK3A 1U36A 1YYML 2OS7A 1W0WB 4G8FA 4HFUH 5ITBL 2V17H 5E8NA 3H3PL 4PGDA 3WJJA 4OLVL 4P5TB 3BISA 3FT2B 1HHIB 1YYLL 5CIPB 1GC1L 1Q9WA 4FQXD 3UBXB 3ROOB 5ADOL 5IT2H 2C1OA 5IK3A 5KS9E 4NRYB 1WAAF 1HQRB 4X6FA 1JUFA 1V7NH 4XPBH 5HYFA 1E4XI 1VEMA 3EOBA 4OQTA 1F3DJ 1LP9E 3CFCH 2EDBA 3GNML 4N5ED 4X6CE 3SCMD 1CXLA 5DSCA 3VFRB 4R8WH 1F4WL 5ECJE 4HWEL 2AGJL 3TYGH 4ODTH 1T04A 1Q9LB 1KYOK 2XN9B 3O11A 4M1CD 2VLRA 1BM3H 4DFIA 5CILL 3TO4A 3FB6B 4Y5VB 5JORA 1CU4L 5MP6L 1IC1A 2W0LA 1XR8B 2VLJA 5DJDB 1IJ9A 3MODL 3SOBL 4NZJA 5CEZD 2R9HC 5L0QC 1MCLA 3MRMB 2VNCA 5B8CC 1MCNA 5I1HH 3U9UB 1TTGA 4PFEA 1CZ8L 4JO4L 4RA3A 4C56D 4KRPC 5E9DA 3WO4C 5KVDH 2GSGB 2QBWA 3QHFH 4HWBA 3MRIB 3BD4A 5DJAB 3FZUC 3H9SB 3CU1A 5D7IB 2C3XA 4PJ5D 2DL2A 2NX5D 5BRZD 1QYGL 2GQHA 2MSPA 3H7BB 4X7CC 3MO1A 5DJDA 2UZIL 5D71H 2DLIA 3MRMA 2J5LB 1MJUH 2K1MA 5GRYA 4PD4K 5CJOL 4HF5L 5JPNA 1FYTD 1H0DA 4POYA 2V2XA 4KGJA 5TFSH 2HRPH 4ELMF 1M71B 4D3CH 4JGUA 32C2B 4KQ3H 1B0RA 5F72S 1ND0A 5D6CB 4NPYB 4XCNA 3RX5A 4X6DE 1GAFL 5DO2C 4JR9L 5J1TC 1ERNA 2Y72A 1R5IB 2AJXH 1DSFL 5DUPL 2WWMD 4Z76B 3QULA 4U1NB 3U4EB 1KB5H 3ROLB 4PLNC 2X1XR 4CVWA 3S4SA 1A7NH 3EO1A 1I1AB 5JUEH 4R7DB 2FCBA 4X9FA 4N8VG 1S7RA 3O2DL 1ZANH 1M71A 32C2A 3MBED 2CRZA 4CMHB 4MCYA 4NPYA 4OLUL 1JGUH 2HFFB 5DJYA 5F7HA 4ORGB 4JRXD 5GSVA 5AUMB 5C8JB 4RWHA 5KSBA 4RWYL 2CDFB 2EZ0C 2R4RH 3ULUC 3SDCA 3VFWB 1ZA3B 4LKCA 4PJGB 3ROLA 1T03L 1KCVH 2R56L 4GKZB 1ZE3C 1NCTA 4PJ7A 4X4XA 1BHGA 3SQOL 1I1AA 4L1DA 5EU7C 1HHJA 4PGCB 1P84J 5E2WH 3CZFB 5FA3B 3QUMH 5HHOA 4OM0L 4XMLH 5DD5H 5EWIH 1ONQA 4PJEA 1J0JA 4AMKL 1QSZA 5I6XB 4PLJC 5GS1C 5I1KL 2NQCA 1BAFH 1LO2L 4L3EE 5EZJA 1N6UA 5I1GH 5AUMA 3THMH 5BS0E 5BJTB 3LDBC 3QB7C 4JN2B 3RU8L 5DK3A 5DQ9B 4MA7L 4OGXH 5I1DB 1LK2A 3R06B 1JN6A 4GKZA 4YHOL 4P2QD 3GK8H 3V52L 4DZBA 5JPMA 3O3BA 1GZQB 1PKQE 1YY9C 3JTTA 4OFKA 5H94A 3LN5A 3UYPA 1RZ8B 1F4HA 3HMXL 2Q3AA 4PJFA 1A7PL 1G7PA 1T66D 3GMLA 4XCFL 4OD2B 3OKLB 3I3EA 4FQQB 5ISZD 4Q9CA 2JIXD 1Z9MA 1MRDH 4YHKL 1K4DA 2FB4L 3NZ8B 4M7JL 4LF3B 4Z7UB 3RWCA 4UNTA 2VSDA 5EU3B 1INQA 3QHZL 4NQSB 2ZUYA 3Q6FB 1JBJA 1HINL 5D7KE 1RZGB 1U93B 4IJ3C 4G6AC 3R06A 4OGAC 4QOKB 2OTWB 1JNJA 1YPZF 5LGJA 1FNLA 3CSPA 4AZ8A 5IGXL 1IE5A 1KIPB 2OZ4A 3RKPA 3VG9B 1IAII 2FO1A 3B9AA 1A6VH 1O7VA 3RGHA 4BM7A 1JRHI 1MEXH 4F9PA 5INDA 1KB9K 5D7JB 4DEPB 2EH7H 1OCWH 2YEZB 2GK2A 2FLRT 3NZ8A 5DJXA 4LF3A 2H2SC 4UIKH 1CFVH 4LLUB 3OPZH 1S3KH 3V79C 3OG6B 1FBIL 3O9WA 4R4FL 3RHWK 1CQYA 4XC3L 3WFEL 2VR4A 3S88H 3BKJH 4JJHA 1CT8A 3TLRA 3UPRB 2BNUB 4PRIE 5CWSA 5DQJA 3VXRE 3VXTB 2OCFD 1GJIA 2QV2A 3JWOH 1MJ8L 5D7JA 3WHE0 1KN2H 3VJ6A 3JTSA 4WFHE 2Y9RT 2X1WL 1CGSH 3Q6GH 4AT6B 4UNVA 5D7SL 3M1BA 3GDBA 5ICYB 2ZOLA 1LDSA 2G2RB 3MLXL 1JPSL 1AHWB 4MXVE 5JDSB 1TVDA 3V0VA 1ED3A 1NFDE 4LEOB 3E2HC 3D0VB 4KUCF 3UPRA 3RY6A 4OF0A 4YDJA 2APTA 4K3JH 3KYKL 1Q0YL 4MAUL 4R90H 4GRLA 4YR6B 3HC3L 1HSAA 4PV8A 4HJ0C 3DUHA 4GRWH 4PR5A 4HUUA 5MEPA 4ONFH 4AIZB 4PJBF 4NKDB 4FTVB 5ACLA 5FA4B 3TJHD 2VZ3A 1MFAL 2JK5A 4ZXBD 3MLWH 1AJ7H 5BCAA 4WI7A 1C5CH 1L7TH 4KV5F 1JYXA 2OJEB 2EIBA 4OCRH 1KCRH 2L7UA 3MLVH 3IAGC 1WGOA 1JK8B 5DR5L 1U2HA 1UJ3A 3IETA 3V5KA 1NGXA 3BE1L 3WV0A 1HQ4A 5MEQA 1YC7A 5I30H 1T1XA 2Z35A 5I15H 1X3DA 1A3LH 2VISA 4G7YL 5T3XL 4HWZB 3SGKC 1HILA 4EN3B 3L7EA 4ONOA 3BUYA 2BZDA 5L88L 3GRWH 1A5FH 3LRSB 3RNKA 3QIBC 2LAAA 2Y36H 4NWTL 1JK8A 3AU1B 2IJ0C 3PGCA 2AEQH 1BVLA 2D31B 2IQ9H 1NCAL 5A2FA 1S9XB 3TH4T 4ZFOB 4U3XA 4YBLB 3BWAB 4F37K 1U2CA 4FOMA 3UDWA 4H8WH 2V7NA 1DQJB 3KPPA 5C0CD 4U6VL 5EOCL 3PWVB 4M03A 4FFVD 3IDMB 4HWZA 1LO0H 1A9EB 4YK4B 1MVUA 4XCCL 2YC1A 2X4NA 2C9AA 1M7DB 5FKPB 3EOTH 3VW3L 4D2NA 4Y4HB 3ARQA 1GGCL 5J11C 4Z7NE 3SPVA 3MV9A 4OF3A 5HI3C 4BQ8A 4IRJB 4Q58C 5ALCL 2W38A 3WFCL 5CJ5A 2IAMC 4J3VA 4GAYA 4QRUA 2YXMA 2IBZX 1XIWD 3K4AA 3MTRA 4M7LT 1QFWH 4LVHB 1ZV5A 4C83B 3P4MA 1HXYB 1OAQH 4JREC 5F71A 2YN5A 1PLGL 1CR9H 3BFOA 3D85D 5GGRA 4MD0B 1FLRH 4LSUL 4MQSB 3ULSA 2K7QA 4BA8A 1MRFL 4X6BA 1N8ZB 1LMKA 4L4VD 5FYKL 1RUKL 1DBBH 3LKRB 2Q6WA 2HKHH 3MRRB 4PREB 4HIHB 4NWUL 2J7LA 2H26B 4RGNB 3CC5A 4WFEE 5CCKH 1X4YA 2A77L 4ODBD 4JG1H 1PW3A 3CD4A 2KZWA 1IT9L 4AL8L 4KK9D 4MYWB 2Z31B 3IDXH 5MEND 1EFXA 3LEYL 4XPHL 4WTWA 2HP4A 2E7HA 2WQRA 3KDMA 5SWZD 5BO1H 5HHNB 3BQUC 4M3KB 4RX4A 1JWMA 2B39A 4KWUA 2YPLE 3W0WD 3G6AB 5D8JL 1T1ZA 1DBJH 4PREA 3U1SH 1QRND 5KSAD 2OTUB 4LSPL 5ABDE 3C5JB 5EO9B 4F57H 4GSDH 3WDHA 4CKVX 4UT7L 4MJIE 2ZSWB 4PY7A 1ZVSB 3CLFH 5HDBE 3WIHA 1XF4B 4KK8D 4YDIL 2P46B 4UIMA 5I19H 1R3HA 3NABH 3ILQC 3EW3B 4NT6B 4P9MH 1C12B 3OKNB 5DQDH 2EDWA 5HYJA 1U8MA 3U0WH 2AJSH 4G6FB 3WKNA 1NLBH 4BZ2H 3QCVH 2H6PA 1DBML 1CK0L 4P99A 1AR1C 1FG2A 4HUWB 3CDGA 4J8RB 4JO1H 3FQNB 3V5DA 3VI4E 4LIQE 3DSFL 3N9GH 5DDHB 5F3BB 4MNHA 1T3FA 5B4MD 3GJFB 4FQ1L 4DGIH 2EIDA 3CSYA 4P49A 4QRQB 1MLBA 2BRQA 3MGTA 2VYRE 1E4WH 2QQKL 1YEHL 4J3TA 3EOAB 4QRRB 4NT6A 3OKNA 4OIIL 3RIFK 5C0NC 4GRWF 4YDKH 3D39D 4DUXA 5C71A 5KTEH 1CDBA 3B9EA 4G3YL 3PHQA 3O2VL 2XYCA 4PRHA 3C09C 1IGIH 1HEZB 4KDWA 4NYLB 1PY4A 4P2RD 1A7OH 2R9HD 3PL6C 1PG7H 1QEWB 5B39B 5GRJL 2NY2B 2JE8A 2AJYH 3HN3A 4ZUVA 1FN4A 5B3JF 3GKZA 2EH8L 4Q0XH 2QADB 1SQ2N 5DMIH 4JKPL 4KRPD 4Y5YA 4P3DA 4Y2DA 4HK0B 5C0JB 1J0HA 2HJLA 4GKSA 2ICEB 4QHKI 4RFOH 4HKXB 4FQXB 5DD1H 1HZHL 1RFDH 5JW4N 3B3IA 3CVHH 3T0EC 1JNNH 4H88H 4AENA 4KJYB 5M7QA 1I9RH 5IF0B 3OF6D 3T1FA 3SCMB 3FN3A 1A6PA 2R69L 3MBXL 3N1PC 4KZEH 2ZUVA 3FB8A 1BQLH 1NCUA 2YSSB 4NCC1 4HK0A 4JN1L 2QSVA 1I3GH 2KBGA 2DQGL 3QH3B 3B9DA 5DO2D 1XF2A 5GGVY 5KVMC 3OXSA 5CD3B 5IVXA 3U7YL 2I07B 2ZG3A 4F7CB 4OZIF 4IS6B 3MV7A 2V2TB 1CL7L 2JB6B 4U33A 1EA9C 2DIBA 2YHGA 4JY6A 1WCQA 4AM0B 1FO0L 2VUYA 3GMQA 5IBTH 3ARGC 3T77B 4XVSL 1N6VA 3D48R 1JZ2A 1DQTA 3S96A 4H1LB 3TWCH 4I18B 4ETQB 5HGDA 4C56B 2VZOA 4JHAL 2N1KA 1IAKB 3VA2C 3WS3B 2HA1A 3S37H 2LU4A 4PJ5B 4YNYA 4LU5H 5ERWB 2NX5B 2AEWA 5BRZB 1VADA 2EZ0D 1F58L 3RUGF 3L3JA 2FDBP 5F93C 2JB6A 4OQTH 5GGQH 4QTIL 3VMNA 1TZHB 1Q9KB 5BVPH 3IXTA 3RVVC 4OTXH 1UQSB 3GSXB 5AZ2H 3IDGB 3REWB 4XH2B 1EHLH 5EFIB 3LKSB 3VGAB 3WS3A 1AH1A 3VGHA 3TP4A 1KPVB 4E41E 4TOYH 5GISL 5DMKB 5ERWA 4JFFA 1N0XL 4G8EB 1KSRA 1XGTB 3F58H 4U1MB 1HHGA 4YEEA 2ZG2A 3BPNB 1EBPA 3S36L 5EIIA 4DFHA 2IF7A 3C87A 3H0TB 5C09E 1AD9A 4MB4A 4NZDA 1S5IL 1FYTA 2CKBB 4P48A 4OLEA 5D7LE 1YY9D 2R4SH 2AI0L 1X5FA 4HWBH 5EO1B 1YZZA 3NGBB 1Z6JT 3MBEB 5GJSL 2ATKA 1HHKB 1TLKA 2WBJA 4N1EA 4JRXB 4YXHL 4NBXB 1KCLA 1AGFB 3FQWA 1RHHA 3HI1A 4NQCD 4G6AD 4TUJA 3VWJD 3RHWF 4K3DH 4XMPL 5C0BE 3NMEA 3RA7H 3RX8A 2GCYB 1ETZA 3CJJA 4JZOB 1WBZA 3B8YA 3SJVA 1PDKA 2VLKA 5JR1H 2NZIA 3HE7A 4JPKL 4WDIB 4ZNEA 4UMGA 4RGOL 5DRWA 5CJXC 1YNKL 4HAGA 1W2KT 2A73A 4C59B 2YRZA 3UTQB 4XBGA 3VFMB 2VXVH 5EBMB 4JRXA 2X70A 1R0AH 2O5XH 2H2SD 1W72L 3IYLW 4MXQC 4F80A 1J05B 1JF1B 2GW5A 2DTMH 3BH8B 5CGYC 5KN5A 1P2CA 3TNMB 3TNNB 2O5YL 4WHYH 4WHDA 5HYSB 1XFPA 3QWRA 5E99L 1IAIM 2LU3A 4I3RH 4P2QB 5I66A 1NGPH 5DJ6A 2LVCA 5CP7A 1FGVL 2XWTB 1MCRA 5EUKB 3HZMA 1WT5C 4WDIA 3ZE0E 1DEEA 3C5ZC 5H8DA 5T33L 4MDJB 3BN9D 2CPCA 1FHGA 5ISZB 4NCC2 2JIXB 5EBMA 4OZHF 1I3VA 1KG0A 4WEBL 2VDOH 1FPTL 1JPGB 3ZE1F 3FCTB 4M3JA 3O3EA 4WTXA 3WNLA 4HS8L 4O02H 2WIIA 4Z7WF 2HH0L 5TH2B 2AP2A 4JFQA 1KJMB 1K3IA 3L3KA 4BSJA 3PWPE 1N5AB 5SWSD 4FZ8H 5ENWA 1F6FB 3RZWA 2X9XA 3OGCB 1JL8A 1K8IB 1DQLH 3NPSC 4OQ1A 4HJ0D 2VDQH 2F5AL 3SDAC 1UWXH 3B2VH 1AFVL 4L8SA 4UT6H 5DJCA 3B9KA 4IRZL 5F8QC 1NL0L 5I75B 4PG2C 3RPIA 1YN7B 2CRYA 4DN3H 1U8OA 1FP5A 3RL1A 5FUZL 3F7QA 1H3VA 1QFPA 1R3IL 5T3XD 2CQVA 5IESH 5EU6A 3HTLX 4W4OA 1RPQA 3CFEA 3ULVH 4NN5B 3CMOH 1U3ZA 4Z0XB 1OLLA 3CXHK 4FMKA 5DJ2B 4PJ8A 4ZS7L 4F37F 2DDQL 1CXEA 1F45A 3DROB 1K4CB 1OF2B 5HJ3A 3ZKMC 1A6TB 2J4WH 4XI5D 3LEVH 5DTFA 3CH1B 2VLJE 1P4BL 3QA3A 5FGBC 1RIUH 2VB5A 1NC2A 1P1ZB 1RURH 1OOAA 2GJJA 1FVDB 4TRPH 1R5VA 3QIBD 3L95A 4W6XB 4EQ2A 3V8OA 5F1SA 2JJSA 3VRLE 5D72H 3BGMB 1G6VK 2LTQB 1D5IH 5CZVH 4ODXB 3FFDA 1LEIA 1AY1H 3CUPA 2NY3C 4JPWL 1SY6L 3DROA 5MEOB 5MHSD 3S35H 4OD3L 1HH6B 1IFHH 4PLKC 1SMAA 5JZ7D 1ZLUK 3ETBF 1ZGLA 4PJDB 2DI7A 2VLLB 4F7TB 4ZYKB 1JGEB 5I1AA 2ORBH 4ZXBB 5JXEC 1QBAA 4WY7H 4RBPK 1AKJD 1L9NA 3IFOB 4HQQL 3BZFB 2K9UA 3BSZH 5JHLL 3T2NH 5DJZA 4PUBH 1JI1A 3JV6B 1NFKA 5HI3D 3DVGA 3I6GB 3VWKA 4J6RL 1GH7A 2DN7A 3U46A 4PRNB 1HIML 2IAMD 3NCFB 4ODXA 1X4ZA 2YD1A 3MCKB 2ARJQ 1LDPL 3QEHB 2CD0A 4NO5A 2DL9A 3GHBH 4KKLC 4WVRA 4I9WD 2FIKB 4FFYL 3OJDA 5FYKD 1A4KB 1CLOL 4Q6IA 1OTUC 1AQKH 3EFDH 3TBWB 5F7DA 1EHXA 4HFWA 2XXCB 4I48B 5GRUL 5F1IB 5IFAH 5KZCD 1RJLA 3RBSA 4F7EA 3AREC 2BVTA 1T6VN 3V6FB 1OM3L 1RJCA 4YHMH 2ZJSH 3U36B 5IW3A 2P7TB 4LSDA 1ZLSH 1N7ML 2FX9H 3VFSB 1MHPL 1QSFD 4WJ5B 1I1CA 4PRNA 2Q3ZA 5D70L 2BJMH 5GZOC 2PW1A 5C0CB 2VDNL 4YZFE 3BD3A 2OK0L 3KAAA 4MJ2A 1M05A 3F12B 1P9MC 4M9OA 1AE6H 1ZSDB 1IGCL 4YBQC 3RWHA 4KRNA 5F1IA 4U7MA 3QFDA 4PJIE 3LPFA 3GJFK 1BZ7A 4KVCH 1XGRB 1YEEL 2YS4A 4F15B 2DQEL 1DN0B 3U36A 1BEYL 1HHHB 1I4FA 1T7ZA 5HHOE 1CE6A 3GSNB 3TBYB 4NO0D 2RIKA 5JQ6L 3PV6A 1HWHB 4NZRH 4Y1AD 2Z4QB 1P7KA 5C0CA 3GMMA 5D7IF 1XIWB 1U8JA 4PV9A 4JCLA 1JMXA 5GZND 5T3ZH 2IFGA 3L5JA 4JQVC 5C2BH 1V05A 2YPVH 3D3VA 5F9DC 2ICWB 3ES6B 3ZTNL 4ERSH 5ACZB 1IQWH 2BRRL 1YMHA 3D85B 4FHBD 4JKMA 3SHSA 5IG7B 1DN0A 1EVTC 2P5WE 4HFUL 5E2TH 4M7ZB 1HHHA 3V6OE 4NM4L 1RIHL 1KPRA 1CXFA 4L4VB 4CN4A 4NUJA 2OP4H 3BVNA 3RIFF 4NO2B 5IT2L 2DQCH 5MERA 1WAAE 3AS2A 4QWWC 3PIQB 3EHBC 5GS3A 4QXTA 1AR1D 1MFNA 4LPWA 1VFAA 2AXFA 3MLSL 2VAAB 5C0DA 2FL5B 3P0YL 3QDME 4P4KB 4UAOB 3VRIA 5JW4Q 3U82B 1DZBA 3W5MA 3HUJB 3TYGL 4L9DA 1TPXC 1A6WL 4ODTL 5JMOC 5MENB 1Z2KA 4WHYG 5CMAA 1I8LA 5ESAB 1KIQA 1ZHBA 1A1NA 1BM3L 3S4SG 5SWZB 4L4VA 5JLZB 3C8KB 8FABA 3DUSB 2ZUUA 5IBLC 4JHZA 2P8LA 4OF6A 3W0WB 1TQBC 3I2CL 3G5XA 5HHPA 5I1HL 1N2RB 5K9JH 3DXAA 1QRNB 5HSFA 5KSAB 1RUAL 2YD7A 1C1EL 2EYRA 2FBJL 4PJGF 1TVBB 3PABA 1KEGH 3E6FA 4DW2L 1LVEA 2O26U 1CFNA 1WC7B 3BKMH 1IEBB 4XHJC 1RUQH 4QF1B 2ZSVB 4UQ3B 2E3VA 5DJ8A 5IEKA 4CU8A 1A7RH 4M7LL 4PRPE 4RIRA 5FOBA 3VH8B 1K6QH 1VGEH 4N5UA 3WMSA 5I9QC 3MUGB 1NLDL 1MJUL 2G60H 4PB9H 1YEDB 5A1AA 2C3HA 4D0DB 4LMQE 3DVFA 4YFLI 5EN2A 2B1AL 3MROB 4LRIA 5TFSL 4Z7VA 1U8QB 3O2WH 3T0ED 1CICA 1H5BC 4ELME 1QA9A 3OSKA 4FXLA 4D0BA 4KQ3L 5IOPA 1P7QD 2I25N 5JOFB 5L8JB 2NMSA 4C57C 4H20L 5H2BB 1F4XH 5TDNA 4N8CL 2QHRH 1GIGL 2AJXL 1NCCL 3D39B 1CFQA 2JCCE 1KB5L 2C7UA 1ZLUH 1TJIH 3IXAA 4XZUA 5D1ZC 5FAAA 4Z7UF 3U6RA 3P73A 5HGHA 1DQMH 1IQDA 3MRHB 1PZ5B 3KYNB 2VITA 3EDFA 3QJHB 2WIMA 3X3GH 4EOWH 4P2RB 5JUEL 1U8QA 3ME0A 3MRFA 3ARBD 5L0QB 4LRNH 1KV3A 5B8CB 4P46A 5ITFB 3ARGD 3BGAA 4JFPB 3WIHH 1FE8L 1JTTA 4PJ9A 4Y4KC 1JGUL 5I71C 3OBAA 4M1DH 4YEFA 1II4E 4HJGB 4KHXL 4KRPB 1ZEAH 5H2BA 3WO4B 4YBHA 3NCMA 1G7LA 2L7JA 3UZVB 3F7YA 4QYOA 2CLVA 2VE6B 1PFCA 2HFEB 4FP8L 3WDIA 5FV1L 4AH2A 3L9RB 3VXUD 3BRFA 3G6JB 3W2DL 4YJZL 1J8HA 3WNOA 1X5YA 1H8NA 1I1RA 3QXUA 4JEGB 3U79A 5E2WL 4RMTA 4XMLL 2P5ED 4MB3A 4HJJH 5DD5L 4EKXA 3RVVD 3KPMA 3IFPB 3RZCC 2ESVD 1A0QH 4JFDE 1N5YH 3VD5A 4LCWE 3NACH 3UP1A 3DV6A 3MRCA 3THML 5L2KE 4MA8L 2UZXB 3C2AL 4KZDH 2NTSP 2M26A 5IMKB 5C7XH 4LSTH 4OGXL 5JNYB 3MYJA 3G6JA 5FIEA 4WHCA 3GK8L 3SY0B 1J7VR 4I2XA 4PRBA 4AIOA 4OV6F 3GJFH 3L1OH 1EEUA 1NC4D 2YWYA 3MV9E 4LMQI 4LLYB 4LSVH 5ESVB 3OF6A 1QLRB 2BSED 1L7IH 3IFPA 4MGXA 5J13C 5CZKA 1AGEB 1MRDL 5FK9B 3E3QC 5CSZB 3KLSA 3BO8A 4LKXA 5LVEA 3CX2A 4BH7B 4MAYA 1R3LB 1A6AA 4XCEA 4L3CB 1OTTC 1YPZE 2WW8A 1QO3B 4EVNB 1X5JA 3B8SA 3SY0A 2Y25A 3VXSA 4R0LB 1DBAL 1FCGA 3ZZ1A 5I8CB 1TJHL 3LHPH 1MEXL 5AD0A 3ARDA 2H32A 4LNRB 5EG6C 4WO4A 4C58B 5IUSA 4YDVB 4PP2B 1OCWL 5DI8B 5KSVB 3MRGB 4JRYD 3MNZA 5B38A 3JWOC 4ORZC 5LWYH 3X17A 4MCZB 3LPWA 4M48L 1MH5B 1CFVL 1BX2B 2C26A 3DBXB 3OPZL 5GS1B 3LRHA 4U1KB 1S3KL 2HFGH 4L3CA 1I7UA 5CBEA 3B4NA 1MFBH 4MXQD 1QO3A 4GXUM 3H9HA 4EVNA 1MCWM 4R0LA 3L3GB 5DUML 3LDBB 5CGYD 5D9SA 1MHHA 3JWOL 4K7PX 3U7WL 3WIIH 3BP4B 1H15A 3L3OA 4DZ8B 1CGSL 4P5KB 3Q6GL 3TBVB 2OYPA 3VXMD 5D4QA 3C5ZD 5D1XA 2EDJA 1P4LA 1MI5D 3QJFB 1WISA 1FLTX 3BPCA 3ZDXF 4WIQA 4ZFZB 2GK0B 3MNWB 1FVEB 4NFBA 4GS7B 4LFHG 2FX8H 3IDUA 5CEZH 4IJ3B 4N1HB 4NQCB 3TIDB 5ICZB 4ODUA 3VMPA 1GZPA 4R90L 3O4LA 3E6HB 3BP4A 4L5FH 1KTLA 4NM8H 1FL3B 4FFWC 3FFCE 4H1LH 4IMLA 4ONFL 5IJKC 4EUPA 5C08E 2CUIA 4PJBE 1MFDL 5HYJE 2DWDB 3V6ZB 5E5MA 5T1DH 2ITCB 3SDAD 2FJHA 1G9NH 3MLWL 2E6PA 3OV6A 2ZUTA 1L7TL 4KV5E 2GK0A 1SVZA 3IU4L 4OCRL 4R97B 3MLVL 2BC4A 3UEZA 4UQ2B 4TTGA 3VWJA 3X3FH 2I9TB 1OW0A 3QFJE 4DQOL 4QGYA 1U42A 5ANMA 5IV2A 2F15A 2EKSA 1QSEA 4RAVA 3RY4A 3P3YA 1T89C 2BSRB 3FMGL 5CKAA 2V5SA 1A3LL 1KCUH 4HWUA 5BVJB 1MWAA 4OD1H 5DC4B 4ODHH 5HPMB 3QI9D 4H8WC 5IEHA 1AGCA 3IRZA 2ARJA 3KYMA 5B3NA 5D2LB 3ZKMD 3K4ZA 4PRHE 4QXWA 4UV4H 2C3VA 1UKTA 3GRWL 1A5FL 4A6YA 2GSIB 2CXGA 1P53A 1Y18B 4JFYA 1WFOA 5DHVB 2F19H 5L8KB 2VXQH 2F5BL 3TN0C 2GHWB 2X9WA 4AEIL 1UM5H 2OL3L 1JWSB 3E2HB 5D2NA 2A6IB 3GJEB 5DMGC 1XGYH 5EU4A 3HC0A 5SWSB 2ZOKB 4H8WL 2Z93A 1JIBA 4CJ1A 5IKCB 5FB8B 2PW2B 4XMKH 3NA9H 1HKLH 2NY3D 4H5SA 2G75B 4MDIA 1FFOA 3MCLL 5CHNB 5D2LA 4L4TE 3KXFE 5F9WC 3T65A 5EH1A 1U8LB 2IBZY 3P9LB 5MI0C 2Y7QB 4RISH 5E5UB 1VFMA 1Y18A 4GXVL 3LY6A 1YEKH 1X44A 1JHTB 4MSWA 2A9ML 2BNRA 1Q72H 3DO7A 5TGBA 2A6IA 1KCKA 1WBYB 1U9KA 3GMPB 1FQ9C 4Q9QH 2PUQT 3BMVA 4YHNA 3FT4B 1FGNL 3F5WB 1QFWL 4HAFA 4OF8A 2Y06H 3CPLA 1G7QB 4LOUC 2D4FA 1H3GA 3IDNB 1OAQL 1WZKA 4KKLD 5IMOB 4HH8A 5IVXE 1IC5L 4Z0BH 1CR9L 1OTUD 1VESA 2EIZB 1BOYA 3D0LB 3QEUA 4MNQA 2BMKB 2QSCH 1VPOL 4KTDL 1MCPH 5HDOA 3ZT6A 3O3AB 2IBBA 3IVKA 3ARED 4KDTA 4U1HA 2C4FT 3QIBB 5F9JA 3KYAA 4WI2A 1UT9A 1BFOA 5IR1B 3L3DB 1UACH 3QXDA 1YUHA 5I0DA 3OKDB 4NSKA 4HC1L 5T5FH 3C5SB 1K85A 5I8EB 3F5WA 1M7XA 3QEQD 3O6FC 4C4KT 3OAYH 2BY1A 1OGAD 5CCKL 5GZOD 3QZWA 1A4JB 2YD5A 3SDXB 4M1GH 4APQD 3QXAB 3OR6B 1S7TA 3D18A 2EIZA 1FAIH 5E94B 5K9KA 1BFTA 4NDMB 5FYLE 2HJFA 3F8UB 3UTSA 4NGHL 4YBQD 2FEDC 1MLCB 5DK2B 1AKJB 1LK3H 2ZCKL 1CDJA 2BVOA 2J8UB 3K0WA 1G0DA 2JB5H 2P47B 4LCUB 5J11B 2JF1A 4NKIH 3M17B 4ZSOA 3D6GA 3LKNB 5DA0B 2IQAA 4LP5A 2VN7A 3BH9B 3IDJB 5FV2A 2IAMB 4WUKH 1W8NA 4RRPA 1UA6L 4EBQH 4UDTB 3P0VH 4JFFE 3QXAA 4LLDB 2FIRT 1F13A 4OFVA 4EEEA 3RWEA 3CLFL 2ENYA 4G9DB 1BGXL 1I75A 1SJHA 3T08A 5BS0D 4KK5C 2BXZA 3H9YA 4JREB 5A3ID 5KZCB 3FOLB 4JG0L 5I19L 3TBSB 4UDUB 3NABL 3FKUS 2YZ1A 1Z9SA 3O4OB 3WJLA 1JV5B 3TPKA 5E8OA 1NLBL 4JZJC 4QHLA 1QSFB 4XWGL 1FZMB 4LCYB 5B21A 3BP7B 2MFNA 3KS0H 2YA1A 3GMNB 4CMMA 4JO1L 3N9GL 5AG9A 2Q8AH 2W65B 2Y6SD 4QWWD 1XGUA 2B1HH 3EHBD 2J6EL 3ELAT 5HVGB 1KBGH 2R29H 4NCDA 5D7KD 4YHYC 1WFUA 4Y5XA 2ZNWA 5IFHL 1KEML 2VXTL 1I3RA 4G6JH 2OLDA 2YKLL 4KVNL 5GJTH 3QUXC 3QCUH 1A02N 3I50L 1EDQA 4YXKL 1HN1A 3FN9A 2YPKA 5LGHL 3BP7A 3SE4A 2VOTA 2X9YA 3SO5A 2E9JA 4NO0B 5TJWK 5IBLD 3I3DA 6FABH 1S7XB 4Y1AB 5BZWA 4XBPA 4NNPH 3WFHA 3GBNH 1PG7L 5DJ0B 2EEBA 4L8CA 4L8DA 1DE4A 2AJYL 3QP3A 3HI6H 5D6DC 3UROR 1LE9A 5B3JE 4Q0XL 2MOVA 5DMIL 1KJ3L 3K8MA 3PHOA 4U6YB 4XHJD 2WWKT 1Q9OA 3DX8A 2BOCA 2OSLB 1XCTB 1V3KA 3LH2H 4PRID 3G6DH 2C5DC 3WE6B 1U58B 1Q1JH 3C6LA 1NFIA 5DD1L 3EBAA 4RNRB 3SKMA 1RFDL 3LS4H 1S7XA 5ILTL 4RGMB 4WFHD 3CVHL 4CDGC 1JNNL 2F74B 3TYFA 3FO9B 5FYKU 2VABB 4K23H 3TBTB 5FO9B 4RFNC 5DC0A 3QCTH 2FECL 2P45B 4U1LA 2X89D 5IM7A 1UXSA 5ETUA 4E42B 4JQXC 2MHAB 2PO6C 1I3GL 4JO2H 2G9HA 4K7PH 1MUJB 3WJJC 4OI8A 3VFOB 3IDIB 4OZIE 2XWJB 3E8UH 4GUPA 3K74B 5D1ZD 4LVNC 4FG6C 1ACZA 5IBTL 4K7FB 2E9BA 5C0EB 4P9HC 3C09B 1BQUA 4X98B 5TQ0L 1DVFA 4U2ZA 1IL1B 2PYEE 5EU6E 4WU5B 1U8IB 3DYMA 4ZS6C 2GKIA 4CVXB 1X4XA 4M00A 1IKNA 1SMOA 3QEGH 1CVSC 5DVNA 4E42A 1S7SB 4KUZH 3L7FB 3L5XL 2FGZA 3ZYOA 1AO7A 3GSNH 4OT1H 3S37L 1VEOA 4LU5L 2CLRB 4JFEE 3VFOA 3RUGE 5CJQL 2FH8A 2VRAA 4P9HL 3TO4C 1VDGA 1ZT1A 4K94H 3EYOB 1AXSB 3VDAA 4OQTL 4XP4H 2P49B 1NAKH 3WUWA 1CGXA 4LSRL 5JIHA 4K7FA 1BBJB 1XR9A 4FMFA 5C0EA 4FQHA 3G9VA 1K2DA 4X98A 4P2OA 4DGYL 1NBYB 2GJ6D 5BVPL 2CGRH 2MTPA 4XAWH 3OHXA 4HLZG 3HC4H 3T0EB 4XP9L 1MHCB 4CU7A 4JDVB 4PJHB 2VKWA 4AQ1B 1G6RL 3G04B 1EHLL 2X40A 3MLZH 3DHJA 5ALBL 1P7QB 2RJMA 3PF2A 3LCYA 3KPRB 1FO0B 2W60B 1SBSH 1OQXA 3CK0H 1DJSA 3D69A 1LO3H 2Q1EA 3VFGH 4F3FA 1F8TH 2J1KA 4KU1A 3DURB 4CJ0A 3BIAX 4Z9KB 5I1LB 4K3EH 4JLRB 4PBWD 1MF2L 1PX4A 3K2UL 2VR5A 1WZMA 3DUUA 4J1UB 3HLAA 2GT9A 2R4SL 3LRGA 4MNGA 3MREA 1NEZA 3BJ91 3QNXB 4HWBL 3ARGB 4JM2A 3BIKB 4HUNB 2O93L 4PTUB 3GIZH 3GSWB 1AGDA 2MCPH 3C8DA 2A6KB 1TITA 1AD0B 1NGWB 4K2UH 4L29A 4GG6B 1FNAA 1JPFB 4OI9A 3VXUB 5FCSH 5J1AB 1YYMH 5ITBH 3A6CL 4Y19D 3RA7L 2DYPD 4PGBB 2Q7YA 1YYLH 1ADQA 2QEJA 3B5HA 1AGBB 3ARBA 5JR1L 4HZLB 5ADOH 3QNXA 2BCKB 1RV6X 2P5EB 1QSVA 3V0WL 4PTUA 1RVFH 3OKMB 4O2FB 4MA3A 5TDOA 2ESVB 1R0AL 2V2WA 3HS0A 2NYYC 1XMWA 5KOMC 1FNSH 1QOKA 3GNMH 3LSOB 4YHPB 4OAWB 3N06B 3W11C 3WS6A 1F4WH 1V3MA 4HWEH 2AGJH 4WUUE 3RVTD 1FZOB 2QQLL 4D0CA 3NCCB 3SDCC 3K4DA 1NGPL 5CILH 5I73C 3VXOB 5FYJE 1AGBA 1CU4H 1NC4B 1TNMA 5IROA 4ISVB 3AMLA 3HZVA 1I1AC 3MODH 1RZKL 3ZE2F 4M5YH 4OZHE 4JPVL 3LS5L 2VQ1B 5E2JA 1IAOB 3ZE1E 4CMHC 1YMMD 3RWDB 1A7BA 2NY4C 2E8YA 5I74B 4YHPA 1CZ8H 4O02L 4JO4H 4YGVB 2CIIB 4Z7WE 2YPLD 2UV3A 1IGTB 4PJDF 1JTPA 5FGCE 4NNXA 3WLBA 4JDZB 1HOCB 1HI6A 4NKOB 3S6CA 2R1WA 1MCDA 2DMBA 3BDBA 5L2JA 1W72B 3SGDH 1CS6A 1DTUA 4M02A 1QYGH 1OP9A 2VDQL 4X9IA 5ID0A 1I8MA 4FFWD 2VWEE 3ULVC 2UZIH 4JRYB 1T0NB 3X13B 3FTGB 1UGNA 2DF3A 2LFGA 5CJOH 4DN3L 3K2MC 3FOMB 3AAZA 2F53A 2CIIA 4RAUA 1RUML 4WU7B 1HSBA 5IESL 5IQ9B 2YD9A 5C07D 5FDWB 4LLVB 1GAFH 4OIBA 3ULVL 1XF5B 2XKNA 1I85C 4JR9H 4XCYB 5F88A 1FZKB 1QVOB 4N0CC 5DUPH 2BXYA 4MJ5A 3KPSE 4JHWH 2B5IC 3C60D 3X13A 3ARWA 4F9PC 3S98A 4ZAKA 3LEVL 4Z78B 3VXMB 2EKJA 3C5ZB 3PGFH 2D7NA 3KYOA 1MI5B 1NMCC 3DXAE 2X4TB 2IEPA 2DS4A 4Q2ZA 4XNYL 1NBZA 3T3PF 1Q94A 1WTLA 2OZ4L 2RFXB 2B7DT 4Z5RA 4Z77A 4HIIB 3OB0K 3O9WC 3TN0D 2H32H 2EE2A 1FZKA 4RWYH 2ARWA 1D5IL 2Z91A 3V0AC 1DUZB 1BIIA 5DMGD 1BLNB 3MV8A 3MLPA 2IH1B 1T03H 4HIJB 3S35L 5D7JC 2R56H 3R0NA 1IFHL 1F6AB 3HCVB 5TDPA 1PQZB 3BT2H 3SDAB 3SQOH 4MVBC 4BSWB 5E56A 1VKXA 4R2GC 3QIUA 1S7UA 5J6GB 4WW2A 5INCA 3A6OA 4OM0H 1OGTA 1MAKA 4Z7VE 3HNTH 5I1KH 1DQQB 2OQJB 3IRPX 4PUBL 4WWID 4XNQA 2BDNH 3IB4A 5J7CC 4G9FA 3VGFA 4KJPC 2R1XA 4WI3A 4N8VB 5EU5B 3RU8H 1RZ7H 1LP9B 3GHBL 4HCRA 4GRLC 2VDPH 2IH1A 4YHOH 2FNBA 4X6CB 1EXUA 3EFDL 3HKFA 4A2MA 1GGYA 3V52H 3DX7A 4IRSA 3QI9B 1ULVA 3MJ7B 3UZQA 3UJJL 3DV4B 3HMXH 3MCG1 1OSZA 3BW9B 5GSRB 4NOBA 4YHML 1BOGB 4YHKH 2FB4H 1ZLSL 5CEXB 5KS9A 4ZPTB 5DRXB 2EDTA 4Y2OA 3QHZH 5SV4A 1T21B 2EE9A 2MKWA 1HINH 3HUJF 1HXMA 4P0DA 1DLHB 1AQDB 2IADB 1LP9A 4QCIA 4EUPH 1U92B 4FQCH 5JOPE 5IGXH 4QRTB 3UC0L 4NZUH 3VMOA 3U2SA 3MSPA 3O6FD 3K1KC 2NY3B 1AE6L 1BD2A 1E27A 5E8DL 1J8HE 1BJ1H 3NN8A 1QACA 1WWBX 2ADJA 3U0PB 3FQXB 1NSNL 3KNBA 4LPUA 2FEDD 4EIZC 4N9GB 5LG1A 4IIQA 1D7FA 4OZGE 3ZHKA 5EOQL 2H2PC 3L5IA 3MRBA 4GH7B 4NZRL 43CAB 1KULA 4HZAA 4Z7QE 2OR9L 1XCQA 1U92A 4R4FH 3NTCL 3H9SE 5D7IE 3WFEH 1KJ2L 1MWAH 3RKDD 3UDWC 35C8L 3MJ9A 5T3ZL 1JZ8A 1C5DA 1OWRM 5EBWB 2YPVL 1MJ8H 3GBLA 4X5XA 2V5YA 1A1OA 1U3YA 4I2XE 1IQWL 1I3UA 3PWJA 3D9AH 5F1OB 4E41D 2X6MA 3FO2B 2DQFA 5T1KD 1RUPH 2FO4B 4KK5D 1A1MA 5JO5A 5E6IA 4AIXA 3AREB 4IDLA 2HJKB 1BF8A 2DKUA 3MLXH 3GSRB 1JPSH 3AFLA 2WANA 2DQCL 3GSQB 2O61A 5BQ7B 1LGVA 2X4UB 5C0IB 4YBLC 4HIEA 2N4IA 3GMRA 2MMXA 3QEQB 5F6HJ 2UWEE 3TO2A 5C86A 1IBGL 1OGAB 1XZ0B 2Z8SA 2XTJC 4JY4A 1Q0YH 2VZUA 4MAUH 4QGTA 4APQB 3VH8G 1G7MA 4JY5H 2FBOJ 4B53A 4X6DA 3UBXI 5DRNA 3EYUL 3IFNH 5DHVH 1S9VA 4FXGA 3STZA 2AEIT 3WL9B 5HDLA 1OAXL 4DKFH 4R96B 1D6EB 1X5XA 1ZA6A 1U3HD 1J5OL 4XRCA 3TIEB 3SE3A 4QRPD 5FUCC 7CGTA 2GEEA 5HI5D 4HGWA 4E0RB 4M61B 1X5AA 2CDEA 1JGDB 4NNYA 4GRMA 1MREH 2V9RA 4NRXA 4PJGE 1KEGL 3BE1H 4NKMB 5F9AC 3G6JF 1ZGLP 1S7VB 1Y6KR 3H3KA 1YA5A 3LAFA 4I13B 5C0GA 4M62L 1RUQL 1LO4L 4ZUTB 3CLEH 4LARH 3NFPA 5BS0B 5FUOL 4GMSL 4PJAF 1SM3L 2R2CA 2FHCA 2HVJA 5T3XH 3AGVA 1D6EA 4GQPH 1M7IB 1B6UA 4X8XA 1FNGB 1F90H 2AK4D 3KLAA 1J88A 1VGEL 4HS6B 4NBZB 1QFUL 3W9DA 3SKJL 3V2AR 3P4NA 3I75B 2VO5A 4EDWL 4I0PA 1IM9D 4ACPA 3HNVL 4PJXE 1I7RA 3CZJA 3O2WL 1GGBL 5F1KC 3W39B 4RGNC 4L3EA 1S7VA 4ZD3H 5C0FB 1S9YA 5A2IH 2V7HA 5EOCH 3OB0H 2VJXA 3QXTA 2VZTA 2AERT 2Z31C 1ZT7B 5FO7B 4OLWL 1ZVHA 3JV4B 2XI9A 3QDJD 1TPXB 5I17B 4J3UA 1VGKA 3ALPA 1T0MB 4OLYH 5I2IB 4HUMB 1EEZA 3PWPD 2PO6D 1PKQA 5BW7A 3VW3H 1MNUL 2H1PH 3FHAA 2YWZA 5CSBA 1GGCH 1WJ3A 1DQML 2I26N 2FWOB 2WINA 5ALCH 3GSOA 1VFOA 4OZ4A 1TQBB 3BHBB 4V2CB 1T20A 3MNVB 4QOKE 1Y6NR 4LDOB 4FG6D 1KYOJ 3JVGA 4FQIH 3BPLC 4KMLB 4D9QE 5IIEA 1TXKA 4WI9A 1U6AH 1UC6A 3PV7A 4M1DL 4OV5B 4ZS6D 1CDYA 3MOBL 2AKRB 3T3MF 1PLGH 3JSSA 5FOJA 4PRIB 1C5BL 5B38G 2CDGB 1T5WB 3PNWA 2EYTA 2VLRD 2QQNL 3TO4D 5I9QB 1TETL 2FR4A 4XPGH 4PJCB 2WNGA 2VLJD 3OR7A 1I9EA 4YHIA 5JIPA 1KB5B 1U41A 3SKNA 1FL6B 2IANE 4ONGH 1BFSA 5IFJB 1A0QL 4NWUH 4P3CL 5HTSA 1N5YL 2IPKB 3MRLB 3F7VA 5DLMH 4H25B 4ZO9A 5GRXG 3DIFB 5FECA 5E9DD 2F58L 4LSTL 5KVFH 3VXRA 4Y5YC 4H26A 4AL8H 4XHQA 1I8KA 1T1WA 3NCBB 4Y2DC 3UTZB 5KSUB 3UAJD 4F7PB 3MFFA 3QSKB 3B6SA 3V5HB 2H8PA 3ZKQD 3MJ8B 2R2BB 4MJ6B 3UPCA 4EI6A 5D1ZB 2A6DA 2X10A 5DK0B 2YD4A 3IKKA 3O41B 3VCLA 2D2OA 2BNRE 4LSVL 3L5WA 4ZQKB 2XQYG 1L7IL 2R2EA 3QO1B 3PP4L 4GW5A 1NFDA 2YRLA 1G9MH 4LSPH 1LE5B 3VD4A 2QADC 2SEBA 3QIWA 5IB2A 5I71B 4UT7H 5F3HB 2E7BA 4FTVE 4EUPG 4GQ9H 3Q0HA 4YDIH 4J3WA 1BJMA 5HY9A 3GGWA 4RA0C 5DK0A 3CNKA 4IHOB 3RWJA 3PWNB 2GJ6B 4ODWB 1DBMH 1CK0H 3QQ4B 1PEZA 5LWYL 5LAXA 4EXKA 3KPLA 2X05A 1CDIA 4K7PY 2HLFC 2E8ZA 3DSFH 4YHLH 2F54B 3OZ9L 1CN4A 1LE5A 4HPOH 3IJHB 5SX4H 2O5ZH 4FQ1H 1R5WA 2HFGL 2NYYD 1LEGB 4N90D 2VN4A 3W11D 3OG4B 2QQKH 1YEHH 5D2LF 1FRGL 3T4AA 3AXLA 4OIIH 3UTSE 3WIIL 3ARFD 1VSCA 3J7HA 1D5ZA 4YHZH 3SDCD 4WW1B 1PJ9A 4NC0B 2Q7NA 4QY8A 4N0UB 3KLDA 5BOZG 2H9GA 3QQ4A 1JE6A 3O2VH 3VFPB 4U1IA 3OKEB 4ZSOE 1ZK9A 4B7IA 4AYFA 4DAGH 2HRLA 2ZWLT 1XF3A 5J13B 5HHOD 2YOCA 2B8OT 1IGYB 2FJFB 5HHXH 2NY4D 2A1WH 4JHBA 1UZ6F 2EH8H 4JVUA 4FXKB 4JKPH 2D7QA 5FYLL 5E2UH 1DR9A 1PKOA 5DC9B 5K9OB 4Y19B 4O51A 4WNQA 4WW1A 1HDMA 2DYPB 4X7SL 2ZNXA 2ADIB 3GI8H 1VACA 1HZHH 5AYUL 5I1CL 5T1DL 1ORSB 4O2CA 1HCFX 1T4KA 3ULVD 3BYTA 3IS0X 1TZGL 2FYYB 3ILPA 1UWEL 5AAWA 5IVZB 4M9PA 3CCHB 3CXDL 3TCLA 5FHAL 2WBJC 4LHJB 1KB9J 1WIOA 1G7JB 4MWFA 1Z0MA 3MBXH 2PCPA 4R4NC 1I7ZB 2P24B 1BZ9B 2BVPB 1IVLA 4JN1H 2DYPA 2XTLA 3BPNC 3HHRB 5GGUA 2C3GA 1F6LL 2GUOB 2HT2D 4N0CD 4OUOA 1YJDC 3OQ3B 2D7TL 5JXAL 3DO3A 3NFNA 4QHNB 3BXNB 4TUOB 1RAMA 3HE7C 5BZDB 1FO0H 4UV4L 3NGBC 4XNUL 3DLQR 3X12B 2VDKH 3PXHA 4G43A 4XVSH 1S8DB 1YMMB 2IMMA 4NN7C 5HGGS 1FORL 3VFVA 1SYSA 2ADGB 3SDXF 2F19L 3FQTA 2VXQL 1DUYB 2YPLB 3MV11 4JHAH 3TF7C 3TVMA 4KKAC 1KTKE 3QZWG 4NFCA 5H37H 3UTPD 1NKOA 3MLYH 4RZCB 1XGYL 1YJDL 5FKAA 1ADQH 3O9WD 5JIIA 1SEQL 2J8UF 4KFZC 1LD9B 4XMKL 4WGWB 1LNUB 1HKLL 1FJ1A 3BXNA 5K9QG 2YD8A 3VD7A 4QHUB 1KIRB 5DUBA 3EDDA 3LEXB 4G6ML 3VXPA 1FL5B 3T04D 3EAKA 4R2GD 1KACB 3ZSSA 1MJJA 3HRPA 2BNQA 1YEKL 3T0BA 4ZFFB 4RRPG 4YIQB 1R3JB 1Q72L 4O58H 5DZOA 3RPKA 3LV3A 3OAZH 1FFNA 4I0KA 5C07B 5EUOB 1V7MH 5GISH 1YN6B 3W9EA 4JM4H 4KJPD 4HV8A 1KN4H 5EPMA 1OTSC 2Y06L 4MJIA 1UB5B 4HW6A 1N59B 4LHUA 4GRLD 4EIGB 3PQYE 3S36H 3QQ3B 2C3WA 3FQRB 2QKIA 1EEYA 1FH5H 5T5NG 5I1IL 2OL3B 3QWQB 3MMEB 3BPOB 1S5IH 4L8SC 2Z92B 3B9KC 4JANA 3DVNA 1AXIB 1HWGB 1ROWA 2HAZA 1CG9A 2QSCL 1MCPL 3OXRB 4XAKD 3AS3A 5J6HB 5GJSH 3PWLA 5EBLB 3U0TA 4X6EA 2EXYC 1GOFA 1UACL 4YXHH 3T8XB 1PD6A 3TN0B 1U8NB 2MPAL 5H35B 3IGAA 4W4OC 1AO7E 1J1XH 3IS1X 3C60A 5DVMA 2JJTA 3LMJL 2I27N 1D5XB 3HZKB 4GOSA 1ITBB 4PJ8C 1FAIL 4AJ0A 4BQBA 4ZPVA 1U8PB 5SX5K 4RGOH 5F9WB 2W9LA 5ID1B 1YNKH 3MRQA 2D4DA 5MI0B 5T3ZD 1E4XH 1QHOA 1E28B 4NKIL 1K8DA 2X4OA 1SJEA 1UH2A 4OJFH 3TPUA 1G9EA 4WUKL 5IW6B 4OLXL 4TVPH 3FO1B 3R1GL 4CAGA 2JJSC 2H2PD 4HH9B 2H3NA 1T5XB 5E99H 1DEDA 3MRJA 3WXWL 5I16B 2NNAB 4JFDD 1UADC 4B7LA 4Y16A 3BEVA 3UPAA 4DKEH 1ZHLB 4E9LA 1CYGA 3DMMA 3O6MH 1M6OA 5IB1B 5DS8B 4WEBH 1FPTH 4Y8AA 2D9QB 3CGTA 43C9A 1GSMA 2GAZB 1OVZA 4M8QB 3HG1A 1NJ9B 2GITB 3MV9D 3VWKC 5CBAB 3C6SB 4OFYA 1B4RA 1T5XA 5E70A 4NIKB 1CI5A 2B1HL 1F11A 2CLZB 4ZO7A 1CGTA 3LKQB 3O6FB 4GG8A 3OKKB 2XZQL 3MQIA 2XTJD 3GSVA 4Q6IC 2R29L 4I3SH 2FX7H 3SGKA 5CEZE 2NY1C 2F5AH 2DLHA 3NIGF 2BERA 1GHFL 4I3GA 1AFVH 1ZHNB 4XC1L 1D5MB 5GJTL 5FM5O 3QCUL 4IRZH 1MCWW 3IT8D 5B22A 1FIGL 1KLUA 2EIEA 3QG6A 5CKGA 3SKOA 3D25A 2W0FA 3BWUC 4HPYL 2W07A 4HCRH 4F33B 1ZT4B 1LEKB 1R3IH 2PR4L 1HH9A 4N0FA 1U8KA 4PJ5E 5C6TH 3DYOA 2RAMA 3FT3B 2NXZC 1WBXA 2X4SB 3MGOB 2V9TA 2XWBB 1OP3K 3MOAL 3QT2A 4LSQL 1MCKA 1IKFH 4E41B 3ARTA 5T1KB 3IJYB 4NRZA 1YEJL 3WUWG 4XP5H 3RDTA 3MRKA 3FQUB 1KNOB 1Q1JL 3OB8A 4PJHF 1EFXD 3WLWD 2LU7A 3V4VH 1K3ZA 3QRGH 3HPLB 1IAMA 4P57A 2DJ4A 4JZJB 4NC1E 4RX4D 3FN0H 3SDDA 3FT3A 4ZUUA 3MGOA 8CGTA 4QHMA 3RWFA 2XWBA 4NQVB 2BK8A 1ES0B 3X11A 1ITCA 3NA4A 5FYJL 4JPWH 2IBGA 1SY6H 1X5HA 3HI5L 3KGRA 3IJYA 3EYQC 4UI2A 1HKFA 4QT5A 4JO2L 4GLRI 4NZTH 4ZDHA 1J8KA 1HNFA 1U3HB 3QUXB 3KJ6H 1NEZG 3EYSH 2ERJC 5C09A 5BXFA 4QRPB 3G5ZB 4HQQH 4O4YH 3E8UL 2APVA 5IQ7L 1ACYL 4PRDB 5HYJD 5D7LA 2I9LB 3CSBA 3MJ9H 3QNZA 4GG6F 3ARXA 1OAKL 1XIWC 1E0OB 4J6RH 2AJZB 1N64L 5E7BA 1HIMH 4JGJA 4XGZB 2QR0B 2P8PA 5C1MB 2GTWA 4UZGA 4FFYH 1CLOH 3CVHB 2NLJB 5TF0A 4TSAL 5H37G 4F2MB 4OT1L 5GRUH 4WI6A 4AK1A 1I8LC 5JHDA 5C0BA 2AK4B 3BQUA 1CFTB 4XP4L 5C3LD 1NAKL 4FQJL 2BSTB 5E08L 2R2HB 2CMRH 5F7NC 3HE6A 1B0GA 4XAWL 3HC4L 1Y0LB 1FYHB 2HYMA 2G5BA 4XGZA 4YPGB 4PRHD 1QFHA 1FFRA 5HHVH 4P2QE 1A64A 4D8PA 4YO0B 4R4BA 3MYZA 1IAIH 2OK0H 1W0YT 1SBSL 3CK0L 4KRMB 1JRHH 1IGCH 2YD2A 5HHQB 3QDJB 4YAQA 1LO3L 2M2DA 1CFSB 1F8TL 4UT9L 4YDLC 3T4YA 5ISZE 2HG5A 3PWPB 1PGRB 2PO6B 2IALB 1N6QL 1YEEH 1W8OA 2J12B 1MIEH 4Y2DD 4K3EL 4G8FB 1UWGL 3AB0C 2HMID 4OZFA 5E8NB 4PGDB 4MMXC 4H0IA 5SX5H 1IM9A 4X0KA 5T1LA 1TCRA 1Q9WB 2BVYA 4V1DE 4I4WA 5JQ6H 4LPCA 4L4TD 4AEEA 2C1OB 5IK3B 3LKPA 4X6FB 1KELL 4LRIC 1JUFB 2HLAA 2JELH 2PTUA 4YO0A 1CICC 5GIRA 4U3HA 4WTZA 3EOBB 3V4UL 2AEPL 3NFSL 4ESKA 2MCPL 4WEUD 2NXYC 4D94A 1FV1A 4WI4A 5HHQA 4K2UL 3VFUB 2DM3A 3QO0A 3F6IA 3QDAA 2J8OA 1AP2A 1BVKA 3NPZB 1G6RB 1T04B 4NM4H 3WHXA 4PY8J 3O11B 1RIHH 2VLRB 3OX8B 3R8BB 3TO4B 5JORB 3MACH 1UH3A 1WTGT 1XAUA 2VLJB 3PL6A 3MV7D 4I5BA 1RVFL 1D6VL 3DX9A 5B4MC 1AR2A 5E2VL 4P46C 3A0OA 4XWOC 2XICA 5IMMA 3MLSH 5C9JA 1FNSL 2HLFD 4M6MH 1EX0A 4PJ9C 3P0YH 2HTKC 3VFUA 3K7UA 4LQ1A 5E9DB 1G6RA 1A6WH 1BD2E 1FNHA 2QL1A 3OX8A 2IPTH 1BQSA 1NQBA 3P77A 2WUBH 1EHAA 2ZZUT 4PGEA 4XNXL 3T2OA 1U91A 1O7SA 3MO1B 3R8QA 2HTLC 5FYLD 3I2CH 4M5YL 4Y89A 5I76A 1OY3B 1KLGA 3X14B 1RUAH 4Z8FL 5JPNB 4OCXH 1C1EH 1H0DB 2FBJH 2V2XB 4DW2H 1IMHC 3K8KA 4WCYH 1EFQA 4PJDE 1B0RB 2BVQA 1ND0B 3HZYA 4XCNB 4XNZB 4HMDA 1OP3H 3RNQA 3BGFB 4JFFD 4M7LH 2AJ3A 4UTBH 3QULB 2JKXA 1NLDH 2YN3A 3WEXA 3EFFA 4PYGA 1L0YA 1X7QA 3S4SB 3X14A 4OSUL 4OIAA 3EO1B 2EDYA 2B1AH 1LP9F 5F97E 2ITDA 1VFBA 1S7RB 3RFZC 4X6CF 3RVWC 5L6YH 4UINH 2J3SA 4MCYB 1HNGA 4MAYC 5DJYB 2MQ3A 2WBJD 1JZ7A 4LLWA 4H20H 2VDRH 5GSVB 3RVUC 4R4ND 4U6TA 5HGAA 1EERB 2NR6C 5KSBB 3LB6C 4OKVA 4X4YB 4N8CH 1GIGH 3ARFB 4YX2L 3SDCB 1NCCH 3LN4A 1CLZL 4LKCB 4JHWL 3CX5J 5I73B 3ARDC 4U7KA 1RK1A 4WO4C 4HWNA 2FSEA 2Y5EA 4PJ7B 1S7WA 3N50A 4PJIB 4X4XB 3DRTA 3PGFL 4KTEL 3SJVD 1HHJB 2VLKD 3HE7D 1FFPA 3GKWL 4XTRD 5HHOB 4FS0A 4JKLA 3RAJH 1QQDA 1I7TB 3T3PE 1FE8H 4FZEL 1ONQB 4PJEB 4R26H 3GMOB 2NY4B 4LCCA 2MQCA 5C0AA 3BDYH 4KI5C 3KPNA 2W9DH 5EZJB 5JA8B 4KHXH 3IU3A 4X4YA 4KKAD 3ARFA 4R0LC 2WZPD 3MA7B 4YXLH 4FP8H 4ZUWA 3ZDZF 3QWOA 1IZKA 1LK2B 4NHUA 3W2DH 1JN6B 3QWRD 1EK3A 4PJIA 3BT2L 4BQ9A 4DZBB 5JPMB 3DI3B 3O3BB 3QHTC 5EULV 1KTDA 1X5IA 5H94B 1VA9A 3JTTB 3LN5B 3T0VA 4PJFB 4X8JA 1A3QA 1G7PB 5F44A 3GMLB 1I7TA 2DM7A 5D1XC 3GMOA 3HNTL 1OP5H 4PG9A 1K4DB 2BDNL 1NDMA 3RWCB 5FO8A 1INQB 5D93C 4MA8H 2R1YA 3C2AH 3MA7A 3HAEA 2APBA 4EJ1C 1RZ7L 3MFGB 1NMAH 2DMKA 2DOCA 2VDPL 3IDYC 4U1JA 2AQ2A 2D03L 1S78C 4DVRL 5LGJB 1OAZL 2OXHA 1OTSD 1QLEH 5JW4M 2B5IB 2P5WA 4F58L 5INDB 3V6OA 1A47A 3ALWA 3CFKA 3M8OL 1PG7X 2PYFA 5BOPA 3IJSA 5DHYB 1CQKA 3VXNA 3B9KD 4JPIA 3CXHJ 1NMCB 4CW1B 5DJXB 3FL7A 1WAAA 5HVFB 4GS7C 3HUJE 3VD9A 2FJGB 5MENE 1N3NB 1U8HA 1OQOA 2EXYD 5A16A 3K1DA 1RZJL 2X7LA 3VWJC 5JDJA 4Q9BA 1JHLH 3O9WB 3Q1SL 1OW0C 4FQCL 3QDMA 5EU6D 1R6VA 4NZUL 1CT8B 1DBAH 5CWSB 5DQJB 1F42A 1EEQA 1TJHH 5GRVL 1UCBL 3W0WE 4OUUA 3TA3A 2JLLA 4HS3A 2WBKA 3VJ6B 3QUYA 4PJ8D 2EXWC 5F89A 3JTSB 4K3GA 1QBBA 4MD5B 5DHYA 5DRZA 1QRNE 4R2GB 2BHUA 4HT1L 4JFED 4CW1A 5IW1A 2CRIA 4M48H 4R97C 3M1BB 4KHTL 1NC2D 3PP3H 4X4ME 3VXQA 5KG9A 2ZOLB 2CIKA 3D1MC 2FJGA 1N3NA 5F1NA 5F7EL 1KPUA 1KTRL 4X99B 1ED3B 3V0VB 4ZMAT 5IMLA 4WFFE 1PBYA 5D2NC 1MWAL 4MQTB 5DUMH 4YDJB 3QQ9C 4GAGH 4GRLB 3U7WH 4U1SA 5IHLB 1HSAB 4PV8B 2WAHA 2XRAH 4A6YL 4N0RA 2CRMA 4PR5B 4XX1E 3D9AL 5ESQA 4MD5A 3BN9C 3O6KH 4HUUB 4KKCC 5MEPB 4U1GC 4PRPA 1RUPL 3O8XA 3GHEL 2A83A 2JCCB 2JK5B 3KHQA 4B5EA 4F9LA 3BKYH 1C08A 1SJXA 2I24N 4X99A 4P4RA 3CSGA 3NBNA 2COQA 5DGQA 5JW3H 2FATH 4TSBH 4ELMA 3S37X 2BFVL 3VWKD 2ZCLH 1UJ3B 3IETB 3D39E 3V5KB 1NUDA 3MZGB 4M7KL 4JY5L 1NGXB 1R24A 4CNIA 1HQ4B 3WSQL 5A40E 5MEQB 3IFNL 1T1XB 1MFDH 1MSPA 2Z35B 3TV3L 4MQXD 4P2RE 2VISB 5J89A 1KJ2B 2JCCA 2NY1D 4DKFL 1HILB 4MX7B 4J23A 3L7EB 4ODVH 2W59A 4J12A 4HKBA 5KAQG 3BUYB 1FZJB 4KDTC 2WK2A 4MB5A 3RNKB 3IU4H 3STBA 1FIEA 4UOW0 3D87B 4HKZA 3RVXC 3PGCB 1HYSD 1BVLB 3EOYG 3VU2A 1WCBA 2HKFL 1MREL 3HNSL 4DQOH 4OCSH 3CFJA 2Q76B 2A0LC 1I8IA 3LQAH 3CLEL 2XNAA 3EZ8A 2NXZD 2V7NB 3CVIH 3KPPB 4LARL 2X42A 4XI5C 3FMGH 4XVJL 4PJAE 2X09A 1KJ2A 4MX7A 1MVUB 3HR5A 4PJCF 2YC1B 3T0AA 1X6LA 2X4NB 2E7LA 3OWEA 1F90L 2V9QA 1FZJA 2YBRA 2X1PA 3DTXA 1KGCE 5FYJD 1TVHA 2UY7A 4MXVF 3SGJA 1NGZA 5D1QA 2X4PA 2DI9A 3SPVB 5EO0A 4UU9A 3MV9B 2B20A 3M45A 2F5BH 2KQNA 4AEIH 1CD0A 3EYVA 1A9BA 1SYVA 3DARA 2OL3H 4F8TA 5HGBA 2Q76A 4IDJL 4ZD3L 4GAYB 4QRUB 4JFDA 4LCWA 1EH9A 5L2KA 2XTJB 5JZ7C 4LLMA 3QDGA 4MD4B 5FGSA 5E8PA 3P4MB 3F7RA 3MCLH 3D3VD 4NN6C 3EYQD 3WFZA 4OLYL 5CLTA 5E1AA 5GGRB 2H1PL 2KUTA 2FLBT 3ARRA 3ULSB 3WJLC 1MRCH 4GXVH 2XFXA 2DBLH 3RTQA 4X6BB 2A9MH 4LGPB 3L3HB 4ODSH 3P11H 5HHMD 5KBNC 1J1OH 3NCJL 1ORQA 3ULUE 4FQIL 1OT1A 2Q6WB 1FGNH 1U6AL 2XY1A 3MRDA 1LO5A 4MD4A 1P9MA 1IGML 3CC5B 3TGXA 4HXBH 3O45A 1YPZA 4X5LA 4FFZL 1IC5H 1JGLH 4Y5XC 4ZOBA 4XVTL 4TNVK 3O4OC 1EFXB 1TZIB 1XGPB 5E00A 1UYWH 5FM4A 4KTDH 1VPOH 1RZIA 3KDMB 3L3HA 3KPSD 3SE4C 3SQBA 3VFNA 4ZUSA 3S5LA 1JWMB 4XPGL 4HC1H 5IHZA 2V6HA 4IOIB 4BKLA 4ONGL 1T1ZB 4LBEA 3DXAD 5GPRA 1GVIA 2Q86A 5DLML 5SWQA 1MCQA 2DIJA 3ARPA 4P5MA 5IB3A 5TQ2H 5KVFL 2P42B 4PY7B 4X80H 1G9MC 3N1GC 1TZIA 4ONHA 1XGPA 1FNFA 3BP5A 4NGHH 4BFGA 4UIMB 2OR7A 1WIPA 3I02A 2ZCKH 1R3HB 3RX7A 3EO9H 5CINH 3C6LC 1UXWB 5HYJB 2IH3B 2BNQE 1U8MB 1CFBA 3OAUL 4IOIA 5D5ME 2H6PB 4NQCE 4IEFB 1FG2B 3CDGB 5GZNC 1UA6H 3V5DB 1G9ML 2UY6A 3K8LA 4MNHB 1T3FB 3BPLB 1GPOL 2NY0C 1CICD 3VGEA 4KY1H 5F96L 3FB7A 3CSYB 1QR1A 1BGXH 3S9DB 1MLBB 2FD6L 2NXYD 4GQ9L