4JR9L

Crystal structure of nitrate/nitrite exchanger nark
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
211
structure length
211
Chain Sequence
b'DILMTQSPSSLSVSVGSSVTITCQASQNITNYIVWYQQKPGQAPKLLIYYTSTLESGIPSRFSGSGSGRDYSFTISNLQPEDVATYYCLQYNSLLTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKNINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrite extrusion protein 1
publication title Crystal structure of a nitrate/nitrite exchanger.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein/immune system
total genus 49
structure length 211
sequence length 211
ec nomenclature
pdb deposition date 2013-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jr9L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jr9L01
3Q48A 3BHBA 2ESVD 1J0HA 4MDJA 2VQTA 1GZPB 2VYRE 2NX5B 3GJFK 3HZKB 3X13A 5L0QC 4EDXB 4P57B 5DHVB 2C3VA 3V7MA 4F7EB 4O9HH 5D2LA 1S9XA 4RAUB 4NNXA 1TQBC 3RWGA 1QPPA 4LK4A 4RWHA 2Y6SD 5EORL 1HDMB 4KJWC 1CDBA 4GW4A 2CJUH 1WBZB 3C2AL 4CJ0A 1S3KL 2O26U 2CQVA 5CS7A 5IB2B 4CDGC 4PJDA 1PEWA 3QAZC 1U3HB 1PG7H 4OLWH 3SHSA 1OF2B 1ADQH 1Q1JH 4TNVF 3JZ7A 1KNOB 4J6RH 3KPQB 2X4SA 1EO8H 2YXFA 2V7NA 3CLEH 4XPHL 1A5FL 1KLFA 3A6OA 3ES6A 5KAQG 3ZDYE 1KEMH 3WFBH 1F4YL 3IDMA 4A2LA 1C12A 4K7PH 3S37H 5GQBA 5DK2B 5JXAH 3DVIA 4OF3A 4PLJC 3SDDC 3QNZB 3H9YA 5ELIA 4N90D 4Y2DC 3VGBA 1FAIH 1NCAH 2G2RB 1BEYH 4HS6B 5E4IA 1SJXA 3CXHJ 4JQVC 2HJKB 5BOPA 4P3CL 4G6AD 4I77L 3BEVA 3D0VB 4ZUWA 3KLHD 4C56D 5I1AB 3D3VE 2KH2B 1G7QB 3O3BB 3VGAB 3TH2T 2XQYK 1BF8A 4DKEL 5IBLD 5E56A 1MJUH 3VRJB 4BH7A 4Q97A 4E41A 4JGUA 5T3ZL 5HTSA 2X4QB 5INDA 2NW2B 5A1AA 1ES0B 3HZYB 2GJZB 4NCC2 3QDMD 4PGEA 4HV8B 1DVFA 1FH5L 3PV6A 3UTSB 5HYFA 1P84K 1R3IL 2GUOA 1IKFL 4HWZB 5EOCH 1GGBH 5JTWA 5SWZD 2F8XC 3EGSB 1K4CB 4N1HB 3WNKA 4HUVB 5F70A 3O3DA 3QULB 4CN4A 1BVKA 5B39B 5I8KL 3VFPB 1UWGL 1UA6H 4ZTOH 3U9PH 2EH7L 3H9SD 2BFVH 1T4KB 4MNGB 3F58H 2EXYC 3BUTA 5CCKL 2BNQA 3RWJB 1DQML 2MMXA 3WFEL 1T66D 3MCLH 4WO4D 5ISZB 4YIQB 1ITBB 5BZWB 5DQ9B 1KELH 3DUUB 3IU3A 4O2FB 4UB0H 4KFZC 4JZOB 4IMKA 4JY5H 5DEZA 3RRQA 3FRPA 1NBYA 3CVIH 4BJLA 1AIFA 1T0MA 4PB9L 3DVGA 5IKCB 4RMVA 5FKAA 2O5YH 4XZUA 3DRTA 5DD6A 5INCA 3KDMA 2HG5A 3U0WH 3RVTC 2P5WB 3KWWB 3GGWA 1FHGA 4PY7A 2FB4L 4K3DH 2IBZX 3AS2A 1BM3L 1A9BB 3IU4L 4OGYH 4QCIB 1UJ3A 3R0MA 1RURL 3L3IA 4HK3N 5F3BA 5CP3A 3VWKC 3VXSB 3SO3B 3KR3L 3D39B 4WI9A 1T0NB 5JHDB 5JO5B 4IJ3C 3TBYB 4WWKD 1MIEH 2P4AB 4UUJB 2O5XL 1UACL 2CLVB 2DTMH 1GAFL 4XWGH 5HPMB 2Q86B 4ZYKB 2JF1A 1I1AB 3SE3A 3S34L 4HFWB 5J1AA 1I7RA 4I5BA 3G5VB 4Q58C 3B8YA 5DJYA 2P5EE 4ZOBA 3UBXB 1MHHB 1XGTB 3DV6B 4Y4KD 4OIIL 1CYGA 2XWTB 2EC8A 3BWAB 1IARB 3VXQB 1KC5L 3ZE2E 5GISL 5LQBL 1S7VB 1K4DB 2IG2L 2VLKB 4LCUA 3ZKQD 1HWGB 5I66B 5F9WC 1S7QA 5IESL 3UYOD 3MV8D 4BQ8A 5DI8A 3RHWK 3WO3B 2IWGA 5ADPH 5JPNA 1PGRB 1DBJH 1N26A 4NJ9L 1GC1H 4Q2ZA 1PDKA 2A2QT 1NC4A 1YPZF 5IROC 4QRPA 5ITBL 4Q6IC 4Z0BH 1BBDL 1FYTE 5FDWB 3K1DA 5DGQA 4GW1B 3FCTA 3OJVC 3LN5B 2VSDA 4X9GA 4BFBD 3P0VL 4HQQL 1HSBB 2WANA 1BZ9B 3AREC 1GZPA 3BPLC 3IKCB 5L9DH 3HZKA 3QI9D 4EDXA 4HF5H 2KZWA 4P57A 5DHVA 3DSNA 1CGWA 4RAUA 3BVNB 3FZUC 4JFOB 2VDNH 3KPRE 4DUWA 1XIWB 2JB5L 1WEJH 5DRZB 2BMKA 1HDMA 2RBLA 5FYJD 2JJTA 2EECA 4ZO8A 3OAZK 2Q8BL 3QB7C 1Q9LA 2BCKA 3P4NB 4NPYB 3O3UN 1RU9H 2HKHL 1U3HA 4ODUB 5HSFA 3MZTA 1Q38A 2XN9B 1QLRA 1CLYH 4LP5A 3GBLA 4JDVA 4Y4HA 3C87A 1CD0A 5CBAB 2FGWL 5GS0H 2ARJQ 5D71H 3TO4C 2EYRB 4LU5H 5C0AB 1R6VA 3P9MB 4Y16A 3W11D 5GGTL 1K85A 3AXLB 4PY8I 3JUZA 5DJ2B 3QNZA 3IYLW 4XP6H 1T1ZB 2D03H 5FXCH 5AZ2L 3QXUA 2G2RA 5AD0B 4DEPC 4HWBA 1AXTH 4TUKL 1IBGH 5LXGH 2WK2A 3FJTA 1JK8A 2YPLB 2HJKA 4XNZC 1WT5C 3OZ9L 1JPTH 2JTDA 3WLWD 1PX4A 5CJQL 3N9GH 1G0XA 1Q9KB 3O3BA 1G7QA 4NT6B 1FG2B 1DANU 2Q3ZA 3CVHB 2DQJH 2XZAH 4PJIF 4XPGH 3IDNB 1BJMA 1XCQB 4XP9L 1G84A 4KHTL 2NW2A 5L0QB 4XBGB 3HZYA 2GJZA 1SJHB 4M03A 4GOSA 4HV8A 3UTSA 1CG9B 1TQBB 2NXYC 3EOAB 1EAJA 1YMHB 3IXTB 3LB6D 1NCDH 4HMCA 3U0PB 2QHRH 5T1DL 2ESVE 5EU5B 4PRIB 2CDFB 1AKJB 1P7QB 1N4XH 5B39A 5E8DH 4B41A 4AH2B 3VFPA 5BVJB 2YUZA 2V2XA 3ARGC 2FRGP 2NY7H 2UWEE 4CL7A 5C0CD 1H3PL 3HI5L 1T4KA 4MB5A 2IPTH 3D25B 1N59A 5LGKA 1A7QH 1DBBL 2CRYA 5T3ZD 3TJHC 2EDNA 1IC4H 3C5ZA 4ESKA 5ISZA 4YIQA 3LEYH 4JR9L 5DQ9A 1G7IB 3Q2CA 4NNYB 4XNMA 4NJAH 2R4SL 1CZ8H 1CL7H 2R0WH 4XHJC 3G08A 4JZOA 5C08B 4YO0B 5ENWA 1QRND 5EUOB 2CMRL 1FAKT 1B2WL 3ILQC 4Y2DB 1OTUD 4YXHH 4C4KT 5F9DC 2A38A 2R29L 2CO7B 5DZNA 5J89A 4H25B 2OI9C 4LMQE 2JJVA 4OI7A 1HCVA 3BKMH 5DR5L 2UY7A 4Q9QL 5HHOA 3GBML 4CU8A 2CPCA 2E27L 1JGLL 1A9BA 4N90E 4WY7H 2DQDL 4QOKB 5T33H 3LMJH 4G8EB 3ZTNL 4OLZH 4PJ5D 3VXSA 1DFBH 3REWB 2YEZA 4LHJB 3TBYA 1LO3H 3FO1B 4R4BB 2CSPA 1P4IL 3H42L 1DBAL 4UUJA 5IBTH 3MBEA 35C8L 2CLVA 5TFSH 4DGVL 1RUML 3UAJD 4ZYKA 3TWCH 1I1AA 2D4FA 4HFWA 3MGTB 5KTEH 2HVKB 2ICES 3I75B 1ZGLB 3HKFA 4MNQB 5I8EB 4GLRH 4WVRA 4KRPD 2Z8WC 2DWEA 1I1RA 4FP8H 4P5KB 1G7JA 1V7NH 2XWTA 5CILH 3BWAA 3VXQA 1RJLB 3BP4B 3LQAH 1HEZB 3RTQB 3STZB 1S7VA 2DM3A 5HYSA 3MRPB 5SWZE 3V0WH 1YA5A 2EDWA 4HXBL 5C92A 2FATH 3MMEA 4CGTA 1IGIL 4DKFH 1P9MA 2F19H 4QTIL 3VJ6B 5JIIA 1QFUH 4QXUH 4WFHD 3RX8A 3OR7B 2VLRB 1HN1A 4OFVA 4LOUC 4M8QB 4KROD 1F8TL 2H2SD 3GUTB 1HHGB 5FDWA 3CFDB 2VXQL 4PJ8C 4GW1A 1BFTA 2YMXL 5I1CH 2H9GB 1GGCL 4NHCH 4PRHB 5TH2A 5MEOA 1OPGH 4Q9RL 3QUZC 4G7YH 5T5NG 5DWUH 2X4TB 2GW5A 4XPAH 1QFWM 1IC5L 2QEJA 2OTPA 4OB5H 3BVNA 3HUJF 4JFOA 5JOEA 3WJJC 5GZOC 2XTLA 1XIWA 2OL3L 1C1EL 5DRZA 4L8CA 4RMTA 1LHZA 3L3JA 3MLUL 3O9WD 3VWKB 5CGYD 5ILTH 2DQCH 4IJ3B 3BIKB 4TVSa 2B39A 3L5HA 4EBQL 5EU6A 4UQ2B 3RUGF 3P4NA 3HRPA 5JIHA 4KMQA 4NPYA 4UIKH 3JWDC 1MFBL 3WFHB 4AEIL 4OLVL 4WW1B 4QRTB 4B5EA 5J4MA 2HJFB 4HKJA 1CTOA 4NQCB 5HHMB 3BSZL 3I3DA 5BQ7B 3ZSTA 5C0AA 1FNHA 3P9MA 2Z8VC 4W4OA 4QLRA 5EO9B 1IM9B 4NQEB 5F9WB 3AXLA 2IMMA 5DJ2A 1F6AB 1MFAL 3C6SB 5CEYA 1N64L 4PUBH 1AHWC 2HFFB 3DXAE 4OD2B 1U8NA 4YHLH 4IOFC 1JF6A 4RGMC 3UYRH 1SMAA 2DJSA 4HULB 5FGCB 1PSKL 2C4FT 5JW5B 2YPLA 2YD8A 4JG1L 5I1LB 2QQLH 1Q9KA 4KZEL 1YPZB 4JFHE 3CVHA 4K07A 1J7VR 5KZCB 5FO9A 1JYNA 2M1KA 2V9QA 3GK8L 3IDNA 4DAGH 1XCQA 3AREB 5I6XC 5J12B 4GXVL 3U36A 3GMPA 4KXZI 4NZRL 3MRGB 3EZJB 3LRSA 3PWLB 5KW9H 1WZMA 1CG9A 2I5YH 3QIWD 4LPYA 1MJ7H 4RISL 5HD8D 2VH5H 2XQBL 3U0PA 3V5KB 4O02L 5CEXB 2HFTA 2XZCL 4PRIA 2ITDA 1UVQA 2CDFA 2X10A 3VH8G 1P7QA 3T4YB 4LCWA 4X99A 3PWPA 2QJDA 3VXMB 1T1WB 3C8KB 3O6FC 4K7FB 1KTDB 3CSBA 3TH4T 5IB1A 4JZNB 2C26A 1UZ6F 4L9LA 3SQOH 4XCFL 3D25A 3I6GA 2EE6A 3W5MA 1R3JB 2X4RA 5EN2B 3S35L 3TO4B 3ZYOA 4X83A 3SDXF 4NNYA 5E24E 4WFFE 4PLNC 2VDPH 3NIFE 2R23A 2NZ9D 1XGPA 2VLMD 3LSOB 5KSAB 3SDDA 3SJVB 1MVUB 2OP4L 3LIZH 3QG7L 4JPKL 2BSRB 2R9HD 5J7CC 4Y2DA 1JUFB 4G43B 4DEPB 5ERWB 2LABA 1LO0L 4JQVA 4XNZB 1DP0A 3B6SB 1KCSH 1U2CA 4L5FL 1AO7B 1OAKL 2YC1B 2AXFB 1CK0H 4G8EA 4M02A 5I18L 3V4VH 4GBXD 5CIPH 4WUKL 5DJ8A 2XTJD 4LL9A 5C09B 2JE8A 4XC3L 5DD3H 4RGNC 5DC9B 1QSVA 3WIIH 3FO1A 1XR8B 2MTPA 3LD8C 1ZK9A 3CSYB 5D5ME 2NXYB 3L3OB 3O2WH 3H6JA 3MZGB 2FX9L 3MRDB 3K2UH 4LARL 1OARH 1QA9B 1TXKA 4U3HA 1S5IH 2VOTA 3QUYD 4NO5A 3I75A 2VXVL 4XCCH 4MNQA 5I8EA 1DQLH 5E2UH 4KAQL 5IFHL 3GSQA 1CD9B 3UJIH 4NBZB 4JFDA 3AAZB 1RJLA 3BP4A 1HEZA 2W9DL 3ARDD 3STZA 1O7VA 3ARQA 3ARGB 4MDIB 4KV5E 5F88A 3E8UH 2GAZB 2OZ4L 4PBWD 4HX1A 4P5TD 3TVMD 5GGRA 4MJ6B 2FECL 3HE7C 1NKOA 4X8XA 1QSFB 4ONHB 5KVFL 4U1IB 5DK0B 5ID0B 2BNRD 1RAMA 2ATPB 2RJMA 1DR9A 1NPUA 4P9HL 3RIAK 4G6FB 3Q1SL 1UM4L 3ZDXE 2F9BT 4RFEB 1I7ZA 3GUTA 3PF2A 1KIPA 5BO1L 3DLQR 1YNKH 4PR5A 4D0CA 4GAJL 4R26H 5CMAA 1YMME 2X4TA 1CTNA 1PY9A 3UTTE 2OI9B 3TM6A 4K8RC 1DLFL 2F5BH 3BH9B 1NQBA 3IFNL 4NUJA 4PGJA 4JFZH 1BGXH 1ZT7B 1KB5L 3IB4A 3HB3D 3TV3L 3FT3A 1HWHB 3MNZB 3JTTB 4DVRL 1FL6B 1TQCC 4MJ5B 1KFAH 3QCUL 5AYUL 5JDSB 3FTGB 1BQLL 3W81A 4UQ3A 3GJFA 3WFHA 4WW1A 1YEDB 1A3LH 1NC2B 3QUML 2BC4A 2G5BB 3DX7B 1AD0B 2DMCA 1IEAA 4KGJA 5DT1L 1R24B 2FBOJ 4PJ5E 4DTGH 1KLGB 4LSUL 4HUUA 4NQCA 3T65B 2M8XA 3NCMA 3LCYA 2BDNH 5BQ7A 3QNYA 4FQXC 2WWMC 5GGUB 2IH1A 4J12A 2LVCA 2PR4H 3HZMA 1CFQB 1IM9A 4NQEA 2A83B 1RFDH 3TC9A 4AENA 4JRXD 4BZ2L 2P7TB 3SKNB 2J6EL 4M6ML 2IAND 2HFFA 2H3NB 3UZEA 4GRMB 4RMRA 2OTWA 5DYOB 5JW5A 5IROA 5J57B 4Q6IA 4JM2D 4MMXC 3KAAA 3WS6C 1YPZA 5E2VL 4IDJH 4PJ8B 4NO3B 3WIHA 4DVBB 3MV9D 2CD0A 1T2XA 5DJZB 3AREA 2N1KA 1EHXA 1IKNC 2ADFH 2F54E 3CX5J 5FOBA 1M7IB 4AL8H 1ZGLM 1AGCB 3MRGA 2EIDA 1U9KA 5EULV 1U8IB 4HK0B 3S8WA 1ZSDA 4GRLA 3UBXG 4HGWA 3L6FB 2ZCKL 3P30H 1Y0LB 3BP6B 3LAFA 2DQUH 5CEXA 5FYKH 4CJ1A 4X8JA 2HKHH 5I1GH 1FGNH 1ZTXL 5IB3A 5FHAL 3NH7L 4JZNA 5TF1L 3LKQA 5HVHC 2D0FA 5FV1L 4Z77A 4WI8A 1JWUB 3WUWG 5EN2A 4IHOB 1MF2H 5ICXB 5B4MD 4A6YH 3EYVB 4JQIH 1LE9B 1A6WH 4RMSA 1LQSR 2AK1L 4X7DC 3ZHLA 4NWUL 3TNNB 5M94B 1M4KA 4UINH 4OZHB 3SJVA 4OM1H 2EDTA 4FNLH 4DN3L 4P9ML 4TOYH 2MFNA 2BSRA 2LU4A 1NUNB 4ZSOE 1AHWB 3VXUB 1JUFA 4G43A 5J1SC 3B2VL 4WUUA 5DVMA 4RGMB 2W0LA 5ERWA 4MHHG 1DE4B 4M7KL 1NMBH 1BOYA 4JFED 3Q5TA 1I1CA 3B6SA 4WI7A 1U0QA 2NY1D 3NIGF 4HMDA 3RU8H 1EJ6A 1AO7A 3LS5L 3V4UH 2YC1A 4WI3A 2VDRH 5FYKU 3VRLF 4OLUL 2K7PA 4PJIA 1MWAB 4WHYG 4YWGH 5I6XB 4QRRE 2VLJD 5D6CB 2CK2A 5L2KD 4X4XB 4HS8H 4GS7C 5FYKE 3CSYA 3T3PE 4DCQB 3MRDA 3ZKXC 1QA9A 5LAXB 3S7GA 2XZZA 3IDIB 4YHKL 4JVUA 4IRZH 2ZG1A 3CUPB 4TTDD 4X6DE 1QVOB 1QKZL 2AQ1A 3GMNA 3AAZA 3VW3L 3O6FB 1EUUA 1DUYB 3OHXB 3BKJL 3WIFB 3ARGA 4MDIA 3CMOL 2GAZA 4LSSH 1EX0A 1I9RL 3M45A 5M7QA 5DO2C 1GHFH 4NM8H 4PTUB 1ZWIB 4DJMA 1MCBA 2NYYD 2ZJSL 4JM4H 4YHZL 2B5IC 4ONHA 1K5NB 1F90L 1JIBA 3SDXB 1MIMH 2Z31A 4HEPG 4DN4H 3HMWH 2I27N 2GSIB 2VRAA 2BVQB 2AJVH 4MXWH 3BW9B 4JFFD 4AEHL 4RFEA 2W59A 4CU7A 5MENB 4U1SB 4HHAB 2AK4D 3LN9A 3MROA 2OS7A 4CMMB 1CVRA 4IRSC 1LILA 3EO0B 5T1LD 2PF6A 3O6ML 1MSPA 3VGFA 3SKMB 1R3KA 5CJBA 1GC1C 1ONQA 4MAUL 3PDOB 1MLCB 3BH9A 4JDTL 2LFGA 1NGZA 4WI2A 1FV1B 5D9SB 5C0BD 4ZFOL 1G6RB 2YK1H 4QHNA 3LZFH 5DLML 4XVJH 2IH3A 1FL6A 4PJAB 4RGNB 3T2NH 5F7LB 4L9DA 4MLSA 3LD8B 4WTWA 4CVWA 5JDSA 3BT2L 3FTGA 3F7QA 2APWA 4XC1H 4X4ZA 5BMFH 4F7TB 4NQTA 4I9WD 1YEDA 1NC2A 3QPQC 4LIQL 3DX7A 1AD0A 3R1GH 5MP6L 1PD6A 1R24A 4P2QD 5D1XA 5FUZH 3I3EA 1S8DA 5D1ZB 2XTJE 2GY5A 4FZ8L 3SKJH 4PTTB 3MCKA 5GSVB 5CP7A 4XNQA 4MAYC 3SKUD 3RWHB 1UH4A 3GNML 4YDJA 5GGUA 3PXHA 3SE8L 1YQVL 4XGZB 2WBJD 3PHSA 1CFQA 3S97C 3ARUA 5F7HA 4WU5B 2P7TA 3SKNA 1J05B 3HE7B 4H0IA 3QRGL 1QLFB 2H3NA 1A4KB 1QOKA 4EIGB 2QADD 5D1QD 5GS0C 3K3QA 4Z9KB 4XAWH 4ZG1A 3L9RB 5B38G 2YMXH 1ACZA 2L0DA 2G60H 4R7DA 1BWWA 3QHTC 4PJ8A 4U1NB 1I7TB 2NXZD 4HXAL 4KMTL 4NO3A 1BAFH 3L7FA 3PQYD 2V7HB 2K9UA 2HFEB 4NBYB 2Y6SC 4MQSB 3QUZA 1TJGL 4LVOC 1KCUH 5CGTA 1V3KA 3LKRA 4ONFH 1S9KC 1VPOL 3GM0A 4KRNA 4HC1H 3ZDZE 2VXSL 1P4LA 3MFFB 1JN6B 1SM3H 5JORA 4TNWK 1BVZA 4J8RA 3AB0C 2V5YA 3WJJA 5T1KB 3HUJA 4M1GL 3L6FA 3GMRB 4PY8J 3BP6A 1T22A 4QHUA 1L6XA 5HYJB 1P5UA 3FB6B 1I9JL 1BLNB 5E8OB 1RUPL 3O6KH 4G80A 3RUGA 4K71C 1UXSB 3D3VB 4JN1L 4OLYH 1U8PB 2VC2L 3ILPB 5CZVL 4R8WH 1SVCP 1U6AH 1QFWI 4ALAL 1MLBB 1JWUA 3D9AH 1MAML 2AJSH 3G5ZA 4NRXB 4IHOA 1H3TA 3QHFH 3D2UB 1LE9A 3EYVA 3H7LA 4G6AC 4PG9A 3TNNA 3KLHC 3RWEB 2HTLD 1CGSH 2X4UA 3HG1D 1WCQA 4BSWB 5IBLC 2AI0L 1CT8B 1IC7L 4RRPA 3ZE1E 1BECA 4MJID 1E28B 2I9TB 2ICWB 2CK0H 1DE4A 4OCLC 5AAMA 2CKBL 4KDWA 1NGWA 3VFUB 1YNLH 1Z3GH 1S7XA 1HXMB 4CADA 4JEGB 3NTCH 2QLVB 4TSAL 2VKXA 3QG6B 2PO6D 2AGJH 1F3JA 1M7DA 2BZDA 1MWAA 4GUPB 1FFQA 3IF1B 3QUKB 4F58H 3IXAB 2MJWA 3G9VA 3P2TA 2AJXH 5D6CA 4X4XA 4LF3B 1MJ8L 1FRGL 4Q7DA 2B1HH 4DCQA 5EU3B 3VMOA 2DL9A 1WFTA 5LAXA 1I85A 3S36X 1MH5B 3IDIA 5HHNB 3CUPA 4E9LA 4JO3H 2MPAH 2X9WA 2X5PA 4XBEL 4WO4C 4XPFL 4R3SB 1DBML 1NLBL 3EO9H 4POUB 4UV7L 5EBWA 2VR5A 4M8VA 4GKOA 3VG0H 4HIXL 3O6FA 4P99A 4GAFB 1DUYA 1FBIL 3OHXA 1T5XA 4PV8B 4F7MB 4M1DL 3HAEG 4YZFE 3WIFA 1MQKL 4Z95L 1A6ZB 2X7LA 4G6JL 1BF2A 2VUYA 2VL5B 5E03A 5HVHB 4M48H 2EDQA 1ORSB 4PTUA 5IT2L 12E8H 2V2TA 1JCKA 4IOIA 4YR6B 3BE1L 2OJEB 5AAWA 1IQWH 2WBKA 4HGKC 2J8OA 5DURD 5JOPE 3SDXA 2RFXB 4KPHL 3T0AA 3MLXL 3LQAC 2BVQA 3BW9A 5MENA 1LK2B 1SY6L 2VWEE 2F53D 3GRWL 5LWYH 4CMMA 3MLPA 2GY7B 4MQXD 5K9QI 2AJUH 4PP1D 1HQRB 4WWKC 2D2OA 1DSFH 5EO1B 1SJEB 4I3GA 1INDH 1GZQB 3DURB 1L7IH 3UXFA 3O45B 5D9SA 4NYLB 2NY3D 3MLTB 3PWJA 4PRPE 4MHHI 5CINH 4Y4KC 3TCXA 4GS7B 1DDHB 1WAAE 3MA9L 2HMID 2RAMA 3OF6A 3RL2A 1W72L 3ZKXB 2W92A 5C6TL 1FYTB 3TT1L 4F7TA 3KG5A 5HHXH 2HRPH 4TNWF 4XCNB 3ALWA 4D9LH 4QO1A 4U1LA 1RVFH 4KJYB 1IAKB 2I07A 1FNSL 4Y19D 4LPTA 5JW3H 2XA8L 4G7VL 5GSVA 2AP2A 4ZS7H 1IVLA 4Q9CA 3RWHA 3MJ8A 1VFAB 1V5JA 1KJ3L 4JG0H 4WI6A 3R0NA 4XGZA 3FN0H 4G5ZH 4AG4L 1OCWH 2G5RA 3KPRB 4U1KB 4WU5A 4NBXB 1A47A 4M7ZC 4CBPA 3HE7A 5C8JA 2B5IB 4HZAA 4WI4A 3QI9C 4JKMA 3RY6A 1MHEB 2AS5M 1QG3A 4JJHA 1E6OH 1IAIL 3ZL4H 2EKSB 5BZDA 2W9EL 4U1NA 1I7TA 4IRSB 4GQ9H 2V7HA 1J0KA 5BVPH 5J6HA 4HFUL 1MRFL 1ULVA 4M7LH 2HFGH 3OG6B 3AS3A 4OBRA 3VFWB 3WNLA 5I17A 3KYKH 2QKIB 4L4VD 1AGDB 1S78D 4ZXBD 5FUOL 2PN5A 3BP7B 1A6PA 5DMYA 3MUGA 5JUEL 3W9EB 1CXLA 1E4WL 3MTRA 4Z5RA 1FNFA 1OP3K 3GMRA 3QUMB 4JVWA 5HYJA 4JKWA 3FB6A 5TPWL 1HQ4B 2Y07H 1BLNA 1NUGA 5E8OA 3HE6D 3W11C 1UXSA 3D3VA 4YHNA 1NCBH 3F65A 3RDTD 2A77H 2VIRA 4POZD 4ZOCA 2X44D 5HDBF 2KPNA 1VFUA 1SBBA 3EDJA 5E6IA 1MLBA 4JHWL 4PGBB 1NAMH 3PP3H 4NRXA 3UO1L 3KLDA 2A74B 1WZKA 4MAYB 3OXRB 4XXDB 3ULVE 5BXFB 2ZNWA 4FQXA 3HMXL 4YDKL 3UTPD 1F4HA 2J6EH 4ODBD 5ALCH 2XKNA 4BSWA 3CDYA 3QPXL 4KVNH 1RULH 5ALBL 5F9JB 1IAMA 4FQQB 1AXIB 4ORZC 4O5LL 1ZT1B 1E28A 2E9BA 3UROR 4JLRA 1ADQA 3I6KA 4P2QE 2ICWA 4XVSH 2ESVB 4M62H 4YDIH 4YBLC 5F89B 1D5ZB 5IEHB 3MUHL 5J56B 4KV5F 3FFDA 1IL1A 3VFUA 3WS6A 5I19H 1TENA 4W81A 2UWEB 5HJ3B 1EAPB 1S9VA 2OM5A 3TF7C 2I26N 4TULL 5DD5H 4R90L 4RIRA 4OCRH 4GUPA 3IF1A 4LVOB 3V0VB 4OLXH 1RUKH 1IKNA 5DMGC 2B8OT 4OD1L 4XB7A 1MUJB 1U3YA 5CJOL 3TYFB 2YPVL 3V8OA 2I9LB 3KJ6L 3QIUD 4LF3A 3PGDB 3QJHB 5I75C 3S3SA 3AB0B 3RKDD 3ARZA 4M5YH 1WK0A 1QHOA 1NGPL 2IQAB 1IZKA 1MH5A 5DHYA 3PL6C 5F1KC 4EDWH 2FHBA 3AFLA 5EWIH 4P0DA 4UT9L 1XZ0A 4GLRI 4GO6B 4HPOL 5JR1L 2YZ8A 4H0HB 3ZZ1A 3C60D 1J1XH 1XF4B 4PV8A 1GPOL 1QEWA 3D85D 2D7OA 3QP3A 2VL5A 3SCMD 2JK5B 3FRUA 5F7NC 4XXCC 4HIEB 5E1HB 2EE2A 3QZWB 2J12B 2VUOA 5A2IH 5F6IC 1V3MA 2OJEA 4JO2H 3T1WA 4RWYL 4C56B 2RFXA 4Y1AD 2R69H 1YY9D 3NPSC 3QDJA 4P4KD 2UV3A 1LK2A 3N1FC 5ECJE 5E9DA 4KJQD 4YFDB 4Q74A 5FGRA 2Y5TA 5FECA 5JMRA 3BGAA 2E6QA 3FQWB 3K7UA 4V1DD 1NCUA 5L88L 2R8SL 2XFXB 1HQRA 4NKQB 4TUOB 4G9DB 3HG1E 5EO1A 3GSVB 4JO4L 2IC2A 2R0LL 1GZQA 3DURA 4FZEH 3UAJC 3MJ7B 1R3HB 5SWZB 4ZFGL 4NGHH 4NZJA 3JV4B 2WBWB 3O45A 5GGQH 4MJIE 3WO4C 4WTXA 5HGHB 4NYLA 2VKWA 3C2SA 3FOLB 2CGRL 3MV01 4ZUVB 4KRPC 5GRZA 1A1OB 5E99H 5GSRB 1JFQL 2XPGB 1DDHA 3IAPA 3SN6N 4G8FA 2DQIH 5D7SH 2NLJB 1K2DA 3HS0B 3MRIA 1E4XI 1T21B 2X1PA 4WO4B 1K9TA 4L3ED 3IVKB 4ZOAA 1A3RH 1OGAA 1IAKA 3KPMB 3WFCH 2BY3A 5TE7L 2GYSA 4OZFG 5GRWA 4NZUH 5IGXH 4U6XB 2F5AH 5DD0L 4JPIB 4FOMA 1QFOA 3U7YL 1VFAA 4E0RA 1FO0L 1I1FB 5L6YL 1BIIB 4EUPH 3JWOL 5DMKB 1NL0L 2Y9RT 1NGXA 4U1KA 2DTSA 4WDIB 4PJGF 4UILL 1K3IA 3EYFB 3ZE0E 2CLZA 4RFOL 5D2LE 4C83A 3O11B 4HBCL 1FN4B 1A6AB 1DANT 1WWCA 3B9KD 4PJBF 2EKSA 4NFBA 1AY1H 4I3RL 4KTDH 2PYFB 1B6DA 4KTEH 4ELKB 3I50L 1I3RA 5HDLA 3O9WC 2COQA 3FO0H 1DN2A 4I2XA 2B1AL 2E8YA 1MY5A 4WWKB 4DW2L 3VFWA 2QKIA 1AGDA 3UTQB 3A67L 4GAGH 3BP7A 4JB9L 5B21A 3HTLX 3N06B 1MCWW 3MLWH 4F7PA 2Q6WB 3W9EA 1CGYA 1O5DT 4JFPB 1OSZB 1BFVL 3DXAB 3OKMB 5BS0A 2DBLL 3KPLB 4WEBL 5GHWH 4Y4KB 1BD2A 4LNVA 4XPTH 3U48A 3OMZA 1A9EB 3QXAA 3K81A 2DQHL 3GHBH 4BFEA 1CICB 1HQ4A 3DMMD 3EAKA 4JCMA 4O4YH 2NW3B 3RVXC 4TTGA 3CPLB 4J3UA 1KCVL 1D9KD 3CZFB 4CRPA 1QBLL 2L7JA 4PGBA 1C5BH 1N2RA 2A74A 2GCYB 3L5XL 4MAYA 3OXRA 3PWNB 1FE8L 4X7TA 1DLHB 5B3JF 3GSNH 2W65A 2P8MB 1T7YA 3KS0H 4QXGL 4U0RC 4FQIL 3V7AG 5F9JA 4E41E 4Z7OE 3MRJA 4FQQA 4PG2C 3D1MC 4M7ZB 1NAKL 4X6DF 5JLZA 1C7TA 5TQ2H 1Q9OB 2ESVA 1UQSB 4Y19E 3TZVD 5HI4C 1Q0YL 1YNTA 1D5ZA 3QI9B 5IEHA 1DN0B 4NQXA 2YUWA 4NWTH 2GIYA 5DD1H 4EI5D 5JXED 1CBVH 4HJ0D 3K4DA 1ZANL 3RBSA 3T08A 1AI1H 3DETD 5HJ3A 2Q8AL 3RBGA 1EAPA 1S7SA 2C4XA 2ZKHL 5EA0H 3O3AB 2XYCA 3P9WB 4APQB 1FCGA 3V0VA 1FZMB 5FOJA 1KN4H 3TYFA 3D69A 1U36A 1U8QB 2I9LA 1ZLSL 5F9OL 3BXNB 5B8CC 4PJFF 4MA8L 3P4MB 3MR9B 2BNQE 2RR3A 4NQSB 1PG7X 4JGMA 4JO1L 2IQAA 3MRNB 3GSWA 4FMKA 1GXEA 3RAJH 3EFFA 3DRQA 3CXHK 1IRAY 5I2IB 5TE6L 4Z0XB 1X6LA 3HI1B 3P4OB 4K7PX 3S37X 4Y2OA 5EOQH 3V2AR 1NFDF 2HH0H 1XF4A 3STBA 1U3JA 4R0LC 5C0JB 5HGGS 2EDHA 4HWEL 4QHKI 3BJ91 3TNMB 1A02N 3M8OH 5C3TA 5IM7B 4H8WH 2DLTA 4P3WA 4C56A 2A0LD 5D5MB 4JPWL 4LHUD 5HY9B 1MAKA 5EZOL 4U1GC 4CN6A 2R0ZH 3PP4L 1I9IL 3QDAA 2WM0A 4GBXC 3MXWH 1X5GA 3LEXB 3K8KA 4YBLB 3T77B 2XTJC 3FQWA 3LS4H 3O2DL 4YGVB 2G75B 5IV2B 1T04A 3IS0X 3UTPE 2AW2A 3QDMA 5T3XL 1CLZH 2YRPA 3RA7L 3GSVA 6FABH 4ENED 1XEDA 3B9DA 3MJ7A 4JQXC 1R3HA 1TCRB 2VZOA 5SWZA 3JV4A 3U7WL 4JY4A 4PP2B 5HI3D 3FOLA 1OP5H 3C09C 4WFGE 4NQDD 3ARXA 4LGRB 4TQEH 1A1OA 3HHRB 1G9ML 3BIAX 2YA2A 4LEXL 5GSRA 2FNBA 2XPGA 5I75B 3C5SA 2IQ9H 1KCRL 3ARDC 3GM8A 3QEQD 4PB0H 5IIEA 2NLJA 3H9HB 4OKDA 3WSQL 5C0CB 2D4DA 2F74B 1FVCB 4BH8B 4P5TC 3TVMC 3F8UB 3GI9L 1PAMA 3PL6B 3BZEA 5D2NE 1T21A 4WO4A 4NN5C 3ROLB 3DX9B 3IVKA 5CIPB 3KPMA 4AIZB 1FVEA 1YMMB 3MJ9H 3ZDZF 4Z7WE 4TVPL 3UTTB 2E7MA 3ZLQC 4P4RA 1XAUA 1CFTB 3CK0H 3MPCA 5DMKA 5FAAA 4HWBH 5GRVL 1A7NL 3VXNB 4WDIA 3CAFA 2P8LB 1UM6L 5F6IB 4F8QA 3PGCA 1KT2A 1UT9A 4HCRL 3OR6B 2JELL 3OKLB 1IJ9A 2NY5L 3NPSB 1A6AA 3WXVL 2UZXB 1CDYA 1XGUB 4LASL 5CWSB 1SQ2N 3M07A 2QTEA 2PYFA 5FYLD 4XBPB 1DBKL 5BW7C 3HB3C 3HNSH 1KJ2L 4PJ5B 1DCLA 3KYNB 3DUHA 1XR9B 2BVEA 4Z7UE 2EIEA 4S10A 4WWKA 2JJUA 4QRSB 4ERSH 3LRGA 3ZE1F 5LGJA 3HFML 3TIEB 3IRPX 1EO5A 3WO4B 2EEDA 4JFPA 1D5XB 2WIIB 3IDYC 3TPUB 2M2DA 3OKMA 3ULVL 1S5HB 1NBVH 4KRPB 5J13C 4LSQL 2PXYC 3KPLA 4N8CH 4Y4KA 1YC8A 2OR8A 4YFLI 3HN3A 4PJ9C 1MCHA 2RGSA 4BZ1L 3B2UC 2NW3A 1TMCB 1TJHL 4OGAD 2ZSWB 4QRUA 1J5OL 4BSVA 4W6WB 3MV8A 3RZWA 3STLA 4NOBA 5H35B 7FABL 4MZ3A 3BD5A 3CZFA 3LVEA 1ZHBB 1ACYL 43C9B 2FJGB 2F54B 1T6WA 4Z78A 3PWNA 4JM2F 4ZUSB 3O41A 1QFHA 4I0PD 2P8MA 3RVUD 4JM2C 3BZFB 4BKLB 1YEKH 4ZO7A 3HR6A 4CW1A 1AJ7H 1GRWA 3NCJH 4JDZB 3MJ6A 1Q9OA 4YQXH 1URLA 3QI9A 3CSPA 4RX4D 5SX5H 2R2BB 4G42B 2MSPA 2CIKB 4OM0H 3P73B 2VSCA 2I60L 1FORL 4PJBB 4EXKA 5BJTA 3SOBL 1R0AH 4DGIL 3O3AA 1CE1L 3O9WB 3LQZB 1KGCE 1MNUH 4H20H 4L1DA 5ANMA 1CFVH 1FZMA 1PBYA 4ODHL 5DFWH 1HCFX 2YUXA 1CXEA 1VEMA 5ADOH 3REVA 3AUVA 1CD1B 3P4MA 2OK0H 3MR9A 2VWEC 1AR2A 4NQSA 1IGCH 2J8HA 4ZSOB 4YHPB 3MRNA 1X5IA 2QSVA 1A14H 5FA4B 4PGDB 4S1DD 5I2IA 2A6IB 5B4MC 4Z0XA 3UJJL 3HI1A 3P4OA 5KVGL 5L8JB 1NDGB 1NDMA 1HSAB 1KIRA 3PP3K 2NCMA 4OT1L 3S4SG 4GG6E 1TVBB 1T89C 4N0RA 2IF7A 4EOWH 2Z93A 3CFIC 4KUZL 4QRRB 2PUQT 3QCVH 1WAAF 5F7MC 4S1QL 2Z0BA 4XPBH 5HHOE 1JZ5A 4U0RB 4X0KB 1IFHL 5HY9A 1EJOL 1BP3B 5K59F 5DF0A 3KLSA 3LEXA 1KBGH 3MSPA 1OQOA 4X6DB 3ZT5A 3U4AA 2GEEA 4GKNA 4A6YB 5IW6B 3BD4A 3GKWL 1G7HA 1TFHA 3C6LD 4KKBD 5KSBF 1CXHA 4F8TA 4PP2A 4KZDH 5CJOH 4TTDC 1J11A 3U4EA 2HWZH 2Z8RA 5B8CB 1BIHA 1LD9B 2BK8A 4NZTH 4N8VB 3H9HA 4M6NH 1A1MB 3CGTA 4X5WB 5C0CA 2F74A 1FVCA 4BH8A 1BZ7B 1MCFA 4X9BA 5DRXB 2NYYC 4W6YB 3ROLA 1WZLA 3DX9A 5CIPA 3J7HA 5L7XH 2DYPD 1YMMA 1A64A 5T3XD 1H0DB 2J88H 3ARSA 4M3KB 2B7DT 1NFDB 4OQTH 1QRNA 8CGTA 3CFEB 4R0LB 3ROOB 1VACA 4XXCA 1CN4A 2P45B 3TP4A 2AQ2A 2P8LA 4XTRD 3GBNH 3NA9L 3OR6A 1MEXL 1H15B 3OKLA 3S88L 2YWZA 3ET9F 4FXKA 4XT1C 2Q7YA 3NABH 4U1GB 1KEGL 3X14B 2VZSA 5I1IL 1NLDL 4X6BB 4XBPA 4GBXB 2XRAH 5J8OA 3BO8A 4PIRF 4PJ5A 5EU6E 2XTJB 4PV9A 2ZSVA 1JPGB 1XR9A 1PJ9A 4TVPD 1MFCL 1JNLH 2KQMA 1JMXA 4G6KH 1JE6A 3N85H 5K9JH 1WZ1L 2ADJA 3B5HA 4LCYB 1FPTL 1D5XA 2WIIA 3C09B 1A7RH 1S5HA 3V5DB 3WDHA 2DMKA 3VXTA 5C0AE 1CU4L 1LDPL 1LO2L 4BFIB 4KK8C 1Q0XH 4P59H 1KIUA 3EO1B 3H3KA 2WBJC 3MV11 3UCRA 5FYLH 4LPCA 4P5TB 2ZSWA 5EG6C 3TVMB 3WD5L 2ZUVA 1J1PL 4P23D 1F02I 1Y6KR 4NN5B 1ZHBA 3LKSA 1OWRM 5DD0H 43C9A 2YPLE 2FJGA 2BNRB 3NZHL 3KNBA 5DHXB 4HKZB 4XMKH 4ZUSA 3VFNA 3NCEB 1J1OL 4ODVH 3AY4C 2BHUA 4BKLA 1M71B 3TEUA 4FXLA 3QCTH 2FBJH 2R0KL 1U8MB 4JDZA 5TE4L 2AVGA 4PJGA 2FHFA 5E6ZA 4YHMH 4UT7H 3V5HA 1QYGL 2R2BA 4G42A 4MXQD 5FK9B 1MCPH 1ETZB 3KPPB 1N6QH 1QSED 2NZIA 4PJBA 3EJYC 4LLQA 1AFVL 4PRIE 1KCLA 1K8IB 2APVA 3LQZA 3CU7A 3O9WA 4LCWE 1L6ZA 4QGYA 3PWPE 1ZVHA 2A9ML 3EJJX 1CXIA 2EYTB 5J06A 4OQ1A 2QQKH 5DQDH 1KJMB 3BZDA 1NCCL 5JOFB 1CXFA 1CD1A 3EOTH 2OX5A 5FYLE 5DEFB 3IDYB 4ZSOA 5D72L 5J13B 5CZKA 2PXYB 3DX8B 4HD9A 1D6EB 2A6IA 2CLRB 4MQ7B 3C08H 4LQFH 4PJ9B 2IAMD 3RWIB 2QQNL 2R1XB 2DAVA 2DLFL 1UWEH 4JREC 2HTLC 2XNAA 4X98B 1HSAA 2FX8L 4BUGA 1JRHL 3MLVH 4JKKA 2VDKH 1ZXQA 1MOEA 3OAYH 1T5WB 2DQEL 3TBWB 1VENA 5AG8A 3SGJA 3L3HB 4S1SL 2OJZH 4ZD3L 3P0YL 3D87B 5C0GB 3ARBC 2VDOH 4O2CB 4DGYL 1TTUA 1UH2A 4JM2B 4X0KA 1EMTL 1T83C 4AEEA 4B0MM 4LBEB 5I1HL 3TT3L 1JGUL 4PG2A 1G7LA 2D0GA 1MPAL 2GT9B 1Q0YH 5F7KC 5A40E 3OG4B 4CNIA 5C0DB 1MAJA 1KPVB 4X6DA 4YHOH 3BPOC 3M17B 3WNPA 1E6JL 2YXMA 2PW2B 4F33B 3QQ9D 2ICEB 4X7CC 1II4E 2AEQL 5TGBB 2CRZA 1TVHB 4HAGA 3QIWA 3H2WA 1NMAH 3T1FA 5C7XH 5F7EL 1GSMA 5GJSL 4EI6B 3ULUD 3V4PL 5K9KB 1CGTA 1KPRB 1A6VH 1FFOB 4JFDE 3CCHB 5GJTH 5T5FL 1PKOA 2YBRA 25C8H 1I8MB 4X6EB 1OTSD 3ARRA 3GJFH 2EDYA 1LD9A 5BCAA 4N8VA 4NRZB 1UCTA 4X5WA 5BV7H 4PJFA 1XGYH 1GGTA 1BZ7A 2GTWB 3MBXH 5C0EB 5KG9B 2DQGL 3SDCD 2RCSL 5JQ6L 4YDVB 4DZ8B 1IAIM 2D7TH 2GK2A 3SPVB 3WN5A 1RZ8B 5GGSB 2DS4A 4WGWB 1H0DA 3H3PH 3PDDA 1JHKH 1HH9B 5FHBH 5LCVL 3MRCB 3QEUB 4WNQA 1UFUA 4H1LG 3WDIA 4PJCF 4K9EH 1NFDA 2FD6H 3CFEA 4W6XB 5IMKB 5DTFB 1PQZB 3OTTA 1QBMH 5F1IA 2FECI 3FAWA 1CQYA 4PRPB 1FC1A 4HUXB 4HKBB 3MRHB 3VFGL 4JKPL 1IGYA 2XXMB 1H5BC 4DOHE 4LRNH 2YRLA 5I8OL 3X14A 2OSLB 5D7LD 4X6BA 2NY3C 4GBXA 2ATKB 4Y5VC 1KG0B 5T3XH 1JGDB 1JPGA 3EYOA 2EZ0D 3I9GL 1IGMH 5E7FA 3TGXA 2HMIC 4JKLA 1A6TB 4Y8DC 5E2TL 2AEPL 2PETA 1OP5K 3U4BH 4P46D 5C0RL 5JQHC 1J8HD 1HHKB 5TQ0H 3MYJB 2OR9H 4U6HA 4RZCB 1I4FB 5IEKB 4BQBA 1JNHA 1BFOB 1KUMA 3BESR 5IUSA 1MRCL 4KHXH 1DVFC 2R15A 1RIHL 1AQKL 3MJGX 4NQEE 3ARDA 4UTAH 3VD9A 3MLRH 3EO1A 1EFXD 1VCAA 1FDLL 1Q9WA 3CFCL 5GRUH 1JZ6A 4P5TA 3TVMA 4X6CF 3L7EA 3IKKA 1U95B 4OD3L 3QWOB 4QTHB 5GIRA 4PPTA 1YY8B 4M43H 4U2YA 4M7JL 2AQ3A 2LTQC 2BNRA 2KUTA 3MACH 3GIZH 2EDFA 4HKZA 3BDYL 3NVQA 4IMLA 3IAGC 1JPFB 2D9CA 4X7SH 5HI5D 3OKYA 3VFVB 5IFAH 3FB7B 1JPSH 3X3FL 1TZGH 1WBXB 1EEYB 1U8MA 5T1LB 1IT9H 3DVNA 4D2NA 4ZPVA 5F1NB 3LN4B 4PS4H 3MNWB 4QEGA 1NEZG 4Z76B 4U1MB 3PHOB 1OTTD 4G6MH 4ONGL 1ETZA 3KPPA 1HILB 1S78C 2ZOKA 4PRAB 5DQJB 2VZVA 4MNHB 2Q87A 5CHNB 3RI5K 4OAWB 5FCUH 5I74C 4ZTPL 1K8IA 3TA3D 3C9NB 3OGOE 3OKKB 1G7PA 2IFFL 4ETYA 5KN5A 1ZVSB 5IHUL 5F3HA 4L29A 2EYTA 3F12A 4XNUL 4P2OD 1SEBA 3HE6C 4UV4H 4MQTB 1KJMA 1MCIA 4LAJH 4CDHA 2XXCB 5CLWA 4OGXL 1N8ZB 1QBBA 4KXZH 4LSQH 5DEFA 1B3JA 5MEQB 3SBWC 2X89D 4P2QB 2JIXD 3NN8B 1YUHB 2QR0A 3K80A 1TLKA 1D6EA 2NTFB 5E08L 1AC6A 1OW0A 1P5VA 5GRJL 1FQ9C 2R1XA 3WL9B 1AC0A 3VE0B 4WCYH 4U7KA 4HC1A 1YZZA 3SE3C 4JRXA 2OBGA 2CR3A 3CC5B 3QXTA 4WUUE 4CVZB 2VXUH 1A0QH 2R2CA 5CUSH 3T0ED 2IANA 4HJJL 5JNYB 3TBWA 3L5WB 1LWRA 3VFSA 3CX5K 1MJJB 5FO7A 3L3HA 4GW5B 2X42A 3FT2A 3L95B 4HUWB 2R56H 2ZOLA 4XMLH 1AO7E 4JM2A 1GVIA 5D8JL 1F4WL 4LBEA 5E2WH 4LSRL 2W60A 5KVMC 4PJIE 5HHVL 1ZA6B 5D70H 1RUAL 1NFIB 1QP1A 3PQYB 4NKIH 3MV9A 4HEME 4NRYB 2EDOA 3O0RH 4Y7MA 1KV3A 5SX5K 5D2NC 1NANI 4YNYB 3UPRB 1NAMB 4Z7WF 2JCCF 2GKIA 3P4LA 4NP4H 5SWQA 1LK3L 2MQ3A 4LCIL 4F33A 1R5WA 1CDIA 4N9OB 3QIUC 3LV3B 5DUML 5TGBA 5E70A 4H8WC 3RKDC 1FZKB 1TVHA 4FQLL 4EI6A 3WXWL 4ELME 3MOBH 2DF3A 1NGYA 5JPMB 1UB5B 3RIFK 2EEAA 4PJXF 3C5JA 2W91A 1T03H 5EIQA 3F7PC 1I8MA 3Q6GH 3TJEL 3EIFA 4JHAL 4QHKJ 4RBPK 1B0GA 1QSEE 5DK3A 2E9WA 4S1RH 4Z7VF 1IGFL 4QRQA 4CU6A 2AJYH 4EVNA 1MVFA 5C0EA 5KG9A 2JJTC 5E5UB 2BOBA 3W0WD 2ADIB 1NJ9A 3S6CA 4Z7UF 3BIBX 3P40A 4YDVA 3V6FB 4DZ8A 1IGJA 5EH1A 3WKML 5AWNH 1Q72H 1RK1B 3K46A 3V0AC 5GGSA 2V6HA 4GH7B 4NHUB 1TJIH 4JREB 3OKDB 1A1NB 3HG1B 4QHMB 3MRCA 3QEUA 1RZIB 4O00A 3KYMB 2YUVA 4OSUH 3UPAA 3ULUH 1UEYA 1L0YA 2AJZB 4KJQC 1E4JA 4MJIB 3QEGH 5DTFA 4Y4HC 3TIDA 3TN0C 1BQSA 4QHLB 5C1MB 1A6UH 3ARTA 1MFDH 1ZVYA 3JVGC 3ARBB 3K0WA 4JFEA 4Y16C 1IFHH 4HKBA 3ZT6A 1WAAA 1C08A 4L8DB 2R2EB 1YEHL 4NSKB 2B4CH 4XNXL 1JWSB 1VFMA 2NX5D 3QH3A 3DO7B 2FGZA 1V7MH 2OQJA 4FFWD 1CLOH 2EDXA 2GQHA 3ALXA 2OSLA 2X4OB 3B9AA 4ISVA 2EDEA 3PUCA 4KVCL 1Q94A 3QJFB 1JVKA 2VLJA 1KG0A 3BPOB 5L2KA 3IFPB 1JGDA 1KYOJ 3JSSA 4F80A 1Q8MA 4XP4H 1OQXA 5I15H 3VMNA 4UTBL 3LPWA 5LKNA 5CKGA 4NC0B 3FMGH 3KHQA 4MVBC 3OKOB 2O93L 5CSZB 3X12A 4TSBL 5C2BL 4NQVB 1YECH 4L4TD 3MYJA 4ZS6D 5KSBA 5DA4A 2NY6C 1RUQH 5C9JA 3IDUA 3MXVL 5I73C 1BX2A 1I4FA 3HPLB 1S9YB 5IEKA 4UBDD 4UT6L 1BFOA 3AMLA 5ICYA 3CVHL 2C3VB 3EKCA 2QSCL 2CO6B 4Q0XL 5D2LB 3N1GC 3RWGB 5SWSD 4LVHC 1K6QH 4B53A 2QBWA 3MRRA 3ULUE 4KI5D 4ZQKA 4X80H 4CN1A 4GW4B 2KDGA 4XP5H 1TETH 1U95A 1GGIH 4QTHA 2GTZA 1YY8A 2X1OA 4OJFH 1Z5LA 3RGVD 1KENL 1K3ZA 1MREH 5DEGB 1N5YH 2UYLB 1QLEL 4JFFA 2B0SH 3B9KC 3VFVA 2AK4A 4MMZC 2X4SB 2YN3A 2V7NB 3G6DL 3FB7A 1EEYA 3BAEL 3C5ZC 3MLYL 3BPCB 2FYYB 5T1LA 5F1NA 1MCCA 3MNWA 4LSVH 1C12B 3LHPL 3AU1B 4U1MA 4O51A 3X17A 1D6VH 3FT4B 3VI3F 1PLGL 2BJMH 2UVEA 1UM5L 1B88A 1H5BB 2OZ4A 4NUGL 1A7PL 1FLTX 1DTUA 5L8LB 3HUJE 4PRAA 4MNHA 1T1XB 4GG6F 4X4YA 3BISA 5CHNA 5JHLH 4EUPB 4KQ3H 2NY3B 4Y5VB 4I3SH 4I8DA 2DM2A 3U82B 3I2CL 3C9NA 3OKKA 4MD5B 4TSCH 1GIGL 4FQ1L 1SEQH 3BEVB 3V6OA 4ZUWB 3RUGE 4RGOH 3IDGA 4TPRH 1LP9F 2BRRL 2WP3T 1QNZH 1N8ZA 4RA0C 4F9PA 5MEQA 1D9KC 3BRFA 3V52L 4P2QA 4QNPE 4XRCA 1FGVH 3UJTH 4Y19B 4OUUA 2F15A 4U31A 1RV6X 4YXLH 2NTFA 3IT8D 3PIQB 4E5XB 2C9AA 1DVFB 1J0IA 3PV6B 2DJUA 1LE5B 3MBEC 4YPGB 1GJIA 2WBJA 1F4XH 1UCBH 1F58L 3CC5A 4CVZA 1KB5A 5D96C 3AMKA 2AV1A 2OLDA 3L5WA 1NCWH 3GO1H 3MGOA 4KK6C 3ZTJG 1MJJA 1BVKB 3TZVC 4GW5A 4JPVH 2LTQB 4FFZH 5D1QA 1HH6B 2N4IA 3U1SL 1FJ1A 1UKSA 4XWOD 5JXEC 3IDXL 3S5LB 4HJ0C 15C8H 2P5WD 2WIMA 5FB8A 3DETC 2BNQB 1J0JA 1ZA6A 3B5TA 1NFIA 1RZ7H 3PQYA 4NRYA 1P9MC 2UUDH 4PYGA 3PJSB 3IU3B 1NAMA 3CXDL 1D5IL 2ZPKL 4H88H 3OAUH 3BD3A 4ODXA 4L4VB 3GSNB 3LV3A 1AFVH 3GKZA 1AIFB 3UP1A 3D39D 1FZKA 3DVGB 5JHDD 4PLKD 2J6EA 3BP5B 1FLRL 3DRTB 4WJ5B 3EFDH 5DD6B 3TH3T 3VD7A 3KDMB 5I74B 4K2UL 5JPMA 4UOW0 2NTSP 5B3NA 1DUZB 4O58L 1RIUL 3HE6B 3VDBA 2DDQH 4KU1A 4N1EA 2YKLL 1UJ3B 4NQUA 4LSPL 3L1OL 1YEIL 4QT5B 1UZ6E 1DL7L 5EC2B 5F3BB 2KQNA 5C0FA 4X9FA 3PWUA 1YN7B 3HZVB 2ADIA 2VLKD 1JNNH 4AT6B 4G3YH 3F7YA 2QQNH 3V6FA 3ARFD 3CSGA 2P46B 2YA0A 5FO8B 4WTZG 5I1EL 4NHUA 1ZV5A 4YHYC 3OKDA 2A0LC 3HG1A 4DQOH 3PE9A 4W4NA 1RZIA 4ZO9A 3KYMA 1I7RB 1MHCA 3SGDI 3B3IA 2AJZA 3RKPA 4MJIA 4XVTH 3MODH 4PBXA 4QHLA 4M6OL 5IW1B 1A7OL 2CUIA 3IFLL 5IBUG 3IETA 4F7CA 3DSFH 4B7LA 2YD1A 3HC3H 1S7QB 1DQQB 3NACL 4NSKA 1QACA 1JWSA 4ENEC 3DO7A 2Y36L 3FO2A 5DI8B 2PO6A 1XFPA 4L1HA 4LPXA 5JPNB 4GXUN 3T0EE 4X9HA 2X4OA 1AE6H 5HI3C 4LAQH 2HKFL 5D2NB 2WZPD 1L7TH 4P2CG 4OZ4B 4ZAKD 2GK0B 5DJAA 4Z7WB 3QIUB 2AABH 2WUBH 3T0WA 2EEBA 3OBAA 4LKXB 5TF0A 3OKOA 3FCTB 5EZIH 3FOMA 3OJMB 1I3GH 5ITFA 1T2JA 5KOVC 4NQVA 4HG4J 3FHAA 4YGAB 1U42A 3N1PC 3HPLA 1S9YA 2X1QA 3EDKA 4LCCA 3WIHL 2XN9D 1UADC 4FFYL 2Y06L 1LO4H 1I1YB 3QXDA 4N0YH 3WV0A 2BMKB 1YYLH 4KK5D 1M7XA 4NM4L 1VEPA 2WUCH 1Q9LB 2BCKB 3GSOB 2IJ0C 3U46B 4Z7UB 1WTGT 1RD6A 1OAXH 2FZ3A 1FFNB 1G9NH 5DEGA 5LGHH 5LVEA 2UYLA 5E4EC 4ODSL 3TYGH 4BK4A 4L9LC 4I1NB 3BYYA 2F53A 1QLRB 4PJCA 4Y4HB 4JDVB 4M5ZH 3TN0B 3QUXD 1BREA 3BPCA 2FYYA 3P11H 4OCSL 4J4PD 3OX8B 3ARPA 4Y16B 3AU1A 2ZUXA 3FT4A 5KS9E 1H5BA 1IAII 2DLHA 2VDLH 1S7WB 4NN6B 1T1XA 1PYWB 4LDOB 4EUPA 2VLLB 1KXVC 5HYJE 3D18A 3FQUB 4Y5VA 4MD5A 1JK8B 1JHLH 4K3GA 4DKAA 4KJWD 2EXWD 1OP9A 1BQHA 3S36L 3CLFL 1JYXA 1AKJD 5F7WC 1HIML 4LLAA 2OR7A 3D0LA 1YJDH 2OXGA 4OGAC 2NY6B 4DWHA 2MCG1 2ADGB 4U49A 5I73B 4L3EB 2DQTH 1GOFA 4Y19A 1JZ3A 1WWAX 1YEJH 1ZHKB 4E5XA 3PIQA 4Y89A 3KHOA 4LVHB 4I0PC 2VDMH 3HNVH 3L5IA 4YPGA 1LE5A 2DKUA 2X41A 3VFMB 1VGEL 4L4TE 3O81A 5DRNA 3MOAH 1UYWH 2H1PH 5HDOA 4X6CA 4ZPTB 5EBMB 2BHYA 5C08D 2VDQL 3P77B 1HH6A 2V2XB 3DECA 4OCXH 5SWSE 2NPLX 1QFWH 3S5LA 3B9KB 1YEFH 1N59B 2D7MA 3ORJA 1INEH 3C5ZB 1RMFL 3A0OA 2EH8H 4XNMB 2V5RA 1WUNT 3T0DA 3MRFB 3PJSA 2X1WL 3QQNA 4QOKD 4XHQA 3G08B 2E3VA 4L4VA 3A6BL 5ENWB 4ZXBA 3GSNA 2G9HA 4RNRA 1YYMH 2ZCLH 1OD7A 3BP5A 4WJ5A 5CFHA 4GG6B 3O4LD 1UC6A 2V2WA 3EYSL 4S1DC 4AMKH 8FABA 4LVEA 1DUZA 4F57H 5IJVB 1HINH 1RZFH 2A73B 3HE6A 4YXKH 4MNQD 5HHOB 4D3CL 3RDTA 5KAQF 3HNTL 4QT5A 1LP9B 4N0UA 3JV6B 5EC2A 1D9KB 3RTQD 3SBWA 4Z8FL 1YN7A 1U8HB 3HZVA 5DUPL 2YEZB 4C59B 4AT6A 2DB8A 1JZ2A 5CD5C 2FEDC 3SE9L 3KPSD 4R7NA 5J0BA 3QDJE 3MBEB 3NBNA 2Z35A 5FO8A 1WIOA 4OFYD 1OM3H 5E9DE 4LHQB 2FL5A 1B4JH 4R2GC 1N7ML 5DC0A 4XMPH 1ZGLP 2VLRD 4KQ4H 3F5WB 3UPCA 2V17H 5D96B 5BV7C 1J8KA 4KKAD 1LGVA 4FQ2H 2DWEB 4K23H 1JZ8A 3TZVB 1G7JB 2YPKA 4K94H 2B20A 5IW1A 5J3HD 4U7MA 1WJ3A 4AJ0A 1XGRB 4PRHD 2FR4A 5HYSB 4NO2B 2D7QA 2DI7A 1JZ7A 1DQQA 3NIGE 1U41A 4S0SD 1XMWA 3C6LC 3MMEB 3VRLE 4J1UA 1MI5D 4K9EC 4FQJH 3MO1B 2JLLA 5D2NA 2AEWA 1RIVH 4OZ4A 1JGVL 1YEEH 2GK0A 5DMIH 4KH2A 4Z7WA 3QIUA 2JCCA 3G6JF 1G1CA 3HC4H 4XVUC 1KXTB 3T4AB 3VWKD 4LKXA 4FABH 5JZ7D 5KJRL 5MEOB 1OAUH 5TH2B 4UDUA 1OGAE 1AGFA 1EGJH 3ESVF 4PJXA 1QPXA 1OAQL 3OB8A 3C60A 1YEGH 5K9OB 43CAA 3D85A 4YE4H 4GRLC 1I1YA 2EKJA 4L8CB 3DOSA 3L3JB 4OCWL 3WMSA 4XH2B 3MV7D 4Z7VA 1P4BL 3X3GH 3WFDL 4XTRC 5EU6B 2J1KA 3GSOA 3U46A 4Z7UA 3NFNB 1KLUB 3ISWA 4R4ND 3INUL 3EJZD 3TO2B 1FFNA 4YHYB 4Y1AA 2VR9A 3BN3B 4P4KA 4WHYH 3VGDA 4LHUB 4GRWF 4KY1H 2O5ZH 1H8OA 3A6CH 2H8PA 3TN0A 3HI6H 4I2XE 4HKJB 3JWDL 1P1ZB 1OSPL 4RMUA 5CEZL 4V1DA 1SBSL 3JVGA 3OX8A 5C86A 1BJ8A 1DQDH 2DIBA 1EEUA 1FIGH 1NSNH 3MJ9A 1LMKA 5IMOB 4NNPL 5CEYB 5I1KH 1NMCB 1S7WA 2LU7A 1PYWA 5BS0E 1U8NB 4HUKB 2VLLA 1BPVA 3O6LL 1MHPL 1BD2E 2FO4B 1R3LB 3FQUA 5KSUB 3FZUD 1NGQL 5CJ5A 1TTFA 1U8KB 3O2VH 3OPZL 4MB4A 1KOAA 3BQUD 4RDQG 3E2HC 4H26A 1SY6A 1T7ZA 3ZKND 5FO9B 4GSDH 3GRWA 3NOIA 1IQDA 3KLAB 3TCLB 1D3CA 5JIKA 3VXMD 3MLSL 4NIKB 4P23C 5IQ7H 2ADGA 3U36B 4L3EA 1IGTB 3GMPB 4M3JA 1WWBX 3LRSB 3W2DL 5LBSH 5I16B 1ZHKA 4HIJA 5GPRA 1PX3A 2R4RL 3E6HB 4D94A 4L8SC 1D5MB 4TRPL 1MWAL 2WWKT 3VFMA 3TO4D 1Y18A 4ELMF 5C07D 1F6LL 5DZLA 2BVYA 4FQCH 1LNUB 2MHAA 2C3WA 1UVQB 2ITDB 4L8BB 4NO0D 3U0TB 4LCWB 4X99B 3PWPB 5KSAD 2XG5A 3HPJB 4ZPTA 5EBMA 5KVDH 5L8KB 3WUZA 3P77A 4U0QB 5IHZB 3QHZL 2VERN 3ZSSA 1EHLH 4MXQC 1W72A 2UZIL 3QAZB 5IB1B 3VD5A 5E4EB 4OI9A 5FDYA 3B9KA 4U6VH 2FWOA 4L9LB 5KSVA 5GGVH 3I6GB 1NCTA 2X4RB 2NNAA 3SDYH 4MA7H 5TDPA 2DD8H 3MRFA 1ROWA 2Z31C 2R23B 3HLAB 1B6UA 1XGPB 3SDDB 2ZCHH 1UKQA 1KF9B 4ODTH 5C09D 4H5SA 4WGVB 3WEXB 1MCOH 2A1WH 4GG6A 2J4WL 2NXYD 4XCYA 3NFSH 3EDDA 1T2QH 5HDQH 5DJCA 2IAMC 3DGGB 5IJVA 2A73A 3DMMA 1CS6A 5F96H 3M1BA 4P5MB 1KXQE 4BELD 2J3SA 1I7UB 1CXKA 1HKLL 1LP9A 3BFOA 3BKYH 3JV6A 4FG6D 1D9KA 1G0DA 5DJ8B 1X5AA 1U8HA 4XP1L 4C56E 3E0GA 3TJHD 2K3TA 4I0PB 3QIBD 1G6RL 3EYQD 5EFIA 1CGXA 2P48B 5ESAB 2P43B 2XZQL 4D9QD 1QSFD 2AXGB 1QUNA 1OGTB 4MSWA 4NO5B 2VB5A 1H3XA 3F5WA 2IGFL 3GSQB 5D1XC 4F2MB 2ITCB 1OAYL 2K1MA 4JFDB 5KOMC 3TZVA 1P7HL 1V3JA 2CRIA 3QDME 3CDCA 1XGRA 4LPVA 3QQ9C 4EI5A 5JXEA 3QQ3A 5F88B 4NO2A 2VE6B 3ULUF 3CD4A 3QFJD 2VXTH 4HX1B 2BVTA 2UUDK 4KUCD 5GGRB 1REIA 1RJCA 3ULUC 3FONB 3MO1A 1Z9MA 4GMTH 4HDIA 3UEZA 1U58A 1QRKA 4YUEH 1OTSC 1I7ZB 2D7PA 1DQJB 2HTKC 3H9SE 3T4AA 1KIPB 2EO1A 2B4CC 3EYUL 5C6PB 4P3DB 2D0HA 4PR5B 3LEVL 2A9NL 4D0CB 4OUOA 3SDCC 2F58H 4MX7A 5CMAB 2B2XH 2AJ3A 1CE6B 4K3JL 1CF8H 3GHEL 3PGFL 4NUJB 2XWJA 5K9OA 1OAZL 1T7XA 1BJ1J 4DOHB 4R4FH 1PZ5A 4XH2A 3O4LE 3FT3B 4OCYL 4K8RL 2FX7L 3UC0H 5AZEL 2MWCA 5F71A 1EV2E 3NFNA 4OTXL 3BKCH 1KLUA 1WTLA 1E4XH 4UQ3B 3TO2A 1N6VA 3GJFB 5KVEH 3NAAL 3C8DA 4HT1H 1BMGA 5I1JH 2H32H 4LHUA 4R2GB 4HPYH 3WCYA 2BC4B 3C8HA 1IEAB 2W0PA 5BV7B 4LOUD 3K8MA 4QNPF 2E6JA 4HUUB 1P1ZA 1ZEAH 4GMSH 3QNYB 3KPSE 3FRPG 4O9HL 1C7SA 5EU7E 2IH1B 3HZMB 2EZ0C 4UDTA 4XNYH 2V5MA 4AENB 5IMOA 3C6LB 2CJUL 4P46C 5FYJH 3LKNB 4OQTA 5IMLA 1TNNA 1PKQA 2FO4A 5KSUA 1R3LA 4NQDA 2OTWB 3FQRB 4OF8A 3HAEH 1C5CH 1U8KA 3RJQB 2XWBA 3LH2H 1KN2H 4Q6IB 1PG7L 4OLWL 3QEQA 1ADQL 1Q1JL 1HOCA 5DFVD 4J6RL 3FFCD 3G6JB 1EO8L 1UXWA 3OJDA 3CLEL 3MV8E 1AP2B 3KLAA 3TCLA 5TJWK 3GI8L 1KEML 3WFBL 3BPLB 4K7PL 3S37L 5FOBB 1IGTA 5JXAL 5I16A 3ZKMD 1LDSA 5FCSH 1RI8A 3E6HA 1LEGA 4YEEA 1D5MA 5EORH 1FAIL 1NCAL 1ZSDB 4GRLB 3W82A 4HGWB 5HI5C 3C2AH 1I85C 1S3KH 1BEYL 3SO5A 1LNUA 3QNXB 4L8BA 3U0TA 4RSVA 3HPJA 5CSBA 4X8JB 5FYJU 3G04A 1TZIB 5IHZA 1OTTC 3VXUD 2EICA 5IB3B 1R5IA 2X4PA 1MJUL 1H9VA 4XPHH 1A5FH 3QO1A 5T5NF 5IFJB 3LKQB 4UMGA 4Z77B 5FYJE 1UB6B 2VZ1A 5ANME 1F4YH 2V5TA 4LRIA 2IBZY 3QEHA 3S98A 4IIQC 3VFTA 1BBJB 2DIAA 5EOCL 1GGBL 5GS1C 3HLAA 1G0YR 4P2OC 5D6DA 5GS2D 1LEIA 4YX2L 4AM0B 4N1CA 3WEXA 4WUUB 3O3EB 5IWLA 1LO5B 4P3CH 3THML 4I77H 3LKPB 2APTA 3EBAA 1UA6L 4ZTOL 4DKEH 1VFBB 5TDNA 1I8KA 2BFVL 3DGGA 2JB6A 3F58L 3VGGA 4P5MA 2J5LC 5T3ZH 1I7UA 3ZKSD 2YD2A 5EB9A 3MCLL 4PJIB 3MX0A 5MI0C 5HDBE 4P23B 1KELL 4JJ5A 3DI2B 3T0EC 1YDPB 3ZYZA 4HLZG 3G5XA 1FH5H 4UB0L 3MUZ1 1R3IH 1IKFH 2DKSA 2YR3A 4JY5L 5D93C 4MS8D 4I0PA 3CVIL 2WLYA 5ESAA 3ZMRA 1QFPA 1FZOA 2O5YL 5EC1A 2AXGA 5C70A 1HXYB 1OGTA 3U0WL 3ARWA 4ELMB 4M6AA 5I8KH 4F2MA 1WBYB 1UWGH 2ITCA 2EE9A 1EH9A 1J86A 1X3DA 3DYOA 5CZXC 3GMNB 4K3DL 2EH7H 5SX4I 4RX4A 2Q7NA 3SGEI 1T0PB 1AGEA 5CCKH 3VXRD 2E7HA 4OGYL 2VE6A 1DQMH 3WFEH 1QSEB 1QHPA 5C07E 1T7VA 4LGPB 1OWWA 2FO1A 3FONA 4PGCA 2VAAA 1FIEA 1MIEL 2BVPB 5HHQB 4PJHF 2VZUA 2DTML 2Z31B 4XWGL 3RY6C 3IDJA 4PB9H 1WQVT 3D6GA 3TLRA 1DQJA 5C0CE 3AC0A 1EHAA 3MROB 3BUYA 4PJEE 3OJ2C 4RGND 5T3ZE 3P3YA 3NCYS 4P3DA 2MQCA 4DFHA 3TFKD 3WYRA 2FB4H 1R3KB 3OKNB 5FGSA 1ONQB 1BM3H 5KS9F 3IU4H 2JJWA 1CE6A 1RURH 1QRNE 1NGZB 5D1ZD 1SYVB 4P49A 5ADPL 5DS8A 4QHNB 4IRJD 3BRDA 3KR3H 4HJGB 1DBJL 2ARJB 5B39G 5FGBA 1GC1L 2IH3B 3WDJA 5EDXA 2RB8A 2O5XH 1UACH 1OP3H 4EXPX 1GAFH 4Z0BL 2ERJC 1SVZA 2RHEA 3S34H 1ZHNA 2VQUA 4DK3A 4PFEA 4YHIA 4P2RD 2XV6B 1GGYA 4OIIH 5D1XB 2L4OA 1S8DB 5L9DL 5E6IC 1IM3A 5ETUB 1KC5H 4HF5L 5GISH 3MCKB 5LQBH 5CP7B 4XNQB 2IG2H 3U83A 4JGJA 4YDJB 5IESH 3HA0A 5E5RB 2VDNL 4LFHG 1WEJL 3B83A 1BZQK 1G9NC 3C6LA 1QO3B 4ZNCD 1MCJA 3LKNA 4K8RD 4NJ9H 4DUVA 4UBDC 5ITBH 1I75A 3VGHA 3FQRA 3DTXA 1RU9L 1BBDH 5T1KD 2BSSB 1NUFA 4NC2B 2A6DB 2BOCB 5F93C 1CIDA 4R7DB 3QFJE 4KI5F 3RX5A 3G6JA 3P0VH 4HQQH 1CLYL 3L7FB 5GS0L 1AP2A 3FKUS 5D71L 3QUZB 3SDCB 4LU5L 4WFHE 3LKRB 1F2XK 2DI8A 5DJDA 5LG1A 1IE5A 2DYPA 5DDHB 1P4LB 3RGVC 3FB8B 5JORB 3ZT7A 2JB5H 4J8RB 1L9MA 4AY0A 4XP6L 2D03L 2YD4A 3HUJB 3D2UD 1V3LA 1AXTL 2Q8BH 1IBGL 5LXGL 1T22B 4QHUB 1YJDC 4C54A 3FQXB 3QNXA 4PJGE 1HHJB 3VGAC 4MD0B 1ED3A 1JPTL 5HYSG 1HNFA 3N9GL 2Z91A 1TZIA 4G80B 3RUGB 2DQJL 2XZAL 4XPGL 3MRMB 4N0CC 4PJBE 2CUHA 1XF2A 3RPIA 2FGWH 4HWNA 5IFJA 5D7LB 1UB6A 1SMOA 3G5ZB 4TUJA 4WI5A 3GSXB 2NY4D 5GGTH 1N5AA 1BBJA 2IFGA 4PG9B 3T0BA 1HHIB 2EIBA 3PNWB 2X4UB 1NCDL 1V8HA 5AZ2H 3PHQA 2QHRL 5J1TC 3I85A 4P46B 4TUKH 1P7KA 4AM0A 4Y4FD 4OZFH 3O3EA 2VISA 1FNAA 1LO5A 1N4XL 3OZ9H 5E8DL 3WLBB 3LKPA 5CJQH 1N0XL 3JTSB 1VFBA 1IILE 1NGWB 2NY7L 3QWRD 1S7XB 2IPTL 4CADB 1A7QL 3DX6B 4GKZA 3AM8A 4MJ2A 1F3JB 1IC4L 1M7DB 4XP9H 5IVXE 1ND0B 2HJLA 4KHTH 2X4NB 5HYQA 3LEYL 4P23A 4XX1E 2CDGA 3MREA 4NJAL 1YDPA 1CZ8L 1CL7L 4NKDB 2R0WL 5IVZA 3HRZB 5B3JE 2XA3A 4L8SA 3FFCE 5GS2H 5T1DH 4YXHL 1DEDA 1HXYA 2HAZA 5DUBA 3VWJD 1JRHI 4ELMA 2FEEL 2W0FB 1WBYA 5FM4A 5EBWB 1QTYT 3BKML 4LP4A 1CWVA 1H3PH 1T5XB 1UWXH 3HI5H 3TBTA 1WC7A 1DBBH 4WY7L 2X7LB 5T33L 3LMJL 2P5ED 1QSEA 3LPGA 1MFNA 4OLZL 2YWYA 4JR9H 1DFBL 3DBXB 2V2TB 2R4SH 4I48B 1LO3L 1U93A 5A2FA 4IOIB 4IIQB 2BVPA 3IFOB 5IBTL 5HHQA 5TFSL 4K94C 5GS1B 2CMRH 2L7UA 1B2WH 3TWCL 4P2OB 1U8JB 3MRBA 4PJFE 5KTEL 3MYZA 4I4WB 3T0XA 2R29H 5HYIA 1I3VA 1NKRA 4FP8L 4JANB 5AUMB 1V7NL 5CILL 2JIXB 5HVGB 5J6GB 1KJVB 5B22A 3LQAL 1FYTD 5DR5H 4Q9QH 3OKNA 3ARFC 3GBMH 2HLFC 2IAMA 2E27H 5EO0A 2YN5A 1JGLH 1A22B 2VLME 3V0WL 1KPUB 2DQDH 2CXGA 2EDJA 1WFOA 3VD3A 1NFDE 2J5LB 3ZTNH 2HN7B 3R8BB 2FATL 1SYVA 4DKFL 2F19L 5MI0B 1QFUL 4HJGA 5TDOB 1MCSA 4QXUL 2ARJA 3T0EB 3PWJB 1F5WA 1RHFA 1P4IH 3H42H 3PWVA 4I13B 1DBAH 2BHZA 4DGVH 35C8H 1RUMH 3GFUA 3KPRD 5D93B 2C3XA 3EHBD 1BFSA 2CKNA 4PJ7F 3KPOB 3RL2B 4KDVA 4KKLC 4X4MA 2SEBB 4MCYA 2IPUG 5I1CL 2QL1A 4NHCL 5I8CB 1OPGL 3F7VB 4G7YL 4JVPA 2EDRA 3T8XB 4U1LB 1RZGB 4LLYB 4F37K 5ETUA 2I07B 5D7IF 4X5XB 4XPAL 5GRXG 1F3DJ 1W8OA 4ZAKC 4IRSD 3MJ8B 4UOJA 4OB5L 3CX2A 1CDGA 4HXBH 3V6ZA 4KJPD 1IGIH 3T2OA 4QTIH 1QO3A 5ILTL 4BQ6A 2DQCL 3WE6A 5C8JB 3ETBF 3BI9X 1F8TH 4UIKL 4KK9D 1GCFA 1H3VA 2BSSA 4PJHB 2VXQH 2ED8A 3NZ8B 3VXRE 3RVWD 2A6DA 5BZDB 2HLAA 2OCFD 5JW4N 1GGCH 2BOCA 2YA1A 3QDHA 4Q9RH 3QDGD 5J6HB 3VH8B 3FQNB 3O8XD 4GT7A 4KK5C 4Y5XA 3SDCA 1VFOA 2BNRE 1IC5H 1I9EA 5I17B 3QPQD 5DDHA 3P9LB 4NDMB 2BY0A 3FB8A 5IQ9A 2OL3H 1C1EH 4PUBL 5KS9B 3MUGB 4Z7NE 3MLUH 4HBQA 4Z5RB 4YHLL 3UYRL 3IJYA 3Q3GA 4EBQH 1WFUA 3QUXC 1TQCB 1P6AB 3FQXA 1HHJA 1OT1A 4MD0A 2FJHB 4J4PC 2ERJB 2QQLL 1MFBH 4AEIH 4OLVH 3CFJB 4YHNB 3QA3A 2VIRB 4M61B 3MRMA 4UNTA 2BRQA 5IF0B 4DAGL 5GS0D 2ED7A 3B9VA 4L3AA 5BRZD 3G5YB 5D7LA 5JMOC 3BSZH 5E6IB 2VR4A 1UENA 3U9UB 5KW9L 3GSXA 3MA7A 1B9ZA 4FQXB 2I5YL 1MFAH 1HHIA 1MJ7L 3PNWA 1N64H 2EXWC 2XKNB 1IZJA 1VGKA 2C7UA 2VH5L 2VN7A 4P46A 1J8HA 4P2RE 5DJ0A 4JLRB 3I6KB 4L4TB 1PSKH 1B4RA 1MY7A 3WLBA 4JG1H 4PD4J 3NIDE 4KZEH 2IALB 3JTSA 5JW4Q 3WS3B 4KC3B 3FFDB 1IL1B 1JWMB 5SWSB 1MCEA 3UTZB 3GK8H 3SQOL 1EFXA 4JRXE 3GI8H 3DX6A 1S9VB 2MOVA 1L0XA 1H3WM 2IANE 4RIRB 1ND0A 4GXVH 2X4NA 4NZRH 3G9AB 4NKMA 5E8PA 5EUOF 5A2KH 4NKDA 2WW8A 2VDPL 3HRZA 4S0TD 3RGVB 3KYOA 3LIZL 4RISH 2XQBH 4O02H 2JJSC 3V6BR 2XZCH 3MV9E 4MA3B 4RFNC 5DHYB 3UTOA 1T66C 1JYVA 4ZFFB 2FIKA 4RCAA 2AXHA 2W0FA 5DJXA 1XZ0B 1KCSL 1ZLWH 2W0KA 4HKXB 4WEUD 5DFTA 1W0VA 4WV1C 1XCTA 4JFXB 4LLVA 4XCFH 1QEWB 1CK0L 3V4VL 4P2YA 3S35H 3UBXI 4AYFA 5DVNA 3FRUB 2FJFA 4Y5YA 1RHHA 4E42B 3DBXA 5DD3L 4I48A 3WIIL 3TA3A 2D9QB 4IIQA 2E9IA 3IFOA 4F37F 3O2WL 5CD3B 3PV7A 2P49B 3GMQA 3QDJB 3K2UL 5GS1A 1OARL 2OP4H 3QG7H 4I18C 4JPKH 4P2OA 4ZDHB 1U8JA 2CDEA 4YX2H 1S5IL 3DYPA 1JYWA 5E9DB 4XCCL 4I4WA 3THMH 3WJLC 1DQLL 5E2UL 2Y5TB 3UJIL 1LO0H 5FECB 1FSKC 3NCFB 4G8GD 3RTQC 2X89A 4JANA 5AUMA 32C2B 2JIXA 5J6GA 1KJVA 4L5FH 4OIBA 1OAKH 3E8UL 5T1MB 5EU7C 1KPUA 4GAYA 2XQYG 5I18H 1FVDA 2HN7A 4EIZC 4WUKH 3GMOB 4XC3H 5TDOA 3T0EA 4JRWA 4KKAC 4LLMB 1INQA 1S7RB 5J3HC 4JFEE 2BX5A 5C0ND 5SV4A 2FX9H 3DV4B 4F15C 4LARH 4G8FB 3KPOA 1F13A 1K2DB 2DICA 2SEBA 1YNKL 2VXVH 3MRIB 4KAQH 5I8CA 5IFHH 3F7VA 4R26L 3T8XA 3VG9C 3CJJA 3V95A 2VLJE 5K59E 1RZGA 1OGAB 4LLYA 4P48A 5EIVA 5L2KE 4X5XA 2W9DH 4G8IA 1Y6NR 2F5BL 2OZ4H 4BUHA 1FL5A 2H41A 5HVWA 4E0RB 2ZUUA 4JFZL 1W8NA 1BGXL 2AV7B 5J11C 1ZE3C 5JZ7C 1NGXB 3S3PA 5KSBE 5KVFH 5A16A 1AH1A 3QXWA 1VADB 3SGKC 4JN2A 1KFAL 1IEBB 4P9HH 3Q1SH 1J0YA 1UM4H 2CLZB 3IAQA 4C83B 2EDDA 4JY6A 3RY5A 5BO1H 4PJHA 3NZ8A 3DXAD 1A3LL 1HYRC 5DJ6B 2V5SA 1JHTB 1X7QA 4GAJH 4IBLT 4HGMA 4DTGL 1I3RB 2J8UF 1RK0B 3LKOA 1CICD 3NFPA 3VH8A 3FQNA 4I2XB 2BDNL 3W0WA 2LQRA 1EIBA 1F2QA 3CFKA 1DLFH 4JFHD 3ARFB 2PR4L 3IFNH 4KI1A 1FFPA 4N0FB 3P9LA 4R4NC 1RFDL 4NDMA 4JFFE 3EJZC 3ZO0A 2X2YA 4HZLB 2AK4E 5FM5O 5IVOA 2F8VA 5KS9A 1KB5H 4F7PB 1MFEL 3TV3H 1U3ZA 1CCZA 4DVRH 3WUWB 2PTTB 3BH8B 5BS0B 2ZUYA 3QCUH 1BD2B 5AYUH 1BVLB 1BQLH 3QXAB 2FJHA 1KYOK 2GITB 5HYEA 2ENYA 1QR1B 1RSFA 4IDJL 3QUMH 3CFJA 3AS0A 4PJ7B 4YFEA 4M61A 5DT1H 5C0BE 2NX5A 2P24B 5J12C 5IF0A 2EYSB 4LSUH 2ADFL 3G5YA 5DGRA 4AL8L 4F7EA 3U9UA 1N2RB 3V6OE 2DBJA 4X7TB 5D7IB 4ZAKB 2W65B 3WLWC 3BQUC 4BZ2H 4APQD 1WBZA 4IDLA 4M6MH 3WBDA 4I9WE 3MRJB 3P30L 3ZKNC 5CJXC 5IHLB 4WHCA 4WFFD 2DQUL 5EBLB 5IB2A 4L4TA 5JLZB 3KYAA 2FHCA 3VI4F 5FYKL 5I1GL 4KTYA 1YNTB 4NQXB 5JW4R 1FGNL 1OF2A 2IALA 4NOFA 3WS3A 5E2VH 1KNOA 5EU4B 3KPQA 4RAHA 1JWMA 4NCDA 5SWSA 3UTZA 3LB6C 2QHLA 1S7SB 3OKEB 4A2MA 1MF2L 3AROA 2OXHA 4HK3J 5DK2A 1E0OB 4JQIL 4A6YL 1A6WL 1CLCA 3D69B 5KSAC 3K1KC 4ODWB 4UINL 1FYHB 4CMHC 1RPQA 3RGVA 4OM1L 4FNLL 4TOYL 4PJEF 2ZCKH 3Q5YA 4HS6A 1EUTA 3PQYE 3QDGE 1ZLUH 4MA3A 3GSWB 5IMMB 3GJEB 1JMZA 2HT4D 3D0VA 3EFFB 3QUXB 4ZFFA 5I1AA 1NMBL 3DRQB 1KACB 3JUYA 1ZTXH 5FHAH 4HKXA 3VRJA 1JF5A 4K71B 3RU8L 3NH7H 3V4UL 3U30C 2VDRL 4JFXA 5TF1H 3B9EA 2X4QA 4AK1A 1EFQA 1ES0A 4ZUUB 4YWGL 1ZAGA 1OTUC 1Z9OA 3RGHA 4WHDA 4IEFB 4AQOA 4E42A 2AK1H 4HS8L 3JWNC 4NWUH 1L9NA 4LLUB 4HWZA 2F8OA 2DMBA 5GGRY 5CD3A 4X7EC 5ACMA 3EGSA 4P9MH 1X5YA 4DN3H 1K4CA 1AR1D 4ZDHA 2XY1A 5DMGD 4BA8A 3B2VH 4IRZL 4PRDB 4HUVA 1NANH 3QULA 5BRZE 1TIUA 4M7KH 2FH6A 4FG6C 2VITB 1N0XH 32C2A 3N50A 2E6PA 1T04B 4MNGA 3QDMB 3LS5H 5T1MA 3PL6D 2I24N 4LSSL 3RWJA 3QIBC 4OLUH 3EYQC 1GHFL 4NM8L 5BZWA 4JY4B 3SY0B 4OI8A 1YMMD 1YN6B 3DUUA 4JM4L 3GMOA 4HUNB 4O2FA 3UTTD 4CKVX 2HT2D 1UG9A 4LLMA 2DOCA 1MIML 3BJLA 4DN4L 3HMWL 4URTB 1S7RA 4WIQA 4MXWL 2AJVL 3DV4A 5IKCA 2VL4A 3C5SB 5IIEB 4IOSD 4YHKH 4KUCF 1PZUB 3H9SB 2P5WA 3RHWF 4RFNB 3KWWA 3BZEB 1QKZH 3VW3H 1UWXK 1FVEB 3BKJH 1EERB 4QCIA 3CMOH 4RRPG 5B38B 4WV1B 1I9RH 4P4RB 4W70A 4KROC 2H2SC 5DRWB 2YK1L 1HYSD 1I3UA 3LZFL 3D39A 2AV7A 1T0NA 1N6UA 2ZJSH 5JHDA 5JO5A 4XVJL 4YHZH 3ESUF 4RMQA 1VADA 1F90H 1BJ1H 3L3GB 4YDLC 3O4LB 3H3BC 3T2NL 1IEBA 3PGCB 4NC1E 1KT2B 5BOZG 5HPMA 2Q86A 1GOGA 4OZIE 4AEHH 5F7DB 1V05A 4XC1L 2YD5A 5BMFL 4I18B 2DL2A 3G5VA 2Y72A 3UBXA 4J3WA 5DJ6A 1MHHA 2EDBA 1JHTA 3R1GL 1XGTA 1X5HA 3DV6A 3O6MH 2ILLA 3SE4C 5FUZL 3VFRB 5EUKB 1FSKB 1RK0A 3SKJL 1K4DA 4XI5D 5CGYC 2VLKA 4MAUH 5I66A