2OXGA

The soxyz complex of paracoccus pantotrophus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
108
structure length
108
Chain Sequence
b'ADDAKPRVKVPSSAKAGETVTVKALISHKMESGQRKDADGKLIPRSIINRFTCELNGVNVVDVAIDPAVSTNPYFEFDAKVDAAGEFKFTWYDDDGSVYEDVKPIAVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SoxZ protein
publication title The SoxYZ Complex Carries Sulfur Cycle Intermediates on a Peptide Swinging Arm.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Transport protein
total genus 20
structure length 108
sequence length 108
chains with identical sequence C, E, Z
ec nomenclature
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08770 SoxZ Sulphur oxidation protein SoxZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oxgA00
2UWEB 1T5WB 2OMBA 3OX8B 3RVVC 2BRQA 2P8PB 3MRNB 4GW5B 35C8L 4N68A 4Y5XC 5D6DC 4GKSB 5HD8D 3KYNA 5J56B 3NCJL 1U92A 2I24N 1DQDH 3IDYB 5F9WB 2VXVL 2AEIT 2BNRD 3GSUB 1CU4H 3SDDB 3QIBB 1DVFC 3VXUD 1OOAA 5MEND 1T22A 5DD5L 3BE1L 5C0BA 5FDYA 3U4EB 3I75B 4BZ2H 4EXKA 1I9JL 2ZCKH 1N4XL 2Z8SA 3MRLB 3MYZA 1MHHA 4U1HA 4Z7VA 4KKAD 3FO1A 4X6DE 3VXNA 5FOBA 4PJ7F 4F33A 5EA0H 1TJIL 5IP4A 3O45B 2W60A 3BHBB 2JLLA 5J6HA 2NY1C 3BKCH 4QRRE 3ZT7A 4MSWA 4MQTB 4J4PC 2BNRA 3ZTNL 4X6CE 4MS8D 2BC4B 3VXUA 1MI5E 1KB5L 4QTHB 5MENA 3SKMA 1QR1B 3AU1A 5IIEA 25C8H 2J4WL 4XRCA 1J0IA 4OJFH 5JLZB 3QNYA 1RK1B 3V8OA 5HI3C 4M1DL 3OKMB 4FTVD 2BXYA 2E9IA 2DQGH 3MGOB 3ZHKA 5F7MC 3DYPA 2QLVB 3C60D 2V17L 4P9HH 2D9CA 2JB5H 4NGHL 5E8PA 5FO8B 4GO6B 3KR3H 4HWZA 4QWWD 5ESAA 4U1KA 4X5XB 1P1ZA 3O2VL 1PSKL 4QO1A 5JIPA 1C8PA 3LRHA 2EH8H 1QFHA 3HN3A 4QTIL 4RGND 5HHVH 1GPOH 4H20H 4KQ3L 4GAGH 4MD0A 3VXRB 5IJVB 1WWWX 1DR9A 5EIIB 4JFFD 5C0EB 5IWLC 5IMKB 3BZFB 2X5PA 4FTVA 5J4MA 1XCQB 4FXKB 3TPUA 2GJ6E 1HXYB 1F6AB 3EDEA 3QUYD 5FYKL 3C60A 3OF6D 3BZ4B 1KCVH 2EDQA 1I3GL 2IBGA 3H42H 2Y23A 3QEGL 1D5MB 4X6BA 3CUPA 5DUPL 1IAII 4ELMA 4NQVB 3DTXB 3O0RH 1BJ1J 1NMCB 4HC1A 3C8KB 4ZPTA 4YHYC 1A14H 3EYUH 4U3HA 2EXWD 1R5VB 2PYEB 3OGOE 1PYWA 2B0SH 3VXPB 1UADC 4G3YL 2ICEB 4JFFA 3VXQA 5JPNB 1JNNH 2V7HB 4JN1L 5CKGA 2XZAH 3OJMB 1NAKL 4EKXA 3QQNA 3DX7B 4QXTA 1MPAH 3SBWC 5GISL 3KS0H 1CFSB 3QUYA 2A6IB 3B9DA 3OF6A 2X41A 2NQCA 4DUVA 5TE6L 5DMIL 4WI4A 4WNQB 4M48H 1YEDB 5I1KH 5DC4B 3WS3A 1WZ1L 5EOCL 5LCVL 4L5FL 3BKML 3U9UB 2ZOKB 4PLKD 3D85B 4JRXD 1XT5A 1LO4L 3IFLL 2EECA 4GSDH 3FB8A 4AMKL 1KLUA 4LEXL 5C0AE 3MR9A 1E27A 4YDJA 4DVRL 5TFSH 2V2TB 1LK3H 1WEJH 1OAXH 3CDGA 1GGBL 4R4FL 3MZTA 2IBBA 3RGVB 5C1MB 1KJMB 5C2BL 1A1OB 2EXYC 4B0MM 3FB6A 3LV3B 4XPHL 2CR6A 1II4E 4PJHE 3VRIB 2MHAA 5GS1C 5JORA 1NBQA 4LBEB 3UBXB 4JKWA 4DZBA 4JRXA 4M3JA 4AQ1B 2J88L 1HH6B 2R1XA 1LDSA 4N0RA 1W8OA 1ZGLB 4WW2B 2ITDB 5AEAA 1DEEB 2W0FB 1PG7W 2NY4C 4ZG1A 4OI8A 3DROA 4JZJA 1ZHLA 3EYFB 3SGJA 3UYRL 2F53B 4GW4A 3FCTA 2X7LA 2FLRT 3V6OE 2O5ZH 5LWYL 4OFVA 5IF0A 5FM8A 1FZMB 4XVTL 5MEOA 3MNZA 1CZ8H 2YPKB 5KG9A 3AUVA 3GSWB 4GBXB 4HJJL 4YGVB 3C9NA 4Z7QF 1A6UL 3MV01 4N0UB 1L9MA 3ULVH 2NW3A 4QOKB 4XI5C 2V7NB 1LE9A 3WXWH 4O58L 3VG0H 3FO0H 1UXSA 1OAZH 2OL3H 4C56E 5JOFB 4OCRL 2CRYA 4JFDE 1WFOA 5ENWA 2J3SA 3SJVD 4YLQT 5F9JB 1HKLL 4IOFD 4CN4A 1BP3B 3DNKA 1D5ZB 4YR6B 5BS0D 4NQEE 2Y36L 4ZTPL 1U8IA 2VLRE 2WLYA 2HJLB 3K8LA 1NFIB 5K9KB 3SDAB 5IESL 4WFGD 2QADD 4JFEE 4XXDB 4R3SA 4ZFOA 3LHPH 4L1DA 4AIZB 5E00A 4JAMB 2WBJD 1IEAB 2ICWI 5D2LB 4G8IB 3ZDZE 4P23C 3LAFA 4YO0A 2VKXA 4F2MA 2R0WH 3G5XA 2DWEA 3SJVA 1BBDL 2XWJB 3SKOA 2CIKA 2E7MA 3INUH 5BS0A 5D71L 4OLYH 1RURH 1BFVL 2XACC 4OF6A 2VZ1A 4UAOC 2DJSA 4LARL 4I1NB 2DIBA 4JO2H 4G9FD 1S7XB 5KOVC 3ZT5A 5DT1L 4DGYH 1JI1A 5KS9F 3BGFB 3TIDA 4XAWL 4HXAH 3CH8A 3EO0A 4XXCC 2WBJA 4BM7A 5GGTL 1HSBA 3LMJL 5EC2A 2J7LA 2FECL 4N0YL 2YUZA 3VI4E 4YDKH 2X4RB 4JREC 5EU6B 3GO1H 3ELAT 4N0CD 4JQXA 3O6ML 4NZRH 5EOQH 1H5BA 4BFEA 5I0DA 4O5LL 1DFBL 5CCKH 4P9HC 4G9FA 4WW2F 1AR1C 3U79A 2VLKB 1JWUA 1LP9E 5J57B 4KC3B 2DKSA 4J3SA 4IRJB 1XGQB 2PYFB 3MRRB 3PP3K 4GFTB 5HYSA 1NC2B 2NY3D 3SE8H 1FVCA 1G7LA 3CVIL 1BZ7B 3GSNH 3L5WB 3H9HB 4M5YL 3QIUD 1FYTD 3PABA 3SKNA 3HMXH 5GSVA 1NFKA 3UTZB 4NHCL 2HVKB 1NL0H 3UXFA 2YA0A 3ALPA 5JOEA 4LNRA 1NCBH 3LEXA 5LGKA 2QL1A 1RUQL 3STLA 4JB9H 5IHBA 5IGXH 3N1QC 4XTRC 5C0EA 4Z7OE 2NTFB 3IS0X 2P5WE 2ZJSL 5IVZB 4AIOA 1YYLL 4TUOB 7FABL 4Q0XH 5HHNB 1IGTA 2X70A 3OKYA 4BYHA 1KTDA 4FG6D 4OM1H 4WU7A 1HSAA 4KRNA 2BNRE 4OCXL 4L8SC 1CFBA 1U36A 3QIUA 1BEYL 3TBSA 1FYTA 5KJRL 3ZHLA 1QSFE 4M61B 4DZ8B 5EU5A 5TF1L 4CADA 5ISZE 3D85D 35C8H 2PCPB 3GMRA 4Q6IA 1CF8L 3L7EA 3NCJH 5GRJL 3OKEA 2VXVH 3O2WL 1MCDA 4P5MA 2VZOA 3NCFB 3GHEL 5HHOD 3F6IA 3WJJC 4E0RB 4GRLC 1WCBB 4OZ4B 5ELIA 3RJDA 1LEIB 3GIZL 1TETL 4ZNCD 1S5HB 5I6XB 5GS2H 2ZKHH 5DD5H 3BE1H 3B9KB 5ICXA 1I9JH 1N4XH 5JO5B 4DJMA 5CIPA 3O2DA 3GB7B 4MJ5A 4QXUL 4ISVA 4FTVE 3RKPA 8FABA 1TJIH 3NZ8B 4M7JL 1F6FB 2HT4C 3W5NA 1RUKL 3HB3C 3O6FC 3ZDYE 1U8KB 4ZO6A 2B4CL 1IL1B 5HHOA 2IALA 4HS6A 5CILL 1U8MB 4GAYB 3ZTNH 1JVKA 3PL6D 4NFBA 4NN6B 4NKMA 4S1RL 1W72B 5IVOA 1KB5H 4EIGB 3NA4A 3RWFB 2B1HL 1X4XA 2J4WH 2HT3C 2VRAA 1WK0A 4M1DH 4JFFE 2K1MA 2GJZA 3GMLB 4KJYB 3MXVL 5FM4A 1BVLA 2V17H 4YNYA 1A4KB 4FRWA 3BUYB 4MJIA 4NGHH 2IPUG 3TVMD 1KXVC 3IDIB 3O2VH 1PSKH 4MDIA 1T89A 1Z5LB 1ZLWK 1KJ3L 3O81A 4QTIH 2W0FA 2IJ0C 2F5AL 2HT2C 1ZANL 3PL6A 4KQ3H 3PUCA 1RJLB 4NFDA 4PJCE 3ES6A 5ESVA 5IR1B 3ILQC 2ZZUT 5LJYH 2GAZA 4LLAA 3DUSA 1IEBB 2YS4A 2P8LB 3QI9B 4U1MA 3RI5K 4M02A 3T0DA 3QUML 5DK3A 1U8OB 5FYKH 1E28B 4KDWA 3ULVC 2J8OA 3HC4L 5J11C 1FZMA 1EJOL 3HPLA 1I3GH 5DQJB 2ARJQ 3QEGH 4CVZA 1HKFA 3Q5OA 1A9BA 2XWTA 5DUPH 3TVMA 2ZSWB 2VR5A 3EIFA 3ZE1E 4Y2DB 5HHPB 3WFDL 1XF2A 4IRSD 1NANI 1J05B 4GRWE 5CP3H 5IKCB 3IJHB 1QLRB 3D39D 3RZCD 3BOVA 3TJHD 2HMIC 2DKUA 3ARBB 4G3YH 4OF3A 2C4FU 1MF2L 4PRBB 5F7YC 1OAYL 4AK1A 1XIWC 4JN1H 3BISA 3KLHC 1NAKH 4IIQC 1HOCA 4J3WA 4ETQB 5GISH 1ZS8B 4Y1AD 2VH5L 4WEMB 2HVJB 4MQ7A 5TE6H 1D5ZA 5DMIH 4HLZG 2VQUA 1Z0NA 4XH2B 1EO7A 3MRFA 4V1DD 1QSVA 1OSZA 1WZ1H 5EOCH 5LCVH 4DUWA 5C0FA 4FQXC 4L5FH 1NGYA 5E6IB 3BKMH 1CK0L 4KJQD 4IRSA 5F7DA 4XC1L 3ARPA 4H1LH 4JGUA 4BQ6A 4HWEL 3G5VA 4P5TC 3D39A 1LO4H 2NX5D 3IFLH 3OJ2C 2ICWA 5J06A 3RZCA 3F7PC 4AMKH 4AT6B 4LEXH 4O4YL 1P5VA 4PRHB 1CQKA 2EYTA 4DVRH 2VLMD 5IBUB 4HGWA 3B6SA 3QIWD 1JBJA 2EDTA 4NWTL 4PRIB 1GGBH 4R4FH 4P2RB 3TH3T 1U8JB 4Y1AA 5KW9L 1D5XB 5C2BH 4D9QD 4XB8A 2VZUA 3JV5A 4NC1E 2O61B 1HXMB 1MWAB 4Q9QL 1PQZA 5HVWA 1BQHG 4V1DA 4XPHH 2WBWB 2QQLL 1BFOA 3WIHA 2NX5A 5F6IC 3STBA 2MQCA 4K7FB 3U1SL 1VFBB 1FNAA 2J88H 1EBAA 3IU3B 3OV6A 3O6LL 3QIWA 3FN9A 4XGZB 2UVFA 2QKIB 3JV4B 3OGCB 3TFKC 3DI2B 4YFDB 2N56A 2A73B 4KVCL 4YH6A 4P3WA 5K9QI 3UYRH 2IPTL 4BSWB 2DTSA 1VKXA 4XPFL 1WBZA 4R2GB 1XGTB 2UWEE 3MJ7A 5K93A 3PWNB 5LWYH 1GGTA 3SHSA 3MUY1 4QXWA 5E5MA 3PHQA 4XVTH 5DJ2A 4K8RL 5AD0B 1NEZA 1DQJA 3NFNA 4NRXA 2PXYC 5HYFA 1MEXL 3BYYA 4AYFA 5KZCB 3OKNA 4HJJH 1YNTB 1A6UH 3ARDC 2ZUWA 5E7FA 4ODUA 3BYTA 3CK0L 4O58H 5HDOA 1UJ3C 4XB7A 4IS6B 1GRWA 3I6LD 1MQKL 3V5KA 2X1XR 5DA0B 4OCRH 4QHNA 1I75A 4FXLA 5ANMA 5CD5D 4HULB 1KT2A 5DEGA 3DSNA 4RNRA 1HKLH 1QLEL 3DYOA 3FONA 3FAXA 5HGHB 5MEPA 2Y36H 3HTLX 3I84A 4N8VA 4ZTPH 1EUTA 5DJ8B 4GG6B 3MCG1 1PZUB 2EYSB 4Y2OA 5IESH 5IOPA 2HJFA 3IFNL 5T3XL 5ABDE 2R23B 1MCLA 1FN4A 4CVWA 1AXSA 4G9FE 4WDIA 2N7AA 5D1ZD 3O9WD 3C5ZC 3Q5YA 5KANG 5DJCA 4J8RA 4K3GA 3G04B 2EEDA 1BFSA 1BBDH 5GGSB 1BZ9B 3HI6L 2AP2A 4U1LB 2GTZB 1DQTA 3VFGL 5D71H 3DECA 3O4LB 1BFVH 3OZ9L 4OKVA 4Z76B 1H3UA 1YEKL 3AB0B 4LARH 3FQXB 4DGVL 5KSUB 5IBLC 5DT1H 4CMHC 1CT8B 1LEIA 2Y1VA 4ZO8A 5D5MB 4BQCA 5DI8B 4F15C 4XAWH 5E8OA 1KIQB 2Z4QA 4JM2F 5IJKC 3MRDB 4NO2B 5GGTH 3LMJH 4N0YH 1SBSL 5D1ZA 3W11C 3O9WA 3EJYD 1S7UB 5ESQA 4WI6A 3RIAF 4HIXL 3O6MH 2VUYA 3KJ4C 2WINB 1FP5A 3QEQD 3RWEB 4O5LH 1DFBH 5D1QB 1U8PB 3AY4A 1GZQB 4YHPB 4NOBA 1QP1A 5B3NA 2ICCA 4N5ED 1KFAL 2DWDA 2C3WA 4LLWA 5CZXC 4ERSL 4Y5VC 5C9JA 3LRSB 2PYEE 4L9DA 2Q87A 3OKDB 4FFWD 2J8UF 4FFVC 2Q76B 3DUHA 3CVIH 4GW1B 3ABZA 1JYNA 4XC3L 4M5YH 4OI9A 5CJXA 5I1JL 4MDJA 4NHCH 1KCUL 1SBBA 4YJZL 3QEQA 3CX5J 2IANB 4BFGA 2E9JA 3KPLA 1ZHNB 1RUQH 3DGGA 3MOBL 5CBEB 3MV9A 1QKZL 3REVB 5DHXB 4QHKI 3EHBD 4H25B 4L8BB 2ZJSH 3EFFB 3KPOA 1DP0A 7FABH 1Z6JT 3QG6A 3VFRB 1EEZA 2I25N 3GSQB 5L6YL 2H26B 4OCXH 4GKZB 1BEYH 1EA9C 1GOHA 4RBPH 5D6CB 5KJRH 3HA0A 4HD9A 3OR7B 3LKPB 2YD4A 5TF1H 2EDFA 4F8TA 3IJHA 4GG6F 3PV7A 2KPNA 4Q7DA 4R7NB 1CF8H 3ZKMD 1MJ8L 1DN2A 3REWA 2PO6D 2R0ZL 5GRJH 3EOTL 2GW5A 4KK5C 3O2WH 2H6PA 2DM7A 2CKBL 3GHEH 1G7QA 1RJCA 3VE0B 1IGFL 4MXQC 4U1IB 3GIZH 1TETH 4P3DA 4OAWB 1MQ8A 4UUJA 5EB9A 2NY2B 1ZHBB 2H32B 3E6FB 2BVQB 3O11A 5CZVL 1YYML 4HKXA 5AYUL 2F53E 3RDTD 4QXUH 1Z9OA 3O3EB 1G7MA 2EDEA 3RBSA 2AKRA 4DEPC 4AEFA 4M7JH 4Z7UF 3MRQA 1RUKH 4BH8B 1P4BL 2PO6A 4NM8L 3I6GB 2B4CH 4NFCA 3MRBB 1A9EB 3V0WL 2ZSVB 5CILH 4YK4C 4P3CL 3RY6C 1MJ7L 3BMVA 4S1RH 4HJ0D 3KYMB 5E03A 2B1HH 2L0DA 4N0UE 1DZBA 1WTGT 4QOKE 3KPSB 1QO3B 1KC5L 2YZ8A 3MXVH 3RDTA 3L6FA 1CD1B 3QR2A 5SWQA 3VGEA 1PDKA 5FUOL 4D0CB 2VZVA 3E2HC 1AD9B 1KJ3H 3E6HB 1KNOA 2F5AH 3K8MA 2WSKA 1S7RB 1OP9A 1ZANH 1HYSD 5B8CA 4FQQA 1MH5B 4HIHB 1AP2A 5I66B 3QUMH 1Q9WA 1EAPA 5D2LE 1Q94B 2HH0L 4NO3B 3HC4H 1C16B 4F7MB 1EJOH 2C3HA 2X40A 4G5ZL 3T09A 2OI9C 2BMKA 1R6VA 3M07A 3BPLB 4H8WL 3WFDH 4OZIF 1GCFA 4O2CB 2GSGB 3IS1X 5DUML 4V1DE 4OUOA 1KB9K 1JPST 4QY8A 2HFFB 3QEHB 2KUTA 5DHVH 1YEHL 3UMTA 3VI3F 1MF2H 1OAYH 2BVPB 2IQ9L 4P0DA 2IAMC 3CFEB 4M8QA 2DL2A 1QFWI 4LCCB 1INEL 2VH5H 3TO4D 2C7UB 5CGTA 1LNUB 2R2HB 1MFEL 3T8XB 5C9KA 5EU6E 2V5RA 3HNSL 4YFLF 2HFEA 2I60L 1CVRA 4OZGB 1CK0H 1RJYA 4XC1H 4MMZC 5L2JB 1T20B 5H94A 4HWEH 5IM7A 3Q6FA 3GJEA 2FIRT 4O4YH 4M7ZB 2EZ0C 5DUBB 2ID5A 2VLKE 5ID0A 1OWRM 5D7JD 3VH8G 4NWTH 1UM5L 3C6LD 1AQDB 2MJWA 3S5LB 4IJ3B 4TOYL 1R3LB 4Z7VF 5KW9H 5E4EB 1LEKA 3V7MA 3TO4A 4Q9QH 5DK2A 1NCUA 1KEML 2QQLH 4MQXD 1U8NB 3PWVA 4I3GA 1HILB 4WY7L 1R24B 3KS0J 3UTOA 1JHKL 5D5MA 1TFHA 1G0XA 4DGIL 3GM0A 3U1SH 2GIYA 3O6LH 5GZOD 1G7PB 1MJUL 5GGVY 5F93C 5D7JA 3QULB 1NKRA 3C6LA 3RVWD 3S7GA 3NCCB 2XOTA 4JFYB 4KVCH 3FZUD 5LGJA 1WBYB 4HGKC 2VKWA 4ZSOB 5T1LB 3UDWA 2IPTH 5F7HA 4RCAA 43C9B 4FMFA 3JV6B 4XPFH 5GGUA 4WTZG 3RU8L 2IAND 3TESA 3SY0A 4HKJB 2LU3A 2P24B 5FB8B 4QHUA 2HRPL 4K8RH 4NRZA 3RHWF 1KB9J 4N1HB 1MEXH 5F1IB 1UGNA 3ZE0E 4F7PB 2DMKA 1IARB 4X9BA 3GEWB 3TZVB 4WCYL 4HX1B 1QRNB 3SGEH 3UJJL 5H2BA 1AJ7L 1TJGL 3CK0H 4MZ2A 5D1XD 4R97B 2E8YA 3L3HB 3UTQA 3CFDB 1MQKH 1M6OB 1UZ8A 4RX4D 2IANA 1LDPL 4XP9L 4ELMF 3BH9A 5ITFB 3T4AB 4TYUA 1R3IL 1HZHL 1QLEH 1T04B 3JVGA 4GMSL 5EBLA 2OYPA 3JSSA 1A7NL 1I9IL 2X4OA 3QHFL 4ODXA 4L8BA 1U3HD 4PJGA 2GSIB 4XNYL 4WUUB 4Y16D 4PGCA 3MV11 3IFNH 5T3XH 3VFTB 2A2QT 4Y19D 1I7RA 1RSFA 6CGTA 3AMLA 3D18B 3S96A 1FVDB 4EUPA 2Q7YB 5F9DC 2P7TA 4PRDB 5D1XA 1TPXB 5HVHB 3IJSB 5ACZB 4LSPL 3LKPA 1VB9A 4OCNC 4QHLB 3WO4C 4CDGC 1FVEB 1CD9B 4O2FA 1KOAA 3CDCA 4KTYA 4RX4A 4HEPG 4LSQL 4I0CC 4OZGF 4NDMB 3HI6H 3C08L 3VFGH 3DVNB 3OZ9H 4F7EA 4HCRA 1MCRA 1YEKH 1U3HA 3WXVL 4DGVH 2A6KA 2FJFA 1BJMA 5C0IA 2DOCA 4CJ0A 3CVHB 1C7TA 4PJIB 4Y16A 5I74B 4Y19A 1IGIL 3C09C 2D2OA 1AKJB 3OJDA 2IPKB 3CFJB 4GOSA 3IDXL 1JTTA 3L3IA 4LLMB 5IB3B 5K59E 1NAMB 4IMLB 1G7IA 3VMOA 3KPSD 1SBSH 4OZFA 3ZYJA 4QHKJ 5ITBL 1NDMB 4JDVA 2WV3A 4XBGB 3L95A 1KXQE 4AL8L 4M62L 4HIXH 5EPMA 3EDKA 3PG2A 3GSVB 1UXWA 1AR2A 2EO1A 3KDMB 4BSJA 1A9EA 1B0GA 4GUPB 3TT3L 3ROLA 1KFAH 5ETUB 4PJEB 3RRQA 2VDNL 5FKAB 1OP5H 4ZUUB 4ERSH 1Q1JL 3QCUL 2XN9D 3TA3D 1BX2B 2GYSA 4P2OB 2CRMA 3KPSA 5DFWH 1KIRB 3Q48A 1KTLA 3RNKB 3ULUE 4XC3H 5CP7B 4UIMB 2O5YL 3IGAA 5I1JH 3WFEL 1KCUH 4E5XB 4EVNA 4RZCB 1FV1B 3E8UL 4LQFL 3V95A 4WV1A 4WVRA 4LDEB 4PJFA 3MOBH 1HHJB 3G9AB 1QKZH 1N5YL 1HINL 2XN9A 1YMMB 3TA3A 4MNGB 5C7XL 4PRHE 5CHNB 4LPUA 3C87A 2XPGB 1D6EB 1C5DA 4JY6B 3PV6B 3QDMD 1T5XB 5KBNC 1C16A 2HYMA 1T1WA 4LSVL 5L6YH 2QTEA 3D3VB 4PRIE 2ZUXA 4P2RE 2A74A 5DDHA 3UJIL 4HPYL 3W9DB 4JRWA 2R0KL 4JKKA 1BIIA 4MB4A 2PTTA 4P2QB 4YBQD 1MJ8H 2AV1A 2JE8A 2DL9A 3UYOD 2B8OT 2R0ZH 3EOTH 3LQZB 3O4OC 3V4UL 5DO2D 4S11A 3ZSSA 2A6JA 2CKBH 2IPUK 2AV7B 3OG6B 5I1DA 1IGFH 1K8DB 4X83A 1EEQA 4NT6B 4UBDC 3QDMA 1E4KA 3JTSA 4M6ML 3RA7L 3HE6C 2EDHA 3H7BA 1YEIL 1KJVA 3T8XA 3HC0B 1L7TL 1SQ2N 5J6GB 5CZVH 1JHTB 1YYMH 4WFHD 5AYUH 1G0DA 4RISL 4LFHD 3N50A 4OD2A 4HWUA 1X6NA 1F3RB 4K94C 4WGVB 3BRGC 4PG9B 4PJ9C 1X7QB 2RIKA 4CDHA 3MJ9L 1LGVA 4OGAD 3SO5A 1P4BH 5HGAA 3BN9D 4NM8H 2CDFA 3V0WH 1BJ8A 4HJGB 4S1QL 4P3CH 2OTUA 1MJ7H 2EE6A 2I07A 2CQVA 4LAJH 4I0KA 2GK2A 4PFEA 4H26B 3HCVA 2ZUUA 5CEZE 1KEGL 2Z31C 4TSAL 3KPTA 4NQTA 2KH2B 1KC5H 1FZKB 1OLLA 4U4BA 1N5AA 2E7BA 3QPQC 3ZKXC 3BJLA 5GSRB 3VRLE 4JY4B 3F7YB 2GQHA 1Y6NR 3ZYZA 4PPTA 5FUOH 3O3BB 1YECL 3DO3A 1YQVL 3TJEL 2PETA 4U7SA 1CGVA 1O5DT 4I0PC 4MA1C 4K8RC 3WNMA 5T3ZD 1U41A 5CSZA 2A1WL 4KKLC 3HZKA 4U0QB 4R0LB 3K1KC 1G9NL 4KHXL 1ZWIB 5BW7A 1PLGL 2HH0H 3BWUC 3QDJD 1WIUA 4ZOAA 4G5ZH 2A0LC 4W4NA 3QEUA 3MJ8B 3I3BA 1HIML 4B50A 2N7BA 4H8WH 5F1IA 4MA8L 5F7FA 3U9PL 1P4LB 3O4LE 5DUMH 5I8CA 3TBTA 1T7WA 3DXAB 3QQ3B 5DC9B 3RWDB 3D0VA 4YHML 1ZA3B 3CU7A 5D4QA 3EJJX 3U7WL 5IROA 4ONOA 3D1MC 1MCNA 1YEHH 4P5KA 3P9LA 3MYJA 4Y5XB 5D5ME 3S8WA 1K5NB 2IQ9H 1AO7B 5SX4H 5EO1B 2OP4L 4KI5D 5DMGC 3WYRA 1INEH 1CDGA 3QDJA 4MCZB 3R0MA 2DM3A 1MFEH 3JWNC 1MAKA 5TE4L 1DVFB 5IHUL 1MCOL 4PRNA 1UFUA 1HHGB 3HNSH 5INCA 1MCCA 4U6YA 5GRVK 2I60H 4KMTL 3UBXG 1SEBB 5F1KC 1C1EL 2CPCA 4U7KA 3BVNB 2NXYD 3QCVL 4KK8C 3TLRA 4RIRB 4WHDA 2CLVB 4ZNEE 5MHSD 1XCTB 5GXBB 4KKCD 1DQML 2DB8A 1M7XA 5FA3B 5JXEC 2NPLX 4NCC1 1F6LL 5DVKA 2CUHA 3JZ7A 1UM5H 1CDJA 3KWWB 5D7IB 1YNKL 4S1DC 2NY1B 4TOYH 3CFKB 2D4DA 3BESR 1LK2A 2HFTA 5CS7A 2GUOA 1W0YT 3IXAB 3VGGA 4RRPG 2VLJB 1VGKB 2DICA 1OSPL 3VFVB 2BJML 1KEMH 1Y0LA 5DRWA 3HAEB 4X98B 4TNWK 1JZ8A 5EZIL 4RWHA 4WY7H 2HN7B 3VGAC 3ESUF 4NCC2 1JHKH 4POZC 6FABL 2IANE 4DGIH 4RDQG 3W82A 1D7FA 1OTUD 1FNGB 1FH5L 1S7QB 1YMHB 3F5WA 1MJUH 5EOCJ 1X5IA 4KHTL 4ESKA 3V6BR 5JMRA 4LLVB 2D7OA 2JCCB 3HPJB 3ARFD 1TNNA 4JDZA 1ZVYA 4MXVE 2NY7L 3RX7A 4ENEC 1NBVL 5EU7E 3H0TB 3HZYB 4A2MA 3RU8H 1FIGL 1ONQA 3FTGA 1A6VL 3KXFB 2HRPH 4XWOD 3K4ZA 4BSVB 4NZDA 2X05A 3GMOA 3BZDA 3B8YA 4Y4FB 4WCYH 2DN7A 3GNML 2O26U 2YRZA 3UJJH 3ARFA 1CG9B 1LD9B 3HLAA 1AJ7H 1TJGH 2EDNA 4G6KL 2FZ3B 5CSGA 4YHYB 4R7DA 4OGZA 4UB0L 1EJ6A 4WI2A 2F74A 2IADA 2P43B 5EC1B 1LDPH 4XP9H 3BEWB 5GGRA 1CLCA 4DQOL 2KKQA 2V9TA 1R3IH 1HZHH 4GMSH 4NZUL 4PJ8D 4XCEA 1A7NH 1I9IH 3QHFH 5F8QC 3VDAA 4XNYH 5DTFB 1H3PL 3L3JB 4G42A 4DK6A 4WW1B 2VN4A 3FHAA 4MAYC 4AENA 4R96B 4X5WB 2BY1A 2DQJL 4S0TD 2XTJC 4YAQA 4BQ9A 4OBSA 1EV2E 3UYPA 1ZT1A 4DCQA 4LSPH 1QSEA 5C8JB 1CGUA 1T83A 2H2SC 1UVQB 4LSQH 3KPSE 3DO7B 3OTTA 5BXFA 3C08H 4Z7NF 4PJ8A 5HGBB 1D9KD 5I1GL 4QRPD 2R9HC 3MUHL 1KIUA 3WXVH 4L8DA 4LKCB 3VXTB 3STZA 4QCIB 1IGIH 1C08A 4LEOA 5D7IF 3CLFL 5GS1B 5LXGL 3IDXH 5D96C 3RWHB 4ZAKC 5B39A 3HC3L 4OFYD 1NGWB 4UIKL 5D2NA 1UWGL 2LABA 1F11B 5ITBH 3WE6A 4AL8H 4M62H 2IEPA 2MQ0A 1CFTA 5IFHL 2LVEA 4QRQA 2XZQL 4S10A 2NY4B 4ELKA 1D9KA 4QRPA 3D6GA 4GJTB 4OZHB 2R1WB 3U82B 3NMEA 4DKDC 3TT3H 1DEDA 3FHQA 4RBPK 2VDNH 1T21A 4HDIB 4L9LA 1Q1JH 3NOIA 3QCUH 3FQTA 1NMCC 4ORGA 3T2QA 1KG0B 2VR9A 3BP6A 5F89A 3VXMD 4OFYA 1MHEB 3QO0A 1FCGA 5DJ6B 4QGYA 1KBGL 2BERA 3JWDL 5BRZD 1QLFA 1RPQA 3DUUB 2O5YH 1KIPB 4X6FB 3WFEH 3RWGA 1F4HA 3L3OA 4X99A 3RPIB 1P7QD 3E8UH 4LQFH 1VACA 3PWLA 4OLEA 1IRAY 4NJAL 1T7XA 3FOMB 3C5JB 3K46A 2X4UB 3VRJA 1N5YH 1Z9SA 1HINH 4QKXB 3ZTJH 2IH3A 5C7XH 2R39A 3VXMA 4F3FA 1N2RA 2F8OA 4LSVH 2CK2A 1YUHA 3GSXA 5BRZA 3S35X 1S9XB 1EFXB 1Y6MR 2ITCA 4KV5F 4HPYH 4PJAB 3UJIH 3WUWB 3MO1A 2WUBL 4Z8FL 3I85A 4M9PA 2R0KH 1F00I 4PP1C 3LKNA 1P7QA 4Y5YC 4X4YB 4P23B 4WFHE 3KYKL 1JF1B 3M1BA 2ESVB 4JGJA 3UPAA 3VFPB 2W9EL 5KSVB 3V4UH 2PW2A 3MC0A 3IJYA 2ADGA 4D8PB 2ADJA 1A2YB 1SJEA 3F7RA 2X4TB 5F1NB 3GMPA 5C0NC 5JZ7D 2OSLA 5DGQA 4UAOB 1A47A 1A6AB 3UZEA 4M6MH 1ZT4B 2DYPB 1RVFL 5CGYC 3RA7H 1N3NB 4WW2C 3GZKA 2FX9L 2AJZA 1YEIH 1L7TH 2MKWA 3JUZA 4ZSOE 4Z7WB 4P4KD 4RISH 5IW6B 1A3RL 1GL4B 4LDOB 3T2PA 1CE6B 1Q9LB 3MJ9H 4RIRA 3W0WB 3MV8B 1MJJB 4JREB 1I8KA 3S36X 5IVXA 2YPLB 3GSRA 3M17B 5AZEL 1UKQA 4S1QH 1FZOB 5F44A 3VWKD 1U91B 4V2CB 4HH8A 5DZLA 2DQFB 1KEGH 2X1QA 4TSAH 1LVEA 4U3XA 3MBED 3LB6C 5EO0B 2DI9A 2KZWA 4P4KA 2GK0B 1A6TB 1QD0A 3ORJA 4PP2A 2CH8A 1D5BB 4UINL 1WZLA 4G8GD 3G6JB 2H3NB 2APBA 3VA2C 1H3VA 4HC1L 1YECH 3PDOA 2MCPL 1YQVH 1CDYA 3TJEH 1JFQL 4LLVA 4M4PA 3ARRA 5DMKB 4WUUE 1J8HB 5FUZL 3VWKA 3WLBA 2A1WH 3RWCB 1FE8L 3HS0A 1X5KA 2H9GA 3G6AB 3BEVB 1F90L 4LGRB 2AABL 2CIIB 3QUXD 4DK3A 5KSBB 1G9NH 3MBEA 4KHXH 4AM0B 4R4BB 2D9QB 4L4VD 1PLGH 1A0QL 5I17A 3WFHA 1NBZA 1CLYL 4KI5E 4NNXA 1XH3A 4G8GA 1HIMH 2P5EB 2NW2B 1P7KB 3SO3C 4EI6A 3CIQA 1EK3A 2EKSB 4J1UA 4MA8H 2ATKA 3U9PH 4LSUL 1S9WB 4L8SB 3BP4A 1HQRA 2ADIA 1WAAA 3CC5A 3TN0C 4YHMH 4Z0XA 4ZFGL 4KK9D 4HUVB 3OR6A 3U7WH 2PKDA 1HCVA 2HP4A 4PJIE 2ICES 5TF0A 4YXHL 5IBUG 1MCFA 4QNPE 2Z8WC 4KMQA 4XX1G 3QUXA 2OP4H 2M8XA 1N64L 4LLYB 3PWUB 3BGMA 2BVOA 2QR0A 4L4VA 2OJEA 5T5FL 4GRLB 5E56A 3P9MB 1KELL 5IHUH 5TE4H 1MCOH 1NSNL 1MOEA 5TDPB 3S34L 1TVDA 2EXYD 4KMTH 2E6JA 1KLGA 5CSBA 1FG2B 5J3HD 2IC2A 1C1EH 5H37H 2Y25A 3QCVH 2CUMA 2YXMA 1PX4A 3DETC 1FO0H 1YN7B 4JPWL 4R26L 3QAZC 4PJEE 1MHCA 5A2LH 5C07D 4P57A 1JNJA 3T0XA 1DQMH 3VFOA 4MNQD 3L3GB 1NH6A 3V2AR 4F7TB 4PJXB 3O6FB 1YNKH 3WIIL 1OTTC 2DLIA 1INDL 3CMOL 4EN3C 4JRYD 3VD9A 4ZS6C 2NY4D 5F6HI 4Y4KC 3T0EC 1OSPH 2BJMH 4NQXB 3ARGC 4LLDA 4OF7A 4YWGL 1RJZB 2PF6A 5BO1L 2VN7A 5EZIH 4JFOB 4QCIA 2D0GA 4EJ1C 4GLRH 1G7HB 6FABH 3GGWB 5HI4D 3RKDC 2NXZC 5IB1A 3MX0A 2HTKC 2X4QA 3K80A 5EUKB 3EOBB 5C07A 1FH5H 1I3VA 3D69B 4MNQA 4KHTH 2EEBA 4UOW1 1YMME 4MNGE 2NY7H 4HAFA 5C71A 4JRYA 3NIFF 3VW3L 1NBVH 2ARWA 4MJ6B 3OAYH 3Q6GL 3U30C 3D3VE 3MRJB 3G6JF 3VGDA 2AJSL 1FIGH 3VU2A 5K33A 5MEQB 3MV7D 1A6VH 4OQ1A 1J8KA 1KLFA 5ERWB 3F62A 3WN5A 4W4OC 1M7IB 5BVPL 4P2QE 4JZNB 1T66D 3WS6A 1DBML 2ATPB 1CL7L 5DEZA 3B4NA 4W70A 1CXHA 3QH3B 4L1HA 4YHKL 1MREL 3GNMH 5A2KH 5GRXG 1UQSB 4X7TA 5KSBF 4ZFOL 4ORZC 3U2SA 4XCNA 4YZFF 1U8LB 5J9PB 2NR6C 4PV9B 4TTGA 4G6KH 3WJLC 3NIDF 4UB0H 2G2RB 1MVUA 1G9EA 4XHJC 4TUJA 4OLUL 3RL2A 3MV7A 4S0SD 1T1YA 3TYFB 3P0GB 4DQOH 5D2NE 4ODBD 1XIWB 1GZPA 4NZUH 4IIQB 3RFZC 3ARQA 1H3PH 1JRHI 2AW2A 4W6WB 1J1PL 5EBWB 4ODVL 1FFPA 4FQXB 2JJVA 2DQJH 3E0GA 4NKDA 1JUFB 4V2BA 3CSYA 4NC2B 4P5TB 4CRPA 4WEBL 4WU5A 3DRQA 32C2B 3PWPD 4RQQB 4G6ML 1OP5K 3MRIB 5I71C 1EO5A 3EGSA 1JTPA 3QXAA 3GUTB 1KYOK 1B0RB 3TGXA 5DRXB 1S7SA 5F3BB 3OWEA 5EOTA 5F7UA 5I30L 5I1GH 2FYYA 2FEDC 5E1HB 4NQCD 5ALCL 5FFLA 3QZWA 4RA3A 5EFIB 3U0WL 2XKNA 4KRLB 4AG4L 3CLFH 5F7NC 5LXGH 2YD5A 1WQVT 1XEDA 2BVTA 3HC3H 4PUBL 1J7VR 1MLCA 3HR5B 4UIKH 5F6IB 3PWPA 1UWGH 3K7UA 4XXCA 5I1CL 5HGDB 4MVBC 5IFHH 4LCYA 1W0VB 2XZQH 3WKML 4IDJL 1LHZA 4X7DC 4WENB 2DLFL 1PW3A 1WC7B 4NQCA 4U6HB 5JHLL 4EDWL 4IRZL 5SWSD 3EZJB 1UB6B 5DS8B 3DXAE 2OBGA 2DD8L 2F54D 5J1SC 2MSPA 3GSNB 1Y18A 1INQB 9CGTA 1AO7E 3U7YL 1IAIL 2BOCB 2PXYB 3BIAX 1KBGH 3JWDH 5HYEA 3D5OF 2VL5B 2ZUQC 1I7UB 5T1MB 3S88L 3ARDB 5A2JH 5B4MC 3K2UL 1DDHB 2C1PB 2WP3O 4WJ5B 1UJ3B 1S78D 1ZSDB 4NJAH 2V6HA 5SWSA 3S4SB 1EHNA 3NABL 4ZD3L 3CSPA 3NA9L 3FT2B 2BOBB 2F54A 4Y4HD 1P84K 3QNXB 4PJBA 5LAXA 2X1OA 2EIBA 3TBWB 5C0CB 3MRKB 5ECJE 2DJ4A 1R5WA 3RVTD 1H3GA 4U05A 5D7IE 2EIDA 3HZVB 5F3HB 3VFWB 4N0FB 2WUBH 3O2DL 4Z8FH 2D31A 3QJHB 4ZTOL 3N1FC 2VLJE 3ME0A 4JM2C 1KYOJ 4YDLB 3DRTB 4PJGF 3VJ6B 3NAAL 4KXZI 3KYKH 5DJDA 3UPRB 2W9EH 3LQAC 4DW2L 5CJQL 4Y4HA 1QFUL 3LPWA 4JPVL 5FYLD 1BBJB 3GKZA 4Z18A 1BJ1H 3FB5A 1EIBA 3HB3D 3NN8A 4ALAL 1Z3GL 2GCYB 2WIMA 5BOZG 3FQRB 2UZXB 3U0PA 3DX9A 1RVFH 2JCCE 3TNMA 2FX9H 4PTUB 2YUXA 4OUUA 1F4XL 4CJ1A 4CMHB 1IT9L 1A1MB 4F15B 5CEYA 4PYGA 4KROC 4TVPD 5IHZA 3MLVL 1A3RH 4X80L 1NUNB 3ILPA 4KK6D 1NGXA 3KXFE 3WBDA 1O7SA 1MFCL 3BD4A 4E9LA 4HZLA 1KB5B 5DRNB 2GITA 5DQ9A 2JJTA 3V5HB 5AZEH 5IQ7L 3KJ4B 5FF6B 4QHMB 5I1EL 3BPNC 5EH1A 2EDWA 1L0YA 1TVHA 3QFJA 3HUJB 1GYAA 4PJDB 4Y88A 4G8FB 4M9OA 2DM2A 3TO2B 1A1NB 2VLLA 4QRSA 4Z5RB 1TVBA 1DUZB 4Y5VB 4R4NC 5J1AB 2VSCA 4UINH 2VR4A 4S2SB 3IFPA 1CFNA 4XNMB 1UWXH 3KYOB 4L4VE 2HG5A 4ZXBD 2BCKA 2GFBA 4X4XA 1RIUH 4HC1H 2MCPH 2VTFA 3AREB 3PGDA 3BPCA 2EYRB 1JFQH 1IGYA 2FWOA 1S9VB 3PNWB 5CMAB 5E5RB 1P84J 1OWWA 5FUZH 4ZUTA 1FE8H 5CJ8A 5M95B 3HRPA 3LCYA 5E6ZA 1R3HA 2K7PA 1F90H 2AABH 1CXFA 4OV5A 1G7JA 5MEQA 4OCWL 5D7LD 1OM3L 3MRHA 1A0QH 3VWJD 3IF1A 1XIWD 5HPMB 3VD4A 1CLYH 4U2ZA 3FQNB 1K2DB 4MD5A 2ED7A 5HDBF 4ZXBA 2A83B 4PJFF 2AJ3A 2ZP0T 3L7FA 2Y5TA 1EMTL 4UZGA 4LSUH 4WHYG 5FM5O 1TXKA 2I9TA 4XCYB 1DUYA 4ZFGH 4FQXD 3ZHDA 3P4MB 4HF5L 3AAZB 4YXHH 1J87A 1AGFB 4MA3B 5IB5B 1I1FB 2OR7A 3LN4A 4X8JA 4PGBB 3S5LG 2FSEA 1N64H 3HE7C 3WKNA 5D7LA 2LQRA 3VWJA 4HMDA 5T5FH 4U1JA 5JHDB 1D5IL 5DK0A 4H1LB 1O7VA 1AGBA 1KELH 1J10A 3WIHL 1NSNH 2FGWL 2YSSA 3S34H 4JFQA 1A64A 4OKDA 1VESA 1BQUA 1AHWA 4NM4L 4OZHE 3X17A 4PLNC 3RWIA 3MNWA 4FQXA 4HIIA 1RUAL 4RMWA 3BQUC 3O3AB 2YMXL 4JPWH 1JUFA 4R26H 4WFFE 5DFVC 1A3QA 3D25A 4NUJB 1U3YA 1QG3A 2EDYA 4DEPB 5EUOA 4NP4L 3SDXA 3LS4L 4MWFA 5F7LB 1OTSC 3IDUA 1N8ZA 5E94B 3WIIH 3X14A 2NYYD 2C4XA 1INDH 3CMOH 4FQ1L 4UT7L 5GZNC 1UACL 5E2UL 3TFKD 4JQIL 4KJPD 3BKJL 1FFOB 4PY8J 2NY0C 4YWGH 2PR4L 3BW9B 5FECB 2AK1L 5BO1H 5JIHA 2Z9TA 1IZKA 3EDJA 3O8XC 1WIOA 3MQIA 2AJVL 3F12B 1YZZA 4JFXB 1BOGA 4N1EA 3HUJF 4C59B 3P73B 3V52L 5ID1B 4LNVA 1CIUA 4G6AD 1XR9B 2H8PA 3B9VA 1N6QL 3E2HB 5E24E 3VW3H 2HJKB 4UDUA 3Q6GH 3IDJB 5DYOB 2AJSH 2WIIA 4PJAE 1DLHA 1ZLSL 1LO2L 5BVPH 1KPRB 1DBMH 3OXSB 1CL7H 2J6EA 5HDLA 3V7AE 4PRPB 5DVMA 3TCXA 3H3KA 4HKBB 3SGDI 2ESVE 2OI9B 4YHKH 1MREH 2Y5EA 3NPSC 2ED9A 3M45A 4WFED 1S7VB 3QJFB 4C83B 3L5XL 1UM6L 4KZEL 4OLUH 4G9DB 3MRMA 1ED3B 2X4SB 4Z7WE 2EE3A 1ZSDA 3EZ8A 1WT5A 2IAMB 3C5ZD 3EAKA 3RVXC 5LVEA 3P4OA 2BHZA 4HUXA 5HD8C 3MV8E 5FO7B 3P30L 4JJ5B 5AAWA 3BN3B 1J1PH 1QBLL 1UB5A 4ODVH 2YPLE 3VFSA 4NQCE 1DSFL 5E2WL 3JV0A 5KANI 4ODHL 3R8QA 5KN5A 1V8HA 4BFIB 4WEBH 1DBKL 2K7QA 2CDEA 4G6MH 1JWSA 1TITA 5T1KD 2O5XL 5FA4A 1F4YL 1D3CA 4MQSB 5JW3L 4KTEL 3C5ZA 3OB8A 2RB8A 4KKAC 5I30H 1LE5B 1I8IB 4KFZC 1P53A 5MERA 1YPZB 3EOAA 4XP4L 5ALCH 5ADOL 4ZYKA 1JPFA 4HUUB 4TUKL 1YY9D 3OXRA 4KRMB 3IETB 3U0WH 3KPRB 3H2WA 3NPZB 4AG4H 4CW1B 2PUQT 1RHFA 4P9ML 3F6LA 4F9LA 4KVNL 2LFGA 3WEXB 4JFPA 1J8HE 1ZHKA 2MQ3A 3QQ4A 1KTRL 4XPBL 4RFOL 3RUGB 5T1KA 1ZEAH 1HEZA 2X1WL 2X4PB 2Q86A 5I1CH 4XWGL 3DPBA 4NO5B 2AK4B 1T2XA 1EXUB 1MCPL 1T1ZA 1Q0XL 2FJHA 3WKMH 4IDJH 1I8MA 3RQ3A 43CAA 1DCLA 3O41B 3BAEL 3NVQA 1U42A 2VDKL 1S5IL 4HZAA 2XWBB 1IKNC 4IMKA 2DLFH 4QRUB 1ETZA 4FQHA 1FAKT 3H9SB 3MCKB 3MROB 5JHLH 4QWWC 4EDWH 4IRZH 3MRCA 4OSUL 2G5BB 5E9DD 2DD8H 1PBYA 2Q8BL 2GY7B 4PJDA 5KSAD 5FYJD 4RGNC 4L29B 3I6KB 4NC0B 1NCCL 3FFDA 1XGRB 1Q9OA 3U7YH 1IAIH 4I48A 3KPMA 2WLZA 3R06A 4KGLA 4LKXB 2V5YA 4P48A 4ZFFB 3UTTB 3KVQA 2YD3A 1J11A 3MJ6A 4GG8A 3S88H 3U46B 3QUYC 4AY0A 2BNQA 4NN5C 2WQ8A 3K2UH 5SWZB 1CGSL 1CXLA 2R2BB 3BD3A 4OD3L 1T4KA 3WNOA 1JGDB 5IMLA 3NABH 4ZD3H 3EO9L 2VZSA 5EO9B 3ALXA 3NA9H 1P2CA 3T2OA 5E9DA 4JANA 1QOKA 1U8HA 5KSAA 2W65B 4RAVB 1I9RL 3QRGL 2EDXA 4KK5D 2UZIL 2C3VA 2BVUA 2XIDA 1T2QL 3G08A 5FYLE 1FL6B 5H35A 5KVMC 3OHXB 4PJXE 3L9RA 4MXQD 1DN0A 5FYJU 5CIPH 3O2DH 5EIQA 4UQ2A 4IJ3C 3KNBB 4HIEB 2AAVA 4LIQL 4ZTOH 5FO9B 3EUUA 1BVKA 4HLJA 3MREB 5JUEL 4PBVC 4NPYA 3NAAH 1WBXA 4LPTA 4I5BA 4I3RL 3WO4B 3ZO0A 3GIVB 5JPMB 3CZFA 1SVCP 3KLAA 5CJQH 4DW2H 1QFUH 5IB5A 4PLKC 4JPVH 4HHAA 4ALAH 1Z3GH 2VXSL 2E7LC 2OQJB 5D8JL 2A6DA 1BD2B 1F4XH 1TDQA 5CWSB 5I8EA 1IT9H 4KRPD 4DFHA 2DF3A 2UZYB 3C09B 1OAQL 5F88A 4M3KB 1IM9B 3GI9L 4KU1A 3MLVH 1MI5D 4X80H 4HUWA 4NNYA 4GXVL 3SPVB 2P8MB 1BHGA 1MFCH 1CICB 1A4JA 3VCLA 4MCYB 2Z93A 2AGJL 5HJ3B 1BQHA 4PR5A 5IQ7H 3D0LA 3ULVE 5I1EH 2EIZA 2D03L 1EGJA 5I8OL 1JV5A 3BGAA 1TCRA 5H8DA 1L6XA 3G5ZB 5HHQB 5J1TC 3T0WA 2XKSA 1U95A 2YC1B 4Q9BA 5DD6A 3GBNL 1U3JA 2NLJA 1MFNA 1KV3A 4FFYL 3BXNA 4X6CA 3IDNB 1MI5A 1F3DH 3MNVB 1EEYA 4UQ3B 4YDVB 4NQSA 5L88L 1EFQA 2GT9A 1B0WA 2AXFB 2GJ6D 4XCCL 4P4RB 3U83A 4QT5A 4MX7A 1MCQA 3P73A 5EU3A 4LCWD 2R2EB 5E8NB 3LKSB 3RIAK 3QUMB 1SYVB 4ZPVB 4HIJA 4LPCA 2D7MA 5I1AB 1QEWB 4TNVF 1FZJA 1HHHA 1TJHL 3EYQD 2FR4A 3IYLW 3DIFA 4OCWH 1OM3H 3WUZA 1I1AD 4WWKA 2CDGB 4XVJL 4XMLL 1VERA 1X4YA 5D7KE 1P4IL 3HG1B 2DIAA 1V3MA 5DHVB 2QEJA 2GJ6A 5B38B 4JO4L 1EMTH 5FHAL 2Q6WB 4QF1A 4IOFC 4Q2ZA 5DJXA 3ARWA 4LCWA 4G6FB 4HK0A 1JK8A 1LO5A 4L3CA 1MIEL 4U6XA 4HGMA 3QJFA 1ZT7A 1F8TL 4HF5H 3BPOC 4AH2A 4LK4A 2JB6A 3W39B 1JNLH 1K9TA 2QADC 3QO1A 3UAJD 1XGPA 4N9GA 1JZ3A 2QSCL 1VSCA 3O4OB 5JW5A 4ZUVA 1I1AA 1I7ZA 2OXGA 1OAKL 2WBJC 5IK3A 5BVJA 2HLAA 1D5IH 2ZNXA 4WIQA 5F72S 4JPIB 1EDQA 1RZKL 4NKIL 3WIHH 1RZIA 2FGWH 1MFDL 5EU4A 3HAEG 3HE6B 5D9SA 4O51A 1CIDA 3FFCB 4GRMA 2IH1B 2P4AB 2PNDA 4ZS7L 2O93L 2H41A 3OAYK 4NM4H 5FK9B 1H5BC 1RUAH 5MI0B 2VQ1A 2YMXH 4ZDHB 2UVEA 3MA7B 5DURB 1RHHA 4NP4H 1PX3A 3LS4H 5IEKB 4PJ9B 1L9NA 2WZPD 4UT7H 4FQ1H 1T6VN 3UZQA 1UACH 2QSQA 5E2UH 1AY1L 3BO8B 12E8L 2ILLA 4JY5L 3KYAA 4RMSA 4JQIH 5HHMB 1LE5A 1EHAA 2EKJA 1T0MA 3BKJH 4K71C 4U6VL 1RZ8A 3VXOB 2PR4H 2AK1H 4EI5D 1A6PA 1GH7A 2BSRB 5IVXF 4N0CC 1NFDA 2Z31B 4PV8B 2CRIA 4F7CB 4JEGB 1YA5A 2AJVH 4CW1A 5HDBE 4PJHA 3ZKXB 4C57C 4ZUSA 3PJSB 3MRPB 3T3ME 3IXTA 3CCHB 4L8CB 3V52H 5TH2B 3GHBL 1AGDB 5L2KB 5F1OB 1N6QH 4TVSa 3UTTD 5C0CE 2Z35B 4YIQA 5DHYB 1YY8B 2NY3C 4I0PB 4MA1B 3RL1B 3UX9B 1GOFA 3MCKA 4YXKL 1J0YA 3QDGB 4EI5A 5TDOB 3QIUC 4PLJD 3VD5A 1EVTC 3GJFA 1ZLSH 3OKLA 1I85A 1LO2H 1A5FL 1KN4L 4NUGL 3P77B 4C56D 3IDGB 4JFDD 1I8LA 4MD4B 5CJOL 3V6OA 2I9LB 4Q6IC 4L29A 2P42B 4PBWD 4EZMA 1AGEB 2R1YA 4NQED 3D2UD 1GSMA 3DV6A 1XZ0A 3C2SA 4PS4L 4IHOA 3MUZ1 1S8DB 3L5XH 4FG6C 1H15B 1UM6H 3U6RA 4JFED 4KZEH 4UU9A 3L5JA 3L3KA 4GKNB 1IAOA 4PJ7B 2AQ1A 4YEFA 2VITB 3MFFA 2YBRB 4H5SB 1WAAF 3U0TB 2ARJA 3LN5A 4HCRL 1PEZA 2VUOA 5DD3L 4C56A 3CMGA 4EOWL 3NIGF 3PHOA 4JFDA 4LLUA 1ZLVH 3QSKB 5BZWB 1OLZA 1XR8B 2HFGL 5INDB 1Z0MA 3P30H 1BZQK 1K8IB 1JZ5A 1QBLH 3HZMB 1SMOA 3KPPB 1RK0B 1F3JA 4NQEA 1V3KA 3D2UA 3OL2A 1DSFH 5E2WH 1NBYA 1RZGB 1R3JA 4ODHH 1X5ZA 5LGHL 1DBKH 5I16A 5FO9A 3RP1A 3O3UN 4FNLL 4PJDE 4JFEA 3QWQB 2O5XH 1MCKA 1F4YH 1X6LA 2RAMA 5JW3H 4KTEH 3UTSB 4CMMB 1PAMA 3RTQD 4F37F 3T3PF 3MLTB 5DJ0B 4M1CD 5I2IB 4ZMAT 2IQAB 1X5JA 5ADOH 4XP4H 3OKOB 1DE4B 3KPQB 5K9OA 4TUKH 3I9GL 4APQD 5B3JE 3LKRA 3ECBA 1T89C 3DV4B 4P9MH 4HEME 1QVOB 4KVNH 4P46D 5CWSA 3VGAB 3OQ3B 3CH1B 3W9EB 4ZQKB 3PL6C 4XPBH 1C12A 1X5HA 2AJXL 4RFOH 1CGTA 1G6RA 4NYLB 4WHTA 3V0AC 1CI5A 4XWGH 1A7RL 2NY6D 3G5YA 1MCPH 1NLBL 4U1NB 1Q0XH 3U36B 3RTQA 2P49B 3BAEH 2VDKH 1S5IH 3C6SA 4LLQB 2D7PA 4YHNB 4YDIL 2FL5B 3TVMC 4FQLL 1M4KA 4APQA 3R1GL 3K4AA 4OSUH 3BJ91 3K4DA 1M1SA 1M05B 4MNHB 4U1SB 5T5NF 2Q8BH 2YC1A 2BSTB 4P46A 1NUGA 3AGVA 2Y6SD 1NCCH 4A6YA 1KGCE 1EHLL 4G80B 4G43B 4R90L 3KLDA 4IM8A 1LP9A 1NANH 3GBML 2P5WD 3WUWG 3DMMB 4U2YA 5DD1L 5JHDE 3S97C 4XNZC 3FAWA 3ZKSD 3IVKA 1CGSH 2COQA 1DQQA 2KDGA 4DVBB 5ICZB 1IEHA 4H0HB 4OD3H 1JZ7A 5EBMA 1VFAA 3V7AG 3VXSB 4G6JL 4RFEB 1QFWL 3EO9H 1UEMA 3P11L 1QSFD 4M5ZL 5IW1A 3I2CL 4IRSC 3VFMA 4XMKL 1YDPB 5ISZD 3V6FA 1I9RH 3QRGH 5JOPE 1R3KB 3RZCC 1VENA 3QB7C 4UDTA 3TJHC 2UZIH 2EC8A 2VE6A 1T2QH 4MAUL 3T65A 4AJ0A 2NZIA 2P5WA 3BUTA 3GSOB 3RHWK 4MAYB 1RV6X 2ZOLB 3DBXA 4UBDD 4KPHL 1QA9A 4LIQH 4CAGA 2XTJB 3BZEA 3N9GL 2CKBB 4TTDD 5JUEH 3TF7C 5I1LB 1J0HA 4I3RH 1QSFA 2G9HA 4KJQC 3S37X 5BZDB 5ISZA 1BLNA 1UWXK 1S9YB 1UZ6F 3BDYL 5E8EA 4PGEA 1JHLL 1ND0B 3QUKA 2VXSH 2P45B 2WAHA 4J3XA 2YD2A 3QIWC 5D8JH 3N85L 5HHMD 3TIEB 1ORQA 1I3RA 3BP5A 2EC9T 4PRAA 3TV3L 1N7ML 4I18A 3FRUB 1OAQH 3GI9H 2MMXA 5D96B 3VH8A 1ZAGA 1NDGB 3A67L 4GXVH 4ZAKB 5L9DL 1OGTA 1R5IA 1JF5A 3PP4L 3EO1A 2V2WB 4J3VA 2Z8VC 3WL9A 5GIRA 2E6QA 4X4ZA 1FL5A 2AGJH 4HH9B 2Y06L 4FHBD 3DOSA 5ICYA 1MLBB 5L8LB 2E27L 4PRPE 4CVUA 3PGCB 2D03H 5IFJB 5I8OH 5AG8A 5I76A 4LCWE 4ONHA 4Y4FC 4JN2A 5JDSA 1BAFL 3GBNH 2M2DA 4PTTB 4JVWA 2FLBT 4FFYH 3WIFB 4KKLD 5IHLB 4HFWA 1FC2D 3UROR 2VISA 2CLRB 5L88H 5HPOA 4JO3L 3GKWL 3QYCA 4XCCH 3CDFA 2Y7QB 1UKTA 1JYVA 2W91A 4WTZA 5T3ZL 1HNGA 2YEZB 1H0DA 4OTXL 4LSRL 2ADFL 2NZ9D 1RUPH 1JNHB 3QUZD 3QXDB 4UI2A 1NJ9A 1TJHH 3BKYL 1AGCB 1YC8A 1S7TB 5TDOA 4HSQA 4PGDA 4XVJH 4XMLH 3HKFA 4PJCA 5BJTA 5TGBB 1E4JA 3O3DB 3UJTL 5DMGD 1P4IH 2Z92B 3I50L 1OD7A 5GGRY 5CD5C 4NKOB 2DS4A 4LL9A 1Q8MA 3B3IB 4JO4H 5FHAH 5CBAB 1AXTL 4XZUA 5KS9B 3MGTA 4OFDA 4PJBF 4FFZH 5BV7C 2CRZA 1MIEH 4ODWB 1YPZE 5A2FA 3SDCD 2DLEA 1NFDE 1F8TH 2VDPL 5AUMB 5IB2A 4Y5YB 4LHUB 4YE4L 3TCLB 4JZOB 1V7ML 3QUZA 1EPFA 3WHXB 1S7WB 2DQHL 4B41A 4YXLL 2QSCH 4PY7B 4LCUA 5IB4A 1S3KL 1OAKH 2JELL 3RWJA 4ZFZB 3MMEA 1WCQA 3FOLB 3RUGE 5D1ZC 3O9WC 4S1DD 1RZKH 2JK5B 3UBXI 4E42A 1ZA6B 4NKIH 1IAKA 1MFDH 1U58B 3PXHA 4FZEL 1MUJB 3CVHL 2X4NA 4G8EB 4H0IA 5INDA 4ZS7H 2IFGA 4U0RC 5GQBA 1K8IA 4RMVA 4I4WB 1KENL 3DX8B 2FO4B 3X13A 1RK0A 4NRYB 3GMNA 4XBPA 4OQTA 4J3UA 3L3DB 3SDCA 1FNEA 3QDHA 3AY4C 1X4ZA 4NZJA 3AMKA 5A40E 3X12A 3GMMB 5JNYA 2YWZA 3U7AA 3TBYA 4EDXB 1QHOA 1XF1A 1QQDB 2F8VA 2CD0A 1SJHA 1AY1H 12E8H 4JY5H 3EJYC 3UTTE 4JR9L 2QSTA 4U6VH 4ENED 1XGYL 4QEGA 5HY9B 2M26A 5CJXC 1WSST 2NMSA 5FCSH 5SWZE 4A2LA 2H1PL 3FB7A 5IMMB 1CDHA 1MCEA 5TE7L 5A16B 4D9LL 1JGEB 4UNTA 1W0WA 2Q7NA 3V9FA 1NGZA 2UUDH 4NYLA 2FBOJ 3GHBH 4Q58C 3CFCL 3OAZK 2G75B 4J6RL 1K4CB 2VERN 4FFWC 3ARUA 2YN5A 4D3CL 3MGAA 3MLZL 4LLQA 4YXKH 1JPSL 3SDDD 3QIBD 5C0JA 5FDWA 3VXSD 1QHPA 4MHHG 4PJ5B 5A43C 1A5FH 1KN4H 4NUGH 3C8DA 1QSZA 1IE5A 3RNQB 1H9VA 1ZGLP 3EW3B 2R69L 2UWEA 4WO4B 5CJOH 1T5WA 1PZ5B 3OX8A 1IGJB 2P8PA 5DJYB 3MRNA 3SO3B 4GW5A 4NO0B 4EUPH 2SEBB 1YC7A 3EHBC 4GKSA 5KOMC 3HR6A 3TN0B 5E99L 4PS4H 1IGML 3QPXL 1A7QL 1BD2E 4OF5A 3LKOB 3WV0A 3GSUA 1AH1A 3RBGA 1V3LA 3QIBA 3SDDA 1IQWL 1T0NB 3IAQA 3VXSA 4HCRH 2BNUB 2JF1A 5DD3H 1VADB 3U4EA 3I75A 4U31A 4K55A 4EOWH 3ZL4L 3TT1L 5EIVA 3MRLA 2HFGH 4X0KB 1R3KA 3ZKMC 4NHUB 2V9RA 3NCYP 2PO6C 5DR5L 5HHXL 4YPGB 2FX8L 3FRPG 4OZFH 4XPAL 5CD3B 3O45A 5LGHH 1CTNA 3BHBA 4FNLH 2VABB 1GHFL 3QAZB 3NCEB 2B2XL 3V5DB 3VXRD 2DTML 2BC4A 1MFBL 4QTHA 3S9DB 1TTUA 3CXHJ 1QR1A 3RDTC 3LKQB 1UWEL 5JLZA 4EN3B 1RK1A 3OKMA 5E6YA 2JIXB 3QP3A 4Y4KB 5JR1L 3MGOA 1ND0A 5EUOF 3T0EB 2BDNL 3TBVB 3ZDXE 3I9GH 4QYOB 1DBAL 3ARGB 5FO8A 4K7PL 1J0JA 4RA0C 4NQDB 3S3SA 4X5XA 1XF5B 3P2TA 4BZYA 2NXZB 2AJXH 1MSPA 4HJ0C 5B8CC 4UTAL 1E6JL 1G1CA 1HH9B 2AJYL 2PYED 1A7RH 1M7DB 2Q8AL 3VXRA 5IJVA 1NLBH 5EIIA 5DSCB 3OAUL 3FT3B 3HG1E 5IMKA 5LQBL 2GTWB 3BZFA 1I1CA 4KMLB 5IEHB 1XCQA 4FXKA 1HXYA 1F6AA 4YDIH 3S4SG 3U30B 4FQLH 4CU8A 4XNQB 3R1GH 2XV6B 2P47B 5HYQB 3BZ4A 4JQVC 4JGMA 3HNTL 3CX2A 1IMHC 1NCDL 1D5MA 1TCMA 4GQ9L 4AEIL 1IM3B 1H8NA 1EHLH 1L6ZA 4NQVA 3DTXA 3FQWB 1MCSA 2VDRL 4R90H 1HYSC 3C8KA 1H8OA 3ALWA 3MUGB 5C09B 4XVSL 4M00A 1R5VA 2PYEA 4LSDA 2DMCA 3VXPA 3OMZA 4E41B 5CLTA 5K9JL 5DD1H 2ICEA 1CDCA 5JPNA 3EYOB 3MZGB 4WTXA 2V7HA 4LHJB 3DX7A 3R4DA 3RGVD 2HAZA 2YK1L 3FFCE 1CFSA 3QWOB 4G6JH 5CFHA 1QFWH 2A6IA 3P11H 3HI1B 4M5ZH 3SQOL 1OW0A 3I2CH 4XMKH 4WNQA 1RULL 1YEDA 1SY6A 1KPUB 4N8PA 1JPGB 3U9UA 1G9ML 2ZOKA 3D85A 1Y6KR 3MACL 4MAUH 3K8KA 3ZKQD 2UYLB 5C0ND 5F97E 2YOCA 4KPHH 3FT4B 3TP4A 4HPOL 4PB0L 5HHME 1QBML 3TO4C 2V2TA 1FQ9C 3N9GH 3WHE0 3FQUB 1OF2B 2X9XA 3RGVA 1KJMA 2Z91B 5I71B 1A1OA 1RZKC 1AD0B 1TENA 2X44D 2F53D 1NGPL 4JZOA 3IKCB 3LV3A 5TDNB 5I75B 3EJZD 3BDYH 4MB5A 3VRIA 1JHLH 1ULVA 4LBEA 1CGYA 3UBXA 3SE4C 3N85H 4HKZB 5D7JC 5L2KE 2A77L 2W92A 5FGSA 1HH6A 3TV3H 1N7MH 4GBXD 1ZGLA 4WW2A 2ITDA 1FFNB 5CEXB 1DEEA 3A67H 3UDWC 5L9DH 3CAFA 3KPNB 3QDGE 4QOKD 1PKQB 4LRNL 4MQXC 3PP4H 3SDYL 1XF3B 3EYFA 1CE1L 4RRPA 2F53A 2Y06H 3QRFM 2E27H 1PY4A 3BFOA 1HHIB 1WISA 5EZOL 3S35L 4BUGA 3NGBC 5GZOC 1C5CL 1ZVSB 1IQDB 3TNNB 1BAFH 2YPKA 3RVWC 4Z9KB 3GSWA 4GBXA 3SDAD 3C2AL 2CUIA 3HRZB 4YGVA 1F4AA 1I7TB 2RR3A 4N0UA 4I2XB 4PJ7E 4QOKA 4JO3H 3GKWH 2V7NA 1OQOA 4B7IA 3V4VL 5T3XE 3JVGC 4CNIB 1ZE3C 5JOFA 3GRWA 5T3ZH 3JTTB 3T4YB 3B5GA 2ZUQB 2XZCL 1NKOA 4OTXH 1U6AL 1JN6B 1X44A 2C1OB 3CFBB 5F9JA 2MOVA 4LSRH 2ADFH 4N90E 1U93B 4YR6A 1XF4B 2H2PD 3UP1A 3BKYH 3WFCL 4X7SL 3QA3B 2HJLA 5K9KA 1NFIA 5D1XC 3SDAA 4C55A 3P4NB 4NCDA 3UJTH 4TQEL 4CVXB 4H1LG 4XXDA 3I50H 1OGAB 4AIZA 3X3FL 3S36L 3UTSE 4JAMA 1IEAA 4X6EB 4D0DB 3QQ9C 5D2LA 4G8IA 1AXTH 1T3FB 1NUDA 2XNAB 4I13B 1OAUL 3T77B 2R4SL 1F3DJ 1TZIB 3VD3A 3GMQB 5EU6D 2XWJA 4JM2B 1U3HC 5L0QC 2VDPH 4I77L 4YE4H 1V7MH 2CLZB 4GH7B 2HKHL 3NFPB 4BH7B 2DQHH 3NACL 5F96L 1NQBA 4YXLH 4XCFL 5DD0L 4BFBD 2EICA 4JJHA 1TZHB 1S3KH 3P3YA 1S7XA 1MRFL 1VHPA 2JELH 1AIFB 2VLKD 2W9LA 1KPVB 2CO7B 2YD9A 1Z9LA 4IRJD 3BWAB 1FO0B 4FZEH 1LEGB 3BP7B 3CVHH 2VDQL 1NC2D 5TJWK 3C5SB 4NHUA 4MXWL 3ROOB 1KENH 2APXA 1JWMB 5HYJB 2X4RA 2XXMB 5FGCB 5EU6A 4KROB 3F7VB 2EO9A 3PIQB 2DIJA 1K85A 2LVCA 3SE3A 3DI3B 2J8UB 3RKDD 2FCBA 1T1XB 5LG1A 1UH2A 3FO9B 4N1CA 2ICWJ 1HQ4B 5C0AB 4LU5L 1RD6A 5IQ9B 1K3ZA 2BSSB 3X11B 2VLKA 4WGWB 3MTRA 1ORSB 5IMOB 2EC9U 4L4TB 1X5GA 3BPNB 4JR9H 1N59B 4B53A 4ACPA 4IRJA 1XGQA 2PYFA 3MRRA 3V0VB 3ZYIA 5C0DB 3IDMB 1XGYH 1TQCC 5GGQL 1NC2A 3DVGB 3EYVB 3H6JA 3N0PB 4JKMA 4M7LT 4X6DF 1X5XA 1WJ3A 2BY3A 5I9QC 1VFUA 3H9YA 1BZ7A 3L5WA 3PF2A 3H9HA 4QRTB 3VXSE 5TE7H 1JJUA 4D9LH 5EZJB 3B43A 4WV1C 3UTZA 3LD8B 5JTWA 2HVKA 1U8QB 1CDIA 3CFCH 3IFOB 3PQYB 3TA3C 1ZLVK 5DZNA 4FXGB 4OCMC 1HH9A 4X6CF 4J6RH 3CX5K 3QXUA 1WFTA 1K4DB 5DJAB 2NTFA 1A22B 4D3CH 3MLZH 1JPSH 2GTWA 5IVZA 1HHKB 3Q1SL 4TUOA 3V6ZB 5HHNA 5AZ2L 2XTJE 4KZDL 4OV6F 4BUHA 2OTWB 3B9KD 4YDLC 1ZGLM 3QHZL 2R69H 2YD1A 1J12A 2Q3AA 1ADQA 2B5IC 4M61A 5FHBL 4DZ8A 3AXLB 3ULSB 3LSOB 2PCPA 4TSCL 3B9AA 5E99H 1IGMH 1C5BL 1YNLL 3QPXH 1A7QH 1E4KC 1P6AB 2V2XB 5JDJA 3T1FB 4E0RA 3KAAA 3KG5A 3RIFF 1WCBA 1LQSR 1IQWH 1SM3L 4OZ4A 1Q9KB 2AXGB 4Z7UB 1S5HA 1SYSB 4L3EB 3HE7B 3B9KA 2OJZL 3ZL4H 3TT1H 3VXRE 3J8F7 3F65A 5JO5A 1P9MC 3TEUA 1A6ZB 4YBQC 1B2WL 1Z9MA 3GB7A 4J12A 4Z7QE 5DR5H 5DO2C 5HHXH 3NZ8A 2ED8A 2FX8H 4XPAH 1HI6B 5B39G 5BMFL 4X4ME 1N6UA 3FT4A 1U8KA 3BQUB 1IL1A 1GHFH 2B2XH 1U8MA 4GAYA 1WFUA 5I73C 2DTMH 3SN6N 1W72A 1MFBH 2VIRB 3RWFA 4JLRB 5C08B 4X9HA 1UWEH 4MVBD 3QI9D 1MRCL 5FOJA 4LF3B 5DC0A 2UY6A 1OB1B 2BDNH 3C8HA 3GMLA 4KJYA 5TPWL 4UILL 2R29L 2VAAB 1DBAH 2IBZX 1A4KA 3BUYA 2NY0B 5EZLB 3AREC 4M6NL 4K7PH 4X9FA 1XGUB 3IDIA 3PWJB 3O8XB 4Y2DD 1TTFA 3WNPA 1J18A 5ILTL 2WWMD 1Z5LA 4UTAH 1E6JH 3GI8L 4NJ9L 2AJYH 5E1AB 2Q8AH 1I4FB 1RJLA 3ARBD 2DLTA 5BW7C 1FJ1B 3TH2T 4OZIB 3OAUH 5IR1A 5EG6C 2DQDL 2FGZA 1IEBA 2P8LA 5LQBH 4HV8B 4PJHF 3QI9A 3ULUD 4HS3B 1YYLH 2Q3ZA 1CFQB 4IOIB 2XI9A 1U8OA 1YN6B 4YHIB 1E28A 5B4MD 5KS9E 3HNTH 5DQJA 4Q9CA 3VDBA 1NCDH 4GQ9H 3SE9L 4AEIH 5A2IH 2ZSWA 4BK4A 4Y2DA 5E6ID 5HHPA 5IROC 2VDRH 4JDTL 1J05A 5IKCA 1QLRA 4XVSH 3KYNB 4I2XA 3NPSB 4PRHD 3ARBA 5K9JH 5AYQA 3JXAA 4PRBA 4R8WL 4PG2A 4GKOA 4YFLI 4CL7A 5IVNA 2X1PA 4J23A 5C6WH 4PRID 3B2UC 4KGJA 4P2RD 4ETQA 5DVOA 3BSZL 2WMPA 1ZS8A 2YK1H 4CN6A 1T22B 2HVJA 5C0BB 3MOQA 3SQOH 2XA3A 1RULH 2OZ4A 4XH2A 4X9GA 1MHHB 4U1HB 2FEEI 4Z7VB 5E6IA 3FO1B 1G9MH 1URLA 3MACH 3VXNB 5FOBB 4F33B 1SJVA 2AI0L 4AT6A 4PRHA 2W60B 4WI3A 5J6HB 4XP6L 4H0GA 4HPOH 4PB0H 1QBMH 5I18L 1CN4A 4MSWB 2ZNWA 4PRIA 4P2RA 1U8JA 1D5XA 3VXUB 5MENB 3SKMB 3AU1B 5IIEB 2O61A 1HXMA 4XRCB 1NGPH 5FYLL 5AG9A 1MWAA 3QNYB 4BH7A 5CLWA 2NXYC 4R2GD 3RX8A 4AEEA 4PGJA 4KKCC 5E8PB 4ONFL 4HWZB 5ESAB 4L4TD 4U1KB 1YJDL 4K7FA 1P1ZB 3EYSL 1VFBA 3H8NA 3IU3A 4KKBD 3ZDZF 4TVPL 2YHGA 5KZCD 4YHOL 2EDOA 2XT1B 4XGZA 2QKIA 3JV4A 3OGCA 2FIKB 5GS0D 5CEZD 4MD0B 4R4ND 2A73A 4LRNH 5J89A 3SDYH 1CE1H 4GXUN 4PJ5E 4BSWA 3QXVA 5I1HL 3DWTA 2NY5L 3LEYL 2DQEL 3NFSL 1E4XI 1T1XA 3LOWA 4FTVB 3FO9A 1XGTA 4G7VL 3TPUB 3PWNA 3K74B 1OTUC 3C60B 4LVHB 1F45A 5EZOH 3S35H 3X11A 1C5CH 4LVOC 5IMOA 4X6BB 5AD0A 3CUPB 4ELMB 3R8BB 1G6VK 3VI4F 4ZPTB 3C2AH 4RGNB 1YNTA 1T80A 3QHTC 1IC1A 1PYWB 1L7IL 4OIAA 3VFUB 3VXQB 5B38G 3V4VH 3ARSA 4IS6A 4O9HL 3E3QC 1J0ZA 4OI7A 4QXTB 4WRLA 4MLSA 2XZCH 3QUYB 1U6AH 4NN5B 5FCUL 4R6UA 1LP9F 2OTPA 5HGHA 3LH2L 3O4LD 3CFIC 4ZUWB 5A3ID 3WS3B 1FG9C 3WFCH 4X7SH 5DJ8A 4GG6A 2EYSA 2X42A 2R23A 1ITCA 3H3BC 1JRHL 5LBSL 3FB8B 1KLUB 3MR9B 1T83C 1E27B 3X3FH 3S36H 4YDJB 2EDLA 2E8ZA 4ETYA 1OAUH 3CDGB 2R4SH 4BK5A 1RI8A 3G04A 1AXIB 3DHJA 5GGSA 1BZ9A 1QPXA 3WDIA 2JJWA 4U1LA 3T0EE 2GTZA 4I77H 3V4PL 5IUSA 3FB6B 5IV2B 3O4LA 4Z7OF 2CXKA 4Z76A 2VDML 1U2CA 3AS2A 3NACH 5F96H 5F7WC 3FQXA 5D1QD 2MHAB 4NQDE 1AQKL 4XCFH 5DD0H 5JORB 5I1IL 5KSUA 1MRFH 1CT8A 1KTKE 4DZBB 4JRXB 5DI8A 2E3VA 2LTQC 2UUDK 2UY7A 2FDBP 2FATL 1KIQA 2G60L 3MRDA 2R1XB 1HNFA 4NO2A 3N06B 2VDQH 2CO6B 4MXWH 1S7UA 4FQ2L 4LRIC 4ODTL 1D9KC 3DROB 4JZJB 1ZHLB 2DQTL 2JJSA 4GW4B 4M43L 2WINA 3FCTB 2X7LB 4HFUL 2K3TA 3JWOL 3RWEA 1L4IA 4L9LC 1QBAA 1U8PA 5D1QA 1GZQA 1KXTB 3PGFL 4YHPA 5T5NG 4LU5H 1NC4B 4ZNEA 5IF0B 4UOJA 5MEOB 3MNZB 5C09E 1UA6L 3LRSA 4JFZL 1SMAA 2KL6A 3K3QA 5KG9B 5GGQH 4E41E 5FUCC 3OKDA 3GDBA 3C9NB 2Q76A 8CGTA 2J6EL 4GW1A 2NW3B 3JBG7 1LE9B 1P6FA 4XVUC 3ZDYF 1UXSB 3ZKND 3Q5TA 3OG4B 1V7NL 5ENWB 1UCBL 1ZHNA 5CBEA 2BSED 3REVA 4L3AA 4PD4J 4H25A 2YXFA 1U8IB 3EFFA 5DA4A 3Q1SH 4HWBA 3VFRA 1NEUA 5AZ2H 2VXUL 4R3SB 5F7KC 5E5UB 3AVEA 3GSQA 3MLRL 2H26A 4YBLC 2CSPA 4ZFOB 2NY2D 4C4KO 4HMEA 4KZDH 3QHZH 4GKZA 2K9UA 5D6CA 3LS5L 4HK3J 4YO0B 1UCTA 3OR7A 1DLFL 5FHBH 1JMZA 4F2MB 3G5XB 3D9AL 3RVXD 2DWEB 3SJVB 4TSCH 3SKOB 2CIKB 4R7NA 4PJCF 5BS0B 2FRGP 1YNLH 1C5BH 1F02I 3HNVL 4FQPA 4YC2B 5JQ6L 3P4LA 1G9MC 3VE0A 3LPFA 1C7SA 4OD1L 3BPOB 4U1IA 1SM3H 1KN2L 5IG7B 2QADB 1MCJA 4FMKA 3TIDB 4OAWA 2ZKHL 1ZHBA 2H32A 2OJZH 3EO0B 3E6FA 2B4CC 2BVQA 2WBJB 3ZE1F 1HSBB 1PKQE 5EC2B 1B2WH 3QZWG 1A3LL 4GRWF 1CICC 3O3EA 4Z6AT 1RFDL 5BMFH 1MVFA 1OQXA 3I02B 4BH8A 1H5BB 5JZ7C 2XICA 3MOAL 4UTBL 3I6GA 4YFEA 2IGFL 2VC2L 2CJUL 3MRBA 4OBRA 2ZSVA 4G9FB 1JWUB 5KVEL 4D0BB 3KYMA 4P4KC 3KHOA 5HYSB 1GGUA 4I2XE 1MRCH 2A38A 1QO3A 5TPWH 2A9NL 4UILH 2R29H 3L5HA 1FVCB 4K71B 1G7LB 2Q1EA 1K3IA 4M6NH 15C8L 1CD1A 3PABB 1BMGA 3SKNB 1JYXA 5GSVB 1NCTA 3T04D 4D0CA 2D0HA 4Y0GA 5ILTH 3WMSA 1AD9A 1G84A 3VWKC 4BKLB 1F4WL 3E6HA 3GI8H 4NJ9H 2FIKA 4CN1A 4LNRB 3LEXB 3DHMA 1S7RA 3MBEC 3UEZA 2W38A 3STLB 2W07A 2BX5A 4DAGL 3LPGA 2DQDH 1MH5A 4HIHA 1OGAE 5I66A 4DWHA 2N1KA 2NY3B 1IBGL 1IGTB 2X70B 1KTDB 1Q94A 2KBGA 4WU7B 4NO3A 1IKNA 1HSAB 4XX1E 4F7MA 5FYJL 3MLXL 3QIUB 3DSFL 3TBSB 1FYTB 5ACLA 3SE9H 5B22A 5EU5B 3B8SA 5L7XL 4CADB 4O2CA 2GSGA 2APVA 4JDTH 1IFHL 3GMRB 4Q6IB 1RUML 2HFFA 3QEHA 3QUXC 4FABL 3L7EB 3I3EA 3VFUA 3OKEB 4P5MB 2MPAL 2BVPA 4R8WH 2HLFD 3CFEA 2UWEF 5E70A 3BSZH 4YGAB 4LCCA 1X5AA 2C7UA 2WANA 1LNUA 2R2HA 1Q0YL 5HYJE 5ICXB 4DKFL 4I8DA 5FGCE 4ZUWA 5FV2A 2FHCA 4KK9C 1UM4L 4RMQA 5CIPB 3SCMC 5MI0C 4OZGA 4MJ5B 2J8UE 4ISVB 5L2JA 1T20A 2VDLL 8FABB 2YR3A 2ZCHL 2AI0H 1QZ1A 5DUBA 4JFHE 4XP6H 4JHBA 5I18H 5HHOB 4L4TE 2IALB 2JJUA 4HS6B 1AQDA 3S5LA 1R3LA 4NKMB 5T1LD 2XXCB 5FYLH 5IV2A 5J3HC 3BRDA 3LRGA 5E08L 3AFLA 1U8NA 2GJZB 1EGJL 1MY5A 1NC4D 1BVLB 4YNYB 1HILA 1R24A 4MJIB 2HTLD 4ONFH 1JZ2A 4WI5A 3PQYE 1YJDH 2IWGA 3EYSH 1SEQL 4MDIB 2E7LA 4TVPH 2KQNA 3AS1A 1G7PA 4YHOH 3TZVD 4M8VA 1QRND 1NLDL 3QULA 4GG6E 3PL6B 4JFYA 5GRVL 3ES6B 1WBYA 4ZSOA 1JI2A 5ESVB 5FM5M 5T1LA 1GGIL 2GAZB 3DUSB 43C9A 5I1HH 2VJXA 2NY5H 3JV6A 2DQEH 3LEYH 3NFSH 4U1MB 3WN5C 4P99A 5HI4C 3UCRA 4G7VH 4D9RE 1V5JA 3WS6C 1T7VA 1NC4A 4HKJA 2F5BL 3THML 2C3GA 2P24A 3RVUC 5FB8A 3HPLB 4CVZB 4GAFB 1A9BB 3WNLA 2XWTB 1YQ2A 3TVMB 4C58B 1FNLA 1TLKA 4F7PA 1XF2B 4WUUD 3TZVA 5BOPA 3P0YL 4HX1A 1QRNA 5HI5D 1TQBC 2OX5A 1L7IH 4Z7UE 3DGCR 5IFAL 3L3HA 4KJWD 4O9HH 3CFDA 4L3EE 1M6OA 1HOCB 4OGYL 2GHWB 1T66C 3T4AA 3WLWD 2FH6A 5ITFA 4XNZB 5FCUH 4LHUG 1T04A 4MQ7B 3LH2H 3MRFB 5JA8B 1OSZB 3FMGL 5C0FB 2GSIA 4RMTA 1NGYB 4WUUA 4IRSB 5F7DB 4S1SL 3VFTA 3G5VB 3D39B 4N9OB 1JRHH 3RZCB 5LBSH 2ICWB 3D18A 1AKJD 1FVDA 2Q7YA 4PRDA 2EYTB 4HGWB 3B6SB 3IJSA 5ACZA 4QHLA 5C08E 1FVEA 5E95B 4P2YA 4Y1AB 1GXEA 4NDMA 4FN0A 4LASL 3RAJL 3V4PH 3DVNA 1PQZB 4V1DB 1F5WA 2VDMH 5DMYA 3ARYA 1BFOB 1AQKH 5I1IH 3CVHA 2NNAB 4PJIA 1X5YA 3IU4L 3LN9A 5IG7A 1KJ2B 2NX5B 4KDTC 1MCWM 5DWUL 1AKJA 1OD9A 5JW4R 2IPKA 3CFJA 1JE6A 2FATH 2G60H 5IB3A 4LLMA 4P2OD 1NAMA 1T7ZA 4IMLA 3L5IA 4XP1L 3QIWB 5T1DL 5J13B 4OZIE 1RZJL 4FQ2H 4I9WE 4K23L 1NDMA 4ODTH 4XBGA 2DQTH 3I02A 1HWGB 4M43H 3TPKA 3VI3E 4HFUH 5JQHC 3WSQL 1VKXB 3JWOH 3GSVA 1WBZB 3MJ7B 2ENSA 3KDMA 3PGFH 2J5LC 4GUPA 2HKFL 2OLDA 5ETUA 4PJEA 3PHQB 5E5MB 5LKNA 5DJ2B 3D48R 5FKAA 1I1RA 4ZUUA 3QDAA 4D0BA 1NEZB 1DQJB 3NFNB 4EQ3A 4NRXB 1PJ9A 1UA6H 1YMMD 4JFZH 1BX2A 4GS7C 4P2OA 1N26A 3OKNB 4UNVA 2XY2A 1KIRA 3DMMC 3RY4A 4ZOEA 3RNKA 1JIBA 2J6EH 5CP7A 3D3VD 4ODUB 4F80A 4K3HA 4UIMA 3AM8C 4K7PX 3V5KB 5C0BE 4RDQF 4E5XA 4QHNB 1DJSA 5ANMB 1V7NH 4RZCA 1FV1A 4BKLA 1KT2B 3MFGB 4P2QD 1UCBH 4HBCL 5DEGB 2V9QA 4RNRB 4Z7VE 2R2CA 2DM4A 2LU4A 3FONB 1HHJA 5MEPB 2DI8A 4N8VB 1YMMA 1DQLL 4MNGA 4MB3A 5CHNA 1IGCL 2XPGA 5IOPB 2HJFB 2XYCA 1D6EA 4JY6A 2VXTL 1PG7X 3PV6A 2VXUH 1FN4B 1T5XA 3MLRH 5MP6L 1AXSB 1ZOXA 3D3VA 4U6TA 4WDIB 1IC7L 4HS8L 3VXUE 3W9DA 1S78C 3LS5H 1LILA 5MENE 1DLFH 5AWNL 3SQBA 2BRRL 5DJCB 4J8RB 3D9AH 4P2QA 4Y4HC 2AEQL 3CJJA 4KXZH 3RY5A 3D87B 3LQZA 3HNVH 5BV7B 4OKVB 5JQ6H 1RU9L 4O2EB 3RVTC 2AV7A 4M93B 1BWWA 4OD1H 5A1AA 3QXTA 4KUCD 1K8DA 5D2LF 1KN2H 4NT6A 2AJUL 4AZ8A 5E8OB 1BGXL 2DDQL 5C0RL 2Z4QB 4FZ8L 4TNVK 4NQUA 3HC0A 1B4RA 5GRYA 5J6GA 5D1ZB 1JHTA 3O9WB 5JW4N 3SEPA 2QQQA 1A3LH 5ESQB 4MJID 1RFDH 4MLIA 4OFKA 1IKFL 2JJTC 4WUKL 4LSTL 4U0RB 4PG9A 1X7QA 2YA2A 1G6RL 3MOAH 4UTBH 2IGFH 4JG1L 2VC2H