3BAEL

Crystal structure of fab wo2 bound to the n terminal domain of amyloid beta peptide (1-28)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
218
structure length
218
Chain Sequence
DVLMTQTPLSLPVNLGEQASISCRSSQSIVHSNGHTYLEWYLQRPGQSPKLLIYQVSTRFSGVPDRFSGSGSGTDFTLRISRVEAEDLGVYYCFQASLVPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WO2 IgG2a Fab fragment Light Chain Kappa
publication title Amyloid-beta-anti-amyloid-beta complex structure reveals an extended conformation in the immunodominant B-cell epitope.
pubmed doi rcsb
molecule tags Immune system
total genus 51
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2007-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
L PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3baeL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3baeL01
1G7PA 5EOQH 4M6NH 1F4WL 4MDJA 1ORQA 5ITFB 4RBPH 3NCYP 5IV2A 2AJXH 1I9IH 3MNWA 3MNVA 1AHWB 5DJ8A 5D1ZC 4EDXA 3BXNA 2G5BA 4OTXH 5T1MB 4FQHB 4HUKB 2EH8L 3PJSB 4QRSA 2EDHA 3MRRA 5DUPL 1U8KB 4JFEE 4R4FH 5DF0A 3BHBA 4UOJA 1G7MB 3KPQA 4TUOA 2Q87A 3NN8A 4XBGB 4XVUC 5GJSL 3BZ4B 4CRPA 3F8UB 4M8VA 3RWGB 1A3QA 4EI5D 5MP6H 2H41A 3HE7D 5HHOD 4TSCL 1W72B 3SDDA 1QACA 2GITB 3NACL 2W1NA 4M6NL 1JN6B 1WFTA 3S6CA 3AU1A 3HPLB 1L9MA 4M5YH 3BAEH 4PD4K 5J13B 1WBZA 1CICB 3QCVH 4NO5A 4MLIA 3IDXH 3RWFB 1A0QH 4CN4A 3X11B 3QEGH 2ZJSH 4NRZA 1CDIA 2AV1B 5GRUL 4LRNH 5IMOA 3H9SB 5C0RH 4JFYB 4R4FL 5TDOA 2Z35B 4N0RA 5I1AB 1GIGL 1TQBC 3MRNB 4U6YA 3QFDA 5E2UL 3VFOA 2VXQL 4NWUH 4Y19D 3S96B 5MP6L 1TVDA 3ARED 3SDDC 2X4TB 3O9WB 4NNXA 4XX1E 4OFDA 1FSKB 1TVBA 1UENA 2XY2A 1N59B 3VRJA 3EDFA 5F6IC 3QCVL 3HFML 4N1EA 5DURB 5IVXB 3DTXA 1F2XK 3IDXL 4PJIE 8CGTA 2ZJSL 2QADD 3HUJF 5JOPD 1CFQB 3QIUD 5J1TC 4UTAL 5T1LA 5EIQA 1UA6H 3MUZ1 5HDLA 3I02B 4GW5A 3LN9A 1MH5A 1K5NB 2R4SH 4NWUL 5IB2A 3TH3T 2UVFA 3KPRA 3PL6B 3FO1B 3U7WH 1HIMH 1D3CA 4PGCB 2IFGA 1FFOA 4U1GC 5D2LF 4X5WA 4YDVA 2UV3A 2A73B 2P4AB 4EVNB 1VGEH 5HGAB 4RNRA 3HAEA 1XGUB 4LOUD 5C6TH 4PBXA 1Z9MA 3KDMB 2ZUSA 2D7OA 3OJVC 2IPUK 2JJWA 1UA6L 4LPXA 5H37H 5C0IA 2JIXB 2VXSH 3PP3K 2J12B 4FHBD 3SDYL 2R4SL 3VFSB 4FABH 5KVEH 3ARQA 1XCQA 4JG1H 4Y88A 5LCVL 5H2BB 4EUPG 4JLRB 1HIML 4YHYC 4XRCA 1A6VL 2AJUH 3G6JA 3S97C 4I48A 4KRPD 3O11B 2A6KA 1ZLVH 1VGEL 1YMHB 5L8KB 5GISH 4R4ND 1SHMA 3SKMA 3ZDZF 2V17L 4LHUB 2CDGB 1MCIA 2EDFA 3W0WB 5C6TL 2P48B 2ARJA 3B9KD 3WDJA 5HYJA 2CJUL 2AGJH 1RIVL 2VXSL 4JJ5B 5GIRA 5MERB 1TQCC 2OJEA 4Q6IB 3RTQB 1M71A 4KKBD 4FABL 2V5RA 4I3SL 1B9ZA 1IJ9A 2AXGB 5C0CB 4FOMA 2Y6SD 1F4YH 3X3FH 4WV1A 2VLKB 2AJUL 5K9JH 3ZMRA 1WTLA 2IQAB 5SWSA 2XFXA 3ROOB 2ESVD 4JO2L 3QFJB 4ODBD 3GMOB 2UUDH 5GISL 3ALXA 4ZMAT 1RHFA 3V8CA 5JZ7C 4FQXA 5C0BA 1RK1A 2EIEA 3ZYJA 2XTJE 1OLZA 3KJ4B 1LP9E 4CJ0A 2AV7B 4K3DH 1N0LA 4ODVL 5IBTH 1CG9A 3WNKA 3NCCB 1I7UB 1G7LB 3FTGB 8FABA 4JJHA 4DUXA 3UAJC 3V7AG 5ICXA 2VLLB 3JXAA 3SOBH 1F4YL 3OTTA 4G9FA 4N9GA 3DRQA 5FM4A 5K9JL 4WV1C 3OHXA 3MV9A 3NIDF 3FFCD 4U1HA 1YEFH 3K2UH 3LN4A 1QRNE 1C7SA 4JPIA 2YD7A 2FR4B 3IDYB 1YJDC 2ZUVA 4FQXC 2X70A 2WV3A 3BZEA 4KZEH 4MQXD 1IGTA 4M93C 1T2JA 4CW1B 4WY7H 4ZXBA 5EDXA 4Z7UF 1JWUB 4DKFH 1KLUA 3RDTD 3PXJA 4JFPB 1IQWL 1S7TB 4ZO7A 5KOVC 2ZG2A 1Y0LB 3X12B 4P99A 4I2XE 3TFKD 4Z7OE 1VFBA 3X14B 3VGDA 1FFQA 4RDQF 4ZPVA 3SOBL 2HT4D 5B3JF 3TN0D 3WIFA 1YEFL 3HZKB 3K2UL 4MNGE 4D8PB 3OL2A 1QBLH 4OZIF 3GUTB 5DD0H 4NUGL 1SJHB 5E0QA 1MI5A 4V1DD 4ZOBA 1E4JA 5J9PA 1GOGA 3CX2A 1T7VA 4WY7L 1U8NA 4ZXBC 4OCLC 4DKFL 3ZHLA 2P8MA 1WBYB 3INUH 3L6FA 4NKDA 4XTRD 1NFDA 3U46B 5MHSE 1Q1JL 2I07A 4PY8J 4K8RH 4UV7H 3ARRA 2FATH 3ZKXC 1AD0B 3JUZA 4H20H 4HBCH 2VLMD 1LNUA 1Q9OB 1PX3A 4GSDH 5DD0L 5E94A 2RHEA 3CH1B 4DAGH 1T20B 2AS5M 4XI5C 1BJMA 2ITDB 4HKZA 3THMH 2C1OA 4M8QB 1DVFD 3O4LA 4X4YB 5ESVB 2XZAH 1CFSA 1U95B 4MQ7B 5BV7L 5DVOA 5EU7E 3AAZB 1ZT7B 3INUL 3DROB 4NBYB 4K55A 5HD8C 3PIQA 1X4XA 1FV1B 4GUPA 1AE6H 3C60A 3CPLB 3H9ZA 3B6SA 5E8PA 4UV7L 2V9RA 3AY4A 2FATL 4RGND 4H20L 4NYLB 2APBA 4M7LH 4CU6A 4YHLH 2EH7H 4GSDL 3ZT7A 2H8PA 4MZ2A 5A2LH 4C55A 4DAGL 1D5BB 3THML 1E27A 4PJHF 4TN9A 2DLFH 3FOMB 2BNRE 1EHAA 3DX6A 4HC1L 4YHIA 3LD8C 4OV5A 1UXWA 4JFOB 3SJVD 2JB6B 3HR5B 3H9YA 3U0TA 3BFOA 43CAB 3NBNA 4HS6B 1N6QH 1AE6L 2IBGA 3BP4B 4LLVA 3C60C 5C07B 1ZGLP 2QQNH 5C09E 3AY4C 2ADJA 4GLRH 5BV7B 1ES0B 1DSFH 4YHLL 2EH7L 1P7QD 2PW2A 1IEHA 3BGFC 3VH8G 3WEXB 1MF2H 2BY0A 12E8L 3NFNB 1UWGH 4HXBH 5BQ7B 5HI5D 5IBLD 4TRPH 5JUEH 2DLFL 4XNUL 3FB5B 5ID0B 3WO4B 2Y9RT 4OCRH 2DL9A 5D8JH 5DYOA 1R3IH 5AZ2H 4TQEH 2J8UE 3SKJH 2F54B 3MLZH 3HI6H 4LLWA 1HHKB 2IMMA 1KEGH 3LKQB 1N6QL 4P3CH 4DCQB 5HI4D 2QQNL 1BVKA 4PRHB 4KI5D 2IH3A 2UWEA 5JHDB 1DSFL 5JW3H 2GCYB 1T1YB 3ILQD 2DWEA 4DQOH 3QUKA 3GIVA 1OW0A 1MF2L 3MRCB 4GRWH 1INQA 3N1GC 1UWGL 1Q0XH 2NY1C 1DE4B 1IAKA 2DBLH 2DQIH 4FFWD 4TRPL 4U0QB 5JUEL 2PUQT 4JVUA 5B39B 1UYWH 1P53A 1SEBB 3DECA 4OCRL 1EO8L 5D8JL 5AZ2L 4TQEL 1K4CB 3MLZL 3GJFA 1HH6A 5E2WL 1J8HD 2WBJA 4WUUD 1HNGA 2XXMB 1RZIB 1NGYA 1WSST 1KEGL 4RFNC 4P3CL 2LVEA 3UP1A 1TIUA 4WTWA 1PQZB 1LDSA 4MJ6A 5LG1A 1OAKH 2NY6D 2VLJA 3WXVH 5JQ6H 4ELMF 4CAGA 4DQOL 2OLDA 4AH2B 2NMSA 1OW0C 4NQDE 2ICEA 1Q0XL 2DBLL 3FFDB 2DQIL 1EBPA 1F90H 2X7LB 5EU6D 2WLYA 1UYWL 3QDME 4ORGB 2YXFA 1AI1L 2DTMH 2E8ZA 3RUGF 5C0FA 4O4YL 5GGRA 3GMNA 5E7BA 3A6BH 5HHPA 1RZFL 1I1CA 2E9IA 2NY5C 2WBJC 5CBAB 4YAQA 4IS6B 1WC7B 5HGHA 3TCXA 3QIWD 4HH9A 1HYRC 2H32H 2ICWA 3MCKB 4RMSA 4YNYA 3AXLB 5D96C 4LLYA 3QH3B 4L8DB 4W4OA 1OSZB 4G8GB 2Y36H 3T08A 1K2DA 2I26N 5L2JB 1F90L 5D71L 1RJLB 4PGDB 5BS0B 3VGGA 2DTML 1E6OH 1FPTH 4OZGB 4KKAC 2DIJA 3V4VH 3KS0J 3GMPB 3QPXH 2HMIC 3T0EE 5IR1A 3KPLA 4GKOA 1X5FA 5CGYC 1ZTXH 3N9GH 4GRWB 2EE2A 2AEWA 4JRYB 3V5DB 5TH2A 3V4UH 2MWCA 3GDBA 1EAPA 2FJGA 1KTRL 5I66B 1JGDA 3V5HA 4W4OC 2LU4A 5D1ZB 1P84K 2Y36L 1MHCA 2BSSB 1PY4A 4RGMC 3JV5A 1RJYB 4J12A 1ZLWK 1E6OL 4G8FB 5FK9B 2ZKHH 1FNGA 4N0UE 4P4KA 5T3XH 1GOFA 1G9EA 2FWOB 4D9RE 4ZUVA 2DYPA 2KQMA 2V7NB 5MEQA 3IF1A 5GGRY 1BZ7B 5FYJD 3H6JA 5GRJH 1ZTXL 3N9GL 1AD9B 3VG9C 4KMTH 5GS0D 1TJHL 1D5ZB 3V4UL 1T89C 1N5AA 1ORQB 2R9HC 4FXKA 5DJAA 4F7PA 5AAMA 3MNWB 5IF0A 1LGVA 3MNVB 4EDXB 3VG0H 4AENB 2G5BB 3SKOA 5I75C 4MCYA 4QRSB 4LKXA 4QCIA 3VFGH 1JYVA 3VXMD 4HMDA 1LMKA 1P4IH 1QUNA 1T1ZB 3BHBB 3ZT5A 2Y1VA 3KPQB 3RQ3A 1FORH 4TUOB 2ZKHL 3NN8B 5T3XL 5HYQA 4P4KC 5J7CC 3HAEH 4LQ1A 3WLBA 2OQJA 4WW1A 2PXYA 3U6RA 5GZND 3SO3B 4Q0XH 1OTSC 3EYSH 1UZ6E 1S7SA 4R2GC 4JN2A 3TNMB 4KQ4H 5LKNA 2X2YA 5L7XH 1WBZB 3QEUA 4NQEE 4NO5B 3S37H 1T6WA 5F7LB 2B39A 3VG0L 2QTEA 4JEGB 1C5DB 2P5EE 4NRZB 4PLJD 5IMOB 3C5JA 3VFGL 4WI6A 3UX9B 3IDGA 2BRRH 1P4IL 1UWXK 3ARVA 5B4MD 4PG9A 5TDOB 3NA9L 1KTDB 1CDCA 4U6YB 4YBLB 3C9NA 3VFOB 1MY5A 4QRUA 5CMAA 3DWTA 1EVUA 4XNQA 4HZAA 5HHMD 2PXYC 4TYUA 5SWZA 4Q0XL 3EYSL 3PP4H 4NNXB 1UVQA 2VLRE 4N0CC 4LSQH 4U1GB 3HN3A 4O2FA 5L7XL 3MLXH 3VRJB 5A16B 2R2BA 2YPKA 3CVHA 3S37L 1X5GA 2VJXA 1BBDH 4Q6YA 2BSRB 1RUAL 4LEOA 4JFQA 2DM7A 1M4KA 5T1LB 2BRRL 2HLFC 4RAUA 4NJAL 1E28A 5LAXA 2YMXL 4OFPA 4F2MA 4OF8A 1WUNT 3CJJA 5CGMA 2RB8A 5IGXL 1YJDH 5IB2B 4YHYB 1BX2B 5JXEA 1C16A 2F19H 5HHOE 2BXYA 1WGOA 4LSQL 3NIFE 1FFOB 3MLXL 4X5WB 4YDVB 3VXTA 1KG0A 4RNRB 1BBDL 5AAWA 3HAEB 3MV01 2Q6WB 1IC5H 5J6HA 3FN3A 3SEPA 4KWUA 3OGOE 2FECI 1NMBH 5LVEA 1IC4H 5GRZA 4JRWA 5C0IB 2DKUA 4UI2A 1S9YA 4JY6A 1TQCB 4UU9A 1U8QA 3HUJE 1JMXA 3KLDA 1YJDL 3QXAA 1CGVA 1A7NH 3VXSA 5E9DA 1G9NC 3UXFA 4LVHC 1WTGT 5KTEH 2R1WA 4Y19E 5JXEC 2F19L 1Z9SA 3QUZA 3C5ZB 3G6JB 4M62H 4I48B 4IEFB 5I1DB 2ED8A 3RGVA 5J12C 3B9EA 2ZWLT 4LHUG 2GW5A 2PW1B 1FNEA 3RVWC 1IC5L 2F8VA 3L3KA 4HUMB 1UG9A 3DIFA 1DL7H 2ARJB 1KTLB 1PYWA 1NMBL 5HYJB 2BY3A 5JOPE 3MJGX 4FFVD 2NY0D 4IBLT 4MNQD 1IC4L 1XR8A 3SQOL 1GPOH 3LH2H 3VXRA 3QDGB 2OJEB 5JORA 3RWEB 3S37X 3MREA 4MJ5A 1PX4A 4GKSA 3OKDB 1WZ1H 1F3JB 4KC3B 1G1CA 4WV1B 5HJ3A 1DBJH 3KHQA 5SWSB 3LEYH 3QUZC 4M62L 4RIRA 1OP9A 4YXHL 1NGQH 3RGVC 4C83A 1QTYT 3DGCR 3KPSA 4Y4HB 4HKXA 1RZ8A 2EDNA 4FQXB 5C0BB 4LBEB 1RK1B 3VA6A 3WNOA 1DL7L 3MRLA 4M93B 1JPGA 1I3RA 1JNJA 2VH5H 4HGWB 1GPOL 4QXUL 4UDUA 1S78D 4HIEA 1E6JL 3ZDZE 1FRGH 2IAMD 1CF8H 8FABB 1FVEB 4NHUA 1WZ1L 3FT3A 4G9FB 4N9GB 5IK3B 5H37G 5AUMA 3RFZC 5KSUA 3OHXB 3ES6A 3MV9B 3HS0A 2NX5B 3LN4B 1NGQL 4JPIB 2DF3A 2R2CA 2JE8A 5IB1A 3PABA 4XPFH 4AL8L 1Z9LA 4O5LH 4YHZH 2R0KH 4YQXL 1EFXD 2WINB 1RPQA 4C4KO 1BAFH 3BZEB 1GCFA 4ZXBB 5EUOA 2JCCF 1SJXA 2VH5L 5ISZD 4JPKH 1HH9B 2PTVA 4KXZI 4KH2A 3ZT6A 1FRGL 1CF8L 1X5XA 3KPTA 3GSXB 5E1HB 1VFBB 1ND0A 1B4JH 2DOCA 1YEJL 4K3GA 5LWYH 1B6UA 3ZKXB 3X3GH 3WIFB 1B0WA 4M5ZH 5C70A 2ESVE 3IFLH 5MI0C 2E9JA 4YHZL 1P6AB 2Y7QA 2R0KL 1MI5B 4O5LL 5BRZD 3NIDE 3ABZA 3WFHA 4ZS6D 5J9PB 2FHCA 1DANU 4R8WH 4CUCA 1RV6X 4JPKL 3OKKA 2P8MB 3OJDA 1BWMA 3L6FB 5ACMA 1DBKH 4KKNA 1HCFX 1FL6B 1NFDB 4Z7UE 1IL1A 3OJMB 3W5NA 1TJIH 3RPKA 2I07B 3RPIB 5LWYL 3X3GL 4OBSA 1T7YA 4LEXH 3FFCE 2Z8RA 4M5ZL 1LNUB 2GYSA 4NZUH 5E94B 2KZ1B 3V7MA 4HKZB 1EERB 4ZO9A 2C1OB 3O4LB 3BMVA 1CFSB 4M6AA 4R8WL 1RHHA 5KANG 4OZIE 1HQ4A 2BMKB 4RWHA 2HH0H 4JFFA 1I8IA 3T4YB 2D7PA 2XQYG 5FGSA 3QEQB 2R1YA 3PIQB 4ZSOE 3DVFA 4HWUA 2K3TA 3O3UN 4GUPB 3B4NA 4NQTA 1BJ1J 5JIHA 1VSCA 3C60B 1TJIL 3B6SB 2YA0A 2HRPH 5E8PB 1NFIB 1EJ6A 1I1RA 4X8JA 2NY5H 4LEXL 1MHPL 4M03A 2YUZA 5C0DA 3I2CH 2H8PB 3BGFB 1JV5B 2L0DA 3Q6GH 4OI8A 1L6XA 5CS7A 1E27B 1FJ1A 2Z8SA 3WE6A 2X4PB 3DNKA 3DX6B 4V1DE 2GKIA 4OV5B 2HH0L 1YEKH 2Q1EA 2WM0A 3K80A 5DFVC 5GQBA 3U0TB 4ERSH 4OSUH 4MVBC 1NC2A 1KC5H 2VYRE 4WHYH 2HRPL 4JZJA 4ODXA 5K93A 3NABH 2WSKA 3MRGA 4K7PY 2ADJB 1CXEA 5GZOC 2NY5L 3B8YA 3HC3H 4MZ3A 4DGVH 4U1LA 4Y16A 3IFPA 2PW2B 3MRKA 4OI7A 2D7TL 4DKAA 5IHZA 5GGVY 2VLME 3Q6GL 2NY1B 2BSTB 4Z7WF 5I1JH 2XWJA 4AG4H 2YXMA 4ELKA 1IFHL 4D0BA 3T2NL 3AS1A 4E5XA 4HG4K 5DYOB 3IFNL 1XGTA 5CD5C 4LLWB 1IAIH 2MHAA 4ERSL 4EXKA 4OSUL 4HIHA 4RFNB 5DEZA 5IMLA 1R5VB 1T7WA 1FNSH 1KC5L 4XB8A 4OD2A 5DGRA 2Q8BH 4JZJC 4WGVB 4OF6A 2X9YA 3UBXB 1I3GH 2UWEB 1VADA 3VW3H 4DGVL 4Y16C 2DWEB 4RGNE 4NRXA 5B39G 3QUKB 3GIVB 3ZE0F 3T2QA 1FZKA 1INQB 1N7MH 5I1JL 3D39B 2I5YH 1IAKB 4ODUB 3MPCA 4YHKH 3W82A 4IHOA 4HIJB 3LS5H 3REVA 2X4RA 1V5JA 1HH6B 2D7MA 1FC2D 2XACC 4PTUA 1IAIL 2WBJB 4S0TD 4HK3N 3SJVE 2VDQH 1C12B 5KAQG 1CE6A 1KNOB 1EHXA 4P23A 2VQTA 2WWMD 3P40A 1TDQA 3EGSA 3VE0A 1XGRA 5D96B 4MJ6B 5ERWA 1I3GL 2VLJB 3LKPA 2MQ3A 4HIIA 3VW3L 1WLHA 5CSZA 4YE4H 2EDXA 2DQDH 5ANME 3H8NA 4UOW0 2ICEB 2I5YL 1L9NA 4MAYD 4YHKL 2A77L 4IM8A 4XP4L 4XP6H 3BQUD 3ZDXE 1IM9D 3KLHC 5C0FB 1BEYH 4HWEH 4TNWF 1JGLH 5HHPB 4CADB 1AGFA 4PJ5D 2VDQL 2MCPH 2P49B 1KB9K 1QSED 4HH9B 4P23C 4YNYB 2PTUA 1KTKE 4O58H 1MIEH 2CR3A 4LLYB 1DDHB 4KI5E 4LGRB 3MR9A 3UPAA 2H2SC 4LU5H 3LRSB 5D7LD 1K2DB 2O93L 3VDAA 4RGMB 3HNTH 4IJ3C 3S4SA 3ZKQD 4AQOA 2Y72A 1NEUA 3LVEA 4HUWA 5CAYB 1ZV5A 5GSRA 3TIEA 5FEBA 4XP6L 2L7JA 5HYIA 3V6FA 3V6OA 3F6IA 3CLEH 1BEYL 2D3VA 3MV8B 4HWEL 5IFAL 3VGBA 1WCQA 5IR1B 3FZUC 3KPLB 3BPOB 4PRPA 1J8HE 4Y5YB 2ZOKB 2PCPA 1A2YA 4WUUE 3VG9B 3RUGE 3X13A 2VSDA 5EC1A 5TH2B 5DJXA 4OGAD 3WLWD 1JI2A 2FJGB 4O58L 4Y4KD 4XC3H 3V5HB 25C8H 4YEFA 1MAJA 4LU5L 3HZMA 5I75B 2WANA 3LCYA 1A14H 5J8OA 5CZXC 1M6OA 1YPZF 5EU6E 4P2QD 3MFFA 5C6PB 1FNGB 4P4KB 4BZYA 3V6OC 3CLEL 4ZUVB 2DYPB 2BC4B 5MEQB 3U7AA 3IF1B 5E8DH 3E3QC 4R2GB 4JDVA 1U91A 1UM4L 4GXVH 1N5AB 5FCUH 5KG9A 4FXKB 4XC3L 4MHHG 25C8L 5IF0B 3CU1A 1G9NH 5D4QA 1JPST 5C09A 2VZTA 5DMGD 4M6ML 5FDWB 1A14L 4MSWA 4Z0XA 1A1OA 3WL9B 3MRHA 3CVHL 5HYQB 4LARH 2AJSH 2EDKA 3FQNA 4YWGH 3RL2A 3AS3A 3MBXL 3AVEA 3WLBB 2OQJB 1XIWA 4XGZA 4WW1B 2PXYB 3ZYIA 3U6RB 5F72S 4XWGL 1S7SB 4GXVL 4OFVA 1YY9C 2FZ3A 4JN2B 1UT9A 5F1SA 1ONQB 4M1CD 1HWGB 3CFCL 4NFBA 3QEUB 1BWWA 1G9NL 4X6FA 2VDNH 3I6GA 3MGOA 1QFWI 3C5JB 1S9KC 3IDGB 2ATPA 4PG9B 1AGEA 1N4XL 2H1PH 4P4RB 1S9VA 1E4XI 2ED9A 2AJSL 2VN4A 2D31A 4YWGL 3C9NB 5J1AA 4QRUB 5CMAB 1NAMH 4X4XA 4G8IB 4XNQB 3O6FD 4JRXD 1XIWC 4TOYL 2CIIA 1U92B 5SWZB 1SBBA 3QUMH 4WHDA 2P46B 5FYJE 4PJFA 1UVQB 4XBPA 1FYTA 3IDMA 4O2FB 3VXOA 5B8CA 3TA3A 2BVPB 2YPKB 2ATKB 2BVOA 2VDNL 3KAAA 3K8MA 4JFQB 3ESVF 4RAUB 3UTSD 1Q72H 2CKBA 1E28B 3VXME 4F2MB 4UBDC 1V3LA 3SCMA 4OFYA 4HS3A 1OGTA 4P0DA 4LVHB 4F8QA 3EYVA 3ZSTA 3IDJA 1C16B 3G5YA 3MX0A 4LCYB 4YHNA 1IGJA 3HLAA 2WBWB 4R9HA 1BFTA 5J12B 3HAEG 5B8CC 3TA3C 3VXTB 1KG0B 1MJUH 5GRXG 1NUFA 3B2VL 3NFPA 3QEHA 1KIPB 4YGAB 5IIEA 1BPVA 2LTQC 3OSKA 3U9PH 1ITBB 1S9YB 4JY6B 4UU9B 4NUJA 1KUMA 2ZCKL 3QXAB 5D7JD 3SCMC 5E9DB 1E4KA 2EYSB 4N0FB 3O8XA 4MWFA 3NVQA 5HHME 4Y2DA 4Z76A 4FN0A 4P9HC 3EYOA 4JGJA 1CU4H 4LGPB 5ESQA 5FUZH 1MJUL 1A1MB 5I1CL 2ZUTA 3CNKA 3L3KB 2X4OA 2IALA 2FEDC 4X7TB 3LQMA 1PYWB 4XPGL 4ZTOH 3QUMB 4NC2B 3LEVL 3U9PL 1WJ3A 3BIKA 5DVLA 3VXRB 1LQSR 1L0XA 4MXWH 5JORB 4FZ8H 1A6ZB 1UB6B 5T1KA 1F97A 5I17A 1E4KC 3UTTD 3O8XC 4NM4H 3MLWL 5GS1A 4Y2DC 5AG9A 3I75A 1GVIA 4RIRB 2ZUXA 4ZTPH 5FUZL 5HHQB 1OGAA 4P2OD 2R8SH 1VGKB 4GMTL 3OKMA 5JW4N 5IWLA 1MCOH 4HKXB 4BFGA 1RZ8B 1S5IH 4K7PH 1A6TA 1Z0MA 3MRLB 4J8RA 4RZCA 3TO4D 1JPGB 4WHCA 1MVFA 1I3RB 4ZTOL 1IM3A 5GGVH 3RI5F 3DXAD 4UDUB 4HX1A 4P5KA 1U58A 4MXWL 3L3IA 4FZ8L 5JR1H 5GGTA 3TZVD 1KPVA 2X4SA 3CFEA 2ZG1A 1MELA 4JFEB 3C09C 2MJWA 4NHUB 1J11A 4NM4L 3RI5K 3NOIA 4N8PA 5KSUB 1QSFD 2Y07H 1QR1A 5E00A 4HKJA 5D6CA 5GS1C 4EJ1C 3HS0B 4MMZC 3PV6A 2R8SL 2FO1A 1N26A 5MI0B 1CGYA 3PABB 3P4OA 1MCOL 5IWLC 1N5YH 4PY7A 5D7IE 4QRTA 4K7PL 2OMBA 3RY6A 3K7UA 1RU9H 1HKLH 5EUOB 5GGVL 4BFIB 4MNQE 1CR9H 1AO7D 5JR1L 5FA3A 3QHZH 4OLVH 2X4UA 1ND0B 4HAGA 2E7MA 1AQDA 4Q9BA 2Y07L 3EYQD 3WYRA 2HFTA 4IMLA 2HKHL 3TP4A 5E08H 3KJ6H 1EMTH 2VLRA 1I8KB 4X0KA 2Y7QB 4XPTH 3VD7A 3IJSA 3RY6C 3SDXF 2QJDA 3WFHB 4UV4H 1RU9L 1HKLL 3D3VA 1R24A 3OKKB 1F6AA 1BF8A 2CK2A 4TVPL 3FB8A 3OJDB 5KSBF 4WRLA 2IAND 5FECA 4LF3B 4W6YB 3QHZL 3QP3A 2QEJA 4Y7MA 1F2QA 4OLVL 3HNVL 2JCCE 3G5VA 4PRIA 5EOTA 1IL1B 3C5SA 1EXUA 1XH3A 2UY6A 1XGQA 3R4DA 1OTUC 4P46A 3KJ6L 4EI5A 5KZCB 1EMTL 1H3PH 1NH6A 3BOVA 4XPTL 4ZOCA 1OM3L 3BD3A 4UV4L 4PR5A 3HKFA 1RHHB 3ZTJH 1HQ4B 1ROWA 3CZFB 4OCYH 4JFFB 5ISZE 3CFIC 3ULUC 5CJQH 5ICYA 1XMWA 3P73B 1F4HA 2R1YB 2VDOH 5DR5L 1QP1A 4NM8L 4K7PX 3PWJA 2IC2A 4WENB 1ZHLA 2QQLH 2ADGA 3FONB 2AK1H 4LMQE 3GM0A 4P46C 5L6YH 3S88H 2NZ9D 1H3PL 2EDQA 1EEZB 2F9BT 3BKCH 1FJ1B 1D5IH 3WE6B 1RUQH 5BRZE 3NIGF 3MRPA 4PRBA 4WFHD 1F8TH 1NLBL 1YNTA 4OCYL 2IFFL 1MCPH 5DQDL 5CJQL 2AI0H 5ALCH 4UAOC 5D2LA 2GJJA 3AUVA 2FB4H 2VDOL 3EIFA 4KROD 4KUCD 4OGYH 4E9LA 1YECH 4Q97A 1NC2B 3ZKSD 5GS3A 5KVGL 1HHJA 2IWGA 1KEMH 3PUCA 4ODXB 2QQLL 1JHKH 4RMRA 2AK1L 3DSNA 3MRGB 2ZPKH 3EJZD 3NCEB 1NEZA 4XMKH 5L6YL 3IFPB 5DA4A 5IQ7H 5CGTA 3BVNA 3S88L 2CRZA 2CUMA 4DK6A 4NWTL 2XWJB 2ADFL 4ELKB 1L4IA 1D5IL 3P0YH 2JKXA 4D0BB 2R69H 4OLZL 4TUJA 1G0DA 4DW2H 4E5XB 3DJ9A 1NGXB 4KUCF 1HZHH 3T04D 3VU2A 5JXAL 3V5KA 1MCPL 2XTJB 5HYSB 2AI0L 1LP9B 3G9VA 5LBSH 2MHAB 1N0XH 4H88H 1T66D 5E56A 5E8EA 2FB4L 4HIHB 4PB0H 4AQ1B 1Q9LA 5IMLB 2APTA 1DJSA 4NN6B 1FNFA 2VISB 4OD2B 3UBXG 1KEML 4IOSD 4X98A 5KS9F 5FO9B 2JLLA 2B1AH 3NTCH 3VI4F 4LCCB 1J1XL 1VADB 3DGGA 4XMKL 1I8MA 5IQ7L 4NRXB 4X6EA 3RKDC 1FZKB 2F8XC 1RMFH 4KRNA 3QSKB 1QRNB 3C8HA 3QG7H 2OMNA 3P0YL 2R69L 1YZZA 3KPNB 1B2WH 1DN2A 4IHOB 4MJID 3WHE0 3REVB 4DW2L 2X4RB 4R7NB 4ZUSA 3FN0H 1HZHL 5DMKA 3GSRB 4QOKA 4PTUB 4Z7WE 5DC0A 5LBSL 1JBJA 2VZVA 1CE6B 1Z9OA 4N5UA 3FKUS 1S7VA 4P2YA 3AMKA 4P23B 3V0AC 3RZCB 3HG1A 5C1MB 3EGSB 1VEPA 5DK3A 3F7YA 4NGHH 5B38A 1XGRB 5ERWB 1J5OH 4YLQT 4Z95H 3LKPB 4HIIB 5CSZB 3WS6A 1JNNL 4LSVH 4WHYG 2PKDA 1RMFL 3T65B 4IJ3B 4JM2D 4MNGB 5I1KH 4F3FA 1B2WL 4O2EA 3ZYOA 1HCVA 3TWCH 2AJYH 5TPWH 1HHHA 2YZ8A 4MXVF 3F7QA 1AGFB 1A6AA 3ZE2F 3K3QA 2VAAA 1X5KA 3EOBA 4JCMA 1FNHA 1F42A 2GUOA 2R2HB 1NKOA 2CUIA 2YN5A 4NGHL 2NW3A 3K1DA 1J5OL 5I1IL 1IGYB 3BJ91 2HJFB 3DX9A 4PJCE 4KKCD 5JQHC 3WS6C 4LSVL 1T03H 2AXJA 2FGWL 3MXVL 3S4SB 3KG5A 5I1KL 1JP5A 4S0SD 4N8CL 5GSRB 1YC8A 3TIEB 1P7HL 3V6FB 1ZS8A 2Z4QA 3L3DB 3TWCL 5HGBA 1IGCH 5TPWL 4HW6A 4PRPB 4G6KL 5I19H 1ZGLM 1DEDA 3X13B 5EC1B 5DJXB 3HC4L 4WWKD 4AEIH 4U3CA 1RZKC 4MS8D 4FFZL 4P3WA 4HWBA 2HLAA 3NPSC 3IAQA 4PJDF 1K3ZA 3DV6B 3PGFL 1LVEA 2C3HA 2ZNWA 3HZMB 4JFZH 1J1PH 4WU7B 5D1QA 1M6OB 5L2KA 5J3HD 1WQVT 4PGZA 5EULV 5SWQA 1IGCL 4AJ0A 1DLFH 3QYCA 4ETQA 4PJXF 1TZIA 4PJ5E 4JDVB 1U91B 2CKBH 3HA0A 2HN7B 1JRHH 4AEIL 1YNLH 2XYCA 5KG9B 1PEWA 1QSEE 3EKCA 3RNQA 2D03H 4EBQH 1U0QA 2HVKA 1SY6H 4KK8C 3WV0A 4WTZG 1MCJA 2OI9C 5C09B 3TYGH 1J1PL 4MSWB 4OKVB 3MYJB 5D7LE 2YA2A 1WICA 5D1QC 2DQEH 1A1OB 3MRHB 1NGPL 3SGEH 1RQ5A 3FQNB 3RL2B 1DLFL 1QBMH 1I7RA 4O02H 1IGFH 1XIWB 4U05A 1QFWM 4XGZB 1WAAE 4F37F 3BH8A 5FA4A 1YPZE 3VWKB 3L3OA 2CKBL 2FZ3B 1YNLL 3L7FA 1FAIH 4PJHA 2D0HA 2ITCA 2D03L 4EBQL 3MNZA 1Q8MA 1SY6L 4F37K 1JYWA 2D0FA 2C26A 2G60H 1CLOH 3D85A 3MGOB 3TYGL 4RQQB 4YFEA 5CUSL 4P9HL 2APWA 2ATPB 2YSSA 4M7ZC 3TT1L 1DQLH 5F7KC 3MUGB 4X5XA 1AGEB 1F02I 2DQEL 1H3UA 3PWPA 4JFDD 3NZHH 3OXSA 4WW2F 4QT5A 3KS0H 1S9VB 2EKJA 5DJCA 2D31B 4P2QE 5J1AB 4O02L 1IGFL 3NAAH 4X4XB 1W0VA 2CIIB 4QHKI 3TH4T 4PJFB 3O3BA 3VGHA 5IMKA 4XBPB 4UTBL 4Y4FD 4L29A 1FYTB 4JVWA 3IDMB 4G3YH 3VXOB 4GLRI 2BNQD 5IUSA 1BMGA 1EAJA 2DMCA 4DKDC 4JKWA 2BVOB 2G60L 1CLOL 1IGIL 1UCTA 4X99B 5ADOL 4RMWA 4YDKL 2NY2C 5EO9A 2LTQB 3S5LB 1IILE 1DQLL 2CKNA 4G7YL 1HOCA 3ARWA 2CKBB 3NZHL 2W0LA 3EO1A 5FYJU 4NQDB 4Y5VB 4PJAA 4XNMA 3NCJH 1BOGA 2IH1A 3NAAL 1SYVA 1N64H 2VXTH 1OGTB 4HS3B 5DK2A 3ZKND 4DVBA 3EYVB 3H3PH 3IDJB 5BVJB 2YRPA 3KYMA 5L8LB 3HLAB 4PJEF 4QRQA 5DTFA 3CSPA 4OGXH 2XZCH 4LFHG 5EZOL 2W9LA 3EJJX 1BLNA 2CMRH 4H8WC 1U3HD 1CCZA 3OV6A 5DDHA 3GSNA 4H25A 3D69A 1GGCH 4L9LB 4NUJB 1MCCA 4PUBL 3L3GA 2X9WA 3PQYD 3DI2B 4PRDA 2VXTL 1N64L 4ELMA 1A5FH 4NHCL 4WCYH 3U0PA 3O8XB 4JKLA 4RMUA 4JRXE 4LCIH 4AEEA 4Z76B 3EYOB 2BX5A 4Z9KB 4PB9H 5ESQB 5GGTL 1IEAA 4OGXL 3RUGA 3H0TB 5CIPA 2XZCL 4PJBF 2DIBA 3E6HA 5F88B 5ACZB 5DD1H 1V8HA 2CMRL 1DQQA 4I0PA 1RJCA 3V95A 3BIKB 3FO9A 4I18A 1GGCL 3UTSE 3GNMH 3UTOA 2E7BA 3C09B 4MHHI 1LO4L 5IM7A 1B3JA 3BDYL 1A5FL 2VERN 4ZFZA 5I17B 4HXAL 5I1LB 2VXVH 1MOEA 4RAHA 3S7GA 4LCIL 1FIGL 3HE6B 5F9WC 1NBZA 1C08A 3I75B 3T0XA 3MROB 4YEEA 2OCFD 3BN9D 4NQCD 2PYEA 4RWYH 3RJQB 3ULVD 3E2HC 3BD4A 5D6DA 4HBQA 1A6TB 4XWOD 4YIQA 3RNKB 4J8RB 4LLAA 4I0PC 1YEDA 5ESAA 1DLHA 1ZSDA 4HX1B 1FG2A 1U58B 4I18C 3L3IB 1RFDH 3CFEB 4CVUA 2CXGA 3UPRA 3CDYA 3QNYA 2VXVL 2X09A 4HCRH 3ZYZA 2QSVA 4NSKA 5AEAA 3AC0A 4QRRD 1Q38A 5E00B 3ULUL 3ULVF 1ZA3B 3PV6B 4POZC 3HMXA 1G7IA 3F7RA 5I1EH 4LCWD 3C6SB 3P4OB 4RWYL 4PY7B 2Z31D 3QNZA 4ODSH 5GRVK 5D6DC 4QRPD 4KKLC 4OJFH 1NGWB 3RVXD 2EDRA 2R0ZH 1S9XB 4LNVA 4H0HB 5F3HA 4QGTA 1TZHA 1RFDL 2F74A 3ZTNH 5F6HI 3I3DA 4ZYKA 1KIUA 2X4UB 2LU3A 2W38A 3F5WA 3UTTE 4B50A 1RI8A 4XX1G 4IMLB 3EDKA 5FIEA 5BJTA 1JVKA 5T5NG 2OR8A 2XA8L 2VLRB 5I1EL 3PP3H 2Q3AA 4ODSL 4X0KB 1WEJH 3BESR 2A6JB 3IYLW 3IJSB 3MRIA 5IB5A 4OJFL 3D3VB 1J12A 1KB5A 1R24B 2VKWA 2NY3D 1K8DA 1F6AB 2P47B 3FB8B 1RZJC 2ED7A 4ODWA 3DXAE 5FECB 1CFTA 1BD2A 1HYSD 3ZTNL 2I9TA 2EXWD 1FFPA 2HTLC 3G5VB 4PRIB 2OJZL 5AG8A 1II4E 5IQ9A 1EXUB 1XH3B 1X4YA 1UKTA 3H9HB 4K7FA 3KXFD 3MRJA 1R5WA 1QSFE 4NO3B 4P46B 4GG6E 4EI5B 3JUYA 5HHOB 3RVTC 2DLIA 3C6LD 1WEJL 4L3EA 1ADQA 3TBSA 1OAXL 1ACYH 3MXWH 2Z9TA 4UAOB 3GHBH 1RUKH 3T0AA 1AO7E 4XZUA 4QXTA 2H2PC 5CEZH 4ZNCD 3PWJB 5I73B 3HUJB 2H6PB 1ZHLB 1CFVH 1PKQA 3V6BR 1YEGH 5KSBE 5FO7A 1NDMA 1NUDA 4P59H 2APXA 2OSLA 5CP3H 5T5FH 4PTTA 2ICCA 2R29H 3QIBA 2FDBP 2ZOLA 2R2EB 4N0YH 5EWIH 3S3JA 3NGBC 3MRPB 4PRBB 4WU5B 5F9OH 4QF1B 1X4ZA 4FG6D 3S36H 4C57C 5SX4I 1YNTB 1J1OL 4W81A 1EZVY 2XZQH 4QEGA 2QADB 4GMSH 5D2LB 1V3MA 3QXUA 4BSWA 4HLZH 2BVEA 3RVUD 2IANE 5CEZL 5T3ZD 2UYLB 5HVWA 1HHJB 5HI3C 1CFVL 3DUSB 3MV7D 1YEGL 4AT6A 3MOBH 5CJOH 3KHOA 1MFCH 4P59L 1YUHA 1FAKT 2DJSA 3QNXA 1UACH 4F33A 1LE9B 4G6MH 4LSPL 3BVNB 3RX8A 5FXCH 2A0LD 3QIBC 4O51A 4U0RB 1RZKH 5EWIL 4TUJB 2PETA 3MA9H 5HYSG 5F9OL 4P5TA 3VRIB 1QLFA 4KK5D 3V5KB 4AEFA 2XZQL 1I1AD 2EDWA 2Z0BA 4R26H 5EU5A 1Q9LB 1EDQA 3EDDA 3ZL4L 2NTFA 3NIGE 3ETBF 2J3SA 1Y6NR 4LKCB 3ARUA 4X98B 3ZTJG 4GAYA 1VFAA 3OPZL 5CJOL 4QNPE 3OR6A 1T0MA 3FB7A 1MFCL 2F58H 5DS8B 3DGGB 1UACL 7CGTA 1QO3A 1I8MB 1CDHA 1QR4A 4OGZA 4X6EB 2VSCA 5T1DH 4DGIH 3DETD 1RZKL 4KRPB 4HWBH 3OX8A 3MA9L 3T4AA 1UH3A 3VXQB 1CK0H 4FQJL 4P5TC 1YEIL 3L3HA 5CP7B 3MLYH 3MQIA 4WFHE 3W11C 4JY4A 3B9KB 4GBXA 3V0WH 2VDMH 1T5XA 2K7PA 3I3EA 4LPYA 3HG1B 2H26A 3F7YB 4M7KH 3WBDA 4LIQE 4YJZL 2F58L 2MKLC 2XIDA 4Z7VF 1YN7B 1OHQA 2A6DB 3LDBC 5DJDA 5KS9E 5T1DL 5DO2D 4DGIL 3MACH 4F3FB 4ZS7L 1J0IA 1W0YT 2K9UA 1ZVSA 2ESVB 3SDCA 4HWBL 3VI4E 2W92A 7FABL 3ZKMD 1AP2B 5F9DC 1CK0L 4G9DA 5LQBH 2Y23A 1XF1A 2VO5A 3WSQH 1RJZB 3MLVH 1HHHB 1SBSH 3MLYL 2EYRA 3VWJA 4GRLD 4NKMA 1A6AB 1D9KD 3EOBB 5GS2D 4BK5A 4GBXC 3V0WL 2VDML 5CEXA 1CICD 3N85H 2GUOB 5KSVA 2NW3B 4M7KL 4J23A 1CS6A 4Z7UB 3LV3A 1GSMA 5E6IA 3S36X 4UT7H 5DI8B 1LO2H 1JTPA 4WI3A 3S4SG 4AIOA 1F58H 3WHE1 4HJJH 2VE6A 5F3BA 4HT1H 3SDCC 5EO1A 3UC0H 1ZS8B 2Z4QB 5HGBB 4MJIE 3WSQL 1WISA 1SBSL 1A3RL 3VH8A 3VWJC 2VOTA 3TT3L 1R3KA 4B41A 3QWQB 5DURD 3RDTB 1QVOA 4DKEL 1MCLA 2HLAB 4MXVE 4OZHA 1UM6L 2MMXA 1LEKB 5HDQH 3BZDA 4UT7L 5E6IC 3ZE2E 2OI9B 4MD5A 1F58L 2MPAH 1NAKH 3QO1A 3ARGD 4X6DE 5D1QB 3TN0B 4HMEA 5CJ5A 3MTRA 3UC0L 3PL6D 1WITA 3KPPA 5SWQB 3UZQA 3IKCA 1VEOA 4ETQB 4V1DB 5BRZA 2BY1A 2EC9T 2VZUA 2NR6D 3UTZB 1JTTA 4LLUA 4PJGF 2EXYC 1PZ5A 3SDAD 1TZIB 2KUTA 3OXRA 3BWAB 4I9WD 3QJHA 1DQJA 1F4XH 2R23A 2P1YA 3RNQB 5HDQL 2HVKB 5EU3A 1KN4H 3I3BA 5A2FA 4UIMA 3STZB 1Q9KB 5L88H 4LQFH 1UH2A 4LCUA 2HAZA 4HPYH 4NKQB 4M7ZB 3GSWA 4PJDE 3UBXI 1A4JA 4XNXL 2J5LB 1TFHA 1I7RB 3EOTH 5A2IH 1ZKAA 4H8WL 4MD0A 2YN3A 2P24A 5FA4B 4HJGA 4XXDA 1EV2E 2AK4A 4ENEC 3L3OB 4WVRA 2OK0H 1F4XL 3QI9A 2A38A 3L7FB 4PJHB 4N5ED 2ITCB 1JNLH 4LHUD 1W2KT 3CUPA 2AXFA 4PJXE 1KN4L 3TIDA 2Z92A 4CVZB 2O5XH 3DARA 4FQLL 2D4FA 1KCRH 1JPSH 2DIAA 3D85B 4HPYL 1ED3B 3AFLA 4U1JA 1WWCA 3UJJL 1JE6A 3RTQD 1CGSL 3GMMA 4TNVK 4RGNB 3PWPB 3W81A 4QT5B 4XP9H 1R0AL 5CIPH 5C0CD 1MFNA 5C7XH 5DJCB 3OKOA 4UNUA 3LN5A 1W0VB 1SYSB 4CVWA 4R0LA 3D2UD 1PZUB 4D0CA 3K74B 4NQXA 3VMPA 1XGPB 3O3BB 3GSNL 5IMKB 2P44B 3QI9C 4TTDD 1JNLL 4QWWC 5EN2A 5I8KL 5INDA 2O5XL 1EUUA 4WI2A 2BJMH 1KCRL 3S5LG 4AMKH 1ODAA 1OB1A 1BBJA 1HHIA 1MFDL 1U3JA 5EO9B 1CD1A 3LSOA 1IEBB 1HOCB 1E0OB 3U36A 1Y6KR 4JDZB 4NFDA 5F7EH 4XP9L 5ANMB 3EO1B 4PJAB 1H5BC 4XNMB 3DOSA 2OTWA 2MFNA 5C0JA 4XPBH 2IH1B 1IAII 1SYVB 5DK2B 1AIFA 4NZRH 2N56A 1BOYA 4R0LC 3RU8H 5TQ2H 3KYMB 4HK0A 1CXLA 4QRQB 5DTFB 3H42H 3E0GA 4RX4D 4U1KA 1ZLWH 2BNUA 3LEXA 4LVEA 2BJML 4XVJH 4AMKL 2CGRH 4CDHA 5DJ6A 3EHBC 3QQ9C 3O6KH 1BLNB 2MSPA 1P4LA 3FQUA 5DDHB 1MCEA 5HHXH 5DZLA 3HMXH 5T1MA 4FQHA 4JFDE 2E7HA 3L3GB 4XPBL 4PRDB 4ELMB 4NZRL 5I71C 3U0PB 3GFUA 4E0RB 3RU8L 4XBGA 1U41A 5TQ2L 4YC2B 3OB8A 5F9WB 4CKVX 1MCNA 4B0MM 1J8HB 2PO6D 2ZG3A 4MB3A 3GK8H 2BZDA 1PD6A 4UIKH 1W72A 2YD9A 5JW4M 3RUGB 4GG8B 2GITA 3VFTA 5CIPB 5EB9A 2BNQE 5E99H 4XVJL 4W4NA 3HPLA 2CGRL 3E6HB 3O6KL 3DVGA 4PJEE 4XNYL 4MMXC 4I0PB 2B1HH 4FQIH 1JWMA 2NXYC 4I3RH 3X11A 2DQGH 4I18B 3HMXL 4G80B 5FYJH 4FS0A 3O4OC 4OLXL 3H9SA 1NC4A 5GS0H 3UZVB 4MAYA 3V7AE 1WZMA 1AC0A 3MODL 4BELD 2Z91A 1KYOK 1ZT1A 4YXLH 1RZJL 1C08B 4HJ0D 1TITA 3B9AA 4Z6AT 1UWXH 4UIKL 2X4TA 3O9WA 1V3JA 5E99L 4OB5H 2PYEB 4OZFA 2R0LH 2E7LA 1KFAH 4QXGL 4U6TA 1N59A 4YIQB 5JA8B 3ALWA 4XCYB 2DN7A 2YRLA 2ZUWA 2B1HL 4FQIL 5IVXA 4I3RL 3E6FA 5ESAB 1DLHB 1ZSDB 2DQGL 3EAKA 4JKPH 4PJBE 1CFQA 1DN0A 5E8OB 4GH7B 3UPRB 5IEHA 3QNYB 4MAYC 5GSVB 3PQYE 1KB5L 2VNCA 4NSKB 1ZHBB 4ONOA 4UZGA 4YXLL 1K5NA 4KJWC 5EA0L 4ZO8A 4X6CA 1G7IB 5EORH 1KCLA 3O9WC 4XVSL 1SVZA 4OB5L 1AC6A 1C5BH 2DAVA 1KFAL 2E7LC 4L4TA 4OQTH 2A73A 4V2BA 3OGCB 3Q5TA 1INDH 1QFHA 5EIVA 3DX8A 5C07D 1K8IB 5F3HB 5HDBF 3I50L 4BZ2H 4U7SA 4Y1AA 4EN3A 4Q9QH 4A6YA 5IMMA 1ADQL 2JIXA 5C0ND 2B0SH 3F5WB 1REIA 4LPUA 4BJLA 5HGDA 4IRSA 5EORL 4P2RA 1ZANH 1EO7A 2B20A 2F54D 4NQCE 1CBVH 3O11A 5IB5B 3ULVE 1XGYH 1SM3H 1YMHA 4CJ1A 3PGDB 2A1WH 5EPMA 1INDL 2AEQL 5F8RC 3IAPA 3A67H 3W0WA 1DUZA 4Z78B 1BD2B 4BZ2L 4G8EB 1WZKA 3BYYA 4PRHD 4EN3C 3VXMB 1P69B 4NZTH 1INEL 5IQ9B 2B0SL 3FAWA 2LVCA 4K7FB 4MLSA 3BRFA 4QRRE 4IRSC 4ZODA 2VLKA 5IBUB 1P9MA 3DO7A 1DBAL 1I9JH 1CBVL 3GSVA 4LCWE 4EOWH 5CD3B 3NGBB 1XGYL 3QFJA 3TBSB 4L8BA 2GJ6D 4JQVA 4QRPE 1UJ3A 1TLKA 1KT2A 2SEBA 3EFFA 3U1SL 1I1FA 3A67L 4JFXA 4FMFA 4JN1L 2FX7H 2CDEA 3EOAB 2P5WD 2WW8A 4X7DC 4QXTB 2OZ4H 2Q8AH 1NCBH 4NZTL 1JGUH 4J6RH 4PBVC 1PKQB 3OAUH 3SN6N 3TPUB 5FO7B 1NDMB 4HSQA 1NPUA 3SE4A 2VLLA 4JR9H 3WJLA 2OSLB 4HS8L 4M9OA 4PTTB 1X5AA 3QIBB 1I9JL 1P9MC 2ZOLB 3ZDYF 4EOWL 1IARB 2IPUG 5IOPA 5I16B 4U1NA 4KK9D 4JQVC 4MXQD 1UJ3C 1AJ7L 1U2HA 4BSWB 4CW1A 4JB9L 1A7PH 1RUML 2Q8AL 1NCBL 5JIKA 1JGUL 4J6RL 1RVFH 4G8GD 5FYLL 3OAUL 4AT6B 4L3AA 2DDQL 1YUHB 1HXMA 3SE4C 4F33B 4JR9L 3KXFE 3X14A 3WJLC 1MCQA 2GQHA 5BS0D 1LDPH 2ARJQ 5FCSH 1FQ9C 4O51B 4PLKD 3QXTA 4FQ2H 3RWDA 3ELAT 4U2YA 5GJTL 2FH6A 3GSQB 4F7CA 1BQSA 5C0AA 3IDYC 5IESL 5SV4A 3GBLA 4XHJC 4KY1H 5EU5B 3LIZH 1G84A 1A7PL 4NO0A 2NTFB 3K2MC 2DD8H 4MJ2A 3TEUA 5D1ZD 1RVFL 1MCFA 4GAYB 1VFAB 3O6LL 2FJHA 2P43B 1U8IA 3FB7B 1PG7W 1QO3B 4OCNC 3LRHA 1LDPL 2XN9A 1F00I 1AXIB 2P7TA 4XVUD 2NCMA 4U6VL 2ARWA 4NBZB 5LGJB 4FQ2L 4H0IA 3C08L 1GYAA 3T4AB 2GY5A 3FQXA 1OP5K 4JY4B 1U95A 2NNAB 2D7NA 3LIZL 5L9DH 1QYGH 4GBXB 4UINH 4PJ8A 2QKIA 3DROA 2D4DA 4HUXA 1BIIA 2H26B 5JA9A 5I74C 5T3ZE 1AR1C 1FV1A 4NOFA 3MV7E 5EZLB 3E1F1 4UQ2A 4UNTA 4HLZG 3JWDC 5DJDB 3WNNA 2X1PA 2A9NH 1MQKH 4NYLA 2V5MA 4LDEB 2J8UF 4LSTH 4G9DB 4N90D 3SDDD 5K9OA 1CXKA 3VXNB 2EYRB 3QO0A 3I6LD 3FOMA 2KPNA 3TO4A 5L9DL 1QYGL 2VDPH 4LPVA 3FHAA 4PJ8C 5IFHH 2XKNA 2JB6A 1J7VR 3HR5A 4NT6B 1Z6JT 4XNZB 43CAA 3LV3B 5KVFH 2EZ0C 2VE6B 5F3BB 1WIUA 3SE9L 1MJ7L 2YKLH 4Z7VE 2XQBH 2YZ1A 5EO1B 4LSTL 4EEEA 1JZ3A 4X4ME 2ADIA 3DSFL 1EFXB 1PG7L 2EC9U 1AR2A 3RAJL 3OKEA 1JL8A 2VDPL 3TO4C 1R3KB 4D0DA 5HBBA 1E4XL 3QJFB 5T3XD 5IFHL 4BYHA 4KQ3H 2VKXA 2JJUA 4FXLA 5IROA 3FO0H 3SDXA 3PDDA 3T0WA 4YFLI 1VCAA 4OZHB 5T1LD 1QPPA 5TJWK 4MD5B 2NPLX 5KVFL 4I3GA 3ZZ1A 2GTWA 3QO1B 4NC0B 5JHDA 1A7BA 2GCYA 2YKLL 1MNUH 2DI9A 5DWUH 3KPRD 4KK6C 4YDIH 5CJXA 3IKCB 3FCTA 2ORBL 5FUCC 2B2XH 5BRZB 5DD3H 4NNYA 3K0WA 4LLUB 3AS0A 3WO4C 2Y4SA 3OXRB 5C8JA 4K8RC 1X6NA 3STLA 3QJHB 4MCZB 2R23B 3FO0L 5IROC 2WIIB 1RZIA 2H3NA 1MEXH 3DLQR 5MEPA 5MENA 2BCKA 4LCUB 5CSGA 2DQHL 4GJTB 3ARDA 2WUBL 1QHPA 3GSWB 5JOFA 1MNUL 1A4JB 2YD4A 4YDIL 5CJXC 5F71A 2B4CC 1VA9A 2B2XL 5DD3L 1I9RL 4BA8A 1SQ2N 2P24B 5E4IA 2V2TA 4XXDB 5D2NA 4Z0BH 1GAFH 3GHEH 3TJHC 2B5IC 3QI9B 5JZ7D 2VWEC 5CBAA 3CUPB 2AXFB 3ARPA 5CBEA 3ARFA 5IFJA 1MEXL 5HYJD 3TIDB 2Z92B 4PJGE 3G04B 3EFDL 5CJBA 4U1JB 1M1SA 3ARDC 3QH3A 5LJYH 3UAJD 3KYNB 1TTUA 5IHUL 4HQQH 3RBGA 3OKOB 2X89D 5L2JA 2QSTA 5SWSD 3LN5B 4M48H 4R0LB 3D9AH 1NBYA 4KJQC 4D0CB 4NQXB 5D2NC 1GAFL 2ZZUT 1JHLH 4I9WE 1KCKA 2DQTH 2COQA 4FQXD 4X4ZA 5EN2B 4POUB 5C0BD 1PSKH 1XT5A 4N8VB 5I15H 3ARFC 5INDB 4JRYA 4A2MA 5JPMB 4R4BB 4UT9H 1HHIB 5I66A 1CD1B 5F7YC 3LSOB 5MEOA 2A74A 3QUXA 4QYOA 3H7BB 1W72L 1MJ8H 4HQQL 1M7XA 3P4NB 4PJ9A 4G9FD 4S1SH 5FUOH 5C0JB 4OZFH 5I18H 3MV9D 5I71B 4M48L 4G8FA 3NCMA 1N3NB 3D9AL 1KIRA 4PY8I 4OZ4B 2CO6B 5C2BH 3LKSA 4HK0B 2HJLA 2DQTL 2V7NA 1U8JA 1PSKL 5DJ0B 5ILTL 4FNLH 4U1KB 2BNUB 3LEXB 4ZXBD 3P0VH 3PXHA 1D5ZA 4W68A 4FRWA 4RFEB 4L9DA 5DJ6B 4OIIH 4UT9L 1FVDA 4DZBA 2G9HA 2NXYB 1P4LB 4XAWH 3QUXC 3FQUB 4AENA 3RWJA 1CWVA 4HIXL 3O4OB 1J0ZA 4GT7A 2FLBT 4PJ9C 5FUOL 5I18L 3TO2A 3IDNA 5C0CE 1T1ZA 1UM5H 2CXKA 3C2SA 1B4RA 4KI1A 2H32A 3U4EA 5C2BL 3L9RA 4DEPB 2JK5A 4XI5D 1MI5D 3JV0A 4ZOAA 1BM3H 4FNLL 3VFTB 1F13A 4A6YH 5EOQL 3P0VL 1ZA6A 3FOLA 3AS2A 3V8OA 3TNMA 1F45A 2GHWB 2R0WH 4OIIL 4M3JA 3DVGB 4CMHB 4JHZA 3WN5B 2AJXL 4XHQA 5HD8D 1I9IL 3QWRA 1AKJA 2C5DC 1JWMB 3CDGA 1C5DA 4OTXL 4OAWA 1S7RB 1NC4B 1HINH 1OWWA 3FQWA 1UM5L 1T0PB 4MAYB 2Z91B 4BUHA 1KTDA 1ZT1B 3EJYC 3NIFF 3BGMA 3I85A 3O4LD 1BM3L 4PJ5B 5CILH 1F3DJ 4NC1C 3SO3C 4A6YL 5IVNA 1FFNA 4OZFB 2EDOA 1NFDF 4M43H 4M5YL 3BAEL 2VZSA 3BRGC 2VZ3A 5A16A 4L8CA 4NKOA 4C59B 1A0QL 3E6FB 2GT9A 2BSRA 4I4WA 3QEGL 5DZNA 3C60D 3P30H 4LRNL 4S1DC 1DN0B 4LPWA 5C0RL 3MYZA 4LASH 3TVMA 5IEHB 1KJVA 1EH9A 3LMJH 5A2KH 2FSEB 2VC2H 4WFFD 3I9GH 4IOFC 4YBLC 5E70A 1YPZB 5GRWA 2P45B 4X6CB 3UO1H 5CILL 1BX2A 3LPGA 3SO5A 1K3IA 2KBGA 4WI9A 4M43L 4L4TB 1LO3H 2N7AA 5FO8A 2W65B 4UQ3B 3O2DH 3WUWA 4FXGB 2Q6WA 1LE5A 2EIDA 3P30L 3DX8B 4DGYH 3S8WA 4P5MA 3IXTB 1FFRA 4LASL 4Y1AB 2GK0A 3OB0K 4EN3B 3LMJL 4A6YB 5IMMB 3TVMC 4MA7H 4YDLC 4R3SB 4PP2B 1MLBA 3I9GL 3U79A 3Q6FA 3L3JA 1JRHI 3GMQA 2NY1D 3U7WL 5HGDB 2C1PA 4IRSB 3QXVA 4P2RB 3C5ZA 3FO2B 1YYLH 2AEPH 5I1DA 1RIHH 1JUFA 2PW1A 3FT2A 5I76B 2RIKA 5EPMB 1H3XA 2BFVH 3SGEI 1AGCA 4DGYL 1DUZB 1KTLA 3PF2A 1O7SA 5EIIA 3HI1A 3OMZA 4MA7L 1FL5A 3QDGA 3RWEA 3KLAB 2QBWA 3O3EB 2K1MA 2V7HA 3MRDA 4JAMB 5HDBE 5KVEL 1I7TB 4JG1L 5IBUG 4R97B 1MFBH 3OKDA 1F3JA 4NCDA 5A43C 3DO7B 1A6PA 3C5ZC 3GSVB 2AEPL 1YEEH 3BKMH 4M4RA 1H8SA 1MJJA 1A64A 2WBJD 4L8BB 1RIHL 3K81A 4Y4HA 4BSVB 1UJ3B 2JJSA 2VL4A 3JWDH 5C9KA 1X7QA 1KT2B 2SEBB 3EFFB 1I1FB 4LBEA 1NLDH 4JFXB 2CDEB 1QBBA 2AGJL 5C07E 4HGWA 4QTIH 2GIYA 2VLJD 3T3ME 1MSPA 2QHRH 3BI9X 1ETZA 1PKOA 1FVEA 1A7QH 1MFBL 2FIRT 3MRBA 3X3FL 5IK3A 3KPOB 4JY5H 5LGHH 2C3GA 4KKAD 4WI7A 3OAZK 4FTVA 1YEEL 2NX5A 2DQCH 2HMID 2F54E 3GJFK 5IOPB 1CXFA 4U1NB 4Y4HC 5CGYD 2JJSC 3JWDL 4PJEA 1NLDL 2WINA 1JZ4A 3VFWB 2XWTB 4K3DL 2R39A 4QTIL 1HH9A 5IBTL 3UTSB 4PRHE 3U48A 4CVXB 2QHRL 5IB3A 2VDKH 2H45A 3GSXA 1HXMB 1P2CA 1A7QL 1JYXA 3LKOA 4PP1C 1FZJB 4JY5L 4L4VA 3IFOA 4JQXA 5LGHL 3N0PB 2DKSA 1UWEH 4XCFH 3RWDB 2DQCL 4OCSH 1IBGH 4F7CB 5C0AB 5DHXB 2GJ6E 3WNMA 1C1EH 4D3CH 5LGKA 2R9HD 4KZEL 4EZMA 3ZDYE 2Z93B 3JBG7 4NO0B 5F7NC 4C56A 2P5WE 2WMPA 1JGVH 5EO0A 5I74B 2FJHB 1U8IB 1U42A 5FOBB 1FL6A 1KCUH 4XCCH 2X4NA 4ZAKA 2O5ZH 3MLRH 4OD3H 2XN9B 3B8SA 3RPIA 2P7TB 1FE8H 4P4KD 4JQXC 1UWEL 3L95B 3DMMA 2DYPD 4XB7A 4XCFL 3M45A 4CMMB 1QBLL 4OCSL 3FQXB 4LP5A 1OTSD 4R2GD 4D3CL 3QULA 4F15C 2ZNXA 4X9BA 5F9AC 1QKZH 3TPKA 1HK6A 2BMKA 4RMTA 4U2ZA 4PJ8B 2QKIB 5F97E 1LK2A 4HUXB 1BIIB 3VGEA 3DRTB 2LABA 1DQTA 3T4YA 1OT2A 3QEQA 5TE4H 2Q7NA 2AQ3A 2B4CH 4G8GE 4U6HB 1U8LA 4XCCL 3SKNA 4BFEA 4NP4H 4UQ2B 3VD3A 1OQXA 3MLRL 2O5ZL 4NQVA 4OD3L 4ZAKC 1NFIA 3HI5H 4K8RL 3CCHA 1FE8L 2X42A 1YMMA 5BS0E 4HBCL 1XR9A 3DMMC 3RWCA 3F7PC 5EG6C 1RIUH 2YEZA 2PXYD 1JV5A 3VRLF 5K9OB 4WJ5A 1YDPA 3QO0B 4Q7DA 4N0CD 5HYFA 2X4PA 3NCFB 1B90A 1QKZL 2XZAL 4GRWE 3TO4B 3W39B 2EECA 3BPLC 1U8OA 5C3TA 5I1GH 2XKNB 3OKNB 5TE4L 2B4CL 3TZVB 4WDIB 1CXIA 4NP4L 2HLFD 3A6CH 1BQUA 2C4FT 4KJYA 5B3NA 4P49A 4QRRA 1GGYA 3FQTA 1IC1A 4M7LL 3ZHKA 1RIUL 3QWOB 5SWZD 2BSTA 1UC6A 4K9EC 4NJ9H 1GOHA 3VXUA 2ADIB 4XMPH 4OLWH 3OKEB 1PY9A 3JV4B 5F1OB 1BHGA 4D0DB 3DVNA 1R3HA 3SDXB 4JDTH 4PG2A 1M05A 1AO7B 5HPOA 4J4PA 1R5VA 1U8MA 1XF4A 3A6CL 5KSBB 1IC7H 1S8DA 1MY7A 4MYWB 2GTWB 3UBXA 4C58B 4X80H 3ZDXF 3EW3B 4KU1A 2XXCB 1TCMA 2AP2A 5JXED 1WV7T 3FCTB 2W9DH 3D39A 4HXBL 1D5XA 4ODUA 5A3IC 4XMPL 4N90E 4NQSA 4AY0A 4LIQH 3MCG1 1T22A 3BE1H 4NNYB 4OLWL 5F7UA 5FHBH 4HIJA 1A3LH 4LHJB 2BHZA 3I6LE 4WFGD 1R3IL 3D0VB 5C8JB 3SKJL 3STLB 2B5IB 3HI6L 3RVWD 1RD6A 4JDTL 1OAUH 4PG2C 5IVOA 3IVKA 4MNHA 2H3NB 2IANB 1DFBH 1S7QA 1C12A 4J4PC 1KNOA 4KI5F 4ONGH 5CLWA 3R8QA 1B0RA 4OUOA 5MEPB 5MENB 4LSRH 5BW7A 2BCKB 1IC7L 2EEBA 5I6XC 3ARDB 5JW3L 4X80L 1X5IA 5JOFB 3VXSD 4Z77A 5E9DD 4DWHA 4KHTH 5FAAA 4HEME 3ALPA 1JFQH 4KVNH 3QDHA 2W9DL 4EDWH 4TPRH 3TCLA 3QUZD 1IAMA 3T0VA 3O41A 5KVDH 4X7CC 3RGVD 1XF5A 2V2TB 5D2NB 4CADA 5T3XE 1OAUL 1DFBL 5CBEB 3HZVA 3ARFB 5IFJB 4TTGA 1I9EA 5BCAA 2J4WH 4AK1A 2HWZH 4L8SB 5BW7C 3VXRD 5C86A 1OAKL 3U2SA 2W59A 1DDHA 3WXVL 5JQ6L 3ZO0A 2YA1A 3JVGA 3LRSA 1KCSH 5EH1A 1AY1H 5D7SH 1JFQL 4KVNL 3FMGH 1VESA 4ZPTB 3KPRE 4TPRL 3IU3B 2RFXA 5KVDL 3V0VA 2VRAA 1U3YA 1HN1A 1NBYB 2DQJH 3KPSD 3MV8A 4UUJB 4N8VG 3PHQB 4E41A 3A6BL 4WO4A 4TSAH 3VFVB 4LAQH 1VKXB 4OUUB 4KPHH 4Y5YA 2ZOKA 4QY8A 1OVZA 2J4WL 4Q9RH 1A8JH 4BQBA 2HWZL 4GXUN 1MAKA 3HZYB 3OKLA 1UZ8B 5MEOB 2A74B 2F53A 2J7LA 4G6AC 3JVGC 3QUXB 4QYOB 5B21A 1KCSL 1AY1L 3QPQC 1GC1C 4PJ9B 3FMGL 1KJ3H 4Z8FH 4HHAA 5C9JA 3ARBA 5EBMA 1FPTL 2YPLA 1KIRB 3G6JE 2DQJL 2X41A 5ELIA 3VFUA 3V4VL 3LKSB 3OKYA 2HJLB 2BC4A 3QPXL 1U8JB 2V9QA 4TSAL 4UDTA 4WO4C 4Z18A 4KPHL 3BPOC 4Y5YC 1AXSA 1QQDA 5HYJE 1SJEA 5FB8A 1KJMB 1Z0NA 1FVDB 4DZBB 1WZLA 3O6MH 5L0QB 2ID5A 1H0DA 2G9HB 3UEZA 2QQKH 4XCEA 5IW6A 3RWJB 4KUZH 5FDWA 4KXZH 4WTZA 3TO2B 3IDNB 1RK0A 4U7MA 1CD0A 3ARBC 5F96H 3WL9A 2H32B 5SWSE 4RFOH 3U4EB 5EUOF 3K4DA 3L9RB 2JK5B 2IPTH 3VI3F 2P8LB 4H5SA 5GRJL 1QLRB 5T33H 1X5HA 4KMTL 1EHNA 1ZA6B 3FOLB 5I0DA 1QNZH 4TSBH 4E42A 1QRKA 4AM0A 1ONQA 2BVTA 3O6ML 4LL9A 1AKJB 2E27H 3HR6A 2QQKL 1J87A 1SEQH 3CDGB 5KOMC 5C08A 1DR9A 4OAWB 3P77A 4HD9A 1YQVH 2QHLA 4BKLB 3FQWB 5J1SC 1VPOH 4G9FE 1MHHA 2AJVH 1FORL 5CZKA 1Q9WA 3MV9E 5KZCD 4P4RA 5I8OH 4QHNA 2IPTL 4G8IA 4QHUA 3BGMB 3PWVB 1JI1A 4OZFG 1U92A 4PD4J 2NW2A 5DRZB 3RKPA 1FFNB 1HWHB 5D5MF 1Q94A 4JFFD 4KQ4L 2NXZC 4TSBL 5DFVD 1Z3GH 2BVPA 5IP4A 4MVBD 4RRPA 4NKOB 5JO5A 4L8CB 2E27L 3SHSA 1MPAH 5DSCA 2ATKA 3PWNA 2GT9B 4I4WB 4ZUTA 4XC1H 2NYYC 2IMNA 1YQVL 3MLUH 3CXDH 4ZFFB 1A6UH 3TVMB 4PJDB 1KJVB 4YDLB 1VPOL 5GZOD 4A2LA 2RAMA 2AJVL 3P4MA 4PGEA 3MGTB 3QDJA 4TVPD 2DI8A 3TYFA 1S9WB 4YBQC 5EZJA 4BM7A 3DV4A 4YHPB 1MI5E 2WIMA 3PP4L 4LCYA 1S7UA 3RWHA 5CD5D 2OR7A 5E4EC 3E8UH 2MQCA 3FT4A 3T0BA 4PJGA 5FO8B 2DWDA 3LB6C 3WUWB 1T7XA 5IW1A 1NC2D 1LE5B 1KIPA 4XC1L 4HUNB 3OF6A 1KGCD 3CXDL 3IETB 1NFDE 2OR9H 4P5MB 1A6UL 2GK0B 3EZJB 5JOEA 3F62A 2WQ8A 1LD9A 1MLBB 4Y16D 2E3VA 4U1IA 3Q6FB 3U9UA 3L3JB 3EO9H 3GMQB 2HKFH 3BMWA 1EEQA 2EYSA 3F7VA 4N0FA 4S11A 2C1PB 2XPGA 1V7NH 4LDOB 5HHNB 3O4LE 2PTTA 1N6UA 1NMCC 1C8PA 1IT9H 3FRUA 2B8OT 1L6ZA 1MFEH 2DICA 3E8UL 3RVVC 1YYMH 1WWBX 3ISWA 1JUFB 3FT2B 3SPVA 1A1MA 2M1KA 1CE1H 1NAMA 4X7TA 1AGCB 3KYAA 1WT5A 4X7SH 4JE4B 3OG6B 2OR9L 5AWNH 1CYGA 5EIIB 3QUMA 3HI1B 1FL5B 3T8XB 2YPVH 3EO9L 2V7HB 2HKFL 3CMGA 1A6ZA 1A7NL 1UB6A 1X44A 2AABH 3MRDB 4G6JH 4WFFE 5CHNA 5KJRH 4WW2B 2XG4A 5KTEL 5D7IF 1XF3A 3KLHD 2VUYA 1NL0H 2JJTA 5HHQA 1Y18A 1MJJB 1YYML 1GGIH 1VGKA 1MRDH 2VZOA 3GB7A 1CE1L 3T77B 4U49A 1X7QB 4OIBA 4P23D 3GKZA 2IGFH 1IQDA 4OM1H 1RY7B 4X7SL 2XWBB 1WT5C 3CFBB 5AWNL 1JK8B 4ONFH 5F1NA 3LH2L 2H2SD 2YPVL 4JFEA 1ETZB 2VR5A 4OCWH 4G6JL 2AABL 3K4ZA 3MJ9H 3MRBB 4LDLB 1DBJL 2FO4A 3D87B 3LEYL 1NL0L 1IZKA 4FTVB 2JJTC 4Y4FB 3BP6B 2W0FA 1T1WB 1NCCH 1GGIL 3FZUD 4NCC1 2Q86B 4XP1H 3IB4A 4F80A 3MBEA 2HFFA 4PJEB 3Q1SH 2IGFL 3QQNA 4LNRA 5DMJB 4L1DA 3KPMA 5C0GB 1V3KA 4BFIA 1X5ZA 2LQRA 2X40A 3VJ6A 2UWEE 3MRQA 4K9EH 2VITB 5IB3B 4OCWL 1MUJA 5CZXD 1P2CB 3L5JA 3LKOB 4XCNA 4J3OC 3MCLH 2OYPA 2Y5TB 3ARSA 1ZHKA 4L4VB 3IFOB 3F58H 1J88A 1R3LB 2NY4C 1L7IH 4DOHE 2I60H 3BUYA 4PRPD 3T0DA 1I8KA 3CK0H 4XP1L 3NCYS 4XPFL 1KULA 3W9DA 4F15B 3MBEC 3Q1SL 5C71A 4PRAB 1BAFL 2I25N 4BK4A 2ERJC 3AROA 4PJIA 4I0KA 5K9QG 1U3HB 1KIQA 3LKRA 4C56B 4PJBB 2G2RB 5EO0B 4JANA 2VLJE 2IG2H 3ARZA 4K9EL 4LF3A 1GZQA 5GRVL 2F15A 3GIZH 3KR3H 5E6YA 1B4JL 2X4NB 4ZAKB 3MCLL 1Y6MR 3WS3A 3ORJA 3F58L 1G0YR 3DMMB 5I8CA 3BDXA 1CI5A 3IFLL 3CK0L 5M7QA 2IBBA 5DRXB 2HT2C 3QULB 1YY9D 4NO2A 4G5ZH 4EQ3A 3BPLB 1JF5A 3CZFA 4FFYH 5F1IB 1LK2B 5C09D 2IG2L 3P73A 4I13B 4PGBB 1DBKL 5GHWH 5I8EA 1U8LB 4WFED 3GIZL 3SKNB 3KR3L 5TFSH 1G7QA 4NQVB 2C4FU 3CCHB 3FONA 1BGXH 2D9QB 1YMMB 1D5MB 2XKUA 4DUVA 1XR9B 5IEKA 3RWCB 2GI7A 4NZUL 4PREA 2YEZB 1XIWD 4PGJA 1EEZA 2XI9A 5FGCE 2DKMA 4WJ5B 1YDPB 3DYPA 1OARH 2IBZX 3CDCA 4FFYL 1U8OB 4ODHH 3MFGB 5HYEA 5GHWL 4CN6A 3QZWB 5TFSL 2NQCA 1OSPH 4KJYB 1D6VH 1HEZA 4UBDD 4QRRB 3FQTB 5DRWA 3IU4H 1BQHA 2WP3T 3I2CL 5DGQA 3IJHA 1MFAH 5TDNA 3K4AA 3VXUB 2GY7B 3BIBX 1DTUA 4OLUH 5EFIA 1FYTD 3OR7B 4QRPB 5GGSA 5DFTA 1NGXA 3TA3D 3B2UC 4ODHL 3DVNB 3VRLE 1YEKL 1R3HB 5HYSA 1LP9A 1GC1H 1M05B 4I5BB 3ZLQC 1ZGLB 1U8MB 1XF4B 1PEZA 2C3WA 2CLZB 3UTPD 2VISA 3VDBA 5CLTA 2YWYA 3CSYA 5FO9A 2C7UA 5I6XB 3NABL 5TF0A 4B53A 1S8DB 3IU4L 4C54A 1DUYA 4KJPC 3HC3L 4LCCA 3SCMD 4OFYD 3CLFH 1JPTH 1MFAL 4OM0H 4KGJA 4AG4L 5T3ZH 5ABDE 2KH2B 3X17A 1ZVHA 1D5XB 1QRNA 4NQSB 2AJ3A 1G6VK 5IHLB 1T22B 3KPNA 4R7NA 5IJVB 4FQ1H 1KOAA 2EDYA 3D25B 3WD5H 2NY3B 2DQUH 3GSRA 3MMEA 4HKBB 2XTJC 3QT2A 1GC1L 2FEDD 4EIGB 3IVKB 4KGLA 4MNHB 1S7QB 1QA9A 4PJCF 1FNSL 3UDWA 1J86A 4KRLB 4WWID 1B0RB 2R56H 2Z8WC 2Q8BL 2X5PA 4NN6C 3RZCA 5DHVH 4I2XA 1FDLH 1EO5A 5E2TH 4LCCC 43C9A 2CRMA 4Z77B 1JPTL 3O8XD 1MIMH 5FFLA 1N7ML 3T65A 3C6LB 4MNGA 4Y2DD 3TCLB 3MLSH 1T0NA 1RULH 5SWZE 3LHPH 3O41B 4BSJA 3LS5L 2A6IA 3BKJH 1XF5B 1F6LL 1ZWIA 5GGSY 1NCAH 5HXMA 3HZVB 4X6BA 3UDWC 1OL0A 3RZCC 1KCVH 1WIOA 2R2HA 3MUY1 3HB3C 4TNWK 5A2JH 1FDLL 3U2SB 1IGYA 4HULB 2HJFA 5T1KD 3V52H 4YE4L 4M61B 2F5AH 2DQDL 4WNQB 3H2WA 3G6DH 1CD8A 1PLGH 2OTUB 1LEIA 4O00A 2VDRH 2EICA 2RFXB 5E95B 3BH9A 3LHPL 3V0VB 3BKJL 1OGAD 3L3DA 1YC7A 4BZ1H 1FCGA 1JGLL 1NCAL 4WFGE 3RIAF 1OPGH 4E41B 2DLEA 4WO4B 2MCPL 4QY8B 1KCVL 1CFBA 4HUUA 4Q2ZB 4M1DH 2OXHA 1MIEL 3OKLB 5ACLA 2JF1A 2F53B 1WBXA 4OD1H 4YUEH 1T4KA 1A22B 3DV6A 3VXSE 1PLGL 5E9DE 4APQA 2VDRL 3HNTL 4WU7A 4AIZB 1U8PB 1WAAF 1T3FB 2A9MH 4HHAB 3HC0B 3ARBB 5EBMB 2YPLB 5E2JA 5DHVB 4F7TA 1CDBA 3VFUB 1CGTA 2BNRA 4L3CA 2V2XA 4G42B 1I1AB 3PGCB 4HF5H 4UDTB 5JNYA 2W0KA 2FBOJ 3AB0C 1AXSB 5EU7C 4CDGC 3LPFA 4F7EB 1IMHC 3JZ7A 2HN7A 2W60A 3G5XB 1QQDB 1SJEB 1P84J 1CGXA 5FB8B 4M1DL 2CRYA 4JO4H 2HTKC 2E9BA 4RAVB 1H0DB 4OD1L 4YUEL 3VXRE 2EH8H 4XCEB 3TBTA 2KKQA 5D1XA 1FN4A 5IW6B 3TNNA 5IW3A 5CEYA 1X5JA 4APQC 4OKVA 3MYJA 1OTUD 2EEDA 5E5MB 2EC8A 1GH7A 1RK0B 2KL6A 4PIRF 4JO1H 2XOTA 3KPSE 4HF5L 5E8DL 4H5SB 4EXPX 4GW1B 2J8UA 3VWKA 2Q7YA 3D3VD 2WWKT 1CL7H 3LQZA 5D9SB 5FCUL 2A83B 2NXZB 3ULUD 3BEVA 4E42B 4JO4L 4AM0B 3VD9A 3UJTH 1CFNA 5GRUH 1H15B 5C08B 5D1XC 4PRID 3P77B 4RQQA 1UQSA 5EUKA 1GIGH 1MLCA 3MUGA 2VR4A 1MHHB 5E2UH 2VXQH 4P46D 3AGVA 1LHZA 1Q9WB 1WFNA 4LARL 4QHNB 3B5HA 4JO1L 2XV6B 4QHUB 3ULUF 4GRLB 1JNHB 1D9KB 3VFNA 3VWKC 2NW2B 1CL7L 4Q9CA 1Q94B 3HFMH 5E4EB 5EUOE 3QG6A 1S5HA 3VI3E 3UJTL 4NBXB 1F5WA 1YEHH 5JO5B 5DSCB 3BYTA 3PWNB 4UTAH 1M7IB 4ZUTB 5B22A 4X99A 1B88A 4J3SA 3P11H 1WFOA 3S5LA 2AXHA 1OTTC 5AYQA 4ZO6A 2H1PL 3P4MB 4PGEB 3QDJB 4NQDA 4Y5VA 4H0GA 5DK0A 2Z8VC 4S1RH 3TYFB 1SY6A 1NAML 3QDMA 5K9KA 5EZJB 3DV4B 1LK3H 5BVJA 3Q5YA 3QUML 2CPCA 2W9EH 1NMCB 1JF6A 1P7KA 1S7UB 3WUWG 4BQCA 2GEEA 4MA1C 3RWHB 3EBAA 3FT4B 3Q5OA 4PJGB 1YEHL 2DWDB 5A1AA 2FRGP 3MGAA 1A9BA 3WFEH 5IW1B 2VABA 5BOPA 2CQVA 5D5ME 1A7RH 3CSGA 4XMLH 3P11L 1AGBA 1X3DA 3ARGB 1Q72L 1QHOA 3SDYH 5DEFA 1LD9B 4L9LA 4Y5VC 5KSAA 4U1IB 4NFCA 5LCVH 3U9UB 3RKDD 4DK3A 3V79C 4S1RL 1JJUA 1A6VH 2VTFA 3F7VB 4TULH 1LK3L 1CD9B 2XPGB 3SDAB 2W9EL 1DP0A 2PTTB 3L5WB 3LKNA 3QQ3B 4Y8DC 3T0EA 1EA9C 3FRUB 2LU7A 3TLRA 3O3DB 2V17H 3MRMA 3UTQA 1KPRA 3H0TA 2HJKA 4JFFE 1GRWA 3SPVB 3WFEL 4X9FA 1JYNA 2CJUH 1CDGA 1NAMB 1RIVH 5F88A 1A7RL 2QL1A 4ODTH 3MJ7A 4XMLL 5ACZA 2FEEI 4K71C 3H3BC 4I3SH 4NZDA 4H1LA 4L9LC 5KSAC 4TVPE 5F8QC 1F3DH 4TULL 4N0UA 5CHNB 5I1LA 4XXCA 3QUYA 1A7OH 5DQ9B 5CEZD 2UZIH 1XF3B 4JO2H 2H9GA 3FAXA 3HE6A 4NQUA 3T0EC 1CU4L 2ZUQC 3MROA 4QOKD 1Y18B 1A4KA 3GB7B 2XNAA 3RNKA 1IQDB 4ODVH 3HG1D 4ODTL 3ZE1F 1G6RA 4ZOEA 1KGCE 3TBVA 5F1NB 4D2NA 3GRWA 3Q0HA 3WDHA 1DZBA 3Q3GB 3BZFA 2X89A 3JV6A 3FJTA 3N1FC 5JDSA 4YO0A 1A7OL 4XXCC 2UZIL 3BGAA 3QUYC 4ETYA 4HV8B 2FO4B 3D2UB 3VGAC 1D6EB 3HE6C 4ZTPL 1J0HA 1ZA3A 4PYHA 3VMOA 2NY4B 2W0FB 5ID1A 1UJTA 3C6SA 1VEMA 4IRJA 3MBEB 1S5IL 1VDGA 2HFFB 4LNRB 1BREA 1IQWH 2ERJB 2FL5A 4NQEA 1NGWA 3BDBA 1S9XA 3KPMB 3CVIH 2P5EA 3BEWA 3VJ6B 3MRQB 4CL7A 2ZP0T 3VCLA 1WF5A 4GG6F 1J05A 1MUJB 1NSNH 3EDJA 1WVZA 4XCNB 4GS7C 3SGJA 2HT3C 1KXTB 1ZHKB 2WNGA 2QSQA 4NUGH 1VFOA 3BUYB 2HP4A 2FBJH 1N5YL 4IRJC 3W9DB 2A6JA 3VMNA 3QB7C 2YUVA 1ZLUK 4PJIB 1KIQB 3CVIL 3WJJA 3LKRB 1UKSA 2W07A 3I6KB 4KK8D 2GAZB 1CR9L 1GJIA 4JANB 5H94A 1GZQB 1Q1JH 4IDLA 1NSNL 2WBKA 3VFRA 5D1QD 5L2KD 3SGJC 3WS3B 2I24N 2DTSA 3H9HA 4QTHA 5E08L 5I8CB 4NO3A 2PO6B 3HE7A 5HHOA 2FBJL 5BV7H 4LVNC 3IAGC 4MQTB 4Z7NE 2VMFA 2E6QA 1RAMA 4NO2B 4HCRA 2B7DT 4K3JH 3WJJC 1MCWW 3NACH 1AD9A 1S3KH 1QD0A 4KTEH 3L5HA 5DD6A 5I8EB 1OT1A 1G7QB 3CDFA 1I1YB 2H6PA 3HUJA 1W0WA 3R1GH 3V6OE 5IEKB 4YX2H 4PREB 4Y19A 4EI5C 4AEHH 1FYHB 3HE7C 3AREA 1DANT 5JW4R 4HC1H 4QLRA 4PRPE 2QR0A 2R2EA 3E3QE 5HPMB 4LLMA 4WU5A 3U82B 4QF1A 3OG4B 4K3JL 2VQ1A 1BVLA 3MJ8B 1S3KL 4QNPF 3QZWG 1FHGA 4G6FB 4KTEL 3D85D 3QIUA 2NY2D 5DJ2A 1EGJA 2UYLA 5I73C 1HEZB 3PWPD 3DUSA 3R1GL 3A0OA 5DRWB 1LE9A 4YX2L 12E8H 1BQHB 3BO8A 4AEHL 2RQ8A 2X44D 3IJHB 4XNUH 4RMVA 3AREC 5TDNB 3BKCL 4M9PA 3V4PH 4OCMC 4XH2A 1RUQL 5EFIB 1I4FA 2YC1B 2VB5A 5GGSB 1K4DA 1F8TL 3VRIA 4FMKA 5F7DB 5ALCL 3QHFH 2QADC 2X1OA 1ERNA 4OGYL 1NUNB 1YECL 3QIUC 2BVYA 1KJ2H 2ZSVA 4LKCA 1NDGB 3CSYB 4WFEE 2C7UB 1JHKL 3BN3B 4LLDA 3GI9H 1P1ZB 4EKXA 2ZPKL 4M7JH 4GKZA 1DUYB 1TNMA 3NA4A 5DS8A 1C5CH 2UZYB 4RCAA 4RA3A 5J57B 5AD0A 2GSGB 3V2AR 1A9EA 4HG4J 1EO8H 3V4PL 1T7ZA 4U0RC 2AJ3B 4ZNEE 4P3DA 5DQJA 5E2WH 4ONHB 3VXQA 2VAJA 2ILLA 2HVJA 2EDEA 3BP7A 3MMEB 5CP7A 5JIPA 3QHFL 1N0XL 4H88L 4PB0L 5CP3A 3B9KA 4LOUC 4Z5RA 1QA9B 4PJAF 1KJ2L 4JPVH 1MHEA 5C92A 5J56B 1HHGA 1I85A 4J3XA 1ACZA 4X9IA 4YPJA 3GI9L 4I2XB 1N8ZA 1OP5H 4IMKA 4M7JL 2B1AL 3NTCL 5K9QI 1C5CL 43C9B 1YN7A 2A6DA 4KRMB 3BP5A 4MA3A 4CNIA 3DURA 3REWA 1AI1H 3SE3A 3QG7L 4FA8A 1T0NB 1BFOA 4O4YH 1NGZB 2ESVA 4KRPC 2EDTA 2A6IB 5BXFA 1AP2A 4PJFE 1RZFH 3FN0L 2GJ6B 2E9WA 1FYTE 1ZWIB 1RJZA 2EEAA 4R4NC 1CTOA 1YQ2A 3B9KC 4JPVL 4X6BB 3SGDH