4JR9L

Crystal structure of nitrate/nitrite exchanger nark
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
211
Chain Sequence
b'DILMTQSPSSLSVSVGSSVTITCQASQNITNYIVWYQQKPGQAPKLLIYYTSTLESGIPSRFSGSGSGRDYSFTISNLQPEDVATYYCLQYNSLLTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKNINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite extrusion protein 1
molecule tags Transport protein/immune system
source organism Escherichia coli
publication title Crystal structure of a nitrate/nitrite exchanger.
pubmed doi rcsb
total genus 49
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2013-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jr9L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jr9L01
1IMHC 3QXAA 4PRHA 3IDUA 3R1GL 3T4AA 1JZ4A 3D85D 4OAWB 3WBDA 3BP4B 1WEJH 4CL7A 1DBKH 2AQ1A 4PV8B 3K8LA 2GT9A 3IDJA 1NCWH 2YOCA 3QH3B 1A14H 5E2VH 4OSUH 5FECB 1Z0NA 1DUZB 3DO3A 3NFSH 3RA7L 5E2WL 1BEYL 2VAAA 3V4PH 2X4QA 1CGSL 2PR4L 1A4KB 3ARFA 4NOFA 1RZFL 4WWKC 2Y06L 4OQ1A 4KRPB 2GCYB 4MCYA 4OF0A 4NQUA 3FOMB 4BYHA 3TO2B 2KQNA 1R24A 4JGUA 3QEQB 1HNFA 2NXZD 1CG9A 4J4PD 5ECJE 3PDDA 4QTIH 5F7FA 1CFQA 2V17H 1GH7A 3LRSA 5C0FB 2W59A 3UTOA 1NCCL 1FPTL 1KTKE 4O02L 5IMKA 4P23A 4P3CL 3D39B 4K7PH 5I1LB 2ADIB 2LAGB 3MLUH 4POZC 1QRNE 1NMCC 1HQ4B 5I9QC 2LU4A 3D85B 4KHTL 5EWIH 1RJLA 1WWWX 2NY6D 2AEPH 1CFVH 6FABL 5CSZA 3S4SA 2DLTA 2GJ6A 4H5SB 3TC9A 3LQMA 4TNWK 2Q1EA 3NABH 2GTWB 1LK2B 4LARH 4JQVC 1KUMA 1S9WA 1TITA 4Y19D 4WW2C 3O6ML 3KS0H 3FT4A 5DFVC 1N0XH 5GIRB 5ESQA 1CWVA 3W9EB 5MEPB 3KYKL 1OAKL 4S2SA 5MEOA 2FH6A 1FZJB 5E6YA 3OAUH 2D7PA 3GB7A 4RGNE 2AJVL 1XF4B 3SDAB 2BVQA 5J4MA 1J0JA 2PUQT 4M5ZH 3P4MA 2B4CC 2F58H 1HQRB 2Q8BL 4KZEL 4LDEB 4YHNB 1OAXH 1P4LB 4NO0B 1IM9B 3BZFB 1FG2B 1D6EA 3UPCA 1ZK9A 5DS8B 4PJBF 1IGIL 1DQTA 1BD2D 1T1ZB 1JVKA 2ZOLB 1FN4A 4ETQB 3V95A 3GEWB 1AKJA 2XZZA 1QRND 3SE3C 4BSJA 2XA8H 2AAVA 2FX9H 3P9LB 4PLNC 5FKPA 2FLRT 5IW6B 4YBLB 3BI9X 3MV7E 3A6CL 4NCC2 5HD8C 3W39B 1VADA 4QWWD 3SDXB 2XT1B 3HI6L 4NHUB 4OD2A 5GS0C 3MJ8A 5DEGA 4OUUB 3WEXA 4H26B 5IHBA 3B6SA 1C5CH 2P1YA 5D93C 4G6KH 2HVKA 3C8HA 4FS0A 4HLZG 3T3PE 4OCWH 4LVOC 1KJ3L 5IT2L 2JIXA 2GK0B 1FDLH 4O58L 2FECI 3DURA 5ESAA 2H3NB 1Q9OA 2VMFA 4NDMA 5HHNA 1LGVA 3UYPA 1G0XA 1EZVY 1LE9B 5SX4I 1AQKL 4RA3A 3OX8B 2BHZA 1LMKA 4MQXD 4U1HA 3SE9L 5GRZA 3S37L 3VXOA 2VABB 2ZUSA 1ZVSB 1BF8A 1CFTA 3MODL 2AXGB 3C8DA 4XVSL 5DDHA 3R0MA 5SX5H 5JQ6L 2B1HL 4K71C 3HUJA 3KHOA 1JFQL 2N7AA 2YPLA 3PWPA 4NKOA 2ITDA 4P2RA 3DRQB 4WTZA 1U3YA 5IVZB 1RJYA 2Q6WB 1RD6A 4OZFG 4A2LA 1BX2B 5JDSA 3BIKA 1RI8A 4MJIB 2OL3H 3X12A 1AE6H 2ERJB 2EDXA 2YKLL 5GS0D 4CRPA 1EEYB 1Q72H 4Z18A 3ET9F 4MDJA 3D85A 5A2FA 2XRAL 3KJ6L 3L5XL 3OJDB 3H3KA 4UI2A 5EIVA 2BNUA 2HT4C 3CFEB 4OV6F 35C8L 4JPKH 4BJLA 4MVBC 4ORGB 1A6ZA 3T2OA 5D7SL 2IADB 2P5EB 1FSKC 3DBXB 1S5HB 1UWXH 4EI6A 3BQUA 1S5IH 5KS9E 5FKAA 1F02I 4GMSL 1HH9A 5GHWH 2ZJSH 5B38A 2KH2B 1A1NA 2OI9B 2HRPL 4UQ2B 4KK5D 3BKJH 3T2NL 4PJBA 2JELH 1ZGLA 5SWQA 4JFFA 4S2SB 4XBGB 4P3DB 2YUZA 5T1DL 5JZ7D 2YD5A 1BD2E 1P6AB 3O6FC 5KVEH 3MLTB 3H6JA 2LFGA 2XKNA 1DQQB 1AD9B 3FQTB 1T0NB 1OSPL 3GMNA 2XOTA 3JWNC 1GAFL 4ZFGH 1AD0A 4GXUM 1NAKL 4PJ5B 2DYPD 1UWEH 2LTQC 1HWGB 3U36B 3OR6A 4KH2A 4N0UA 1I8KA 2BZDA 3IKKA 1OTUD 1OP9A 3ULVD 1JWUA 4RFNB 4IOFC 5FGSA 1U41A 5BQ7A 3H3PL 1A7NL 3FO1A 3KPQA 1BJ1H 5IP4A 5EN2B 4MXVE 4GKNA 5FYKE 3FFDB 2Z93B 3WFEL 5FGCE 2Q86B 1JHKH 2VDRL 2I9TA 1MCOH 2EXWD 5FHBH 3UJIH 4APQB 4RNRA 4HWZB 4HK0B 5D6DA 3KLDA 4NKQB 1CZ8H 2GJZB 1S9XB 3RNKB 3OAZH 5SV4A 4YGVA 4Z7NF 5HHMB 3RL2B 4J4PA 3QQ4B 4RQQA 4BK4A 4FRWA 4RGMC 2J4WH 3AU1A 4LDLB 4HS3A 5C0RH 3E2HB 3RWHA 4Y5YA 4PRNA 4R4FH 1V3JA 2WW8A 2Z0BA 3QNZB 4N9GB 3D9AL 3WSQL 4FZ8L 5JUEH 5FUCE 3O2WH 1UM5L 1GCFA 3LN5A 5C08D 5F7EH 1ZVYA 3HI5H 3IDMB 1D5BB 4DGYL 4NRXA 1M7XA 4OZ4A 4Z0BH 1YNTB 1KACB 3K74B 4HKZB 5GXBB 2K3TA 3NVQA 3LKSB 4LLDA 1QSVA 2YN5A 3DSFL 3I50L 2HP4A 3JWOH 2IH1A 4EUPA 5D93B 3RJQB 3IFOB 4J4PC 4ETYA 2BJML 1X5IA 1DN0A 3TJEL 1C08A 4KZDH 5KSAD 5C0BD 3VXMA 1UG9A 2WUBL 5E8OB 5HI3C 3OAYH 1FORH 4K7FB 1OWWA 2AJ3B 1TQCB 2NCMA 3W9DB 4JANA 4ZS7H 4HJ0D 3LRGA 1JPGA 5DJAB 3LV3A 4MJ6A 3O9WD 5JOFA 1IGIH 3OX8A 1ZWIB 5C0AB 2B0SL 2VNCA 5CMAB 3D3VA 2HFGL 4ZG1A 4ZSOA 2QHRL 3L3KB 3VGDA 5GGSY 1HQRA 2F58L 4U49A 1S7WA 4UU9B 3WCYA 2NXYB 4HKXA 3WDIA 2APXA 4OZIA 4YHYC 1Z9OA 4GAJH 4PRPB 4KKBD 3QJHA 5DI8B 4DGVH 3D69B 2EIDA 2QKIA 4LPUA 4OV5B 3OAZK 4TNVK 1BM3H 4DOHB 1L7TL 1QFPA 5DMGC 1NCDH 3HC3H 3F7VA 2AVGA 2HKFH 2FCBA 2ENSA 3QNXB 1KJ3H 5L7XL 5DRXB 2W65B 3NABL 2OR9L 3L5IA 1WIOA 1QRNB 1JTPA 1KC5H 4RA0C 3MJ7A 2NX5A 4UB0L 3U4BH 4RGNC 1GOHA 4Y2DA 4IMLA 3ARED 5EBLB 2M8XA 4M3JA 4CVZB 5FUOH 5KVMC 3RVXC 3PHOA 1EJOH 1FZMB 5JQHC 4FQXA 2HAZA 1WQVT 1R3HA 4Q9QL 3AREB 1YEEL 4N1CA 15C8H 4YXHL 2CR6A 3DI3B 1AY1H 1IAOB 2FX7H 2APBA 3CX5J 5JPNB 2I5YH 2GSGB 5I76B 4O2FB 3DJ9A 5CBEA 2AP2A 4APQA 3TWCH 1E0OB 1CD0A 3W0WE 3OKDB 4KKCC 2FHCA 3U9PH 5GGSA 4PRIA 1OP3H 3S5LG 4L4VE 1HINH 3I75A 4K3HA 2Z8RA 5I17A 1RAMA 3HZMA 2R9HD 4W4NA 1WTLA 4RQQB 1OQOA 1F8TL 3VDBA 4ZTPH 4OCYL 3BKML 2R2BA 3UTTB 2IPKB 5ERWA 2HG5A 1UA6L 4N8PA 5DEGB 1I7ZA 4Y4KA 5L2KB 2EYTB 4GW5B 5FB8B 3FRUA 3WFHA 4BH8B 1C5DB 3OGCA 4J12A 4D0DA 2WM0A 2G2RA 3QDGE 1EO8H 5EU5A 3MRDA 1S7TB 2Z93A 4WEBL 5E8DH 1A1OA 4GRMB 5I0ZA 2UWEA 4JFHE 4FQIH 1BQUA 2A73B 4PB0H 4HGKC 3I85A 3U0TA 4YHIA 4M9OA 1SYSB 3MRPB 3OSKA 1CICA 1TETH 4UAOB 5HHXH 1SEBA 2NY7H 3PG2A 5B4MD 1MIMH 5DTFB 4EUPG 4PYHA 5T3ZH 5E6IB 1H8SA 3JTSB 4TQEL 2XZCH 5TE7L 4PGJA 3BIBX 5D2LF 2D7TL 1JWMB 4PRNB 1ZGLB 4MSWA 4ZQKA 3C5ZD 1I85C 3STBA 3CCHB 4XNUL 3BIKB 5DD3L 3QJFB 4ODHH 2ZNWA 3CX5K 3K1DA 2P7TB 1HIML 4MAYB 3JWDH 4Y5VA 4BSVB 2IFFL 5J57B 1MFCH 1RZKC 2Z92A 5E9DA 3WUZA 3BAEH 3C6SB 2VDRH 3HE7D 2R0LH 2EEBA 3MBEC 1R3JA 1T5XB 3OZ9L 4LHUB 3VI4E 5ISZD 1J0YA 1OT2A 5ITBH 4CN1A 1DEDA 3LSOB 5EA0L 43CAA 1B88A 2W38A 2PYED 1UZ6E 1F58L 3CAFA 3ARQA 2XTJB 3LQZB 2CK0H 2HT4D 3O2DA 1BQLL 1DLFL 4XXDB 3U9UB 2DQCL 2YUXA 3SDYL 5C0EB 3DMMC 3HZKB 2BJMH 3BX7C 4H0HB 3IRZA 3L3KA 3RTQD 4HKJB 3QDMA 3TPUA 1UJTA 1YYLL 5DD5H 4YHML 1EFXA 3RTQB 3FQNB 5DMYA 3ARFD 4FQXD 4YFLI 5I74C 4DW2L 3KXFE 2C5DC 3QIBC 1RUMH 4GAGH 2PW1B 4CADA 3E1F1 5F8RC 1A6PA 2OI9C 4I48A 1CVRA 1EFXD 3QNZA 4YEEA 2NY0C 1DBML 1TDQA 3EYOA 1HCVA 3P77A 3ES6B 1T1YB 3TIEA 2X4TA 2IJ0C 3LKQA 2YBRA 3TH3T 4LLDB 4PGBA 2GFBB 4Y2DB 1MCWM 5BV7B 4YX2L 4WWID 2G75B 2EYSB 3UDWC 4NO3A 4G6JH 1LK3H 4LU5L 5HGHB 4D0DB 3U6RB 3MQIA 2F5BH 4HUWA 1UQSA 4Z7VE 4YAQB 4BFIB 3V0AC 1FO0H 3LEVH 3NTCH 1EEZB 1JGDB 4RFNC 4NBZB 5I19L 4LP4A 2PTUA 2IPUK 4JRYB 4L9DA 5LG1A 2XZAH 3HPJB 3S96A 5T1KD 3T65B 4OTXH 5FCUH 1YPZB 4PY8J 5C0BB 5KSAB 4PR5B 1IFHL 1KPVB 2BSTB 5D1XC 1VPOH 2RCSL 4QHUA 4HDIA 1E4XH 3V7AE 3IDMA 2FYYA 3IDIA 4MA8L 4PJAF 1RHHB 3QUZA 1C5BH 1K8IA 3ME0A 4HIEA 5I66A 1XEDA 1AH1A 5D7IE 2UUDK 3C2AH 3LEXB 5DHYB 4LKCB 1TIUA 5I1KH 5J1SC 5DEFB 1G0DA 5TH2A 5H35A 1T0PB 5F9JA 4NQCA 4RAUA 3HHRB 4AH2A 1U8NA 3KPMA 4ERSH 2Q3AA 3ARGC 5C0DB 2BRRL 3GIVB 3VI4F 5F7WC 1UM6L 4L8BA 2WUCL 3EJJX 3ABZA 2AJUH 4G6KL 4QNPE 1QO3A 1RHFA 1TZGL 2R1YB 1JYWA 4LOUD 2VH5L 3RWGB 4N9OB 4HQQL 5DGQA 3MRCB 1IAMA 1WICA 5CZVL 1QEWA 2Y36L 4OFKA 3QDJA 4P4KA 4Z95L 5JIKA 4TRPH 4LIQE 4KQ3H 1C8PA 2DQJL 3EYQC 1HDMB 4G8IA 3IFLH 4JFDE 3WNNA 2Y06H 2CJUL 2VDPH 2X4UB 4OZFB 4ODVL 1OM3H 2F74A 2P8PA 4WTWA 2X7LB 1I9RL 4PJ7E 3MV9D 1X6LA 3R06A 4MLSA 5I17B 4I77H 4WJ5A 3DROA 1CLCA 1NGZB 1KTLB 3S7GA 1QSEB 3D3VD 5EIIB 4PJ7B 4UTBH 1PZUB 5DJZA 5JR1L 1KENL 3BE1L 5E9DD 3IETB 3G08B 3HS0B 3TJHC 4BH8A 4TSBH 4JFQB 2X4OA 5FAAA 2DQGL 4PFEA 5CGYD 2C1PB 4KPHH 4RFOL 5F9WC 3BKYL 3QG7L 1CDYA 4NQDD 3OJ2C 1I3GL 4G43A 4XPHH 4I0PB 2X4QB 5DD1H 2XN9A 4YHOL 4NO0A 4ELKA 1BQHA 2CO7B 4I13B 3FO9B 5HPOA 2IF7A 5IB1B 2RFXA 5E7FA 5SWSD 1KEML 1FYHB 3RVUD 4OKVB 3U6RA 4YHPA 4DKEH 1CFNA 3BO8A 4OLEA 4Z7VA 3EHBC 1RUML 3QHTC 3QFDA 1BZ9A 2NY3B 2BY2A 2ZCHH 2DICA 2A83B 4NN5B 2ZUTA 1T2QH 4JB9L 4I48B 4K23L 4OB5H 3U83A 1FL5B 2IBGA 4Q6YA 1EHLH 2BVPA 2L7JA 5KSBE 5E6ID 1G7LA 1BFVH 5MERA 3S35H 1MCHA 5T1KA 3KLHC 4KJYA 1X5YA 2ZCLL 4LLVA 4QRTB 4U6VL 3INUL 3TBVA 1YN6A 1WBXA 1YMMD 4FG6D 1N5YL 5BMFH 1RUQL 1T1XA 1MJ8L 3QNXA 5E0QA 3OAUL 1T20A 5GRYA 2YUVA 2GK2A 4U1MB 1CU4H 1RJCA 3KPSD 4E5XB 2F5BL 4F8TA 3HUJE 4OZGF 3WUWA 2DBLL 3L7FB 1JF1A 1YNLH 4WFGE 3PWPD 2V7HB 4LLMB 3OMZA 4EBQL 4EZMA 1GVIA 4HBQA 4OT1L 2EYRB 2NY0B 2VXVL 4NZUH 4P23B 1KXQE 4P5KB 5J12B 3CXDH 4HIXL 4HUUB 5D1QB 4MYWB 3FN9A 4EDXA 3RL1B 1FNLA 5D1ZB 4YHNA 1H3PH 5C71A 2JCCA 5IMLA 1EGJA 5CSZB 2VXSL 3HLAB 2ZOLA 5FO7A 4Z7WE 3HG1E 4GMTL 1NMAH 4UT6H 3UTZA 5DHYA 3DECA 3L3GA 3RWCA 3VFOA 2XQYK 4JFDA 1VENA 2DQFB 4CDHA 5J9PA 3G9AB 4CMHB 5L2KA 5HYSA 1RZIA 3HR5A 1AXTH 3IU3B 4QRPE 1EEQA 3UTPD 1CGXA 2JJVA 3GMRB 2J5LB 4N68A 1FL6A 5CFHA 3V4VL 3CSPA 1UGNA 5CIPH 1U3JA 1CDUA 1U8OA 4L5FL 4XHQA 3F6IA 1A9BA 2GKIA 3O11B 2XICA 5ADOH 2IGFL 2A1WH 4ODWA 2OTWB 4GG8A 4OCXL 2H9GA 6CGTA 3WN5B 1F2QA 3I6LD 3IU4H 3T1FB 4F7EA 3RWJA 1FFNA 5E4EB 4U3HA 4XNMB 3IGAA 2F8XC 4P5MA 3J7HA 4HG4J 4X98A 4XB8A 1WZKA 2H32H 3Q5YA 4OZGE 4KZEH 3QUXB 4HGWA 4KHXH 5K93A 4YK4B 1QBBA 4NQDA 2YSSA 3SKMA 1JMXA 5HI4C 3OKOB 4OLUL 1J1XL 3GMQB 1GPOL 4UINH 1UCTA 5EC2B 5GGUA 3VI3E 1CF8H 1ZHLA 3OKMA 4JN1H 1TCMA 1BOGB 5KVEL 4M7KH 2WBKA 3IJSB 4HWBH 1HXYA 1LEKA 3STZB 3ROOA 1KTRL 1NJ9B 4LCWE 1U8NB 5JXEA 1HH6B 3QFJA 4LL9A 5FUCC 4O2CA 4Z8FH 2WV3A 1L0QA 3ZE1F 3B9KD 1RVFL 1MWAH 4GBXA 3QIUC 3SKOB 4K94H 3GMOA 2EXYD 4X8JB 3FQRA 3LEYH 3DBXA 3V5DA 5D96B 1H3GA 4YDLC 3B9VA 1NGPH 2AV7A 5F9OL 3VFPA 4YIQA 1A2YA 2X2YA 3D25A 3VFRA 2X4SB 1LEGB 5FYJD 3GI9H 4U1GC 2CRZA 5IV2A 3OXRA 1UB6A 2R4RL 4XP9L 3FFCB 3OPZH 4YHYB 3T8XA 1S5IL 3BD5A 4FABL 1FCCA 3T0ED 4PJ9D 3X17A 2HLAA 1KNOB 4EIZC 5JW3H 4OCYH 3F65A 2IPTL 3TPKA 1DUYB 3VGAC 4WNQA 3PWNB 4EI5B 3KPTA 5T5FL 3MLRL 4LLVB 1KBGH 4M93C 3B5HA 3W11C 1QHPA 2B5IC 2I25N 3FB5B 1G9NH 4HZLB 5GJSH 3L3GB 3SE9H 4WI6A 3TIEB 1J8HA 3QHZH 5DJ8A 1IQWH 4OI8A 1QFUH 1QSEA 1CTNA 3EBAA 3UO1L 4U1MA 4JR9H 4PRBB 1JTTA 3FAWA 1IGYB 2AJUL 4P5TA 3TZVC 4N0FB 2XTJC 5F7HA 1YDPB 5GRJH 1CD1A 5JQ6H 2OQJB 4ZFZA 5SWQB 2P8MB 1YEGL 3O41A 3UZVB 1FFRA 4UDTA 4KRNA 4XT1C 5GPRA 5J13B 3ARZA 3VXSB 5EH1A 1JNNL 3QSKB 1AQKH 2XN9B 3SJVB 4LF3A 1T6WA 2EDFA 3BEWA 3O2WL 4QOKD 1NFDB 4QGYA 4PLKD 4R96B 3WNOA 2FBJL 4UILL 4F7CA 1K5NB 2VXUH 3T1FA 3ZKND 1LO5A 3U4AA 1H3TA 2Y5EA 5AYUL 2WNGA 5A2IH 3TBSB 3FMGL 1B0GA 3CFBB 4PREA 2YEZA 3DUHA 2DQEL 4O4YH 4DOHE 4OZ4B 3SQBA 3MRNA 4JG0H 4UIMA 4D3CL 4OQTA 5I71B 1UJ3C 1D5ZB 4HWZA 5KG9B 3RIAF 5ADOL 1U8OB 1IGMH 3TFKC 4NCC1 5CEZE 4M48H 4Y5XA 3X3FH 5KZCD 1LO0L 5D6DC 5INCB 2EE2A 3PQYA 1UH3A 3QIBA 3N9GL 5DMKA 4M6MH 2FJFA 5AZ2H 2AK1L 4YXLL 2VXTL 3OF6A 4KI5F 3O2VH 4K23H 4OB5L 2R2EA 4D0BA 1G7MA 2W0KA 5GGSB 4KJWD 3RWIA 4ACPA 3QA3B 4UT6L 3TVMB 4Y0GA 2CIIB 4IHOB 3UXFA 5LXGL 4NQDB 2QSCH 5D1QA 3MRLB 1QR4A 3B9KC 4QY8B 4OZIF 5EU6D 2AJZA 3BPOB 3PWUB 1YNTA 8CGTA 3HFMH 3O6FB 2UWEE 1YEJH 4P2RE 1GIGH 2VAJA 3K4ZA 3ARDD 5DJYB 4HMDA 3VWKD 4M43H 4UIKH 5JW4Q 5IWLA 2BNRD 4WUUE 4K7FA 1F4YL 4N0CD 1UCBH 1GGUA 5JIHA 4XI5C 3VXME 3VRJA 1OAYH 1QRNA 5ID0A 2P5WD 4KI5D 4WFEE 5CCKL 2EYRA 3VWJB 4KTDH 5EUOF 4ZDHB 4WW1A 4NJAH 3BIAX 2BC4A 3GI9L 1FC2D 4BM7A 3WJJA 5CILL 2V9RA 3O11A 3K3QA 2X41A 3RU8H 2E3VA 4KK8C 4NZTL 1AGCA 1SM3H 1LNUA 3TYFB 4KK8D 3GSXB 3DUUA 4L3AA 1HHJB 3KPSB 1LO4L 4HMEA 4ONOA 3VXSA 5EO9B 1L0YA 4X9HA 4MAYA 2FX7L 2IAND 1QNZL 4LCIH 2V2XA 3CIQA 3F58L 4R90H 4A6YL 3ZL4H 3QUXA 3DIFA 2EEDA 4KU1A 2Y25A 3KPRB 3ECBA 4OSUL 1ORQA 2VC2H 3SKMB 5DSCB 4G8FA 4E41E 2PF6A 4N1HB 1N59B 3EJZD 4LVEA 4MNQE 2Y7QB 3CFKA 3QEHB 2DYPB 1BJMA 1PVHA 4UINL 4HZLA 3B4NA 4X9FA 5L88L 5I1EL 1P7HL 3UTQB 4F58L 4XTRD 5L6YH 3TBVB 5IBTH 3QUZC 1I1RA 3SY0A 2HVJA 4NNYA 1IC4H 3MXVL 3SE3A 1A1MA 3O81A 1WZLA 2NLJA 3DVNA 2QQNH 4R4BA 3VGEA 1IVLA 1P69B 2OL3A 4P59L 3UJTL 5JHDD 5IJKC 1ADQA 2VZSA 3PGFL 3EGSB 1XH3A 5GJSL 4EOWH 4F57L 4U7SA 3CDGB 1CLYH 1FVCB 2W92A 1IGML 4JDTL 3V6ZB 2DQIH 1XT5A 1U3HB 4Z7UE 3VG0H 2FJGB 2VLRA 3DHJA 3U82B 4U6HA 1LO5B 5CUSH 2VDPL 3EOAB 3BW9A 3WKML 4P5TC 3AC0A 4NYLA 3QXAB 1R5WA 2E9JA 3G6JF 4Y2DD 4RMTA 5EZJB 3ZHKA 2HFFA 4HHAA 4XGZA 4GKZB 1ZV5A 2DQTH 3BP4A 1X5HA 4F37K 3O6LH 4KC3B 1AC0A 3C6LD 1I3VA 4LPYA 4WHTA 3VE0B 5I1AB 2XWTB 4S0TD 4LLWA 4NNXA 3PWNA 1BAFH 5D7LD 3CFDA 1V7ML 5HHOD 4Y4HA 3UBXG 3UTSE 1CK0H 2CLRA 2NY1D 1CE6A 3CSYA 4MHHI 2FEDD 1KJ2A 4POYA 3CLEL 4CU6A 2VZ1A 1QSZA 5FV1L 3QNYB 3TO4D 4Z8FL 4YBQD 1XGUA 4U1GB 1YA5A 3VW3H 2YPKB 3P11L 1LO2L 2KUTA 3B83A 4OCRH 4D0BB 1JWSB 1LE5B 1EH9A 4NKIH 4NQCE 4UDTB 3P0YL 3GB7B 1P2CB 3G5YA 4JPWH 3B9KB 4KHTH 1T4KA 2O5YH 3B2UC 3UZEA 5C0IB 5C6TL 5FM5M 3QIUB 4GBXC 1IILE 4HAFA 4I4WA 3FQNA 3TA3A 4KUCD 5T1MA 1ONQA 2E6PA 1LQSR 2EC9T 4OLWL 3ULSA 3MUGB 2DM3A 4C56A 4PLKC 3VFWB 3QUYD 3UTPE 2Q8AL 2FEEL 1F11B 1X4ZA 2H26A 3I02B 5JW3L 3W82A 2Z35A 2BVYA 3RJDA 2K7PA 3I2CH 4AQOA 1ZVHA 4IDJL 4HS8H 4G8EB 3CLFL 3KPPA 3KNBA 2X05A 4NHUA 4TUKH 5C07A 3SGKC 2VITA 5TQ2H 4AG4H 4MNQA 1MCOL 1FGNH 4M00A 1ZA6A 1DUZA 1R5VB 3ILQC 3LPGA 3QDJB 4IOFD 1UYWL 4KKLD 3JZ7A 1DN2A 4HXAL 5E4EC 5GRWA 3FFCE 3R1GH 5DVOA 4M1DL 1RJZB 3L95A 2ADGB 4U1JA 3W11D 3VFNA 1QR1A 1Q9KA 1A3LH 4NUGL 3HPJA 1Z3GL 3S96B 2F74B 5E6IC 4U1HB 2VLJB 2W9EH 3U46B 4HWBA 5HTSA 3VXOB 4HULB 5EU3A 3SDXA 5BJTA 3B43A 2QSCL 1A6AB 3MMEB 1NEZB 2DQHH 3QEGL 2UWEF 3GKWL 1VPOL 4Z78B 1M71A 2BCKB 3JTTB 2DN7A 1KIQA 1BFOB 4AL8L 4DAGH 5JW4M 3NCJL 1NL0L 4LCWD 4NPYB 4KVNH 5HPMA 1HSBA 1I7TB 2Y1VA 1OP5H 4CVUA 4JZNB 2AJXH 43CAB 2FEEI 5DGRA 5E2VL 3ULUE 2PW2A 3MRFA 3M45A 2NY6B 2X4PA 5TFSL 2AXHA 5FGBC 4I0PA 3TO2A 1F3DJ 3BGMA 3N85L 3QPXL 2YPVH 1MI5B 5AYUH 4RBPK 5KSUA 3ZYJA 1CD1B 3Q6GL 4LNRA 1KB9K 4YNYA 4HFWB 4XC3L 3QBTB 4LSSL 3VGBA 2Z31B 1TZGH 3SBWC 4AEHL 4XWOC 5I0DA 3SJVA 3BT2L 3V2AR 5ESVA 4PJ8C 1I3GH 5DF0A 5DEFA 2APVA 1SY6A 1V3MA 2A77H 2NYYD 2WWMC 3GJEA 3MXWH 5FYLD 1YEIL 4RGMB 5GRVK 3Q3GA 3MLUL 5J1TC 5D7IA 1F4XH 4GAYB 4K55A 2V5SA 5DVMA 4G9FA 4QRTA 4GAGL 1A7PL 3A6OA 2J6EL 5I1DA 1MCQA 3TEUA 3THML 1DDHA 4U6YB 3D87B 5EU4A 2YMXL 2UUDH 5I1KL 3QO1B 1IARB 4E0RA 1G9ML 3MOAL 5ACMA 4JKLA 4G5ZH 4I2XA 4PV8A 3QIWB 5D7KD 4QRPB 3W9EA 1Z9SA 1SBSH 1OGAD 4GXVL 1CE1L 1F90L 3TP4A 3WUWB 4HWNA 2IAMA 5TGBA 4WFHD 3V6OA 1A6UH 4UBDD 2YPLD 2EDDA 4XAKD 1QLRA 4S1RL 5HGHA 4F33B 1PW3A 1MCKA 4OIBA 4J8RB 4AIOA 5F1NB 3QZWG 4AM0B 2FO4B 3OQ3B 4ZFOB 1WT5A 3WJLA 1WK0A 3TT3L 1QFOA 3T3PF 3MLVL 4P2QD 2BNQD 4TTGA 3T65A 2D4FA 2HT3C 4LSVL 4QXWA 4Y89A 4HW6A 2DMBA 2IALA 4R7NA 5E8EA 4UDUA 1ES0B 4X4YB 3P9MB 3QWRD 1H0DB 5I8EB 4P49A 2VLJE 4EN3D 3LIZL 3K0WA 3AAZB 4OLVH 4CKVX 4D9QD 4Y88A 3DARA 2VLJA 5IFAH 3KG5A 4LCYB 2HLFC 3L7EB 5FO9B 1FC1A 4TQEH 1UEYA 4JFFD 4L4JA 1FVDB 2O5XL 1IKFH 4FZ8H 3X3GH 2L4OA 1KB5L 3EYFA 1OWRM 4L4VA 1VACB 2F54D 3KPLB 1HHGB 2MPAH 2IANA 4LPCA 1L6ZA 3D39E 3MREB 4W6XB 4LQFH 1FVEB 2CGRH 3BYTA 3QUXD 1UEMA 5E99H 2R23B 1FL3B 4FQQB 3SN6N 3PXJA 1EHNA 1FFNB 4R90L 4NJ9L 3I9GH 3LKPA 1JZ7A 1A1NB 2R0KH 5JTWA 3DO7A 5HVWA 3U0PB 4KDWA 1KPUB 3CGTA 4FFZH 3W5MA 4QTHB 5JR1H 5IVXF 2Q20A 4PTUB 1JHTA 2FIKA 1T03H 1Q0YH 2XKNB 5IF0B 5LGJA 2XIDA 2OZ4L 3KS0J 5FKPB 4LLYA 4JEGB 1OM3L 5I8KH 3TA3B 1MUJA 4JO3L 2IQAB 3HR6A 4OZIB 3PJSB 1D3CA 4GOSA 1MFBH 4QTIL 1A6VL 5TDNB 4N0UB 3VWKA 3EAKA 2Q7YB 1M6OA 2Q8AH 2GY5A 5ALCL 4EI6B 1FFQA 3C6LC 5JOPD 2P42B 1KGCD 4M8QA 4KI5C 3BPLC 3W81A 5IUSA 1OAZL 2LVEA 1NC2A 3MA9L 3WIHL 1B2WH 4GS7C 4DGIL 5GRVL 2Q86A 5HVHB 3RY6C 1NAKH 5DWUL 4CVZA 2IAMB 5GHWL 4NM8L 1LP9A 1Q94A 4YHOH 4JFOA 3LN9A 4JM2D 2ATKB 3WN5A 1HNGA 5CHNA 1CD8A 2Y6SD 4ZOCA 3NA9H 4UTAH 1VFAB 4JM2B 5SX5K 2AGJL 3IGAB 3CUPA 4YWGH 4JQIL 4UZGA 3EO1B 3K2UH 1GZPB 1QOKA 4ZFOA 4UBDC 3OR6B 5DJCB 5J9PB 4Z7WA 4HFUH 3KPRE 1AO7D 1KJVB 4XCNB 3JV6B 5I1CL 3O9WB 3T1WA 1AKJD 3ARBA 2V9TA 2XA3A 1N6QL 3I6GA 4KUZL 4BUGA 3CVIL 1H0DA 1D5BA 2AI0L 2JJWA 5B39G 4L3ED 4NZUL 1XMWA 3EJYC 4TN9A 4KK6C 4XBPB 5B4MC 1SQ2N 4JQVA 1KSRA 3MLXL 3LMJH 3VXRB 5FEBA 1E27B 3DXAA 1T3FB 4ORGA 2HN7B 4YUEL 4AENB 4ZFOL 3JUZA 3WFEH 3TT1H 4G6FB 5HDBF 1FVDA 3WHE0 1S5HA 4XP6H 1CT8B 4LVNB 4XWOD 3QP3A 3CFJB 3CH1B 4P5KA 1HHGA 4Z77A 2XWJB 1X7QA 4L8DB 4EKXA 1HKLH 4LBEA 5GS3A 1F6LL 4UV4L 4X4YA 4JKWA 2XQYG 2CGRL 3BQUD 5JW4N 3LKPB 4GW1B 2R0WL 1A7OL 2KZWA 3N1QC 3S88H 1NSNL 4HKXB 3MSPA 4I9WD 1B0WA 4B50A 2IH1B 3PQYE 1KNOA 3PDOA 5IKCA 1UM5H 1FO0A 4LSDA 1BF2A 1KB5B 1XR9B 2GW5A 1EO8L 4LCYA 4OM1H 2CH8A 1AGDA 3MRBB 3FJTA 4U1LB 4XMLH 5I75C 4KRPD 4CMMA 1BM3L 1K9TA 3Q6FA 4HJJH 3G5VB 1WZMA 3OR7B 4PRHE 1MRCL 5INCA 4OLVL 5IK3A 3KPLA 1JUFB 2ZSWA 5IR1B 4GKNB 2EO1A 2BMKA 4EEEA 4HGMA 1JZ2A 3SDCB 3BP5B 4F3FA 2CO6B 5FUZL 1ZA6B 3PHOB 4PGDA 4NWTH 4LGRB 5T5NG 1JV5A 3PV6B 1H5BC 3QZWB 3GJFA 2LU7A 3GMMA 2M26A 3IAGC 3NZHH 4ZD3H 3DO7B 3QXDA 4QHNA 5CBEB 4YDJB 1C1EH 3TBYA 3EDFA 3EOTL 3FN3A 3ARDA 4P2OA 3RIFK 1IEBB 1MF2L 1JFQH 1YY8A 4FMFA 3GKZA 1MFDL 1FP5A 3L3JA 2N1KA 4N1EA 4LKXB 4IOSD 4K3JH 1ADQH 1MWAL 2YWZA 1AGBA 4XCFL 1I7ZB 3BVNB 4TUOB 2P8LB 5KSBB 1V7MH 4EUPB 4KMQA 1DQLL 4RISL 2DWDB 4NC2B 4TSBL 3VFTA 1BVKA 3DMMD 3FRPG 4WIQA 1ZLSL 4O2CB 3GBMH 4WO4A 2HMIC 1LP9F 1J11A 1NGWA 2HMID 1W72B 1MCLA 2E9IA 4FQ1H 2BXZA 4NM4H 2XY2A 3W9DA 5DD1L 1FNAA 1LNUB 3O3BB 4TTDC 5E03A 4ZS6D 3TYFA 1A9EA 3VFPB 3QT2A 2VL5A 2V2WB 2WLYA 2GQHA 3IXTA 5DRNB 1H3VA 1SYSA 3H7BB 1FYTB 2PYFA 3RVUC 2ARJQ 4N90E 4OJFL 1P5VA 3BH9A 2Z8VC 4WW2B 2Z31A 3S3JA 4Q97A 4OGXL 3ZKSD 5K33A 3KR3H 5KVFH 3AFLA 2ZZUT 5EOTA 3T0AA 3O4LB 5DUPL 1QBLL 3DTXB 4JHWH 2EE9A 1X5LA 3DWTA 5I1GL 4RWYL 1SJXA 3P77B 4ZTPL 1VGEL 3LKOB 3ZT7A 4UTAL 5DJYA 4JO1L 2E9BA 2P43B 2PO6C 2YBRB 4PJ8B 3IFNL 3QI9B 3SCMD 4NKMB 5CEXA 3WO3B 4E0RB 2A74A 2ED7A 4C54A 3DVNB 3HC4H 1E28A 2UZIH 4K9EC 4CW1B 4Z95H 2DL2A 2OTUA 4GUPA 4M1GH 2KBGA 4OM1L 1DFBL 2VRAA 2FL5B 2VDQH 4JHZA 4FP8L 1S7RA 1IE5A 1BBDH 5EO1B 1JPSH 5MP6L 3F5WB 5CEYA 5F9DC 3ZKMD 1D6EB 2PETA 2W0FB 4WU7A 2W60A 4X8XA 2J8UA 4ZFFB 1XGTA 5CILH 2J8UF 3UAJC 2NY2D 5D7KE 4NRYA 1LVEA 5EO9A 1IAKA 3QXVA 4LLWB 4XCEA 2PW1A 4LPTA 4MAUH 4CADB 5I1JH 1MQKH 4IMKA 1EPFA 1P5UA 5K9QI 2CLZB 1WAAA 1RFDH 2QADC 2C1OA 2NZ9D 3OR7A 3QEHA 4NWUH 1X5ZA 4NKDB 3ZZ1A 3EFDH 4D3CH 1EDQA 1K2DA 4ODXA 3SGEH 3LKQB 3NIDF 4KXZI 1K6QL 1KT2B 3D0VA 2VN7A 4EOWL 4F57H 2NXYC 3IETA 3P0VH 3BXNA 3NCYP 4OUOA 3WUWG 2GK0A 3D2UB 4WUUB 2HN7A 4HKJA 3VD4A 2VAAB 4R8WH 1W0YT 2SEBA 3K8KA 5K9JL 3PE9A 1XF1A 2ED9A 1YEHL 4B0MM 2J8OA 4BFIA 3RZCA 4YAQA 3F58H 3MRIB 3VRLF 4I4WB 5DVKA 3FOLA 43C9A 1DP0A 1FGVL 3V6BR 2OJEA 4NBYB 4Y1AD 5H37G 4L9LC 4J2XA 3WFCL 1EBPA 1LO0H 3BH9B 1RHHA 3BUYA 3IDIB 1MCJA 3MA9H 4OGAD 2DQIL 4Y16A 4MA7H 5I1HL 3GMLA 1RQ5A 2H32B 5CEZL 3KNBB 3PDOB 5IKCB 1L9MA 3DLQR 4I3RH 4M7LL 3WJLC 4ODVH 1H9VA 1RZGA 4X7TB 4MD0B 3AS1A 3SQOH 5HI5D 2FGWH 1IAIM 3VGAB 1IC5H 3FQUA 4PP1D 1LE9A 5ESQB 4NSKA 4QRRD 4G42A 2H6PA 5B22A 3LB6C 4LGPB 3BYYA 2CD0A 3RVTD 4U1NB 2GUOB 1V3LA 1IC4L 2R1YA 5GIRA 1TTGA 5DDHB 3DGGB 1T1WB 5AYQA 3HE7A 3QPQD 4KUZH 1AHWC 2CDGB 3NTCL 4QXTA 4B41A 4KK9D 5F1OB 3T3MF 4PJ9B 5ID1A 1F4WH 3EYSL 5DLML 1CR9L 1K8IB 1DQJA 1FIEA 4M4PA 4TRPL 2EXWC 4XPFL 1CVSC 1S7RB 4LMQI 3NCCB 1S7QA 3SEPA 2KPNA 3TFKD 5JXED 1ODAA 1EMTL 5E95B 3TA3C 3B2VH 4M5YL 1AI1L 2AERT 2EDHA 4ENEC 3ZDZE 5CKAA 4R3SB 5KN5B 4JZNA 3RHWF 4H26A 4FTVA 5EULV 4LSQH 3U2SA 4JJ5A 1P7QA 3I3EA 5E1AB 3IF1A 4K7PL 5EO0A 2EO9A 5SWSE 1MREL 3FO2A 3BKCH 4Z0XA 4WY7H 2DB8A 5GJTL 5DZNA 4WTZG 1U8KB 3RVTC 1OF2B 1TCRB 3ZYIA 3CDYA 4XP4L 2VZUA 1FBIH 4MD5A 3RNQA 4LNVA 1NL0H 1I1YB 3W5NA 4H8WL 4O9HL 5H2BB 3VGFA 5CJOL 3LH2L 1WIPA 2A6DB 4M03A 4QLRA 3TCLA 2AK4A 4F9LA 3JV4A 4BKLB 3HKFA 4EN3C 5HHOE 3GSNA 2W9LA 4KGLA 2AXJA 1EHAA 4UNTA 4OGXH 5DMJB 4KJQD 5GGTA 4O51B 2AK4E 4Q7DA 1OARH 3LQAC 5D1QD 1CBVH 4ZO9A 5HHOA 4KZDL 4MHHG 1PKQE 1N3NA 3MFFA 2J8HA 5D70H 4QF1B 4Y4FB 2J2ZA 2R56H 5C0CE 1MNUH 3PWLA 1F4AA 3QDHA 4GMTH 1V8HA 4CU7A 3S36X 3MPCA 1KYOK 4NHCL 1RPQA 4NZRH 4ZUWB 3V4UH 3CPLB 4JO2L 4YGVB 5ICXA 2HT2D 4KJQC 2VXQH 2V5MA 4EN3A 4WHYH 4HCRH 5IG7B 3TGXA 3RBGA 5BVJA 4X4MA 4PG2A 1FAIL 4N8VG 5JHLL 3FO0H 2A9NL 3IFPB 2F5AL 4FTVD 2ATPB 2OR7A 3TVMD 5BOZG 2EIBA 3T2PA 5CGMA 1P2CA 1UYWH 4KWUA 5CJXA 1C5CL 1MFNA 1NDMB 4M62H 3H9ZA 5KW9H 4HT1H 3DX6A 4LSRL 4PD4K 3HE7B 1LK3L 2JIXD 1ZT7B 3DNKA 3BEVB 1XZ0B 1ZSDB 4PJ9A 4P23D 4UMGA 5FCSH 5TQ2L 5IFJA 1DQML 2P8PB 4R7DB 1CLOL 5FYLL 4S1SL 3GSOB 4KUCF 3QCUH 2EDJA 1JRHI 1ZTXH 2DQFA 3GDBA 1CCZA 1I1AC 2ZKHL 1R3IL 4EJ1C 4NSKB 4JDVA 1HEZB 2B1HH 3AMKA 4PJXA 4OIIH 3TCXA 4DAGL 2UZXB 1JE6A 5K9KA 4PPTA 1BIIA 4TUJB 2GJZA 4FQXB 4P5TD 5TF1L 2ICEA 1A9BB 4U7MA 3VFRB 3KYAA 3C2SA 5SWSA 4DGYH 4ELKB 1IGYA 4P5TB 3ARUA 2CDGA 4QXTB 3TO4B 5F1NA 4I0KA 2VYRE 3E6FA 4DZBB 1A9EB 3SBWA 2R8SL 4WUUA 4YFDB 4XP5H 3RNKA 2PO6D 1DQJB 1P4BL 1B9ZA 5TE4H 4U0QB 2H45A 3WIIL 3FB6A 3L3DB 5HHMD 2NY4D 3RL2A 3QG6A 1HHHA 3WDHA 4J23A 3V8OA 3B9EA 3GHEH 1EVTC 4OD3L 5KSVB 2BK8A 5TDOB 4C83B 2VLLA 5F7EL 1G9NL 1NPUA 2VLRD 1KXVC 1FL6B 2X1WL 4OCXH 3CU1A 4U2ZA 1OQXA 1LDPH 5LVEA 1GGYA 3ARTA 3KJ6H 3L5XH 3MA7A 4HH9A 4AY0A 1P7QB 3LDBB 3F12B 2FX8L 1QLRB 3MGAA 5CWSA 2IPTH 1OD9A 2C3VB 1FZKA 3X14B 1BZ7B 2HJLB 1U2HA 4MCZA 5JHDB 1OCWH 5T5NF 1KLGB 2KKQA 5FECA 5FUZH 3L7FA 1MI5A 4OD1L 1Y0LB 1WBZB 5DQDL 4TOYL 4GBXB 1MCRA 2X09A 4LSTH 5FV2A 2C3XA 1GC1H 4MNGA 5CZKA 1S78D 5IMMB 3MR9A 2H2SC 1FNHA 1X5FA 3FOLB 4WDIB 5F7NC 1NGPL 4K94C 4XZUA 8FABB 2P44B 2ESVD 3E3QC 1C12A 1MOEA 3SE4A 1P53A 4NQSB 4YHLH 4ZPTA 1D9KB 4BK5A 3MLZL 3U4EA 1A0QH 1ZANL 3WS6C 3EDDA 1U8HB 3OWEA 4RZCA 4HLJA 5T3XL 4M61A 3VW3L 5F1IB 5D70L 1LO2H 4Q9QH 1ITBB 1ZHKB 2APWA 1N4XH 1Q0XL 4FFVD 1TMCB 1X9QA 5L8KB 4JRXB 1MRDH 3Q1SL 5FOJA 1CICD 1QD0A 5F7DB 4DN4L 1QUNA 1WCQA 3P30L 2QLVB 4HD9A 1DQMH 3QIWC 3ULUL 3SE8L 4LK4A 3IXAB 1AQDA 4UUJB 3WS6A 3LQZA 5CZXC 4ODWB 4QOKA 4L8DA 3S35L 4KMLB 2ATPA 5FGCB 5MEPA 3BH8B 5KOMC 3V7MA 4Y4FC 1ACYL 4JN2B 4K7PY 2XNAA 4XNXH 4XCYB 2M2DA 1MCSA 4I3SH 3RZCB 1QLEL 2BDNL 4KKAC 3OKEB 4HGWB 3MOBL 1A7RH 3S34L 3X13A 5I15L 2BXYA 3UTTE 3HAEB 5ICZA 5C2UB 4PRPD 5H94A 2JE8A 1YMHB 2FEDC 4EVNA 5C09D 2XPGB 5EOCH 4NNPL 4PRHB 4XBEH 3T4AB 4Z7VF 2YK1L 4NJ9H 1MHPH 4KRMB 3PNWB 3C6LA 3Q2CA 3SGEI 2J5LC 1P7KA 3O3AB 4S11A 1NC2B 3S88L 3MRNB 1NKOA 3SGDI 1E6JH 1NMCB 5E2TL 5EB9A 3F62A 5HVGB 4X5XB 4JDZB 5HYFA 5KS9B 3ROLA 4NHCH 4FQJL 1S7SB 3QXWA 1FLRH 2VB5A 2YD1A 4MJ5A 2Y5TA 1OAZH 4NNYB 1BLNA 5BV7L 3QULB 3CXDL 4HIXH 4KKCD 4KV5F 5E94B 4MA3A 4ZYKB 4PGEA 3MCG1 4KK6D 4XCCL 2QHRH 5IEHB 2PTTB 1FN4B 5DJ2A 1X4XA 4O4YL 3TIDA 2DQDH 4E9LA 2F8OA 3LHPH 4X6DB 4TVSa 5E6IA 3L3IA 2VLME 3CDGA 5KOVC 3KWWB 3BJ91 3DYMA 1UM4L 4JHAH 1T04A 4XWGL 3ORJA 3V4PL 3BKCL 3ELAT 3MV8E 2MSPA 4HIEB 4ONHB 5I66B 5IESH 4G8GD 1TVBA 1BQLH 1DLFH 4JDTH 1QBMH 2BSRA 3DGCR 2WIIB 3N1PC 5H35B 4HG4K 3TNMA 1N8ZB 4Y16D 3GHEL 3WXVH 1KCSL 1XIWC 3TN0D 2R15A 1V5JA 2ZOKA 3MRKA 3HCVB 4ZO7A 5DJ0A 1CDHA 3FZUC 4P48A 4CDGC 2AQ2A 4V1DD 4YWGL 5D7JD 5HJ3A 1MCCA 5B21A 4P57A 1Y0LA 3JVGC 5D7JC 5C0BA 5KSAA 2CPCA 2DOCA 5LBSL 2IADA 4ZXBA 1MHEB 5K9KB 1CFVL 4LLQA 1J8HD 3RWDB 2AXGA 1EX0A 1RZJC 5TF1H 5C0BE 1ZLSH 4XB7A 1A6VH 1SMAA 1UXWB 5EUOE 3IRPX 4FFYH 4CVXB 1P4LA 1A4KA 3ARFB 4HJ0C 3C9NA 4QHKJ 4LASL 4LVHB 4MWFA 4O2EA 1N26A 3MXWL 1IFHH 4P2OB 4AH2B 4YEFA 1R3IH 1RURL 4HPYH 2VLKE 1AGDB 4IDJH 3C5ZB 3GBLA 5D2LE 4WCYL 3GIVA 3I84A 3OV6A 1MFAL 1PG7X 1J0HA 3IB4A 3JVGA 5AZ2L 4ALAH 4H20L 5M7QA 1IAIH 1BWWA 4EI5C 5IM7B 3FT4B 4L29B 3DROB 5EZOL 1CLOH 4F7PA 2YEZB 3H0TB 3ECBB 3HI6H 5FYLH 2X40A 1QVOA 4HPOL 4PJXF 2QV2A 4XRCB 5ICZB 4FA8A 5K59E 3L1OL 4ZDHA 5KSBA 2YXFA 4V2BA 4HF5L 1BIIB 2BVQB 2XTJD 1KIUA 3EOBB 2HVKB 4OIAA 1BFVL 4HT1L 1HOCB 2YPKA 4PRID 3PNWA 5ACZB 3ARWA 4LRNL 2ZG1A 2MQ0A 2D2OA 3AY4A 1CT8A 1W72A 5ADPH 2BNQB 3QXDB 5DJ6B 1NH6A 1JJUA 3QAZB 1P7QD 5SWZE 5L2JB 1CG9B 3QEQE 4LEXL 3PGDB 1YPZA 1OP3K 3NAAH 3CVIH 4XCYA 4XHJD 5FDYA 5B8CB 5IW6A 4YPGA 4NRYB 1VEPA 4IRJA 1WAAF 1A4JA 2ADIA 4ZYKA 2HH0L 3V52L 1D6VL 4PB0L 1S8DB 2UVFA 4H88L 5T3XE 5FYLE 4YFEA 4X99B 3GNML 1W0VB 4XMKH 4QRSA 2C7UB 3VFUA 1MHPL 4NQCB 4RAUB 1MFEH 5AG9A 4RZCB 2FO1A 2X4OB 4OFYD 5TQ0L 2DIAA 1BX2A 3O2DH 4J3SA 1ZHKA 3DX7B 4PJBE 1DBAL 1EERB 5J1AB 2LV4A 5I16B 3ULVC 3O3AA 2M1KA 4UT9L 5HDQH 4NGHH 4TVPE 1TJGL 2XWTA 5EA0H 3HI5L 3QI9A 4POUB 3QUXC 3MUJA 4XC3H 4ZPVA 3EGSA 4L8BB 5GZOD 5C7XH 4PJXB 1TQBB 2MCPH 4X6CF 3BP5A 1S9VA 4F3FB 4OUUA 1MVFA 4TULH 1U8JA 3IDGB 2JB5L 4WDIA 3UC0H 1TVHA 1WZ1H 3FQWA 5ITFA 4OZGA 3QFDB 3ULUC 4ODUA 3UROR 1U3HA 1OTSD 2HTLC 1L0XA 3WFBH 4DVRH 4BQ6A 4X6EB 1IM3B 4OZHB 5ITBL 5IVZA 4EDXB 2PCPB 2JB6B 2AJYH 4AEIL 5KBNC 5MERB 3IVKA 1HHIA 3VI3F 4RISH 1TZHA 1P6FA 3H8NA 2FHFA 4WFFE 2ZCKH 3ULVH 3L3HA 4QO1A 3BN9C 3GMPB 2NR6C 3RDTC 2NTSP 4QRRB 1G84A 4GQ9L 3UJTH 3JUYA 1CLZL 3EO0A 4M3KB 4NM8H 2D31A 4O2EB 5FM4A 4H25A 4LIQH 1ZE3C 2R56L 1HCFX 3G08A 1D9KD 3HS0A 4LASH 2ZSVA 2AGJH 2VR9A 2CSPA 4NNPH 12E8L 3GI8H 3MGTA 5CJXC 1GL4B 5DJDA 5D72L 4WO4B 1RZ7L 3EOTH 1PEZA 1ND0B 4K8RC 2DMCA 4M6ML 4ZUVB 4JN1L 1NFKA 2AEPL 1QYGH 2VOTA 4TPRH 4YR6B 3HC4L 1B3JA 1NAMH 1PZ5A 2ICWB 4IDLA 4JPIA 5D1ZA 3E6HB 4X4XB 1DEEB 1IGJB 2PYEA 3S34H 1FJ1A 4J7RA 4KTEH 3SCMA 4MNHA 1CFSB 4XVTH 1CGSH 4BFEA 2G5RA 5C09E 5B39A 3QJHB 2NY3D 4N8VB 3UYRL 3P40A 3VXQB 3G9VA 1MFAH 4LRNH 5SWZB 3V6FB 1C12B 3NPZB 2DQDL 4RGOL 1T22B 3MJ9A 4OLYL 1I1FA 3PWPE 4PJGB 4Y5YB 3VFMB 1JL8A 4JREC 4JFPA 3BPLB 5CEZH 3KPSE 4M43L 4UIKL 4U3CA 3NCYS 3GFUA 1BFSA 4LHQB 3NIDE 1WAAE 4ODXB 2OMNA 5JZ7C 5ERWB 2F15A 1D9KC 3ILPA 4X0KA 2GYSA 4OLZL 3JWDL 2H2PC 5BZDA 1DSFH 1KN4L 1LEKB 3STZA 5TGBB 4WCYH 4YGAB 3TNMB 1ZHNB 4FXKB 4IIQA 5GGQL 1MH5B 3VXUE 5LGHL 4BSWB 4NP4L 2SEBB 3B2VL 4MB4A 3VXMB 4MD5B 3RNQB 4EQ2A 1LWRA 1OW0C 1EZVX 1QBAA 32C2B 4X7DC 4PRDA 1IEHA 1FGNL 2D7TH 1I9JH 2AJ3A 3GMOB 2C3WA 3HUJF 4M1GL 4H1LB 1AGFA 4GXVH 5IBUG 1QFUL 3S37H 5B8CC 1R6VA 1UACH 3IAPA 1BVZA 2K1MA 3HAEG 5D5MB 4PJGF 3IDXL 4ZXBB 2BOBB 1R3KB 2NY0D 2O61B 4ZSOB 5D1XA 4X6CE 4J3WA 3IFNH 5I8EA 2FJHA 4Q58C 3RP1A 3WIHA 1EMTH 4WI4A 4TUKL 5CGTA 1EVUA 5CJ8A 1DQDH 4PJCE 1R3LB 3EFDL 4YDKH 2ZG2A 2I60H 5CP7A 3IDNA 2B4CL 2L0DA 5CIPB 2ZJSL 3NFSL 3RI5F 3EIFA 1RZGB 4X7TA 3HLAA 3UAJD 3Q3GB 2FIKB 3L7EA 4W6YB 1VEOA 3RZCC 2N4IA 4G3YH 4LSUL 4G6JL 4LU5H 5J89A 1T5WA 4NQXB 2CDEB 3ARRA 2D0FA 1OD7A 5C7XL 1KV3A 3QO1A 3H9SE 3OHXB 4GRLA 4NC1E 4I0PD 3BMVA 2WZPD 3CZFA 1CXFA 2NMSA 3MLYH 3OXRB 4HK0A 5FUOL 1BPVA 2H41A 5ID1B 1R5VA 3AREA 4M8QB 4S1RH 3OB0H 5BO1H 5J13C 3IKCB 3KLHD 1JWMA 5BS0D 2FO4A 4FQ2H 4XVSH 5C8JB 1PZ5B 1DQLH 4JANB 5B3NA 1DUYA 2VXQL 4YHLL 4XNMA 1FH5L 2R0ZL 4PRIB 4UV7H 3TCLB 4N0YH 1J86A 4P9HL 4X98B 3MRMA 3PGCB 3E3QE 3C5JB 2YD9A 2Y9RT 5IBLC 3L6FB 4PJGE 1EIBA 4Y4KC 3V6FA 3PDGA 4GJTB 5EBLA 4ELME 3WFZA 3UTSB 2BSRB 5CINH 4HUMB 2XZQL 4UIMB 3KYMB 3EOYG 4LLUA 1BOYA 1C5DA 3N9GH 3UYOD 1HOCA 5KAQF 5CBAB 2OL3L 2WMPA 1SM3L 2JF1A 2Z9TA 5F72S 4ZS6C 4HEPG 3HNSH 2B7DT 5C07D 4ONFH 4JPIB 4XBPA 1RURH 5ANMA 4WUKL 3MREA 1XIWD 3EKCA 1EAPB 3ARYA 1CGTA 1MH5A 1RSFA 1JPFA 3PIQA 5KW9L 4BKLA 1FBIL 4WUUD 3TBWB 4EDWH 4HUWB 3MBXL 3LRSB 1A7BA 1J5OH 1VFOA 1T2QL 4M6AA 3IYLW 5JPNA 3AS2A 2VLLB 1PG7W 3VFUB 5DJXB 3H9HB 4NC1C 3PP3K 4ZUSB 3BP6B 1L4IA 1RJLB 1ERNA 1VGKB 2Q3ZA 1AXSB 3NA9L 4JM2F 3L5HA 3JSSA 2GJ6B 2B8OT 4OKDA 1A1OB 3HRPA 5E7BA 3M1BA 1BGXH 5EPMA 1T0MB 3B5GA 1FZKB 5C9JB 4DEPB 4PBVC 2X70A 1HZHL 5TQ0H 5CIPA 4LPVA 3U1SH 1MFBL 5E6ZA 4PJAA 4X80L 5A16A 4WVRA 3SKJH 4NO3B 4KHXL 3LS5L 1FIGL 4DKAA 4E41B 4KMTH 1OL0A 4GSDL 4MJIE 3V5HB 4GW5A 5FB8A 3BHBA 4G9DB 4JR9L 1AO7E 1JIBA 5HYQA 1N7ML 4BZ1L 1CK0L 3VGHA 3ZDXE 3H9SA 5ICYA 1KCUH 4DQOL 5F6IB 2X42A 5DK2A 1KELL 2W0PA 1REIA 3C60B 5EZLA 3OKLA 4QXGL 3OGOE 3T0EE 1DQDL 1UH4A 3QEQD 3S3SA 3QUZB 4C56D 4C4KO 2ED8A 1NBQA 1N2RB 1NGYA 4OD1H 3VCLA 1R3LA 4LKCA 1MCPH 5HYJB 1EGJL 3HNVH 4PG2C 3FZUD 2VE6A 2ENYA 2IAMD 3G6JA 5H8DA 1DVFA 2XFXA 3MYJA 5C0ND 4GRLD 1NUGA 4HJJL 4PYGA 3P4NB 1FNSH 2VZOA 3VMOA 2VR5A 1MEXH 1K4DB 3FO0L 4L3CB 1KEGL 4A6YB 3GGWA 4RGNB 3PWLB 3DVGB 4LARL 3P4OA 3RKDD 5HD8D 1S7UA 4U1IB 5IMOB 1U8MA 1EBAA 3ARPA 4ELMA 3IDYC 2G5BB 3EYUH 4G6AD 4OM0L 2NXYD 1NC4A 4ZUTB 1R5IB 2DD8L 2F54A 3NPSC 4QHLB 4KROB 3TPUB 1P4BH 3WIIH 5BXFA 3WSQH 5F44A 1FNGB 3O8XC 4Q2ZA 4MJ2A 2J6EA 1YNLL 1IT9L 4H1LA 3DIFB 1XF2B 2B20A 3BESR 4Y5YC 3KPNB 1ED3A 5J8OA 3TVMC 1MJUL 1MVUB 1T66C 4KJPC 1G9MC 4QHUB 1N59A 3M17B 4X6FA 2GHWB 2D7QA 4NQSA 1KYOJ 3DV6A 1JNHB 4R2GB 1XF5B 2UY7A 4V1DE 1B4JL 3L6FA 1OOAA 1HQ4A 1T2XA 5HI3D 3SKNB 2VISB 3CJJA 1C1EL 1XF3A 3X12B 1ETZA 4JO4H 3ZSTA 1NGQL 3MLVH 3TWCL 4G5ZL 1V05A 1RK1B 4ZS7L 1XR9A 4NZTH 1HYSC 1PGRB 3OPZL 5C0CA 3HNTL 3IS1X 1LK2A 1AXSA 1M6OB 4M6NL 4XVJH 4B53A 4UILH 5JLZA 4E42B 2GY7B 3M1BB 1QO3B 4YHKL 3GBNH 4NQVA 5IOPB 4B5EA 1BLNB 5C1MB 4LRIC 1UKQA 4CN4A 2CIKB 4NP4H 3QHFH 5IEHA 3RWGA 1JPST 1WFUA 1AQDB 4UB0H 3CZFB 4QOKB 4U2YA 4P2QE 3U48A 4LQ1A 3WNMA 1KB5H 4GAFB 4HHAB 4J3VA 1GC1L 5CS7A 4D8PB 3GMMB 3WLBA 1L7TH 3MGOB 2WP3O 4MJ4A 1IAII 1DFBH 2C4XA 4G9FD 3U7YH 3P3YA 3WD5H 1KB5A 3ZTJH 4GLRI 3SO5A 5INDB 1A7OH 1IQDB 2NY4C 4IRSC 1RZJH 1BIHA 1RIHL 1V3KA 1Z2KA 1VHPA 1KTDB 5GGVL 2AJXL 4LKXA 2VLRE 3OTTA 2BNRB 1NGYB 4P9HC 5CLTA 5IIEA 3BWUC 4Y19B 7CGTA 1O7VA 4UOJA 1U3HC 2V5TA 5KTEH 3A6BH 3RGVD 1XGUB 1XAUA 2X4TB 2XRAH 3MRCA 1SY6H 4ONFL 3RA7H 4EXPX 2Y7QA 3BE1H 4FFVC 1A1MB 1MHHA 4KDTC 4CGTA 1KPRA 1J0KA 2DWDA 4AEEA 4W70A 5C70A 3QAZC 1F2XK 4RNRB 5KAQG 2R4RH 4YDIH 2XACC 1I9RH 5D1ZC 3BWAB 4HC1L 4WHYG 3P11H 4O9HH 1IBGH 1CFTB 2H9GB 1I7UB 2WBWB 3GSWA 5F8QC 5SX4H 1CF8L 2CKNA 4GRLC 3I3DA 1FYTA 1UENA 4ODHL 3RVWD 3G5XB 3MCKA 4OCNC 4XH2B 2FYYB 1EV2E 2FJHB 5EWIL 3VD5A 2HFFB 2BVOA 4JREB 3MYJB 2BOCA 5F1IA 4YO0A 1KJMB 5GRUH 1O0VA 1UZ8B 2PXYB 3SDDB 2W9DH 4Y5VC 1DANT 3RI5K 3RBSA 3I2CL 3Q6FB 5BV7C 1CXKA 3T4YB 2X6MA 1KFAL 3BP7B 5D8JH 1E4WL 1IC1A 4ELMB 1PLGL 3X11A 2DQCH 4K8RD 5K9JH 4OLXL 1A0QL 1RFDL 4L8SA 1TJIH 2JJTA 4X9BA 1QBLH 1W2KT 3KAAA 3ZKNC 4XP1H 3S37X 3MV9E 4PJEE 1FNGA 5I1IL 5HHPB 4APQD 4EQ3A 1MHEA 1BJ1J 1FQ9C 1F4YH 4ESKA 2XNAB 3WFDH 2X4NB 3F8UB 4KDVA 1ULVA 4XCCH 2OZ4A 3FHQA 1N64H 3QQ9C 5FO8B 5L0QB 3ULVF 1CXHA 1ORSB 4RAVB 4EUPH 4Q6IB 4R4ND 4X6FB 3TV3H 4PJFE 1HI6A 3ZE0F 2GSIB 4MWFB 3BN9D 1NUFA 1ZT4B 4L4TA 3MRJA 4FFZL 1I7RB 4X6BA 3DX7A 2P47B 5DR5H 5C08B 2X4PB 1E28B 4AYFA 3O8XA 4MXQC 2EDYA 1JN6A 1J7VR 3AS0A 1CIDA 3C6LB 4EI5A 4JM4H 1BP3B 1GHFL 3CC5A 3ETBF 1AGEB 3NCEB 4YK4C 3WHXA 4OCWL 5KJRL 4P23C 5JOPE 1HZHH 4PJCF 3U1SL 3HC0A 2ITCB 4HFWA 4GG6B 1KCSH 3CXHK 5CAYB 3S6CA 1RUKH 3AM8A 4R2GC 3QCTL 2EH7H 3WJJC 4OQTL 1OGTB 5IV2B 3U7WL 1H5BB 3V0VA 4YC2B 4J1UA 5EFIB 4QRQA 3FCTB 5EOCL 3DYOA 5D2NA 2ERJC 3OKKB 3IS0X 3MGOA 2V7HA 4GAYA 2HLAB 4IOIA 4ZNCD 3AB0C 1RJZA 4P46C 3WO4B 2P24A 3RWHB 1I3RA 5D2LA 2EDBA 1NEZA 5DC9B 2R2BB 2P46B 2QEJA 3FAXA 2NXZB 5DQDH 4Z78A 5IGXL 5IIEB 4FQXC 2DQHL 3M8OH 3GSNB 3PWVA 4PJIF 1KCUL 1IM9D 4PLOB 3CDCA 4DQOH 2W1NA 1ZHLB 3MGTB 1T03L 1KELH 1C08B 5DUML 1DANU 3TBTA 4J8RA 4G9FE 4PB9H 2A38A 4KKNA 4DCQB 4I3RL 2AJSL 4M7LH 3STLB 2YD3A 1IT9H 1JGEB 5IB4B 3MLPA 1MRFH 5C2BH 4PLJD 3NFNB 3AROA 3OG6B 4I0PC 4GBXD 4LPWA 4AEFA 1UWEL 4AIXA 2CQVA 1U95A 4FQQA 1GXEA 3MRIA 4OM0H 3BGMB 4ODSH 5IOPA 5CSGA 4GLRH 5EIQA 4CAGA 1ZOXA 2I26N 4MJ6B 1XCTA 1A4JB 3UMTA 1GGCH 4LCUB 4OZGB 4PG9A 4LNRB 4YNYB 4PTTB 1MSPA 1S8DA 2VLJD 4IRJC 2E7LC 1SJEB 1ZGLM 4GG8B 1NQBA 2OTWA 3MFGB 4OF6A 3RU8L 4HXBH 2GTZB 3EO9L 1QQDA 1XGTB 5A3IC 4HUKB 5CJQH 3P0VL 3ROOB 2VE6B 3GJEB 4L29A 1D5XA 2EC8A 1WFNA 4QRPA 3LN4B 3EFFA 1UKSA 4RIRA 3AXLB 2AABL 4X8JA 3MYZA 5C6TH 4YDIL 4NO5B 3RKPA 2YKLH 3ZTNL 2GCYA 4MCYB 1U93A 1IC5L 2L7UA 2YD8A 4JHWL 4NM4L 3VFVA 3DGGA 3MV7D 5IBLD 2X10A 1R0AH 1MPAH 4ZUVA 2VR4A 1BFTA 1KPRB 1T89C 1J87A 1MCEA 4PBWD 3INUH 12E8H 3RWJB 1GGIH 5D7IF 3GUTA 3BD3A 2HKHH 1Z0MA 4OFPA 1HYSD 1GAFH 3GMPA 1T6VN 4LF3B 3TO4A 2AV7B 1NFDA 3REVB 4R7NB 5E8EB 5D9SA 2AK4B 1MREH 4I18B 3ZDXF 1UB6B 4FTVB 1Y6KR 2CR3A 1I1FB 4BQBA 3EYQD 5FGBA 2J12B 1JNHA 5DQJA 5IT2H 1T66D 2BVOB 4KJPD 5E5MA 1QFWL 2BNRE 1OGAB 5EU5B 3GM8A 2GJJA 3ZE2F 1KJMA 2O93L 1OAUL 2YD4A 3WFHB 2H8PA 3BT2H 4F7TB 5I2IA 3O3EA 1TPXB 5MEQA 4K9EH 3LZFH 1CZ8L 2O5ZH 3K81A 1S3KL 2DKUA 1DBJH 3QWOA 2CK0L 3F6LA 2GUOA 3TN0A 4FQLH 1U92B 1T2JA 4DUXA 5HGGS 5IQ9A 5J3HC 1A5FH 2B2XH 2J88H 3QEQA 3MRPA 1GJIA 1KCRL 1YPZE 1IM3A 1WFOA 2P48B 3TZVB 4XMPL 5LCVL 3DX9B 2FBOJ 3B8YA 2IFGA 2GI7A 2CXKA 5DRZA 4BUHA 3WMSA 1YN7B 2PXYC 4XVUC 3N0PB 1WTGT 3LQAL 4Z7UF 4LSRH 1IZKA 3T0XA 2IAMC 1G6RB 3IDXH 3CFKB 1YEJL 4NKOB 4X7CC 4DEPC 4R4NC 2I07B 3V5KB 2PO6B 1E27A 3DXAB 4ZUWA 3VU2A 4LHUD 1T7WA 3T0VA 1IGTB 4U1SA 5IWLC 3VWKC 2D3VA 1U0QA 3QCVL 4HBCL 5F89B 3PWJB 2EZ0D 1KULA 3ULUF 4IRSB 1EJOL 3VXUA 1KEMH 2CLVB 2R2EB 3IJYA 5IR1A 3CFEA 3LAFA 1P4IH 1EAPA 3MV8A 1TVDA 5MEOB 3QH3A 1VKXA 1OF2A 5ELIA 4PJHE 5KVFL 2CMRH 2BX5A 5IMMA 2ARJA 4LSSH 4JZOA 4PV9A 5D7LB 4AMKH 5JUEL 3DXAE 4QY8A 5IB2B 5DHVB 3BUTA 1WJ3A 1AHWB 2IGFH 4DKDC 2ADJA 4PJHA 1A6TA 5F96L 3SOBH 5H2BA 5DR5L 4JM2C 5DS8A 1FFOA 3EJZC 4IIQC 4UNUA 1KLUA 5J0BA 5FHAL 4PJDA 2VLKB 2WBJB 3NGBB 5HGDA 1YY8B 4MJIA 2F53A 3PL6D 3LMJL 5I74B 5M94B 4MA8H 1UA6H 4LEOA 2AXFB 4HFUL 3NCJH 4YDVB 1RK0B 3ARBC 3HZVA 2OJZL 1C7SA 4HIJB 3ES6A 3WXWL 1I4FB 3ZE0E 3VXRE 4TSAL 1L7IL 2XZCL 5TE7H 2CUHA 4KTEL 2GAZA 1Z6JT 5C0JB 2VJXA 5EOCJ 4JVPA 5I1JL 3BD4A 2MKWA 3MZTA 4TVPD 3V6OC 2HYMA 1Q0XH 2ZPKH 1WV7T 4WU5A 3SY0B 1UQSB 3MXVH 1Z3GH 3D18B 5FOBA 4A6YH 3G6JE 2NLJB 1P84J 3DURB 4QYOA 5ESAB 4XMKL 3O3DB 1TZIB 3UPRA 1RUKL 4KKAD 4JN2A 1SYVA 2XWJA 1W72L 2J8UE 1XH3B 2LAAA 1JNLH 3H9YA 5DLMH 1FZJA 2WBJD 3CFJA 1SBBA 5CD5D 3EW3B 3C5JA 3GSNL 8FABA 3RUGB 1CS6A 5KVDH 1T7ZA 3GSVA 2AJZB 4IEFB 2BSTA 5B38G 1T7VA 3MLWL 3BQUC 3GIZH 5KANG 3TZVA 4P2RB 3BN3B 4I1NB 3KPSA 5DJXA 5I30H 5TFSH 3KWWA 1MCIA 2H1PL 4HJGB 4P4KC 1AKJB 4G7VH 1A22B 3TNNA 1K6QH 3P73A 2R0KL 2R2CA 4XPTH 4NRXB 2VDMH 5CJQL 3QUKA 4F37F 3BKMH 3C60D 4NQTA 4YE4L 4NNXB 4G7YL 2BFVL 3ZLQC 2E7HA 4JRXA 2HFTA 5I1HH 3CSBA 3P0GB 5E99L 2QHLA 2E6JA 4HCRL 3UTTD 3DRTB 4PGDB 1JGUL 4GT7A 3KVQA 3VFVB 1JNNH 4PTTA 1BD2A 2VZVA 5MI0C 1BECA 1E6JL 5GSVA 5SWSB 3VDAA 1Z5LB 3ALWA 1UH2A 2DKMA 3W0WB 1MNUL 5JOFB 15C8L 4YXHH 5GRJL 4XBGA 1KN2L 1R5WB 2WP3T 5CEYB 2NQCA 3ESUF 4WHTB 4YXLH 3TBYB 3W39A 1DVFD 4CVXA 1G7HB 1S9KC 3CFDB 1A02N 4EIGB 5KSVA 1OAQH 5C0GB 1DVFB 2PO6A 2DJSA 1IC7L 5D9SB 3R8BB 3RUGF 3CSGA 3P9WB 3T0EC 3DHMA 3ZE1E 4E41A 1KJ2B 3KYOB 2CKBL 1C16A 1U91A 1CTOA 1C7TA 4DK6A 2VDOH 4PY8I 5DFTA 1ACYH 1RIVL 3LKRA 4C59B 1B6UA 2HVJB 1I4FA 2OBGA 1DL7H 4MMXC 3HG1D 2KZ1B 4X7SL 4QXGH 1Z9LA 4HPOH 4JDZA 3VGGA 1F6AB 2AI0H 1CE1H 5ENWA 2A9MH 4JY4B 2J8UB 2EDQA 1JPFB 1Q0YL 1RUAL 4LCCB 3RKDC 3VCLB 4XXCC 3AS3A 4M7LT 2EE6A 2DDQL 3TN0B 3GK8H 1HIMH 3VFSA 1MRDL 3G6JB 3SGJA 4XP4H 3MV7B 3QISA 5D2NC 3L95B 3B3IB 3IXTB 1G7IB 1ZLWK 2P45B 3P2TA 1SYVB 2JJTC 1JWSA 4D2NA 1YMHA 3CVHH 4HUVA 4IJ3C 2VQ1A 2V5RA 1NCBH 3O0RL 4X6DF 5EU7E 2P5WB 4OGYL 4YXKL 4P2QB 4F80A 1MAKA 1U58B 3OKMB 2VITB 4HKZA 3QUMB 1UACL 5EUKB 3EJYD 2EYTA 5CEXB 4HS6A 1I1AD 25C8L 4PJ5A 1U6AL 1FZMA 1A3RH 5CEZD 1PSKL 3VJ6A 3ROLB 1ZEAL 4NO0D 4LHJB 4RIRB 3N50A 2RQ8A 3B9AA 3MUHL 1AIFA 4PS4L 5IFAL 2APFA 3LS4L 3EYFB 5J6GB 1FZOB 3FQRB 2Q76B 3MOQA 4ZSOE 5DJ2B 3O6FD 2RHEA 2ZG3A 4XPTL 2IANB 1F58H 4Q74A 4N5UA 5EO1A 2HJFA 2CRYA 5C07B 5JMOC 4X9GA 2DKSA 3HE6D 3MROB 1JK8B 4ZAKD 1GZQA 1J10A 5EZIL 2XI9A 2FLBT 4IRJB 5D1QC 3D0LA 4V1DB 1KF9B 3CXHJ 5DHVA 3ZKXB 2IMNA 1NANH 1JI2A 1A14L 1XF3B 3OKEA 3TESA 4PJEB 4DFHA 4DTGL 4MSWB 4ZQKB 4KQ4H 1UWGL 4WGWB 4G7VL 3AUVA 2NY1B 3D69A 4FG6C 3GI8L 4EVNB 5T3XD 3U7YL 1RU9L 5T1DH 4DUVA 1S78C 1DDHB 4U6YA 2HA1A 4MA7L 4HIJA 4XCEB 1NBZB 1ZHBA 1VA9A 3DUSA 1A6AA 4X4ME 4YHZL 1RIHH 4GW4B 3LKSA 3LKNA 1IL1B 5BZWA 3HAEH 3HTLX 2A6JA 2DQUH 3LB6D 1MAMH 4BFBD 2YUWA 1TVHB 1JHLL 2X5PA 1R5IA 2IQ9H 5IEKA 1E4XL 3GBNL 1AHWA 3HMWL 3ISWA 1H3WM 1MCNA 5MENE 1ND0A 4P46D 2AJYL 4MMZC 1Y18B 1CD9B 2ZUUA 1S7QB 2GSGA 5F9WB 5I76A 1YEFL 2OK0L 1ZMYA 1I1YA 2BNQA 1AJ7L 3B8SA 5FM5O 1IGJA 2PYEB 3LV3B 5CKGA 5E00A 5IF0A 2GSIA 4NN7C 4QRUA 1CU4L 3UC0L 4GQ9H 3R8QA 4LCCA 5I15H 4UDUB 5IM7A 2RBLA 3G5XA 3MCKB 1KJ2L 4YBQC 4XVJL 4BH7A 3VD9A 2FDBP 4FQHA 2WWKO 3T0EB 5TDNA 3AAZA 4Z7WB 4NQED 1CGYA 4ZTOH 5HXMA 4BQ8A 1WISA 3F7RA 4PREB 5D8JL 2EDNA 2VQTA 2F19L 3CMGA 2C7UA 3QDJD 1TCRA 3BZEB 4UQ3B 3OAYK 3OGCB 4HK3N 1QRKA 4XC1L 3NGBC 1YZZA 2A9NH 4IRZL 3SE8H 1PKQB 3BWAA 2VUYA 4L4VB 1NBVH 1NMAL 4JQXC 2GFBA 4WFFD 4XPAL 5BVJB 4WWKB 4PJ7F 1CDJA 4D9LL 4QRQB 4PJXE 2R0WH 3H3PH 3QQ9D 1ZA3B 1QSED 1QZ1A 1YECH 3D3VB 2YWYA 5IVNA 3LY6A 1RZ7H 4H1LG 3CUPB 1GGIL 4PRAA 5KJRH 5AD0B 4K71B 1M4KA 3BOVA 3O6LL 4Z77B 5IHUH 1NLBH 5HHME 5HHOB 2XWBB 4LSPL 4RWYH 3T8XB 4MXWH 1KENH 3I6GB 4PTUA 3HRZA 5EU6E 5BVPL 3NZ8A 3D39D 3D0LB 4V1DA 4R0LA 2OX5A 5KN5A 5EUKA 4PGCB 3P9MA 4PP2B 1F42A 3DOSA 4UOW0 4IS6A 1YQVH 2W65A 4LEXH 3O6KH 4RDQF 3RAJH 2NY6C 2VLMD 5KANI 2VDML 4R3SA 1G6VK 5H37H 3EYVA 3SDXF 4Z0XB 3BZ4B 4EBQH 4OF8A 2ORBH 2NYYC 2WWMD 4OI9A 1RMFL 2QQLL 4ODUB 1TENA 4WY7L 5E1AA 5IK3B 5LJYH 1CN4A 5BRZB 3D48R 5ACZA 4ZODA 1EUTA 1X7QB 3OKYA 2ICWA 4OLXH 4YR6A 4FZEL 5IJVB 4WI5A 3RX8A 4QCIB 2IPUG 3BEWB 1DZBA 3QUYC 1F6AA 4Y16C 1LO3L 5DXWA 1QFWM 3BGFB 3OF6D 3IKCA 4YXKH 4K07A 1RVFH 5D6CB 1CFBA 1XCQB 2E7CA 4DZ8B 1OSZB 1X5KA 4OCSH 2NY3C 4JM4L 5D2LB 5CD5C 1QHOA 5JHLH 4OD2B 3P9LA 3QO0A 5F3BA 4HWBL 5IVOA 3MOAH 4GXUN 5I73C 5E1HB 5KG9A 4NIKB 3VMPA 1T83A 4FQHB 5J1AA 5GS2H 1TJHL 1O7SA 1RUAH 5DURD 5C86A 3VD7A 4OF7A 2RGSA 4FQCH 5ICXB 2GEEA 3DX8A 5GZNC 3CZJA 1XIWA 4QXUH 4D9RD 4WEMB 4OIIL 4NBXB 4XAKE 5CCKH 4GRWB 4Y1AE 2XKUA 1J1PL 5HHNB 5LGHH 1DVFC 5F7UA 3QDGA 4Y5XB 2C1PA 1JHKL 1U8JB 1U36A 4N8CH 2EDTA 3C5ZC 5DUPH 1NAMA 2MTPA 2WQ8A 1G7IA 5HYEA 3O45B 5F96H 1JZ3A 3ZTNH 4DKFH 1JYNA 5D96C 4XVTL 4OZHA 3Q6GH 1KJ2H 2X7LA 5BV7H 3MO1B 4KAQL 3H7BA 2R1WB 3OBAA 1TXKA 3OKNA 3EOAA 5EZIH 4C4KT 4WJ5B 3SE4C 3AM8C 5E8NB 1JCKA 3FN0L 3ZYOA 5EZJA 4TPRL 1GGCL 1NFIA 2BY1A 1J0ZA 1LDSA 2XZQH 1XGQB 1U8PA 2FGZA 3W2DH 2JK5A 2OR9H 1EEYA 2XWBA 2NTFB 1UZ6F 1ZHNA 3H42L 4XX1E 5FIEA 4OFIA 5JDSB 4DJMA 3GKWH 3PP3H 4W81A 1NGWB 4R8WL 3MJ6A 4CU8A 4P99A 25C8H 4LQFL 3LD8B 2IEPA 4NZJA 3NCMA 5D7JA 4YHZH 5GGRY 2FHBA 3PHSA 5A16B 3B2UD 4U05A 1JK8A 2P5EA 1JF1B 3KJ4B 3GSXA 3O0RH 1H5BA 1LP9B 5GRXG 1QEWB 1LILA 2GJ6E 5EORL 4WEBH 1CLYL 1ZLWH 3RWFB 2WBJC 3CMOH 4LSUH 2VQUA 1A8JH 3X3FL 4LOUC 4ETQA 3ARDB 2P24B 2JCCB 4FQLL 3LRHA 2ZCKL 3KPRA 3WIFA 3ULVL 1GOGA 4JG1L 4IRSD 4FZEH 5TDOA 4P46B 4C83A 1E6OH 2WUBH 1B4RA 3EDJA 2V2XB 2ID5A 2R1XB 3SKJL 4H8WH 4GKSB 1UB5B 4P2QA 4ZAKA 3WV0A 2A6KA 4F2MA 3I6LE 4JZJB 4PJ7A 3LEXA 3R4DA 3IU3A 1CXEA 5DMGD 4G9DA 2EYSA 3BH8A 3U7AA 5EN2A 1OHQA 4QKXB 1GIGL 3P4OB 1BZ7A 2HJLA 4KKBC 5CGYC 1HILB 5DD0L 4QHNB 5CSBA 2A77L 4R4BB 1T7YA 3A67H 1S7XA 2NZ9C 2HRPH 4CNIA 3BSZH 2ZUYA 3FO9A 1P9MC 3QULA 5IMLB 3TN0C 4WU7B 2VL5B 1N4XL 1KLUB 2DI8A 3GSRB 4LSPH 2Z4QB 5DHXB 2AQ3A 4HC1A 2VSDA 3HZYA 4YHPB 2PYFB 1MHCB 2XN9E 4J3TA 3VH8B 1SMOA 1U42A 3G6DH 2AXFA 3MJ9L 3KYNB 1YNKL 1WVZA 3O9WC 1NAMB 4LP5A 3L3IB 4X9IA 3QZWA 4WWKD 3MLZH 3AREC 1MRFL 1XGPB 2DS4A 3EYSH 3P4NA 4H1LH 3DTXA 1T89A 4OZHE 4JJHA 3QCUL 1MELA 1J0IA 3H9HA 4ZUSA 3OZ9H 3BPOC 3QFJE 4YLQT 4CMMB 4RFEB 2KDGA 5A2KH 1OVZA 3BUYB 2RB8A 4MX7B 4WGVB 1MFCL 5L8LB 4U1SB 3D0VB 3I9GL 1HXYB 1NUDA 4OZFH 4RGOH 4PJIB 1MJ7H 3OHXA 3KLSA 4GRLB 4TVPL 3S36L 1JPGB 1UKTA 5DJAA 4P9HH 3LEVL 3TBWA 4BA8A 1UFUA 3VFGH 2R39A 4HWEL 1V7NL 1LDPL 1UXSA 4FQCL 4JFXA 4MZ2A 4UU9A 1B0RB 4MD4B 4JE4B 3ARBD 5F3HB 4WI8A 3L3JB 2I07A 4U31A 4PJDB 1LO3H 2ICWI 3FTGB 1N2RA 3PV7A 2QKIB 1SVCP 3RWFA 2WINA 1YJDC 1ONQB 4HBCH 1CICC 1I75A 4XNZC 2WSKA 3L5JA 3PXHA 2R8SH 4XPFH 2LABA 5DJ0B 1QPXA 5EU4B 3H2WA 4ZD3L 4G8EA 2CK2A 4BZ2H 2AK1H 2QADD 3SPVA 1TLKA 1I9IL 1OPGH 4TSCH 5HYQB 4HH8A 2P4AB 4GKSA 5JMRA 2X89A 5DK2B 1K2DB 3LH2H 2B4CH 3MJ7B 4PJHF 3CD4A 2O5ZL 4XWGH 3RWEA 1BEYH 5ANMB 1F3RB 3FRPA 4M6NH 4RGND 1U8QB 2B0SH 1MQKL 3GSUA 4F7EB 1TZIA 2QSVA 5HGDB 2G60H 5GSRA 1OTTC 1N6QH 1ZAGA 2J88L 3C8KB 1DBKL 2C3HA 4PRAB 4WW2A 5B8CA 1OSZA 3H3BC 3RAJL 2QR0B 4M6OH 2E7BA 4MQTB 1MFEL 2NPLX 2F53E 2EEAA 5C3LD 5DVLA 2IPKA 1YEIH 3L9RA 1G7PB 3ESVF 3L5WB 4M62L 5IB3A 3VRIA 3EYUL 3LN5B 4UT9H 1NGXA 5HDQL 3HZMB 3NZ8B 1KIQB 3SO3C 3KGRA 2DIJA 1ZT1A 1BOGA 5IB5A 2VISA 1U9KA 2YD7A 5JIPA 5HDLA 3PP4H 3REWB 1T1XB 1MY7A 1WBYB 4LVHC 4MDIB 3NIFE 4IS6B 3V0WL 5T1LA 3HI1B 1QFWI 1MCWW 1ZANH 3QEUA 1NC2D 4K3EH 3V8CA 2COQA 5IQ7H 3MRQB 5D5MF 5ENWB 3WE6A 5JLZB 5FA4A 1NUNB 1HILA 3HNVL 3SKOA 1IGCH 5EG6C 2I24N 1DR9A 3DRTA 4U1NA 2XKSA 4YUEH 5BRZA 1SJHB 4FMKA 5DTFA 5K9OA 2QSTA 5D7LA 1MWAA 4XNQB 3EHBD 3RQ3A 4FQ2L 1ZWIA 5C0AA 4YHIB 3RVVD 4OF5A 3GSQA 5I18H 1MHCA 1Q9WB 3OKLB 4FTVE 1WWAX 1RUPH 3HMXL 4X99A 1CFQB 2B1AH 4XPGL 4ENED 2V6HA 4WTXA 5FO7B 5JW5A 4P2OC 5IHZB 3GMLB 4XP1L 5FHAH 1AR1D 1D5MA 3DPBA 5DI8A 4RMVA 5C0CB 3I6KB 1QKZH 4HS6B 3QJFA 2AV1B 1RZIB 3HR5B 1HI6B 3JV5A 1QACA 3BGFC 5C0GA 5C0CD 5I1DB 3UBXA 5J3HD 4HIIA 1DL7L 1QSFD 3FQXA 2Q7YA 1OSPH 3F7YA 3QIBB 4DN3L 4ZAKB 3MRGA 2Z31C 5J7CC 4I3GA 1I8IB 1UM6H 3PL6C 5GS1C 1PKOA 4RWHA 4WO4C 4XPAH 3CC5B 2A6IB 2GIYA 5E24E 3D2UA 1U8KA 2P8MA 1QTYT 1WT5C 4DKEL 4FHBD 4R26H 5HHXL 4ELMF 3PGDA 1IAOA 1DBBL 4GS7B 1IJ9A 5GGQH 2ICEB 4GMSH 1I8LA 4JFFE 3CNKA 1W8OA 1BZQK 3BDYH 1OGTA 2WAHA 4Z7OE 1LD9A 3O45A 2FSEA 1N5AB 1YMMB 4LDOB 4LAQH 4N8VA 4JCMA 3K80A 2WWKT 3TYGL 3EDKA 1VGEH 2WINB 1V7NH 3C8KA 3TBSA 2ARWA 4D0CA 4L1HA 1OCWL 1KN4H 4HS8L 4F2MB 1CDCA 1JGUH 4HJGA 5HGBA 3NA4A 4KXZH 1P84K 2DWEB 5I8OH 1KXTB 3SDDA 2BNQE 4BFGA 1NJ9A 3LS4H 2NZIA 5CJOH 5FO9A 2A6JB 3ILQD 3M07A 4YE4H 5IW3A 1KCKA 1E4JA 5E2WH