4JR9L

Crystal structure of nitrate/nitrite exchanger nark
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
211
Chain Sequence
DILMTQSPSSLSVSVGSSVTITCQASQNITNYIVWYQQKPGQAPKLLIYYTSTLESGIPSRFSGSGSGRDYSFTISNLQPEDVATYYCLQYNSLLTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKNINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/immune system
molecule keywords Nitrite extrusion protein 1
publication title Crystal structure of a nitrate/nitrite exchanger.
pubmed doi rcsb
source organism Escherichia coli
total genus 49
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2013-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jr9L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jr9L01
1MF2H 3GK8L 4LHJB 3BOVA 3GJFB 3VCLA 4UT6H 4KKAD 1V7NH 1OGTB 2FD6H 3HPJB 4Q7DA 1A14L 1RURL 4S1DD 1DE4B 3KXFB 5LGHL 1K8IA 3LD8B 1F2XK 3B9KC 4IOFD 3FQXA 1N4XH 3FRPA 1ODAA 3V6ZA 2F5AH 1NAMA 4BZ2H 2YPKB 3EYVB 5IFJA 1HINL 3QFJA 1GGYA 1XGUB 4LVHB 4X6EB 5BW7A 1YN7B 3X13B 3MRNB 3TESA 3SDXB 3KNBB 3GIVB 2W60A 4S1QL 1RAMA 4X6DB 1FC2D 1DEEA 4JKKA 2XZAL 4LPWA 4S2SA 3MLWH 4KK8D 3L3OB 4BZ1H 4NKIH 2B7DT 4OLXL 4NO0A 4V1DE 5GJSL 3PABB 4Y5XC 3QDGD 2XTJE 1GC1C 5HBBA 5IW1B 2ZSVA 3MACL 1YJDL 4ODWB 1NCTA 1Q9LB 5IB4B 1IQDB 2CLRB 1HXYB 2A6KA 3CFCL 1NFDF 5FYKD 4UBDC 1R3IH 3MR9A 2VLMD 4IRJC 4OD3L 2V2WA 3UJIL 5D70L 5GGSA 3U2SB 2B1HH 3GSXB 3D85A 3WNPA 3RP1A 1B9ZA 1QRND 1QBAA 1QG3A 2HJLB 5C0CB 1S9VA 2LTQB 2VAAB 4FQIH 2AXFA 1MCWM 4TSCH 5D7IE 3MODL 1J1OH 3NAAH 5HVFB 2P48B 3QULB 4OB5L 2BY0A 4GMTH 3I3DA 4MCYA 4YZFF 4JZOA 1J0HA 2R0WL 4AG4L 2H2PD 4M4RA 1W72H 3N0PB 1UYWH 4F7EA 1FFNB 5TQ0L 5TDOA 2BERA 2ED9A 2DAVA 4DQOH 2A9NH 4J4PC 1CL7I 1NDGA 2D03H 3DX9A 3F12A 1A6WL 4NQXB 1EA9C 1M05A 4AT6A 4K94C 1BD2E 4XVUC 3SDXF 4OLZL 4PRAB 3RVXC 2EO9A 4LQFH 3NFPA 4X6DF 3MA7B 4HKZA 3RTQC 1UACH 5EC2A 2YHGA 1N5YH 5HVHC 5JW4Q 5D7IA 1BFVL 4GAYB 4J3UA 1PKQE 4LSRL 5CUSH 1U3HA 5A2FA 4BUHA 2CXKA 1XGYL 3L3KA 1EEYB 1MHCA 1LO4H 2Z8SA 3DVFA 2WWKT 4DUXA 4PTUA 43C9A 1I1FA 1A3RL 4WHCA 4RQQA 1BD2A 1P4LB 3CVIH 2CPCA 3S97C 4UT7H 1WZ1H 3LS4H 3QXVA 4I0PB 1F97A 4H20H 1LNUA 4DW2L 5I73C 2OTUA 4I3RL 1JHLH 1H5BB 1ZMYA 4DK3A 4X6CB 4H0HB 4P46C 3FQRA 2AXHA 4LKXB 2XWTA 1XH3A 4Z7UB 1OTTC 1EGJA 2FDBP 3KPRA 1AQDA 1D3CA 4OQTL 3CCHB 4QF1B 5JQ6L 4QRTB 3VXRB 1QA9B 4R90L 3W0WA 2FR4A 5D6CB 3BGMA 1TXKA 2ZZUT 3C5ZD 3DUHA 4ZS6C 4NIKB 1WT5A 2H41A 3VFPB 1DUZA 5H37H 4BFIB 1BVZA 4E42B 4FXKA 4U6XA 1IGYA 4QWWC 4UT9L 1AR1C 5HGBB 5EOTA 3BZEA 1T03L 1CD0A 3D9AH 4OGXL 4WNQB 2FBOJ 5DMYA 2VABB 3NABL 3OKLA 1KPVA 5DFTA 1RZFH 2IPTH 3P4MB 4PJAB 4C54A 3G5ZB 5BV7B 4G5ZL 3KJ4B 1U3HC 4OLUH 4ACPA 4JHWH 1TZHA 1IC7H 2DQDL 2G5RA 2C1OA 3FOLB 3GMPB 5CHNB 5JIPA 5TGBA 1S7VB 1MRDH 1W0VB 1ZTXH 3GB7A 5E00B 3MLYH 2A9ML 2VWEE 4I3SL 1A6ZA 1K3IA 3ZDXF 4TNWF 2NX5D 4WW1A 4KUZL 3RZCA 1KXTB 1OAUL 1FNSH 2X4NA 2E9JA 1EFQA 1SM3H 3C8DA 4PGBA 3HE7A 4HIJA 4X6CF 1BM3H 1RUPH 5I1CH 1AKJB 3SDDB 5E5MB 5GGRB 3ZDYF 5I17B 3ULUL 4JKMA 1S7RA 2ADFL 1MY7A 2CRMA 5CSZA 4F15C 4Z7UF 2EE6A 2FNBA 2VKWA 1A5FL 3BE1L 4RFOH 5DUBB 1IAKB 4F2MA 2NY2D 1G6RH 4MJ6A 4NJ9H 3REVB 1MJ7L 5EN2B 5IW6B 1V3JA 1NUDA 3IJSA 3EO9L 3RUGA 4U0RC 3KG5A 1Q1JL 1W8NA 5DEGA 3NZHH 2AJZA 5CP3A 3WLBB 4JO3H 1MY5A 1BX2A 1VFAB 3QXAA 4JPWL 3BUTA 3IFPB 1TZGL 1KTDB 5F7YC 5DJ2A 5CZVH 2P42B 3G04B 1OB1A 3ARED 4B7IA 4GAGH 5SWQA 4NNPL 1KCRH 4PJAF 2A2QT 2BOCB 2FECI 3VG0H 3X14A 5FM8A 1ZE3C 5HTSA 4QRPE 1JPFB 4YHNA 2UZIL 2IAMA 1A4KA 3FTGA 4FFZL 4XNYH 4MQXC 5HI3D 5C6PB 3ORJA 3ZKXC 3PQYE 2NYYD 5C08B 1IEHA 1HHKB 2UWEB 3HMWH 1T1YA 3T2OA 5IJVB 1RZ8A 1XIWA 5F7NC 4LLVA 3RVVC 3PV6A 3V5HA 4MSWB 2DQJL 4PLOB 4QRQA 1CIUA 1QO3A 3QH3A 1FCGA 4U1HA 3ROLA 5EUOB 4QCIA 3HE7C 1AI1H 5LG1A 2PXYA 4KZDH 3MLSL 3QJFB 4QNPE 1CL7L 4NQCE 1EUTA 5FKAB 5H8DA 4QRPA 1R3LA 5GRUL 4NQUA 3MLUL 2WWMD 3Q1SL 3SBWA 4XP5H 4HV8A 3H7LA 4NN5C 5IR1A 3PDGA 3RU8L 1KG0A 1M6OB 1Z0MA 4QRRD 1FCCA 4L8SB 5D1ZC 4R3SA 5DK0B 3PQYA 5IMLB 1I1AB 4QXGH 5DRWB 1P7HL 4YK4C 3RNKB 4PJCB 2VWEC 2QSCH 3NZ8A 4R7NA 4OZFA 4HSQA 3DRQA 3DMMB 2DQGH 1FL6B 4KI5D 3O2DL 4CN4A 3RGVD 1HIML 4GXVH 4FTVB 5I66B 5EUKA 4W81A 2FX9H 4JDTL 4ODUB 5KSBA 5B38B 4X9FA 3S35H 1BQLH 5D7LE 2IAMC 4XX1G 1PBYA 3W9EA 5FUOH 5MEND 5LQBH 2YZ1A 4FQ1H 1G7PB 4G7YH 4ONHA 4PUBL 4NQVA 2HRPH 1JV5A 1IE5A 2UWEF 5SWZD 4IRSB 1MI5E 1XIWC 5EFIA 1UENA 1YMMB 1DLHB 2GEEA 3TCXA 4S1SH 4WI5A 4S1RH 4UINH 2R0KH 4TVPL 2PXYC 5JPNB 1V3LA 1XF5A 4HWBA 4HWUA 3NA9H 5EUOF 5CEYB 2E7BA 5J6GB 3LKRB 2AW2A 3QUZC 4JANB 1F5WA 1AE6H 2DD8L 2XZQL 3SBWC 3LQZA 1FL3B 1WIPA 3TIEB 3MRCB 3QAZB 4L9LA 1E4JA 2C9AA 5EC1B 4J6RH 3LPFA 4OFIA 4MDJA 4FFVD 2GJ6D 4PJCF 4M5YL 1MI5A 2NXZB 1OAKH 5GGUB 2UYLA 1KN2H 5DYOA 3SDYL 2I9LB 3NTCL 1AGDB 3HZKA 5F8RC 1RZIA 3I85A 2FJGA 4HCRA 4K7FB 3VFUA 4IBLT 4C56E 3HE6D 4XPBL 1KJ2A 2I60L 3NBNA 4Q6IA 3WFDH 1PLGH 1JGEB 4ZPTB 3WCYA 1BQSA 2CK2A 3O8XB 5FCUL 3W5NA 5FHBL 1ES0B 4LCIL 2GCYB 1NGQH 2ARJB 2HLFC 2N1KA 1TFHA 2D7NA 5ETUA 4LSQL 2R1WB 3U36B 2ZUTA 4F37F 1YEKH 2EXWC 3TYGL 4FG6C 3ULVE 3BFOA 5E6IB 2Z91B 4TUJB 5KJRL 1RUMH 2YR3A 4O9HL 2DLTA 5CBEB 3ILQD 3OKOA 1A9EB 5IBTH 3SKNB 1B4JH 4PIRF 3HAEG 5EU5A 1CDYA 2BVPB 5F6IB 2R4SL 3BEVB 3PP4L 4U1IA 5J3HC 3SJVE 3KLHC 5FB8B 1PDKA 5JOPD 4ZUVB 1AD0B 4KRNA 4P4RA 2P5EB 4R4FH 5BV7L 4HLZG 1Z9SA 4FQJH 2I27N 4C56A 3MO1A 4YBHA 5K9JH 4M48H 3JUYA 1N8ZA 3TN0A 5A3ID 1WFUA 4EUPA 2BSRA 4NHCH 1MAJA 3QNXA 5DD1H 1IGTA 5EPMB 2QQKH 4PRIA 3FN9A 2M2DA 4HULB 4WWKA 4UNUA 4R97B 1NCNA 5DJ0B 3I9GL 2XXMB 1N5AB 3UTOA 3WKMH 4RX4D 5EZOL 3KDMB 3V6BR 2DIJA 3C5SA 1L6ZA 1CR9L 2RFXB 4LSUL 5E24E 1A4JB 4UQ3A 1DBJL 2BDNL 1OAXL 2XWJB 1VKXB 1F3RB 3Q5TA 4RISH 2FECL 2EYTB 4NO3A 1VADA 1ADQH 3RL1B 1NKOA 1XF1A 4Q6IC 2DQTH 4HJ0C 3FT3A 1A7PH 1C08B 4F58H 1UXWB 1R0AH 1F42A 4UV4L 2PW2A 5IHBA 3RRQA 1IZKA 3PWPE 2BNQD 5E6ZA 4A2LA 2D7OA 4OV6F 3PXHA 4XCEB 3QUYB 1REIA 4DAGH 2AV1B 3Q5OA 1H8NA 1T2QL 1SYVB 2X1OA 3INUL 5F6HI 1OQOA 5F89A 2FJHA 2A0LD 3KJ6L 1S3KH 2E9BA 4CN1A 2CIIB 2DQHL 5JORA 4JFEB 3LOWA 3AAZA 4ZUWA 3IDXH 4TRPL 1OT1A 5BS0D 3TN0C 4U7KA 3MRQA 5IB2B 4F33A 5FYLD 2DM3A 2ZKHH 3WDHA 1YEJL 1CICB 5DFWH 3K8KA 4PJEB 4N68A 4EI5B 3LV3B 4BSWA 1QQDB 1YEIH 3EFDH 5I76B 2CKBH 3CX5J 3OAUL 4YDVB 2ZJSH 1EHXA 4M1DH 1IJ9A 4XNZB 5DVMA 4CNIA 3KR3H 2FH6A 4HIEB 3TT1L 2O61B 1MAKA 4AY0A 3CZJA 3NH7L 5MEQA 4JHZA 4WFGE 1YN6B 4HUXB 5FA4B 2XWBA 3KHOA 5DK2B 5JHLH 3QPXL 3TBTB 3G6DL 3CD4A 1U92A 3V52L 5J06A 4UTAL 4UOJA 4ODXB 1YEFL 1CBVH 5JW5A 4UIKL 2BFVH 3ARDC 1CN4A 5F3HB 1LK2A 1RULL 4IIQB 1FAIH 4M1GH 1ZT4B 4V2BA 2Q1EA 5MEPA 4U1LB 3G5YB 3L6FA 5I1HH 1OWWA 4Q2ZA 2AK4D 3JTTA 1LO3H 2XFXB 3FFDA 1JVKA 3QDGB 3VFWA 1OHQA 1NBYB 4K3JH 5FV2A 1U93B 4UILH 3SO3B 4E9LA 2AJYH 3PGCA 3U30B 4YE4H 4EOWL 3LRGA 1R3JB 4LCWB 1IC4H 1J0ZA 1MJJB 3SN6N 4YC2C 1XGTA 4HPYL 5LGKA 5EO1B 5IIEB 2I24N 1W72A 5KSVB 3JVGA 4PRDA 4APQA 5I1AA 3O41B 5KOVC 3BP4B 2V2XB 3MLTA 1MAML 2DLGA 1K5NB 1UWXH 5T1MB 4PJEF 5DJ8A 5DD5H 5IHZB 1I8MA 5E4EB 3AU1A 4YFLI 4PLJC 5B8CB 2CK0H 1ZLUK 3VMNA 1IMHC 3V5KB 4K9EH 3ZSSA 2ICES 1ZA3B 4WENB 1LILA 1XGPA 1NLBL 3A6BL 2B0SH 1RK0B 4FABL 2EEBA 1YPZA 1YQ2A 3DETC 1MFDH 1Z5LB 1SMOA 4KQ4H 5I8KH 1D6EB 1BWWA 2A6DA 2IGFL 5E9DD 1H0DA 1TTGA 3HC3L 3MFFB 1VCAA 5CD3A 4NCC2 3MV01 3WN5A 1GAFH 5DMJB 5E8NB 3A67H 4POYA 1TQBB 1HYSC 2VIRB 2A77L 3DUSB 5K9KA 2D7QA 4JN1H 2QQNL 1H8OA 3MYZA 2HTLD 3QIWA 3QEQA 3DO3A 3O11A 4LLQA 4M3JA 4G7VH 5E2JA 1JGDB 5F7DB 2MQCA 5CEZH 1QZ1A 1OGAA 3UTTA 2X1XR 3O9WD 3D18A 4WEBH 2HFGL 5CGMA 1NGPL 3OL2A 3QZWG 4YAQB 3SGDI 1IM9A 1J5OH 1J05B 3GIZL 1KENL 3CSGA 3JVGC 4JO4L 4APQC 5C0GA 1QBBA 1HSAB 5HI4D 1UWGL 3VXOA 4OFYA 5J6HA 2VL4A 4EVNA 2OI9B 3NGBB 1TITA 2HFEA 5F9WB 5DJAA 1QFWH 3VI4E 3FO0L 4KJPD 5AZ2L 5AZEL 5JOEA 3T77B 4I9WE 2BP3A 5CD5D 2WINB 5C09E 1INDH 2NY4B 2RCSH 3DGGB 5HD8D 4MNQB 3MZTA 1FE8H 5EU6A 4M7KH 5LGJA 1KNOA 2HVKA 4LAQH 2IH1B 3WN5C 5D7JD 3KS0H 1JYXA 5CJOL 4POZD 1QLEH 4MJID 3DSFH 5DDHA 4JRYB 3GSRA 3D3VA 4ODTH 3IVKA 5DQJA 1U8OA 3QA3A 1PKOA 1NDMB 5KVGL 3RWDB 3VJ6B 2YPVL 3P9WB 3RY4A 3GMLB 1ACYL 4OGYL 5T3ZL 1P84J 5I0ZA 4HX1A 1W0YT 4P4KD 1S5HA 1LMKA 2OSLB 3K2UL 3H9SE 1GGCL 1F13A 4KH2A 3VFSA 3MRPB 2EICA 3BEWA 4UB0H 5F3BB 5J11B 1U9KA 4Y16D 5DD3L 3HRPA 3IXTA 1KB9K 3QQ9D 5E8OB 3KLAA 4BH7B 1JTOA 1NGWB 5BRZD 4HXAH 1H3TA 2GYSA 1DFBH 3SDCD 2NY5H 1U8QB 3LAFA 4EN3D 3MRMB 1FGNL 4ZTPL 1IM3A 2XN9D 3BIKA 2A6JB 1EEZA 3VRJA 1S8DB 2H32B 1CDIA 1E4KC 1BLNA 1YNLL 4ODVL 4Z7WA 2PCPA 4E41A 4L4TB 4WTWA 3DSNA 3CK0H 4M9OA 4KROD 1Q9OA 1C8PA 2NY2B 3ALPA 2NTFB 3RJQB 5IFHL 1DUYB 4PGJA 4MQTB 2DBLL 4KJWC 1FN4B 3BVNB 3AS0A 2FIRT 3J8F7 1N0LA 2ZUVA 5J13B 3WXWH 4XPGL 4HXBL 1NCAL 4WY7L 2BVOB 3RWGB 3GUTA 3IFLH 1LDPH 3TCLB 2X2YA 3CFKA 2QHLA 3J7HA 1RPQA 5D5MB 2YXFA 1BBJB 1EAJA 3JWOH 1U95A 2WV3A 1H3UA 3PIQA 1K85A 1FFOA 1KIPA 1EO7A 1IC5L 2RB8A 3BI9X 4WIQA 3TZVC 2QLVB 5KW9L 3HI5H 1RQ5A 1BJ8A 1WAAF 4R2GD 5DQDL 1BZQK 3C6LD 4LHQB 2JB5H 2FATL 5IGXH 3H3PL 5DJ6B 5ISZA 1CD1A 2X44D 1KF9B 4HG4K 2F58L 2PTTB 1TJGL 2WIIB 4XCFL 3QDHA 4TSAL 4X6FA 4OZGB 3LSOB 2Z31A 3HC0B 3B9KD 3HNTH 1ZHBA 3UPCA 1HQRB 4WHYH 3VDBA 4HBCL 3CU1A 1KB5H 5FYKL 3SGEI 3DRTA 1ZS8B 3TH4T 5EBGA 4FZEH 3KPNB 2BRQA 4RMVA 4FHBD 3D0VB 1PZ5A 3DVIA 1UZ8A 1VPOH 2R2CA 4GQ9L 1EAPA 4JFQB 4ODHH 1FG2A 5GS2D 3LQAL 4QRRB 1ZLSH 5D2NB 2X9YA 2VR5A 3MJ7B 3S37X 5F9AC 3MV11 32C2A 1HH6A 5DEFA 4OF0A 2AQ3A 5DMKA 2D31A 5BZDA 5C70A 5L9DH 1KT2A 4Y4KA 4X8JB 5C9JB 1U8HB 2HFFB 4MB5A 4ELKB 4PS4L 3VFOB 3ME0A 1LP9A 3VRIA 3WSQL 4ONFL 3RGVB 2CDEA 4KRPD 4PRPE 5C0BE 5E8EA 2EH7H 5D5MF 3JZ7A 2BCKB 3D39B 1WUNT 5K9OA 5JR1H 4XWOD 3WXVL 1JGVL 1Q0YH 3RWEA 3CPLA 3UEZA 4NNXA 4HUVB 5A16B 5E8PA 4E0RB 4XBGB 1ITBB 2HT3C 4OGAC 5EO0B 1NUGA 4R96A 4PGCA 5INDB 1P7QA 3PP3K 1CG9B 2VN4A 4IHOB 4JFXA 1R6VA 2D4FA 4C4KO 5GXBB 4LASL 1EZVX 4PV9A 3FHQA 4NRXA 3QNYB 5GS0L 1I3GL 1FSKC 2WSKA 2Z31C 1MJ8L 2OTWA 3BMWA 3BX7C 5EA0H 4OZGF 4PRHA 5BVJB 1P7KA 1WEJH 1IKNC 2DJSA 3IDIA 2IANE 3GSWA 4MD5A 5DI8B 4MD0A 1M71B 1QRKA 3QFJD 2AJXL 2VISB 3EO1A 4JY4B 1NAKH 1RZJL 1JNHB 4CDHA 2VERN 2YPLA 3FRPG 4DGIH 4M7JH 1BVKB 1YA5A 1OF2A 3MMEB 3OJDB 5I15H 2N7BA 3O45B 2NTSP 3PDDA 3RVXD 3ULSA 4JZJA 4X80L 4G42A 2HT4C 1QSZA 3T2NL 2GJ6B 4NO0D 2EO1A 4UIMA 4Y4KC 1FVDA 4UI2A 5IP4A 2H2SC 2EEAA 5J0BA 5B3JF 3ARTA 4KHTH 4NDMA 1LE5B 4JDZA 2YWYA 4DJMA 1JYNA 3HE6B 1INEL 3IS0X 2E7LA 4MS8D 4CDGC 1RIVL 3VXUE 4NRZA 5F96H 3GMMB 3G6AB 4C83A 3B2UC 2MCPL 2RQ8A 2HT2C 2MHAA 4ZMAT 1QBLL 2AI0H 2FB4H 1YYML 5F7HA 2AXGA 5KSAB 1N6VA 3VGAC 3TNMB 3OXSB 2HG5B 4JFFE 3MJ9L 2VDLH 4XNQB 1YEGL 3HC4H 4OQTA 3GRWH 2W9EL 3VGHA 3GMOA 4PJ9A 4DGVL 5HYIA 4EIZC 3GI9H 4K71B 5E4IA 3ZYJA 2Z92A 2VSCA 3UJJL 5EG6C 3H0TB 4N0CC 3BP5B 1OTTD 1D5MA 1CWVA 4YO0A 5J1TC 4ZAKC 5I2IA 5ERWB 3NCCB 1QSVA 1R5VB 2UUDH 4HUUB 1PG7W 3DXAB 5I8CA 4KDWA 2Z9TA 5C0EA 4M6OL 1U8PA 2X41A 5ENWB 5TH2B 2MJWA 3QNZB 1UB5A 2B4CL 3QDJA 3OJMB 5CZKA 1AXIB 3P0GB 2JELL 3GMQA 1RMFH 5CBAB 2JTDA 4QWWD 1AR1D 1R5WA 1GPOH 2F53A 3PHQA 2MMXA 4J3SA 1WBYA 5GGVH 5F6HJ 3ILPA 1QSFE 5HYQA 4RBPK 4WO4A 1RZKH 5T1KA 3MRHA 2FL5B 1HILA 1K6QL 4ZPVA 1U3HD 1OAZL 1T1XB 3V7AG 2OL3B 3K74B 1XF3A 4R8WL 1ND0A 4N5EC 3WS6A 5BVPL 2BC4B 2DYPA 1AQKL 1JRHI 1Q72H 1MOEA 1F3DJ 1CT8B 4GMSH 3WBDA 3HZMB 4MD4B 1MCRA 1BD2D 3T3MF 1JNNH 3P11L 3BZFA 5IQ9B 2YWZA 4I18B 4BQ6A 5IT2L 4G8EB 1S5IL 1AY1H 2V9QA 4PJ9C 4XAKD 8FABB 5I6XC 2NZIA 4PTTB 3GSOA 3UDWC 4F3FA 4Y19E 4CU8A 4L29A 2OCFD 3D69B 1K4CB 1QSFA 1ZK9A 1MRCL 3B9EA 1D5XA 2RGSA 1BOYA 2CKBA 3KPRD 1SJHB 1OGTA 3ZTJG 3MLXL 1MRFH 5FO7B 2NY1B 4KGLA 3MX0A 1S7WB 1RU9L 2VOTA 3KWWA 1G7QA 4YBLC 4YHPA 3W0WD 5BS0B 1QBMH 3O6KL 4MA7L 5IWLC 5ANME 5ID0B 2MWCA 1JI1A 3C8HA 5E2VL 4I8DA 4W68A 5ADOH 3C5JA 2NY7H 2YPKA 5SX4H 3EYVA 1G7LA 5L0QC 4GS7B 3ZE1F 3EGSA 3VFTA 1UQSB 4JB9H 3R1GH 1DDHA 3MJ6A 3NOIA 1T89A 4ONOA 1QD0A 2WWKO 4RIRB 4PP2A 5CCKL 5I8OL 2DKSA 2DMKA 3QO1B 3FQNA 3SGJA 4MAUL 4CVZA 2FGZA 4MZ3A 4KKLC 4F57L 1M7IB 3WS6C 3V4PL 3VGBA 2BNUA 1CK0H 2EE9A 1MEXL 1QNZH 2DS4A 1NCWH 4WU7B 4NYLB 3UYPA 4K2UH 3I02A 5ANMA 3ARFC 2CLRA 2DJ4A 4XVTH 5AD0A 4RGMB 1X5HA 4AMKL 1J86A 4N0YH 4K3HA 3T1FB 1KACB 3JWDL 3RVVD 3SOBL 3RZCD 2AK4B 4YR6A 5ID1A 3V79C 3IJHB 3FAXA 3LEXA 4NZRL 1X9QA 1KLFA 1QPXA 4YGVB 3QQNA 1P1ZA 4MXVF 2ITCB 4KHXH 3MNWA 5DVKA 1QLFA 1GXEA 5CEZE 4M5ZH 4XVSL 2D4DA 4KAQH 4XPHH 4LLUA 4TOYH 5GRXG 1UC6A 3STZA 1YQVL 4NZTL 1QSEE 1ACZA 2M26A 1XCQB 4QEGA 5EZLB 1G7HB 4KDVA 3T8XB 1CIDA 2XA3A 3RNQB 1KC5H 1QR1B 2E9WA 1B6DA 1KJVA 1E6OL 3HI1A 1T66C 1V5JA 1HCVA 2C3HA 1LEKB 1MIMH 2R0ZH 3OHXB 2O5YL 5E7BA 3SGJC 1FL5B 1SQ2N 4PB9H 4U4BA 3MA7A 4MHHG 1ZAGA 1C5BL 4M6MH 4D0BB 5HPOA 3CVHB 2MTPA 3QDME 1NL0L 2KH2B 3PWLA 4F9PA 1DLFL 4RZCA 4EKXA 1CDUA 3L5XH 5FYJD 3WHXA 4BUGA 1PQZA 3QXDA 4RFNC 3LEVH 5C0IA 2OK0H 5HHNB 1MCOL 5EU4A 5IOPA 3E8UH 3VGGA 1XIWD 2O5ZL 3NFNB 1F4AA 1JZ6A 1A1NB 3IFOA 3QXUA 1JZ3A 1HKFA 4KPHH 3QZWB 5EIVA 4LNRA 3OKKA 2DI9A 2VQUA 1DBAL 3FT4B 4MMXC 3QUXA 3SKJL 1I3RB 4OJFH 2UY6A 3BGFB 3O9WB 1E27A 4K9EC 4AM0A 1SEBB 4U2YA 5HI5C 4X4ME 3TPUB 3I6KB 12E8H 3QDMA 4MX7B 2J12B 3OAZK 2FBJL 2VXQL 3VRLF 2CUHA 1PVHA 5MEOA 1P2CB 4PJFA 4OD1H 4M43H 3JTSA 3CFDA 3IKCA 5JOFA 4WW2A 1KCUH 4NQEA 4G9FE 4RMQA 4XP1H 3OZ9H 4D0CA 5IVXB 3MRFB 5DQ9A 1MUJB 4NHUA 5FOJA 2ORBL 1ULVA 4WGVB 5D6CA 5ADPH 5L8KB 5D7KD 3S34L 4L5FH 4K8RL 4G9DA 4PD4K 3MBXH 5GPRA 3CXHK 1D5ZA 1OARH 4NGHH 1JRHL 1RZGB 4LCCA 1CDBA 2YD5A 2IALB 3ZE2F 4OZFG 3KPOA 5I1KH 5FKPA 2GK0B 4X4MA 2VABA 3NFSH 2HLFD 2EYSA 5D7JB 4PJAA 3P77A 5DD0L 1BQHA 5ILTH 1MVUB 4M61A 4MJIB 1L9MA 4EDXB 3ARYA 1TVBA 4OLYL 4QXUH 4LP4A 3I6GB 3MOAL 3V2AR 3PGFL 1Q0XH 1ZANH 4R0LB 4KTEL 5J3HD 3KLHD 4X99A 4GW4A 3DYPA 5IEHA 3UTSA 3MV9A 4P4KB 3QUXC 3LS5H 4F80A 1FPTL 3CDYA 3STLA 3TV3L 4Y16B 3RA7H 4X4ZA 1I8LC 2AJSL 4QXWA 4X5WA 2EDQA 4JAMB 3MREB 3Q6FB 1VACA 4LBEA 1ONQA 1JN6B 3VXTA 1SJVA 2ATPB 2B1AH 1NBZB 5DRXB 5KVDH 5BRZB 1T1ZA 1ED3B 2R69H 4WW2C 4YXLH 3RAJH 4H0GA 4HIIB 3GBMH 5IVXF 4FQXB 3HUJB 3RWFB 2VO5A 1WF5A 4LMQE 4MA8H 4W6YB 1QVOA 3SPVB 3DTXB 1MREL 3WLBA 1OP5H 5J12B 2YEZA 1X4ZA 4LCCC 1FNGB 1HI6B 4KKCC 4HJ0D 1SJXA 5H35A 4YNYB 1OPGH 2DQFB 2F19L 3MACH 2AEIT 1CS6A 4LVEA 3E1F1 3MUHL 4HGMA 5ALBH 2YOCA 4YXKH 1T0MA 1KTDA 1A2YB 5JDSB 2IC2A 4JZNB 4P2QE 3CFBA 5D1QB 3WFCL 3V6FB 2KPNA 5I9QB 3DUUB 1XF2B 2WANA 3U46B 4YPGB 1C12A 4U1NA 1Q9KA 3MRRB 4GRWH 3JV0A 4P23B 4JREC 1I1RA 1XF4A 5F9OL 2NNAB 4JQXA 3QHZL 5EO9B 4W6WB 1IKFL 2FJFA 3SQOH 1JGLL 3D25A 4LNVA 5FECB 2VE6A 1DBMH 1KSRA 4JN2B 2WLYA 5T3XD 4NWTL 1UZ6E 1NGYA 4G6AD 1AC6A 1JYWA 1UADC 3EYSL 5IJVA 3I3EA 4Y89A 1ZA6A 4ZG1A 4PG9B 1MLCA 2AJVH 2ZOLA 4PRID 1GJIA 5TQ0H 4P2QA 4WWKD 2ZCHL 3I2CH 4OM1H 3U79A 4LOUD 5B21A 4MJ5A 2KZWA 4Y5YA 5I1EL 3ESUF 3OQ3B 4PJHE 1MWAB 5GHWL 4EUPG 4Q9QH 1T0NA 1WC7A 4CMMA 3P9LA 3VXQB 2FX8L 3ARUA 1M6OA 3HUJF 1DN0A 5DK0A 4PB0H 3B9KB 1WJ3A 1UCBH 2WIMA 1JP5A 3MRDA 3NPSC 3TO2A 1JGUH 2AK1L 3GSQB 4K7PX 3V4UL 4OCYL 1EH9A 1M7XA 3ZT5A 3ZKND 5F21B 3FT2B 5AYQA 5D2LE 1BMGA 4XMPH 1Q9WA 4U2ZA 4UDTA 3UBXI 4YDIL 1X6LA 2YC1B 4XRCB 4ZDHA 2IBZX 5DJXA 4C57C 5IFAL 1CF8L 2LAGB 1EXUA 3S37H 5TPWL 3HZVB 3MXVH 5A2IH 4ZQKA 2C3GA 1OTSD 4JY6A 1PJ9A 2OR9L 4JQXC 4Y5XB 3P3YA 2LV4A 3N50A 2P46B 4HMDA 4LLAA 4JFHE 4J3XA 4WDIA 5L6YH 2OJZL 2ZG1A 4ZO6A 4MAYA 4BH8A 2YXMA 5FO9B 3KYKL 4GKZA 4XVJH 3P4OA 3RX8A 3F7VB 4QTIH 5BO1L 3WFZA 4L8BB 5FIEA 1A8JH 4LCYB 3WL9B 4EDWL 3M07A 3QRGH 4P5TA 4LSSH 4X9IA 3VCLB 4MNHA 1H15A 1F02I 4M3KB 2R15A 4JANA 3MV8E 4BK4A 1XFPA 2JCCE 1V7ML 1TIUA 5GGVY 4GLRI 1EPFA 3MRJA 3HLAA 1GZQA 1FORL 3FQXB 3RDTA 4FQCH 5LCVH 2E6JA 5JLZA 3FL7A 3V6ZB 1NAMB 3SE9L 4LEXH 2VYRE 5IFJB 3DETD 3QFJB 3BD3A 2L4OA 5GGUA 1F8TH 5MP6H 1MFEH 3DV6B 5DURD 2I9LA 3LPWA 2Q3AA 2W60B 1DL7L 2APVA 3F62A 3M17A 1HYSD 1DEEB 3S4SA 5JXEA 4M93C 4S2SB 2CMRH 4NO0B 2EZ0D 5J1SC 5HVHB 3MV8A 2YBRA 5DUPL 1RK1A 5JW4N 1ZVHA 5HGGS 4KZEH 5HHPA 2ZSVB 2G2RB 4KDTC 2VXSL 4ZSOE 5F9JA 4MAYC 3R06A 3K46A 5LVEA 4N9GA 1DN2A 2R1WA 2OZ4A 3TO4A 3RFZC 2A6KB 4JPKH 4KUZH 4MA1C 2F54E 1ZHLA 1MFAH 3FB8A 2JJSA 3MR9B 2KUTA 1A9EA 3EOAA 1LO2L 1N3NA 1NJ9A 2BVPA 5KZCD 2Q8BH 2V2WB 2CJUL 3CXDH 4GRLA 5GGSB 4R4BA 1N0XH 3CU7A 3D85B 4G3YL 3EYUH 4XCCL 4P5TC 1SBSL 1AXSA 5HHVH 4FQPA 1S9VB 2V6HA 1TETH 4YXHL 4X7TA 2AXFB 2JF1A 3QO0B 4ZFZA 2G75B 5D8JL 5I73B 3IXAA 1CFSA 3EOTH 3CMGA 2R0LL 4MCYB 4JZOB 3OSKA 3VXMD 1UJ3A 3RDTC 4Q9CA 4F7EB 3GJFH 4JPVL 2N4IA 3U1SH 5TDOB 3N1FC 5LWYL 4ZFOA 3BIBX 2F54A 2AQ2A 1WBZA 1TQCC 4HC1H 3WO3B 3MXWL 1NDGB 1YNKL 1GZPA 4PJGA 3DX9B 3F12B 1A4JA 4RMSA 1BBDH 1M05B 4AT6B 4KY1H 2ITDA 2ZUWA 3B9AA 3V7MA 3EUUA 4LARL 1EIBA 5IMKA 5JXEC 3NFPB 3P40A 4LDOB 3O6FA 3QIWD 4AEIH 5EC2B 3QEQD 1CZ8L 1ETZA 3MTRA 5D6DA 5D7IB 4Q9RH 4D3CH 1FFPA 1OGAD 1UWEL 3ZMRA 4DN4H 1KN4H 3WKNA 4DVRH 2VXVL 1NCCH 3UTTD 1U3HB 3W82A 2R8SH 4YDJA 3CNKA 1DQLH 4O4YH 2DQJH 2EH8L 4WI8A 3DLQR 4Z78A 5IHUL 1WZLA 3L3KB 1MHCB 1IM9D 3BD4A 3MBEC 3QCVH 2W1NA 4PTUB 43C9B 5ALCL 1I1FB 5D4QA 4YDKH 1GGBH 1OD7A 4RQQB 3BPOC 4JO1H 1BD2B 1GIGL 1JF5A 3RVTC 2HLAB 5I19H 2CIIA 4XNMA 4OFYD 1XR8A 3P9MA 2EDKA 2APTA 2OP4L 2P8MA 5J7CC 4PJBE 5DEZA 1BJ1J 1LNUB 3VD3A 4HKXB 2OTUB 2CIKA 3BPNC 5I74C 4U6VH 1QFOA 3V6OE 3FQRB 2WUCH 4M6NL 1UJ3C 2ZUUA 2JIXA 1CU4L 4JLRA 5GS1C 1XH3B 3KPRB 2F9BT 5SV4A 3ROOA 4ENEC 1AQDB 5I76A 3X17A 1OP3K 4F15B 5EU6D 4FZ8L 1I8KA 3W11D 3BUYA 4D2NA 3X3FL 1QTYT 3W0WB 2FR4B 1RZKC 3BGMB 2F8XC 4JO2L 5E8DH 3WS3A 4HUXA 4X7SL 1DUZB 4U0RB 4WFFD 4QHKI 3D3VD 1AJ7H 4GG8B 5CMAA 4FXKB 3G5XA 1V8HA 3O6FC 4U6XB 4YHLL 1IGYB 5A1AA 5SV3A 5EOTB 1MWAL 5D6DC 4PJBA 5C0FA 3BZEB 5DA0B 4Z7OE 4ERSL 3OKLB 1KPVB 3PL6A 2DICA 5D7IF 2C4FU 2IQAA 1CVRA 1BREA 5IBLC 3G5YA 4P2OD 4PJDA 3EJZD 5T1DH 1T5XA 1TZHB 3P2TA 3BESR 1HKLL 2C1OB 2VDQH 4GUPA 5F9DC 4DWHA 4KXZH 4KVNL 2DLFH 4IRZH 1J1XL 2XY1A 3DJ9A 5TFSL 1NBYA 2C4FT 5EBWA 5TGBB 5DJDA 3ZKXB 3GB7B 3WDJA 3VXSA 1A47A 1A6ZB 3IU4H 1NANI 1MPAH 4LCWA 4K3GA 4WW1B 3RZCB 4RWYH 4XP9L 2X4NB 4ZYKA 2VQTA 1GC1L 4Z95H 4XBPA 4PGBB 3G6JA 4FFWD 3QI9A 3HE7B 1U36A 2FRGP 2A38A 3LKSA 4HIJB 5DF0A 4RNRA 1D6VL 3CLFL 4E41D 1S7RB 5HDOA 3BKCL 5CSZB 3AMKA 4F2MB 2ZCKL 2GW5A 4O5LL 3SDYH 3L5JA 4MJ6B 5C86A 2QJDA 1WWBX 4NN5B 3IJSB 4QHNB 5D1ZB 3QXTA 3RUGB 3B83A 5DEGB 4KGJA 2DI7A 1X5LA 2AJZB 3V9FA 2O5XL 4YK4B 4DGYL 3ZT6A 1DEDA 1BX2B 2FZ3A 3TM6A 5FGRA 4HGWA 3QXAB 4KMTH 1Z0NA 4GSDL 5CWSA 2X4PA 1U8KA 3FB7A 4LSQH 5BZWA 5HHXH 2JKXA 1UVQA 4I2XE 3MRGA 3PL6C 4Q58C 5DJ2B 4MCZA 4G8FA 3TYGH 1OB1B 5E99H 2VXUL 3DUSA 5SWQB 3QCUL 4J7RA 2HH0L 3X14B 3WEXA 4HPOH 1OM3L 4YHNB 2IAMB 1A4KB 1CE1L 3FTGB 5DHVA 4X0KB 2YN3A 4HKJA 2WBKA 1IBGH 1KUMA 5DSCA 4K94L 2VQ1A 4OGAD 5ISZD 5I1JH 1DQQA 3WMSA 1ZSDA 1T1YB 4URTB 1RZ8B 4BKLA 4J1UA 1XIWB 2QBWA 4LLVB 3TJEL 3PV6B 2IADA 3V5HB 2XT1B 3ZL4L 3LCYA 3LQAC 4HJJL 1JUFA 4QRQB 4I77L 4U1HB 1QO3B 3QH3B 3BXNA 4EXPX 1PG7X 3E3QE 3MQIA 3ROLB 4MHHI 2AEQL 1CFNA 3QI9C 4I2XA 4QCIB 5TF1H 1NMBL 2PXYB 1JHKL 3FB6A 1DQMH 5GIRA 1VFMA 1JIBA 4BQ9A 1RIUL 2GI7A 4Q9BA 3LEYL 3HG1E 3K8MA 4M6AA 4L4VD 5DVNA 3QUZB 3SE3C 3FO1A 4R26L 4QRPB 5L2KA 1R3LB 3FRUA 4HV8B 5IR1B 1EJ6A 1KG0B 1KGCD 2DLHA 4R3SB 4LF3A 3PQYB 4RMWA 1UM5L 3RUGF 5H2BA 3QIBA 1HHHA 4HF5H 4K3DH 4RAVA 3NZ8B 1HHIA 3O4LE 4P9MH 4R7NB 4OZFB 3BH8A 3DRQB 3MGOA 4PRBA 1CVSC 1CGSH 3WD5H 2DTMH 3GSNL 5EUKB 2DQEH 2ZUQC 3HB3D 4JRYA 1OSPL 5DT1L 4XPAH 5B22A 5KSBB 2ZOKA 3F8UB 5C3TA 4BFBD 1NDMA 3B2UD 2HT2D 3INUH 1FNHA 2EECA 1NC2A 3W9EB 1DBKL 1I3UA 1EBPA 2VDKL 4ONHB 1U91A 5GRVL 3FHAA 4NQVB 4JFZH 1JV5B 3RI5F 1VERA 2DL9A 1WAAA 2I07A 5KVFL 2IFFH 5EFIB 15C8L 1RZJC 4UV7L 1F6AA 1L7IH 2VR4A 5GZOC 3O4LA 4RMRA 4A6YB 3Q3GA 1F58H 3O3DA 1HHJA 1WLHA 1INQA 2Q7NA 1T7ZA 4PRHD 4GRWE 4OIIH 1UKTA 2Z0BA 1XF5B 5HHME 1SY6L 3U0WL 4WUUD 5C0DA 1JNLL 4P9HH 2V7HA 1AIFA 2YPLD 1BZ7A 3LQZB 3TA3A 2NY3C 4HK0A 3QIBC 4MDJB 5DA4A 2FX7L 3NMEA 4UIKH 1MI5B 4WI9A 5TE7H 2UYLB 2ESVA 5DYOB 1J12A 4C55A 3H6JA 4YH6A 4O00A 3E3QC 3HZKB 4D9RE 3HI6L 3L3HA 1RZIB 3CDFA 2FJGB 3VFUB 4MA3A 4QLRA 1JF1A 1KJ2B 1SEQL 3JBG7 4Q6IB 3PWVA 3RIFK 4HS6A 1AP2A 5KSBF 1CGVA 4KC3B 3BT2L 1C16A 4X5XA 3NACL 1CE6A 1MIEL 4RCAA 5D5MA 3AS3A 5JIHA 4YX2H 3JWNC 1F4YL 1I7TA 1O7VA 1F4XH 4LGPB 4NM8L 5KVEH 5I0DA 3O2WL 4IEFB 2H45A 1EZVY 3OKOB 3OKNA 2BVEA 4QT5A 5EU5B 1H8SA 1RIHL 3BKYL 4P5MA 2YUWA 3BHBA 1G0XA 4U1IB 4YUEL 2B4CC 3ISWA 5JHDE 1PEZA 2XA8L 1TMCB 2AGJH 4JRXD 4P4RB 2DB8A 3QIUA 1AGFA 3IFNH 4OAWA 3F58L 4C56B 3MO1B 4B5EA 2RJMA 3T4YA 3SGKC 1N8ZB 3TN0B 5DR5L 4EUPB 2BSRB 2NXYD 4LPUA 5HDQL 3QNXB 1QUNA 1IGTB 2N56A 1Z9LA 4PRIB 5ITBL 4WWKB 4HQQH 3QDJD 4Y5VA 2H6PA 1T3FA 1VGKA 3C5SB 1ZT1A 2F53D 1FV1A 3FQUA 1SMAA 2HTKD 2VL5A 3TT3L 3CDCA 4UQ3B 3MROA 4WO4D 4FNLL 5T1KD 3SJVB 4D8PA 4OT1H 5A2LH 5C2BL 5JHDA 4JE4B 5C07E 4NO3B 1FNFA 1VADB 4K7PH 1BF8A 3EDFA 3FT3B 3S96A 4XAWL 4WFHE 1OW0A 5IM7B 4LK4A 2GSGA 4ZXBA 4F7PA 2Q86A 3UJTL 2P8PA 3ULUD 2NMSA 3KYOA 2LABA 3UTZA 3UTPD 3MUGA 4Y2OA 5DUMH 2BCKA 3GMRA 3T0XA 4MXQC 3NPZB 2R39A 4PJ7E 3OWEA 3GIZH 5C0AD 3OKYA 3U9PH 6FABL 3GHEL 4OZHE 4PJ8A 3AUVA 4KK6D 4YHYC 3FO2A 2QEJA 3BO8A 1QSFD 5F89B 2FJHB 3FO9A 4ORGA 3HA0A 4KJQC 5J4MA 4B0MM 1U8NA 3QG7H 3SKUD 1A1OA 5C07A 2Q76A 1A7QH 5JORB 1JWMA 1PX3A 3AAZB 4ZUWB 4G8GA 4JY5H 4YC2B 1AXTL 3RVWD 4NKMA 3HMXL 3MRQB 4F33B 5D1XA 1P4IL 1V3KA 2DTSA 5CJXA 5L7XL 1I9IH 1L7TH 3MC0A 4WGWB 4OSUL 1IAII 3PHOB 4BSWB 4QOKE 1KXQE 3LN5B 1NSNL 4CNIB 4PJ7A 1S9WA 3T0AA 5EWIL 5MEQB 1PG7L 4N8CL 1ROWA 3K4AA 4M8VA 3ALWA 1U92B 2DQIL 4DKFL 4HS8H 4M9PA 1KB9J 1OW0C 4QY8A 2VDNH 2ARWA 5FUZL 3GO1L 4WI6A 3UROR 3SE8L 1WBXA 3AXLA 4TPRH 5JW5B 5DURB 4CVXB 3OKDA 1GGCH 3T0DA 2Y07H 1LK2B 4Z0BH 2MPAH 1LK3L 2WNGA 4NO5A 5MEPB 4YZFE 1KEML 1F3DH 4QOKA 3L6FB 1IGFH 2X89A 2W0FA 4CBPA 3JTTB 4CADA 4KKNA 4PJ8C 2NY6C 3FFDB 4Z18A 35C8L 5C0RH 5C0ND 1OCWH 1K4DA 3VFWB 2IG2L 3TNMA 3U7AA 3KPSE 3B5GA 5CAYB 4EI6A 3PGCB 3MLPA 5C0CD 1PSKH 4HFUH 3VD5A 1I8IA 4NJAL 5HI5D 4X6DE 1DVFC 1K2DB 1M1SA 1XGTB 1EO5A 1KJ3L 5D1XC 1KOAA 5KZCB 1QYGL 1W72B 4PRDB 5CJXC 5IVOA 1Q38A 5LXGL 2X5PA 4APQB 5I1AB 2XPGA 3BP5A 1P6FA 3MLTB 1S78C 1D7FA 4YHML 4JQVA 1NPUA 5DJ8B 1I8MB 1DQDH 2J6EL 3OB0K 3AU1B 1UM4H 1X7QA 2YKLL 1GCFA 4PGEA 4A6YL 1XGPB 3BRGC 3V4VH 2F15A 3KPSA 1XMWA 1YPZB 2FGWH 1MFCL 2XQBL 3BAEL 4FQ2L 2HKFH 3LQMA 2A6DB 1H0DB 4G6JL 4PJIA 5CD3B 4TVPD 4H88H 2Y36H 3WN5B 2PYEA 4PY8I 1NC4B 3DVNA 4Y2DA 5HHOA 4QRSA 1VGEH 5K9KB 3ARWA 4WWID 3M1BA 2B39A 1RJLA 1IAIM 4M7LL 4EIGB 3EHBC 4XH2A 3QIWB 3QEQB 3O11B 4LLQB 3MNVA 4L3EE 3FFCA 1A6AA 1KEGL 3RY6C 2VITA 3TBSA 4PJ5E 1QACA 1OGAB 3DURB 4JG0H 3UTTB 4JG1H 5L88L 3D18B 4HCRL 1D5IL 1TTFA 4AEHL 1KJ2L 4E5XA 3HFML 3MUY1 1IAMA 1UKQA 3QDMD 2H1PH 1IM9B 2WAHA 4DK6A 4PLNC 4FP8L 3IETA 1A64A 2AABL 5C0GB 3MCLH 3MA9L 1FLTX 1KCSH 5FYKH 1ZGLA 4NQED 4KVCH 2Y6SC 1SJHA 4RGNE 4AL8H 3VXOB 5J6HB 4ZTOL 2HFTA 1UM6H 2HFEB 5DJAB 5KANI 1S7QA 3VXRD 3W2DH 2EXYD 3N85L 4L3EA 4KJYA 2CLZA 2HKHL 5HSFA 5D93C 1RJZA 2C4XA 3MLZL 4PJ5A 3VH8A 2DQUL 4XMKH 1DBBH 2P8LA 1JZ8A 2J8OA 5EU6B 3T2PA 5LGJB 4G8IA 1YPZF 1RUQH 1KNOB 1F6LL 1IFHL 2HVKB 3ZDXE 2HVJA 3P0VH 3D2UA 1ZT7A 3WUZA 4P59L 3DROA 4JEGB 4NO2A 3PP3H 3LRHA 4HHAA 5DDHB 3ZKSD 4Y2DC 1Z3GL 5I1LA 3GSRB 3D3VB 3IVKB 4X6CE 2QQLL 5K93A 1RFDL 2X7LA 5DQJB 3ZDYE 3ULVL 3SKMA 1U8OB 3QA3B 4JFDE 3S98A 4N0FA 5IUSA 5B4MC 5C0JA 1BQHG 3GI8L 2XRAL 1NMCC 5SWSE 4WFEE 3RKDD 3UTSD 3MV9D 1AO7E 4JJ5A 4HX1B 1S5HB 2Y25A 4OLVL 3I3BA 1SVZA 1YDPA 3VFSB 3BEWB 4QHUA 3EJJX 3DBXA 5AYUL 3IXTB 1NCDL 1NMAL 4U05A 3KLAB 1IAIL 4Q6YA 3NCYS 3SDDD 4GKOA 3ARVA 4LIQH 3QYCA 3U7YH 3WJJC 2BY2A 1MCQA 4QXTA 1IM3B 4JFDA 3PE9A 3BIKB 4W6XB 1EEZB 3H3KA 3VRJB 1MF2L 5SWSA 3UAJD 3I75A 1BLNB 1AO7A 1DQTA 4UT6L 4Z7WB 3DX7A 4AJ0A 2PCPB 5T5FH 3RNQA 2FD6L 3HNSH 1RSFA 4XT1C 3VFNA 3D87B 4C58B 1Q9OB 3PWUA 2VNCA 1WCQA 1GGIH 5DWUH 5FOBA 4YFDB 4L8DA 2VUOA 4I48A 1C1EH 1MHHB 1ZVYA 3NCMA 1N4XL 5AAWA 1HWHB 1FL5A 2AERT 2F5AL 4WI4A 3BSZH 4BZ2L 5CJ8A 4R4NC 4RGNC 4XI5C 2OQJA 3RIAF 1Y18A 2ZPKH 5FDYA 3GUTB 2HMIC 3VI4F 5DHYA 3CFKB 4OM0H 1YEHH 3MLWL 1U95B 4BZ1L 4NKIL 1TCRA 3PIQB 1A7NH 1FFOB 1A1NA 1K9TA 4H26A 5TQ2H 5E1AA 2NZ9C 4CJ1A 1BJMA 1BVLA 4YFEA 1CD1B 3NCEB 5F7WC 1VEMA 3DV4A 1R3IL 5EOQH 4PBWD 3QHTC 2UVEA 3O81A 4MX7A 4XNXH 4X6FB 4WHYG 1LEIA 1FSKB 2B1HL 2Z31B 4J12A 4KI1A 1I1AD 3BKJH 1ZHBB 4ODBD 4TULH 2VH5L 4OD2A 3MRFA 4FQIL 3DRTB 4Z7WF 3U4BH 4O2FA 1J1OL 4D9QE 5GSVA 5C08E 1IGMH 3NAAL 3DMMD 1P5UA 1PZ5B 1MCPH 2UWEE 1TJIH 4GMTL 1UZ8B 2P24A 1EAPB 1FG2B 4FTVD 2YD2A 1W72L 1UYWL 3PJSA 1TNMA 3FQWA 4DOHE 1AQKH 2GUOA 5HYJE 1GGTA 4DQOL 2A9NL 4CKVX 32C2B 1HH6B 3L7EA 5DEFB 2D31B 5BZDB 2D03L 2YSSA 5GGQH 1KT2B 4Y4KB 3MV7E 3P11H 1FIGH 3MOBH 5T33H 1LP9B 3VRIB 4NN7C 2CDEB 3VXNA 1I1YA 1YECH 1CTOA 4XBEH 4LQFL 2XTLA 5HDLA 1J0KA 3GHBH 4OGZA 5K9OB 1UACL 4NQDA 1N5YL 3RWEB 3CPLB 4NNXB 3WLWC 1CDHA 3WNMA 1TTUA 3VGAB 3QB7C 5E8PB 4FMKA 1U8IA 2Z4QA 1YEEH 3LHPH 4R96B 1P7QB 3LRSA 1CXKA 4P5TD 2L7JA 3ZDZF 3GDBA 3HNVH 4JFXB 5HYJA 5K9QI 1URLA 2B8OT 1LO4L 4N0UE 2LU7A 4NRXB 1CLOH 2FO4B 3MV7A 2NCMA 3CVIL 1E6JH 5DFVD 4UT7L 3RDTD 4GAJH 4PRHB 4H8WH 4G6KH 1P7KB 1WZ1L 3LS4L 3S3JA 3CLEH 3IDIB 4J23A 1SHMA 4DTGH 4K7PY 5FK9A 4H20L 3GSWB 4MD5B 4MD0B 1JHLL 43CAA 3EO1B 4X7CC 3RWFA 1F45A 1BAFL 2DIAA 2IBZY 2YPLB 4X9HA 1OF2B 1RD6A 3W9DA 2IWGA 5CEXA 3ULSB 4G42B 1A9BB 2OM5A 5F8QC 3O8XD 4DN3H 4U1SA 3FQTA 4M1CC 1PD6A 4UIMB 5BMFH 4OF8A 1FVDB 4JZNA 4NT6A 4N0UA 4AMKH 1N64H 1P53A 4HD9A 3S4SG 5ESQA 5FM4A 1LP9F 4HEPG 3TO4D 4NDMB 2CGRH 5F1NA 5BCAA 4JDZB 4TQEH 3EYFA 1UGNA 5GJTH 3D9AL 4C83B 4XPFH 1FNAA 2AXGB 1RZFL 4GRLD 2JK5A 3RVTD 4OLUL 1KULA 4JHWL 3DX8B 3C60A 1IC7L 3UBXA 3MYJB 3GMOB 4PJ9B 5I6XB 2HJFA 4ZD3H 5E94A 3S9DB 2VLJE 2ICWB 2EDYA 2Z92B 1MRDL 1J9CT 2QL1A 1ZTXL 3MLYL 1D5MB 2B2XH 1RVFH 4YO0B 4LSTH 5I2IB 3UXFA 2VB5A 1FNSL 3UZQA 5I8CB 4YBLB 1SM3L 1A1MA 5DMIH 5T3ZD 5C0EB 3NVQA 1T5WA 2DDQH 1U8PB 4KWUA 2F8OA 1BM3L 1RUPL 5I1CL 1JFQH 2OTPA 1UB5B 3GSQA 4NP4H 3GMQB 4RFOL 3O6FD 3QXWA 5L0QB 4YEEA 5DGQA 1G6RL 3C9NA 1R5WB 4NJ9L 2F53B 3PHQB 2P5EE 1OTUD 4D0DA 1WBYB 5AG9A 1N6UA 3FB5A 2YA1A 3ILPB 2G60H 3EO0A 5HYQB 2VLJA 4OUOA 1CQKA 5T1KB 3MRHB 3NZHL 1I7ZA 5DO2C 1HILB 3H42H 4ZPVB 2ICWI 4JO3L 4XB8A 1XF3B 2P5WE 5GISH 4TTDC 1ND0B 4N90D 4YWGH 2C1PA 2IBGA 2DYPB 1FDLH 4NQSA 3ZTNH 3RHWK 4NKOA 3C2SA 5CZVL 2X05A 4LPCA 4IRSC 4GAGL 3BZFB 4U3HA 3PWJA 1KCRL 4OCRH 4RRPA 3VG0L 3TEUA 3C60C 5GSRA 3F7VA 4IRJA 1I1CA 2NR6C 1HXMA 4XNYL 2E9IA 3GSOB 3H9HA 1CICD 3HAEH 4F3FB 2WW8A 1N59A 2R2HA 1G0YR 2DWEA 4L29B 3TFKD 2AJUH 2Y23A 3EJYC 1QSFB 2JIXD 4PP1C 4BSVB 1D5XB 2KQMA 2CKBB 3BYYA 3HMWL 4H5SA 3Q0HA 4HLZH 2P5WA 3FZUD 4Y4HA 1A0QH 5KOMC 3JV6A 3KWWB 1G7QB 3SCMA 4YHPB 4ETYA 5BOZG 1AI1L 2J1KA 3KYMA 5FUCE 4KZDL 3LZFH 4QYOA 5CGTA 1LQSR 3JV4B 3Q2CA 1J1PH 1G9MH 3C5JB 1G7LB 2XZZA 4J4PA 3OV6A 1B90A 4R9HA 3EGSB 3VFTB 2ADIA 3DV6A 1DDHB 4XP5L 2GT9B 5CFHA 1IQWH 3PL6D 1C7TA 4JFEE 3H9YA 4PP2B 3LMJH 3HRZA 4PV8A 4QXGL 1GHFH 3FQNB 3DO7A 4FQLH 4CVZB 3R8BB 5FEBA 2D3VA 2QSCL 4NOBA 2DBJA 3RTQA 2BNUB 3A6CH 5FF6A 4DEPC 5CGYC 2DQGL 1E4XH 4HS3A 3BN9D 2G2RA 4GXVL 2NW3A 2GTWA 4MWFA 2FX9L 3I02B 5ANMB 2OL3H 5AD0B 3VXSD 3IB4A 1NUNB 4ZFFA 3ULUF 3S35L 3AFLA 4LCWD 1OP5K 1BQLL 4OFVA 5F6IC 1FH5H 4YR6B 1R3KA 1AGEA 2PO6C 3P0YH 5ID1B 1CFVH 5FUOL 5LQBL 1DP0A 1MNUH 3LEXB 5E2TH 4RMTA 3WHE1 1U3JA 4FQ1L 1P1ZB 4PRNA 1BIIA 3UYRL 5EIQA 3FOMA 2HRPL 2VXTH 1BJ1H 5KTEH 2OJEA 1GSMA 5KG9A 5F71A 5DJCA 1UXSA 4L3AA 3MNWB 3QO0A 1QLFB 4HWZA 2G75A 4HMEA 4Y4HC 3WE6B 4PYGA 4OLWH 4V1DA 4LKCA 3SCMC 4R97C 4LLUB 4S1SL 3L3JB 5BOPA 4S1RL 3GSNA 3FMGH 4P46A 4UINL 2R0KL 3STZB 4X98A 2PR4H 1HSBA 5DD6A 3NA9L 3OAYH 1W0WA 3FN3A 3QDGE 4TNVK 2R2EA 2V5RA 4BFEA 4ZS7H 1U2HA 3B4NA 1IC1A 3GBLA 1AE6L 1KJVB 4NFDA 5FYLH 2E7HA 3HI1B 2ADGA 3QCTH 4RA0C 4Z6AT 4H1LA 1V05A 1FZKA 2VZOA 1TCMA 2VLME 4J6RL 2V2TA 1N7ML 1T1WA 1CGXA 1F11A 3F7YA 2VAJA 1OAKL 5GS0D 3UP1A 1KN2L 4CVWA 3PWLB 1QRNE 4LLDA 2VTFA 4TSBH 2XZCH 4RZCB 1JWUA 3GBNH 3T08A 3WHXB 1PQZB 5FUCC 3QXDB 1SY6A 5C0IB 3WFDL 1PLGL 3ZYZA 5IJKA 5EU4B 5IOPB 3VXPA 3IFOB 3UC0H 5GZOD 1NGQL 4YHKH 4PR5A 4LNRB 3OKKB 4N9OB 2WM0A 2HLAA 3ZKQD 1JE6A 1YEKL 4MDIB 4LLWA 5CZXC 3QUXB 4HWEH 1BZ9A 3O3EA 1RUML 1E27B 4AM0B 1T20A 4HKXA 5IBTL 1B4JL 3GSUA 5L2KD 3QDMB 2XTJC 1NUFA 1X5KA 4YQXH 5I16A 1QRNA 3AMLA 5MEOB 5B39A 4PJFB 1NCBH 3QT2A 3P73A 1PKQA 2NY4D 3JTSB 4R4FL 5A2KH 3CFDB 4MNQD 3IKCB 4XZUA 4M03A 4WW2B 5JOFB 4NQEB 1I75A 4FQJL 3QIBD 4D0CB 2A73A 2E27H 4LSDA 5DQ9B 3B9DA 2V17H 4NHUB 5K9JL 4M48L 1HNFA 1OD9A 4XXDA 5D72H 4CU7A 3ESVF 4DFHA 3QUKA 2CQVA 4NHCL 4IOFC 4J3OC 5DD1L 2QQKL 2DOCA 4G9DB 1DANU 4LIQE 1ZHNA 4JRYD 1D5ZB 4GG8A 5EORH 3WKML 4LCCB 4FMFA 3KPOB 4X83A 1MCKA 3U0PA 3GNMH 5FKPB 5JUEH 4GBXA 1QFWI 2HN7A 3C08H 3PGDA 1DANT 2EYSB 4FXGA 4RISL 4LU5H 3P77B 2MQ3A 1BQHB 4TN9A 4M61B 1ADQL 3ZYOA 1TVBB 3CVHH 2DQTL 5IJKC 4G9FB 1D9KA 1A7PL 4F58L 3EOBA 1R0AL 5I75C 1TDQA 2ADJA 2Q8AH 1WWWX 3O4OB 2GTZA 4X99B 4ZUTA 4GW4B 4O58H 5IEHB 1JZ2A 3UTSB 3MV9B 1HHGA 1B88A 2E3VA 2VZ3A 1JPSH 3K2MC 2VDRH 3STLB 2AEPL 4DAGL 4KTDH 4X5WB 1SJEB 3ZYIA 4PLKD 1VACB 4LBEB 4R7DA 1ONQB 4X8XA 3VXTB 5I18H 5I1GH 3TA3D 1S3KL 2FHFA 4KKBC 4ODSH 1T1ZB 5B8CC 4PJFF 5CILH 4L4TD 3IDXL 4WW2F 2ESVD 2H2PC 1IGCH 2ZKHL 2LVCA 5FDWA 3Q6GH 5IBUG 3IDYC 4QHNA 5D1ZA 1QVOB 4U3CA 3H3BC 4B53A 4OFPA 3NPSB 1YEIL 3EFDL 5KN5A 2CKBL 3VWKA 3T0EE 2YEZB 2ZJSL 2BY1A 3KR3L 5H35B 2QSQA 4NBYB 3C5ZA 2EKJA 4GBXC 4X9BA 1J18A 1T0MB 2XV6B 3LVEA 3CFBB 3U82B 3N9GH 1CD9B 2NX5E 5JHLL 3ES6A 3CX5K 2C7UA 3GJFK 5EOCH 1J0IA 2FHCA 1C12B 1MFNA 4U1NB 1Q9KB 1D9KC 1FP5A 1X44A 4Y88A 3HMXA 1XF4B 1JPTH 2CJUH 1CBVL 2IBBA 4TUOA 4X0KA 2BFVL 3D6GA 1S7UA 2FJFB 2W65A 3D25B 4GKNA 4M1GL 1WWCA 2VE6B 2FEDD 3P30H 4KJQD 3QIUD 4NUGH 1B6UA 1NGYB 5I1HL 4FXLA 3V5DB 3T0EA 1LO3L 3TJHC 1ZA6B 1MLCB 2R1XA 5ECJE 3B2VH 1ZVSA 2ZOLB 4WU5A 3K4ZA 4Y4FA 4K3JL 1QFWM 4P2QB 5FHAH 4UILL 3TF7C 3NGBC 4P2CG 2AJYL 5F9WC 3VDCA 2VDOH 5JIIA 5LWYH 4YE4L 4MJ5B 1EMTH 3MXWH 3BW9A 4Y5YB 5DZNA 4YBQD 5CJ5A 1IC4L 3QUZA 4YHZH 1NEZA 1T0NB 1I4FA 5FGCB 1WC7B 2MCG1 1T21A 4CMMB 4NZUH 3P9LB 5C3LD 1WITA 4UOW1 3I6LD 7CGTA 1DN0B 2J7LA 5HYSA 3T0VA 4JQIH 1OLLA 4HDIA 3MRDB 5DD5L 3TO2B 3VWKC 7FABH 3AVEA 2OR7A 1DCLA 1ZEAL 4LMQI 3LKNA 2CK0L 2BRRH 3C5ZC 4K9EL 1MFBH 1CXHA 4OCXL 2H8PA 3QEUA 1Q9WB 2PNDA 4ZXBD 4UDTB 2YA2A 3QHFH 4ZDHB 3LKQA 2B0SL 5DJXB 3WIIH 1KIRB 1Z9MA 4NM4H 5FO8A 2NY0D 4ZUUA 3U4EA 1IL1A 3PHSA 3D39D 1EXUB 4M93B 1MCEA 1JTTA 1MFDL 4KQ4L 4ZQKB 4JY6B 4TUKH 5I8KL 4NQCA 2N7AA 4GFTB 4Z8FH 2NY6D 4K23H 3WFEH 3AREA 1GAFL 4WDIB 5DLMH 5FA3A 4PBXA 3CMOH 4MAYB 3A67L 4BH8B 2J6EA 1OP3H 2CUMA 2Z35B 4JN1L 4MA1B 4YEFA 4RGOH 4GKZB 3VFVA 1WFTA 3P4OB 3T0EC 1NFKA 2EC8A 3QQ4B 5IROC 4G8GD 2F74A 4QRRE 2X4QA 4WFHD 4G7VL 1A3LH 4CRPA 4A6YA 2C3XA 2KBGA 5D1XD 4DKEH 5CEZL 3C6SA 4Y4FC 2F5BH 1OQXA 5I30H 2GY7B 1F4WH 3CIQA 2ZWLT 4P5TB 4WEBL 1DTUA 4MNHB 1H15B 4KI5E 4LSVH 1B2WL 5CIPA 1J5OL 5D7LA 5D71H 4P2YA 1PW3A 4LPVA 2JLLA 3MRJB 3HLAB 3CC5A 1GZQB 2ZSWA 4K3EH 3D0LA 4WUKH 1CGUA 3RDTB 5JLZB 3G5VA 1DJSA 2NY2C 2IFGA 3IDUA 1MWAH 3MUJA 5MENE 1UA6H 1QFWL 1MHPH 1TQCB 2J2ZA 2BJMH 8CGTA 4B50A 5FV1L 2V5TA 5SWZE 2I9TA 1INDL 3M17B 2RCSL 1DSFH 4TNWK 3S4SB 2XQYG 1FE8L 1Z2KA 4M7KL 2X70A 4M7ZB 1OAYH 3BMVA 4LAQL 1AGBA 3MV8B 2YBRB 1RK1B 5KSAD 5GS2H 2JCCB 3AREC 5HHPB 4LLMA 4OLEA 2D9QB 4UQ2A 2PW1A 5E56A 1QLEL 3LIZH 5F9JB 1E4WH 3R06B 4L8CA 1SVCP 2BSTA 3DSFL 4N9GB 5EBMA 2Y7QA 3TO4B 4ODTL 1ZHLB 2Z8WC 4J8RA 5DVOA 3FB8B 2JB6A 5HI3C 5MENA 4ZFGH 2BK8A 3EOAB 1N3NB 4K8RD 4LRNL 1NJ9B 2EE2A 2XKNA 1MQ8A 4H8WC 4GRLB 2GJ6E 3BPOB 4R4BB 5SWZA 5M94B 1MLBA 2UZYB 2Y6SD 1F90H 1AXSB 4UB0L 1J87A 3O3AA 4X7TB 4XP4H 3LN9A 1KCLA 3DXAD 4OCSH 4ZFZB 4JR9H 3IXAB 1CFSB 5I74B 1YEDA 2ZNWA 1HCFX 4HXAL 3EYQC 4AYFA 2ICWJ 1UJ3B 1DFBL 5GS1B 1YY8A 2NY5L 3BRFA 4XGZA 1FZOA 1F4HA 3OF6A 4ZFOB 2F54B 3IAQA 4PJXE 1WBZB 4WHTA 4JVUA 4PBVC 1GZPB 4PJGB 4DVBA 2VLRE 2ITDB 2PYED 3SJVA 1JPGA 5HDBF 4B41A 1NAMH 5HHOD 5IMKB 5TE6H 4CUCA 4XNUH 3CK0L 4GXUN 3O6FB 4KI5C 5IM7A 4QHMA 5JOPE 1ETZB 3FFCD 1ERNA 5HHQA 2CLVA 5F70A 1FO0H 3ARDA 3IDGA 1FFPB 5ESVA 2JCCF 3THMH 3O2VH 4YDJB 2AS5M 3WXWL 2EDOA 4Z78B 5CINH 1PY4A 4L3CA 4PJXA 3IDMA 1P6AB 5TF0A 2VLKE 1LDPL 3IFLL 1X6NA 1NMBH 2YD6A 1NFIB 3ZE1E 3OXRA 3EYOA 2ERJB 2VLRA 4OZ4A 5GGTH 2D0GA 4M7LT 3JWOL 4MB3A 4HH9A 4XNMB 2YD8A 1XR8B 3P9MB 1FYTE 2P8MB 2NY1D 1H3XA 3HI5L 5E08H 2J5LC 2CIKB 3OKEA 2R4RH 2JB5L 3OR6A 5TJWK 3GGWA 4P0DA 3IAPA 3PWPA 1HH9A 4OFKA 3PHOA 3RL2A 4CAGA 2JIXB 1BFSA 4JLRB 3LN5A 3NIFE 4KQ3H 3ROOB 3ULVC 1C5CH 2VZUA 1I8KB 1T7VA 2BNQE 3BUYB 3D2UD 2FWOA 1I9EA 2VLKA 2NQCA 3HNTL 4PJGF 4N1HB 1NEUA 3VH8G 3WS3B 5JMOC 1T04A 2EYRA 1KB5L 1LO0H 4R4ND 5CMAB 5LBSH 3G5XB 2UY7A 4FZEL 1FYTA 4NFCA 2HAZA 4PJBB 4ZO7A 3HZYA 5C0FB 1EJOH 1VPOL 3RX5A 4G80A 5CKGA 2GAZA 4CVXA 3PL6B 5GRJH 2IQAB 1ZLSL 1U42A 2X4RB 3RWIA 5F7FA 3VW3H 3V0WH 4XC1H 5BS0E 15C8H 4PJDB 4I5BA 3N1PC 3L3DA 5FYLE 1T5XB 1X3DA 5EIIA 3QEGH 1P9MA 3LKOB 5SX4I 5L9DL 3NIDF 3TNNA 4GUPB 2BNQA 3AB0C 2YK1H 3RWHA 3Q5YA 3MLRH 5EBWB 4DKAA 5DJDB 3VFRA 2EH7L 1QHOA 3ILQC 3VFGH 3VXSB 2NPLX 1I9JH 5JR1L 4ETQA 1Q0YL 1MCNA 4PYHA 5F1IA 1K2DA 4ZYKB 2Y06H 3BDBA 1IAOB 2WQRA 4XBPB 1KBGL 3G6JB 3TLRA 3QI9B 4GG6E 1G9MC 3LKSB 3BP6A 4RNRB 3ARXA 2JE8A 4JCMA 5A3IC 4WTZA 1HNGA 2KZ1B 3ZTJH 1FGVH 1T6VN 3VWJA 4AENB 5EA0L 3HI6H 2GITA 4F37K 1WEJL 2AK4E 1EGJH 2R1YB 3RWJA 5TDPB 5ABDE 1WISA 2GIYA 2FZ3B 1CFTA 3S36H 4HGWB 3S8WA 2DLIA 3DWTA 5DTFA 1FJ1A 1MIEH 2Q7YA 2HJKA 1NAKL 4IJ3C 5CWSB 2X4PB 1U8KB 3FB7B 5BZWB 5JW4M 3RJDA 4DGIL 1UVQB 4M7JL 4PJBF 3MRGB 5I15L 4QRUA 1NC4A 4MCZB 4G8FB 1BIHA 3VRLE 4GG6A 4LDEB 1A6VH 4LSPH 4G6FD 5JW4R 4YFLF 3FONA 3WEXB 4PJDF 1P9MC 2C26A 3N06B 2YD7A 4MJ2A 2VZVA 4EBQH 2EDXA 5DHVB 1M7DA 4HKJB 4YJZL 4Z7NE 3DURA 5DSCB 1JL8A 2VQ1B 4KHTL 1DQQB 1ZSDB 1S9XA 3PF2A 3R0NA 1JWSA 5ACMA 5F96L 5JW3H 1H9VA 4BKLB 4J1UB 2IADB 2AI0L 2FB4L 4BYHA 1JUFB 2WMPA 4U3XA 3BXNB 4F7CA 2J4WH 1CFNB 3S5LA 4I2XB 2BSED 3FB6B 2VDLL 2DWDA 5GIRB 3HC4L 4Z7OF 5E9DE 2OZ4L 3G6JF 3GRWL 5DMGD 3RVUC 3OGCA 1RUKH 4DZBA 3QQ3B 1FRGH 4RFEA 1JTPA 3GSVA 1IGIH 5TE4H 3GI9L 3FO1B 4YIQA 4OF3A 5HVWA 5L2KB 3VWJC 3FRUB 3O6MH 5GS3A 4IMLA 3O0RH 3WNNA 1HK6A 1JHTA 1E4KA 2BOBB 4LF3B 2NY3B 2FO1A 2FYYA 1ORQA 1U8LA 5C92A 5H2BB 1IEBA 2XKSA 3QDAA 2K7QA 3QIBB 1HHHB 1UJTA 2WQ8A 2X4SA 4RAVB 2GJJA 1HHIB 1J0JA 4M1CD 5ACZA 3L5HA 3BH8B 3MGOB 4PRBB 1RZ7H 1UEYA 3L1OH 3TWCH 3KS0J 5JXAH 5CP3H 2FLRT 5IB5A 1RMFL 5E9DA 3PWNA 2ZOKB 4HAFA 3GMNB 4NQDD 4ZFOL 1GPOL 1VEOA 1Y0LA 5GGVL 1NC2B 5IVXE 1RZKL 4MNGE 3HTLX 1G9NH 4QO1A 1FBIH 1U91B 5C09A 4GW1A 1AXTH 1Q72L 1B0RA 2KKQA 2I07B 4OCWH 3TZVA 1F6AB 1I7UA 4S11A 4Z9KB 5E70A 1KLUA 3O4LB 4GMSL 3BDYH 3Q3GB 2CKNA 4RMUA 3O3DB 1HHJB 1QKZH 3ARZA 5FYJH 1INQB 1JNNL 4LEOA 4LL9A 1U3ZA 5HY9A 1AY1L 4XPTH 1G6RA 1ZGLP 1I7RA 4FQXD 3UO1H 3UPRA 5C0DB 4I3GA 3RBSA 1KLGA 3HPLA 1E28A 4EZMA 4MJIE 4JKPH 3FAWA 2V7HB 3NIGF 4GW5A 1H3PH 2VDPH 1QR4A 1AIFB 1A7OH 2CDGA 1BZ7B 3CSBA 5C9KA 2GK2A 3TA3B 4MNGA 5IBUB 5CJQH 1JNJA 1UB6B 3WO4C 3GM8A 4HK0B 3H9SA 1CLYH 1G7JA 3P4NA 1MRFL 4UU9A 2H9GB 1QBML 1QFUH 2ESVB 1U58A 1MHHA 5D1QD 2DM7A 5FXCH 3O6LH 1VEPA 5C6TH 1AHWA 5EBLA 3L3HB 5ADOL 4X7DC 4GRWB 2NY7L 1VESA 2VLLA 3ARSA 1JF1B 4MA3B 4P23D 3DHMA 1MCFA 3PWVB 35C8H 4HS6B 5CLWA 5JQHC 1AP2B 4JB9L 3R1GL 5BRZE 1HQ4B 2G9HA 4XMLH 3VU2A 1C16B 4X5XB 1CE6B 2AJ3A 3B9VA 2YS4A 1I85A 1I7TB 2HTLC 3OB0H 2XN9E 2CH8A 3EDEA 4HT1H 1CK0L 4Z7VE 4ONGH 2NR6D 3TBVA 1RJCA 3OKNB 5EU3A 1QNZL 1NCWL 4QT5B 4LCUA 4YHYB 4P5MB 3WIFA 3BHBB 3WDIA 4K2UL 5E0QA 3BWUC 1HDMA 4YHMH 4XVTL 4PP1D 3T4AA 5L8LB 3PNWA 1GH7A 3UBXG 4N0YL 2NLJA 4BQ8A 3QIUB 1AGFB 4F9LA 4OAWB 1YYLH 4TVSa 5BQ7A 5KS9E 4NBZB 3EFFA 3IGAA 4CU6A 2QHRH 3T4YB 25C8H 3E6FA 4O02H 1MSPA 1T83C 3OG4B 4MVBC 2GJZA 1RUAH 4HWBH 4EXKA 4XHJC 5JZ7C 1IKNA 3V8OA 3ECBB 4KHXL 5E7FA 4EN3A 3SDAA 4Y5VB 4OV5A 5D9SA 4CVUA 2H6PB 4KJPC 2XN9A 5JMRA 5MHSE 1T3FB 4S10A 1VGKB 4M5ZL 1ZT1B 4KAQL 5CD5C 4XPHL 5H94A 1FV1B 3GKZA 4TOYL 4Z7VA 5DS8A 3VG9C 3FQUB 1BGXH 2VL5B 1EO8H 3MROB 2VLJD 5DC0A 1KFAH 5EULV 4OIBA 1AHWC 4D8PB 5KVMC 4MMZC 5EDXA 4XCNB 4KMQA 5JHDB 2BVTA 2Z93A 1KC5L 1XAUA 1A21A 4GRWF 1WFOA 3S96B 5KS9A 4HBQA 5J8OA 3KPQA 5D7JC 5MI0B 5CGYD 4IOSD 3BKMH 2GSGB 3OX8A 4ZXBB 4F7PB 2Q86B 2R0ZL 1MIML 3C2AH 4UTBH 5LAXA 2IJ0C 2P8PB 3KYOB 1I85C 2NY0B 3UTZB 1II4E 4M4PA 3MUGB 1KJ2H 4JHBA 4PB9L 3GMRB 4UBDD 3BYTA 4M6ML 2BVYA 4IRJD 2LVEA 1EEUA 5D7SH 4QHLA 4PJ8B 2NY6B 4JFPA 3L5XL 2J88H 3BO8B 3FO2B 4RRPG 3EDDA 1A7RH 2X4UA 3LEVL 3FO9B 1KCVH 4ORGB 2OK0L 1XGRA 4F7MA 4F9LC 1U8NB 3E8UL 1A1OB 2BSSA 5C07B 3PG2A 2Q76B 3C6LA 1JWMB 4KPHL 4Y4HD 2IQ9H 5EZIH 4G8GB 1DVFB 1NQBA 4NKMB 4NQTA 2FO4A 5D1XB 4NNYA 3MJ8A 4GT7A 4HUKB 2Q3ZA 4YHOH 3SDCC 2W0PA 3I50H 2L7UA 1TENA 5T3XH 4PRPA 5C0BA 2OYPA 3F7PC 4OJFL 4EN3C 5IG7A 2BXYA 3SDAC 4ZAKA 5CP7A 4J4PD 4LRIA 4PJ7B 12E8L 4EUPH 4N8PA 1G0DA 1S9WB 3K1DA 3Q48A 1MJUH 4OZHB 3LH2H 2PYFA 4C4KT 4OD1L 4M43L 2AXJA 4XVUD 4HUMB 3E6HA 1KCUL 2QKIA 1A9BA 4XP1L 3OZ9L 4KROC 5IESH 5DZLA 3IS1X 3RTQD 1YNTA 2HWZL 2XNAA 1D5BA 3K7UA 4QY8B 3C87A 5ADPL 1YC8A 4BJLA 1WBXB 1NGXA 3AXLB 3NCJH 4HUNB 4L5FL 3OKDB 3EZJB 3MBXL 1OARL 1H3WM 4NGHL 3KPMA 4NO5B 2EDEA 3BJ91 4QOKB 2W0FB 2IANA 5I1KL 4CADB 5E6YA 4NPYA 1JF6A 1RV6X 3NFSL 2R56H 1K4DB 1CDCA 1EHLH 1WTLA 1O0VA 4OF7A 3D85D 1A6PA 4HEME 5ILTL 2JJUA 4LGRB 4EI6B 2ATKA 3DX8A 3BP7A 2D7TH 3MYJA 4QXUL 1I8IB 4R2GC 2QQQA 3C6LC 3H8NA 4V1DD 3AGVA 1Q0XL 1I9RL 2DRUA 3UDWA 1PFCA 1ZANL 2XTJD 4Q0XH 4U6YA 5FM5M 2ICWA 1BP3B 4GAFB 4P46D 4WRLA 4F7TA 2XPGB 5ITFA 5D96C 2R29H 3IU3A 3LS5L 4D9LH 4K55A 4JHAH 3VMPA 1SBBA 5FGBA 3L3GA 3VXUA 3RA7L 4LRIC 1X7QB 5I1IH 4PJ7F 4OKVB 5IWLA 4PGEB 2X09A 4ZS6D 4G6MH 2B1AL 5KVDL 4OZHF 2OX5A 1ADQA 4CMHC 2R69L 3KPSB 4JFFA 5D93B 4P3CH 4YXLL 2LFGA 3RAJL 4MXWH 3GBML 3DPBA 2W9DH 3L3IB 4RSVA 3KPLA 1FO0A 4H1LG 4PJIB 1KELH 4MA8L 5E2UH 2PYEB 3U0TA 3DVNB 2ZCLH 4Y2DB 5HHOB 4QRSB 1OAQH 3M1BB 1RJLB 1OPGL 4XH2B 5ALBL 4YXKL 1QEWA 2I5YH 3MNVB 5GGTA 4KRPC 3FFCB 1A6AB 4JM4H 2VITB 1NMCB 3TBSB 2ARJQ 2E6PA 3ARFA 1MH5A 4OTXH 4XWOC 5AAMA 4NRYA 1CLZH 2A74A 1U6AH 4E5XB 5DC9B 2WUBH 4JPIA 3SQOL 3VFMA 1W8OA 4NCC1 2WP3T 3IETB 4Z0XA 1DBML 4IDLA 3V7AE 2VH5H 4BSVA 4KKBD 4WCYH 2W92A 2YMXH 2X10A 3S6CA 1ZGLB 4DZ8B 4YLQT 4XWGH 5FGBC 2W0KA 3IRPX 4BSJA 2VRAA 4IDJH 4ZOEA 1S7QB 3O3UN 3WV0A 2AJVL 5B39G 5F88A 4L3EB 1P4BH 2IMMA 4FFYH 4KJYB 2MQ0A 2CLZB 3I2CL 3JV4A 4OM1L 4Y7MA 1RJZB 4PJ5B 3VH8B 4XC3H 1TPXC 5BW7C 2P8LB 4ALAH 2SEBA 5ICXB 4Q9QL 4G8IB 4JFOA 5JO5A 5CS7A 4GBXD 1FZMA 2A83B 2HVJB 4V2CB 3D2UB 1ZT7B 1J8HE 2GT9A 3MUZ1 4HIXH 4Y19A 4PB0L 3DROB 4PJIF 4NO2B 5IVZA 1UCBL 4XAKE 2VZ1A 4HHAB 1JGUL 1XCTA 4J3VA 5I1LB 2VDMH 1A6TB 4RGNB 1D9KD 4HKBA 4R6UA 2X7LB 3B6SA 3EBAA 1T6WA 3SKMB 1EX0A 4XMPL 4MQXD 1A7BA 2D0FA 4N0FB 3KPRE 5C0JB 3FN0H 4Q74A 2WLZA 2A1WH 3BIAX 5GRWA 4MS8C 2V9RA 4JJ5B 1A3QA 5EZJA 3S37L 3W0WE 1X4XA 2OMBA 3MXVL 5BJTA 1YDPB 4LAJH 3TJHD 4QHUB 4HZLA 3DBXB 3E0GA 3RPIA 5L6YL 1J8HA 3HE7D 2VC2H 4JFYB 3BH9A 2MOVA 3U48A 4XVJL 4XB7A 4WI3A 4QTIL 3WE6A 1BAFH 4Z5RA 4QXTB 3L3JA 4JFDB 1A6UH 4KXZI 1PGRB 5D1ZD 3WJLA 3QRGL 3M8OH 5SWSB 4LSSL 3I75B 1S7TA 4XP6H 1AO7B 3VWKD 3QUMH 3DX7B 4BK5A 1N6QH 4FS0A 3MRBA 5ICZA 3VFNB 3BPLB 5AWNH 3PWUB 3MLVH 2V5MA 2AEWA 5FOBB 4L8DB 2OR8A 4I48B 1ZWIA 4FQCL 4H25A 4J3TA 5LCVL 4XCYB 4LEXL 2OQJB 4MLIA 1Y18B 4LVOC 2IAMD 1F8TL 3BZ4B 5MP6L 1MFEL 3SKOA 1EHNA 5DHYB 3CH1A 3UYOD 5E2WH 1QFHA 4NN7B 4LP5A 1JMZA 5JTWA 1QSEA 3KLDA 4N1CA 3U7WH 4G6FB 4M62H 4X6BA 1WIUA 2OLDA 1TCRB 2CMRL 3T0ED 4L9DA 1X5FA 3RUGE 3S88H 3K80A 4H26B 5E1AB 4KZEL 1M4KA 2YUXA 3IT8D 2Q6WA 4Y4FD 2PXYD 4HWNA 3GKWH 4DUVA 1BVLB 4MDIA 2YD4A 4JPKL 1RI8A 1MFAL 3DV4B 4KK5C 3QUZD 4PFEA 1VA9A 1OSZA 2KQNA 2XQYK 4HAGA 4QRPD 4YDLB 1I8LA 4WV1A 2Q8BL 1KYOK 3CXDL 1ZGLM 1I3VA 3L5WA 1LEIB 1N0XL 3WJLC 1G7IA 3X3GH 3PQYD 2CR3A 3EYUL 3B43A 3REWA 5E5UB 5HHVL 1NEZG 3D1MC 4OD2B 1TETL 3MRLA 3TVMA 4O2FB 1BHGA 1KPRA 5FYJE 3EOTL 4O2CB 5GSVB 1WT5C 1NKRA 1FVEA 4LQ1A 4UMGA 2P24B 5HYSG 4HJGA 3PJSB 1TJHH 1Z9OA 3FQWB 3U1SL 4MQ7A 1YMHA 2GUOB 4N8VA 1KTLA 4PPTA 4NWUH 1NLDH 3L7EB 3WFBH 3T2QA 4HC1L 2Z8RA 4NQCD 1HN1A 4HH8A 2YSSB 1BBDL 1BOGA 4KY1L 3OPZH 2EIBA 3RX7A 1AFVH 1P5VA 1TVHA 3VXNB 1I1YB 2EXWD 4FG6D 4G9FA 3WIHH 5HPMA 5HVGB 1IT9H 3M45A 5F7EH 5AUMA 4AEIL 4NQDB 1MCBA 3AS1A 4Y1AE 4Q9RL 5IQ7H 3VD7A 3T65A 4D3CL 1BPVA 3GK8H 1CD8A 5IF0B 4DN4L 1KN4L 4DVRL 4OUUA 1NCCL 3TPKA 1U8IB 2Z4QB 2R8SL 3LRSB 3RZCC 3CDGA 2EDRA 1DQLL 4O4YL 4DOHB 3G9AB 5DGRA 4GH7B 5HYJB 1A14H 1RURH 1YUHA 5D7KE 3TYFA 3U9UA 1VDGA 4KMLB 2CO7B 5D7LD 3E2HB 5LGHH 3DI3B 3QCVL 1SJEA 4WV1C 3OJ2C 3QJHA 5KSBE 3JV5A 4YDKL 1GGBL 3MV7B 4JO1L 3WFHA 3BZDA 3EYQD 3BQUA 3I84A 4OCLC 5I19L 5E1HB 1A02N 1Z6JT 1HINH 4Z7QE 5FK9B 3TVMC 4LHUA 1RJYA 4ORZC 1MI5D 2KL6A 3BD5A 3MRKA 43CAB 4U6VL 3ZLQC 4S1QH 1JZ5A 1PEWA 4Y1AA 2XZAH 2WUCL 4MJ4A 2LAAA 3W9DB 3KGRA 2DMBA 5CEXB 4OLXH 3FKUS 3IKKA 5GJSH 1QLRA 4OI9A 2R2BA 4U1SB 1YJDH 3FQTB 2BNRE 1WV7T 1G9NC 4NT6B 5E8DL 4N0UB 3CFCH 2ICCA 1VFBA 5ESQB 1AJ7L 5F1NB 3OAYK 5JA8B 3X12A 4OD3H 5IEKA 3EYFB 4AH2A 1A22B 3UJIH 2FSEA 1MHEA 5D70H 4ZOCA 3W39A 4RDQG 2RR3A 3UYRH 2BHYA 4RAUA 5GRZA 2NY5C 2JK5B 3ZHKA 1X5ZA 5CLTA 5T1DL 3MODH 4UAOC 3C60B 2XI9A 3V5DA 4C56D 1WFNA 3UBXB 1O7SA 1S7SA 4OB5H 1U8MB 2VDQL 3QG6A 4JVWA 3TN0D 3C09B 1OP9A 2DLFL 2HJFB 2R0WH 4IRZL 4AG4H 3X11A 5E94B 2BNRA 2P7TA 3BQUC 2BHUA 1KB5A 5HGHA 3IU4L 1MPAL 3OF6D 3ULVD 1A6WH 1RHHA 4RWYL 5FYJU 1BFOB 5ESAA 1A1MB 3T3PF 4OLZH 1CCZA 4Z95L 4I0CC 1T5WB 3SJVD 1J88A 1N7MH 3DX6B 4AIZA