2OXGA

The soxyz complex of paracoccus pantotrophus
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
108
structure length
108
Chain Sequence
ADDAKPRVKVPSSAKAGETVTVKALISHKMESGQRKDADGKLIPRSIINRFTCELNGVNVVDVAIDPAVSTNPYFEFDAKVDAAGEFKFTWYDDDGSVYEDVKPIAVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords SoxZ protein
publication title The SoxYZ Complex Carries Sulfur Cycle Intermediates on a Peptide Swinging Arm.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 20
structure length 108
sequence length 108
chains with identical sequence C, E, Z
ec nomenclature
pdb deposition date 2007-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08770 SoxZ Sulphur oxidation protein SoxZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oxgA00
5DR5H 4KTEL 1YC8A 4G43A 5T1KB 5GHWL 5C2BH 4PRAA 3GK8H 4LLWB 3H3KA 1YPZB 2Q7NA 3QRGL 2WLZA 4P5MB 5DUML 3R06B 1RZGB 1U95B 4JFDD 2XWTA 4NC1E 4U1NA 4PJEA 4ERSL 3LEYL 4XNXL 5B3NA 2DBLH 4P3CL 5JOPE 2QADD 4N1EA 1F11B 3W0WB 5BV7H 4P2OD 3PXJA 2AK1L 1T1YA 1QSEB 2FJFB 4MWFA 2D0GA 3HI5H 5KVFL 3TEUA 3AGVA 4LPYA 4UAOC 4KAQH 1Q72L 2FGWL 3DX7B 1C12A 5IMMB 4HIJA 5ACZB 4Z7UF 1I7TB 3EDJA 5HYQA 3TESA 1CXEA 4ZAKC 1Z9OA 4P23A 4TN9A 2F5AL 5I71C 5J12B 3PGFH 3SDAC 1RIHL 4MDJB 2I9LB 3UMTA 1IC4H 4NQVA 3Q0HA 2YN5A 1X5IA 3DV4B 2F54A 3H7LA 3CFJA 4KQ3L 5MERA 4NC0B 1KJ3L 5HYIA 1ZANH 3MCLL 1T7YA 4PLKD 4ZOCA 3W9EA 2UZIH 2V6HA 4AQOA 5SX5H 1N0LA 5IOPB 1ZWIA 5FOJA 4DUXA 2CO7B 4XZUA 4K71B 2SEBB 3DNKA 4YZFF 3VFSB 1LO2L 4KUZH 2X89D 4E5XB 5IBUB 3LB6C 1DL7H 4N5EC 4OZHF 1BBJB 3GJEA 3LOWA 3ALPA 5C09D 4CVUA 4KROC 3C5ZC 4V1DE 1IGJA 3L3OB 5C08D 3FRUB 2YKLL 1UQSA 5DFTA 3VD3A 4PRDB 1CFBA 1T83C 1FG9C 3ULVE 2UVFA 5J57B 2VQ1A 4U7SA 4PGCA 3WLBB 2FIRT 2MQCA 3PIQA 2VXTL 4NSKA 5FKPA 5KVGL 4C59B 3VXPA 3CUPA 3UZVB 5D7JB 1T1ZA 1W0VB 3BZEB 5DQ9B 1R3HB 5AZ2L 5JPMA 3PWUA 4JFFD 3VXNB 1Z9LA 3OV6A 1N8ZB 3WFZA 5F72S 2JJWA 2H1PL 3WJLC 1QSVA 3C2SA 4Z7VA 1IE5A 3KLHC 3FO0H 4KHTL 2EE9A 1XT5A 4B7IA 5CKGA 3GI8L 1P4BL 1A5FL 1G7HA 4JY4B 2CUIA 4ZQKA 1LD9A 2AXGB 1RU9L 4AH2A 1AIFB 4X9GA 3CFIC 5H8DA 2IANA 3QISA 2Z8VC 4KZEL 1PBYA 4LLWA 5I1HH 5D7KE 2UY7A 3D6GA 4FZEH 1G9NC 3B9KC 3GBNH 5IM7A 2KKQA 1TQCC 2EYTB 1A6ZA 4BZ2H 4YDVA 3U36B 4EVNB 1NJ9B 4MSWA 4O2EB 4WFGD 5FYJE 3SCMD 2HLAB 5JORB 3RHWF 3A0OA 3RL1A 1A6PA 2R23A 4JZJA 1C5DA 1QD0A 5E08H 4JVWA 1FLRH 4YXLL 1GIGL 4JRXB 3CMGA 4DAGH 5FF6B 4WUKL 3JWDL 5E9DB 4Y19A 1JGDA 2V9TA 1AI1L 5AUMA 3P4OB 2W9EL 3I3EA 3HZVB 2ZNWA 1R24A 2YZ8A 4HGMA 4TOYH 1SY6H 1Q9LB 1JPFA 3VMPA 4GRWF 3N85H 3ELAT 3EO1B 2A6KB 3EDFA 4WV1B 3O6FB 5T5FL 3VI3E 2NY6D 2JELH 2WZPD 1SVZA 4X5XB 2H45A 4NQCA 5BV7C 5HYJB 3TO2B 4X80L 1JN6B 4JFQB 3VXTB 4P2QA 4YBLB 5DD0L 1EZVY 3FKUS 4KKBD 2DQDH 5DUBA 1KCLA 4U1KB 1A9BB 3A6BL 1S3KL 3QXUA 4NJAH 1UWGL 2VZ1A 3G04A 4HPOH 4QRPD 1FE8H 4MQTB 3DVIA 3SGDH 3UZQA 1PDKA 3U1SL 4LSUH 3QUXB 4XVTH 3ZSSA 3DYOA 1N4XH 2ZKHL 5HYSG 4PLNC 4JGJA 3NFSH 2PW1A 3WN5A 3FO2B 5KJRH 4MYWB 2CLVB 1FQ9C 4J6RH 4MAYA 5LXGH 5D7JA 4NO3A 1FVDB 4G5ZL 3KNBB 1ZS8B 2A0LD 4LVHC 1YN6B 1RJZB 4K94H 4A6YH 2BNUA 5DFWH 3EOBA 2BOBA 2DMBA 2Z91B 4TVPL 4KVNL 1AD9B 4LKCB 4OTXH 4XP9L 3KYMA 4U1GC 3X11B 4JY5H 1H3WM 2Z8RA 4IOIA 1N0XL 4HUMB 3X14B 1NCBL 4XPTH 2OTWA 3K2UL 3F6IA 1OP5K 5J3HD 2GTZB 3HMWL 4NKDB 3NA9L 1E6OL 3QUZB 4U6HB 3F7RA 2C3HA 4IDJH 4Q9QH 4OQTH 2CH8A 5EC2A 1XR8A 3DMMB 2XWJA 4IRZL 4U6XB 3BPOB 1LMKA 1HK6A 1INEH 3PQYE 1OPGH 4OJFH 4TNVK 4X8XA 5J1TC 3U2SB 4IJ3B 4JFDA 1AE6H 1FGVL 1ADQA 4XPFH 5J8OA 1E4JA 4S2SA 1JHTA 4L8BA 4P2OA 4KK8C 3GIZH 1WIOA 1BAFH 3B5GA 4O5LH 1T04A 4OCWH 4ZSOB 2LFGA 1LP9E 3GB7B 3RWHB 4J3UA 2X4UB 3GSWB 1PVHA 1UH4A 3JUZA 4HDIB 1MPAH 2ZOLB 1CDIA 5HDBF 5DRWB 2J1KA 2DQHH 1XR9B 5ADOH 5JIHA 5CEZE 3AROA 1F45A 4WU5B 3D69A 2WW8A 2KPNA 5GZNC 1FIEA 4TSAL 1ZVYA 3D3VD 1S7WB 1WBZB 3WKMH 3HZMA 1INDL 1ZLSL 1YPZE 1Y6MR 2HLFC 5JW3L 3G6DH 4XB7A 1R5VB 4JO1L 1KTLA 2NY5L 5GZOD 4JCLA 1OAQL 1QSEE 1DQML 4JB9H 1U6AH 2VZ3A 4U2YA 3ZYOA 4PRNA 4GRWH 5ESAB 3UBXA 4DN4L 4PJIB 4KJPC 4KJYB 1ZHKA 5JXAH 2IQ9H 3BAEL 3UEZA 3X3GL 1BFOA 1J8HD 5DD3L 2DQUH 1WCBB 3O3DA 3WFEL 3UTPD 3MX0A 5FB8A 3VXRD 2X89A 5CZXD 5EU3B 3KYNB 3N50A 5FK9A 2FD6L 4MXQD 5C09A 3NCYS 5EPMA 5C08A 4XXDB 4OZFB 2FYYA 3FQUA 3G5ZB 5EA0H 2AJ3B 2VH5L 2QHLA 3MOAL 5LG1A 5HHXH 3CPLB 2PO6C 2XT1B 5T3ZE 1MCQA 1RMFH 2QBWA 4KK5C 3NH7H 4CVWA 5I18L 1MCEA 3V5HA 2ZUYA 1FH5L 4NZRL 3QUYB 5EUKB 4NOFA 3F65A 4PJDF 5JHLL 4F7EA 2YPLD 1YEEH 1G0XA 4Y4HB 1X7QA 5EU4B 4JFFA 4R4NC 4KVCH 1SJEB 2Q6WB 4KK9D 5GGUA 3OXRB 3QHTC 5DD5H 1RULH 1QBAA 4LCUA 4X6DF 1G9ML 3GSOB 3C09B 3QG7L 1S7TA 1IGML 1DBKL 3THMH 4YDLB 5JXEC 5DMGD 4TSCL 4BZ1H 3WXWH 1MNUL 2X7LA 1D5IH 2FH8A 3VXOB 4KGLA 3S35H 4H1LG 5FM5O 3IFLH 5IB3A 4X6FB 5DRXB 1YEDA 2AP2A 3V0VA 4MD5B 3REVB 4EDWH 2G2RA 4DW2L 4RZCA 3GGWA 1TIUA 4K94C 4EI6A 4PJ7B 4ZSOA 5K9JL 4YWGL 1ZHBA 2V5RA 3SCMA 3LH2L 1YJDC 1S5HA 1DBAL 4ZMAT 3GO1L 3HLAA 5EZJA 3E2HB 1DFBL 4I5BB 3BISA 3U4AA 1AFVL 1F2QA 4AQ1B 1DQJB 3JV6B 3ZHLA 4TUJB 1KYOK 4OZIA 4P9HL 1A7NL 2ZUQC 1IAIM 3UJJL 1TPXB 5T5NF 3VH8A 3HC3L 5IWLA 4NRXB 3OB0H 4QHMB 3FFCA 3FHAA 4KTDH 4MX7A 4UIMB 1F6AA 2JB5L 4NBXB 5C1MB 3RWDB 4FQCL 5KAQF 1HI6B 5LCVL 3CFBA 4AZ8A 3NCBB 4ELMF 4GAGH 4TSBH 4JRXE 1BF2A 5F1NB 3KYNA 3W2DH 5E4EB 4XBGA 5E9DE 3Q1SL 3UTTD 4LLQA 3VXRB 3MODH 4QRPA 1AC0A 1HSAB 1LILA 4LU5L 3U4EB 2ZSWA 5D2LB 1T5XB 2H3NA 1B6UA 5F7LB 2R4SH 2XQYK 3EO0A 1AY1H 1CLOH 1HDMA 3MA7B 3DX9A 4TTDD 4UB0H 4ZDHA 3PNWA 4X6CF 4H1LH 1N26A 3HFMH 4NZTL 5TE7L 5HYJE 1T1WA 3IXTA 2VN7A 1UJ3C 2VE6B 2MTPA 1IAMA 2BX5A 5T5NG 3G08B 3NIDF 4MLIA 5FHAH 3RWIA 3VWKD 3BGAA 2R69H 3VDAA 4I0CC 1D5MA 5FO7B 1NGWB 1TJHH 5IEHB 3U4BL 3MV7B 3BQUB 1NFDA 1R3KA 5KAQG 3VG0L 4QHNA 1EO7A 1C7SA 5HHQB 5D7SH 4P59H 4JO2L 2I9TB 1H5BA 4ZD3L 3D0LB 4K7FB 2CK0H 1QFPA 1C1EH 4QF1A 2J6EL 4KWUA 4WUUB 2FWOB 1NGXB 1MQ8A 4N9OB 5LWYL 3MLWH 3NFPB 43CAA 2OI9C 3WFBL 3UC0H 1DUYB 1YEJH 3P4NA 4M6NH 2AVGA 2AI0H 1MQKH 1RZKH 5HGBA 3AU1B 1X5XA 4BK4A 3RWFB 4JFOA 1CN4A 1S9XB 4NM8H 2QSVA 3IDYB 1BZ9B 1WTGT 4YE4H 4QY8B 4OD3H 4Y2DD 4HUUB 4NO0D 4I5BA 5F21B 4BQ9A 4LP4A 3EO9H 3DO7A 4MS8C 3RAJH 2GHWB 4TVPD 2EYSA 4WWKD 2PUQT 2ZJSL 1OD9A 4AEIH 1FYTE 5CEYB 1TJGH 1T5WB 1TVHA 5DC9B 3TWCL 1G1YA 3DX8B 4CRPA 1FIGH 4NP4H 4U1LB 1WZ1L 3D3VA 3V9FA 1EAPA 4J4PD 3CGTA 4H0GA 4MXVF 3ES6B 4I0PC 4PG9B 1IKNC 3ABZA 4UINL 1NMCC 2VWEE 3DO3A 1N3NB 5JA9A 1IEAB 5I1AB 1MCOL 3S35X 4ZNEA 4NHUA 1OSPH 4NQED 2HTLD 3V8CA 1J8HA 4YHPB 3FO9A 2VISA 4PY8I 3STZA 1KEMH 3BE1H 1AR2A 3VXRA 4ZXBC 2WINA 1C5CH 2X42A 1IAII 3NTCL 3QIWB 4QRUA 3QCVL 3PJSB 3IDMB 4XAKD 2X70A 4ONHB 2Q86A 1Z3GH 4F7CB 3SGEH 5IUSA 1EHLL 2CRIA 4QLRA 3FN0L 4P2YA 4EUPB 3O8XB 1UKTA 1RZ7L 2G75B 5GRVK 4HBCH 3LAFA 4R26H 1FC2D 2ITDA 4JR9H 3RP1A 4G8EA 2LTQB 4XC1L 2F53B 1H3PL 1S7UA 4X9BA 2C1OB 2YPLA 4JDZA 5FO9A 4DEPC 4Z7OE 3BT2L 1L0YA 4PJGF 3ECBB 3AS1A 2PCPB 4OIAA 3C6SB 3LEXA 1SYSA 2EKJA 3FT4A 4HIXH 4X0KA 1R0AL 1MSPA 2YHGA 3B6SA 2OBGA 3WS6C 4LOUD 5GGVL 4PB0L 3RIFF 3T65A 4MD0A 5F3HA 2M1KA 4O4YL 4OCYH 1Q1JL 3A6OA 3GNMH 4PGEB 4GJTB 4P4RB 4NO2A 1H3TA 1NAKH 5DRZA 2P5ED 3LD8B 3AMLA 3AS2A 3WIIH 2X4QA 4BM7A 1KNOA 2YA1A 5JUEL 1F58H 1NGPL 2N7AA 5IR1B 1RPQA 1YQ2A 2UYLB 2YD9A 3FCTA 4QT5B 3UXFA 4UV7L 1DEEA 4WI7A 3T0XA 5KSUB 5EU5B 3ULSB 1QPXA 3MRBB 4UT9H 3UYOD 4CNIA 1NBZB 1MCFA 3DYPA 1Q0XH 4U1MA 3DI2B 3QEHB 4I13B 3RWGB 1MCBA 5DTFA 5DD1H 4PP1C 2R8SL 4U6VH 1LQSR 4DQOL 2ZPKL 4XC3H 4KKCC 4EN3B 4R97C 1MVUB 2DYPB 1NDMB 2D03H 3CFEA 5D93B 4PJ7E 5DS8B 3MROB 4NWUH 1RZKC 3TIEA 3MGTB 4PP2B 4R7NB 3OB0K 2D7MA 2YK1L 2AEQH 1G9EA 2AJXH 2FL5B 3BHBA 4LRNH 4ZUUB 35C8L 2R1WA 4M7LL 2YD8A 3QAZC 4PRPD 3SQOH 1KEGL 3UTTA 2GK2A 1KJMA 2B1AH 3PDOA 4G6MH 1MLCB 4LASH 4XXCC 1PGRB 1VFOA 4ETQB 2Y23A 3LEVH 4PRHD 3WKNA 4HUKB 4G8GB 4ZUTA 5ICYA 2KUTA 1C7TA 1OARH 2G75A 2HJLA 1MCJA 3KLAA 3RBGA 5GGSB 3UYPA 1FCGA 1EHNA 2XZAH 1G9NL 1T2QH 2BCKA 3QA3A 5TQ2H 2CQVA 3HTLX 3PP4H 5I1EH 1FBIL 1E0OB 1KIRA 1A6WH 1WVZA 5HPMB 3VWKA 1YEGL 2F58L 4HG4K 3UTSD 3S37H 5IFAH 4LSRL 5I15H 3L5WA 1UENA 1JPGA 5D2LE 3ULUH 5ICZB 5C0EA 1A7RL 2EE6A 4DCQB 4AM0B 3VE0A 5B38B 4NCDA 5DR5L 4ODWB 1D5ZB 3BXNA 2EKSB 3QEGH 4KMTL 2V7HA 5C2BL 1PG7X 1BOYA 3GK8L 1DUZB 3MNVB 2FGZA 3MRJB 4MZ2A 3TJEH 1DBJH 2HT3D 4Q0XH 4L5FH 4XP4H 2DBLL 5BV7L 3H9HA 1B0GA 1T1XB 3QP3A 3MV7E 3HI5L 4YC2B 3MA9L 2JB6B 1A3LH 3BEVB 3HI1B 4Y2DA 3LKOA 3OKDA 1FJ1A 4NO0A 3QI9C 2HFEB 4DZBA 3TNNA 5EOQH 4WWKA 1IAOB 4JZOB 4WUUE 4PTUB 1EO8H 3S36H 4TRPL 3PGFL 4XT1C 4MVBC 5BW7C 3NABH 3VFOB 3KPTA 4KKAC 1IC4L 3Q5OA 1UWXK 3TC9A 5FOBA 2DM4A 4J4PA 4M1CD 4JN2B 5EU6D 4UT6H 1P4LA 3F7YB 1ETZB 4CJ1A 1HHIB 2R2HB 4PGBA 3EFDH 2MFNA 3K8LA 2MJWA 5T3XH 3HPLA 2BXYA 1N6VA 3MOQA 5A16B 3BPNB 3QQ3B 1J12A 4BQBA 4R7NA 4HH9B 3WNMA 1ZANL 2G60H 5JLZB 2UZIL 3FQWB 4NQEA 5I1GL 3L7FB 3LV3A 3DVNB 3JXAA 1JWUB 1ZA6B 4XBPB 4DGIH 2JJSC 4NC2B 2DQFA 4LPVA 5GRUH 4S1SH 4UOW1 3IKKA 4KUZL 4CN4A 4J7RA 1DL7L 5F88A 3S3SA 3TA3C 4XCYB 1QEWA 1WGOA 3ZDZF 1J9CT 3VWJD 3MRNA 1PZUB 4H88H 4UNUA 3TPUB 4Z78B 2VAAB 2E8ZA 3BWAB 2FLRT 4MA1C 1X5LA 5TGBB 4RWYH 3WS3A 2IAMB 2VIRA 4PJXB 1H3XA 5DI8A 5J1SC 2CIIB 5CMAA 2NXZB 4L4VD 1UEYA 5L8KB 1U93B 1BECA 4Z77B 2I07B 2O5ZH 1DEDA 2VLJE 1J88A 1W2KT 5EIQA 4PRIA 2YD5A 2HP4A 3UTSB 3PE9A 4LEOA 3T0VA 3ZHKA 3OZ9H 4NKMA 2XRAH 1UACH 3OR6B 3OL2A 3UPRA 5A43C 3V8OA 2GK0B 3S5LA 3QH3A 4UQ2B 5JO5B 2YS4A 5BVJB 3MBED 2GT9A 1U8PB 3OR7B 1YEIH 1MJ8H 1WISA 3HRPA 2P5EA 3HAEB 4YFLI 5I1HL 4GG6F 3C60B 2IPUK 2F53E 4NNXB 4U49A 5BZWB 3GBNL 3HUJB 5A2IH 3Q5YA 1CICD 5JHDD 4LCCC 2XKNB 2H2PC 1YDPB 1BQSA 4YAQB 3RGHA 5TDOB 3S88H 4M6OH 1CCZA 1Z9SA 4KU1A 1XIWC 3BDBA 4Q9CA 1F13A 4NQSA 5E08L 1MJUL 5GS2H 1Y18B 1FLRL 1NMAH 3QO1B 4L3CB 4DAGL 3TVMD 3I9GH 3ULUC 3IF1A 1ZA3B 4OZ4A 4MJ6B 5KZCB 1MWAH 2BVYA 5FYLH 4LK4A 5IF0B 1GAFH 3QXAB 1PW3A 1BOGB 2P4AB 3IYLW 2Q7YB 1A3RH 2YEZB 4TOYL 1MFCL 3EAKA 2C3WA 5CUSH 1BGXH 4ZAKD 1OCWH 1HHIA 3N85L 3HCVA 2R0LH 3AREC 3SDAD 5ALCH 4LLYB 1YEHH 5FA4B 1S9KC 5GQBA 1M71B 3GI9H 1ZHNB 5IMOA 2JELL 3FQWA 3EGSB 3GMNA 5FYKD 5D71H 2PKDA 5GGRB 4TUKH 3G5VA 2BVQB 1A9EB 2A6JB 1UM5L 5D4QA 5F1KC 3NCCB 2DQDL 5SWQA 4Z7QE 2DRUA 4NJAL 4PRPA 5TH2B 2UWEB 4OBSA 4HPOL 2MCPH 1FE8L 4IEFB 3KVQA 4KH2A 3MLRH 4LSUL 3L3HB 2V5YA 5E0QA 5DJ0B 2F19H 2K7QA 1N4XL 1XH3A 3RUGF 1GC1H 2AQ2A 4WEBH 5F9JB 5TDPB 3LB6D 4PRHA 1JZ2A 3IDJA 4N5ED 1G7IA 3FB8B 3NFSL 4KDTC 3VRLF 4A2LA 4KROD 3C5ZD 2NX5D 5I1IH 5KJRL 3GHBH 4L1HA 1YECH 4J6RL 3BKYH 2X4RB 3QDAA 3RTQC 3ARGB 1MHCA 2HTKC 3UJTH 4JJ5A 1FO0B 1HEZB 5IW6B 3LHPH 2Y5TA 4K94L 2PW2A 4A6YL 1J1XH 5F7EH 3QHFH 3WO4C 3HE6C 5JOFA 3WHXB 5GGTH 2Y07H 2FNBA 4OTXL 3UTSA 1C16B 2YOCA 5KS9A 4EOWH 1K4CB 4UDTA 4TQEH 5E6IB 3SKOB 1D5XA 3SKNA 4BSVA 3CFDB 4XPTL 4OGXL 3L3KB 5JO5A 5I2IA 4G8GE 4NNYB 3KLHD 3O3BA 3QZWA 2E9IA 4F7PA 4IDJL 4Q9QL 3RWCA 1Z0MA 2P1YA 4OQTL 3BUYA 2CKNA 3MBEB 1A6AB 1CU4H 1LNUB 3FB5B 2YD6A 1INEL 5CZKA 1OPGL 4OJFL 4WI2A 4XP1L 5ISZD 5E5RB 1AE6L 1YDPA 4XPFL 4CUCA 3CXHK 4JKPH 3GIZL 1BAFL 1PFCA 5D7IA 5DURD 2VLRB 3B9KD 4O5LL 5K9OA 4PJFF 4OCWL 3OTTA 1U8QA 1YMHA 5CSZA 3BH9A 5BJTB 1X6NA 3G5YB 3NCJH 4P0DA 1G7MA 3V6BR 3SDDB 1R5WA 2CKBH 4X4XB 1QG3A 1CR9H 4HUVB 4N8VG 5IBTH 1MPAL 4NM4L 3BIAX 4R96A 5IF0A 2AABH 1T80A 3IB4A 5ADOL 1IMHC 2DQHL 4G3YH 3VXMB 4PJAA 1EAJA 2YD2A 5BCAA 4UTAH 4NZDA 1UC6A 5HDOA 2DMKA 5L9DH 4PRBA 5EU6A 1W0WB 3G6DL 4FNLL 5DJAB 5JR1H 4D0DB 2J6EA 3FT2A 5C07B 2X5PA 3PWPD 4M7JH 1U6AL 1S8DA 2CR3A 3VJ6B 2BHYA 3TLRA 5HHNA 1Q9OA 2NMSA 5JXAL 5I6XC 4Y5VC 5JW5B 2IQ9L 5BS0B 2IBZX 2X4NA 5D8JH 4LPTA 5DQDH 2DQUL 4LFHD 5L2JB 4RSVA 1ZT7B 4M1GL 4JKWA 2WBWB 4JG1H 3G6AB 5TDPA 3VWJA 2DIAA 5EA0L 5D2NB 3BEWB 3VRIB 2P8PB 1RMFL 4R0LB 1B4JH 3QFDA 4LLUB 5E6ZA 2OL3B 1VFAB 1FAIH 3RX7A 3ZKMC 4NN7B 4FQXD 5IVXF 3V7MA 1OL0A 3BZ4A 1ZGLA 4HS6B 1NMBH 3V6ZA 1NAMB 3KPMB 4GKSA 4L4VA 3U0TB 1G7JA 4QRQB 4FG6C 1FFNA 3L7EA 1BJ1J 2BDNH 2NY2C 2FLBT 2ZG3A 4Y5XA 4PJHE 1NCCH 1LEKA 4KVCL 2E7BA 5DHYB 5FKAB 1E27A 2ZUXA 2OR9H 2JJVA 4PJ9D 2EO9A 3SDXA 4I9WD 1RULL 5DD5L 3T3ME 1YY8B 4PGZA 1FVCA 1AO7B 4C56D 1OLZA 1D6EA 3THML 5F7DA 5E5UB 5CIPH 3P9LA 4HGWA 2DJUA 1GC1C 3WXWL 1I7ZB 1MCIA 1HXMB 4Y5YB 3UCRA 4B50A 4PJXE 1AC6A 5I8KH 1D5IL 4YHKH 5E8OA 2FHFA 3CXDH 4GW1B 3IFLL 4PY7A 1JNJA 4X7DC 3IDIB 5DHVA 1MHHB 5HVWA 3JTSB 2CO6B 3V5DA 3OGOE 4HWBH 4WHYG 4EDWL 1CICA 5JHDA 4P5KB 4RFEB 4G8FB 3QFJD 2IQAB 2BSRB 4F33B 1FGNH 4LKXA 1WV7T 5ITFB 3NVQA 1S7SA 4K7PH 3WO3B 4KK8D 2Y7QB 3BP7B 1MFDL 3TVMA 1AGFB 2GUOA 3GMOB 3O3EA 4MJ2A 2N4IA 1N6QH 3UP1A 3S3JA 4Z5RB 3DRQB 3KXFD 4ZAKA 2ITCA 1I8MA 3HUJE 3RVXC 1RIUH 3C5JB 2W91A 4KTDL 3SDAA 4PJEF 5GZND 3NN8B 5DJCB 3QUMA 3V52H 3DHJA 1BBDH 1MHPL 2YD7A 5GS1B 3X12A 4TSBL 2KDGA 3DROA 3W2DL 2XQBH 2IH3B 3O2DH 4KJPD 5IMKA 4UU9B 5C70A 3MODL 4OSUL 3QWOA 1QVOA 4NFDA 4K07A 3WYRA 2APFA 3QCTH 2R4SL 4X7SH 1AY1L 1CLOL 4J12A 4KKLC 1I1AD 2ATKB 5I1LA 5ACLA 3C5ZA 2NX5A 4G6JH 4UB0L 5GSVB 4WI9A 3TCLA 2VXSH 2G5BA 3HFML 4LSSH 3BKML 2PO6D 4WHYH 1T83A 2HVJB 4YIQA 3CLEH 1T66C 2F9BT 1OF2A 2R69L 4ISVB 1JYNA 1TJHL 5C0DB 5K9QG 2NY4C 5D1XD 3O6LH 1BMGA 2UWEE 3TO4B 3TYFA 4HUXB 1WWAX 1I1FA 4MQXC 1MJ7H 4WTXA 2J8OA 1KLGA 5IMLB 5D7SL 4P59L 4GMSH 4PJ9B 2D7PA 5E03A 3MJ7B 2CK0L 3WJLA 4L4JA 4XBEL 4C56B 3IXAB 4CVXA 2OXGA 1PQZA 2X9XA 3G6JF 3F12B 3MV9B 3QQ4B 3X3FH 5ANMA 1FP5A 4P3WA 5FGCB 5JXED 3UC0L 5C7XH 2DL2A 2A73B 1I3RB 5IBLC 4RGMC 3RZCB 1YEJL 3BMWA 4M6NL 5ISZA 3VDBA 2AI0L 4WW1B 3DSNA 1MQKL 3KPLA 3MC0A 3NACH 4MJ5A 4ZOAA 3HG1B 4MNHA 5BRZD 4JFED 4NM8L 4YE4L 3B9KA 4Z7VF 3HKFA 4OD3L 3ZE0E 4PJCB 3T0BA 4ELKB 5FDWA 5F3BA 1UCBL 4AL8H 3V0WH 1YNTB 2PR4H 4GSDL 3ZO0A 4HC1H 3EO9L 4F3FA 1AGFA 1MH5B 2EE3A 5FYJH 3RAJL 3RWEA 2H9GB 5E2WH 2FJHB 3CMOH 1TJGL 4LDOB 2YXMA 3DRQA 5BVPH 1FIGL 4NP4L 3V6OC 4GRMB 2NY1D 2FJGA 4L8CB 2HVKA 5HY9A 1UB5B 1P2CB 4Y1AE 1HYSD 4LCIH 5MHSE 1F90H 3MRHB 4U6YA 1S7VB 4R9HA 5D1QD 3PWPA 2D31A 1WUNT 3QDME 3P0YH 1OSPL 5DYOB 3UROR 3GJFK 5DEGA 4OI7A 5A2FA 5HD8C 1CDGA 4W4OC 1YQVH 1DBMH 4NC1C 3ZE2F 2NR6C 5JMRA 1XMWA 4XCNA 3S3PA 2R0WH 1KEML 3VXME 1A6VH 1C5CL 4E42A 1IC7H 2C7UB 1QPPA 4HJ0C 4HXAL 4YPGA 3SPVA 3D18B 4MQ7B 4RFOH 4JDTH 2HFTA 4GKZA 1Z3GL 2NXYC 1AHWB 5GSVA 1HHGB 3BFOA 5C07E 5IFHL 3PL6C 1XCQB 4QOKB 1A7BA 4HBCL 4LHUB 4HLJA 4R26L 4FQXA 3TZVB 5FXCH 4TNWF 4BJLA 1LO0H 3CNKA 1N2RB 1FVEA 4HEPG 5BS0E 3KR3H 1U58B 2X44D 1NANI 2W65A 1EHAA 5IFJA 3ARDC 2A74A 5T1MA 1KUMA 4HUXA 1KPUB 4AEHH 4QRRB 5F6IC 4FTVB 1Q94A 5CFHA 4C4KT 5F89A 1CTOA 5D1XB 1AQKH 5MEOB 2OTUA 3VXQB 1QHPA 4PJ9A 5FO8A 4KY1H 3T4AA 4IDLA 2ICCA 5CINH 1T20A 5D2NE 5F1IB 3RNKB 4C56A 4OCYL 2BSTB 3A6CH 4NQCE 5C0BB 5HVHC 1FNFA 3VXUB 3IJHB 1XGRB 3O45A 3QHZH 3CSYB 3MRRB 3B9DA 1NAKL 2DQTL 1RUQL 3ZKNC 1ZT4B 3WIIL 2WSKA 3PF2A 5SX4I 2GJZB 2AGJL 1F4YH 3HI6H 3QFJA 4NO5A 3TYGH 2J4WH 2A83A 2R9HC 3LCYA 2JCCA 2E6QA 1CYGA 4O9HH 5E56A 1XEDA 3SKMB 5ESVB 4FABH 2YC1A 3RGVC 2B5IC 2RCSH 4GBXB 4KI5E 4M7ZC 5EBMA 1AO7E 4N1CA 2VZOA 5B8CB 4D9QD 1GRWA 1MFAH 2UZYB 5FAAA 4MNGA 1Q0XL 4XHJD 1XF4B 3TFKD 4G8IA 5DJXB 4MS8D 1CFTB 3X17A 3KXFA 1RJYA 3KPQA 5DD1L 5CKAA 4LCYB 1UGNA 5HGHB 1OAYL 4HKBB 4R7DB 5CEZH 1VKXB 4ORGA 2D03L 1SJHB 5EH1A 5KN5A 3MACH 4NWUL 4PD4K 5I66B 2P8LA 4I0PD 4F7MB 1J1PH 4C4KO 3MRCB 5I19H 2Z4QA 2AEQL 2VZTA 2FIKB 4FQHB 4HV8B 3V5KA 4K3DH 2AJXL 4HWNA 4LRNL 1X44A 5DVOA 1CXHA 5IB1B 4G6ML 4LASL 1U8MB 5BMFH 2DQEL 2VLKB 3WL9A 1KOAA 3LEVL 2NTFB 4ZXBD 1I1AA 1CWVA 1CGUA 1A4JA 1OARL 1T7ZA 4MHHG 4OF6A 4PTTB 4HWZA 1JRHH 2XZAL 3TP4A 1T2QL 3QJHA 5TQ2L 3PP4L 2C3GA 4RA3A 1ZEAL 2PO6A 4DGYH 1RHFA 4IIQA 1K2DB 2EIZA 3HPJA 1T03H 2BY3A 1GGIH 1TZHB 4H26B 1SY6A 5I1EL 2QL1A 2OJEA 2V2WA 32C2B 1A6WL 3ARXA 2VABA 1KPUA 2EDKA 3P9MB 3S37L 5D1XA 3LKNA 4QKXB 5IFAL 2A6IA 2HAZA 4N68A 5I15L 5TFSH 5I76B 4E41D 1BLNA 1GZQB 3BP4B 4GRLB 4LVNC 5CD5C 1OWRM 4ZOBA 3P3YA 3P0VL 1S78C 3GSXA 1MLBA 1OD7A 4NRYA 1CDJA 1P5UA 2O26U 3MJ8A 1RAMA 1ZVSB 4D0BB 4OV5A 4C54A 3QEGL 4B7LA 4ONFH 3ZT6A 3ESVF 4GW5B 1OTTC 2CLZB 5JXEA 3TJEL 1NBYA 4P2CG 4EI5D 4Q0XL 5IW3A 4XP4L 3TM6A 2ZP0T 1OGAD 3VFRB 3FQNA 4MGXA 5BRZA 5JNYA 1MEXH 4JFEA 2AW2A 4JO4H 2Z93A 1YY9D 1UADC 1NC2B 3GKWH 5L2KD 1A3LL 2CLRB 1XF5A 1W8OA 5GSRB 2GJ6E 3UBXG 3TT3H 5EOQL 1WSST 4N90D 1WBXB 3S36L 3W9DB 4OUUA 3OXSA 4P5TC 4FQLL 5HHVH 4NQXB 3BW9B 3NABL 5FGCE 1VEPA 2X09A 1BZ7A 1FHGA 4W6YB 4RAUA 5C0CD 1DLHA 1U91B 2GFBA 4UT6L 4S0SD 2M2DA 5DDHB 1G1CA 4G6KH 5DK0A 3EFDL 2ARJQ 5T3XL 3BP6A 1G0DA 1WWWX 3HG1E 3OG4B 3ARSA 1FPTH 3D39D 5D1QA 4WFED 4OQTA 2OXHA 5ESQA 5F1SA 4PP1D 2G60L 4ZPVB 3VGAB 3OKMB 4PJCE 3O3AB 4KKCD 3RA7H 4PGDB 1MAMH 4DGIL 5E2VH 1B9ZA 1CFNA 2Y6SD 5GRUL 4S1SL 4N0UA 4ODTH 5E6YA 3WDIA 5EFIA 3M07A 5C0JB 4HIEB 1HIML 1JGVH 5K59E 1KACB 4OZIF 4WU7B 1EEZA 1N5AA 2NTFA 4HIIA 4XWOC 2X4SA 3WFDH 1YMMB 3GIVA 3QQ9C 7CGTA 5IIEB 1XGTB 1P84K 1JGUL 1UA6H 1I9IH 4OF8A 3MNZA 3DV6A 4M62H 5MI0C 4RWYL 1DN0A 1CDYA 4P46B 1A8JH 5HYSA 4PJIF 1NEUA 4R90H 4ZUSB 1JPTH 1H0DA 2C1PA 3LQZA 3MR9A 2P46B 1RFDH 4JHAH 3K4DA 4GLRI 2O5ZL 2Y5EA 4Z7OF 5DVMA 2RB8A 4XNQB 2EDHA 1UJ3A 5HHOB 3ILQC 3OAUL 2H32A 3FFCE 3OZ9L 1HE7A 2QKIB 4NWTH 4ZYKB 4X99B 1NCAH 5DHXB 1M1SA 3L6FB 1YEIL 4QOKE 1MJ8L 3ZE1F 3L3DB 3QEUA 2P5WB 3VG9B 1GH7A 5J12C 5JQ6H 3RL2B 4HIHA 1FRGH 5D7LB 4MB4A 1EGJH 4URTB 4M61B 2NNAB 1KFAL 1QSFB 2UZXB 2EO1A 1AXSB 5EULV 3RX8A 3CH8A 5C0GA 3TV3H 2EDQA 5E8EB 5IP4A 3S88L 1A1OA 1UG9A 5CP7A 4LQFH 5EO0A 3REWA 4PS4H 3DTXB 4JFYA 5F9OH 3H3PL 3QYCA 1NMAL 1A3QA 3FOLA 4LLMB 5C0BE 4N0CC 3I9GL 3VXUE 3O81A 1MWAL 5FYLL 1BWWA 4TUOB 1GAFL 5DFVC 3HC4H 4LSTL 1P7KB 4WO4B 1ZGLM 4OZFG 5DJ8A 1F00I 3AXLB 1A3RL 1WBYA 5CUSL 3MXVH 1BGXL 1G7QB 1OCWL 4LRIC 3LN9A 1HQRB 2OR8A 2OQJB 4BUGA 5ALCL 4MVBD 1YEHL 5EUOB 5EN2A 2FX7L 3GI9L 2DN7A 4CMHB 4JKLA 3O3AA 1NFIA 5D1ZB 3OMZA 2AV1A 4I0PA 5D71L 2PTUA 2P44B 5D7JC 4TUKL 2GTWB 4ZO6A 5KG9B 5I1CH 3TN0B 5IJVB 3K3QA 1F3DH 1CFQA 1CFSB 4BFEA 5DJ2B 1MCKA 2MCPL 4HFWA 3MLRL 5HI3C 2F19L 2FHBA 1GC1L 1RJLA 4WEBL 3D1MC 4ZXBA 1TFHA 5F7NC 1ZK9A 5AD0A 3TA3D 1XF3A 4P2RD 5I1IL 3IVKA 1YECL 5MENB 2H8PB 2X4PA 4NDMB 3SEPA 1QLEL 1QRND 2GSGB 1RZ8A 4Q58C 3UJTL 3QNXA 3H0TA 3WXVH 1H8OA 3HRZA 1I4FA 3QHFL 4UV4L 2YBRA 1WAAA 5GGTL 5EC1A 2Y07L 5BZDB 2QSCH 3IFPA 3L5IA 4I8DA 1P5VA 3OAZH 2IFGA 4P2OC 4EOWL 2QKIA 4TQEL 3P40A 1FFPA 1T7XA 1D9KD 3LDBB 4E41A 4GAYA 1UXSB 4K3EH 1INQB 4P57B 1J87A 1ZLWK 3JVGC 3BOVA 3UTZB 5KSBE 3LIZH 4KQ4L 2NY3B 4OZFH 3WS6A 3FQXB 1IQWH 1CU4L 3NZ8B 4G7VH 3IGAB 4M61A 3K1DA 2PTTB 1TCRB 1AXSA 4EI5A 2VN4A 1W72L 4F37F 1KXQE 1BJ8A 3WFHB 1OGAA 4JKPL 4WV1C 3O6FC 4U7MA 4H1LA 4JVPA 5L2KA 3ARFB 5EBLB 1AD0B 4OZGA 1M7DB 4NBZB 1AXTH 3EYUH 4U1SA 5DEFA 4LLMA 2DKUA 2CKBL 4YBLC 1EMTH 5GRYA 2CUHA 1CR9L 4L4TB 5IBTL 3GSUA 3VD4A 4FN0A 3U46A 1IFHH 4G3YL 1XIWD 2VB5A 2AV7B 1FNEA 1CBVL 2J5LB 5FHBH 5D5MB 4UTAL 4LBEA 4RQQB 3O11A 5L9DL 3DOSA 5C0CA 3ULUD 5EUOA 3KPNA 2NY0B 1XAUA 2VLLA 1PX4A 5MEQB 2FO1A 3D39A 3BZFA 4HQQH 4HWUA 4M7JL 1B0RA 4X6DA 5ID0A 3IDGA 4U0QB 5GGVY 2XPGA 5CBAB 1LO5A 3CH1B 2GITA 3SJVB 3DETD 5D8JL 1MCWW 3OKOB 5H35A 4JFXA 3MRIB 4Z7WB 5J56B 4RFNB 5DQDL 1Q38A 1O7SA 1ZLVK 4MAUH 3PWLA 4HG4J 3L5XH 5DMKA 5IKCA 4X6BA 5EOTA 1AKJB 4JG1L 3WNPA 5IB4B 4OAWA 1IM9D 2W0FB 3LY6A 2BERA 4GUPB 5E24E 5A2LH 1QQDA 3QUZC 1DTUA 4WI3A 4M4RA 3W81A 4XXCA 3EYVA 5I8CA 3DMMC 3SE3C 5I75B 3NIFF 1LVEA 3TBSA 3BPOC 1T0MA 3ZHDA 1GPOL 3CD4A 5JIIA 2DLFH 1NMBL 3GSRA 1T0NB 4AMKH 4IJ3C 3DBXA 3Q48A 5FA3B 3RTQD 4EBQL 1PG7W 1T22A 2LAGB 3LKSA 2HN7A 3LPFA 3R8BB 2BDNL 2HTKD 1NDGB 4M6MH 5T3XD 1CI5A 3RVVD 1NCCL 3KPOB 1LE9B 2IFFH 3OG6B 4FFZH 4XX1G 1G0YR 5E5MB 1EBPA 2W60B 1CK0L 4AY0A 2BRRH 3WD5H 3HE6D 2VXVH 3S9DB 1U8KA 4JY6B 4IMLB 1A7OH 3OAYH 1JWSB 2EDXA 3FAWA 3PWNB 1GGBH 1OY3B 2VXQH 1I7UA 4YHKL 2CSPA 3CXDL 3CVIH 4J3TA 1NQBA 4ELMA 1F6FB 1UVQA 1HILA 3IFOA 1EUUA 4HWBL 4HK3N 3DXAA 1IGYA 1YNKL 4GO6B 2VL5B 2CDFB 2LV4A 2CDGB 1ONQB 1FNGA 1FGNL 3MJGX 5HHOE 4G9FD 1V7MH 4U2ZA 5DJZB 4LF3B 2Q76B 5I16A 3MJ9H 4K7PL 4ZFZA 1MCRA 2BVUA 2BVOA 4QNPF 1HHKA 4RGND 1TQBC 3WUWA 4B53A 3BP5B 1UZ8B 3W39A 2P5WE 4UQ3A 2GCYB 2XZQH 1AXIB 3QI9A 3OPZH 3MMEB 3PWVB 4UIKL 3TT1H 4BFBD 2HFFA 1WLHA 3NAAH 3VFNA 3KYKH 1QSFE 3QNZA 4N9GA 1R3JB 1RIUL 5HHMB 4EUPG 3IU3B 4NJ9H 1CVRA 5EZLB 1MREH 4TVSa 3MV8D 4KV5F 3DUSA 4WHTB 5B3JE 3HNVH 3RY4A 1BBDL 3T77B 2PYED 3IT8D 2A0LC 4OLVH 3QPXH 3LN5A 4Y4HC 1JV5A 1EVTC 2GYSA 2XQBL 3CVHA 1KLFA 3O2DL 2HRLA 3MCG1 1J18A 5I73B 1TZIB 1RZJH 2JJSA 2JLLA 4K9EH 3C8KB 4RDQG 5JIKA 3QCTL 5GS2D 4X7SL 3BGMA 2HFGH 5DZOA 4YDIH 7FABH 4YDLC 2K3TA 3TA3A 5TPWH 3L3GA 3CU1A 4P2RA 4G6JL 3PG2A 3MLSL 2VXSL 4HMEA 5IW1B 1LGVA 4LSSL 4BQ6A 1QRNA 2ED8A 4NPYA 2DI9A 3N1GC 5LAXA 1VADA 3CLEL 1F4AA 1TZGH 1U9KA 1EEYB 4AG4L 2V2TA 3S6CA 3AFLA 3O6LL 2VLMD 2C3VA 3OJDB 4LCWB 1BVKA 1MJ7L 4FG6D 2AERT 4D2NA 1C5BH 1D9KA 5SV4A 4GMSL 1DQLH 3E2HC 3QXDB 4BSJA 1EXUB 1UM4H 5HDLA 2XNAB 1ES0B 3LRGA 1IM3A 4LLDA 3KYOB 3MJ6A 1S7XB 5EIIA 2PETA 2XWBA 5I1DB 2BOCA 5MENE 1JL8A 3X3FL 4D3CH 4EUPH 4OCNC 1OHQA 4G80A 1NKRA 1BWMA 2BNRD 3EYOA 5ADPH 5J6HB 2XN9D 1NGYB 4ZS7H 3CC5A 5HGAA 5GZOC 3O9WD 3JTTB 1SM3H 5C86A 1IAKB 5IT2L 4MDIA 1TETH 4Y8AA 4AL8L 4LCCA 2PR4L 4HC1L 1N59A 1UZ8A 4CMMB 1SYVA 1K8IB 1KC5H 1NCWH 1UB6B 5E2WL 2AJZA 3CMOL 5E4EC 4RGNB 4FMFA 1XIWA 3SO5A 1A6TB 5BVPL 1B3JA 2OTPA 3RIFK 3NFNA 4CN1A 3LN4B 1OGTA 1A1MA 4PRIE 3V4UH 4NUJA 1F90L 5D70H 3OGCA 1L4IA 1M7IB 2BNQB 4Y0GA 1JJUA 5LJYH 2XIDA 3FN9A 4ZFOB 2QQLH 4W70A 1KPVA 3BZDA 1DLFH 4QHLB 3RVXD 3MGOA 3P0YL 3PGDB 3ROLA 4X4ME 1EZVX 3SN6N 3O4OB 4GXUM 5F6HJ 4APQB 4YJZL 2PYEB 1YQVL 2AKRA 4L4TE 3EDEA 3WSQH 2BFVH 4N5UA 4Q6YA 1JWMB 1EFXD 1A6VL 3GMQB 3BQUC 3FT3A 5D5ME 4RFOL 5CZVH 3M1BB 4KK9C 4L8SB 2FECL 5CD3A 4JDTL 4M9OA 1IM9A 1ED3A 2IC2A 1DQQA 3S5LG 2DB8A 1JNLH 1IC1A 4YNYA 4HHAB 5B38G 1LDSA 4MCZB 3C87A 3D9AH 3VXSB 5M95B 3MOBH 1MCCA 4KKLD 1JF1A 4JRWA 4KDTA 1LO0L 4IRSD 3VI4E 3SJVE 3MRQA 3KR3L 2WLYA 4HJJH 1TENA 5F96H 3RTQA 5SWSB 4DTGH 5DEZA 5AYUH 3CXHJ 3IDYC 4XNZB 4NN5B 2FX8H 1AQKL 5K9KB 1T66D 1X5JA 2QSQA 4K3JL 3HE6A 4KY1L 5CINL 3L5HA 4ZFFB 1RZJC 2NY4D 4H5SB 4ODUB 4W4NA 2APXA 4K9EC 2QQKL 5KBNC 2VDLH 3A6CL 4MQXD 3QHZL 1UZ6F 3CIQA 1FCCA 4PV8B 4YO0A 5F9AC 1QR1B 1I8LC 1P1ZA 4HUWB 2QR0B 2OK0H 4PPTA 2ICWI 2JJUA 4GOSA 2WK2A 2BNRB 2HG5A 2J4WL 4P3DB 5IBLD 4G9FA 4FABL 2VDOH 2OR7A 3JV4B 1FL5B 1PZ5B 2RCSL 2M8XA 3MCKB 3I6KB 1DCLA 3P73B 4UOW0 4CW1B 1PY4A 5BQ7A 1OAKH 3MLTA 1WJ3A 1FFOB 4YX2H 3QIWC 5I8EB 4FXLA 5HJ3B 3N1FC 2M26A 1CD8A 1OVZA 3EDDA 4Z0BH 3Q3GA 1LEIA 1M7IA 2D7TH 4JQIH 5KS9E 4XMKH 4ZFOA 3VFPA 1IRAY 1II4E 4JLRB 4RMVA 3MV8A 4TTDC 3MACL 3ETBF 3RU8H 4HS3A 5J06A 4HFUH 2AQ1A 4NYLA 3P11H 1NL0H 1J1PL 4RGOH 1AGDA 5TDNB 2G9HA 2LTQC 2IPKB 4LDEB 4X7TB 4J23A 4RRPG 4K3DL 1X5YA 1KGCD 1CGXA 5KSVA 5J6GA 1TITA 2Z31D 5CJOH 1HH9A 3VWKC 4XCEB 4PREA 4KK6C 4O2FA 4XNUH 4ZUWA 4Y5VA 1JGEB 5HD8D 4PJAF 3BDYH 4LPXA 3DVGA 2NR6D 4KJWD 4ZOEA 5D72H 4OLXH 5JOPD 3H6JA 3OBAA 5HHME 3S96B 1I8KA 3AAZA 2MHAB 5C9JA 1JNNH 1MWAA 2AAVA 1OT1A 4LAJH 2ENSA 1BIHA 2DI7A 1XZ0A 3D2UD 1T03L 1CVSC 2CDEB 1GGIL 1KENL 5L6YH 1N64H 4LIQL 1QLRB 1MCPH 2J8UB 4L1DA 3NGBB 4OLYH 4Y4KB 3SGDI 4EZMA 3VW3L 5TFSL 4ZG1A 3VCLB 1VFBA 3ARDD 1SEBA 1XGUB 4ODUA 3C9NB 4YXHH 4L3AA 4Y2DC 5DLMH 5LGJB 3V95A 2JIXD 2QQQA 3WIFA 3S4SB 3BSZH 1DE4B 3BYTA 2FZ3B 1RQ5A 1F3JA 1PKQA 4ONFL 5JPNB 1KB9K 4JZNB 1RUAH 5E1AB 5IROA 2MPAH 4JANB 5FCSH 2VDMH 1AGCA 4LVHB 2L0DA 2XTJE 3RVTC 3L9RA 4EN3C 2XN9A 3ZKND 5I17B 4V1DD 5D93C 1MEXL 4JO4L 3O9WA 1B2WH 2YSSB 4LCWE 5DVNA 2L4OA 3GKWL 3MZGB 1PZ5A 3MRMB 3FB6B 2Y36H 3WE6A 3ULVD 2J88H 1TDQA 5T1LD 2X9YA 3RRQA 3TT3L 2R9HD 4R6UA 1HQ4A 12E8H 3R1GH 1I85C 4F9PC 1OQXA 5GGTA 2EDBA 3RGVD 5HHPA 1U92B 5HHVL 3E0GA 1MHEB 5AEAA 3K46A 4IBLT 2GSIB 1QRKA 2IH1B 1HH6B 4XVUD 1AGBB 4JLRA 3UJIH 3LRSA 4WVRA 1M05A 3SDXE 5DXWA 2R15A 1FPTL 1T3FB 4ZS6C 1B88A 4JFPA 2UUDK 4EQ3A 2NZIA 3RA7L 4PLJD 2ICWB 1ADQL 3FTGA 3QCUH 5E2VL 3F7VB 3CFKB 3ROOB 5DSCB 5F7MC 4ODTL 3EIFA 5D7KD 2E8YA 4OM1H 4PJBA 4GG6A 1EFXA 1FN4B 3O6KH 4UI2A 5INDB 5JOEA 4U4BA 1JGVL 3O4LB 2BC4B 4LP5A 3QQNA 5JHDE 4FQQB 2D7NA 3CCHB 4X9IA 5IB2A 1MUJB 3WFDL 3I75B 3PV6A 5FYJD 2BNQE 5ILTL 1I9IL 1U8JA 5IEKA 3L3IA 4M62L 4NZUL 1H3VA 2YPKA 1C08B 1N6UA 1QFWL 2CDEA 5JDSB 3I2CH 1VGKA 4R90L 1JPTL 4IRSA 4JHAL 1RFDL 3GJFA 2EICA 4X5WB 2R1YB 2EH7H 4JDVB 4Y4FB 4YC2C 4N0FA 5J13B 4CL7A 3HC0B 4EQ2A 2C4FT 4WW2B 3JWOC 4NWTL 4UOJA 1OTSD 3QWRA 1JNHB 3PWJA 4YEFA 1B90A 3NPZB 4GS7C 4CU8A 1NCAL 2JF1A 4GKOA 4Z7UB 4ZPTB 1D5BB 3RBSA 1XGQB 5CD5D 1KIPA 3GMLB 3VXSE 5JQ6L 1EGJL 4HAGA 3FOMB 1XCTA 1KELH 1HSBA 2PXYB 1BQHA 3GUTA 25C8H 4BH8A 3OSKA 3KS0J 5E94A 3NIGF 5SWSE 3S34H 3TV3L 2CIKB 1OTTD 1YN7A 1FO0H 3BPNC 2HT4C 2KH2B 4V1DB 4Q6IB 4ALAH 3WHE1 2B0SH 5F9OL 4ZTOL 4S11A 3V2AR 4AIXA 3RNQA 5IHZB 1T4KB 4ZNCD 2FEEL 3K1KC 4POYA 1DANT 4XP5H 1FZKA 3QDJE 4EDXA 3IDUA 5DGRA 4OZHB 1JF6A 4DK3A 4N8VA 1QBLH 1IEBB 4JJHA 4P5TD 4FHBD 1LO3H 5CIPA 3V6OA 5FM5M 1FZMA 1T3FA 5EBGA 4I48A 1RK1A 1WICA 2IAMC 1L7TL 4Q97A 4A6YB 1X5KA 3BO8A 3U9PH 3F7VA 2NXZC 5I1CL 5KSAB 4JPIB 1Y6NR 4KJQC 1A2YA 4BFIB 2DLTA 2Z31A 3MRKB 4JG0H 3PQYD 5D6DA 5ISZE 4FQQA 2C5DC 1T21A 3MLUH 3QEQB 4GAJH 5EU7E 2YXFA 4BKLB 2ATPA 5TE4H 4B0MM 2H6PB 4OCSH 4TNVF 3P4LA 2AK4A 3QQ9D 2Y25A 2V2XB 4QXTB 1KCSH 3C60C 2FB4H 4YR6B 3SHSA 3D2UA 3DIFA 3LKQB 4DKEH 1FNSH 3WXVL 4JKMA 1G7PA 2FR4A 1LEGA 1JF5A 3WJJC 3KWWB 3MO1A 3GSQB 5CEZD 2FH6A 5T1KD 2QSCL 4H8WH 5FYKH 3EFFA 5E8PB 3RPIB 5D6CB 1DN2A 2ZOKA 3ARDA 3L95A 3W0WD 1G7LA 4K3EL 4OLZH 3B2UC 1R3LB 2JIXA 1X5FA 5LGHH 1QSED 5E2UH 3ILQD 4NOBA 2R2EA 3LIZL 2ICES 4R3SA 1KJ2B 1PYWA 4G7VL 4NCC2 3D0VA 2ZCKH 2OL3H 4MNQB 1R6VA 3T8XB 4YDJB 2CIKA 2J8UE 4Z76A 1NUGA 4XH2B 3L3JB 3MRGA 2W9LA 3C5SA 1HXYA 1L9NA 1KULA 5J0BA 1SEQH 3ZDYE 4XPGH 4MB5A 4PUBH 1YYLH 2VDKH 5T3ZD 1JZ4A 1CT8B 4PD4J 4DVBB 3T4YA 5IV2A 3EYUL 3HE7B 4L3EE 4I77H 5T1LA 4LSDA 1EMTL 4WENB 2DWDA 1XGPA 1QO3A 5IQ9B 5IVXA 4LFHG 1IFHL 1BF8A 1NGZB 3RGVA 1ZMYA 3IJSB 5FHBL 4DGVH 2OZ4A 4N0CD 1KIQB 1FL3A 1VACB 4YHOH 5M7QA 3M17A 43C9B 4QRTA 4FXKB 5EWIH 3VWJC 4POZC 4O2CB 1EPFA 5IB5B 1ZSDB 1KCRH 4I9WE 1CE6A 3CU7A 3MYJA 2ZCLL 4HQQL 2AEWA 2JCCF 3ARGC 5CHNA 1X4XA 5CEXA 1P7QB 1I8IA 4IOSD 2R0KH 3PXHA 4HWEH 5I74C 1SMOA 1FV1B 4U1IB 1MRCH 2X1WL 2CGRL 3MZTA 2DM3A 3OHXA 4MAUL 4HZLA 1JHKH 1TCMA 3L5XL 5B39B 5GRZA 4S0TD 1S7QA 4LLVA 5E6IC 1S9WB 1S5IH 1YYMH 1BFTA 4IOFD 3OKEB 2E3VA 1OP5H 5HI3D 4KUCD 4L8DB 1CE1L 3MBEC 5BXFB 1CL7H 3WFCH 3EOAB 1CG9A 1MJJB 2Q87A 4HX1B 2DLFL 4P4KB 3STLA 3Q6GH 4AIZA 3KWWA 3PHOA 4U1JA 1KG0A 5E2TH 2BRQA 3MRPA 5DJ6A 5HI5D 4HCRH 4MCYA 1CICC 5E8PA 5AAMA 1U41A 1JZ8A 2WBKA 4M8QA 3W82A 3O4LE 4FFZL 3SGEI 3SE8H 1TNMA 1JGLH 1KJVA 4Z0XB 3WD5L 2EC9T 3SDDC 5ENWB 5DQJB 1A7OL 5HGDB 3KLSA 4LNVA 2QEJA 2Q3ZA 1ITBB 2YD1A 3TVMC 4WJ5B 4F57L 1GGBL 4OIIH 1FZOB 2ZSVA 4FXGA 1EDQA 3CVIL 3KPPB 4PJ5B 3RKDC 4JRXD 5C6TH 2WWMD 5BOPA 1QUNA 3QG6A 3SE9H 5DRNB 2RFXA 3P77A 5E9DD 5H2BB 3C08H 1SBSL 4X98A 3G5XB 3FONB 3RI5F 4DEPB 1FZJA 2NW3B 2NW2B 4DK6A 5C8JB 3GMRA 2P24B 4GW4A 3B43A 1V7ML 4MA3B 4RAVB 3X13B 5TJWK 1IARB 1XGYH 1A14H 3MJ9L 3P30H 4H8WC 2P48B 3O6FD 3B8SA 1ORSA 3PABA 2ORBH 4Z7UE 4D94A 3KJ6H 1P53A 4QYOB 5HYJD 3T2PA 1JK8A 2XZQL 1JUFB 2BY0A 3OPZL 4M00A 3TT1L 2F8VA 3WDJA 3NAAL 1MFEH 1WZLA 3KYKL 1OLLA 5CWSB 1KB5B 1Z9MA 3KGRA 3I50H 4ONGL 4P5TA 1L9MA 4R0LC 4X6EB 4NJ9L 3QNYB 4QXWA 1ND0B 3QUXD 2PYFB 4J8RB 3E6FA 3K74B 4LHUG 4D0CB 4NN7C 1ACYH 1MCNA 3DX6A 1ACZA 3HNVL 2GKIA 4CKVX 4D8PB 4YGVB 3U0PA 3W5NA 1WFNA 4OLVL 1MAKA 3QPXL 5CSBA 3G6JA 3T3PF 1U3JA 4PJDB 5EZIH 3ARBB 3Q5TA 1WZMA 4FA8A 3PQYA 3QSKB 4PR5A 1XF2B 1HCVA 4YZFE 5GRXG 4IS6B 3SY0B 4K9EL 4OZHE 2LU3A 4KI5C 3OKKA 4OF7A 2HFGL 1NSNH 1WF5A 5C0IB 1F4XH 2FO4A 4MD4B 5TPWL 3HR5B 5IHBA 1LP9A 1M6OB 3CZFA 3EOAA 4Y5YC 2O61A 4RNRB 2XQYG 5J9PA 1MJJA 3UO1H 1U8IB 4M5ZL 1WITA 2D0HA 4I1NB 3I02B 1I7RA 3QUZD 2EXWC 1HHJA 1FYTD 2QHRH 3DLQR 1GXEA 3DMMD 3O6ML 5T1KA 3WMSA 2DLGA 4I3GA 3PHQB 3FMGH 5EO9B 1YPZA 4EXPX 4P5MA 3R06A 1RZGA 1U95A 3QEQE 5M94B 1C5BL 5F6HI 4K2UH 4YBQC 3UTQB 1DQLL 5C0FB 3W0WA 1F11A 4M43H 1Y0LB 1UM4L 4N1HB 1QSEA 2FJFA 4O51B 5I9QB 3B83A 4JM4H 3LS4H 4YXKH 3M45A 3BJ91 5E00B 3DX7A 5IMMA 5ACZA 4D3CL 4QWWC 1I7TA 3FQRB 1U8LB 2B8OT 3TH4T 2EIDA 4DKFL 1K8DB 5ADPL 3F6LA 4MDJA 4ZS7L 2I9LA 5ICXB 1VCAA 2RAMA 1SM3L 3MGAA 3MUJA 3DV4A 2R2BB 3VFVB 2RGSA 1BP3B 1TETL 1UM6H 4I4WB 4I3RH 5GS1C 2ERJB 3V79C 1KC5L 1NCWL 1O7VA 1RUML 2A6DB 2P43B 1MOEA 4WDIB 5GS0H 4M02A 1VESA 5EG6C 5C0AB 5IOPA 4OKDA 1WEJH 1I1YB 1K4DB 2X1XR 2SEBA 1EA9C 4MNQE 1C8PA 3VFSA 2X4OB 4E5XA 3BDXA 3V4UL 5D70L 1BBJA 2W9DH 3RJDA 1MI5B 4J8RA 1IL1B 5E8DH 4GRWE 2QQLL 3L3OA 5FFLA 4S1DC 1DLFL 3FRUA 5JW4M 4LRIA 1QLFB 5FM4A 4X6CB 5CJBA 4CBPA 3BIKB 4FQXC 4PRDA 5LQBL 1BHGA 1U42A 5J11B 3WLBA 5MEPB 2JK5B 3WSQL 2BFVL 3QUYD 1W0VA 3BZEA 5IJKA 5DQ9A 2GEEA 2X9WA 3TO4C 1R3HA 1BFSA 3RIAK 3MRLB 5CZVL 4Y4HD 4XGZB 3OKLB 3VXNA 1N8ZA 1G6RB 4PJ9C 1OSZB 1BD2B 1YJDH 3D25B 3IETB 1GCFA 2HKFH 3V4PH 2RHEA 4FQ2L 1BIIB 4F7TB 3D9AL 4PJ8B 4UNTA 4CVZB 4FP8H 3MOBL 4JY4A 4JRYB 2AXGA 3PP3H 1AIFA 3QIBB 3MXWH 3RZCC 4HJJL 2Y4SA 5F96L 2XG5A 3ARVA 1FYTB 1U3HD 5F97E 4DTGL 4R4FH 2G5RA 5AYUL 1JHLH 2FX8L 2CR6A 3RX5A 1QKZH 2EEAA 2XYCA 2HWZH 4YHML 1P7HL 2EYTA 3U48A 1T7WA 3U36A 4EVNA 1NJ9A 4O2EA 1H3UA 2HJFB 4YPJA 4C57C 2VDLL 2HLAA 1JI1A 4PLOB 4RBPK 5JORA 5DJDB 4WFHE 4JRXA 1A6UH 4KTEH 2OK0L 3JVGA 1S7RB 4XPHH 5FF6A 5E9DA 2F74B 4OFPA 3EOYG 1WAAF 1BVLB 3P4OA 3QRGH 5ETUB 5ICXA 4AENB 4ERSH 2N7BA 3HZVA 2MQ0A 1ZT1B 5DJYB 4LNRB 1Q9LA 2AK1H 3OKNB 4KFZC 3EO1A 2A6KA 2OSLB 4I2XE 4Q2ZB 4WV1A 3O6FA 2P7TB 2VITB 1OAKL 4X5XA 3T0EB 1M4KA 5HYJA 2H32H 3TO2A 1JN6A 4JFQA 4PJ5E 3VXTA 2CXKA 4Z0BL 1RIHH 4U1KA 1A9BA 3UPAA 2D7TL 1AHWC 4XMKL 1L0QA 4RWHA 3U9UB 1I1AC 3QUXA 1PSKH 1MAJA 3RU8L 4HFUL 15C8H 4L29B 3P11L 2IADB 1NL0L 4RGOL 3TZVC 2CRMA 2YPVH 3FB7B 1EGJA 4OT1H 3GMPB 3FO2A 3B8YA 3MCLH 4OZGF 4IIQC 4E0RB 2CLVA 1WC7B 1R3IL 3KPSB 4LSPH 4XNMB 4DZ8B 1RV6X 1FVDA 5CJOL 1HOCB 3KNBA 1JMXA 1ZS8A 3AS3A 3CSGA 4XNUL 1YN6A 1RJZA 4PJGB 4Q9RL 3KHOA 3ZZ1A 5D1XC 3UYRH 2NLJB 5JW4Q 2V5SA 3BDYL 4ZTPH 3IRPX 2Z91A 3S7GA 5INCB 5GS0C 1I9EA 1V7NH 3DUUB 1EJ6A 4OLXL 5D72L 3T0DA 1AD9A 4LKCA 1RUKH 4WNQB 1U8OB 4ODHH 2VUOA 1QACA 3MV7D 3BQUD 5DWUL 5L2KE 5EUOF 3H3BC 1BIIA 3X11A 3AREB 5EO1B 1J1OH 1UXWB 2A1WH 3X14A 4QTHB 3EW3B 4X83A 3BVNB 2E7LC 3DECA 1KPRB 3P2TA 4QCIB 1MIMH 2GTZA 5DMYA 4NKDA 3MRFB 1AP2B 3QUZA 4U6HA 4ONOA 5D9SB 5L6YL 1N64L 4WUUD 2NCMA 1B0WA 1TNNA 3DMMA 4PJDE 3SE3A 1MCPL 4OLYL 4U6XA 1U3HB 3P4MB 5SX4H 3U2SA 2DWEB 2WANA 3CZJA 5FYKU 3SQBA 4YXHL 4GBXC 3TIDB 5DLML 3HMXA 4HKXB 4OCXH 1X5HA 4OFVA 1Z5LB 3BSZL 1WFOA 3GB7A 3RWHA 5DVKA 1PX3A 3LKRB 2X4UA 3CAFA 3GSWA 1RUAL 2V7NB 3E3QC 2MPAL 2NY1C 4HDIA 2F74A 2VDML 2ZOLA 3GSNB 5DRWA 1XR9A 5KANG 4Q74A 4LQ1A 1HYSC 2D0FA 4WU5A 3VFUB 2Q8AH 1S7WA 5SWZB 1WBZA 1B2WL 5D1QC 3TPKA 5HXMA 3KDMB 2ZWLT 3QXVA 4JHBA 1R5VA 3H7BB 2Y36L 4ZUVB 2J88L 4OV6F 12E8L 4UDUB 5ESAA 2AJSL 3IJYB 4MJIB 4PJIA 4KJYA 4NCC1 4JM2B 2DIJA 2Q1EA 5IG7B 4X8JB 5C3TA 1WCBA 1SJXA 3SGJC 1F3DJ 2VLJD 1OT2A 3O41B 4FZ8H 4QHUB 3UJIL 5EU3A 1I75A 3QIWD 1RVFH 1G6VK 3SDCB 2PTVA 4XXDA 4OZFA 3G5ZA 1X9QA 1RZIB 2AJ3A 2AXHA 3H2WA 4UNVA 4KPHH 5T5FH 4XMLH 3BJLA 5E95B 3CPLA 3O8XD 3V7AG 4F15B 4QGYA 2DOCA 1HOCA 1DDHB 1IGTB 3T1FB 3WEXB 3QUYA 2F53D 4OM1L 4PG2A 5EUKA 5IQ7L 2NLJA 3MRDB 3O6KL 5CGTA 4G42B 5C0AE 3VD5A 4BSWB 5D5MF 1T2JA 4C58B 1X5GA 3DXAE 2VXUH 1CGTA 4Y4HA 2VNCA 5EU4A 4GRLC 4ODXB 4QO1A 2AXFB 4OQ1A 4P49A 4JQXC 2EYRB 4KK6D 3ZT5A 4HW6A 1SJEA 1MI5E 2Q6WA 3OXRA 3QJFB 2LE9A 1KLUB 3A67H 3QO0B 1PKOA 3GSOA 3DRTB 4XRCB 4IHOB 4X6CE 1AP2A 3BPCB 3I2CL 5DZNA 3NOIA 1NUNB 4Z7WF 5I6XB 1UWEH 4M7KL 3VXOA 3NIDE 3BH8B 1FG2B 4X6FA 3AVEA 2EH7L 3PP3K 4BH7B 1OB1B 2VDPH 4H25B 5DRXA 4NQDB 5ERWB 1AGEB 4XP9H 4MD5A 3REVA 4GG8B 3IS1X 2C4FU 3WBDA 1BD2E 3IRZA 4H0HB 4PJ7A 5H94B 1RURH 4H20H 1U8HB 3CFCH 5CBEB 3FQTB 3QULB 3K2UH 4FFVC 3WUWG 1CF8H 3SGKA 3B2VH 3NPSB 3NA9H 3SO3B 1QP1A 4QRSB 4JRYE 4XHJC 5J1AB 1NFKA 1K5NB 1KELL 3TH2T 1J0IA 4NGHH 3TFKC 1UWXH 2VKWA 25C8L 1DQJA 3JV6A 4TUJA 5F7UA 1RK0B 4HKJB 3S34L 5C71A 2IPUG 5EORH 2WBJB 1A4KB 3VFGH 4NQUA 4KC3B 4ALAL 5J4MA 3VGAC 4NRXA 4QHMA 2B0SL 4JVUA 3RVTD 4EN3D 2VDRH 2DYPD 4UIMA 2GQHA 1QRNE 2VERN 3RWDA 1NCTA 4LVOB 1HI6A 4XP5L 1DANU 3UZEA 3ZDXF 3HZKB 3LZFH 1RSFA 4LGSB 3JUYA 3ME0A 5F1NA 4TSAH 3MNWB 4WCYH 1ZHLB 2VLJB 1LO3L 3K2MC 4MXVE 3EYFB 1HSAA 4LLAA 3U4EA 2NY5H 3DGGB 5EIVA 5D2LA 2VQTA 1BX2B 1T5XA 4XCCH 5AG8A 1PG7H 1P4IH 3JBG7 4PV9B 3U9PL 1OAQH 4G8GD 4OD1L 3MA7A 4F37K 2MNUA 3H9YA 4Y16B 4ZS6D 4M8VA 2KZWA 3C2AL 3T0EE 5DD3H 1TVBB 5DGQA 4JG0L 4KTYA 3SBWC 3UTOA 2VE6A 2I24N 3QDGB 3G08A 4R8WH 3MLUL 5FDYA 4G9DB 2FD6H 2EYRA 4GAJL 3MJ9A 5FO7A 1UEMA 1NGWA 3ULUF 3IAQA 2ADGB 5IEHA 1E6JH 3RDTB 3MV7A 3BQUA 3MOAH 4OCSL 3ZKXB 5HHQA 5KOVC 2W1NA 5JA8B 2I9TA 1IKFH 1KCSL 2I26N 3LMJH 1W72B 3D0LA 2FB4L 4K7FA 4KKNA 4DKEL 1KT2B 1FNSL 4OFYD 4RA0C 3JV5A 1FH5H 3VRJB 4WUUA 3DUHA 2FWOA 3LQAH 1NGXA 4EI5C 5JHLH 3KPSE 4WWID 3QUML 4QGTA 3NFPA 2QLVB 3E6HB 3HZYB 4HXBH 4H8WL 5F70A 5FYKL 3PV7A 4PJGE 1DUYA 2GAZB 5LBSH 1YY9C 1HHHB 2DKMA 3AU1A 4OLZL 3RWFA 3KPRB 1AJ7H 3Q6FB 5LGHL 1S9XA 4XCFH 3CVHH 1G9MH 5E2UL 1BZ9A 4QY8A 4HUUA 4JREB 4TSCH 5DD6B 4NNPL 5I8OH 3MBXH 2ZCKL 2DKSA 2OL3L 2F5BH 2ZUWA 4NQTA 4R4BB 5CEYA 3VFTB 1T5WA 3DX8A 4U1LA 1I8LA 1EEQA 1CLZH 4Y7MA 1TTFA 4CMHC 2DM7A 1SEQL 1S9VB 4XPGL 5D1ZC 4PUBL 1CD1B 3ES6A 2VDKL 5K9JH 4LGPB 4PG9A 4XWGH 4YWGH 1ZTXH 5DC4B 1DBBH 5FECB 2X4TB 4HKZB 4I77L 3TN0C 1N3NA 2ESVB 3GO1H 1IEAA 2HT4D 5I1AA 3C8DA 5A2JH 2ID5A 3CX2A 3BRFA 2Y6SC 2Z35B 3LSOB 1FL6B 4DGVL 5J7CC 3D85D 4YHPA 5T3XE 4ZFGH 4YHOL 4WGWB 2VLJA 5EWIL 2XV6B 1U36A 3QIWA 3RUGB 4HLZG 3UPCA 1KCRL 3PJSA 4XVJL 3IDMA 5SWZE 2H2SD 2R2CA 2EIBA 3ALXA 4ONHA 4LPUA 4F7CA 1RUPH 3BYYA 1F5WA 3OX8B 3SDYH 3L1OH 2R0KL 2DTMH 1GGUA 4EUPA 4HWEL 3O8XA 1WT5C 1MRCL 1TVBA 2IAMD 1CDUA 3MUZ1 4YHLH 3FO1B 1JHKL 1YC7A 4MJIE 1R5IB 2F53A 2NXZD 4V2CB 2C1OA 4KJQD 1YYML 1S5IL 3LDBC 3C6LB 3DWTA 3ECBA 2PCPA 3C6SA 4KHXH 3UDWC 4HK0B 2BSSB 3AC0A 2R1XB 2NY3C 2X1OA 3SE4C 4I18B 5DMIH 1CL7L 3WFCL 2WQRA 4F2MB 1KB9J 3Q6GL 2NY5C 5TE7H 4NKOB 2DL9A 1V3KA 2ZUVA 5E2TL 2BK8A 4PGEA 4P4RA 4HCRL 3HZYA 3GSVB 3C60D 2IF7A 5K33A 3DURB 3SE8L 2NYYD 1NC4B 3QBTB 1VEOA 5FUCE 2BMKB 1WIPA 3TBWB 5IR1A 1U8NB 2EC9U 3B3IB 2UYLA 4XP6H 1J05B 4OIBA 4K23H 4QT5A 8FABB 5KSUA 4OI8A 3ZMRA 5EU5A 4OIIL 3ULSA 4KAQL 3B2UD 3PL6B 3MRBA 2J5LC 5DT1H 1IEHA 5C6TL 1ZAGA 2CXGA 3SE9L 4HLZH 5KZCD 1NBZA 2DQGH 1T89C 3C08L 3ILPB 3QEHA 4XPBH 3RWGA 3LQAC 1IQDB 4NQDE 1HWHB 1E28B 4WI5A 1XGYL 1CIDA 1A14L 3LKPB 3P30L 4EN3A 1MVUA 2DYPA 1NDMA 5FYLE 3F8UB 5DS8A 4RFNC 2MOVA 3T2OA 1IBGH 3MROA 2ORBL 4X4YB 3R0MA 3KJ6L 3MGTA 1I3GH 4PP2A 3IAPA 4WTZA 4P23D 2ZJSH 1G9MC 3WUZA 3CDGB 1A1NB 1H15B 3VFMB 2FL5A 4ZUUA 1I85A 4F9PA 1MFEL 1ORQB 4JPWH 1WZ1H 3D85B 4YHNB 4Z7NF 3I50L 1NEZB 2FCBA 1EJOH 1OP3K 4PJHB 2K9UA 4Q9BA 2Z0BA 1MLCA 1ACYL 5I75C 4GXVH 4ETQA 4LHJB 3MFFB 4IM8A 4POZD 4G8GA 5FGSA 5GGSA 1KCVH 4U1HB 2E9WA 4C83B 4M7ZB 4YDKH 3ARGD 3DI3B 1DJSA 4R2GB 2L7JA 4PGJA 3SKUD 4G6FB 3MREB 2IWGA 4HK3J 2P8MB 3NCYP 3TBYB 2ZG2A 3VU2A 1LDPH 2HKHH 5HPMA 3QWQB 3TBTB 4L9LB 5DK2B 3ZDZE 1D9KC 2XFXB 1YEKH 1O5DT 4P9HC 5E6ID 5LKNA 4I0KA 3FO0L 3UO1L 1QFWM 4B5EA 4PYHA 5ICZA 1CD0A 2H26B 3C8HA 1Q9KB 5IVZB 3IFNH 4OFYA 4DCQA 4AM0A 2VR4A 3VFWB 2QHRL 1Q9WB 5B38A 5GPRA 4ODWA 1D5ZA 2B7DT 2EKSA 3ZTNL 5KTEH 1OW0C 3TBVB 2HRPH 1SJVA 4X7EC 3BT2H 1DUZA 3BI9X 3MNVA 4PJBF 3OWEA 3MRJA 4Y1AD 3QDGE 4FZEL 2ADIB 1IC5H 4LPCA 5MHSD 4J2XA 4K2UL 4M43L 4BZ2L 2ZUSA 2BVPB 5GIRB 1T1XA 2VLRD 4JAMB 4IRJB 1YUHB 3AB0B 4JM4L 3LS4L 3U30B 1CTNA 3QDMD 5EDXA 2JB6A 3HI1A 3BEVA 4YXKL 3B5HA 2HFEA 3SDDD 3FFDB 4J1UB 4AT6B 3IDXH 4KRPB 1IAOA 4JZOA 4GG6E 4PTUA 2Q8BH 1VEMA 3UAJC 4G43B 3VXMD 5IESH 1MFBH 4PRAB 3RKDD 3VFOA 4DKAA 3N9GH 4EIGB 3S97C 4EXKA 2XWTB 4U1NB 4UMGA 4KRNA 4PJEB 3AMKA 3GFUA 4JN2A 5CCKH 5A2KH 1SY6L 3F7YA 4PY8J 1ETZA 4YHYB 1V3MA 2R2HA 1T1YB 1UM6L 2EDNA 1E4XH 3H9SE 3KPRE 4I3RL 5C07D 4UV7H 5HI4C 5A16A 3QQ3A 1ZLUK 3DETC 4M03A 4HH9A 1C12B 4HIJB 5JLZA 3VA6A 4G7YH 3CDGA 3L7FA 5HYQB 3DVNA 2EC8A 1JWUA 5BS0D 1ZA6A 3EOTH 4XBPA 4P23B 1WEJL 3D85A 1TMCB 3TCXA 5E2JA 2HMIC 5CGMA 3HNTH 4NQVB 5F7KC 1A02N 4XCYA 3ORJA 3F7PC 2F54B 3CFJB 4XVTL 1CQKA 4TULH 5MERB 3TPUA 4Z78A 2VAAA 3BWAA 3RPKA 5HTSA 5TGBA 2YK1H 2KQNA 2ESVE 3W9EB 2IAMA 4PJXA 1FC1A 1H8SA 5LXGL 1QNZH 1ZWIB 2CIIA 4XZUB 3SOBH 1AR1C 3RVVC 4S1RH 1Q8MA 4MHHI 2D7QA 4ODVH 1SBBA 1U93A 4RRPA 4Z77A 2I07A 4YK4B 4W6WB 2J3SA 3GJEB 3EHBC 1YJDL 4DUWA 1IGJB 3RUGE 2HKFL 3S4SG 3V4PL 3MLPA 3FHQA 3VRLE 1UQSB 3OR6A 4CAGA 4KI5D 4JY5L 2GK0A 1AO7D 4FP8L 3U79A 4JQVC 4LGRB 1D7FA 2VQ1B 4UQ2A 5BVJA 3VGFA 4PGCB 3PIQB 4NSKB 5FKPB 1U8PA 3OR7A 3VXPB 3CUPB 1BQHG 1T1ZB 2XA8H 3HAEA 4R4FL 3C60A 1KTDB 5DZLA 5JPMB 4NNXA 1JHLL 5F71A 3PWUB 2O93L 2EXWD 5BZWA 3HUJA 1EH9A 1QKZL 3WJJA 5D96B 2HWZL 4GXUN 4Y1AB 3V6OE 4HS8H 4Z7VB 2XKNA 4ETYA 4YAQA 3MTRA 5TDOA 1QFOA 4LEXH 1OTUC 1G7HB 1QFWI 4LARH 4RGNC 5GRWA 3GRWH 4U0RB 4ZQKB 3WNNA 1LD9B 3D5OF 4YBQD 3QDMB 1HZHH 9CGTA 1Y18A 5AYQA 3QO1A 1A6UL 4L3CA 2B39A 2IANB 4KMTH 2VC2H 1TTGA 1ZA3A 4XPHL 6FABH 4MJ6A 2KQMA 1JP5A 3KS0H 3UBXI 4QWWD 3QXAA 3B4NA 1BOGA 2Q7YA 5IM7B 2YA0A 2YEZA 3WKML 1A6ZB 5C6WH 4YDVB 1NBQA 4WW2F 5E7BA 4LLYA 4MSWB 4PJFE 5FA4A 3MA9H 3WNKA 3BPLB 3O4OC 4APQC 1M71A 1ZHNA 2AK4E 3GJFH 3BUTA 3QIUD 4OF3A 3RL1B 2R23B 3EGSA 4JZJB 1C5DB 4C55A 4JB9L 3ZKSD 2MKLC 5GGRA 2BVQA 3FAXA 1A9EA 4EIZC 4DKDC 5CJXC 1J0JA 2A6JA 4TRPH 4L8SC 3AM8C 3G9VA 4Y19B 4EKXA 1JGDB 4DVRH 5AUMB 5TH2A 2UWEA 1R24B 5HDQH 1ODAA 2Y72A 3L3HA 1JPFB 1PSKL 3N06B 5DJ0A 15C8L 4FQIH 4RMTA 5F9JA 5HBBA 5GRVL 2YPVL 5F1OB 3FB8A 4OT1L 5HHXL 1BZQK 1VGEH 5I1GH 2FEEI 1LK3H 3ULVF 3NH7L 4NQCB 2X4RA 4S1DD 4LSPL 3ARGA 4MB3A 1VPOH 4W6XB 3OQ3B 1FO0A 1HEZA 1HKFA 4HT1H 4P2QB 5IW6A 2OMBA 4WI4A 4XNZC 4NN5C 5DUBB 3UYRL 4ZTPL 1YEEL 1V7NL 4OB5H 3WHXA 3G04B 1RUKL 4ODHL 4MMZC 3TO4D 1C16A 2ZCHH 2ENYA 3BD5A 1K4CA 3SKOA 5E6IA 5CJ5A 1J1OL 2GJ6D 2A1WL 3CFDA 2PW1B 3WN5B 3L3KA 1DR9A 4YQXH 1MIML 4NNYA 5GRJH 2Z8SA 5IVXE 2LABA 4JFHE 4MAYB 3H9ZA 5IHLB 1VDGA 5IROC 4NO3B 3MV9D 4BZ1L 3MBEA 2EZ0C 1KTDA 1A6AA 1LNUA 3FB5A 5DF0A 5TE6H 2BNUB 1CLCA 3WHE0 3EOBB 2BOBB 3I6LE 3S35L 1BQLH 1EERB 2VQUA 3RZCD 4Y1AA 3QT2A 2CMRH 3O9WC 5A40E 5SV3A 5TF1H 1TTUA 3KYMB 1OQOA 2DTSA 3HG1D 1JTOA 2VLRA 4IOIB 4OCXL 3QDMA 2FDBP 2OTWB 5BJTA 3G5YA 3SDDA 4X4XA 4YUEH 4HUVA 5EC2B 1XR8B 5EU7C 2XTLA 2XWJB 3VXMA 2VKXA 2Q8AL 3KJ4B 4JFDB 1W0WA 2QADB 4S2SB 1JHTB 4HPYH 4L8BB 4P2OB 5DJAA 4D0DA 5I0DA 5C07A 1T04B 2YRLA 4J3VA 1MJUH 2ARWA 3VI3F 3VJ6A 3EYQC 3QIUB 1IGIH 2JKXA 5BOZG 5JW5A 3RZWA 5BS0A 3S98A 4EJ1C 4GAGL 4OLWH 5L2JA 2B1HH 3D69B 4FZ8L 1ZT7A 3U7WH 2EDOA 1MFCH 1RVFL 3HZMB 1SHMA 1B4RA 3GM8A 3FFCD 2V17H 1I9JH 3G6AA 4PJEE 3U7AA 1JPSH 1KTLB 4DN3H 4KPHL 5D2NA 4XMLL 3BEWA 5GJSH 3VRIA 2DM2A 2P8PA 2VO5A 4R0LA 4LLUA 4NUGH 2L7UA 2OL3A 1VFAA 4IRSC 4QOKD 4PRNB 1Z0NA 4LHUD 2FRGP 3UBXB 1CXLA 1UM5H 1ZHKB 3NGBC 4Y4KC 3TZVD 4CU7A 1BFOB 4HS6A 1NAMA 3KPMA 2VL4A 4RIRB 3O3DB 4YHZH 3U0TA 4BYHA 4QRQA 2VXUL 3ULVH 2OJZH 5FB8B 5FHAL 5FK9B 5C09B 4QRRD 4FTVD 1GSMA 5DHYA 5EPMB 5FKAA 5C08B 2A9MH 2FYYB 3FQUB 5GGQH 1WFUA 2F54E 3A67L 5GS0D 1YY8A 3ARTA 2OZ4H 1CS6A 4H0IA 1AO7A 3ESUF 4UBDC 2GJ6B 4HAFA 2OP4H 5C0BD 3V5HB 3VXUD 1C1EL 1I7ZA 1HXMA 4Y5YA 1UWEL 1KCUH 4GW1A 4F7EB 1L7IH 3MLWL 3IDIA 2VDPL 1MHHA 1X7QB 3JTSA 1MCHA 4JFFB 3ZT7A 3CSPA 4OCRH 4P5KA 4RFEA 4G8FA 5GGUB 1RZKL 2IQAA 2BSRA 1KN4H 2X10A 2YUZA 3TNMB 4F33A 2A77H 1RURL 4H20L 4OGXH 4LCUB 3CFCL 4I3SH 1CF8L 5ITFA 4KDVA 3B2VL 1LP9F 1S7TB 4GBXD 4O02H 2MMXA 2Y7QA 3G6JE 2X7LB 3BP7A 4NGHL 3GMOA 4NN6B 1KN2H 4XP1H 4AEIL 5IB3B 1YNLH 3WIHH 1NPUA 5EORL 4WFFE 4Z5RA 1EFQA 1YEDB 3V0VB 3VFGL 5F7YC 5CP3H 2G2RB 4RZCB 3GGWB 1YPZF 3C5JA 1ROWA 1W8NA 4RMQA 4EI6B 3K4ZA 4Z7VE 2VDRL 1ZHBB 3NN8A 5DJCA 5KVMC 3SCMB 3DARA 1S5HB 3QIUA 4HCRA 3HLAB 5EZJB 2Z92B 2J8HA 5B39G 2Z31C 4NM4H 5GS1A 3LZFL 3QB7C 2AQ3A 3E8UH 5D6DC 2IANE 4Z95H 5T33H 4WTWA 4WCYL 4OZIB 4KJWC 2IH3A 2XY1A 1MIEH 4UU9A 3BE1L 1KJ2H 2EDTA 1JCKA 3VH8B 4FNLH 2VLKD 3W0WE 3FFCB 4XCCL 1PG7L 1P4IL 4MX7B 2X2YA 5KVEH 1F02I 2ATKA 1F6AB 2NY6B 5EZOH 4J3XA 3IAGC 1B6DA 4IMKC 3CFBB 1D3CA 1K85A 3ZE2E 1TQBB 2BJMH 4RIRA 2HVJA 4JR9L 2XZCH 4Y4FC 2AJVH 4QXGH 1GOHA 5SX5K 4R8WL 4XBGB 5J13C 4M1GH 4Y19E 4ISVA 1LWRA 4LLQB 4WW2C 5C0DA 4QRPB 1E6JL 3TO4A 2AJUH 2ZSWB 4HIXL 2H3NB 3EO0B 5IMLA 1K9TA 4GRLD 1HDMB 2GJ6A 3DX9B 1IKFL 4LIQE 3LMJL 3MJ7A 4ZDHB 3PNWB 3ZTJG 1WIUA 2PXYC 3IXAA 1N7MH 1AQDB 3GNML 3LQAL 3F12A 3MV9A 1T1WB 3QQ4A 2GY5A 3IXTB 4BQCA 1NCDH 4P2QE 4HXBL 2A73A 2DQIH 3RWIB 1I3RA 1ULVA 3RZCA 4Q6IC 1D5MB 4MXWH 4XMPH 5LBSL 3MLXH 4WW1A 3TNMA 1F58L 1NFDB 1AJ7L 1HNFA 1P9MA 1R3KB 3HG1A 3R4DA 4QHNB 4XCFL 3CVHL 3ULVC 3QPQC 1RIVH 1NC2D 2W0PA 1NGQH 1H5BB 5HSFA 4PJCA 4ELKA 4KUCF 5JZ7D 1YNTA 4QF1B 4D9RE 5I8OL 1FAKT 5DMJB 3MBXL 4UT9L 1MH5A 2F5BL 4FFVD 2H9GA 1UKQA 2FJHA 43CAB 5KVDH 1I3VA 5IBUG 4XVUC 2OYPA 4GRMA 4ENEC 3P4NB 1CLZL 1QSZA 4L8CA 1UB5A 1P2CA 5HGBB 4BK5A 4U3HA 4JFOB 4XWGL 1ZTXL 4U6VL 1DBBL 3MRHA 1S7VA 1NUDA 5KSAC 4XC3L 4PLJC 4JGUA 2Z92A 5L8LB 3VGHA 1ZKAA 2VZSA 1MFDH 5DYOA 3DO7B 4M93C 3O2WH 4CGTA 2EYSB 2DQJH 4ZFGL 1TVHB 4MZ3A 5K93A 1FORH 1P6FA 2C7UA 4FOMA 3D3VB 3SQOL 2W59A 3D18A 1EAPB 4MQ7A 2B1AL 4AEFA 2IMMA 4JFDE 1T6VN 1YMMD 3ZTJH 1RUPL 1AHWA 3SDYL 3L1OL 1PAMA 2DTML 1HHGA 5C0ND 3RI5K 4NHCH 1MHPH 1XCQA 4QOKA 4HBQA 4NHUB 4LHUA 5KSBB 4YHLL 4P46D