4XVSH

Crystal structure of hiv-1 donor 45 d45-01dg5 coree gp120 with antibody 45-vrc01.h01+07.o-863513/45-vrc01.l01+07.o-110653 (vrc07_1995)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
228
structure length
228
Chain Sequence
QVQLLQSGAQVKKTGASMRISCKTSGYTFLNCPINWVRQAPGRGLEWMGWMKPRGGAVNYPQKFQGRVTMTRDMSTDTAFLDMSNLRSDDTAVYFCARGKYCTASDYYNWDFEHWGRGTLVTVSSPATKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords VRC07_1995 45-VRC01.H01+07.O-863513/45-VRC01.L01+07.O-110653
publication title Maturation and Diversity of the VRC01-Antibody Lineage over 15 Years of Chronic HIV-1 Infection.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 228
sequence length 228
ec nomenclature
pdb deposition date 2015-01-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xvsH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xvsH01
3CH1B 3IDGA 1F6AA 1HSBA 3FZUD 3TVMD 3PL6A 1H3GA 1MJJB 1A7RL 3WFEL 2YD7A 1R5IB 1GPOL 1FYTB 5CIPA 1U3HB 1BGXL 1YEFH 4ELKA 4PJAE 1I8LC 4FFYH 4MZ2A 1CLOL 4MWFB 4B7LA 2W65B 1IZJA 1NCWH 2Z8RA 5C0JB 4FNLL 3UBXB 5J13C 5CEYA 2EYSB 2PF6A 1IT9L 3CVHA 5DQJB 4L4VB 3WHE0 4PJIE 3ARBC 5F88A 4Y1AE 5GQBA 4XB8A 5E70A 1UA6H 3PWNB 1AE6H 1NBZB 4HS8L 2VWEC 5ITFA 4JRYA 5E2UH 5DMGC 5HHVH 3QEQB 1ED3B 2AERT 4HDIB 5TQ2H 4HFUL 3QWOB 5E2TL 1QVOB 2X1PA 1FFNB 2MQ0A 2VZTA 5M95B 3KPOA 3TT3L 2EDKA 2W9EL 1JF5A 1MRCH 3WEXB 2D4FA 4WGVB 4UDUB 1S7SB 3RNKA 2FYYB 4U6TA 3DSNA 3KXFE 1EGJA 3HZMA 4BKLA 2DMBA 3O0RL 3TA3A 3QO0B 4YC2C 3TWCL 4RNRA 5C6TH 4URTB 2LU3A 3D85B 5HGBA 4PJCF 5DZOA 3W2DL 5CEXA 2ADIB 1INQA 3K8LA 3V5DB 4P9MH 2H1PL 3O3DB 4UU9B 2EIBA 4LSTL 3RY5A 1Q0XH 4I18A 1BQHB 2M2DA 1I1YA 1KCRL 1RZFL 3ZYZA 4QHMA 1INDL 4OM0L 5FKPA 1J12A 2LE9A 5EZJB 4YIQA 3BT2L 3S96A 5B3NA 1VPOH 3F58H 5H37G 4YHMH 1RZGA 3FFDA 1QLFA 5D96C 3IFOB 4ODSL 2WIIB 3RUGF 3SDXA 1ZANH 4NNXA 4RDQF 3U30C 1YNKH 1NMCC 4D0BB 3W11C 3EYSH 3S5LG 3TCLB 4KV5F 4EUPG 4F9LA 2NY1D 3VH8B 4XCFL 4AT6A 3DWTA 3MLYL 3U0TA 4GAJH 5T5NG 4NWTL 2C5DC 4KKNA 4ZSOE 1KCVH 1T83A 3HC3H 3MBXL 3QDGA 1PAMA 3HTLX 1T1WA 4ZQKA 1JV5B 4K8RL 1WSST 4OB5H 3V6BR 2PYFB 4GSDL 5DD6A 5LGJA 3MO1A 3MXVH 1FAKT 1LDPH 1EXUA 4JFEA 2J4WL 4Z76A 3T65B 3T3MF 2ZUYA 4WFGD 4Q9RH 4QWWC 1FVCB 2F15A 4QRPA 2J6EL 4P2CG 1ADQH 1E4KA 3VFSB 1A47A 1XF2A 2WP3O 1N3NA 4PYGA 4WHTA 1UB5A 3NN8B 1QRNA 3JVGA 1HZHL 1U6AH 4RISL 4MNQB 3L3HB 4Z7WB 3ARDB 4Y88A 1B4RA 4OZIB 1CXHA 3CAFA 1LNUA 4AQOA 5EBGA 1GL4B 2CDEB 1BFSA 2VXTH 3QUZA 4G6JH 1A6UL 4XWOC 2DL9A 4FA8A 2HT3D 3WFHB 1JRHH 4OIAA 4V1DA 1CF8L 3KPNA 1MJJA 5JXAH 1QBLH 4WUKL 4FQCH 4PRHB 5BVJA 3WO3B 2F5AL 1WFTA 1JMXA 2HFEA 5EC2B 3MRHB 4MWFA 2FH6A 2W65A 1A7QL 1RJYB 4JZNB 2A2QT 1IKNA 5SWZD 3LH2H 2EYSA 4U1SB 4EXKA 1LD9A 4NRYA 1UACL 4Z95H 5DQJA 4JFDB 3QPQC 3RA7H 3O45A 1NFDB 4I9WD 3MLXL 3TV3H 5I15L 3PWNA 3MCKB 3INUL 3NZ8B 3SBWA 3HFML 2H3NB 4P5TC 2GJ6D 4WWKA 5KTEH 1ED3A 4P23D 1OPGL 4TQEL 2FJGB 1QVOA 4D8PB 3EJZC 4JKWA 1R6VA 5BCAA 5IKCB 4BFBD 2DIAA 1AH1A 2E6JA 3R1GH 3GI9L 3MBEA 5DUBA 2V2XA 1S7SA 5DQDH 1N8ZA 1BP3B 2IBBA 3WXVH 1B90A 2FYYA 4YHKH 4F7MB 1CDHA 4GRMB 4NT6A 4JPVL 1Q9WA 1NDMB 1BF2A 4X7TB 3D85A 3FRPA 3GSVB 4ZPVA 4LASL 5CP7B 1F11B 3ZTJH 2VDOH 4DGIH 1SBBA 5F6IC 3MLUL 1Y6NR 2HWZL 3V5DA 3EYOB 1FZOA 1MJ7H 1PLGL 5I1CH 2EDYA 4PLKC 4PRIE 5FYJH 4OGYL 3D39D 4ZXBB 4J6RL 4F2MB 1U8JA 1XR9A 3ZL4H 5F9WB 4D9QE 4IMKC 4XVUD 1GC1L 1BQHA 3MNWA 1A6PA 5IK3B 5KSAB 3EDEA 4H8WL 3LRGA 4C57C 5EOQL 4XC1L 1KEML 5B38B 5ADOH 3LZFL 4NQEA 5EO1B 2YC1B 4WEMB 3IFOA 1XGYL 1P4BH 2WIIA 5L6YH 4WV1A 4HX1A 3JXAA 4WFEE 2EDJA 4YDJB 4PJFE 2UY6A 4RGMC 4D0BA 2EIZB 3JV6B 4QTHA 1D9KC 5EB9A 3B4NA 5DD5L 1NGQL 1B6DA 4F57L 3H6JA 1K4CB 4P46B 3P40A 2Y6SC 3H9HA 4ONGL 3P4MA 1YMHB 4KFZC 4Q2ZB 4R8WL 4QRRD 4P2QE 5IMOB 1GGBH 2GSIA 5GGQL 1JV5A 1FIGL 4CW1A 4P9HC 1TTFA 4C56B 4KI5E 1QFWL 5IB4A 1W72L 4MJIB 4LVNB 2PO6D 4PUBH 5DJDB 2YN5A 4KQ4H 3T1FA 3QFJD 5EZLB 1R3IL 3JUYA 4Z7VB 5FK9A 5C70A 1H3PH 4AIXA 4QT5A 4NJAH 1KTLB 1DLHA 5CZXD 5JHDB 4LEOB 4X7DC 1MNUH 2AEQH 3T04D 5MEOA 3BE1L 3MJ7B 4MNQA 4BQBA 5DEGB 4Z7WA 3RGVC 4JO1L 2Q7NA 3UZVB 4NCC2 4N0YL 4HJ0C 4RAUB 2CDEA 2R2CA 2F9BT 4XTRD 2GTWB 4NKDB 5BS0E 3TN0D 3CFJA 3PWPB 4NQUA 4XAKD 1I9RH 1P7QB 1G9NL 2H32B 3QQ3A 3IT8D 4PRHA 5KSBF 4PRPD 2VAAB 4MQTB 1WTLA 5F7KC 1PBYA 3WIFB 2X2YA 4JZNA 3BWUC 5JOFB 4TSAH 2XRAL 4A6YH 2JCCA 4U1SA 1TZGH 4ZAKC 3EOYG 4JFDA 1NH6A 1PW3A 2OR9H 3KDMB 1IFHL 2VR4A 3P73A 1MVUB 2QQNH 4AQ1B 4NNYB 1BBDL 3IKKA 4Y4HC 4Y2DD 5D1XC 2RQ8A 3RZCB 3FB6A 3M8OL 4EQ3A 3Q2CA 5CILH 1G7JB 4YGAB 3RPKA 1IAIH 3VFGL 4J3UA 5LG1A 1K5NB 3OKLB 3WD5H 1K3IA 3MOQA 3O3BA 4L4TD 4XBPB 2QBWA 1I1AC 3A67H 1NCBL 3MRGB 1OCWL 3KJ6H 2AS5M 1DE4B 1CU4H 3Q5YA 4OD1H 4KDWA 3KNBA 3U1SL 3B2VH 4JFOB 1U8HB 5L8LB 5ICYB 4F7MA 4GRMA 5GS0H 1DEEA 1XGTB 4HK0B 4XWGH 1NDMA 4HWEH 2VLJE 1TJGL 1MAMH 3GSVA 4NN6C 3BH8B 5CP7A 3U0WL 1F11A 5CCKL 4FQXD 1I7RB 4JM2A 2XI9A 5T3ZE 2JIXB 2GYSA 5CD3B 3WBDA 4P5KA 3SE8L 3HE6D 4XPTL 1U41A 3IDUA 3N0PB 4ZXBA 4G7YH 4JCLA 2R23A 5HHXL 4F2MA 1W0VA 1PG7X 2B0SL 4LVEA 3MRRB 4H1LB 4HKBB 5IK3A 1UYWL 4MXQD 2X9XA 5B38A 5F7FA 4WI7A 4HLZH 4FXGB 4X98B 2D7TL 2DM2A 4PJ9B 4X6DB 4I13B 3GHEL 5EU6E 3VFVB 4MJ5B 2UZYB 3WNLA 2XWTA 1IGML 3LPGA 3KWWB 5ID0B 3VXSD 4H88H 2XPGA 5C0BA 4JREB 4HD9A 3C5ZA 5IMOA 5DT1L 4JFFB 4E42B 1S78C 5H94B 1DTUA 2PXYD 3W0WA 5I1JL 4U1HB 4GQ9H 4C56A 1LP9B 3BZDA 5DJDA 3RVTD 5LQBL 1I8KB 3SDDD 4Q0XL 3QDJB 4Z7VA 4WUUE 3HE7A 3CD4A 1RIHL 2F19L 4MA7H 3BEWB 1ETZB 4X0KA 2DD8L 2QADC 4G6MH 4NOBA 2NY5H 3MJ7A 1XT5A 1HI6A 5DEGA 1NGYA 5KSVB 4MJ4A 1KTDA 4UTBH 5TDNB 5E8OA 1RUAH 4NQCE 4RAUA 4CU6A 1UKSA 4JRXE 3QUXD 3ULUF 5E6IB 4P0DA 2I9LB 4GRWE 1SVZA 2H32A 2WBJC 4P3DB 1T04A 2VAAA 2AGJH 1RJCA 2UUDH 2VO5A 1A7OL 4EVNA 4PG9A 1YY9D 3HZVB 4UT7L 4QO1A 3EYUL 2DLFH 4LL9A 5JOFA 5KVFH 1FNHA 5KAQF 4NO3A 3T3PE 35C8H 2XXCB 3QZWG 5EFIB 3KDMA 2GTZB 1AR2A 2MQCA 2WUBH 1KV3A 2VLRE 3KHOA 5J9PB 3H0TA 3UTTD 3HI5H 2ID5A 3IKCB 4Z7WF 3N9GL 4IRJC 3RZCA 2H26A 4OZIF 5HY9A 4U2ZA 2L4OA 4M6NH 2MKWA 4YLQT 4BSJA 3DYOA 2G2RA 1G0DA 1AO7B 3X12A 3I9GH 2RHEA 5D7JB 5J12B 1BWMA 4GQPH 1ZLVH 3KYKH 4CBPA 3BH9B 5FHBL 1DE4A 3O8XA 1MQKH 5ELIA 2YBRA 4X6FB 5DURB 2DKUA 4JFOA 1U8HA 5DMGD 5BZDA 1XGTA 5E56A 4HK0A 3GO1H 3BH8A 4N8VG 4S10A 1FNLA 2R15A 1NFDF 5ALCH 5C08B 2XNAB 1OGAE 4PRAB 1KTRL 4PJ8B 5DZNA 4XHQA 2HN7A 5KZCB 1A0QL 2CJUL 3GM8A 3MRRA 2RFXA 3MLWH 4OTXH 4YXLL 4PV8B 4KK9C 3IFPA 3L1OH 3U7YH 4I4WB 1QLEH 2F53A 1AP2B 4PIRF 1IMHC 4X98A 1GHFH 1IGCL 1P2CA 4X6DA 5DVOA 5DVMA 1TVHB 2EKSA 3VFVA 2YD3A 3RX7A 5F44A 4MJ5A 3ULVL 4LARL 1CZ8L 4PJXB 3KWWA 4AIZA 4NKIL 3QG6A 4TUKL 4E41B 3IAGC 2HT2D 2VDML 3LEYH 2JB6A 3VFMA 2ZOKA 1MLCB 3U9UB 2VQTA 1QFUL 1XF5B 4HK3N 1RMFL 3W11D 1LP9A 1HCFX 3BD3A 4XPHH 4NBZB 5TGBA 5F7LB 2OZ4L 1MRFH 1WWAX 4ONFL 2R0KL 2VLKE 4JY5L 3CSPA 4PREB 1ETZA 5F9JA 3EO0B 4K3HA 3BMVA 3O2WH 2XFXB 4YDKL 1DBML 5DHXB 4WI3A 1GGIH 4QXGL 4POZC 1GXEA 2NY7L 4LCCB 4ZMAT 3SO5A 3MRPB 3QCVH 5GISL 5TDNA 1X5HA 2QSVA 3AS1A 4BM7A 2AK4B 3BW9B 5L9DL 5IEHB 4X6BB 2WMPA 1TLKA 4QWWD 1Q0YL 1NSNH 2ADJA 1NAKL 3ALWA 1IQWH 3F62A 2I9LA 2RBLA 5I1LA 5KS9F 1VEPA 2CK0H 2LV4A 3L3GB 3T0VA 1T3FA 2DQEL 1VFUA 1P7KB 3ZT6A 5SX4I 3QEHB 4PJ7E 1MHCB 4HUUA 3T2NL 3WFDH 3ARGB 5D70L 1LE9B 3HZVA 4I2XA 1T2XA 1J1XL 3MNZB 3JSSA 1DQLL 4LNVA 2K3TA 2VIRB 5C9JB 3MYJB 2P8MB 1BM3L 3G6JE 3TBWB 5E8DH 5FF6A 1U8OB 1NC4D 1V3JA 3MLSH 3EYQC 2DLGA 4JFYB 4FFVC 4LEXH 3UZEA 1YA5A 2FIKA 2DKSA 1I1RA 2ZUXA 2BCKA 5E9DB 2Z93B 4MHHG 4LPUA 4KGLA 4M7ZB 3CZFB 1QACA 4JKMA 4TOYL 4YXHH 1TVBB 4A6YA 5IFHL 4DZBB 4RIRB 5KVMC 3QPQD 3BH9A 5L7XL 1N5YL 4MA3B 2B1AH 4CUCA 2E7HA 1NCUA 4Z8FH 1WJ3A 3PDDA 1A64A 1BEYL 4DTGH 1NCCL 1OT2A 2F54B 3WFBH 1EVTC 4D3CL 4PGEB 1E0OB 6FABH 4K23H 4FXKA 4P2OB 5D7IB 3EJZD 5F1KC 1TCRA 1UM5L 5E5MA 5E6YA 4OLZL 1ND0B 4HG4J 1DUYA 3DGCR 1YEGL 2XNAA 4M1DH 4G6KL 1NGPL 4HC1L 3BX7C 3WKMH 2VZOA 2IADA 3PHQA 3VD7A 3I6LE 3P11H 3UTSA 2JJTC 2P46B 3SE4A 2WK2A 5ACLA 4BZYA 1FPTH 1KLGA 4N9OB 4QXUH 2IH3B 3CPLA 4PV8A 4Y5VC 3C08H 2EC9T 4F33B 5AG9A 1XZ0B 4UAOB 5JNYB 5DS8B 4PLNC 5DJZA 1F58L 3V4UH 4KAQH 1AP2A 3LQMA 2IBZX 4MJ2A 5ICZB 3D69A 2YK1L 1CXIA 5AUMA 1UM4H 2P47B 3AC0A 1ZOXA 3SY0A 4DQOH 4H0IA 4LHUG 1LDSA 1HKLH 2LTQC 1FN4B 4J2XA 2DQTH 4J3WA 2DBLL 3PABB 1F90H 2MHAB 3QPXH 5DJAA 2ENYA 4OJFH 1U91A 1F3DJ 4LSUL 5I75B 1WBXB 3RKDD 4F7PA 3VA6A 4G43B 4PJHB 1LO4L 1TETH 1P6FA 4QCIB 3PIQA 5E4EB 1G9MC 4KMQA 4JG1L 2PW2B 2Y6SD 1WFNA 4DFIA 3MMEB 5CFHA 4DKDC 4KJYB 4DW2L 1UH2A 2DQJH 1FGNL 3R06A 3RAJH 4O2FB 3EO0A 4N9GB 4Y8AA 5MI0B 3RNQA 4ETQA 1FQ9C 5HHOA 1FL6A 3FCTA 4FABL 4NP4H 4LCCA 1J0YA 4DUVA 2R69H 3MRPA 2R2EB 1CE1H 3WXWH 2J88H 4X9GA 3QCUL 4JANA 4YDVB 5E2VH 2N7AA 5HYSG 4IJ3C 3CX5J 1UM6H 1EIBA 3MPCA 1KLFA 1DQML 2HRPL 4XRCB 1GSMA 1I8IB 3QEHA 4MDJB 1LE9A 1NL0L 3MNZA 3AM8A 2EDDA 4HJ0D 2BSSA 5EN2A 5C9JA 5DD3L 5EC1A 2FNBA 5I17B 2EXWD 5F3BB 4LIQH 3ARXA 43CAA 3G6DH 5I8KH 2DQGL 5F9OH 4JFYA 4OD2B 4S1SH 1A5FH 1KIQA 4G8GB 4NM8L 2BRRL 2W0LA 4RFNC 3DI3B 4L3CB 5E9DA 4YX2H 4ZYKB 1RAMA 1B4JH 3FO2B 4IHOB 1YJDH 2CRIA 1M71A 1AGCB 5FXCH 4BSVB 5K9KB 4QLRA 3A6BH 4GAYB 4R96B 4ZAKD 5K9QI 4RIRA 5EU3A 3TNMA 5D7SH 2NYYC 3PQYE 2J8UF 3X3GH 1D6VH 4Y4HD 2FRGP 1U8PB 3ZE1E 4L9LC 5D1XD 4U49A 5EU5B 1T7WA 3KPRE 2VKWA 4LU5H 4LLYB 2CGRH 4P2OA 3LS5H 1JTOA 4M93B 4WW1B 4OQTL 2GT9B 5IW6B 4XT1C 5HGDA 1QSFB 4ZO7A 4OZFH 4C4KT 1ND0A 1MCPL 1I1AD 1Y6KR 2AJVH 4NRXB 1UJ3A 5MENB 2H2SD 5MEQB 2YD4A 4HWBH 5D1ZB 3MV7D 4LCWA 1P4LA 3ZSTA 4G7VH 2UUDK 2XQYG 3TIEB 4ODHL 5B8CC 1WZ1L 2VL5B 2FLRT 4ZO9A 5E94B 5KANG 4L1HA 5BMFH 2ZKHH 3K81A 3VE0A 4F33A 4QNPF 4BFGA 4ZNEA 5GS1B 3FQNB 5DS8A 1ITCA 2RAMA 3OB8A 4TVPE 3QHFH 1BZ7B 3FFCD 3ALPA 5BO1H 5GRXG 1I1CA 3O3EB 1R0AL 5I1HH 2DMCA 4LGRB 4PY7A 3H7BA 3OKEB 3OXSA 2P48B 5GSRA 4BZ1H 4LSRL 5ALBH 5EZOL 4HT1H 1FN4A 5IG7B 2FATL 3PABA 1ZLVK 5CJ8A 1EFQA 1GGCH 4EDWH 1C16B 4Y5XC 1MHHB 3ARFA 3MLZL 3MRFB 3L3JA 1K8DA 4JFPA 1G7LB 4ZPTB 3L7EB 2OL3L 4HCRL 4PJCE 2MFNA 4L8CB 1RIVL 4QCIA 1CXEA 2YRPA 4YPGB 4JO2L 1CFVH 2CR3A 4Q9CA 5BRZE 3DUSB 2DL2A 5C0AA 4PJEE 4KJYA 1JUFB 3IDMB 4O2FA 2P5WA 1TQBB 2VZVA 2GITA 2EDFA 2BVUA 3S36H 2VDRL 1SJEA 4MX7B 4PJXF 1WBYA 1YEKH 1T4KB 4YDLC 1FL3B 4ALAH 5BW7A 3DOSA 3GSNL 3RUGE 3T1WA 1OOAA 3VW3H 1LO3L 4ERSL 1PG7L 4YDVA 4XI5C 2X4QA 3TZVB 3E6FB 2QADD 4OGZA 5ACZB 5DDHB 4KV5E 4GS7B 5EBWB 1T2QH 3L5JA 3OZ9H 4L3EB 2AJ3B 4YNYB 4PBXA 4XRCA 1BMGA 1I8IA 3T77A 1N0XH 12E8L 4MDJA 7FABL 5IHZB 5JORA 5CHNB 3C60C 3K2MC 2VDPH 3EW3B 1CVSC 3EOTL 2NX5B 4B41A 5C7XH 3TCXA 5D1QB 5F3BA 4LLDA 4U7MA 5FGCE 3T08A 3KYNA 5LGHL 4G8GA 5JTWA 5FYJU 2WBJD 1LO2H 2CPCA 3WIHH 2XZQH 2W9DH 5HYIA 2K9UA 5T5FH 4L3CA 3NA9L 2WQ8A 2ZCHH 5GRYA 4IHOA 1C5CL 2NXYB 3MV8D 4L8DB 3HR5B 2A0LD 4PV9B 1AGCA 2ITCB 2CUIA 4GAYA 3MOBH 5CEZE 3ZDZF 3H2WA 5GGTL 1A14L 5A2LH 4XCNB 3VXUA 4X9IA 3ZHDA 2LAGB 4DAGH 1X6NA 4OCNC 4DKEL 4XNYH 3BKYL 2V5TA 3WJJC 5J1AB 4MAYD 3JWDC 1DDHB 3QIWB 15C8H 5E99H 1IC5L 1W72B 2D0GA 5A16B 4FP8L 1YEJH 3BPNB 4XPAH 4X5WA 2GT9A 3AFLA 5CP3H 1AY1H 4WHYH 3O4LE 1E4JA 1QSFA 2YKLL 4GAFB 3UAJD 5MENA 3Q6GH 3C9NA 3GUTB 1IGTA 2FD6H 4X9FA 1DN0A 5EO0A 5FYKD 3LY6A 2WSKA 1OWRM 3TVMB 4TSCL 1FNFA 1Y18A 4WO4B 3H7LA 1JHKH 4AYFA 1WVZA 4BQ6A 1QFHA 3NIFF 4X83A 5JIPA 4OAWB 5AZEH 5CLWA 1ORQB 1AFVL 3QNYA 3TT1L 1FC1A 2BNRE 2YD5A 5DSCB 4UZGA 1MF2H 4QRQB 5D7IF 1T21A 1DANU 4KK9D 5JA9A 2BRQA 1JVKA 1YEHH 1C16A 5HPOA 4MS8C 3I6KB 4K2UL 2ZUUA 3MRFA 3QHTC 3GSWB 4OM1H 1C8PA 1KCUH 4TSBL 5FO8B 3L7EA 2Z8WC 1KLUB 3OGOE 2YUZA 4YPGA 3FMGH 4WTXA 3MREB 4OGAC 4P9HL 3U79A 1QA9B 1FCGA 3HUJA 3ILQC 3DUSA 4X4MA 4JRYE 2BVOB 4FZ8H 4LQFL 2R0LH 1FZKA 3UO1L 1JYWA 2FX8L 3S4SA 3S5LB 1U8IA 1QP1A 4MNGE 5F3HB 5HHQB 2V6HA 1UZ6F 3B9EA 4WI8A 2X6MA 5C0FB 3WHE1 5HYJD 2V2TB 1KFAL 5IW1A 4MX7A 3OG4B 3AU1B 4H5SB 5DMYA 3HAEH 3WCYA 4L5FL 5CJOH 3ET9F 8FABA 3IDYB 1KELL 1IZKA 3TZVA 3E6FA 5ACZA 5JW4M 4MCYB 4OUUB 4L3EA 2AJ3A 2BXZA 4YNYA 3OB0H 4PJHF 4KUCD 5IHZA 2QHRH 5CHNA 4EOWH 3FQUA 4PJDA 3S88H 3D5OF 4J12A 3EGSB 4U31A 2NX5A 1DQJA 1A6WL 2O61B 2DYPA 1OSZB 1PSKH 5JO5B 2WP3T 2ESVD 4F58H 4CKVX 1NBQA 4XGZB 1UADC 4OZHA 4KJWC 3FQTA 1FYHB 4OI7A 2NY1B 1F2QA 1D6EB 1EMTH 3LKNB 3GI8H 3ZYOA 3LN9A 5JW5B 2DQIL 4TTGA 1NMAL 4PV9A 3Q48A 2GQHA 2ITCA 4Z0XB 4PGBB 1D5IH 1WFOA 4LCUB 1QFWM 3EYQD 1QSEE 3IFNL 2PETA 3MRJB 4FFVD 5HHME 2V5SA 1AQDB 4KTDL 1F4XH 5D2NB 5J1AA 5I8CA 3LDBB 2ZZUT 4V2BA 2UZIH 2DQDL 1YQ2A 1N7MH 3QDGE 1W72A 5CJQH 5A16A 4HAFA 4ZFZA 5KSBE 1O7SA 4HIJB 4FTVB 1T89A 3BDYH 4WY7H 2GI7A 2P5EB 4GH7B 3OAZH 1NMBL 5H8DA 3WIIH 2A6DB 4O51A 4M7KH 1SY6H 4PGZA 4LPWA 1I8MB 3GNML 4Z7UB 3ARZA 1PY4A 1W0WB 4AG4L 3EOAA 4ZFFA 3ETBF 1QRNE 4XH2B 4YBLC 5KBNC 5EO9B 4XCYB 4FRWA 3DYPA 5CBEB 1FVEA 4JPIB 4UNUA 4S2SB 1G7HB 3DV4A 5SWZB 2I26N 3C2SA 1CTNA 1VFAB 5DSCA 3S8WA 5IHUH 2Q1EA 1MI5D 3QXTA 1JZ7A 4IDJH 4MA8H 1FYTE 5FGBA 2QHLA 4J3OC 4F9LC 3V6FB 3BPCB 4JLRA 1I3VA 1IC7H 3F7YA 4IRSB 1B2WH 2OR7A 1T83C 1HH9A 4AEHH 1EBAA 1KLUA 2W59A 4L4VE 5AD0B 1C1EL 3VD4A 1JPTL 1Q94B 5GJSH 3OGCB 4NM4L 1U8QA 5J3HC 1QA9A 3IB4A 4UTAH 2ARWA 2Y36H 5TPWH 1S7VA 3QEQE 5C0EB 5HHQA 5FCUL 1E4KC 3T09A 3T2PA 3QI9A 3HS0B 4Q9BA 4XBGA 2L0DA 5J1SC 2BOCA 3JVGC 3K80A 2OJZH 2VDQH 3SCMA 1GIGL 3D39B 1MFCH 2ICES 3IVKB 4BFIB 5K9OB 2APBA 1ZVSA 4HKJB 3HI1B 4JDTH 1GH7A 4MCYA 3QNZA 5GGVY 1UXWA 3ZT5A 2B5IC 4LSSL 1K8IB 3GIZL 3TNNB 1CGTA 1JTTA 4EBQL 4MVBD 1HSAB 1T1XB 2RCSH 2O61A 5ETUB 4H20L 1OSZA 5JO5A 4MJ6A 4U1GB 2BNQD 1P4IL 1S5IH 4JHAH 3LRSA 3MLRH 4X80L 1YPZA 3LKNA 1BJ1H 1KN2L 3GBNH 5JW5A 3CDGB 5F7NC 4MMZC 4QRRB 1WIUA 3LKQB 5DD0L 1U3JA 3ARUA 2YMXL 4WWKC 1U8KB 4Z0XA 4J3XA 4NKQB 3RBGA 4PGBA 4HIXL 3VWKD 4ZUWB 2PO6B 3HMXH 4ZOEA 3QFJB 3IRPX 3MJ9H 3D9AH 3Q6FB 4Z7NF 3S35X 2IALB 4HH8A 3OL2A 3NFNB 2Y5EA 3MBEC 4UMGA 1I3GH 3HPLA 3ULUE 1FORL 3QA3B 5ILTH 3G9AB 3QUKB 4WVRA 3L3IB 3VG0L 3K0WA 2A9NL 2A6DA 3GB7B 3H9SD 1I85A 1YEIH 3S34L 1I8MA 3NIDE 1BQSA 2CXGA 1XGUB 4YGVB 5A2JH 3EFDH 4LLMB 4XH2A 5EO9A 4PRPB 4MNQE 5F1NB 4JFZH 4Z7WE 4DGVH 2QLVB 4QRSB 4OZIE 1I75A 4S2SA 3E1F1 1G7HA 3BPOB 5MERB 4XHJD 4AH2B 1S9VB 1VFAA 4WV1C 1XF4B 4DGYH 1UWEL 4CGTA 4ODVH 4Z77A 4DJMA 4F15B 3VFPB 4PRHE 3VXQB 2V5RA 5C0RL 2GJ6A 4YH6A 1FSKC 4FQLH 1V7NL 3BO8A 3BPCA 4P23A 3DO3A 3QJHB 3R0NA 4LQ1A 1CL7H 1FZMB 1OM3H 4FXLA 3V4PL 3D48R 3S97C 4JFDE 5D2LB 5AD0A 4NO2A 4L4TB 1IGIL 3PUCA 1NFDE 2OQJB 5FO7A 4PGCA 3RIAF 4ETYA 5C6WH 2A38A 3MNVB 2BOBB 4Y5YB 1NEZG 25C8H 2KBGA 4TRPH 2C3WA 5C0EA 4UB0L 1QPXA 3O9WC 1FFQA 3MACH 1QR4A 3OBAA 4ODBD 4FQXB 4RFOH 1JYVA 1A9EB 3HS0A 3MV01 3H42L 3HE6B 2VOTA 1MWAH 3D39A 1CG9A 4LAQL 4PRBB 3IVKA 1FFOB 1KYOJ 5FDWB 4XNUH 5DTFA 4ZOAA 3P30L 4HZLB 1JNNL 5HDQH 1DUZB 3HI1A 1GOGA 3RI5F 2KKQA 1K8IA 1RURH 5DUPL 3QISA 3TNNA 1J0ZA 4KRPB 1TQCC 3U36B 4QY8B 4LKXB 1KN4L 4NC1C 1T1XA 3ME0A 4U6VH 3HAEA 4LFHG 1IAII 5ETUA 4ONHB 3DBXA 4XI5D 2G75B 2OJEB 3D0LB 1ORSB 2HMIC 4OKVB 3DO7B 4R4BB 3AROA 3VXSB 4EDXA 2NW2B 2IG2L 5T5NF 4JJHA 3C60D 4QHNA 3DROA 4QRRA 1X5FA 1MCBA 3VRIB 1OAZH 5E08L 3E2HB 3AMKA 1S9KC 1IBGH 1TVDA 2PXYB 3WDHA 1RVFH 4ZUWA 3QUMB 5IESL 2PO6A 2XZCL 1ZVYA 4OF8A 1KT2A 1T7XA 2AJXL 1XH3B 2IALA 1Z3GH 1JNJA 1MCHA 3WUWG 1L9MA 3QA3A 3IJSB 4DWHA 5C1MB 3CXHJ 4K94H 2DBJA 1Q72H 4OQ1A 1L6XA 4C56E 1DBBL 2OZ4A 4MJIE 1ZVHA 4OLVH 3WNNA 3SQOH 3O3AA 4JM2C 1EEYB 3GB7A 3VDBA 4GKSB 4Z7VE 3OB0K 3EIFA 3LEXA 5F72S 3B5HA 1B6UA 1XGUA 2ED7A 3CFEB 3QUXB 3TN0A 5JHDE 2C1OA 2OI9B 1S7RB 1EZVX 4IDLA 4PRPA 1Z9OA 5L2KD 1JNLL 1QHOA 4IMLA 4KMTL 4K3EH 1P84J 3BKML 1MFBL 4N8VB 3KPSB 1UC6A 4EZMA 2P7TA 3M17A 1I7UA 1KJVB 4XP6H 2DTMH 1XF4A 3PWPE 5E7BA 3VG9C 1FZJB 2B2XL 1EHLL 1DBJL 4QXWA 2Z8SA 3UTTB 3VFPA 3OX8A 4Y2DA 2GK2A 1EDQA 4GXVL 4M6AA 3F8UB 5CINL 5E2WL 3ZDYF 4NUGL 1PEZA 1NQBA 3MA9H 4AMKH 5ERWB 1FZMA 1ODAA 4HWZB 5J13B 2CDGA 3C5ZC 1A1OA 4Z7UF 1MREL 1PVHA 2IFFH 2IAND 3ARBB 4L4TA 3NH7H 5C0GB 2XWJB 2E27H 4TNVK 1TXKA 1NC2B 5ITBL 3OAZK 3DVIA 1KB5H 3OR6B 3HE7C 4HJJH 1C5DA 3V0AC 3S7GA 1IEAA 4FQXA 1BD2B 1MFNA 1DL7L 1A6TB 4OGAD 4GG6A 4LLUB 2A77H 4DOHB 3ILQD 2MOVA 2Z9TA 2NW3A 1MFDH 4LSPH 5FDWA 1AJ7H 1OAYH 5HHPA 3PWVA 3NCEB 4HZLA 3RWGB 4OF7A 5I9QC 1DUZA 4YC2B 1TPXC 5I8OH 4R4FL 4U6HB 3FRUB 3GMMA 1D5MB 3HNSH 8CGTA 4UT9L 3VGDA 4F37F 4G5ZL 3E6HB 4YWGH 3U4AA 5D72H 4IOIA 1RQ5A 3V9FA 1ORSA 4OKVA 2DQCL 4LLAA 2Q3ZA 4G9FD 4R4BA 1MCOH 3VXSA 5T3XD 4PJIB 3GK8L 4H26B 5D96B 1E4XH 2AVGA 5IT2L 4LRNH 4X6DE 1WT5A 5DMIH 1BAFL 2R1XB 4EI6B 3U30B 1NMCB 1S3KL 3QUMA 4G80A 1V5JA 3BUYB 1BZ9B 3SDDA 3L5XL 2XKSA 3J7HA 5CZVH 4HWNA 2BVQA 2NY0C 2OL3B 2DM4A 3O8XC 3V5KA 2CQVA 4K7PH 3BAEL 1V7MH 1OW0A 5IMKA 1XCQB 3IJSA 2PNDA 5TE6L 1E6JL 3RL2A 1LP9E 5ANMA 5FGRA 3HMXA 3KG5A 4U1JB 4EKXA 1EEYA 4GFTB 3UYRL 4GKSA 1WISA 2FEDD 3S37X 2W07A 3OAUL 1CLOH 4FQHB 1EH9A 3SOBH 3SQBA 3QUXA 3UP1A 1LILA 4M5ZL 3ULVF 5IB3B 1KC5L 3GMRB 1J1PL 4JZOB 4WNQB 1T80A 3G04B 1WIOA 3CCHB 1B0GA 4JZJA 2AXHA 3UJTL 1CE6A 2KZ1B 2AJZB 1P7HL 3IU4H 1HQRA 3UJJL 2H8PA 4N8VA 2W9LA 3C8HA 2EDBA 3QIBC 3W9EB 2XTLA 3PNWB 2EH8H 5EWIL 1W2KT 4B53A 1NC4B 3WNKA 5IR1B 3E8UL 1TJIH 1CXFA 3CSBA 1JWSB 4M8QB 3UTTA 1VFMA 2DI8A 4Y4KD 5IFJB 1JNHB 4WTWA 2NZIA 3LN5B 2BXYA 1I8LA 1IAOA 4N0UA 2FJHB 2YD1A 4WU7B 1G7MB 2W0FA 3KJ4C 1HH6B 4OD3L 1FFPA 3LKPB 4U1NB 1IGJB 4JJ5B 3T0BA 3X3FL 2LAAA 1F4YH 2E9IA 1RUPH 1OTTC 4HH9B 1BHGA 2HKFH 1A8JH 3CK0L 3O41B 5JUEH 2XWJA 4RGOL 1QBAA 4P5TB 1CD8A 2H1PH 3ZYIA 3EOBB 4PD4J 4B50A 1EJOL 4Z18A 4JR9H 1AO7E 1MJ8H 2E7MA 5F8RC 4X7FC 4RA3A 1JGEB 4AEFA 4ELMB 2AJUL 4ZG1A 2D7NA 5JW3H 4OQTA 4ZS7H 2FBJL 4JFED 3RWGA 3I2CH 2BY1A 2YZ1A 2FO1A 5K9QG 4QGTA 4HUMB 5D2LF 5F6IB 1Z5LA 1F4HA 2WWKO 3QH3B 3N1QC 1MWAA 4NWTH 4YHLL 1YYML 4P4RB 2Y7QB 3MBXH 1JHLL 1VESA 3T0WA 4JO4H 1EAPA 1KJ3L 4PB9L 5IQ9A 4KXZI 2XKNB 4V1DD 1F8TL 1HK6A 1J1OL 3TO4D 1AHWC 5AEAA 4H26A 5HYSB 5IHBA 2I9TA 1X44A 3VJ6B 4LPTA 2R1XA 4EI6A 4RGMB 1D9KB 2ORBL 3KPMB 2P42B 3NCJH 3BUYA 4PJXE 4F8TA 1BZ9A 4TUJB 2ZPKH 3L6FA 1MSPA 2X9YA 3ABZA 3DTXB 4E41E 1K2DB 1TZHB 1QKZL 4KKBC 3RY4A 3IETA 5ISZD 4HCRA 2OL3A 2OTWB 1ZA3B 3MV11 4XZUB 4JEGB 3M45A 1Z9LA 5HI3C 3JWDL 3OPZL 1QRKA 4CVXA 1U2CA 3GBLA 5BQ7A 4FFZH 2FX9L 3O2VH 4M5YL 2J5LC 1I7ZB 4U1JA 1NBYB 3RX8A 1JZ4A 4FQHA 2X89D 3JUZA 4JZOA 1SJHA 3I50L 3VDCA 3ILPA 4XP4L 1UACH 5HYFA 3CCHA 5HHOE 5GS0C 2AJZA 3RGVB 4F80A 3QULA 5EH1A 2BVPA 1UXSB 2AK4E 1IVLA 4UBDC 4D9RE 1RD6A 1X9QA 4DVRL 3SGEH 3BRGC 1YECL 2DICA 3PNWA 2VH5L 5IR1A 1C08B 3MLVL 4M8QA 3DETD 4MCZB 3EDJA 3RPIB 4FZEH 1B9ZA 1KPUB 4EQ2A 3MGTA 2HAZA 1PDKA 5LWYL 5CEZL 1A3QA 3EYFB 3CFDB 4WU7A 1YN6B 1J0HA 1MCQA 1G7MA 3QCTL 4GOSA 4O02L 1A1NA 2D0FA 2AXGB 1K6QL 1IGJA 4JJ5A 4ZAKB 4P2QB 2A6KB 3ZKSD 5D9SB 1RIUH 4XX1E 5DUMH 3G9VA 1I1FB 4U3XA 4P3CH 3O41A 1IRAY 4K9EL 5EPMA 4Y4HB 2HT4C 1IEBB 4NZRH 3S35L 3LKSA 3T0EC 5FYKH 5IGXL 3BDXA 5E9DE 5D1XB 3BSZH 5AZ2H 2PW1A 3CMOL 4KRNA 2XIDA 1X7QB 2X4RB 4X6EA 1HIML 3PP4H 5J56B 5I16A 1K85A 3ECBA 4X7CC 3NIFE 4ELMA 3OKDB 1IC4L 1I1AB 2R0ZH 5T1LB 5KG9B 4XP5H 3MROB 1T1YB 2XZZA 3MV7B 1KB9J 2APWA 3I3DA 4MZ3A 4LF3B 2PTUA 5HGAA 5ADPH 1VSCA 2IPUK 3O9WD 5D7IE 4NN6B 4CNIA 1YEEL 3TBYA 3CFBA 2WUCL 3QH3A 3QFDB 2NY5C 3FFCB 4ZUTB 3KYOA 1HYSC 4HW6A 1HDMB 4P4RA 4CRPA 3RJDA 5C6PB 2GK0A 1X5ZA 5J89A 4NDMA 2CMRL 3V52L 4JKPL 5F1IB 3UTOA 1RUQL 3KYMB 1INEL 4ZNEE 1IGYA 5T1DH 4I5BA 3A0OA 3MCLH 2I27N 3CVHL 4KKCC 2DQHL 5TH2A 2DLHA 1BLNB 1FVDA 1JGUH 3DSFL 4ZS6C 5AYUL 2HMID 3IFLH 3IDXL 1K2DA 3JTSB 3L3KB 2EE2A 5I2IB 3HMWL 5HJ3A 1ZA3A 4N0YH 2X4PB 5F21B 4XP1H 1DLFH 4FQ2L 4QRUB 5IWLA 4PJHE 1HWGB 3T2OA 5F7DA 1I7ZA 1EGJL 1HEZA 3TYGL 4PJIF 1JFQL 2ZUVA 5E8PB 1A9BA 1UJ3C 5IHLB 4TPRL 2OXHA 5DR5H 4Y89A 1RUKH 2QADB 1J0JA 3U0PA 1GOFA 5T33L 1C5BH 3CSYB 4JRWA 3OHXB 1IFHH 3VRLF 3KPPB 4RWYH 4G8FB 4JM2D 1UXSA 3QHZH 4I77L 4M03A 5FCSH 3RVVC 1F13A 3QEUB 3D2UB 1N6QH 1TIUA 4H0HB 4HXAL 3WLBB 4GAGH 2R8SH 1C08A 1UT9A 3VFGH 3HG1D 4MCZA 3BEVA 2WBJB 3G5YA 4EUPH 3IDIB 1KPUA 2NXZC 2EYTB 1YY8B 3BGAA 1YN6A 3LQZA 5CGTA 4X5LA 5LCVL 1KXQE 2AXGA 4OCWH 4ZAKA 3ARFC 2WWMC 4YR6B 1FJ1B 1IGFL 1TJHL 5GRVK 2XV6B 4G8GE 4F7TB 4Y4HA 1H8OA 1IEBA 4OIBA 5D1XA 4IRJB 2HJFB 4UOW1 4JN1H 4U1MB 1X7QA 2X4RA 2VLJD 4WFFE 5C0BD 1KUMA 2B0SH 5J6GB 3IU3B 3OKDA 1X5LA 1UYWH 1MPAL 1I1AA 3B9VA 2Z0BA 4ZTOL 4J23A 3FO9A 3W0WD 3BHBA 3MV7A 1KCSH 2BFVH 1NDGA 4NQXB 5BW7C 2EE6A 3HNTL 3TLRA 2VQUA 5B38G 2OP4H 1JZ6A 3HC4H 2DI7A 1QSFE 1V3LA 5JHLH 4W70A 1U2HA 4HEME 4M48H 1DVFC 4PJGB 3GMQA 5MENE 1RHHB 4P2RA 4JGJA 5JR1L 4LHJB 4M1CD 2XZAL 1GYAA 3JV4A 5F1IA 4PS4H 2EDWA 4GW1B 2G60H 5E1HB 3ARRA 3BYTA 5LQBH 3ZE2E 4OV5B 1CYGA 3Q5TA 4N1HB 5IV2B 3LMJL 2YD8A 3R8BB 4U6XB 3RWJA 3P77B 1YUHB 2F19H 4OCSH 5JPNB 1HCVA 1JK8A 4DKFH 1XGPB 1FNAA 3NFSH 4MA1C 3L3KA 2JELL 3KR3H 3DUHA 1VGEL 1EO8L 5DYOB 3BPLC 5INCA 3FN0L 4DVBB 2R4RL 3PDGA 2AJSL 3RWDB 2J8HA 2X4PA 5FB8B 2VDNL 3DRQB 1T22B 1MUJA 4UV4L 1F4WH 1J0IA 1A7OH 5E8PA 2NY0D 3O8XD 5B3JE 3VXTB 1U58B 4LLVA 2HH0L 1ZLUH 3OHXA 4X7SH 3KS0J 1JP5A 3KPPA 5E1AB 5JQ6H 4G8FA 3C5JB 5B39B 4WJ5A 4Z9KB 1U8NA 2ESVB 3QEUA 1OAKL 1ES0B 1HWHB 2F58L 4L3EE 2KQMA 1T66C 4YHOL 1U8MB 4GMTH 4NQTA 2EYTA 1YY8A 2Q86B 2VXVL 1A1MA 4PJDE 3B2UC 2B7DT 5AG8A 1LO0H 1MEXH 3U83A 1CGYA 4CMHC 2NX5E 3MV8A 5E7FA 2DQUH 3QYCA 4JM4L 1WAAA 4N5EC 3A6CH 3G08A 3QIBD 4YR6A 3SPVB 4JQIL 3FO1B 5FYJD 4UUJB 4X6CB 5EBMA 1T0NA 2OSLA 4F7TA 1DBAL 4KJPC 2G5RA 5TFSL 2BJML 3WO4C 5DA4A 4MAYA 5CAYB 1UQSB 4OF3A 1U3YA 5C0DB 3ARWA 4XMPL 4KHTH 2JF1A 3LEVL 3RU8L 5AAWA 5KVEH 3NFPB 3DVFA 4XPGH 3DX6B 4GBXA 1OTTD 4NC0B 3TC9A 4OCRL 2YWZA 4ZO8A 4PJFF 2XACC 4HMDA 3S37L 5JLZB 1VB9A 4NQXA 1TZIB 1KSRA 32C2B 1AR1C 4S1QL 5DEFA 3ZTJG 4PJ5D 1ERNA 1H3UA 4BSWB 2X70A 5FM4A 1CZ8H 3QWRD 3ISWA 4PJGA 3THML 2O5ZL 1IM3A 5DHVB 4TUKH 4KI5F 3BD4A 5DI8B 2VDMH 1ZK9A 4KK5D 2FX7H 2HTKC 3PDOB 3P0YH 2LU4A 2F5BH 5D7KD 4HUWB 1MI5B 4UILH 4OIIH 2RGSA 2IPKB 4Y5VB 4AEIH 1IKFH 5IVXB 2RJMA 1HHHA 4OLWL 4JCMA 4BZ2H 1DQDH 2FO4B 3RY6A 1N4XH 4U6XA 3X17A 1YUHA 4MD0B 3REVA 3SN6N 5DRXB 1S9WB 3DVGB 2XTJC 4FQQB 1YEFL 2LTQB 5I8EB 1NGWB 4FFYL 2FGWH 1AKJB 3PHOA 1G1CA 1FGVL 1NCWL 3MUGB 4OT1H 5GISH 2VLKD 4P5MB 3TBVB 3DRTB 5IOPA 3RWDA 3BP6A 3SJVA 1UA6L 5HYJA 1T22A 3BOVA 2DS4A 1AE6L 1YJDC 3ZHKA 2MQ3A 4YHIB 3MXWH 5E2UL 5HHVL 1T89C 3MUHL 5TQ2L 3ZDXF 5D70H 3FT3A 5ESVB 5ESAA 1HILB 3IJYB 1XIWD 4OLYH 3GSRA 4ESKA 3LQAL 1I7TA 3U4EA 1MRCL 1ONQA 5E1AA 3C6LD 4OFDA 5B39A 4GKOA 3FQRA 5C6TL 2ESVA 1CD0A 3IF1A 4U0RC 5DZLA 4M1GH 4IJ3B 1SEBA 2IJ0C 3UTSD 1AD0A 3ESVF 1WCBB 2WV3A 1IEHA 4P9ML 3WS6C 5KW9H 2AJYH 2CH8A 4G8IB 1UB6B 1Q0XL 3P4LA 1ACYH 5FGBC 3UDWA 4E5XB 3EJYC 2X4TA 4MDIB 1S7XA 4UBDD 4WWID 1A4KB 5T1KD 3RIAK 3JTTA 2C26A 3FO1A 4H25B 1YNTB 5D8JH 3GSXA 1VPOL 3F58L 4YHML 2EEBA 1CBVH 1TENA 1UQSA 2DOCA 4RFNB 3QQ9D 4G6KH 1ZANL 2C3VB 3F5WB 2W38A 1YNKL 3V5HB 5MP6H 2B4CH 3EYSL 3BUTA 4ISVB 1AXIB 4JGUA 1EFXD 5I71C 1EJ6A 1DSFH 4GAJL 2HT4D 3QI9C 1KCVL 3HC3L 3MV9D 3H9SB 5D2NE 3T0ED 3N1MC 4ZUUA 2EDHA 4L9LB 4WFGE 5JLZA 3H3KA 1ZA6A 2HP4A 1TZIA 1RK0B 1F6LL 3SCMC 4OB5L 4YFEA 4MXVE 1LWRA 2A6JA 2EEAA 4FG6C 4JHBA 3MXVL 4J7RA 3T4YB 1FO0H 4FTVE 1LDPL 3MRLA 1NEZB 1MJUH 4A2LA 1ZT7A 4Q9RL 1MCRA 3ZDYE 1A3RL 2ED8A 1ADQL 1GGTA 5B8CB 2JJTA 4Z7UE 1BBJB 5IBTH 5FECA 4LSUH 1RU9H 1U6AL 5E8EB 1H3WM 1H15B 2X7LB 1MI5A 3QXVA 4Y5VA 3GGWA 4HLZG 1J8HD 4OFYD 5IVXA 4ODXB 1ZSDB 4G6JL 2VXTL 2YPKB 4YHNB 2FO4A 1MIMH 3PF2A 4LVHB 1HYSD 1JRHL 2NTFB 4GKNB 3OWEA 4R9HA 5SWZE 5DRXA 3RWCA 5JXAL 3UTQB 2X41A 4KZDH 4FQCL 4PGDB 4I9WE 5I8EA 2X4OB 3GJFH 1NGWA 5FHAH 5BZWA 3AXLA 2VN7A 1Q9LA 1S7TA 4HV8A 4Y5XB 3LH2L 3DRTA 4HKZA 3EO9H 4KKCD 4Z95L 3PGCA 1JZ2A 2YSSB 3RA7L 3D3VD 3K46A 2C1PA 3GSUB 4BYHA 2IH1B 3U46A 2ZUWA 3KPRB 3TV3L 1S9YA 5DVNA 4LBEA 1DQMH 5BV7H 4YHIA 3T3PF 1D5BA 2FHBA 3NAAH 5GZOD 5ESVA 2FL5B 5DD3H 1HILA 5JA8B 3RL1A 1I85C 4OF5A 2F8OA 5T3XH 3R1GL 1N59A 3WDIA 1N5AB 4N90D 2Z31D 4QTIH 3VA2C 3WXVL 4O00A 4GLRH 4YDLB 4NO0D 2BRRH 3WUWB 1JN6B 1CL7I 3D39E 4W4OC 1HHJB 2EZ0D 4NZJA 3ZMRA 3VFOB 1B0WA 4DGIL 2BNQA 1FAIH 4ZDHA 1MJ7L 5D5MB 3T4AA 5EUOA 4G8IA 1UB6A 5FYJL 1CFSB 3DIFB 3C60B 4OFIA 4E5XA 4ORZC 1ZTXH 3ZL4L 5GJTH 3RVVD 4P23C 5C8JB 1JI2A 1FV1A 3VWKA 1Y0LB 2SEBB 2PUQT 3ES6B 2BY0A 5ADOL 3U4BH 2QSQA 2YXMA 2FEEI 3BZEA 1WC7B 4XXCA 2NXZD 1P4BL 4GW5A 5TF1H 5L6YL 1NLDH 3F5WA 4P59H 4DKAA 4QRRE 1S5HA 4OV6F 3X14B 3ULVE 3V5HA 3CU1A 3OKKA 3I3BA 4PJEB 4NQVA 3BFOA 5DQ9A 2WWMD 1NCDH 4XAWH 1ZHNB 4D9LH 4R2GC 4Q9QH 3QFJE 1ZLUK 3H9SA 3WE6B 3OF6D 1KBGH 3FB7B 4QEGA 2EICA 4OCLC 4NRZA 1HYRC 3SKJH 3RHWF 1HE7A 5FUCC 5ICXA 3VGEA 4PUBL 4KQ4L 5IVOA 4R3SA 3T4YA 4XVUC 1N6UA 1NEZA 1K4DA 4HSQA 4I0PC 4X6CF 1H3PL 2DQFB 4S1RH 1A6VH 4NJAL 4TVPD 1KTKE 2C7UA 2QEJA 3MC0A 4X99A 1VEOA 3HNVL 4R97C 4J8RB 3BD5A 3HRPA 5I19H 5B8CA 1MNUL 4NUJB 2YRZA 5FEBA 4YO0B 1BBJA 4MHHI 3B6SB 4WCYH 2BNUA 1H15A 5K33A 4XAKE 4DZ8A 2HKHH 4TUOB 3NPSC 4NBYB 4PRPE 4PR5A 2ICWB 4ODXA 1J5OL 4RMTA 1DVFD 4ODUA 2ZUQC 2CO7B 1A2YB 2CUMA 2GHWB 4RGNC 2VZSA 2X5PA 3CSGA 2NTFA 5TDOB 2HLAA 5C0IA 5FYLD 5I73C 2BSRA 2VXQH 1I9RL 5I0ZA 3STLA 4CN1A 4CDHA 4Y5XA 1G6RH 5FA4A 3FO0H 4TSAL 4A6YL 3GSNH 3OR7B 1TZGL 4PJ7F 1LEIB 1MCLA 2OR9L 3UPAA 1BFVH 2IH1A 4C55A 2QQNL 5D2LE 1HNFA 1TNMA 5H2BB 4L4TE 1R3HB 5DD1L 4U3HA 2AEPH 3VD5A 3O4LB 2AI0L 5MEPA 5HPMA 1CT8B 4QF1B 3VXUD 5C0NC 5IQ7H 5AWNH 4EN3A 4J1UB 1IAIL 1SYVA 3MOAH 2FL5A 2RR3A 4J4PA 2HJLB 4YEEA 1LEGB 1N2RA 3WD5L 1MCWW 4L8BB 4LVOC 1SEQH 3A67L 4XTRC 4M3JA 3KJ6L 4JFHD 1N5AA 4K3GA 1CU4L 4YFLI 5LGHH 3VXRD 4OD1L 4E0RB 1R3JA 3L9RB 2MWCA 1FRGH 3B2VL 1WZKA 3I75A 4K71C 1JN6A 5GS0L 4NYLA 3BVNB 4XWGL 4HWEL 1ZS8B 1MAML 1EEQA 1RUMH 3IDGB 3S36X 2XQBH 1HSBB 4G9FB 1OT1A 4M4PA 3AMLA 5D5MA 4KK8C 1NKOA 4L8SA 3TH2T 3C60A 4G7YL 1G7PA 4N8PA 5CSBA 5L0QC 2VITB 4Y2DC 3SGDI 3KPQA 5BXFA 5L2JA 2V17H 2ERJC 3OKMA 3HPJA 4ELKB 1N64L 1CS6A 2R0WH 5F7YC 5C8JA 1Y0LA 3FQXB 3AY4C 1OAQH 4U33A 1RFDL 3HCVB 4PGJA 4OKDA 3CVHB 2YKLH 3VXSE 3RWFB 5F88B 2BVTA 1T0MA 1AQKH 3UROR 3B2UD 5FV1L 3B9KC 5ITFB 2R4SH 1JPFA 5J6HB 1QD0A 3X14A 4J3VA 4JRYB 2AK1H 4W6YB 4I3SL 4N5ED 4JG0H 3VRJB 1OVZA 1MRDH 1VA9A 4HBQA 1ZHNA 3BQUC 5KN5A 3PJSA 2MPAH 5GXBB 1CQYA 1NANI 3KPOB 2EKJA 1DCLA 1KULA 3VCLA 3FB7A 5CGYD 3LV3B 4NWUH 1LK3H 4Y0GA 2R1YB 4UV7H 5TJWK 3RNKB 4O4YH 4NFCA 4GQ9L 2X4SA 4FFWC 2CDFA 2ITDB 3QJFB 5L2KA 1VACA 3QDMA 1U36A 4RNRB 1G7QA 4LPCA 1YN7A 1X4XA 4HS3B 5I18H 3TM6A 3VWJA 3PHSA 3MGOA 5CEXB 1INQB 4G6ML 1ZT4B 4KK6C 4YO0A 2VERN 3B6SA 2NY5L 1AR1D 3NVQA 5I74C 2V7HA 5JIHA 4YBLB 4UTBL 4I18B 2ICWA 1FO0A 1RUAL 1H8NA 4LPYA 1JGLH 5FKPB 1RZIA 1KPRB 3SKMB 1ZEAH 3BZ4A 3S96B 4HPYH 1RZGB 1B88A 2JJSC 2IANA 4CL7A 1KJMB 3SDXB 4NNXB 2AGJL 5L88H 2QKIA 4XP9H 3UTTE 1KENH 3S4SG 2UVEA 4M6OL 3RVTC 4N0UE 5KVFL 3SDDC 5C86A 4LLQB 4KQ3H 4AT6B 1LEIA 3U0TB 4P57A 2WUBL 1CR9H 4XVTH 3QDGB 4WW2F 1ZGLB 2XTJD 3HI5L 5H2BA 1OW0C 2X09A 4ZQKB 1YMMD 1TTGA 4M6NL 5DD6B 2ZJSH 5LGJB 4K55A 5GGRA 3I9GL 5IF0B 1JWUA 4JFEB 1EXUB 4Z76B 2HJLA 3F7QA 5TE7H 3KYKL 4QRPB 2Y07H 4U7KA 4BH7A 1MLBB 1MQKL 1RPQA 1BD2E 4WHTB 1UB5B 4GXUN 4E0RA 1A6ZA 3L9RA 3HC0A 3KGRA 4NZUH 4JZJC 3HZYB 4DOHE 4D0DB 3GO1L 5CSZA 5C0CA 1DP0A 1LNUB 3Q3GB 1AXTH 1EA9C 3ROOA 3QRFM 2CKBH 5I66A 4G9FA 5ALCL 4V1DB 2Y5TB 2B5IB 3NPZB 2AQ2A 3KPNB 4MNHA 4G9DA 3GJFK 2VITA 1F2XK 5BVJB 5IB2B 1D3CA 1MIEH 3GRWH 5JPMA 2HFEB 4OTXL 1OAXH 2DKMA 2FDBP 3DJ9A 3FQXA 2G5BB 3PV7A 2X44D 3L1OL 1QLEL 3HCVA 1QR1A 1LD9B 4OFPA 4NRYB 3WFCH 3RWFA 1GHFL 4ONOA 3O45B 4GW4A 3DXAD 3EJYD 3U7WH 5J6HA 1MCFA 1P53A 4WWKB 2AABL 1JPSH 3VRJA 2P8PA 3PWLB 3H9YA 4M7LH 4ODTH 3VRLE 3DV6A 5SV4A 3FT2B 3BWAA 2BC4A 2YA1A 2BY3A 2EDXA 3LV3A 2R1YA 1WGOA 3MBEB 4S0TD 5DUBB 2V2XB 1N8ZB 3MFFA 4OZFG 1H3XA 4WEBH 2ITDA 3QJFA 3V6OC 1FG2A 4NT6B 4XPHL 3UCRA 1Q9WB 5D7LD 4PJAA 5IM7B 1CDIA 2ICEA 4ZPVB 4HS3A 4UINH 1L7TH 1MRFL 2HFGH 3QI9D 1QQDB 2W0PA 4XNZC 3O2WL 1ZT4A 1FZOB 3BGFC 4TVSa 3FAXA 5CJXA 3SCMD 1GGIL 4NQSB 3K1DA 4PJEF 1U8JB 1XR9B 1ULVA 1FYTD 3QCVL 4FG6D 1NAMH 4XCEB 4Y4KA 1U3HD 3MNWB 1KNOB 1B0RB 43C9A 1KPRA 3SKMA 3LN4B 2HT2C 1NSNL 4NQEB 2BHZA 1IQWL 4WFHD 1FCCA 3QG7H 4QRTA 2CK0L 3K2UH 4HQQH 5T3ZH 1KJMA 4WV1B 4HX1B 4MD5A 1F02I 4WTZG 4HIHA 4TYUA 1KJ2H 3W5NA 4QTHB 5C2BH 4KRLB 3F7VB 4LDLB 1ZGLM 3CMGA 1FSKB 2AQ1A 4LLQA 5EU7C 3QEQD 1H3TA 3E0GA 2I5YL 3BKJH 5E8DL 1X4ZA 3H9HB 3MLSL 3NOIA 4WI5A 3P4MB 1SJVA 4O2CB 4NKMA 4LEXL 3EDDA 3SDYH 1ZGLA 4DN4L 2GSIB 4OLUH 4CW1B 1UH4A 3DURA 2V9TA 1T5WA 5IB4B 5JW4R 2XOTA 3GIVA 3T1FB 1PKQB 4APQC 4PB0H 5IF0A 5FK9B 4QT5B 5FIEA 3O9WB 2MCG1 3CXDL 2ZNWA 1DLHB 2R29H 2B1AL 4GO6B 1MLBA 1CLCA 4ELME 4Z8FL 1RZJH 4FOMA 4FQIH 5MEOB 4NBXB 4DTGL 4K94C 1LO5B 3HZYA 3WFBL 4D0DA 1HN1A 3FB5A 6FABL 4K23L 5FA3B 3Q3GA 3WSQH 1X5YA 3LIZH 2Y5TA 3CFJB 3WKML 2KPNA 5E4IA 3TO4A 5HDBF 4LSQH 3VFTB 2X4UB 3P11L 3QQ3B 4ZSOA 1TQCB 1DQTA 4U05A 2IBZY 5IB2A 3QBTB 1FPTL 1UWGH 5JOPD 4QXUL 1J10A 2R39A 2XA3A 3MA7A 4UQ2A 2G5BA 4MMXC 3MRKA 2JCCB 1FLTX 3V4UL 4KAQL 5GGSA 5T1MB 5TE4H 4NZTH 3OKNA 2I60H 1UM4L 1OSPH 3P73B 5ISZA 5KJRH 4X9HA 5I1IH 4DQOL 3GMPA 4GRWH 4PLJD 4IIQA 3FB6B 4X8JA 1HKLL 4QOKD 3PWLA 2DQTL 4RMVA 1F90L 3FT2A 2PTVA 3O3BB 5GSVA 3QPXL 4OJFL 1RJLB 3OQ3B 2X89A 4GJTB 2EDEA 2CRZA 4FQ1H 4WHYG 3KNBB 3SE9H 4JDZA 3V0VA 1TETL 1XMWA 1DEEB 1R24B 1SYSB 4HLJA 1X5JA 3KLAB 5IM7A 5IJVB 4R2GD 1OQOA 2VZUA 2BHYA 4JM2B 1QQDA 2OXGA 3RAJL 3WL9A 5C0RH 1RJZA 4GRLC 1V7NH 3WV0A 4P5KB 5EZIH 4HGKC 1C12B 4NQSA 1RI8A 4NP4L 2R23B 3HG1B 1W0VB 2R69L 4XCEA 1CE1L 3WXWL 1KEGH 4LDEB 1UCBH 2J88L 4I0PD 1KNOA 2PYED 1B0RA 4YQXH 1A3LH 3LN4A 1RHFA 5E2VL 2OYPA 3A6OA 1UM6L 4R26L 2R56H 1LGVA 1GZPA 4XPFH 2EC9U 4YFDB 3VG9B 3RGHA 1M6OA 3RKDC 4MGXA 4PLOB 3C09C 1JL8A 3F7VA 2J2ZA 4JPWL 2XWTB 4NN7C 1II4E 3H42H 5IJKC 4HXBH 2HFFB 4LIQL 3CVIH 4NO5A 4RGND 5KVGH 3G6DL 2XPGB 5C0BB 3P30H 3K4ZA 5F9OL 4JVUA 3C5ZB 4O2CA 4S1SL 1A5FL 1KF9B 2NY6C 1ZLSL 1KIUA 4YX2L 3W0WB 4OZ4A 4NGHH 5IWLC 1B4JL 1RZKH 1YJDL 1PKQA 2R2BA 2P44B 1KN4H 3A6BL 5FM8A 3HE7B 3CC5A 3O9WA 2UYLB 5D7SL 4YUEH 2APFA 2E9JA 4X0KB 3X3GL 1D6VL 3SDXF 4PG2A 3HAEG 1UWXH 1LO5A 1TTUA 1HI6B 3MV7E 5C0ND 1NGYB 4MB4A 4JN2B 2AAVA 3N1FC 4LU5L 4G6AC 1KTDB 3BN9D 2CGRL 2JJVA 5FA3A 3LS5L 5I9QB 5E8OB 2FECI 2EXWC 2AJVL 3K4DA 3RKPA 2J12B 4WI4A 2XZCH 3JWOH 3QAZC 2H45A 4GKZB 4G7VL 3VFTA 2X4UA 3NACL 1R5VB 3S98A 1T04B 3FFCE 5F7MC 1RZ8A 4EVNB 5BMFL 4PG9B 2ZKHL 1Z6JT 2YZ8A 2UWEB 1NUGA 2X1WL 2CKBA 4NO3B 4CMMB 5T1MA 4P46D 4KK8D 3ZDXE 4Y7MA 1S7WB 5BO1L 3H0TB 1A22B 3N06B 1FE8H 5I1HL 5CKGA 4I48A 3V8CA 4BZ1L 2H26B 3VXOB 5CZKA 3GRWA 5HY9B 5ALBL 4HT1L 3VD9A 5HHNA 2G2RB 3X12B 4PBWD 1GGCL 3VXMD 4EDWL 5HI5D 1JNLH 2ILLA 1HHKA 1OGTB 1WFUA 1QZ1A 2NY0B 1RJLA 1CDBA 1AGEA 3O8XB 2H2SC 2YBRB 3B9KD 4JB9H 3S3PA 1DEDA 3WLWD 3RFZC 4Y2OA 1KXTB 5BZDB 1R24A 3BQUD 1SYSA 3KLAA 5IJVA 3CFCH 3G5ZB 4ZUVA 3L3DA 1XR8A 4JQVA 1VEMA 1AGDB 1C12A 3S36L 5HDOA 4NOFA 2HN7B 3HG1A 4FFWD 1P7QD 3G5VB 3TP4A 1YEKL 1GZQA 4ALAL 2RFXB 3UC0L 4P4KA 3WS3B 3WDJA 3VW3L 3IFPB 3RWHB 2F53B 1P5VA 1EO7A 1YNLH 4HS6B 3QIBB 1T2QL 4KK6D 4PTUA 2VXUH 1P2CB 3GSOB 1N0XL 4JO3L 5DRZA 2EKSB 5C07D 5JDSA 1XGRA 1VKXA 5IROA 4LMQI 1NAMA 5C7XL 4AIZB 1MAKA 2HFFA 1VADA 3QG6B 4F8QA 3MV8E 2VLJA 4F3FA 2HRLA 3KJ4B 1H5BC 1WAAE 2JB6B 3L5WA 4RBPH 3VFMB 4JFQB 2ZOKB 1QO3B 1LO2L 3F7PC 5IEKA 3WIHL 2XZQL 5E03A 3ULSA 2ZSWA 2KZWA 5T5FL 2ZCHL 3AVEA 4S1DD 4UT6H 3U6RA 5TGBB 3MOBL 2ZCKH 3SKOA 4KC3B 2UYLA 1J86A 4PJ5B 1D5XA 5F9JB 4XNYL 1BFOA 3QRGH 4ZOCA 4ZFGH 4JGMA 15C8L 5EU4A 4JN2A 5K9JH 4CADB 3HZKB 4XPAL 1REIA 3MR9B 1AY1L 1BAFH 2GEEA 2D31A 3Q6GL 2ADJB 2Q3AA 1ADQA 1UEMA 2FD6L 4GKZA 4PJGE 5I1LB 4XNXH 1R5VA 3FN9A 1T3FB 1JGDA 4PJ9D 4HUUB 1GAFH 3BAEH 1CFBA 4I2XB 1JHKL 2JB5H 2A0LC 2WANA 2UWEA 3OJ2C 4CMMA 1CK0H 3NIDF 1N26A 5AZEL 1OY3B 5FF6B 1S7WA 3MYZA 1AHWB 2FIKB 3BP5A 3L3OB 3G6AA 3TIDA 2HJKA 4MAYC 2BCKB 1WEJH 4JFFD 3VXOA 2N1KA 1MF2L 2YPLD 4KVNH 5SV3A 1YEHL 4A6YB 1TCMA 1VERA 3QDJD 3UJTH 4NQCA 4GBXC 1OGTA 3UAJC 4XVSH 1CLYH 2VN4A 5SWSD 4OM1L 4YAQA 5GZNC 3NABL 3UMTA 5E2JA 4O2EB 5EWIH 5HYJE 3FMGL 1YYLH 2Y1VA 4FXKB 2JCCF 1QNZH 2J5LB 3G5ZA 4FZ8L 2R0LL 1TCRB 1BFTA 1DJSA 2M1KA 5E5MB 2PR4H 1DUYB 2A73A 4K7PX 1NGZB 4HAGA 3U48A 1AGDA 2OK0H 1RY7B 2X10A 5C09D 4HKXA 2IADB 4HWUA 5I30L 3PHQB 3P0VH 2VLRA 3UTSB 2YPVH 3G5VA 1KPVA 1KLGB 2IPTH 2C3HA 4NJ9H 2Q8BL 3CPLB 3WS3A 3GSQA 4AEEA 3UJIH 5DJZB 4XMLH 3RWHA 2LABA 4BJLA 4HS6A 3QIBA 3D69B 2ESVE 3GSOA 3O81A 5T1KB 3RY6C 5I1KH 5AUMB 1OAUH 3SY0B 1P6AB 2QHRL 4EOWL 3S88L 1JZ3A 1BPVA 4ZO6A 1KIRA 5LXGL 4JM2F 1SM3H 4PPTA 1PSKL 4LSVH 1ZMYA 1AO7D 4F58L 2FBJH 4JFQA 2D0HA 1QO3A 5D7JD 5DJAB 3P9MB 1NCAH 1U91B 3I6GA 3C2AH 1EMTL 4X6CE 5A2FA 3BRDA 4TVPH 4F7PB 3GI8L 5GRWA 2EEDA 1M4KA 3MV9B 3T0EB 2ARJA 3PIQB 3MODH 3GMOA 3X11A 2DDQH 1YYMH 4I1NB 1D5IL 4PJ5A 4WO4C 3O2DH 4X8XA 1KJ3H 5CWSA 3R06B 3QWRA 1F4XL 2VUYA 3RNQB 4ETQB 4AJ0A 5C08D 5HHOB 1FL6B 2UZIL 3FCTB 4PJ8D 1XF3A 1N7ML 5F6HI 4L9DA 5FYLH 4CADA 4APQD 2B1HH 3HZKA 1TNNA 5CJQL 3F6LA 1MCJA 4WGWB 5KOVC 3MR9A 3F7RA 1I3RB 3BDYL 4WY7L 4JANB 2EO1A 3EYVA 4O9HH 2ORBH 3MLPA 3WIIL 4KZEH 1CLZH 3KAAA 3S9DB 3ZE0F 5FAAA 2AQ3A 2FB4H 5F6HJ 3B43A 3UDWC 4TNWF 1WLHA 1CN4A 1JTPA 4U1IA 4Z7VF 5EN2B 2BSSB 5EC1B 1QTYT 2IQ9H 3QUYC 4OCXH 1MI5E 3HN3A 3C6SA 43CAB 4M5YH 1L7IH 5IVXE 1KIQB 5C92A 1AHWA 2R9HC 3PWJA 4MB3A 2VLKA 2O5XH 2QQLH 3L3OA 2QQQA 5IHUL 3U7AA 4C54A 3D3VB 5F93C 2ICWI 4IDJL 4MA8L 5DMJB 3I50H 1M71B 1MHPH 2NR6C 5BVPH 2VQ1A 5EU3B 4R0LC 3TNMB 4M00A 1IC7L 3C8KA 4ZD3L 1UWXK 1B2WL 5HYEA 3IDYC 5F7EL 1IAIM 4EI5C 2E9BA 4AEHL 4OCYH 4RMRA 1XIWA 1HQ4A 4O2EA 2FWOA 5GJSL 2BSTA 2OX5A 2ICWJ 3CFKB 2Y36L 1AI1H 3C6LA 5HGDB 3GJEA 5TPWL 1GGYA 2AK4D 5DFVD 4D9RD 3HLAB 1NGZA 1UJ3B 3ORJA 3SDCA 4LCWB 2Q20A 1P4LB 5FUZH 4O02H 1K6QH 3D25B 4LCIL 2DB8A 3VI3E 2VDQL 3FQWB 4JY6B 3VE0B 1EEZB 1MFCL 4K9EH 4PBVC 2O5YH 3S35H 4DCQB 5JQHC 4GRLD 5ECJE 3ZTNH 4JDTL 3AS0A 5T1KA 1Z2KA 3E3QC 2BNQE 4N1EA 4PY7B 1F45A 3H7BB 1IC4H 3OXSB 4MQ7B 5GSRB 1EHXA 1OTUC 1P69B 2R2HA 2NXZB 2RCSL 3RDTA 2AXFB 1OLZA 3DMMC 4NCC1 4XVJH 5IVZB 3PGFH 1MFEL 4KHXH 1F3DH 3QUML 3BKCH 3OKOA 1KGCD 1LEKB 2XA8L 4A2MA 1S5IL 3ARFB 3P9MA 4JHAL 2VR5A 3L3JB 1EFXA 1K8DB 4JFPB 1AXSB 4HHAB 3GBNL 3DPBA 4PY8I 3MV9A 3T0EA 2WUCH 1Q9OB 1U42A 5CSGA 2L7UA 2Z35B 1CD1A 2F54D 5C0AB 5CUSH 4G8EB 1P9MA 1FIEA 3HMXL 5CIPH 2P5WB 4X6DF 2D2OA 3IXTA 3MJ9L 2NY6D 5FUOH 4UNTA 3D9AL 2GITB 1YDPA 1SJEB 3H9SE 4PY8J 1I3GL 2VTFA 1WBYB 4MVBC 2D9CA 4UNVA 3AAZB 1R3KA 5H35A 1I3RA 3LPFA 1BIHA 1JYNA 4OLEA 2HG5B 3VXNB 2X4QB 5AYUH 1J8HA 4OFYA 3CDYA 1DVFB 4X9BA 3ZT7A 1YEIL 2EE3A 5ENWA 3T77B 1LP9F 4KTEL 4XNQB 1W8OA 4IRSC 3UTPD 4G6AD 5JORB 3EFDL 4ORGA 4IOFC 2VLLA 4KVCH 4PJBA 5FM5M 4JFZL 4DGVL 4NZDA 4RBPK 4LLDB 1F4AA 3VWKC 3KYNB 3JV5A 3LD8C 1EGJH 4ZFOL 1O0VA 3AREC 5EA0H 4XXCC 4NSKA 5ID1A 3D3VA 4DGYL 1YC8A 1OB1B 4ODVL 2XN9D 5DO2C 1CICC 5FGSA 1D5ZB 4FQLL 4MA1B 2I24N 4MXWL 3GDBA 4XCCL 3VXUB 5KVDL 1CL7L 3UPCA 3W9DA 5E8NB 2PTTA 3BPLB 1OM3L 4NQDD 1UJTA 4LPXA 3KVQA 3CDCA 2EDLA 4W68A 1Z9MA 5DWUH 3BGMB 4HXAH 3CFKA 2Z31A 3VXRB 4KI1A 4X5WB 3FTGA 4B7IA 1IAKB 5DRWB 4NO0A 1MFAH 25C8L 4TRPL 3HLAA 3C9NB 1IGTB 3MACL 1BF8A 4HF5H 1MH5A 4KY1H 3FB8A 4RFOL 1DN0B 4OLXH 5B21A 5EO0B 4QXTB 4XHJC 3D25A 3DHMA 1G0YR 3QEGL 3FQWA 1MWAL 1Y18B 4JY6A 4RWHA 4TTDC 4Y16C 1EEZA 2CIKA 3SKNA 2FEEL 5CLTA 4K3DL 1MELA 4XNUL 2BSED 4DCQA 5HDQL 4P2RD 3UXFA 2F74A 3QNYB 5F7HA 3STBA 2VE6B 1RURL 1GVIA 2E7CA 4MQ7A 5D5ME 4BK4A 4U6VL 1QEWA 2AXFA 5IVZA 1T21B 1UCTA 4R4ND 4WI2A 4YE4H 1HOCA 4CMHB 4WFFD 2IFGA 1CGSH 1LEKA 4IOSD 3NIGE 3NGBC 3NA4A 1AXSA 4HHAA 4QHKI 4EIGB 4HJGB 4JY4A 3WO4B 3OF6A 1Q9OA 1JJUA 3MRIB 3TBTB 4K8RD 2Z35A 5GPRA 4UQ3A 3HUJB 1IBGL 1P5UA 2XZAH 4G8EA 1RVFL 1FZKB 4UIKH 4EN3C 3S4SB 1U8IB 4J4PC 1DQQB 4AM0A 5INDB 1Z3GL 4QHKJ 5D1ZD 4PP2A 5IW1B 3ZSSA 2VXSH 1I9IH 1XEDA 3ZYJA 4CAGA 4K94L 3AAZA 4MQXC 1Q72L 3DX7A 1HINH 3GMNA 5C3LD 5IIEA 3BISA 8FABB 2HG5A 1FH5H 3VXNA 4OLVL 3SQOL 1I4FB 1XCTB 3CLEH 3O6MH 1DVFA 1EZVY 1ZKAA 3RWEB 2A83B 3T2QA 4XNQA 2EDNA 4L8SC 3FQUB 4PJDB 4PJCA 3FN0H 1DQJB 1J9CT 2IMNA 2DYPB 4MAUH 5CMAA 5I6XB 3GHBH 3W5MA 2ZOLB 4OZHB 3FQTB 3DECA 4KPHH 1JF1B 5DGRA 4JPKH 2OM5A 4XP6L 5B4MD 2DTML 3H3PH 2PN5A 1OB1A 2IANE 5HTSA 5DXWA 2XTJB 4RQQB 2VDLH 1U8LA 1YMMB 1RV6X 1QSZA 3FKUS 1D5ZA 1BVLA 4KJQD 1LQSR 5GRUH 3RUGA 1FBIH 1RK1B 4YK4C 4AMKL 2P24B 5E8NA 3JV0A 3VMOA 5F96H 2IFFL 5I8CB 1OARH 5B22A 3NH7L 1V05A 3BGMA 5IMMA 3VXRA 1EX0A 2E27L 5HDBE 1IAKA 2B4CC 4ZFZB 5DRWA 1E28B 1G0XA 4CVWA 4GBXD 4I3RH 1KB5L 4HJJL 1L9NA 5KOMC 4BELD 5DFWH 3VWJC 4R7NA 5GZND 4O51B 4JM4H 4FN0A 4L29A 4QXTA 3S6CA 5F9DC 3K7UA 2WINA 3T0AA 2XYCA 4JQIH 3EOAB 2A77L 4ZFFB 1MFDL 4LSPL 1AJ7L 1OAYL 3REWA 3ULUH 2KDGA 4NKOB 3MCG1 3QXDA 4OZFB 3FT4B 1FG9C 1FVEB 5D1QD 1R3LB 4XMPH 1QBMH 5I8OL 4U0RB 4WI6A 1JGVH 2OCFD 1OP5H 4KH2A 2VE6A 3DV4B 3HNSL 4G3YH 4G9FE 4MQSB 1F6FB 4HK3J 5T3XE 4OCRH 5DVLA 1F97A 4ZNCD 3DXAB 3LS4H 4YWGL 5F97E 5D72L 5DK2B 2D03H 4KWUA 2WLYA 3GBMH 4JLRB 4S1QH 1MCOL 3F7YB 4Q6IA 4AK1A 1HH9B 4HJGA 3THMH 1E4XL 2O5ZH 4HIEB 4K7FB 3MRIA 3TBTA 4LRNL 4HG4K 3ZHLA 5DMIL 5C2UB 3QIWD 1U8QB 3W39A 1I9JH 2ADFL 1H3VA 3BP7A 1S7VB 3QP3A 5D7LB 5I71B 1DQQA 1FNEB 5CZVL 3AS3A 4NIKB 5INDA 3SJVD 5GHWH 3QI9B 1A7BA 3CLFH 4K7PL 4XBGB 4ZOBA 5L8JB 1OWWA 1V7ML 5GRVL 2BOCB 4GG8A 4MYWB 5BV7C 3SCMB 1GRWA 5I1EH 4WO4D 1ZVSB 1I4FA 1XCTA 2E5EA 4QYOA 3RWEA 5CD5D 2GCYA 3AS2A 3QNZB 4D0CA 4F7EA 1UXWB 2Y4SA 2A83A 3SOBL 1FGVH 3U82B 2KL6A 3QDHA 4NN5C 2VR9A 1DFBH 2ZCLH 5BOZG 3L7FA 2CUHA 4HULB 3IU4L 4MJ6B 2ZOLA 1S7QA 3VGGA 3B3IB 1JF1A 4CN4A 3LRSB 1NBVL 4MNGA 1YPZB 2EH8L 3MSPA 1P1ZA 1TJIL 3L5IA 1MAJA 3PGDA 3TJEH 4RQQA 3SDXE 4GMSH 4M61B 3QUYD 1YMMA 4POUB 3LQAH 1EO5A 2YD2A 3RVUD 1RK1A 3LHPH 3QQ4A 3ZO0A 1NUFA 2R9HD 3B8SA 2P24A 1MCEA 3QIUC 2FEDC 1F4YL 1RUPL 3H8NA 3K1KC 4Z7OE 2DTSA 2HKFL 3P4OB 3HPLB 3WN5A 5JUEL 1WBZB 3CX5K 5B39G 1WITA 2ARJQ 1E28A 2NR6D 3BESR 5A1AA 4KUZL 2X4NA 1UEYA 1NUNB 3WNOA 3VFWA 4JR9L 5DGQA 2M26A 3MRDA 4CJ0A 1UZ8B 1MJ8L 3AB0C 4JFEE 4EI5D 2WBWB 3P4NA 1OL0A 2IGFH 4QRPE 5CJXC 3QWQB 5A40E 2IC2A 1BREA 1IL1A 1RZ7H 2NY4C 5JW3L 1T7YA 4Y4KC 4ZS7L 1VFBA 4NKOA 5EDXA 4OZFA 3FT4A 4HUVB 3I2CL 2EDRA 5HGHA 1R3LA 1SBSH 2MCPH 3MJGX 4C58B 5FOBA 2DAVA 4HWBA 4OI9A 1XGQA 1OP9A 1A7PH 1QSEA 2JJUA 3RX5A 4NHCH 3ELAT 5EOCH 3WS6A 4PRDA 4V1DE 2VABA 4RAVB 3V6ZA 3C5SB 4Z77B 1NLBH 1QLRA 3DXAA 2Y9RT 5DK0A 4JO4L 2GJ6B 5DK2A 4Y19D 4UOJA 4QOKB 1E4WH 3BO8B 4P23B 5KSBA 4I8DA 5GGVH 2X9WA 1CVRA 4R7DA 4NO2B 1T03L 1L6ZA 4HIEA 1OTUD 5JMRA 4K7FA 1F42A 4DFHA 3DGGA 5ISZE 1A3RH 3DMMD 5FO7B 4PGCB 4C83B 5F9AC 4WTZA 5IVNA 3ZE2F 3TYFB 2QL1A 4MD4B 2H32H 3NCJL 2VRAA 4ZUSA 5E24E 1JRHI 1M05A 2ZPKL 4FTVD 5D7LA 1S8DA 1U95A 1FNEA 4M4RA 4R2GB 3T0XA 2P5ED 1Q38A 3IGAA 3CH1A 3MTRA 4N8CH 3LPWA 3SO3C 1A21A 2BDNH 1CG9B 4NFDA 3VFRB 4OSUH 4FFZL 3O2VL 5DTFB 1R5IA 2NMSA 4HPOH 1FYTA 2YUVA 3Q0HA 1U3HA 4I0PB 2PYEB 2NY2C 1SJXA 1N6VA 4ZTPH 1YQVH 3IDJB 4KDVA 5C0JA 4YHZH 4R97B 3TO4C 3UBXA 2CLRB 4FQJH 3NZHH 3HUJF 4L4VA 4OCMC 2QSCH 3HAEB 3GM0A 1HKFA 3DBXB 3NPSB 1NBZA 5B3JF 1V3MA 5HDLA 1OTSC 2ZUQB 3B3IA 2DJ4A 4EDXB 3QEQA 4HDIA 1MY7A 4RGNB 3QWOA 4IRSD 4NQEE 5I73B 1FFNA 4QHNB 3DROB 4IOFD 5AAMA 4M61A 4FZEL 2C4FU 4IIQC 3WEXA 4UDUA 5IFAH 2AW2A 5E5RB 1ZV5A 2YXFA 5MHSD 4H1LH 4M43H 1KT2B 3ARED 3WIHA 3QO0A 1LMKA 1RIUL 5DUML 4PJDF 2OS7A 2P8LB 4P3CL 3P4OA 3V4VL 1WBZA 5DO2D 2ADIA 1CICD 4NZRL 3ZKND 5FYKL 4UU9A 3O3DA 5GRJH 3BSZL 5AZ2L 3RTQC 4NCDA 2VLMD 4OZHF 1PKQE 1UZ8A 3O3AB 3PP4L 1MOEA 4K3JH 3LEXB 4LVOB 4NPYB 1EHAA 2R0ZL 3TN0B 4XP5L 2C1OB 5EZJA 3SDAC 1DBKL 3DETC 3ZKXC 5CP3A 4K71B 5ADPL 5D71L 4IMLB 4HUVA 4W4OA 3QNXB 5DJ0B 2N56A 5IBUG 4K07A 1QBBA 2KQNA 3DYMA 3TCLA 4Z5RB 2P7TB 3M17B 1I7UB 3U9PH 1FC2D 3VH8A 2B8OT 4RAVA 2A1WH 4TTDD 4Y16D 3TH3T 3C5SA 1IILE 5L0QB 2E7LC 3OX8B 4Y2DB 5D6DA 4NC1E 3ULVD 2ERJB 4OI8A 2X1XR 5DEZA 5KS9B 4QOKA 4JVWA 4O58H 2QJDA 2PYFA 2CDGB 2JCCE 5T1DL 3VXMB 1A1OB 1A7NH 3MCLL 3T65A 3ROLB 1FVCA 4C83A 3B9KB 3HNVH 3VFSA 1MCSA 3TYFA 3NN8A 1JGUL 2E6PA 4MD4A 4JQXA 2EH7H 3F12B 3IFLL 1K9TA 3L3HA 3BQUB 1C5DB 3ARDA 3FAWA 5EORH 2ICCA 3VGFA 4OZIA 1IEAB 1J5OH 5J4MA 5HD8C 4PG2C 5IB1B 2CKNA 2DIJA 4GG6B 3WFHA 4XP1L 1DLFL 1HXMB 2NW3B 4XC3H 3VFRA 5HHPB 2P49B 3PWVB 3HB3C 4EN3D 4ODWB 4J4PD 1OP5K 4I0PA 4LHQB 2PYEA 3S3SA 5EC2A 1UVQB 3BMWA 3MRHA 3O6KH 3GMMB 3IDJA 5DR5L 3D6GA 1RJYA 1IE5A 4H0GA 1RUKL 4CDGC 2CLRA 3BI9X 4L1DA 1VFOA 4MQXD 5I74B 1C5BL 2UY7A 1NFDA 5EOTB 5C07B 3HG1E 2QSTA 3MCKA 4RWYL 4IOIB 4LOUC 3NZ8A 4KI5C 5DD1H 2H3NA 3O6LH 3QHZL 4YDIH 2AI0H 3CUPB 3V95A 4YHPB 2FJGA 1EVUA 4D8PA 1N6QL 2R8SL 4JHWH 4GAGL 5HBBA 5IKCA 4R90H 4G80B 4XMKH 4U4BA 1Q1JH 2W1NA 4LRIA 3SDDB 5D4QA 4OCWL 2BVQB 2NCMA 3EJJX 4X7TA 2QQKH 5C0BE 1CTOA 2P8LA 2FECL 3V5KB 5IMKB 3EYOA 2HTLD 3W0WE 3RL2B 3TEUA 3ZE0E 4JN1L 4OFKA 4P99A 3TPKA 3CH8A 5ANMB 3UTZB 5FO9B 4JQVC 1N64H 1YPZF 3Q1SH 4GUPB 4RMWA 5KSAA 4NPYA 1FNSH 5E00B 2DJUA 1KCSL 2BFVL 1RFDH 1PZUB 5EO1A 2YC1A 5M94B 4KRPD 2B20A 1B0GB 4JZJB 3QDMD 1CE6B 4P4KC 3QNXA 7CGTA 5DJ0A 5F71A 1HQRB 4YDJA 4EXPX 3VWJD 4D2NA 3JV6A 2EIZA 2OP4L 2V7NB 1M7DB 3HC4L 2H8PB 2ZG1A 4I3SH 4Z5RA 1SY6A 4F7CB 3P2TA 5JHLL 4M48L 1K4CA 4P46A 4YHYC 2HLFD 4MXVF 1HHIB 1YMHA 4Q2ZA 2X1OA 5IROC 4RX4D 1X5KA 2V9QA 2K7QA 3KLHC 1IAOB 4PS4L 4N0UB 5KS9A 2QR0B 2G60L 2YPLB 4M62H 2W0FB 4XB7A 3AY4A 4X7EC 4MJIA 2UWEE 1FDLH 3QQNA 3VXMA 4ZFOB 4KTYA 1FFPB 5EZLA 4GT7A 3IJHB 1RULH 3RP1A 1JF6A 4BQ9A 3ROLA 5SWSB 4F9PA 1KTLA 2XXMB 4OCSL 3VMNA 3B9KA 5JHDA 4IRZH 4LEOA 5J11C 3WFZA 4DKFL 4YBHA 1G9ML 4X4XB 3F12A 3NFSL 3BQUA 3KR3L 1EK3A 4I3GA 5IB1A 3NTCH 2YD6A 4LP5A 5C09B 2GTWA 4NKDA 1HXMA 4M1CC 4HBCH 3PWPA 1QYGL 5LJYH 3STZB 1F4WL 1P7QA 2J8UB 4ODWA 3HI6L 5CBAB 4XBEH 2DM3A 1UVQA 3SGKA 4TNWK 4M6OH 1Z5LB <