4JR9L

Crystal structure of nitrate/nitrite exchanger nark
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
211
Chain Sequence
DILMTQSPSSLSVSVGSSVTITCQASQNITNYIVWYQQKPGQAPKLLIYYTSTLESGIPSRFSGSGSGRDYSFTISNLQPEDVATYYCLQYNSLLTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKNINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite extrusion protein 1
publication title Crystal structure of a nitrate/nitrite exchanger.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein/immune system
total genus 49
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2013-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jr9L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jr9L01
3OKNB 1T4KB 2K9UA 4UZGA 1HHJA 3QIBB 2JCCF 4FFWD 4ETYA 5FUCC 3O3AA 1JWMA 5EBGA 3WXWH 1YEJH 4UOJA 2EDWA 4ETQA 1U3YA 5LXGL 4RWYL 5DYOB 4YGVB 2VXVL 2DQJL 2R0KH 4Y5XC 2GSGA 1FJ1A 1HE7A 1NUFA 3QCVL 4UBDD 3GSNB 3W9DB 5B8CB 2DIJA 2WLZA 3VFWB 4CMMA 4Y2DB 2MQCA 2YUVA 3BN9C 5C07D 4IMKC 3SO3C 4MQ7B 3UEZA 4B50A 2C3WA 3S9DB 5CIPA 3VXMA 2CIKA 3LD8B 1H3TA 3LCYA 3EJYC 4XNQB 3DV4A 3O2DL 5E2VH 5FB8B 4ZUWB 3EDFA 5C9KA 1A7PL 1FLTX 4OQTL 4Y88A 1U93B 1RIVH 3S4SG 4EI6B 1UB5B 5KANI 5EUOB 4OB5L 2QQKL 5INCA 1E4WL 1AO7A 4G6JH 1QG3A 5C0CA 5IMOA 1F4WH 3TV3L 1U9KA 1BJ8A 5FYJE 3LVEA 3MYZA 4BK5A 4XP4L 1OAUH 2A0LC 4CRPA 2VC2H 3O3DA 1YECL 1T2QH 1LP9B 5FYKD 1EDQA 1QBBA 4RMQA 2OM5A 2EICA 3QJHB 1DL7L 4J4PC 4LLVB 5E08L 3UO1L 4JHAH 3EYOA 3BEWA 4PJGA 2C3XA 4LAQH 2VIRB 2XZCH 4YHYB 1CTNA 3DWTA 1SJEB 2FATH 2IF7A 5LGJA 2WANA 2GTWA 3WSQH 3MJ9H 3B83A 4AIXA 5C09E 1P84J 3FB7B 1CXIA 4GQ9H 2XT1B 2E8ZA 3GMOA 2X41A 5J11B 3S6CA 5I1EH 5GISH 1NCCH 3LN4B 4WFGE 5BW7C 5D5MB 3JVGC 5CP7B 2BSED 1XEDA 4YDJA 3IAGC 3BKCL 3KLHD 1JGEA 4K3EH 3KYMA 4I1NB 3SKNB 1MVUA 5E8NA 3HUJA 3SCMC 2GI7A 4GS7B 1OAQH 3FN0L 15C8L 2FH8A 2HN7A 5D1XA 1ZHBA 2CDGB 1QFUL 5F7WC 4ELMF 1JPGA 4K7PH 3SDXA 3BP6A 1QBLH 4X4XB 5CJXA 4PRDB 5IB5B 3CFJA 1S5IL 3ARBD 1IZJA 4Q74A 3RQ3A 1MCEA 32C2B 1CK0H 2Q76A 2YPVL 4PB0L 1R5VA 2E3VA 3E6FA 3X11A 2OXGA 4DQOH 4JDZB 4LARH 5K9KA 2F53D 4O58H 4Y19B 5JW5B 4X6FB 5CGTA 3T8XB 5I15H 2I9TB 1A7OH 1MLCB 2W9EH 4KHTL 3RWEA 3WKML 3LDBC 4OGXL 4IEFB 4G9FD 1QFWL 3CGTA 3WN5B 1CDCA 2QSVA 4PP1C 4N0YH 4OCLC 4G8FB 3HC3L 1X5GA 1X6NA 5DUBB 4U2ZA 1WICA 5KSUA 4J7RA 1BFSA 4RZCA 1QACA 5DA4A 3UTZA 2EYSA 3QG6B 2NY0C 4PRHE 4FQIL 3C60C 4WWKA 4FQLH 5GZNC 1JN6B 1K3ZA 3P0VH 1RK0A 2WM0A 4Z8FL 2OL3B 4C59B 1GIGH 1RVFL 2A0LD 3T4AB 1BEYH 1CE1H 2CQVA 3B5GA 4H88L 4DZBA 3ARDB 2R69H 1FHGA 3MV9D 4YHLH 3CVHB 4MA8L 3LB6C 3WKNA 2CD0A 2O5XH 2NX5B 1OGTA 5BQ7A 5ESAB 1KLUB 4RIRB 1KN2H 2FJHA 2IGFH 1MF2L 4QRPB 2DD8L 1R3IH 2VLLB 5B38G 1IL1A 1VDGA 4YHIA 4LCWE 2EH8H 4O4YH 1JHTA 4WUUB 2YSSA 5JOFA 4JRWA 1WVZA 3OPZH 3EZJB 5D7LD 2P48B 5AG9A 1TVBA 4NCC1 3DSFL 5IFHH 2X4SB 5I71B 5MEQB 3AREA 1KCUL 3U7AA 3PV6B 2IAND 1GPOL 5ICZB 4P9HH 4QOKA 2YEZA 2X7LA 4H8WH 4NN6C 2XG5A 1MCPH 4FQQB 4NC2B 2VE6A 1ZOXA 5DRZA 4HLZH 3B43A 5DJZA 3DX7A 2OQJA 1OGAB 4MJ5A 2Z31D 1EVTC 1IC5H 3V9FA 2Y06L 3U48A 3TYGL 4M1GH 3KR3H 2XQBL 3MRHA 1ZS8A 2Z91B 4I3SH 1A1OB 4LNRB 4PR5A 5F7YC 1IAOB 2IEPA 3TJHD 3S96B 2Z35B 3O0RL 2CLVB 3L3OA 1G7PB 5E4EC 6FABH 1RZFH 5B4MD 1A14L 4QHMB 3MBXH 2K7PA 4HBCH 4OLZL 5T1DH 2J88H 3WDJA 4LCCC 3LZFL 3ZKQD 4C83B 1I3RB 5J3HC 5F1SA 1EBAA 2XTJE 4NUJB 3NZHH 1ONQB 4G7YH 4YXKH 2AXFB 1XF1A 5EN2A 3QUYB 2YK1L 5D7IF 3VFRB 2XQYG 1MI5B 5CSZB 5DQ9B 2VDOL 2VDQH 5HVHC 3KPSD 1EJOH 2VLJD 3C08L 3P2TA 1MIML 4LLWA 3F5WA 5C0FA 1S9KC 5FV2A 4GT7A 4ZDHA 2NZIA 3Q2CA 1LO3H 1KG0B 1T2XA 2VXUL 4G8IA 5CHNB 2Y07L 3LB6D 4POZD 3FN9A 3HAEB 2QADC 2JJSA 5KS9B 5E8DH 2JKXA 1V3LA 1BBJB 4YXHH 5TDPA 4LU5H 4Y5YB 4HIIA 4LRIC 1MHPH 2GITB 4HUNB 3CXDL 3PV7A 4WHYG 5GGVL 3K3QA 2FEEL 5F3BB 1QFWM 3L1OL 1GGTA 5DD6B 4ZFOA 1UZ6F 5DSCB 4R97B 5FGSA 5DHYB 3CJJA 1J9CT 1UJ3C 3W11D 4JPIA 5HYSB 3ZE0F 1UACL 1Q94A 5AZEL 3QG7H 3D3VB 1JUFA 2B5IC 3LS5L 2P24B 1V7ML 3PWPB 4ZOAA 1TDQA 1F8TL 3BPOB 5IMKA 3MGOA 5K93A 4OFKA 3S37X 3FQTA 5L0QC 1KPRA 1F42A 4GRWE 2D03H 3HE6A 1UWXK 3KPRD 4JO3H 2FD6H 2H32H 3OKMA 1N0LA 4JKWA 5TH2B 2CRMA 2DQFA 1CLZL 3P11H 3S88L 1IGFL 4X80H 4HZAA 5DK2A 3QCTH 2VLMD 4WUKH 2D9CA 5E2UL 3SO3B 4QXGL 1AR1C 4IRZH 5TGBA 3VGFA 1F4XL 4PFEA 1EAPB 5I74C 3MCKB 4L9LC 5T3XE 4LF3A 3HMXL 3L95B 4IRJA 4IJ3B 4FMFA 2SEBA 2N7BA 3PP4L 3QPXH 1AGCA 4NP4H 5B39B 2OMBA 5J3HD 1EFXD 5ACZB 2GAZB 1GZQB 3DO7A 1JPFB 1H3XA 2HT2C 3TCLB 5IMMA 4KMTH 1X5FA 3GSQA 3BOVA 3Q6GL 5E1AB 1A7QH 3NCJL 1QSEE 1U58B 2UYLA 3G6DH 3FQXA 5HGBB 1UADC 1HWHB 4JFYB 5CCKH 4L3EE 2AV7B 2BVTA 1S7TA 3QDJE 2VQUA 5DUML 5L7XL 2RCSH 3QFJA 4OKVA 3WNPA 2EKJA 4XVTH 1TJIL 3PJSA 2FZ3A 3TZVC 1AJ7H 3KAAA 1G6RA 1LK3L 2AJXH 2IBBA 5HHMD 4V2CB 1IEAA 1EVUA 2F58L 5MI0B 4MAUH 1I1FB 5T1KB 5JHDD 4AT6A 1IM3A 2HTKC 3BWAB 3QUMA 4XVSH 2VR9A 2QADD 3CK0H 2V2WB 4LCYB 4ZOBA 4QRSA 4DFIA 3WNLA 4RFNC 4FFVD 1ZVYA 2DI9A 4PREB 2WWMD 5SWZB 1Q1JH 3QCUL 4XXCC 5JW4N 3B8YA 4M3KB 3SCMB 3U2SB 5C0RH 4FQ1H 1LEKA 2UWEE 3ZKMC 2FHBA 1RUMH 4XWOD 1TCRB 3N85H 4PJIF 5TJWK 3TJEH 4C56E 2B7DT 4MAYC 5I73C 2DJ4A 1FE8L 2NMSA 3MLSH 1E6JL 3QWOA 1KB9K 5E6ZA 2F19L 2V5RA 2YUWA 3V4VH 2ZP0T 3QAZC 2XN9A 4PGCA 5GPRA 1C8PA 1KCSH 4NM8L 4MQTB 1F13A 5E5MA 3IVKB 4NKOB 4WV1B 1T7YA 3SGEH 5IB4B 3FB5B 3TESA 4LLAA 4HS3B 4OT1H 4Y5VB 1KBGH 3JUYA 5EDXA 1ULVA 1U8IB 1EXUB 3ZYOA 5KG9A 2D7TH 3GK8H 1EZVY 5DT1L 4MJ6B 4LASH 2XPGA 3C87A 3LDBB 1AR1D 4XHJC 4LQFL 3PDOA 5D2NA 1G0XA 1JF6A 3DV6A 1MCNA 1WT5C 4DN3H 5ITFA 4BFIB 5DR5H 3EHBC 4FG6C 2J1KA 4YX2L 2EIEA 2L4OA 5B21A 3LKSB 1U95B 4KAQL 5FKAB 2VDKH 3R0MA 5SWSA 1FO0L 5BZDB 3B9KC 2VISB 4EN3A 1HNGA 2NY0B 4LLYB 1UWGL 3C60B 2I60H 3FOMB 3V7AG 1D6VL 3ZZ1A 3C6LA 1MFBH 4I48A 2HT2D 4LSRH 4GKZB 4BQ9A 5KVDH 5IHUH 1R3KB 5HGHA 4JFXA 5BV7C 2IQ9H 2XKSA 4K8RL 1Q0YH 4QHUB 3SKOB 2Y5TA 1OP3K 1TENA 3ZYIA 4XCNB 3O2WH 2IG2L 1RZJL 4JREB 3DUUA 3P9LA 2HH0L 4URTB 2YUXA 3V5KB 4Q9RH 1CDGA 2CMRL 4ODSL 5F7LB 5DD3L 2J4WH 4KQ4H 8FABB 5ESVB 1FZMA 1XIWC 1UT9A 4LSVH 4PJBE 5D2LF 5E8OA 5ENWA 4A6YB 1OPGH 4RSVA 2RFXB 2P5WD 1OLZA 1QA9A 5DEFA 5E0QA 1OM3L 5MEPA 1KPUA 2H45A 4RX4D 5FHAH 2KUTA 2HTKD 2DI7A 4GG6A 5DA0B 4XAWL 1ZSDA 5FYKH 4WO4A 5D71L 2UY6A 5IF0B 1A3LL 1NEUA 3BGFC 4P4KC 3RGVC 5KSBE 3MLZL 1EUTA 1YN6A 7FABH 3QH3B 4LSSL 4WI8A 3OAYH 4Y1AA 2HFFA 1GJIA 4L4TA 3ZKMD 5GGSY 3B6SA 4LSPL 4M6AA 4NSKB 3WEXB 4HH9A 4MAYD 1KT2B 2BVQA 5F6HI 4JN1L 1UXWB 3GHBH 3BZEA 3GBNL 5I1CL 4Z7UE 2DQIH 2V5YA 3RAJL 1FNGA 3WLWC 1Q9WA 1ACZA 3AAZA 5FHBH 1ORSB 2DDQH 4PJ5D 1ES0A 2A1WL 4OJFL 1NBZB 4UIMA 1TJGL 1JIBA 1QKZL 1D7FA 1LK2A 2AJ3A 5A16B 3RWCA 4EBQL 4EOWH 5MERA 1TETH 1TZGH 3BEVB 1QSFD 1A6TB 3SDAB 2FO1A 2HKFL 1G7HB 4G80B 2QSQA 3EKCA 1YYLH 1K6QH 4LPWA 2AK1H 2FDBP 1MJJB 4XHJD 4AEFA 4NZTH 5C08D 1L9NA 3HC4H 4IMLA 2FR4A 3QEGL 4YEFA 5A43C 4WFFE 2BOCB 4EI5B 3FMGL 3D1MC 3EHBD 4FG6D 1UKQA 1UC6A 3B9KD 4RMVA 5E5UB 5C0AD 2J8UA 1OAYL 3NPSC 5LXGH 5J6HB 2JB6A 4RWYH 2LAAA 2VXVH 4LPCA 2DQJH 4M6OL 3STLA 3GNML 3QCVH 5IVXA 1CICC 1J8HE 5HHMB 2ITDB 1HSBB 1IKNA 4EUPA 2AJZB 1G7JB 3IJHA 4M1DL 5I9QB 4JHBA 3MJGX 5I1IL 3T0AA 5FYJU 5GXBB 5DD5L 3GUTB 1XIWD 3UBXG 4TPRL 1BIHA 3V6ZB 1XF4A 1I3UA 2EDKA 5I8EB 3O2DH 4AIOA 1M05A 5D1ZB 1A7PH 4OQTH 2CKNA 4K8RD 2XZZA 4JQIL 5KOVC 3IDIB 1C16A 4PLJC 3DX8B 5SV4A 1ZHLA 2PW1A 2EDOA 2QQKH 4OB5H 5DGQA 1E4WH 5JNYA 5KZCB 3W0WA 2AK4A 3KLDA 3RGVD 3TV3H 5AZ2L 1AIFA 3MMEA 3TPKA 1O7SA 2V7NA 4XP4H 5EU4B 3RX8A 3LOWA 3UJJL 1YECH 1N2RA 3X12B 1BMGA 5F7NC 2EEAA 3MR9B 1DL7H 2W0FA 5E08H 2VLKE 4ZAKD 3UO1H 2X09A 4OUOA 5DI8B 4YGAB 1DN2A 3ARFD 4E41A 3NVQA 2ZPKL 3HZVA 3QDGD 1TZHB 4DOHE 1HIML 3D5OF 3KJ6L 1J5OL 1S9VB 3A6CL 4WW2A 3X3GL 4L9LB 4EKXA 1C08A 5INDB 2ICWA 4JKMA 1WSST 1MRCL 1MCDA 3BKCH 2QHLA 1AQDA 1U8JA 5DDHB 3L3DB 4KFZC 4U1KA 1WC7A 3O8XC 3FN0H 4HXBL 15C8H 4TN9A 2ZSVB 4P2RA 1QFUH 5FUOL 3V0VB 2P5EE 1AD0A 4X0KA 3EJJX 5DXWA 3K8KA 4HLZG 4FXGA 2JB5H 1B0GA 2YPLD 3HUJF 3FFCE 1S5IH 1G9NC 1H8NA 5BZWB 4L4VB 1F4AA 1DBJL 3TZVB 2N4IA 3HPJB 3O6FB 3O4OC 4HMDA 2PKDA 2YPVH 4PB0H 5IV2A 1CICD 4Z7WA 5EZLB 4X6EA 3SBWA 3SDXF 5DVKA 3C9NA 1YYML 2CR6A 2F8OA 2DN7A 4XXDB 1CBVL 3P4OB 5CZVL 4KHTH 3FQWA 3WKMH 4OGXH 4QTHA 2ATPA 1QFWH 5GS0C 3O3EA 2BNRE 4JY5L 1MAJA 2WBJA 4ZUUB 3HC3H 2BHUA 4WUUE 1PW3A 3DRTA 2EH7L 3L5WA 2H2SC 5I73B 3HZYA 4JG1L 1PG7X 4FQIH 1JZ5A 4PTTB 1BQUA 1LE5B 3BP5B 1DQML 1J1PL 1KLFA 1MIEL 2X4NA 4LPYA 5HDLA 3VA6A 3T3PE 3KG5A 4ZS6C 3CD4A 2FBJL 4Z8FH 1RVFH 4KV5E 3KXFD 3BIKA 1A02N 4H88H 1FYHB 3CMOL 1BX2A 1CT8B 4M48L 3ZDZF 4LCIL 4I2XA 4MA8H 1T04B 2DL2A 5K9OB 3Q5TA 1VFAA 4OZHE 4O2EA 4GW4B 4JCLA 3RWDB 4WEBL 1CXHA 4M61A 2FEDC 1MF2H 1PDKA 1IKFL 2DD8H 1V05A 4PY7B 3KYNB 5I6XB 5C07E 4BQBA 1NDMA 4EDWL 4AJ0A 1NJ9A 2NXYB 1UH2A 5HYIA 2FYYB 1M4KA 2APBA 4XH2A 2JK5B 3TC9A 3DSFH 1T03L 4WFED 1KCUH 1KEGL 1GPOH 3TNMB 3G5YB 3VRIA 5HHOD 4D8PB 5I8OL 5LGHL 1ACYL 5D1QA 5BXFA 4S10A 3R1GL 2VQ1B 2R23A 3CLFL 3O8XD 5DEZA 3J7HA 2Q8AL 1A7BA 2YKLL 3N9GL 5F72S 3L5JA 1K8IB 5ISZD 1R24B 4OI7A 1ZLWH 5BRZB 3IDNB 4HKBB 4ZUSB 1MUJA 1XGUB 4PJEB 4ZSOE 1RJYA 4E0RB 2O26U 3ULUL 1T1WB 2Y06H 3OHXB 3FB8B 5CMAA 5FYKE 3TYGH 2I24N 3NFSL 1TJHL 2OXHA 4FABL 1LDPL 1BFVL 2XQBH 3TA3B 1XIWB 1L4IA 2YD5A 3O0RH 1FZKA 4HEPG 5CJXC 1QVOA 2FGWL 1A14H 2GUOB 2EZ0C 3QFDA 4OLZH 3MGTA 4XBPA 4P5KA 3LZFH 1EPFA 1PLGL 2X4RA 5E7BA 5C0JB 4HWUA 2CDEB 1QRNA 1JVKA 2BERA 1QHOA 5C0IB 3BGFB 4P4KB 3V8OA 5GS0D 3FT4A 2KH2B 5L8JB 2YK1H 3M1BA 1YDPB 1E4XL 4NQUA 5EO9B 2VDOH 3VXMD 5GGUA 1E27B 2X4OB 3MV8A 3C08H 5ICXA 1MIMH 3MUZ1 3BDXA 3ARRA 3NFNB 2WK2A 5IW1B 1OLLA 4YHKL 2FO4A 3HLAA 4HC1A 5BVJB 3PP3H 3PWUA 3LRSA 4F33B 3T0EC 3EYFB 2VXUH 4ORGA 4WWKC 2EO9A 1AO7D 1NGYA 5C0CD 2Y07H 5ID1A 2DLGA 2E7HA 4CDGC 3FAXA 2F53E 2Q7YB 3O2VH 1BZ7B 3CXDH 5GGVH 3VXTA 1QEWB 5HY9B 2H26B 5DVNA 1HWGB 2OSLB 1T89A 5C2UB 4CN4A 4XI5C 3L1OH 4R3SB 3VXSB 3P9MA 4G9FE 1OQXA 1VHPA 2C1PB 2AJUL 1UACH 5ID0B 1T1XA 5AZEH 3CXHK 43CAA 1JWSB 1DE4A 3SPVB 4X6CE 3LS5H 3IETB 1V7MH 4K9EC 1F8TH 4E9LA 3N1FC 1D5XA 4CN6A 1FZJB 3H9HB 4QGTA 3NPSB 3MNWA 1IEHA 1FZOA 3AREC 5J12B 5T33L 3C2SA 2I07B 3C5JB 1URLA 1CICB 1CDUA 3TBSA 4JDVA 4IDJL 5IM7B 1CLZH 3S88H 5E6YA 1TMCB 3SE9L 1IGFH 2LU7A 3MUHL 3MV9E 2NPLX 4IHOB 4OUUB 2PYEA 5D1XD 4F9PA 1QLFB 1HEZA 5E2UH 2XFXA 5EG6C 5B22A 4QXGH 4NHCL 5ANMB 3G5ZA 1F4XH 1WBZB 4XB7A 1KYOJ 2VAAB 5GS3A 1VFBB 4NYLA 2XTLA 3HMXH 5K33A 1ETZA 1M1SA 5FEBA 3PP4H 2B0SL 5IIEA 2P43B 3NCBB 1TPXB 5D7LE 1DDHB 4ZNCD 3D2UA 4JJ5B 1RFDL 1NEZG 2A6KB 2VL5A 1FGVL 3CFKA 3CMGA 3Q6GH 1IGML 3LPGA 3NCJH 5JQ6L 2R0LL 2JCCE 1YJDL 3H7BA 2OZ4A 3T04D 1S5HB 3QNXB 5DUMH 1U8PB 2BRQA 5L7XH 4R7DA 4QHLB 1TJIH 4LHUB 3DIFA 1EIBA 1NGQL 1KPVA 3JV6A 4PUBL 3WFEL 4BUHA 4M02A 1LK3H 2GK0B 4FOMA 5I8KH 4P59L 1FNFA 2MCG1 2F58H 1I9EA 4WWKD 3K4ZA 3DBXB 4UNVA 2CUIA 1QLRA 1T7WA 2GFBA 3OJVC 5LJYH 3QXWA 4JO1L 3HRZA 4ZFOL 4I18B 5IK3A 4PLNC 1P84K 4QXTB 3QCUH 1N26A 2JJSC 4XI5D 4C55A 4WI5A 1RHFA 4TULL 2BVYA 3MX0A 4IDLA 2EE2A 2H9GA 2XA8L 2NLJB 1FE8H 1E6JH 1PX3A 3B3IA 4YIQA 2F19H 5JUEL 1T22B 3UAJC 1XH3B 3L3IB 2VABB 2YD2A 4HJGB 3NTCL 1P4LB 3GSRA 1OARL 1F45A 4JM4L 5HYJA 1XGTA 3MV01 3KPSE 1CGXA 2VLJE 3EYUL 4KKAC 3BPCB 5FOBB 3ARED 3O4OB 4JFFB 5I8CA 1NDGB 4QOKD 1ZKAA 3BZFA 2H41A 2YWYA 3LSOB 1TVDA 5C0GB 3G6JA 3EAKA 1K4CA 5DJ8A 1MCCA 2EDRA 2YD8A 3MYJA 3HE6C 2I27N 5DT1H 2P8MB 5DK0B 1Q9LB 3VRLF 1D5ZA 4OFPA 1JF1A 3RI5F 4LQFH 3TN0A 5C0NC 4NWUL 1GVIA 3WLBB 1WCBB 3IDUA 4DFHA 1KJMA 3LKRB 4GKSA 4R2GC 2AXJA 3M17A 1NGXB 4PGEB 4YBLB 4YX2H 2A6DA 4KAQH 3RX7A 1FO0H 2NW2A 3ROLA 4KROC 3VXMB 1UWGH 4KK6D 1D6VH 4G5ZL 4LKCB 2R15A 4YDVA 3AC0A 3IAQA 4IRJC 3NH7L 2Q87A 5IB2A 3BGMB 1BWMA 5I17B 4K8RH 2H32B 4DK3A 4UB0L 4ELME 1HI6A 2EXYC 2WBKA 2IG2H 1RZJH 2ZUSA 3KPRE 1G6RL 2HH0H 3NCEB 1FFRA 2CMRH 1X6LA 2EDYA 5DD3H 1JHKL 3MSPA 4WHCA 3QJFA 4MHHI 4M5ZL 3QUML 1LMKA 2VLME 1OM3H 2EYRB 5DJDA 4MA7L 1I1AA 1RU9L 4TTDD 2YBRB 5FO7A 5J7CC 5GGRY 2BMKA 2AAVA 4PRAA 1C5DA 4PJGB 4XAWH 1U6AL 2GSIB 4R96A 5D71H 2LVEA 2R4RL 4UU9A 1JYNA 1A3LH 4UNUA 4YPJA 4QF1A 3E1F1 5HDBF 4JANB 3MLZH 4HK0B 3OMZA 3OJDA 3FT3A 2X89A 3VGEA 1KENL 3QISA 4LSSH 1P1ZB 3R06B 1GGIL 1M71B 5H94B 3T0WA 4GG6F 3VWKB 4LSPH 1MJ7L 5J9PA 3G08B 5HHVL 2GT9B 4JN1H 3HUJB 4NNXA 4DVBB 5C7XL 2BSSA 3KPNA 3GBNH 5I1CH 4ODUB 3BH9A 2BVOB 3OKOA 2P42B 5DRXA 2VNCA 1N8ZA 3P4MA 3RAJH 2O61B 3C09C 4KKAD 2QHRL 3ARVA 1FRGL 1NGWA 3VD3A 1I85C 1KTRL 2A1WH 2NY3D 4OJFH 4P46C 1TJGH 3PHOA 1TVHB 1QKZH 1S8DA 5HHME 4EBQH 1BD2B 1KIPB 3IFNL 2WWKO 5JHDE 3HE6D 5DJXB 5L2KB 2HKFH 5GQBA 3TVMA 2X4QA 3X11B 2R1YB 1J12A 1CD1A 3DJ9A 1EEZB 3QEGH 1Y6KR 5DJCA 4R2GD 4X5WB 1QBML 4U1JA 5FKPB 1WBYB 3QULB 3RWEB 1JZ7A 3F6LA 3FMGH 4PJCA 4U1GC 1UM6L 1RJZB 2D3VA 4PBWD 3V6FA 3UPRA 1TITA 4RFEB 4KROD 3U6RB 1HHIA 5D2NC 5TF1L 2WIMA 4P2QD 2VLRB 1OAYH 3BW9B 3RY6C 4IRJD 1CGUA 1CLOL 4WJ5A 2ZG2A 4PJDA 3ZMRA 5KSUB 2WW8A 4M6OH 1BZQK 4U6HA 3GNMH 5JDJA 1G84A 5IEHB 2E7MA 3BKJL 3T65B 1XGPB 4RZCB 4EN3C 4NO5A 3T0EB 5D96B 1FIEA 2EXYD 5E00A 4M1DH 3DETC 1IEBA 3BKYL 3BX7C 2J8UF 5I1IH 1JWUA 4AEHL 1NL0L 3IXAB 5E6IA 3QI9C 4PRPA 5DD5H 1IAIM 4TPRH 5I1AA 2DBLL 4L8BA 5IVXF 2E27L 3ZE2F 1EUUA 1K8DB 1PX4A 3ZT7A 2CUHA 3ARGB 5J13B 3QFJD 3TT1L 5BQ7B 4JQIH 2XV6B 4GUPA 5M95B 1FFOB 1GAFL 2MHAB 3I85A 3MUY1 4X99A 3DVGA 5F7KC 3EO1B 3LQZA 5AZ2H 4QRQB 1VACA 2OP4L 3GSXA 3GKWL 5CINL 2JIXA 4K3GA 3UJJH 4QTIL 1PZUB 1CDBA 4B7IA 1N5YL 1ZAGA 3C5ZA 1W0VA 2PYFA 2CGRL 2XZQL 3VMPA 1PQZB 4LK4A 1AKJB 2A77L 4F80A 2DIBA 5EZJB 2AERT 3MRCA 5DJYB 4X4YB 2ZPKH 1N4XL 3FQRA 4GMSL 3DNKA 1HIMH 3KJ6H 4N0CD 1J5OH 4DKDC 2XN9D 3A6CH 4V2BA 1R6VA 4EXPX 3X3GH 2LTQC 2P5WE 4PJ7B 1Z6JT 1MRCH 3TLRA 5H2BB 1VKXA 5CBEB 1G9NH 1S7RB 1INEL 4NQTA 4HXBH 5HD8D 5MENB 2ESVA 1CG9B 4Y7MA 5I76B 5FUOH 4WW2F 2JJTC 1NC2B 1UZ6E 4OV5A 1BZ9A 4B7LA 3ZE0E 3QXUA 1G9MC 2VKXA 4G7VL 4YC2C 2Y7QB 1YA5A 1EK3A 2ARWA 4UT9L 1DBJH 1FYTA 2EXWC 4HWZA 2UY7A 4GG8A 2WIIB 1T5XB 5SWSD 4YHPA 4EN3D 3I3EA 2V5TA 1AGDA 2QSCL 3C6LD 3GSOA 2AEWA 2EDBA 1YYMH 3DETD 4FS0A 4PJ5E 5CIPH 1CBVH 5CZVH 2JF1A 3RTQA 1QRKA 4ZXBA 2DI8A 5C0BB 2IFFL 5DRNB 3S35X 3RL1A 4EDXA 5K9QI 1IKNC 2XNAA 4PRIB 4JY5H 3ECBB 3V5DA 1QSFE 4Z7WF 2HYMA 5D7JC 3RWGA 1T1ZA 2QL1A 3A6BL 1P5UA 5FFLA 5KTEL 2EH7H 1RZKL 1X5XA 5C08E 2WSKA 3MC0A 4JG1H 2R0WH 2DWDB 1P7QB 3ZO0A 1DQMH 1HDMB 1J1PH 1MIEH 4O02L 5D7SL 3TGXA 2FBJH 4WO4D 4ZTPL 5EO1A 5C0AE 3ALPA 4JR9L 3CMOH 4HUMB 3BO8A 4M48H 3TBTA 4LCIH 3RIFK 4APQC 2ZUXA 1MJUL 2VDNL 5T3ZL 3HC0A 4E5XA 4GAFB 3H9SA 4KZEL 3UJIL 1MAKA 1ZK9A 2J8HA 4WEBH 4Y1AD 12E8L 2YHGA 3STBA 1QQDB 1HQRA 4L4TD 5EPMA 4KTYA 4IOFC 1IKFH 4OAWA 1H0DB 4FQPA 3WNMA 4EDWH 3ABZA 3BUYB 4KU1A 5IR1A 1DUZA 4YDLC 4EVNB 2VDLL 4WI6A 1F02I 1T03H 4WI9A 1KEGH 1FFPA 3EOAA 1OHQA 3HE7C 4ZFZA 5I8OH 5JIIA 1FH5L 5LGHH 1ACYH 4N9GA 4YZFF 5TGBB 3QEUB 4NQDA 3OR6B 4RGNC 2ARJB 4Z5RB 5FECB 4N0UE 2X44D 3R1GH 4WW2C 3CLFH 3VDCA 1FL6A 2Z0BA 1A9BA 2Q8AH 5AUMB 3DXAA 1JI1A 1ADQA 2YKLH 2IADA 4NQSA 1P2CA 3BDYH 3N9GH 4X7FC 5HHQA 4PJIE 3BP7A 5J8OA 5C9JA 1OTTD 1BIIA 3ULUH 1DBKL 5IMMB 3VH8G 1RK1B 3NFSH 3LKNB 1OWRM 1TJHH 4Z0XA 4FABH 2EXWD 1LDPH 1BFVH 5IHLB 1PG7W 1REIA 4P3DA 3VXRB 3MRBB 1N3NA 5ETUB 2D9QB 2EKSA 3DECA 4YAQA 3FONB 3MLPA 3H42L 2FGWH 3QDGE 2GQHA 1JNHA 2KQNA 4MS8C 1P7KA 1UEMA 3EYVA 3L3KB 5EOQL 3ULVF 4G8EA 1PLGH 3BISA 4R26L 1OB1A 4AK1A 3DX6A 5HI4C 3SBWC 4P4RB 2X1WL 4UMGA 1Q72L 3OGCA 1MCLA 4G6KL 4JFDB 4OZIA 1X5ZA 1E4XH 1Z5LA 3IKCA 4XBEL 3DROA 4JRXA 5F88B 1DEEA 5EBWA 3BI9X 1KTLB 4I0CC 1ZT4A 1S9XA 1KB5A 2EDFA 4GOSA 4AENA 4O2FB 3HR6A 2APTA 3MBEC 2WBJC 4PG2C 3B8SA 3KNBB 4U7SA 2YPLE 2NY4C 3QEHA 4LAJH 2HT4C 4YHKH 3C09B 5CD3A 3IS1X 4ENEC 1DSFL 3QT2A 3W0WD 2AK4D 4X83A 4LLDB 1HYSC 4P46B 2XN9B 4PGCB 5IBLC 2DYPA 3SJVB 3T2OA 1JGDA 4XNYH 4ZO8A 4G6ML 2BOBA 1L6XA 1AI1L 5IB1A 4OLWL 1BQLL 4IOFD 4U1MB 4NIKB 1IFHL 5D2LE 3QHFL 2ADIB 1ITCA 1NBYA 3DRQA 3JUZA 2GTZA 5ICYA 5DTFB 2UZYB 2AJUH 1F4YL 4GRLA 4E41D 3OKNA 1T4KA 5DLMH 3QIBA 3CLEL 3PF2A 5I1GL 2ZUVA 3ILQC 3SGJC 3CZJA 3IYLW 3QZWB 2OJEB 1CD9B 4MLSA 3HTLX 5JQHC 3OAZK 5T33H 3MV7B 4EXKA 3ULVL 5DYOA 4W6WB 2Y6SC 5D1QC 2COQA 4YGVA 3JV4A 3JV0A 1S3KL 3KXFE 4RDQG 3WFBL 3SE9H 3FFDB 5A2KH 3GSNA 3W9DA 2W91A 5B8CA 3VFWA 1PVHA 2AXHA 4Y2DA 3U82B 1A21A 2QQLL 3FJTA 4LVEA 3KYKH 4P2RD 4I13B 2A6IA 1A6WL 2H6PB 1IAII 4NHCH 4OGAC 3QI9B 1A6UL 1IQWL 1L6ZA 3FQNB 5EU7E 1AGEB 3L7EB 3LN9A 4M7ZC 3G6AB 4MS8D 1FL3B 3ME0A 4XNQA 5FB8A 5L8LB 5IVNA 2B0SH 4ZUWA 4Q6YA 4PV9B 1U93A 4JVPA 4NQEB 1E4KA 3RWJB 2DQDL 1QA9B 1UB5A 1GOHA 5E70A 1KPUB 3LN5A 4WFEE 5ERWB 5EUOA 1RFDH 1I9IL 5HHOE 1GOGA 4H0IA 1YNTB 1FGVH 4WNQB 1IGMH 1WIUA 4BZYA 5JQ6H 2R0LH 1CVSC 1YJDH 4NKDB 4OLEA 2A9ML 4X5XB 1LP9A 5ISZE 3RU8L 1O0VA 1EGJA 2WBJD 1NGQH 3QJHA 1XMWA 2W38A 4X9IA 4BH8B 3MZGB 4L4TB 4LLVA 3WFEH 2NY4D 1CXEA 3TEUA 2A73A 4JFQB 4K07A 4KY1L 4P59H 2VIRA 3MO1B 4PY8I 1SJEA 1UXSB 4NRYB 4ENED 2A74B 4RMUA 1GHFL 1RJCA 3PE9A 3FB7A 3S37L 1G9EA 2LTQB 4KXZH 4CKVX 2XICA 4CU7A 1FNGB 4J6RL 1B3JA 4JO1H 3LN4A 4OD3L 5D5MA 3AAZB 3ZSSA 5GGSB 5BVPL 1WTLA 3LEVL 1TQBC 4V1DA 4KI1A 5I1HL 5GGTA 4C58B 5CP3A 3SKNA 2AJ3B 4BSJA 3MRGB 4TULH 1Q9KB 3D39A 2DQCL 3VFSB 2EIZB 2XA8H 3H8NA 5FO9B 2CDGA 4ODWB 1T89C 1FL5B 5JUEH 1UH4A 3GJEB 2N7AA 4QRTB 2MTPA 5I30L 4RISL 4YC2B 4IMLB 3NTCH 4JM4H 1OARH 2EDLA 3VXME 4X4XA 3EOBA 3TO2A 4PRDA 4MSWB 5IB5A 1IVLA 3EYUH 5DVLA 3PGDB 2Y6SD 5D1QD 3GB7B 1YY8B 32C2A 3FZUC 1KLGB 5J0BA 4OFYA 1W0YT 2CLZB 2DJSA 3QIWC 3NZ8B 4JDZA 2FL5A 1AO7E 5C0CE 3KWWB 5C6TL 4Y19A 1IGIL 3VI4F 5JW5A 4X6FA 4OGAD 1U8MB 3NA4A 3T8XA 1HH9B 4KRNA 1MLCA 4F15B 5HSFA 2I9TA 5EIIB 1NCDL 2LAGB 5IHZB 4L5FL 1MRDL 4NWUH 3EOYG 1XGYL 3G6JF 3ULVD 4K71B 5D7JB 1XF3B 2PO6B 3MA9H 4D0CA 4F9PC 5KVGL 5CLTA 3GMNB 3WN5A 1I7UB 2F5BL 4M7JL 1A2YB 1OD9A 5GRVL 4W68A 4G8FA 1HSAB 4PJGE 5DUBA 1MFCL 5DHXB 1PKQB 2Z93B 3TYFB 3FQUA 4AZ8A 2IPUG 5CILH 4G5ZH 3QG6A 4NC1C 2OZ4L 2CKBB 3NH7H 1C16B 2ERJC 3EYQD 1JN6A 3GRWL 1ZHLB 2PW1B 4CVXB 3U4AA 1QRND 2QLVB 2BRRL 3RBSA 4UB0H 4YFLI 3H9YA 3W0WB 3T0VA 4MCZB 4APQB 1YY9D 1RIHL 1G6RH 3ARDA 4IRSC 3VH8B 3CVHA 1CFQB 5AD0B 3KLAB 5JZ7C 3HUJE 1JHKH 4OM0L 1J7VR 1BBDL 2NX5A 3O45B 4M5ZH 3QUMH 5ESAA 1KLUA 1EHXA 3JWDC 4RIRA 1N6UA 3K81A 4MA7H 4QRPA 1RU9H 3MV8D 2VLLA 3OR7B 1A4JB 2Y36L 4YDLB 3SDXE 3MRKB 1U6AH 1V3MA 1A22B 1PYWA 2R4RH 3AXLA 5FYJL 1T83A 1WZMA 3P77B 4Z7VB 1XF5B 5DRWB 3HE7B 1RMFL 1HHHB 2X4SA 5MEQA 3PV6A 3IS0X 5ICZA 4DGVL 4RGNB 2GCYB 1KENH 2NY6C 2E9BA 2ZUQC 4MNGB 1GGIH 1XF2B 4L1DA 3I9GL 1MJ7H 1HXYB 4FQQA 3WIHL 3U7YL 5HHVH 3BDBA 2EC8A 3QDAA 1F3DJ 3O3BB 4U49A 3J8F7 4XNUL 2CH8A 1Z9MA 3C2AL 5FCUL 1WC7B 5C7XH 1U91B 4HDIB 4NZDA 1IAKB 1WZKA 1OGAA 4TYUA 3HMWL 3K46A 1BOGB 2YD9A 3ARUA 3VGBA 2QHRH 1CL7L 4LSUL 1FRGH 1BQHB 2Z91A 1A1OA 4LNRA 4OQ1A 5DVOA 1IAOA 4KJWD 3FZUD 3ZDZE 3ZLQC 1T1YA 2Z35A 1XT5A 1GL4B 1GOFA 2CLVA 3EYSL 3LH2L 1RULL 2J6EL 3IFNH 1G7PA 4NPYB 1NAKL 4QHMA 3MRNB 3ZKXC 3RZCD 4C83A 1I3RA 4YLQT 3BVNB 3U83A 4NUJA 1ONQA 4OCWL 2PYED 1I8KB 2YA2A 1U8OB 1QBMH 2AXFA 4JFZL 4I0KA 3RKDC 4CBPA 3QUYA 1UM6H 1I1CA 3VFRA 3TN0C 4PLKC 2X05A 1YEKL 1MI5A 2ZJSL 5CSZA 3PNWB 5DQ9A 5TF1H 5KSVB 4RMTA 3C8KB 3MBEB 4CAGA 3LKQB 1CLOH 3SE4A 3BKJH 4LPVA 2OYPA 4P99A 4OFDA 3QEQB 3D2UD 4PJCF 3C6SB 3BJLA 1ZT1B 1KG0A 3BKYH 4QOKE 5CHNA 4RGOL 1F6LL 4AEHH 3HAEA 5JZ7D 1NL0H 1OF2B 5KS9A 1ZWIB 5L88L 1BBJA 4Y5YA 4DCQB 4PJDF 1MNUL 4K7PX 4DJMA 2DBLH 2DLFL 2E27H 2GITA 3UTQB 4YBHA 1VFAB 3TT1H 5F3BA 5AAWA 4MX7B 5DD6A 4F57H 1MRFL 1GAFH 3BESR 3EFFB 5DSCA 5DHYA 1IRAY 3D9AL 4JFEB 5HYSA 5CJ8A 3VI3F 1FV1B 4NDMB 4QRRB 1FO0B 2OP4H 3D3VA 5GRWA 5D6CB 1MCWM 3GKWH 1JTOA 5CINH 2P24A 2NY6D 3WBDA 3PWPA 5LG1A 4H0HB 4WTWA 35C8L 5KVEL 4QTIH 1I1RA 3LKOB 1N5YH 4X6BA 3MACL 1SM3L 1T3FB 3Q5OA 1SHMA 2CGRH 2XZQH 5TH2A 5FYJD 2A77H 2R23B 4U1LB 2ICWJ 1GXEA 3FN3A 2M1KA 4YBQC 1F3DH 1N4XH 1I1YA 4GMSH 5D6DA 4HGKC 2D7PA 1E6OL 2O5YL 2BXZA 1N6QL 1CS6A 1U42A 4K23L 5HGGS 5HYJD 1EAPA 4M7ZB 2DWEB 3VDAA 1EBPA 5DZLA 3L95A 5DZNA 2BX5A 3GIVB 2D7NA 1UA6L 1INEH 1AXTL 3D25B 1T66C 1KYOK 1QVOB 1RZ8B 1ROWA 5B39A 3FT2B 5ACZA 2VWEC 2GAZA 5IOPB 5JXEA 1FN4B 4PRIE 1GZQA 3BMWA 2UV3A 1JPFA 3TCLA 4GBXC 3TVMC 5E1AA 3WCYA 5F44A 2NY2C 3E6HB 2DM2A 1U58A 4G7VH 3TN0D 1BLNB 5HGBA 1SYVB 5IWLC 5D9SB 4JFYA 4UT9H 2AV7A 4K7FB 4J4PA 4QNPF 2GJ6B 4Y16A 3G9VA 5DO2D 1PKOA 2QSCH 4P5TC 1C7TA 5CD5D 3N1MC 1I1FA 3MV11 5T1KA 4HV8B 3NABL 3BWAA 3BRDA 1JNJA 4X4MA 4LCYA 2HJKB 3NAAL 2IFFH 1YUHB 1NFDB 3L6FB 4OCMC 3T77B 1NGYB 1TQBB 3N1QC 3JWOC 1YMHB 1I3GL 4BELD 1RZIB 4PREA 5KJRL 5SWZA 3A6BH 3CZFB 4K94L 3EDEA 3K4AA 3SCMA 3U2SA 4NO0B 3QUXC 5KTEH 1RZKH 3UYPA 5E6IC 2JE8A 3VXTB 1HHGB 3P9WB 4PJ9B 2PW2B 1TCRA 2CLRB 3O6ML 3SN6N 2ZUUA 2W9DL 1I1AD 4DGIL 3AMLA 1O5DT 3WUWB 2IWGA 1TQCC 3G9AB 3OV6A 3ZL4L 4P23B 5IVZB 4HCRA 4O02H 5D7SH 4ZFGL 1G1CA 3AY4A 4ZTPH 4YUEL 4KJPD 3BD4A 4JR9H 2PETA 4NKOA 1MJUH 4WV1A 2VDNH 4FQJL 5T3ZH 2YPKB 2ZNXA 5IB4A 3FB5A 1ZLVH 4ZFFB 2X89D 4MA1B 4KZEH 1V7NL 3I02B 4IOSD 3UJIH 4HS3A 12E8H 3QIWB 4Y5VA 5L2JB 8CGTA 1U8IA 1EXUA 2EE6A 4MJ4A 2DBJA 1I7RB 4MJ6A 5E8EA 1WFOA 3OSKA 4XWGL 5LAXB 1UFUA 1BF2A 3IAPA 3RJQB 2VDLH 4OIAA 1I9JL 2DS4A 3QFJE 5F9AC 4OKDA 5EWIL 1FH5H 4BFIA 5FYLD 1X4ZA 1YEGL 2L7JA 1CCZA 1MSPA 4F7MB 1X44A 5BZDA 1AY1L 3O3UN 2VISA 4PS4L 3TPUB 4LLYA 3FOMA 1PEWA 1B90A 4NT6B 2ERJB 2Z9TA 4GKZA 4Z9KB 4R7NB 1R3KA 3TVMD 2DJUA 3VG0L 5GHWL 5DMYA 2NY2D 3ESVF 4MXQC 4IRSB 1DBKH 1DQLL 4QHUA 3SKOA 4XCNA 3WNOA 1G7MB 1ZXQA 5E9DB 1E4JA 1I7TB 4UAOC 3V5KA 1GZPB 5T3XL 3BZDA 8FABA 5ESVA 1HZHL 1JPSL 3H42H 3TBWB 1PG7L 4TUKL 4A6YA 1RV6X 1PEZA 2RFXA 1EMTL 5EOQH 5L6YL 5K9JL 1OW0A 2XN9E 1MCSA 4R26H 4LAQL 2XZCL 3R0NA 4KMLB 3HHRB 3VRLE 3ARYA 5IF0A 1Q72H 4ZODA 1CZ8L 5EO0B 4G6KH 3IDXL 2ZUQB 3RBGA 2CUMA 3OKLB 4XBEH 3QH3A 1PZ5B 4TVPL 5E6ID 2YMXL 4PRPD 3M07A 4NCC2 1DCLA 4NSKA 3QHZL 3WEXA 2VXTL 3UTTB 5DS8A 1KT2A 1KB9J 2GW5A 1CU4L 1UXWA 2RBLA 1MREL 1MCOL 1G0YR 4I3RL 1F4HA 3HI1B 1UKSA 5D2NE 4OZIF 4LSQL 1DSFH 4PV8B 5ALCL 4PP2A 5F89B 1HCVA 3VFNB 4QT5B 1CIUA 1ORSA 2FH6A 5SWSE 1PAMA 5DHVB 2WUCL 2JIXD 1LO0L 1NBZA 1XGTB 4G6MH 1GCFA 1FAKT 1AI1H 4OLWH 1BQLH 1UWXH 3O81A 1BWWA 3C5ZD 3ZKXB 3BEVA 1IFHH 1A6TA 3SDAA 3QHFH 4HW6A 1G7HA 4G80A 3LEYL 1MQKL 4JE4B 3NACL 4UT7L 4QWWC 3S36L 1OT2A 1MJJA 3RFZC 1F4YH 4EJ1C 3U0WL 3EO9H 2IALB 3ZKNC 4YDIL 3CLEH 2BOCA 3QDMA 4EI5A 1MFDL 5I1GH 3BIBX 1ADQL 5HDBE 4JM2C 1L0QA 3RVVC 1KF9B 1OTSC 2DQEL 3IDGB 3ULVH 4GG6E 4HWBA 1T2JA 1G7LB 1Y18B 4LMQI 2FHFA 1S3KH 3WFBH 3BMVA 2GKIA 2ITDA 1HSBA 1NAMA 2RQ8A 3CNKA 2ESVD 2AJZA 1G7JA 2QQLH 5DC9B 4PJXB 5IB2B 3HNVL 2NY1C 3DOSA 4UQ2B 4OCYL 1A6UH 4KMQA 1IQWH 4Y1AE 2E6QA 3GSUB 1SY6A 4L4TE 4LRIA 5EFIB 1TNNA 3GUTA 3HR5B 3V6ZA 4IIQB 4CVWA 4YHLL 2G9HA 4N0RA 5I8EA 2KZ1B 1FYTD 5D1ZA 4MJIB 1Z2KA 2B1AL 3IDIA 5F9DC 2DQDH 3DX8A 1KEML 3HRPA 4XPGL 1I9IH 2YS4A 4PRAB 1NCUA 1KB5L 2ZZUT 3TNNB 5IBUB 3RTQD 3QRGL 4XB8A 5EU4A 4ZXBD 4Q2ZB 3DO3A 2HWZL 1U2CA 2NY5L 3RVXC 3QQ3B 1KV3A 2A9MH 4X7CC 5HVGB 3RU8H 3X12A 4AIZB 2AVGA 3K1KC 5EUOF 1YNKL 3MR9A 1TZIB 4LLQB 5GGRB 3OQ3B 4DKFL 5DI8A 4FQCL 1BP3B 2W59A 4KY1H 4TUOB 1U3HC 2Z4QB 4NRZB 3FRPA 2H2PC 1Q8MA 4L8SB 1TZHA 2EC9U 4TVPD 1GHFH 2BSSB 2Q3ZA 2NY5C 1S9YB 1LP9F 1S9VA 1ZV5A 4FFYL 1WUNT 2OR8A 3S37H 4KJQC 4R4FL 1N8ZB 3P4MB 4J6RH 4Z77B 3PUCA 2J8UE 4OD3H 5F7MC 4L9LA 5SX5K 5BVPH 3LEVH 4WWID 5I1HH 3DHJA 5DDHA 1OP5H 1KJ3L 5IVXE 3ZE2E 3H9SD 3AS3A 3N0PB 1CIDA 4PLOB 2DQCH 4WGWB 5E5RB 4GBXB 2ZSVA 4YH6A 3TVMB 3V0VA 3ZKND 1U8KB 1A4KB 4YR6B 1H3GA 5D5MF 1FVCB 3L7FB 3MCG1 4F9LA 2F5AL 5I30H 5BJTB 4RISH 3IXTB 5CJOH 4NJ9L 1HH6B 5I19L 4LLUA 4GRLC 1OTSD 3OBAA 3VFUB 5BZWA 4L4VA 4NKMB 3GSNL 5C2BL 3QIBC 4G8GB 3TZVA 3HPJA 3O6FA 3QWQB 3KYAA 4NQDD 4KKBD 4H1LB 4HGWA 4GW5B 2P7TB 3TO4B 4D9RD 4P5TB 4B41A 5EZLA 1KELL 3W0WE 2AK4E 1F3JA 2B4CC 5FCSH 5C6TH 2DQHL 3DXAD 5ECJE 4KK9C 4GW1B 1IGIH 3W39B 2W65B 1RJLB 2NY1D 1VGKB 4PGZA 4XXDA 1ZLUK 3N1PC 3P4OA 4NO5B 1NCDH 3WNKA 4L5FH 1MRDH 4NWTL 2YR3A 2YRZA 5B8CC 4RMSA 1XGYH 5KVGH 1J05B 2DICA 3SHSA 4HAGA 1JWUB 2F5BH 1F00I 4M7JH 3QUXB 3PDGA 5CZXD 1BJ1J 5E6IB 4ZUUA 1MFCH 4AH2B 2KQMA 4M7LL 3WL9B 5EC1B 4E41E 4IBLT 3IKKA 4JQXC 3WFZA 5GS1B 2HMID 3SKJL 3JTTB 3O4LB 2OZ4H 4PTTA 1LE5A 2DMKA 3BP5A 5F9WB 1BVLB 2HKHL 4GUPB 1UH3A 2YD7A 3D0VB 1E4KC 2BRRH 1EGJL 1EX0A 2LABA 4ELKB 1RIHH 1CT8A 3GSXB 1T04A 4F7TB 5K9OA 4OM0H 3BSZL 1BBDH 4GW4A 3REVB 3RWDA 4JRXD 2C4FT 3BWUC 1ZVHA 3OKDB 4P2RE 3VWJC 1W0VB 1BOYA 4PY7A 5F9OL 2Y36H 3KYNA 4HK3J 3F7YA 4PBXA 5HDQL 4NO2B 4KJQD 2FYYA 5J6GB 5FYJH 4YHYC 2JK5A 1IE5A 1R0AL 1RMFH 1S78C 1TCMA 4LRNL 4R4ND 3TNMA 3OX8B 3G5YA 4DGVH 3JV5A 4D8PA 4ZUVB 2DYPD 3E3QC 2F54B 3X3FL 4XRCB 4Z7WE 3I9GH 3L3HB 2P44B 1KCLA 2VQ1A 1AGFB 3WIHH 4MQSB 3U7YH 4M00A 4JRYB 4XPHL 3WXVL 5IGXL 1KC5L 4HHAB 4FTVB 4XNUH 1BM3L 2XWJB 3MFGB 3C2AH 5FCUH 1R24A 3QUKB 5TE4L 5BRZA 3VMOA 4XP6L 4HKBA 4ZUSA 2C3GA 3NA9L 3AROA 3G5VB 1XGUA 4PJEA 5DMKA 4E0RA 3HMWH 4GRLD 1T1WA 4PRNB 4RMWA 1E28B 3OHXA 3FB8A 3SKUD 1CL7H 5IB3B 1HKFA 4OD2B 1FNHA 4LSUH 2DQTL 3QIBD 2AS5M 4JPVL 3TA3A 5CKAA 3SDDB 1CDJA 3EYSH 1LD9B 3LH2H 1RULH 5FGCB 4ONFL 3MJ9A 2GUOA 1NAKH 4CJ0A 4F58L 4KK9D 5C0JA 4WHTB 1IT9L 2CDEA 1RZGB 1N64L 5C0IA 4P4KA 1NC4B 4YHZL 1BAFL 4Y2DD 2E7CA 4I2XE 4BQ8A 4X7DC 2OK0L 4OZ4A 4JFZH 2D0HA 1YDPA 5E94A 3V79C 1YEKH 2ZJSH 4YZFE 5EO9A 3RWGB 3FHAA 1XR8B 2OL3L 1BJ1H 1E27A 2X4OA 4LFHD 2VRAA 3NFNA 3MQIA 2LVCA 1ZMYA 1QHPA 5IW1A 1NANH 1NGPL 4PJAB 5BVJA 4F8TA 3KYOB 4JPKL 1JPTL 3EYFA 4Y4KB 4RGOH 5DD0L 2A6JB 2E7LC 4M9PA 5L88H 1MNUH 4PJFB 4Y4HB 2DLFH 2YC1B 2Q7YA 1MFNA 1BZ7A 3BD5A 3TIEB 1QEWA 5HY9A 4F8QA 2OSLA 2BY3A 2IH3B 4NKIL 4R3SA 1HQRB 5FA4A 5BS0B 1MRFH 3VXSA 3V5HB 3ULVE 5KS9F 2C1PA 2ZUWA 3D9AH 4D9LL 3SY0B 5ID0A 3GJFH 4WDIB 1JWSA 3SPVA 1QLEL 4JM2B 3IETA 35C8H 4CVUA 2V6HA 4Z7NF 4XBGB 1YMMB 1IGJB 3RIFF 1FFPB 1FZJA 3H9HA 1T83C 3MACH 4AEEA 4U6YB 1SM3H 3SOBL 3ZTJH 2VZ3A 3QYCA 2I07A 3C5JA 4RAUA 5LGKA 2RJMA 2EDEA 1QRNE 5TDNB 4TUJB 2JELL 1EERB 1FL6B 5IM7A 3D39D 4KK8C 2APVA 4IHOA 5EBMB 3MRDB 4ERSH 1E6OH 3PQYB 2O5YH 5ANMA 1N6QH 4K23H 4DTGL 1WBZA 2VAAA 3MV8E 1GC1C 2HJFA 3VXQB 5KAQG 5IBTL 3DUHA 2J4WL 1UA6H 1AXTH 3FKUS 4O5LL 4S1QL 2DMCA 1DDHA 4OFYD 4JJ5A 1NMBL 1A3QA 1JF5A 2XZAL 2GY7B 2A6KA 3U7WL 2YA1A 4Y19D 5E4IA 3CH8A 2NYYD 4TNVK 4N1HB 5GRXG 3QA3B 5CS7A 3V6OA 4KXZI 3ARPA 1S5HA 3QNXA 1U8PA 2NZ9C 3OXRB 4QHLA 3DVIA 5BOPA 4QHKI 4LHUA 4ZNEA 4OLXL 1U3HB 4HUVA 2GK0A 5EIQA 3MRIB 5BO1L 1ED3B 5CEXB 2FJFB 4RGMB 5AEAA 3DBXA 2ZUTA 3SE4C 3NABH 4WFHD 4Q6IB 5DF0A 3D0LA 2NCMA 3VXUB 2AABL 4N8CL 1CGVA 1WBXB 4I18A 1I3GH 2EEBA 3KJ4B 4NZRL 3ARDD 4MNQB 4HIXL 4JFOB 2H3NB 4QXTA 3DHMA 5KJRH 1MHEB 4K94H 4POUB 4ZUTB 5EB9A 4NUGL 1R3JB 2NX5D 3K7UA 4BH7B 5T1LB 2PYEE 4RQQB 3O6MH 1CGSL 4MJ2A 2W9DH 2NLJA 4QRPD 3CXHJ 4DGIH 4AYFA 5F9JB 1NBYB 3ZL4H 3U0TB 1WGOA 3VGAB 3FOLB 3MREB 1T22A 1ZT7B 1XH3A 3L3IA 4GLRH 2VABA 2X6MA 4NBZB 4YUEH 4R97C 1P4LA 4BK4A 4N8VG 2WP3O 4FQJH 3BPCA 5FOBA 2VO5A 4JFFA 2VXQL 1OWWA 3IJYB 3H2WA 4MQXC 1NDGA 5DQJB 1OAKL 5I66B 1V7NH 3LSOA 5C0GA 3H3BC 3BPOC 4KPHL 3VFMB 1VEMA 1AHWC 4I0PB 2V7HB 3RVUC 1WWBX 4KK8D 1NPUA 5E03A 4S1DC 1CDHA 4OZGB 3T1FB 2P8MA 5DK0A 3JV4B 2C1OB 1Q9LA 4XWGH 5GJTL 2PTTB 2X1XR 3LQAC 1U8NB 1JMZA 1I9JH 1OGAD 4XVUD 2MJWA 1GGYA 2A6IB 1KCVL 1WCBA 3WLBA 3LKRA 4R9HA 5D6DC 4KKCC 5EWIH 1NGXA 4GRWH 3S34L 1YEGH 3S98A 1HCFX 4PGEA 2J12B 3H9ZA 4GRMB 2IAMB 1AY1H 1K3IA 4PS4H 4XMPL 4HUXB 1A6AB 4LKCA 3VFTB 4IJ3C 5HYQB 2G5BB 1FIGL 3VG0H 3BGMA 5GHWH 4PG9B 5I17A 3LN5B 3DX9B 3VXPB 3VGGA 1DQLH 3IDMB 1W72B 2H32A 5JXEC 2YN5A 2C3HA 1OQOA 2NZ9D 3PABB 5T3XH 5I1JL 3QUYD 4ONHB 1HZHH 4WI4A 1JPSH 3VWJB 1PG7H 4TUKH 5LBSL 3SDCC 3LIZL 1MI5D 1DZBA 2EYRA 1EMTH 3QIUB 5L6YH 3G04B 4LPTA 2YBRA 5EU6A 5K9JH 2A73B 4Y16C 2GSIA 5HYJE 1ZLWK 4LP5A 4PYHA 3VI4E 2EIBA 3K0WA 4Z7QF 1CZ8H 4G3YL 3CFBB 2HVJB 5MI0C 4JANA 3IDXH 4HK0A 2EE9A 3G6JE 4KUZL 4DWHA 1P1ZA 3R06A 1HOCB 4TVPH 2YMXH 2E9WA 1M71A 5H94A 3ZHLA 3VWKA 3QHZH 4V1DB 2HVKB 2VXTH 4X6DB 3G08A 5EBLB 2DLTA 2GT9A 1CU4H 4HMCA 2A2QT 3P40A 3D39B 4DVBA 1DP0A 1MREH 5J56B 1MCOH 4I3RH 5FAAA 3E8UL 5EZIL 4ODUA 5FO8B 4LSQH 4J3VA 2BVOA 4HWNA 3OZ9L 2O61A 2FSEB 5ALCH 4XMKL 5I0ZA 5DJ6A 1UZ8B 3D3VD 1I9RL 4MQXD 4RRPG 4ZS7L 2WUCH 2JB5L 4U2YA 1LO0H 3PWPD 3AY4C 3F8UB 3EOBB 3TO2B 1TVHA 1S9WB 1BD2A 1KIPA 1AD9B 2DTML 4S1DD 4WV1C 4YO0A 5DJXA 5L2KA 1U41A 5JIPA 4NM4L 1QD0A 3LEYH 1MQKH 3NACH 4UT7H 2R1YA 3S36H 2AJVL 4Y5VC 2FL5B 5F7UA 1MWAB 4PJHB 3U0WH 1EEZA 3BN9D 3U79A 5KN5B 4YDIH 1II4E 4X5WA 3OWEA 1I8IA 1H3WM 1MFDH 1WBYA 3QULA 1CFVL 5FKPA 1ADQH 1V5JA 1RJZA 3CC5B 2Q6WB 4U3XA 4RFEA 4D0CB 3U6RA 2DQEH 3EJYD 5H37H 2VLRA 3BW9A 3WIIL 3FQUB 2AXGB 2BNUB 3D85B 4J23A 5IEHA 3T65A 1XGPA 1SEBB 3T0EA 5JXED 4JFPB 1ZA3B 3T3MF 4A6YL 3HNVH 25C8L 4OCYH 3IXAA 2C26A 4K3HA 1LE9B 4JREC 1K8DA 4P2CG 1K85A 3TBVB 1A7NL 3ARGA 1J1XL 4J4PD 4R4BB 2O5ZL 2B1AH 4Y16D 3L5HA 2VQTA 1KEMH 1FFOA 4BZ1L 2MHAA 1BHGA 4O51B 4FFZL 3V52L 4XPGH 1JGVH 1D5MB 3RWFA 1FC1A 3EO1A 5FYLE 3TP4A 5T1KD 1KB5H 4QRQA 1OW0C 4J8RB 1PYWB 4LVHB 5J1TC 3AXLB 3QRGH 1MAML 1G1YA 4GMTL 2HWZH 4QXUL 2NY5H 2VWEE 2APFA 4HT1L 3R4DA 4NQVA 5HVWA 1YNKH 1YEDA 2D31B 5SWZD 1NBVL 1X5KA 4DKFH 3SCMD 1PQZA 1AKJA 1OCWL 3V8CA 1DANT 4FQCH 2X2YA 4GXUN 5EZJA 2X4PA 5DJYA 4X4YA 3W82A 4Y8AA 5L8KB 1V8HA 4PJCE 2EO1A 2QR0B 5HTSA 4CDHA 3RUGB 4FFYH 3QUZC 4R4FH 1WV7T 2OS7A 5EUKB 4PJ7A 1I8MB 4PJDE 5H2BA 1X5YA 5SWQB 1KJ3H 5CBEA 1T1YB 1S7RA 1RUAL 2HJLB 2Q20A 2FX8L 5MENA 1CG9A 5I76A 1NSNL 3U30B 3ARXA 1NC2A 3SDAC 4BQ6A 4HIHB 2B4CH 2F5AH 4PRPE 3VI3E 2FJGB 4HWBL 4NJ9H 5BMFL 5I19H 1PJ9A 4CL7A 2Y7QA 3T0DA 1M7IB 4PP1D 3BXNB 5F6IC 5C2BH 3GSNH 3RY4A 4W4OA 4WU5B 4EI5C 1NCWL 1L7TL 2CK0L 1JE6A 2WIIA 3HB3C 5JLZB 3BRGC 1T5XA 2RB8A 1KN4H 1UGNA 2NY0D 1KELH 2JJWA 1FVDB 3C60D 2HRLA 2DQHH 5GZND 2VH5L 1H3VA 3IT8D 1GSMA 1EEUA 4TOYL 1WZLA 2FLBT 4HFWB 4KKLC 4NWTH 5C0BA 5DRNA 3WDIA 2AQ1A 4PRIA 4PTUB 2VZOA 3ECBA 3S5LG 5I9QC 1U8QB 2HFEB 2ZG1A 3C5SB 4UTAL 1L7IL 1DTUA 3MLVL 4M7LH 1BVKB 3O2VL 3RRQA 5CEZL 3SKJH 2DWDA 1P7QA 2BVEA 1HDMA 5D1ZC 2FIKB 2XWTB 2HKHH 1V3JA 1DQJB 1EGJH 4GXVL 3S4SB 3X13B 3MFFB 3SQBA 4HF5L 4TSCL 1DUYB 1J11A 1R5IB 4XCCL 1OVZA 1R5WB 5ESQB 4JN2B 3BSZH 1NFIB 1AHWB 1CDIA 4X6BB 3DMMC 3I75B 2ESVE 3AM8A 1QQDA 4QNPE 4QHNB 3QXAB 1X5HA 1LWRA 1H0DA 5F9OH 3U4EA 4U1SB 3GMRB 3NN8B 4PRBB 3BUYA 2PR4L 5HDQH 1MEXL 3ZDYF 4EVNA 2WV3A 5CGMA 1I1YB 1R0AH 4LRNH 3ET9F 1RZ7L 1FYTE 3OAUL 1XCQB 1O7VA 1T0MB 3VFGL 4MZ3A 2ZKHL 3QEUA 3X3FH 3OR6A 4Z5RA 2ARJA 4Y8DC 5FECA 1U8LB 4Q9CA 3U46B 5D70L 5DFTA 3SE3C 2OTUB 3SKMB 3BQUB 4P3WA 2BY1A 4XPHH 5IGXH 3DSNA 4M4RA 5AUMA 5FM4A 1KC5H 3WXVH 1BPVA 1KXQE 1BM3H 2BVPB 2P46B 3SDAD 4HS6A 1IGYB 2FECL 4JLRB 3MRLB 5TE4H 3ZTJG 4XP6H 3NA9H 2VITB 1KJ2L 2OBGA 3MRJB 4ZTOL 1Y0LB 1RK1A 2X40A 4MZ2A 1U3JA 2IANA 2DQTH 3LKNA 4EI5D 1PY9A 4JPVH 1MH5A 4OFIA 4F9LC 3VXRA 5IJVB 3MRBA 3SDCB 3HB3D 5ETUA 4X7SL 1F3RB 3FONA 4Y89A 4ONFH 3KPLB 4NN7C 4TVPE 4PJEF 1YN7B 4JAMB 5FDWB 2APXA 1NCAL 3L3KA 4F58H 4Y16B 2R0ZL 3O6FC 4I9WD 3UTSB 1NKRA 1VFUA 4UT6L 1IT9H 5AYUL 5I8KL 1ND0B 4KKLD 3VFVB 1N64H 2W9LA 4YHZH 1BAFH 2BK8A 4P4RA 4R90L 4GKNB 2OK0H 2V2TB 3H9SE 4JQVA 1J0ZA 4UQ3B 3RWIB 4XP5L 4JFDA 5A3IC 5HI3C 4W4NA 5F88A 3UROR 1KTLA 3I3DA 3U36B 2W92A 2OL3H 4K3JL 5T5FL 4O2FA 5D1ZD 2F8VA 3F12B 2W60B 3KNBA 2UUDK 4WU7B 4GH7B 4XZUB 4ALAL 5GRYA 4BSWA 1NGPH 2AJSL 1CFNB 3EJZC 1FVEB 1YMME 3DARA 4JPKH 4D94A 4FXKB 2FX7L 1JPTH 2VXSL 3GI9L 5KZCD 5DD0H 4MMXC 3B9DA 4LLDA 2X4UB 1I85A 3FO1B 4NQDE 4P46A 1ZGLM 4YHNB 1D9KB 1QNZL 3SJVA 4D9RE 4U0QB 5CEZD 3MOQA 3OG4B 4AM0B 3A67L 3DXAE 4U1MA 4RFOL 4WY7L 1EH9A 4QKXB 4NKIH 3BE1H 2ADIA 3IGAB 3TFKC 5DTFA 5E2TL 2VB5A 1QZ1A 5EC2B 4D9LH 1J1OL 5E8EB 5B38B 3IU3B 1QLEH 5CUSL 5I6XC 1OD7A 2NXYC 4M93C 5AYQA 2ZOKB 4AQOA 5BV7L 3QZWA 2EIDA 2OJEA 3N1GC 3RY6A 3ULSB 1QP1A 3SOBH 4GQPH 3MV7A 5MP6L 5EOCJ 3B2VL 3PGCB 2JELH 9CGTA 1EEYA 1A6ZA 1KGCD 4OIBA 3FFDA 1DBBL 4P9ML 3HFML 3QB7C 4BSVB 4UUJB 4OZIE 2H6PA 3W9EB 2AQ3A 3CSBA 4JRXE 3QI9A 4LEOB 2GJJA 3FQNA 4DTGH 4LGPB 1RSFA 4MMZC 2YD1A 2MWCA 3MLRL 1AGEA 3L7EA 5IBTH 4L4VD 2P8PB 3G6AA 3W81A 1FL3A 3P0GB 3TA3C 3O6FD 3TZVD 4PV9A 1K2DB 4GSDL 4O5LH 4S1QH 3VE0B 4NQEA 4CU6A 4KRPC 4ZG1A 4P2OC 5M7QA 3BYYA 3RWJA 1NMBH 3ESUF 5ERWA 4BFGA 3MLYL 2XZAH 5HXMA 1YC7A 3U7WH 1YNTA 2Z8SA 4WNQA 3CFCL 3GMPB 2MMXA 5HI3D 1ZA6B 3V4UL 3UZEA 4HG4K 4NKDA 2E9IA 4X5XA 5LVEA 5F6HJ 5C09B 5DC0A 2OR9L 4BH8A 4OLXH 2CDFB 3V2AR 2AQ2A 3HAEH 4JFQA 3F7VA 5J4MA 5DS8B 2P47B 3MO1A 3EJZD 1MPAL 5BO1H 1UXSA 4NRYA 1D5BA 5MHSD 3QUZB 2A74A 4N1EA 5E7FA 2AABH 3O6LL 5KSAC 2X70B 1Z0NA 2YXFA 4N8CH 3KHOA 4PP2B 4NZRH 5GGSA 1R3LB 3FAWA 4HIXH 2NXZC 1J8KA 4HX1B 3C8DA 4NUGH 3ARTA 5DURB 3MRGA 3LPWA 1F90L 3NIFE 3TFKD 1Q9KA 3VFSA 2EIZA 1KIRB 2JJTA 5IW6A 1CGSH 2FBOJ 3NIGF 2CR3A 3BD3A 5E8PB 5FO9A 3MJ6A 4ODWA 1FL5A 4XCFL 3GJEA 1LGVA 4WVRA 4QRTA 2NXYD 3QQ9C 2GY5A 2PN5A 4YK4C 5JOPD 1F6AB 1MCIA 5F6IB 4MSWA 2MFNA 3QDMB 3L9RB 5GGVY 2VXQH 1M7XA 3PGDA 3CPLB 2J3SA 1OAKH 5MEOA 3GB7A 1YY8A 1JRHL 4KPHH 2ED7A 5IQ9B 1KLGA 2VR4A 5EUOE 2CLZA 43C9B 4OF7A 3HG1A 5IHBA 3NZ8A 2VAJA 3KWWA 5DEGB 5J12C 2XKUA 5GJTH 3UP1A 1U8MA 1FG2B 1HH9A 5BRZD 5D72L 4OCXL 1NAMB 5EIIA 3RPIB 5IHZA 2WQ8A 5EORL 1T21B 2XIDA 4PRHB 1LP9E 1KCVH 4WENB 5D7JA 1XF3A 1P69B 2PO6A 1X4YA 1NUDA 3GMNA 1I7UA 2BY0A 5E24E 1ZGLB 2YZ8A 3S34H 1A2YA 2EYTB 3TA3D 3X17A 1HSAA 3GMMB 2F8XC 3GJFB 1PKQA 2Z93A 3TYFA 4XMPH 5JORB 2G9HB 2IH1B 1FNEB 3GHEL 1S7VB 3G5XB 3MCLL 2NTFB 2BC4B 2CKBA 4MD4B 5H37G 1FIGH 2EEDA 3ZHKA 1TPXC 1F5WA 4CVXA 4GAYB 3WS3B 2Q86A 3S97C 5HHPB 3KS0J 1CI5A 5D5ME 3PL6C 4PD4K 4P4KD 4BJLA 4P9HC 4MCZA 4APQA 5JHLL 4V1DE 1WEJL 4AY0A 4LCWB 1UKTA 4H8WC 3VH8A 5I1LB 1CFQA 1T6WA 5AD0A 3KLAA 5I1JH 3DMMB 5DJ0A 3D39E 3ZT5A 1P5VA 4DKEL 3O45A 3V6OC 5LBSH 2N56A 3LIZH 1ZHKA 3AUVA 4FRWA 5D7IA 3AS2A 4Q9QL 3OR7A 1A4JA 4OBSA 3MRKA 1D6EB 1U0QA 3F58L 4G3YH 3WLWD 5DRWA 3P77A 4Z7VA 1XF5A 2FWOB 3HE7A 1HHHA 1WZ1L 1OL0A 1CL7I 2GCYA 4KUZH 4MNGA 5EULV 3OJ2C 1XF2A 4PJGF 3F65A 2X1OA 1JHLL 3KPOA 1HXYA 4I18C 4OTXL 5LQBL 2G75B 4Y19E 1G9NL 3O3BA 3EZ8A 3ARQA 4MDJA 4DUXA 1S7SA 1U91A 3E8UH 4HDIA 5EZIH 1IAKA 3VXSD 3QQ9D 4HZLB 5SX4I 3OZ9H 4N0FB 4C4KT 4XMKH 4NOFA 5DWUL 4BA8A 1BOGA 3O9WC 1I9RH 4ZS7H 4Z76B 3TBYB 1BQHA 4LLUB 2XTJB 3WFCL 1NBQA 4HUUB 4U31A 3CX5K 4NFBA 1JGLL 4NN7B 1RIUL 3MRQB 3MTRA 2DTMH 4DK6A 4NPYA 5GS0L 1XGQB 4WFHE 2VYRE 3S3JA 3O6KL 4NM4H 4HGWB 1CLYL 3VRJB 3MRNA 2ZSWB 1G6VK 2R2HB 3BZ4B 4PIRF 2AJVH 1G7IB 5GSVB 1F3JB 3BVNA 4NO3B 3QSKB 3U4BH 4KTDL 1I8KA 4NQXB 4CADB 1U8OA 4LGSB 3WMSA 1CFVH 4HH8A 2NX5E 4Y2OA 1RURL 2PF6A 3VG9B 1HHKA 3SE8L 2ZUYA 3CUPB 4QRPE 5KSVA 3PNWA 3C8KA 4P0DA 3MBEA 1X9QA 3WIIH 4PG2A 3LKQA 2J8OA 3BP4B 1SVZA 4YBLC 1XGRB 3PXJA 4PLJD 3KDMB 1J0HA 3BN3B 2R0WL 3QEQA 3C6SA 3WFHB 1ZT1A 1JV5B 4A6YH 25C8H 3NFPB 2VSCA 3FO9B 1OF2A 1ZWIA 3AU1B 4DCQA 3MRPB 4LFHG 4ODHL 7CGTA 1KXVC 2FX9L 3QNZB 5LCVL 3UTQA 4EIGB 1A7NH 1J1XH 3HCVB 4S1SL 2O5ZH 4XPTL 4LHUD 4LHJB 4MX7A 1OGAE 3T0XA 1A8JH 4NNPL 4BZ1H 3EFFA 4FFZH 4GRWB 3V52H 3P73B 4JFEA 4FA8A 3JTSA 1FV1A 3DGGB 3F7YB 3H0TB 1AH1A 4NDMA 4QRRA 1FO0A 5D6CA 4M93B 1CQKA 1TTFA 5T1MA 3SGJA 1MAMH 1B9ZA 4GMTH 4ZO9A 4QXUH 2KZWA 4PGDB 4CMHC 3LKOA 4HT1H 1CFTB 1ZHNB 4UI2A 2D7QA 4YDKL 1X5IA 4OGYL 1T3FA 5TQ0L 3PWVB 1NBVH 2C4XA 4F37K 1OCWH 3WO3B 4U1LA 1IQDB 4MA3A 3L5IA 3VWKC 3EFDL 4JDTL 1HYRC 1V3KA 3BDYL 1FAIL 1NCTA 3BPNB 1A1NB 3IDJB 1GYAA 5DMKB 3GBLA 2XA3A 5DMGC 1MI5E 1H15B 1FNLA 1X7QB 4LVOB 5DJAB 2VDPL 2MNUA 2DWEA 1IM9B 1DVFA 4JFFD 5A1AA 4XT1C 4YQXL 3GIVA 4WI2A 5B3NA 4KRPB 1QSEB 4P2OB 1RUAH 3D25A 1RZ8A 3PG2A 3FT2A 2FX8H 2Y23A 3L3GB 4HS8L 4L3EB 5HGAB 5TQ2H 5IOPA 1FN4A 1NSNH 3QDJB 4PJ7F 4JCMA 5KS9E 2R39A 1NUGA 1F11B 4HWBH 2RAMA 4FNLL 5BMFH 3E6HA 2HAZA 2RR3A 3TT3L 5IEKB 3O41B 4I5BA 1BLNA 1SYVA 4OZ4B 2M8XA 5D9SA 3FTGB 4XPFL 5F97E 4K7FA 5JPMB 1NCWH 4Z7NE 1T7VA 3DYOA 1L7TH 1ZLSL 5IG7B 2CK0H 5E94B 3EW3B 4RBPH 1E0OB 2V9QA 2GJ6A 4IM8A 2H2SD 1G7QB 2XACC 1R3HB 2QKIB 1SJHA 5FUCE 1QTYT 3D3VE 2X4TB 1SYSB 2MPAL 2VH5H 4LIQL 1A1MB 2Y72A 3PWPE 4HV8A 4TOYH 5LWYL 4ZS6D 5KSAB 4X7TB 2UWEB 1AQKL 2HJKA 2YN3A 3B2UC 4GLRI 4Y4FC 1YUHA 4C56B 1NUNB 5D96C 1NFDA 2DB8A 2F9BT 3L6FA 4Z7OF 3T77A 1VCAA 3NCCB 2NXZB 1YMHA 4PYGA 2XY2A 4FFWC 1J86A 1RZIA 4UV4L 4XNYL 3CZFA 4UTAH 1L7IH 4NO0A 4O2CB 3MLUL 3MLVH 4K9EL 3WJJC 2FEDD 4FP8L 2ZCLL 1HHGA 5CEZH 4PJ9A 4K2UL 2PW2A 3UBXB 3OGOE 2CLRA 4QGYA 3WUWA 3ARGC 2G5RA 5J13C 1JTTA 1Q9OB 1JJUA 5FA4B 3T0BA 3WE6B 4P23A 5IVZA 1JFQL 4YK4B 3NCFB 4UBDC 3NCYS 4WRLA 2Q1EA 4GXVH 4HF5H 2VZTA 4U6TA 5HVFB 4TSCH 4G43B 5DLML 2ADGB 3NGBC 5CGYC 1MCBA 4F2MB 2NQCA 4XCCH 1ITBB 4Q97A 2YPKA 4QRUB 3EO0B 4ZFFA 2LQRA 2XWBB 3Q3GB 3I02A 4HKJB 3QIWA 2K3TA 5L2JA 3VWKD 2BSRB 4RAUB 4KJYB 1I7RA 3W2DL 3NOIA 2DAVA 2PR4H 3TCXA 5LAXA 4LVNB 1MEXH 4K3DL 4J1UB 5DMGD 2YD6A 5KVFL 3ZDXF 3KYKL 4F7CB 1RZ7H 4MLIA 2XKNB 3OAUH 4JZNB 5IJKA 1OSZB 3KGRA 1CGTA 3RDTB 3VFGH 2ZKHH 2AEPL 3MUGA 4JGJA 4F7MA 2HJFB 1KNOB 3OKKB 5D70H 5DUPL 3TPUA 1FLRL 1BD2D 2EZ0D 5TFSL 3LPFA 4I4WB 4WHDA 4X8XA 4NT6A 2M26A 5L2KD 3GSWB 3QXTA 1NCBL 4X4ME 3RNKB 4R7NA 3S3SA 4IS6B 3PL6B 2B2XL 2JJVA 3T4YB 1FBIL 1YEIL 4IRSA 1KJ2H 3PGFL 4ZTOH 1MFAL 1G7MA 1QSVA 1FG9C 1KOAA 5SWZE 4MB3A 5E9DA 1I7TA 2YOCA 1GZPA 2EE3A 3BRFA 4X7SH 2OX5A 2UVEA 3OL2A 4JY6B 3TBWA 1UCBL 3D69B 2VLRD 1NCAH 1AXSB 1P4IL 4W4OC 4E42B 3KLHC 1J87A 2R0ZH 4HUVB 5EU3B 4UT6H 5AYUH 3B2UD 4WCYL 3B5TA 2OI9C 4R90H 1AGBB 3T0ED 4EEEA 4CU8A 4XNZC 5EO0A 3D0LB 5HYEA 4JKKA 4XP5H 4TNVF 2VTFA 3OKLA 4WTZA 2ADJA 1PZ5A 4KDVA 4Z7UB 4TTGA 3D18A 4C57C 4K3JH 5T5FH 3ARBC 3UTTA 3I2CL 3ARGD 1LEIB 3HI6L 4YWGL 3OB0H 5F3HB 4ALAH 2H1PL 4NQCA 2ZOLB 2AJSH 3UYRL 3HI1A 3IU4L 3O9WB 2FX7H 2VXSH 3GI9H 3CFDB 3HAEG 4PV8A 4M6NL 5CGYD 5F89A 2M2DA 1IC7L 1UB6B 3VFNA 4QT5A 5CBAA 4WI3A 4NNYA 1QNZH 1BJMA 3UBXI 1Z0MA 5DHVA 2FCBA 3A67H 4RFOH 4WY7H 4FQXB 4OI9A 5ADPL 2RIKA 1AKJD 1B0RB 4D3CL 5HYSG 5E2TH 3AM8C 4JB9L 1J1OH 3UTPD 2WINB 2IALA 1IAIL 1NGZB 5J1AB 5CUSH 4Z7QE 1VESA 1J8HB 3HPLB 1EAJA 1DN0A 1A0QL 2YD4A 5BV7H 3MA9L 2X10A 3IFOA 1RAMA 1VFOA 3MJ7B 1IC1A 1MCWW 3IDGA 5MP6H 3B2VH 4I8DA 4LBEB 1G7LA 1Y18A 5CILL 4LCUB 1DBBH 2QTEA 5JW4Q 4P9MH 3HFMH 5MEND 1QUNA 1QPXA 1AXIB 1NC2D 3K1DA 4P2YA 4PJXA 2D7OA 2EDTA 4UQ2A 1EHLL 1ERNA 1C1EL 3GSUA 2DOCA 5EFIA 4JO4L 1CFSA 4BKLB 1T7ZA 3UYOD 3MLRH 1UCTA 3HR5A 4IIQA 3KPTA 3IB4A 4ZD3L 4G6FB 5B39G 3FB6B 4MJIA 4GSDH 3V0AC 3MLYH 5EU6B 1UJTA 1VB9A 4K55A 1FDLL 4MXWL 3CFCH 2VLKB 3QQ4B 3TNNA 1JZ6A 5FK9B 4CMHB 4YFLF 3V4UH 3H6JA 2Z31C 2AKRB 4Q2ZA 3SGDH 5C0BD 1W0WB 4YNYB 5EH1A 2ADFL 1BGXL 4PRID 5KOMC 1AC0A 3QQ3A 3Q1SL 3AFLA 4DOHB 3VFPB 4AIZA 4JQVC 5I18L 2BDNL 2OR9H 1TZIA 4LLQA 3TJHC 5GGRA 2HLAB 2XXCB 3MOBL 4OZFH 4TUOA 2Z4QA 5B4MC 1MPAH 4NRZA 3B9VA 2J2ZA 1T20B 1ZVSA 4L8SA 3QDME 5IROA 1P7QD 2BJML 1FNAA 3UAJD 1NH6A 4MWFB 4U6VL 3MRFA 1S9YA 2BNQA 3O6LH 3T3ME 3U1SL 3ARZA 1UENA 5DMJB 3RP1A 4Z77A 1YPZA 2P5EB 1OTUC 2P8LA 5BCAA 3WYRA 4I9WE 1OSPL 4W6YB 1WK0A 4ZYKB 5TDOB 1F90H 1MHHA 5E2JA 3FFCB 4ISVB 5GS2D 1VA9A 4OCSL 4YO0B 4GBXA 1U8KA 4XCFH 2R2BB 1A4KA 4YR6A 5JOEA 2DIAA 4PJ8B 1FVCA 3L7FA 4DZ8B 5BJTA 3LEXB 2FRGP 2QV2A 3IXTA 5C0ND 1F2QA 5IWLA 4OF0A 1HH6A 3UZVB 3TF7C 3VFUA 1I8IB 4NKMA 4F7EB 4POZC 3EOTL 1RHHB 5DFVC 4G8GA 3D48R 1JRHH 5CJ5A 4H1LA 4GW5A 5F8QC 1M7DB 2P7TA 3TO4A 4P5TA 2BNRB 4DAGL 3QXVA 4GW1A 3W39A 2W65A 1JNLL 1RJLA 1EO7A 1VGKA 2EDDA 3UPAA 4DEPC 5CEZE 1NCNA 5D72H 4OCXH 4Y4FB 3AB0B 3O11B 2DLHA 2NY7H 5EORH 3W11C 4W70A 1FC2D 3FO2B 4TSBL 2CRYA 2QSTA 1J05A 1KJVB 1TLKA 3CVIL 2Y4SA 3QUXA 4ZPVB 3VXRD 1ZLVK 1QO3B 4AH2A 5C6WH 3WL9A 5EC1A 3GHEH 4NJAL 4HKXB 5GS1A 2W1NA 3JTTA 3MCLH 3O4LA 3EDDA 4U1IB 5GRJL 5A2LH 1BVLA 4OZHB 1EO8L 4F57L 1IBGL 4U05A 2EDXA 3D0VA 3NGBB 3RWFB 5JHLH 4ELKA 3DI3B 3TM6A 1WEJH 4XVJL 5C07B 3QO1B 1NEZB 2DKSA 4F7TA 4JFDD 1LHZA 1KGCE 4DKEH 3REVA 3PHQB 3MXWL 3L3JB 1S7XB 3HZKB 3OKDA 5ITBL 4NQVB 4Q9QH 4G6AC 1YEDB 4BFEA 1N5AB 5F71A 4HWEL 2X4PB 4NO2A 2BY2A 1FPTL 1ZTXL 3HNTL 5J6GA 3F58H 2VDML 2E7BA 4L4VE 1HQ4B 4OLVH 1OTUD 1WZ1H 4KDWA 2HLFC 5FOJA 3NIDF 3I6GB 3OX8A 4P46D 5FF6B 4ZUVA 3SJVD 2F54A 4XRCA 4ZSOB 3L3HA 1JHLH 1G9ML 1AGFA 4KVCL 4OTXH 5LQBH 3I6KB 4HQQH 2ED8A 4JRYA 3RA7L 4HHAA 4FTVA 1DBML 4L8CA 2XWJA 3NCYP 4H25B 4OGZA 4Z7VF 1S7WB 3QUKA 4UDTB 4NZJA 2V9RA 3BH8B 3G5VA 2IQAB 4PRNA 5DWUH 1E28A 2BXYA 3VGHA 5IB3A 4OD2A 3GI8L 1YEFL 5DFVD 2VN7A 2P4AB 5FGRA 4CGTA 3WFCH 1NLDL 2OTPA 3SDDA 4FFVC 4MNHB 4BZ2L 4JGUA 1LD9A 1JGLH 1RIUH 1KCKA 5GS0H 5MHSE 1T5WB 3V7AE 2WWMC 3O6KH 3MV7D 1CLYH 2I25N 5IMLB 4WHTA 2QQNL 3OKEA 2OI9B 2VR5A 4XWOC 3BHBB 1RZGA 2AJYH 2HFTA 2R1WB 2AP2A 4KTDH 2NR6C 1NC4A 4MDIB 1JP5A 4XNZB 5CWSB 3PWLB 2UZIL 3ZDYE 1I4FB 2VSDA 1RURH 4F15C 3QI9D 2CKBL 1VEPA 4LPXA 3SE8H 4L9DA 1VADB 1VEOA 2A9NL 3ARBB 4DVRL 4MB5A 2DKMA 4K71C 2PO6C 4RAVB 5AWNL 3V6BR 3VW3H 1XR8A 3ILPB 3SGEI 4Y5XB 4WW1B 5JOPE 4XPBL 1TXKA 2F53B 4NQED 4M43L 5CSBA 1QOKA 1U92B 4PJAA 1LNUA 3MNVB 3KYOA 4N5EC 4OFVA 1TNMA 4RA3A 5C92A 4Y4KA 2CPCA 5HHNB 2A6JA 4LNVA 4G9FB 3FRUA 5GSRB 3CSPA 4P5MB 4JG0L 4PJFA 4ODHH 4Y4HA 2FX9H 2YC1A 4P2QA 4P57A 3TIEA 5LCVH 4G6AD 1ZEAL 2IPKA 4X6CB 2DF3A 3AGVA 1SBBA 4S1SH 1FNSL 4RDQF 5BRZE 4XPTH 2IH3A 2RHEA 4H5SB 4OV6F 4MXVF 4PJEE 5BS0A 4NNPH 4M7KL 3V5HA 1NMCC 3U4EB 2D0FA 2V9TA 3CAFA 3SY0A 4WDIA 2HLFD 3IFPB 4JM2A 1WIOA 2IBGA 2K1MA 3K80A 1MFEL 5SX5H 5JDSB 4XBGA 1YMMA 2Y1VA 3MV9B 1IGJA 4L1HA 4X8JA 4YDKH 4U6YA 4OGYH 3DTXB 5TQ0H 1HXMB 3HKFA 4QO1A 5HGDB 3DYPA 5TDNA 3FRPG 2ICCA 4TUJA 4J3TA