2W5PA

Drae adhesin in complex with chloramphenicol succinate (monoclinic form)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
140
structure length
140
Chain Sequence
GSFTPSGTTGTTKLTVTEKCQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPTDNSAWTTDNGVFYKNDVGSWGGIIGIYVDGQQTNTPPGNYTLTLTGGYWAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords DR HEMAGGLUTININ STRUCTURAL SUBUNIT
publication title A Structural Study of the Interaction between the Dr Haemagglutinin Drae and Derivatives of Chloramphenicol
pubmed doi rcsb
source organism Escherichia coli
total genus 29
structure length 140
sequence length 140
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 2w5pA00
1RXLA 1UT1A 2JKLA 2BCMA 2IXQB 2JKNA 1UT2A 1USQA 2W5PA 2JKJA 2VERA 1USZA
chains in the Genus database with same CATH superfamily
1XIWA 1G9MC 2F74A 2DQIL 1XSIA 4OD1H 1A9EA 2CLRB 3SO3C 3US9A 2DJ4A 4F33A 3GMRA 3AG1B 4HHAA 3ZKMC 1UTDA 3RTQA 3H85A 1YDPA 4PG2C 3AQDA 4KHTL 3ZE1E 4MD0A 1HHGA 4AH2B 5GGQL 4WF7A 1A4JA 1V7NL 1KCKA 5EZIL 3D85B 1FVEB 3UZQA 2EICA 5SWSD 5F7MC 2GITA 2HTKC 3T2NL 5F2FA 4WWKC 1FE8L 2XXCB 2JLLA 2FVNA 3Q2VA 4XT1C 2C1PB 2D7TH 2DWXA 2VDKL 3REVB 3T71A 4L5FH 3ZLQC 3P4LA 2NNFA 5JUEH 5L9DH 2DIEA 2CDGB 3O81A 5J1AB 2J20A 1DZ0A 4DP5X 5M94B 4JO2L 1HKLL 2AS5M 1LO5B 3L5IA 4NZTL 5AW2B 2PXYD 5CWSB 3DX8B 4QJ3B 4U6YB 4J8RB 3B9KB 1MCCA 3BFWA 1RSYA 5D7SL 4YHKL 5KYUA 2D0FA 3I50L 4G6JH 2ED6A 5DMYA 4L4VE 4QHMB 2AVGA 5EUKA 2DKMA 2QQKH 2JVUA 4NC0B 2QSCL 3UTTD 4BUQA 3QDAA 1M53A 5AW7B 3H9YA 1QSEE 5TDNB 4BKTC 4UCFA 1ESOA 4YFLF 1XF5B 4P06A 3UG4A 3Q6FB 3KWVA 5I1AA 4G80B 5FYLD 1T22A 1V55B 2AXJA 4RAUA 1IM9B 2Q7YB 3QZNA 4AWJC 5IB2B 4P3DB 3ALXA 1MFEH 4HH9B 4QY8A 4ZS7L 3ZYIA 3VTAA 4AVKA 4DOHB 3RJQB 2EIKB 1WG3A 4AEIL 2DL9A 4PB9H 4PP2A 2P5WD 3L7EA 1WZAA 1MG2C 3MTRA 5AW5B 4QRPA 5G5DB 4EQ3A 1OTTD 2DF3A 3Q06A 3MUUA 5I1KH 2ZSWA 3FBQA 4NO0D 3L5WA 3SYPA 1T7XA 4IU3A 1DQVA 3MO1A 1Q9WB 1WIOA 1FFOA 1QWNA 4EMZA 4KROC 3IMWA 4LLUB 4G5ZL 2IGLA 2FL5A 3I9IA 4S1QH 1ZGLP 4YXKL 4XMKL 4M5YH 4O58H 5KANI 2ORBL 3BVWA 2X10A 3FYEB 5HHOD 3CX2A 2WTRA 4PB0H 4DN3H 1RZJH 3VWJA 2OTPA 3V5HB 3DGGA 3JTSA 3L2MA 1ZMYA 4X9YA 4M7KH 1CFTB 4MVBD 4YZFF 5DDHA 2VLKB 3I75A 4IRSC 1MEXH 4YHIA 2EYSA 2EKSB 5E8PA 1MKFA 4P2QE 5EBGA 4UBDC 2HPOA 2X4SB 2BP0A 1M7UA 5E4AA 4JVPA 5BUPA 3HG1A 2OAAA 3Q43A 1GYCA 4XBPB 2X5PA 4EXPX 3FMGL 5DYOB 1Z3RA 2VDNL 1CICA 1M7XA 3EDKA 3EJQA 3U1QA 4QRRA 5C0JB 5IW1A 4HJ0C 3S3BB 4JY5H 1FO0A 5C2BH 1IGML 4HK0A 2BSRB 2LABA 3B5GA 2WOYA 3S7GA 5EOQL 4QXGH 3K2MC 1MW2A 3K0WA 4EN3A 1MCKA 4LKCB 1F4HA 2F7QA 2ZUQC 1U0QA 3EF7A 4XR8C 3HZVB 4BQ6A 1V3JA 2AJUH 2VISB 4G59C 3BAYA 4FJ6A 4RGOH 3VG0L 3HLAA 3D0LA 4GO6B 1N5AA 1Q1JL 1JD7A 1ETZB 1MF2L 1YPZA 3VFMB 1AP2B 1NUNB 2VXSH 5DRWB 3LVTA 2CO7A 4XPHL 5MEQA 3LDBB 3EDEA 2H47C 5LGKA 2WCSA 1KB9J 3VD2A 4HULB 1L6XA 1YA5A 2G2NA 4RMQA 4WI4A 4AQEA 5I76A 5DEGA 3NCJL 2H6UA 3HN5A 5CSZA 3STLA 2EP6A 4N24A 2NY2C 3QO1B 4NKOA 3AT0A 3L9BA 4W9FC 3PV6B 2IIJA 4M5TA 4JLRA 1A1MA 1G0XA 5H2BB 4IDJL 2YUVA 4P59H 3T4YB 2JWYA 3EH1A 2BVYA 1P1ZB 2NZ9D 2PO6A 1S9XA 2H4EA 5MI0B 3ZK0A 4R4BA 5IOKA 2QKIC 2VC2H 3AREA 5ESQB 4P05A 2NLJA 3TT3L 3GJFH 3SKNB 2X0WA 25C8H 1XTMA 4LP4A 1P5VB 4I5BB 1QRNB 1QTPA 3IWVA 4ZFFA 4UOW1 2GFBB 2Y72A 3T2PA 1O5DT 1FZOB 1IEHA 2EC9T 2RR3A 4CGTA 4R5XA 1ZT1B 1Z0NA 4ZUVB 5DWUH 1KJ2H 1ZCRA 3IETA 2QHRL 1BMGA 2IQ9H 4WI0A 5GGRA 3FCTA 1LE5A 2LV4A 2H3KA 4XO9A 4X4ZA 3TXAA 3Q0HA 4X6CE 5HI5C 2V3DA 2ZT9C 1JGVL 3BVVA 3BAXA 3CC1A 1B0IA 1NBYA 4V2BA 4DFIA 32C2A 1HT6A 1YNLH 4GBXA 2R2EA 2CIIB 2VDQL 4NSKA 1I9EA 4YBQC 3UDWC 5DI8B 3C60C 4DP8X 4QRSA 4ZW3A 3INUL 3VXNB 4XVOA 1S4IA 2WVVA 3S6CA 3NCMA 4FTVB 3TEXA 1TVDA 3CU1A 3QJQB 1WAPA 1KULA 4MQ7B 4MKTA 5C0CA 2PTVA 3BSZH 5IUCA 2CO2A 4NFDA 4X6DB 2D8KA 3BP5B 1C5CH 3G6DH 2FATL 2ROXA 5I6PA 2ZYIA 5EB9A 1KGWA 4FXKA 1HAWA 1XH2A 2EDDA 4MD4B 3EOAB 4XP6H 2M8XA 5JQ6L 4G8FA 4J8QA 4K3DL 1KDIA 4XX1E 8PAZA 5I15L 3HAEH 2FYYB 1H3UA 1JI1A 4RLDA 4C83A 3KS0H 2P5EE 5E1HB 4YWGL 1JAEA 1HCVA 3A5VA 4ZO8A 4U4IA 4A7VA 5LQBL 5LN8A 5KSBE 5HPMA 2W9DH 4OF6A 4YUEH 4CVZA 4MA8L 1OE3A 3A67L 5FA3A 2HRLA 1IFGA 2WIMA 2X2UA 3O4LE 3OAZK 5HGDA 2D73A 3FF8A 3S4SB 2EZ0D 3HPJB 2XLLA 4XAKE 2FDBP 3NBNA 3IDIA 1QTSA 3ZDWA 1TETL 1EZSA 5BQ7B 5HDLA 3MLUL 4XP9L 3QUXC 4NX0A 3TCXA 4RISL 3V5DA 1DEEB 5B1JA 5AW0B 1D9KC 1QATA 2BJMH 4QCIA 3BWAB 4MHHG 5FUZL 4G6KH 1HK6A 4MD5A 1FGVH 3KHQA 4UDTB 3MPCA 1BBDL 1BIHA 1UWXH 2E76C 5BW7C 3ZRCC 1MI5A 3B8YA 4UQDA 4AITA 4WI8A 4JE0A 1JFQL 1JPTH 4W6WB 4ABWA 3ABZA 4OQ1A 2WIIA 4Y2DA 6CGTA 2FBRA 3F2LA 4P5KA 2K4AA 4X7DC 4HIIA 2VLLA 2IPTH 4HETA 3ARBB 4XN8A 3G08A 3MODL 1E7VA 4PLNC 2CBMA 4TUKH 4YPJA 1MAJA 5GXBB 1DLFH 4XNMA 1F11A 5EIIB 4Q74A 1HL9A 1YAIA 3WLBA 3LYRA 1JN6A 1IM3B 4DUXA 1OZTG 2JCWA 4PYGA 4LHUA 3HB3B 3FAXA 3EW3B 2R4RL 1ZHBA 3OKOB 4F93B 3DX6A 3JVGA 3PAYA 4ANWA 5CEXA 3ARVA 1C8QA 1EHAA 4FP8H 4AQ1C 4X6DF 5JW3H 5L8JB 3T0XA 2HN7A 3TLRA 4MZRA 3A3YB 2CGRL 1KCWA 4TULH 4YK4C 2JELL 3ET9F 2WNKA 2MQ3A 3BWUF 3N9GH 1YUKB 3OLIA 3HNSL 3ESUF 1NMBL 2DICA 3B83A 4J27A 2F5BH 2FJFB 5GRJL 4EAEA 3DVFA 4A6YH 3O8XA 2K78A 4B96A 1LP9A 3EZJB 4M48L 2AABL 2XZZA 4LQFL 4NQSA 3HC3H 3H9SE 4UF7C 4EIZC 1NAMA 4DFHA 4OFYA 4QYOB 2IAMB 2FT6A 3TIDB 4DP2X 4HUVB 1HYSD 2PW1A 3SOBH 1S5IL 5FV2A 3WY2A 4Y5VA 3QDGB 1NGZA 2E7BA 3M17A 4PV8B 2ZCKL 2DWYA 2WXIA 4HJUA 4OW6A 1QYGL 3LIUA 4XO8A 4XAKD 3JSSA 1PCSA 5I73B 2DQTH 4FNLL 3K74B 3DRTB 2VL5B 3NAAH 1BBJA 2IBGA 1QI4A 4XC3L 3ARFB 3BUYA 5JYLA 1E5YA 3QIWB 4N85A 1OKEA 5CCKL 2X9XA 5ANME 1GS8A 2GJ6B 3BEVB 3HMWL 5DR5H 5T1DH 3DXAD 4ZMOA 5AENA 2KDGA 4WY7L 3L3GB 5KSAA 3QARA 4BV1A 4LFHG 4MCYA 3MRCA 1BQHG 3B9AA 3OD3A 4FQIL 5E8EB 5A3ID 3ES6A 2BVTA 3QQ3B 5E9DB 2GUOA 3CN4A 2C3HA 3GHBL 1NFKA 2IDQA 2X89D 1A1OA 3G6JA 2NY5H 3E6HA 3GSWA 4L4TB 4HUUB 1KGJA 3S37X 4K23L 4R2GB 4WFFE 2GBVA 3RAJL 1OSPH 2OP4H 4YHML 5DD3H 2AXGA 2ZCHH 5IB1A 4HUKB 1QI3A 2E4FA 4L37A 1LO3H 2E7MA 3VCLA 4L8DA 5DD5H 3RGVA 1IIIA 1JNNH 1J5OH 5I1LB 3VA6A 3P40A 4MBOA 1MW0A 3VWKC 3RVUC 1KWKA 5IVZA 2BNRA 3O6KH 1A6AB 5JW4N 4LDEB 2HMIC 3UTOA 1X5KA 1KTLB 3I02B 4OCRH 3K1KC 4KRLB 2EDMA 5I2IB 1CFQA 3POCA 3QEQD 1KYOK 1DJGA 1KPVB 4JQIA 2IH8A 2P8LA 3OAYH 2A9AA 4KAQL 4NFBA 5E6IC 4ZQKB 3RWGB 4P9HH 2AJVL 4UTBL 1Z7JA 4Z3JA 3CLFH 3JWDH 2ZOLA 3QPQD 2WYTA 5L7XL 2AXFA 1NJ9A 1E9OB 4HU2A 3B3IA 5T3XE 3LSOA 5IP4A 1JXJA 3H42L 3BKJL 3Q9PA 1AMXA 1FZJB 2UZPA 3K7UA 3FN3A 1EIBA 5SWQA 2ISDA 1UT1A 4D9QD 3WIFA 1EFXA 4XNQB 1FRGH 3P0VL 4WEMB 5GHWH 1RHFA 5IT2L 1P4IH 3IJSB 4E9LA 5JW5B 4WIQA 3AY2A 5I16A 3LKSA 1N12A 2BC4B 3RDTA 5IMKB 3FQWA 2V8MA 3DDGA 5ACMA 3IDYC 2WQWA 2G0KA 5H37G 2NTSP 1R3LA 1SRDA 3SDCD 4GQQA 1KIRA 2V9QA 3VRJA 5IIEB 4OLUL 3MVSA 1D5ZB 3FT2B 5FM5M 5JPNC 4IBWA 2GC4C 4M7LL 5ERWB 5E5MA 2A9DA 1ODAA 2YBRB 3IDMB 4JANA 1HQ4A 1XH3B 4G8GA 2BVQB 4ISVB 2Z4QA 2Z6FA 4WFFD 4YLCA 3SE3A 3ULAB 1BLIA 3BH4A 1HHKB 1WT5A 2A83A 4DKDC 1JGIA 1QLEL 1FFTB 2NY6B 4AI7A 4HJJL 2CUIA 3PXHA 1TYJA 4GRLD 4W81A 1BPLB 3L3HA 3ULVC 3CSGA 4HIEB 4PRPD 5IBLC 4G9FA 5BJTB 3NQIA 5F1OB 1VAHA 1I7ZB 1EZLA 4FXTA 5C0IB 3R8BB 5C2UB 5KVFH 5EZLB 1E7UA 2VAJA 1XF4B 3UTZA 2LU4A 4X5XA 3QUZD 3SE8H 1TQSA 2F54A 4APQA 4XNYH 2CBOA 4PJXA 1M71A 1RSFA 4R7VA 2ZOWA 2VLRA 4FN0A 4ZAKD 4GLRI 1X5ZA 3JUZA 2IVFC 3SKUD 3LNHA 1CDYA 2G9KA 1E4JA 4G7YH 3IEAA 3PPSA 4I85A 2B4CL 5ISZD 1UWEH 4YHOL 3C5ZB 4OM1H 1E9QB 4NO2B 3DX7B 1TZHA 2EC8A 3QR0A 5DTFA 5C0AD 4BSWA 1SFHA 5T3XD 1BIIB 2IADB 4MMYA 1QLRA 4HX1A 4IBVA 1SBSL 4KNTA 1WICA 1BXUA 1NA8A 4HWNA 5E24E 4YZFE 1AGDA 2ATPA 1KPUB 1IFHL 3LZPA 5HD8C 2HG0A 5DCCA 4MKMA 4NUJA 3C6SA 4HUXA 3GK8L 4FL4B 3FRPG 1OK0A 4C4BA 3DX9B 3QYMA 3O6FD 5F1IB 5J6SA 1BSIA 3BMVA 5KVEH 3QG6B 3WXVH 4LPVA 4NO5B 3K72B 1WZ1L 3P4MA 3AU0A 4AVIA 4GJTB 3GJFK 1BVKB 3KNBB 5K9JH 2J43A 2CDEB 1JWSB 4BSJA 4Y4HA 4BH8A 4UM9A 4GUOA 2BLFA 5D1QD 4K8RC 4DKEL 1WF5A 1FZMB 4EI5C 2Z91A 2I9TA 5FYKE 4FI6A 5E7FA 1FO0H 1J9CT 1JGEB 3CH1A 3PL6A 4S1RL 5L88H 2M83A 3WE6B 4NT6B 1J5DA 3EYQC 5EN2B 4O2CA 3QR1A 3ELAT 5CGYD 4D3CL 3RWEB 4NZRH 4AM0B 1UVQB 2BVEA 1PEWA 2J8UA 1NL0L 5D6CB 3SSGA 3QORD 1LILA 4QD2E 2IG2L 3I9AA 4D94A 1KFGA 2AQRA 5GGVL 1FL5B 1X5JA 4WJ5B 3IJHB 3M1BB 1S7WB 4LBAA 3U7AA 2IBZY 1KLGA 1MCHA 1VENA 5CZXD 2XKNB 2AJYL 2X0UA 2OYPA 1U3HC 1FORL 4KTGA 1J5IA 3FUJA 1BZDA 4B9KC 4LARL 3F6JA 1JUFB 4BZ1H 5F8QC 3D39A 5JPMB 1I9RL 3V0JA 1SJEB 3GLAA 2Y3AA 4MMXB 1DZBA 4N3UA 4N8VB 3LKNA 2N7SA 3PYCA 4PMEA 1PBYA 2VRKA 1XCQB 1IBHA 3BE1H 2XXGA 2VLKE 3SPVA 4JRXA 1BZ9B 3FQUA 1RJZA 2CA3A 2O6PA 5IHZB 1WFOA 3ATBA 4MA3A 3BW9B 2VR7A 4XAWL 3UROR 1NWPA 4N0FA 1AS8A 5HY9B 1T5XB 1Y6MR 4JZJC 2NY0D 3PGFH 4WHTB 2B9AA 5IB3B 4S2SB 4LMQE 2W07A 3IAPA 2XWJA 4F1ZA 3PAZA 4MJIA 3QG7L 5GGUB 4ZDHA 4PS7A 2MJWA 5GSRB 3EJZD 5F9WC 2EH8L 3FAWA 2APVA 3TASA 2J25A 4CMHB 3QWOB 3LS4H 4MGXA 4POUB 5IK3A 1NSNL 1V27A 3VXSA 1E27A 3QIBA 1WAAF 4HC1L 1VEMA 5FYKD 3DX2A 4B95C 4ZD3L 2QDWA 3RFRA 1BCIA 1U6AH 2VIRA 4FQQA 2E9BA 5D7JB 3ZX1A 2Z1PA 3BP4A 2Y4SA 1R17A 1P6AB 2EO1A 3QDJB 4E9TA 1GVIA 1UWXK 4E9RA 2PWEA 4ODUB 2CCVA 1V3MA 1BFOA 3CFKB 3BGMB 4S1SL 3ZPDA 3WKQA 1IGTB 4PJAB 3MA9H 4YR6B 3CSPA 1I1AC 1UD4A 1F5WA 3CXHK 1JF6A 1M7DB 5T3ZL 4DEUA 2DWTA 1P2CB 5I8OL 2HLEB 1G1KA 1UOVA 3Q8FA 5FX3A 1W8NA 3IDXH 2OI9C 1JNHB 3KPPA 2I9LA 4JFFB 5I1EH 1BXAA 1CE6B 1NINA 4CSTA 2X4PA 4O2FA 3ZQ9A 3NN8B 3ULUL 1YEJL 4Q4IA 3UBXG 1CD8A 5EBMB 4OZIE 3ZL2A 1MWAB 2CBPA 1IBGH 3RNQA 1DBAL 1SLXA 2XBDA 3N1PC 1H8LA 2VXQH 2QKSA 5DFTA 4YIQB 5C0NC 2UZYA 4JFTA 4ABUA 1T1XB 2EC9U 3RPIA 1NLDH 2K6WA 4N2NA 2YEZB 2A6JB 1QRNE 5FDWB 3TO2B 3OHMB 3QPKA 3LNEA 3QZPA 3PJSB 1D5MB 3U1SH 3RIAK 4FFWC 3E0GA 1VFBA 3FH8A 4FLOA 4P2RE 2X44D 3MRHB 3MREA 4BRVA 2V7NB 4LF3B 1CI5A 4H1LG 1K4DB 4C55A 4N1CA 2C8NA 4ACPA 2A9NL 5J6GB 2D9QB 2D3VA 4AJWA 3MN8A 4UTBA 1AG0A 5DJ0A 5CAYB 3S8GB 5CEYA 4LCVA 5AW9B 3T0EE 1IUZA 4YL9A 5D5MB 3J8F7 2AXWA 2IGFL 1YYCA 3DI3B 1QSFB 2PTTB 4AJVA 1YEKH 1Z9LA 2VH5H 3ESMA 2GTZA 4FNQA 3EYUH 4NQCA 4U7KA 5E1AB 3IN0A 2EDHA 4G8EB 1UJ3B 5E1IA 3LD8C 3FU5A 4I18C 4XBEH 3HE7D 2UUDH 5EU3A 4Y4KD 4MXWL 2EDBA 4PJAF 5D7IB 2NY7H 3MBWA 3X13B 5EC1B 3UTPE 5IV2A 4OZHA 3IFPA 3MRJB 1P7QA 2G75B 2KHAA 4NC1E 5F0MB 3RVXD 3NTCH 3SDXA 1VKXB 1H6TA 3SZ6A 5AG9A 4JREB 2ITDB 1M6OB 3FN0H 4WFGE 4X6DE 5E0QA 4NWTH 1X44A 1ZV9A 3MJGX 2EYRA 3MBED 2ZOKB 5L0QC 4KK8C 3OMNB 4QXVA 4LAQH 1EK3A 1UATA 4ZUUA 1VPOH 3ARWA 3SKJL 3QNZB 1SHXA 4RGNE 1HOCB 3F7PC 5F6IB 2XWZA 2Y7QB 3DVGB 5DU7A 2CK0L 4I8DA 4UI2A 3G04B 2QQNH 1XD1A 2D7NA 1LWJA 2OS7A 1PJ9A 1AXIB 4MS8D 1S9KC 2MHAB 3II3A 3CN2A 2E75C 2UXFA 3UBGA 5ALBH 3ARDB 1XGYL 4KRPC 1YSOA 4HOMA 3F01A 4U1SB 3WFDL 3QUMB 1IGCL 3FQYA 4B3EA 1NAMH 2JI1A 3FSAA 2RQ8A 3CZGA 2XKSA 1W72L 1I9IH 3LTVA 4L9LB 1K3IA 5DJYA 1TVBB 5EOCH 2HB0A 4TQEH 5I1DB 4Y0GA 3ARYA 4P2RD 4D8OA 1UM5L 1PAZA 2DWDB 3B9VA 4YHPB 4YQXH 5IOPA 1CIUA 1LEKB 3TA3C 3S3SA 2QGEA 3P77A 4GLRH 3HR5B 5KTEH 2PPFA 3KPRA 4DZBB 5D5MF 3OAYK 3G5XB 3MLYL 3MUJA 3ME0A 4RAVB 4X5WA 5E8OB 4KY1H 3UAAA 4LOUD 3T0ED 2WVUA 2M26A 1BF2A 3IK2A 1DUZA 1S7TB 3ZHLA 4CBZA 1TSRA 3FONA 4GSRA 3PWNA 4X0KA 3SDDA 2XZCH 3H9HA 4LPUA 1AC6A 4DVRH 2NUPA 1EXHA 1GAFL 4BUHA 1OGAA 1CQYA 1JE6A 5AFAA 4NHUA 5HVHB 4X7TB 4FCAA 1ACCA 3UTPD 4JZNB 3DV4B 3B1TA 3L8QA 1CXIA 1Z5LB 2IGTA 3MSPA 1B4LA 1NGXB 1TMQA 3J27A 3MR9A 3QNYB 3AU1B 3OR7A 3RGHA 3D3VB 3QYNA 4CC4C 4DH2A 4OLXH 5EBWB 1K5NA 2OM5A 3T09A 3LPWA 3SOTA 4K7PL 3Q44A 1BZQK 4HFWB 2AEQH 3RZCB 1XB6A 2VM9A 1U8OB 3IFLH 2WKLA 1YLBB 4XGZB 4JFEA 3PWLA 5HDBB 5B1AB 3BH9A 5C0BA 5ICXA 4ES9A 1OSZB 5MENA 5BVPL 4M8UA 5F9OH 1RZFH 3L2NA 1TQBC 4OLZH 4WSGA 5D9SB 4G1EA 2CNYA 4P5TA 1MZZA 5C3IA 1XEDA 1PQZA 1IBYA 2F9BT 1ECYA 4LLMA 4IEFB 4OLYH 3V4VL 1N8ZA 4LDLB 3K4DA 5AVQB 4JFXA 1PIGA 1G7MA 2MQCA 4FG4A 1KYAA 5C8JB 4NKMB 2P7TB 2VMEA 5F3BA 3EGSA 4YZWA 1KGCD 4HPYH 5IFJA 1F4XL 4Y7OC 3HZKB 3RP1A 1D5IH 4AYFA 4XMPL 2GJ6E 5HYJB 5HHPB 5EPMA 2JI2A 4XCEB 1BZ7B 2AV7A 4H8QA 1RFDL 1TJIL 2A5UA 3SE9L 3S88L 2V7HA 1N59A 5BZZA 1A3QA 1FYTB 5D6DC 5HHNA 4PBXA 3KEHA 5E9DE 5JHDD 1HH6A 2E6QA 5IMOA 2B20A 1RU9H 4AQ8A 3UPRB 1G84A 5DRXA 5I30L 4L4TE 1LE9A 4KZEH 1T2JA 3T4AB 5BO0D 5E08H 2L8AA 1S7UB 1U36A 3WLWC 5TQ0H 4X99A 3H3PL 4PJBB 4TUOB 5DMJB 2EECA 1QLFB 2EIBA 2V9RA 4HSQA 5INDA 5HI4D 3UGEA 3GIZL 1FBIL 2CCWA 3CFCH 4POZC 3S5ZA 3TX4A 4Y9EA 2COVD 5A6IA 3BJLA 1WYJA 4PIBA 3IGKA 4PREA 4ZUSA 4NOFA 5C9JA 1NCAL 3D4YA 2BINA 3ML9A 4JQXA 3DHMA 3GJEA 4XN2A 1KZQA 4ZXBD 1K8DA 3GMOB 1FG2A 2AC0A 2BY3A 4HC1A 1INEH 2VDOL 2QSTA 2OZNA 3VXQB 1ZHLA 4JG9A 3F84A 3WJMA 5ID0A 4LQ1A 3EIFA 4JPIB 1ZDQA 3JVFC 2AEOA 2JKIS 3TWCL 2ED7A 1G0YR 2UZXB 1ZLUH 4GMTH 5EU6E 4LSVH 4KITB 3MRFA 1KEGL 3MRMA 5DC2A 3E9UA 1WJ3A 3VSUA 5IQLA 2Y3NA 4S11A 4Q9QL 3P9MA 2OFQA 1CDBA 5I18H 1KLUB 1B0RA 3BQUC 1E30A 1ET8A 1VFMA 1W16A 1ZY9A 3LXAA 2WM0A 4XXCA 2ZX6A 3VXTA 1PY0A 4YGVA 5FOBA 2WUBH 3MUGA 4NZJA 3HE6C 2ZUTA 1DJXA 2R83A 5DEZA 1KJVA 2YGOA 4GRMB 5GRUL 4LL1A 1E4XI 1EEYB 2VKWA 3ZDZB 2A9CA 5LG6A 2BVOA 1CL7I 1U91A 4AL8H 4OUUB 4UTCA 2EDOA 2JKNA 3MHZA 2B16A 1SXSA 1ZHNB 1KMGA 5D7LB 4UNIA 1RZGB 2C9UA 2K6ZA 4PJBF 2A3TA 3GIVA 4D8PA 4ZMVA 2Z8WC 1CGTA 2V17H 3VFOB 1KGIA 2WLHA 4N25A 4X5QA 1RL1A 1R5VB 2GVYA 5I75C 4J3WA 3B34A 4F5CA 1HINH 1Y6NR 4XNAA 3J7HA 3MZTA 1CTNA 1NCUA 1M7IB 3RWDB 2Q86B 4PRIB 2AQ1A 2YC1B 2E86A 1H3GA 1LO0H 2WJ7A 1HKFA 2YD5A 4ODVH 4PJ5A 3QJHB 1SQMA 3S3CB 4KWUA 4QMEA 5KEZA 4JMNA 4HISA 1BHGA 1NEZA 1KT2B 2K45A 1I1FB 3DX4A 2NUTB 3O6MH 1U95B 3LZNA 1VESA 4F8LA 4MAYD 2AJZA 2HT3C 3UPAA 4ZPTA 3U0WL 2ARWA 1EJOH 3AG2B 3QIUD 3EJCA 1IEAB 2F19L 3QULA 1OM3H 4OFIA 4DJMA 3GJFB 4CAGA 5C6PB 5H4ZA 1JV2A 1KWGA 2HYMA 1KV3A 1H3WM 4LGPB 3X3FH 1Z1WA 5F88A 4Y5XC 2A6IA 4PI2A 1DJYA 3SPIA 2HFEB 1K9TA 1B4JL 2HT2C 5CMAB 2X4NB 2CO4A 4KKQA 4UWQB 3V4PH 1G7HA 2P3YA 1KJ2B 5IKCB 5J9PA 5BRZA 5JW4R 1PKQB 3MRBB 4N0CD 2K8MA 3QZOA 4P5SA 1OB1A 5EO0A 2MH4A 1AVAA 1TVHA 2XN1A 3P11L 4NLAA 5E6SB 3ZDZF 1XV8A 2LGNA 5DGQA 3IU3A 3EYSL 4EBQH 3D50A 3VYPA 1XL4A 3MRIA 4IMLA 3QWRD 15C8H 2EABA 3I74A 5TF1L 1XF1A 4K5OA 1RZ7H 5EU7C 2E9JA 2EDKA 2AAVA 3MRLB 3OKLA 2FJHA 4NM8H 4X4MA 5FHAH 2WHVA 5IHWA 5J0BA 5C6TH 1W72A 4XB8A 3REWA 4YLQT 1NCTA 2KH2B 3SYOA 1H5BC 2QR0B 2Y5QA 5F21B 3MU3A 1R75A 1RURH 2WLLA 2WXHA 2O5XH 3L45A 2G3NA 1WAAE 1L7IH 3AXLA 2K0RA 1IBFA 3NEXA 4L4JA 4PQXA 5JORB 3CE1A 5ENWA 2AK1L 1N70A 3IMRA 1FN4B 4KI5E 3WNJA 3DHPA 4Z5RA 1DFBH 4ABQA 4DUWA 4NGHL 1ES0A 3T65A 3BRGC 4NN6B 2IJ0C 1QVOA 1ZT4B 4OGXL 2HJKA 1LO4L 2YLHA 4H8WL 1BREA 2EXYD 1DDTA 3FQTA 3HAEB 4PJ8D 1WA0X 4HWEH 2EDWA 2G5RA 1I8UA 2YUZA 3VXMA 5DD1L 4PRHA 2G2RB 4PFEA 5DJAB 4LCIH 1FPTL 2HJFA 1N19A 3EJYD 4WGWB 4Z1PA 5F44A 2J72A 2R2HA 2UUDK 4PP1C 1J0YA 3RU8L 5BS0D 1OL0A 3GSNA 4ATTA 3PP4H 2FQFA 2QV2A 2OL3L 1CFVH 4AIOA 5DFAA 2R23B 4CGUB 1J1PH 2GJZA 2DYRB 1H15A 4I3GA 1CG9A 1L9SA 1A8ZA 5F96L 4OSUH 2Q8AL 2DLFH 3JQOB 4HIXL 2GAZA 4HBCL 5CM1A 4GAFB 4X8JB 3EH2A 2YEVB 5EZJB 2AKRA 3AFLA 2YD4A 3B9EA 4F1SA 1ERNA 1Z9SB 2CALA 1VFUA 1ZJAA 2IPKB 3IM1A 2AXHA 1OAZL 1YZZA 3KH3A 3HC4H 1WH0A 3WHXB 5F7HA 3BMWA 2FR4B 1VA9A 1KBGL 3MX0B 5DFVC 1JZEA 4HXBH 4WRLA 3V4VA 2R0KL 3A6OA 4PS4L 3TPUB 4JO4L 2YKKA 2OW7A 3T77A 2XYBA 5E23A 5C0RL 2VJ8A 3MBXL 4GQ9H 5FB8A 5SWSA 3UJTH 4BBWA 3ARGC 1PG7L 3AABA 5BMFH 1I3RA 1IC5H 3O4OB 1CB4A 2PCXA 5L2JA 5LWYL 2XVKA 4MNHB 1R3IL 2BOCB 2ZX9A 2XTJB 3QDJE 5I1GL 2ZAIA 5ILTH 1FCGA 3SB3A 4KI5D 2IPUK 4J6RL 1VFOA 1WBZB 4OJDH 3WMQA 3FS9A 1ZPUA 4QIRA 2ZXEB 4HGWB 2H2SC 4W1TA 4UT6L 4PJAE 1HZHL 4A6YB 3KYOA 2TSBA 1JK9A 2WYHA 3AQYA 5AD0B 4BDVA 4G6ML 3LH2H 2RD0A 4HBQA 4ZO7A 4AEEA 2LAAA 2I07A 2I60H 3C87A 5CP3A 3FDWA 4PPTA 4XPFH 4PD4J 2PR4L 2A4EA 5EFIA 3OB0H 1RIVH 4L3EB 1BM7A 3W0WA 2NX5D 4N87A 3VJ6A 3L5XL 1U8LA 3BLPX 3IJ8A 3HEIB 2F15A 2PETA 1DSFL 2VYRE 1JZ3A 3QUYC 2ZQKA 5C07B 5LNDA 1Q9LB 3U2SB 3VFVB 4YE4L 4YNYA 4NRYA 5GZOD 4PWJA 5T1MA 3SN6N 2WXJA 1RPUA 3WKNA 2LQRA 1SM3H 2B1HH 2NYKA 3W9EA 2YPLD 3Q8BA 4QRUA 3LZQA 2GTWA 1RULL 5EF2A 5I5IA 2K70A 2EEBA 1X5AA 4Y1AD 5FXCH 3STZA 4PJDB 3RHWK 3LKQB 5DD6B 2X4OB 4Z7QB 3DBXB 3OJVC 1TQWA 4AJYV 5D5ME 2OXGB 5F0JB 1BJ1H 4K5MA 4A68A 4JPWH 3TEYA 2WVTA 3BZFA 1QSFE 3IU4H 2W0FA 3KYNA 5E2TL 5E6ZA 5B3JF 1OPGL 4FFYH 4M62H 1A14L 5BCAA 3FB6A 2P47B 4V1DB 4JFDD 4OCNC 2UYLA 3D25A 3QH3A 4KPHH 3QI9C 1OD9A 1AY1H 3LNIA 1ADQL 5AAMA 1CYWA 4K94L 2BMKA 3HN8A 1OV8A 1DQJB 4WU5B 4NCDA 2Y6SC 3PWJA 3RIAF 3TJHC 4M8VA 3CC5B 3TVMC 4TUJB 2X4UA 5C08E 3RWJB 1KJ3L 4XPTL 1EHLH 1E4XH 3TBVB 2Y24A 1DQIA 3E7JA 3QXUA 3MC0A 4I3SH 4UMSA 1A9VA 3A6BL 3MV7B 4P2OC 1QBAA 2MCPH 1L5GA 4K71B 2VXVH 3FTXA 3MDJA 3VFNB 2F74B 4JW3A 5I6NA 4L4VA 2OJ1A 1A9EB 4I4WB 4F33B 4UQEA 2JTDA 4BFOA 1YMHA 1QSEA 3NZHL 4MD0B 3V4UL 1D9KB 2WZ6A 3KYKH 1W0YT 1A4JB 1L7TH 1UH3A 3O41B 4JDTH 4PH8A 5E94A 3ZRFC 2ARJA 4CDGC 4IOIB 1ZSHA 2GITB 1NMAH 2CAKA 4AIZB 1OWRM 5E6YA 2ZP8A 3KCWA 4PJCB 4JY4A 4P5MA 5LGHL 4HJEA 4JM2C 4OGAD 1GYAA 4M56A 2PW2B 1ACYL 4YVNA 3BDXA 1U8HA 4KH9A 1RK1A 4DP7X 1HZKA 1MCIA 1AE6H 4PJDF 4AT6B 5DC4B 2GSGA 4Z7QF 5FGCB 5MEPA 1R0AH 4NZDA 4HCGA 2SEBA 1ZLUK 1J8SA 2ZCLH 4ZO6A 3U0TA 1DVFA 3WFEL 4X80L 4Q4EA 1EAPB 2YD6A 4KC3B 3UBXI 4B9JA 1F8TL 4AQ1B 5KYUB 1G7PA 4EXKA 1OCWH 2Y7MA 2VDRH 3MLVL 5EUKB 2Z93A 1HSBA 4Z77B 5I9QC 3P4OB 5EEZA 4QRTA 4YK4B 5F7KC 2ZOUA 2G9HB 4J28A 1MCOL 1MVUB 1Q9KA 4PG9B 5IJVB 5B38A 3R06B 1FNHA 4F7PA 1QTYT 1AO7E 1YEGH 1RUKL 2A73A 4G7RB 4HIHA 5AB1A 4RAUB 3RX9A 1TZ8A 1GOFA 2ZXAA 4KUCF 4QRFA 5C08D 2BIMA 2BNUB 3RILA 2B5IC 4P2QA 3VXUE 1WBXB 3MXVH 6FABH 3NCWA 3D3VE 2HH0H 3Q6GL 1E6OH 3QHZH 4PP2B 3L7EB 4QYAA 4LEXH 3SBRA 2VUYA 3F58H 3KJ4B 3WDHA 1KXVC 1UG9A 3IMVA 1ITBB 5DHVA 4NRXA 2YHGA 3HCVB 1LEIA 3L5WB 3LEYL 2AQNA 4IU3B 1H19A 2JIXD 4Z8FH 3MO1B 5IG7A 1UB5A 4BCYA 1M2OA 4XH2A 5FYJH 2UZIL 3U6RA 2PPEA 2W60A 2WUCL 1AACA 3JZ7A 4L5FE 7PAZA 4NQQA 1FJ1A 3OKYA 5HDRA 3WD5H 4PJCF 4UM8B 1J1XH 5AWNH 4E9YA 4MNGB 1WHPA 1IE4A 4A67A 1D3CA 2VN6A 4JG5A 4JPKH 4OBRA 2NXZD 5DA4A 1RJYA 4XWOD 2Z34A 5DDHB 3VU1A 3P54A 1BOGB 3K4AA 4WCYH 4LCWB 4YHIB 5H37H 5AB9A 4Q14A 5AG8A 4LSRL 1ZSDB 3P02A 4O02L 5HYJE 3QCUL 1WCBA 3HG1B 5IBTL 4ZNCD 1NCWH 1MPAL 1AJ7H 4HLJA 4ORGB 3AS2A 4KTEH 5F9AC 4QRRB 4RH4A 5IW1B 1XHHA 1AIZA 3IWUA 3OAUL 1JVKA 3TN0B 5AL8A 3FTYA 1FO0B 3V6ZA 1G1OA 3TNNA 1NOFA 3LKOB 3F7QA 4EO5A 3VWKB 1X4YA 4UOJA 1FFPB 4O00A 2VW4A 3RX8A 3ZO9A 1QW8A 3ZTNH 4PWEA 4EN3B 4W70A 4QDGA 1SY6A 4LLWA 3WDIA 5I6XB 1NLBL 2GEEA 4PJBE 1AO7D 3GDBA 3MRGA 3TBSA 3QO0B 5ACZB 1R47A 1W6WA 2I25N 3D0LB 1S9YA 1N5AB 2J1XA 4G7SB 2VLME 3OXRA 3SKOA 4OFQA 5J5EA 7FABH 1BG9A 4GT7A 3LRSA 4R90L 5DHYA 5F3HA 2NY3C 2P44B 3KPMA 4AQEB 2JXMA 1TU2A 1PLGL 3NJLA 2V2TA 3L2LA 2X1OA 1AD0A 1F3JB 4OB5H 3HA0A 3STLB 4FHKA 4OJFL 2GHZA 4LVNC 1N2RA 1OF0A 4NKOB 1CFNA 1XR8B 4X6CA 2ZOOA 3K0YA 4UB0H 1A1MB 5KBMA 1J5HA 3BFOA 1RP9A 3EH5B 3BKMH 2PCFA 4OFDA 1EXGA 4W9GC 4F7MB 1KNOB 3CCHB 5JHDB 1L3NA 3VYNA 3MJWA 3VD1A 4LB8A 2ZG3A 4ES8A 3P9WB 5I1HL 4MQXD 3QZWB 4R4BB 2PXYC 4PW9A 3HG2A 4P2YA 3IDYB 3CN3A 4TYUA 4XE0A 2EIDA 2NLJB 3KPSB 1G7QB 3KPLA 3GXFA 3KPNA 3IF1A 4ZUTB 1S3KH 1QFUH 1XB8A 4ZFFB 5JPNB 3N1QC 3MOAL 2VAAA 2XFXA 3DTXB 2BPBA 4H0HB 3IDGA 1HHHA 3IETB 4ZZFA 3UH8A 3ZDZE 1HL4A 4WI0B 3FCTB 1Y7VA 2ZUUA 3OXSA 5PAZA 2P5EA 1UM6L 3CDYA 4Q58C 1T3FA 1HI6A 5D7LE 5GISL 3BP7A 3I6SA 4XXWA 5KSBA 2JJSC 35C8L 2LVEA 3M45A 5F7LB 1NBYB 3ATFA 2XTLA 5C0DA 2F8XC 4ZNEE 3O4LA 4NZUL 1RJLA 1Z6JT 1OAQH 1OTTC 3L4TA 1WC7B 2AQPA 4GAJL 4ZUWA 4J7RA 5KAQG 4ANVA 4HSAC 2W95A 1R3HA 3ARPA 2UV3A 2DEXX 3PIQA 5HDQH 3MGTB 2WVVB 2HLFD 4MA7L 4PRIE 3UYOD 5CGMA 2EIJB 3LX9A 4XBMA 5CSGA 4P8QA 3VI4A 1BAGA 1TQUA 3GZKA 3ZMNA 2W0KA 1NC2D 1FH5L 5EF1A 1SHMA 3L3KA 5K1JA 4F9LC 2Q9OA 5JIHA 2OBGA 4XP1H 1KCLA 2X0VA 2YRPA 1T83A 4Y5YA 1A7RL 1LJMA 2DQEH 4PR5A 4PTUB 4FXKB 2J1KA 2WXFA 4UNTA 1CZ8L 3DURB 4WFEE 2X89A 3KWWA 5AB2A 1JNLL 1GC1L 3M7FB 3NABL 1JTPA 4P46D 2KZWA 1U92A 5FKPA 1XMWA 4HKJA 1G6RH 4C83B 5DK0A 5DS8A 5DK3A 5FO8A 4OCYH 2PYFB 1FNFA 3BO8A 5IHBA 3HZMB 4CVZB 2RQEA 5IR1A 3FTWA 4F7CA 3P3UA 3KLAB 4LLYA 5HGDB 4KKAD 5TH2A 2XG4B 5GS1C 1PKQE 1L9MA 5CINL 1U8JB 5D1ZD 2O6CA 2YAFA 3OC8A 4KK6D 2D03H 4IBUA 3NGBC 4H88L 3BUPA 3A23A 3OB0K 3D9AL 4DETA 3R1GH 4EI5B 5SWZD 1UXSA 1K4CA 3DI2B 1JZDC 4MD5B 2YN3A 5TGBB 2R69A 2KERA 4FQ1H 4DGWC 4ACTA 1MI5B 4NENB 4YDIL 1QNIA 4UMGA 1WE5A 3F7KA 1ZANH 4TL4A 3T1FA 1CF8H 3H9SA 4Y2DB 2GABA 43C9B 4O9HL 3F64A 4JFQB 3VDCA 4YSQA 4L18A 2NY1C 4CNIA 3TESA 5FOJA 2CXGA 2D9CA 4U1GB 1OCZB 1DL7L 5A2IH 1N64H 3VMOA 2Y6TE 3WEXB 2H32A 3APDA 4Y16D 2FQEA 2J12B 2HRPL 1A6TB 4G7VL 5TK2A 4MDJB 2QHLA 3BGAA 1MCWW 1HWHB 5JDSA 2DIJA 3KHOA 3GZPA 4WNQB 3TO4A 3WIIL 2VUOA 2R2BA 5CEXB 5ICZA 1E5AA 3O3UN 2HVJB 2FGWH 3DO7B 5TDPB 5ANMA 3K6DA 3UX9B 4U1MB 2FD6L 4PTTA 1X4ZA 4DKAA 2BVUA 1IILE 2EDNA 2HN7B 4Z0XB 3TT1H 4WWKD 4F58L 1TKWB 2HUHA 3EOTH 3ENEA 5CO1A 5D7EA 3O11A 4HWZB 2NSQA 2AJSH 2C3XA 5CKGA 4NN7C 4WFED 1E65A 1BVNT 4IHOA 2DYPA 3FO9A 1RCYA 3O6LH 2X6UA 1NAMB 5DUBA 3LZOA 4KHXH 4XB3A 4JZJB 1QABA 5CP3H 4Q97A 2E5EA 2EEXA 4X7CC 2IANB 1P4LA 4QUOA 4AC4A 1A6ZA 3A6CL 3O2VL 3JTTB 2FK9A 4H1LH 1TJGL 3DK0A 3V9FA 1YN7A 3TBYB 5E56A 4RDBA 4U2YA 5F9WB 2BP3A 1Z9NA 2B08A 4M6NH 4PRPA 5FA4B 1KCRL 1BBJB 3D2UB 5FYLH 4OR1A 3LZFL 3FOLA 5I5JA 2PO6C 4WK4B 1AGFB 2GCYA 2UXTA 3ML8A 4RZKA 3Q3GA 2X87A 4Z3HA 2IH1B 3EHBD 2F1AA 5I0DA 4PVLA 2ZYHA 3AREC 3QUZA 5KSAB 4JRFA 5GRYA 4JHAL 4RVBA 4X7SL 2VUKA 3ES6B 4MLIA 5IJKA 3X14B 3L4YA 5IW6B 2N56A 2GUOB 3IXTA 1OARL 2CLZA 3GB7A 4A37A 1I1AB 2VSKB 2E74C 3G6JB 1ZWIA 3E80A 4FZEH 4FXGB 4MRBA 4N1HB 4PW4A 4KXDA 5C0AA 4UQ9A 5B3JE 5IMMA 3HUJB 1IT9L 1KBKA 3C9NA 3WAJA 1PD1A 3MLRL 2MKWA 4OZFG 2XTJE 2RHEA 2AXGB 4IU2B 3VI3A 5IB1B 4NDMA 1EANA 3IJ9A 2FBJL 2ITCB 3KVDD 4L8DB 3P2BA 4IMKA 4OF5A 1C7SA 2ALAA 4O4YL 2MKLC 2W0LA 3PXLA 5IVZB 2WP3O 2BNRB 1RIUL 4AGPA 1C5BL 3C5SB 4LASL 4EUPG 1SLVA 4IRSD 3BEWB 4AGMA 3MV9B 4L3EE 5EEYA 3DPBB 4FULA 3AVEA 4LPTA 4UBDD 2XQ0A 2B3RA 2O72A 4KU1A 3FQ4A 4HKBB 4QF1B 4KXBA 4I88A 4JO5A 2APBA 1DQMH 3T6VA 4JCLA 3DUHA 4I0PC 4M7LT 2EIMB 4R7LA 1AKJA 1CXFA 3IKCA 4WUUD 5C07E 3N85L 5J13B 3NEOA 4HJ0D 1A4KA 2FUQA 5FWQA 5ALCL 5TE4L 4XCFH 5D2NC 1MHHA 1NAKH 1PCXA 1NJ9B 2AGJH 4GKNB 3B3IB 3UFIA 3LSOB 4K9EH 4IRJD 1GGCL 4NQVA 4LLVA 4FQ2L 1J1OH 1JG9A 4UT9L 3QC6X 3QORA 1QASA 4JJ5B 4KRNA 3WIFB 4RMRA 4HG4J 2WY3B 1DQLL 4FEMA 2E9WA 4XNXH 1I8AA 4XCCH 2ENQA 2CLRA 5F9JA 4WENB 5D7HA 3RDTB 3W2DH 1KC5L 4PJDE 5EF3A 3MLSH 1B2YA 4Z7QE 3Q48A 3NSDA 4AH2A 3VXRB 4P2CG 3CN0A 4FI8A 4XTRC 4DPBX 3D85A 1FVEA 1A3LL 2FIRT 4N26A 1CYXA 3A4AA 4K3HA 5A7EA 3TYGH 3VRJB 3CV5A 4WJG3 3HUJF 3A24A 1X5IA 1HEJC 1XGUA 3WIHH 1NGQL 4GB9A 1VCBC 2XV6B 4V1DE 2NY2D 3KGTA 4HHWA 5D1XD 2VSCA 3L1OH 2C1PA 5L0QB 4GSDL 5BUAA 3ZSSA 3REVA 1WHOA 4OLEA 3MJ9L 4GIOA 1RUMH 3K46A 3U7WL 3SEPA 5J89A 2CDGA 4OT1L 4ZTEA 2FQDA 4KUZL 4U7MA 3U82B 3L3HB 3DJTA 3C6EA 5A1AA 5CWSA 3MV7E 4U6YA 3RHWF 3B9KA 3MNWA 4KTDH 4M6ML 3ZTEA 3AXHA 4GMSL 3NCXA 1K3ZA 4I9XA 3UTZB 2BX5A 1P4BH 4X5XB 2FYVA 4FLRA 2F54B 1WWBX 4IKNA 1A7OH 4APQB 1FDLH 1CO1A 2NQCA 5AB0A 1XF5A 3L5HA 2J71A 3V6FA 1SUHA 3Q6FA 4ZX4A 4G80A 1BD2D 3TA3B 1PYWA 3CUPB 5DHVH 1IM9A 4TV3A 3IDJA 1TZHB 5J12C 4BSWB 4P3DA 4GIPD 4P23C 1E4WH 1OCCB 4PJCE 4HH9A 3VRLF 4CN4A 2GJPA 5HI5D 1A6WL 4IS6B 1QLRB 4HX1B 5JR1H 1VZGA 1G4RA 3O8XC 5CN1A 1DQTA 2R0ZH 2BFVH 3GS7A 1PAMA 1AGDB 2XZAH 2ATPB 4DK3A 4N2IA 4YBQD 1DQDH 2O6FA 3C6SB 4NEHB 4X6FB 1O9VA 3C60D 1UKSA 3EH3B 5I1JH 4Y5VC 3E2HC 2HXAA 4YDNA 5JXED 2E27H 4LSPL 1QQDA 5IJCC 5KBLA 2ICWJ 4JFHD 1URZA 2P4AB 3FW6A 4R0LB 3V0HA 1X5XA 3P4MB 3ZL4L 3PJNA 3PGDA 2WXKA 1ORSB 4Y4HB 5HHMB 4PLKC 4UM9B 5CN2A 1CFTA 1T0NB 3FQ1A 3N55A 2QTVA 1Z9MA 4QO1B 2Z91B 4PRAB 4PM1A 2E3VA 2VLKA 5T5FL 2YKLH 3CH1B 3GTTA 4JQVA 5KVFE 1M9SA 1FWXA 3SGJC 2A74C 1PLCA 2XACC 4XX5A 2Z7WA 5F71A 4NJ9H 2EKSA 4M6OH 5I19L 4GI8A 3KAAA 2X4SA 3H0TB 4OCSL 3TPKA 1ETJA 1XL6A 2J8UB 1SY6H 4J6IA 1UXMA 3MRRB 4XBPA 4DW2L 4NQTA 3NCCB 4JHWL 4UTAH 2ZWNA 5DYOA 2D7PA 4F7TA 2CUMA 4LNRA 4RRPM 2ERJC 3WG7B 3V52H 5C0JA 3MROB 3PE9A 1JPFA 1C16A 4GSQA 1JMXA 2BSRA 4ONOA 3BISA 4P2AA 4YFLI 4A2FA 3IPBA 4C54A 3QUXD 1T7VA 4KQ3H 2W5PA 4U3SB 1NC4D 1IV8A 3UTSD 3U4BH 4JHUA 4LCCC 4Y1SA 4EEEA 1MJUL 5D8JH 4EKXA 3UAEA 4LKCA 3V4PB 2ADGB 3MJ6A 2BSTB 3DSNB 5L2KE 1QRKA 2KMWA 4D0BB 4HVBA 3QAZC 2VISA 5CU5A 2JJVA 5IB2A 3OZKA 4L1SA 2O5YL 4FS0A 4MNGE 2DQUH 4DGYL 3LKNB 2YFOA 1ETZA 1FAIL 3D18B 2XETA 4Y4KA 3VFMA 4MCMA 1AP2A 3S35H 5DRWA 3BKCH 3N40P 4LXFA 3B7UX 4R97C 4BHUA 3SPVB 4LCWE 5KVEE 3SDCC 4DTGH 2G60H 2ZX5A 3HS9A 2VW6A 1CLOH 4U3HA 3D1MC 1S9VB 4G9DB 3GRWH 4B9ZA 4ZMZA 1H6FA 4U6HA 1OE1A 5ANHA 1OXYA 2HJLB 5E99L 4NERA 3US1A 2QV4A 1UD2A 3BDBA 3FPYA 5F7EH 3CFUA 3FUHA 2XWJB 3TJEH 2BIOA 3TZVB 1SVBA 3L17A 4P9MH 4ZDHB 5EZIH 5HI3D 4YHLL 5I6LA 4GRLC 4OZIA 4ZW8A 4K3GA 4FOMA 1XR9A 3D6GA 5ESQA 4ODSL 3FK3A 1PL3A 2EDEA 3VXSB 2IOMA 3NJNA 3QIBB 4LIQL 4MTMA 4WEBH 1T7YA 1P5VA 4I5BA 3RWHB 1QRNA 1X6LA 4GAGL 3WFHA 3BPCB 2RB8A 2GFBA 4H2CA 2WBXA 4JO1H 2YRLA 3BP4B 4FQJH 2HKHH 1FZOA 2PWGA 3Q9QA 3GMMB 1B3JA 4ZAKC 3TBTA 4P2RA 2MTPA 3U83A 4KDTC 5KW9L 5CILH 4ZUVA 5FGRA 1JZFA 3BSHA 3I6KB 1SYVA 1YCSA 3TONA 1DE4A 1MSPA 1YRKA 2DJUA 1E6JL 3QJTB 3T0AA 2JFCA 1F58H 3H3BC 4JEGB 4HT1H 3DARA 2DIAA 1EV2E 1EPFA 2YAPA 3BQUB 4BGLA 3LS5H 3T0EA 3KPPB 2I9LB 2QSCH 4FNPA 1NH6A 2BS9A 2CO3A 2HWZH 4RFNC 2EUXA 3KGSA 4O2FB 1TTCA 3CVDA 1UHVA 2CIIA 5L2KD 2EUWA 3SDYL 1T4WA 1KEMH 5DI8A 3JV6B 1OLLA 3HS0A 1O7SA 4XXDA 4YHNB 1A7BA 3UO1L 1BPVA 4GT0A 5KZCD 3KPSE 1UM4L 3O6FC 4DAGH 2CGZA 2IH3A 2AI0L 3RPIB 1E5CA 3IPFA 1NPNA 2EVFA 1NKRA 2E59A 3DNKA 3AGVA 4E9WA 4JY6A 4FQXD 4W9CC 2YUXA 1DVUA 2DQJL 2FO8A 4X6DA 2A77H 3BP5A 4WNJA 2VZTA 3PG2A 1VFBB 5D1QC 2YA1A 4NQDD 2J5LB 2DKUA 1LL1A 3MREB 1L9PA 4RGMC 4ZOBA 4DQOH 4BK5C 2X4TB 3HFMH 3VQ1C 4ZG1A 4MD4A 2OMXB 3KR3L 1MN4A 2J5WA 3C2AL 4IRZL 5CGYC 2G3ZA 2OZ4L 2XKUA 3NCYS 5DJ0B 4AUYA 3ULVE 4ZYKB 3RVUD 1IX2A 2ZKMX 1T21A 4TSBL 4IBQA 3ZQWA 1HXKA 4UT9A 2QPFA 4PD4K 2GTZB 2J4WL 4NQCB 1XMEB 4OFVA 3P2TA 3S4SA 3HPJA 1JZ2A 3SJVD 1C1EH 1EZUA 4LMQI 1JDCA 1GIGH 1REIA 5BQ7A 5EU3B 2AQ2A 1BQLH 1DEEA 1VLXA 4ELMB 4ZMQA 2Z31B 3OX8B 5IV2B 2AK4B 4OZHB 3ZGHA 2UVFA 1T7WA 1ECZA 5E6ID 1IC4H 1U8QB 2DJSA 4M29A 2AJXH 3FMGH 4M7ZC 4B9CA 1LK3H 2VDNH 1OHZA 3CH8A 3TCLB 3EO9L 1OPOA 1YEHL 4E9VA 2EYRB 1JPSL 1LGVA 2AQTA 2OMTA 5LBSA 3ARBA 3GSVA 1MAML 2PYEE 3MJ9A 1MJJB 3AADB 1JPEA 2ZPKL 3O3DB 5EIIA 3VM5A 2FX8H 1IM3A 2F8OA 1Q72L 3MCLL 2PF6A 4ZMLA 3Q1SH 2VERN 2XV0A 3VH8A 4FXLA 1EAOA 4U6VH 4ANXA 2NY0C 3AY4A 4MA1B 4AMKL 3DYOA 5EOTA 2LAGB 3GBML 1KN2L 12E8H 1CLCA 3N06B 1E67A 4N8CL 4KVNH 3M86A 1X6NA 4Y8AA 2ZJSH 1XBDA 1JTTA 3DGCR 2JB6B 3FC8A 4HS6A 2VRQA 3MMEA 1IAKB 2K1MA 2ZWLT 4PJEB 3SPCA 5KBPA 3NCJH 4BZ2H 1YC7A 1UENA 4QJ5B 4BE5A 3ZXAC 4ZXBA 2FJFA 1CDJA 1IEBA 4U1NA 2YMXL 2IAAC 2CO1A 4HFUH 2D4DA 3KPRB 2O5ZH 1ZEAL 2BHYA 3ULVD 1V7ML 4X5WB 3UJIH 4YS4A 5IBLD 1JVOA 3D0VB 4PWGA 4QYOA 2IAMA 3TIDA 3OL2A 4M6AA 3U7YL 4HUVA 2F6AA 1PGRB 4U3CA 4B9PA 2LU3A 1TZOA 1A25A 1MCPH 2JMRA 3PWNB 3DSFH 4YDLC 4PV8A 4FQHA 4GINA 4N0YL 4JRYB 4WW1B 1WD8A 3KDMB 4ELMF 1OGAB 3DRTA 4OZHF 2VL5A 3DDFA 1TLMA 5EHFA 4NHUB 3ARFA 4JKPL 5JOPD 5CU9A 3QIWA 1WS8A 4XP5L 1JXKA 2GJ6A 2L7EA 4YDKH 1RAMA 4GW4A 1YJDL 3L3GA 5T3XH 3OR7B 4WHCA 1QOKA 2QHRH 2WQUA 4ALAL 1K5NB 4MBRA 5E8EA 5HSFA 3SPJA 4AXWA 4LRNH 5E9DA 5F7WC 2EIZB 3EGDB 2PYED 2ZXBA 3PWLB 1UH4A 1YYML 5T5FA 1CS6A 2IC2A 3GXPA 5MENB 5LCVL 1WA1X 4L4TA 4NXSA 4FYRA 4HUUA 2YSSA 4XMVA 3VD7A 3ARRA 4OLVL 4Z7UE 5AVVB 3ZHDA 4EZLA 3IFOB 1OGPA 4S0SD 1PQZB 2YS4A 2IANE 4LLDB 1IRAY 3K71A 5CBAA 2FX7H 2X42A 1R19A 1MWAL 2DQHH 1G7MB 1FYHB 4PJEF 2QEJA 4IOFD 1HIML 5I1LA 1QFPA 1XGPB 2V2XA 4K8RD 2P43B 1ZHKA 1UYWH 4JPVH 2VERA 3TYFB 4M3JA 4AYFB 5AOKA 2MQ0A 1ADWA 2VDRB 1G87A 4I1RA 4JE4B 1J10A 1KTLA 1AZUA 3BAIA 3FFDB 3EYQD 2J56A 2GG1A 2IH9A 3WJLC 5C71A 4MAYA 2WNWA 3HE7C 1IVLA 1YMMD 3GRBA 5CR8A 3QIUA 2MCG1 3MRNB 2NSMA 5HHNB 1S2EA 5JHLL 4G71B 4Z3IA 2ICES 1HZLA 3HMXL 4KGLA 3BPNC 1QUPA 5EU6A 3RVXC 4EPSA 3RWGA 4BM7A 1LE9B 1QFWL 4F2FA 3DIDA 4WTZA 2QGBA 4U0QB 5I8KH 3HUJE 1E9OA 1CGWA 4M3HA 2WWMC 4XMWA 2BO0A 1U3HD 3QYCA 4X99B 3ZMRA 5I24A 1FZJA 1KCVH 1C8PA 2YXFA 1MRFH 1NFDE 1GCYA 4GAAA 3T65B 1R33A 4HCRA 4XNQA 1FNAA 3MLUH 1MLBB 4K3JL 4ZT1A 3RRQA 3IJSA 1S5HB 5EG6C 2DDQL 3N1MC 1XH0A 2XPGA 3PJLA 4Z7WE 3VGEA 3Q1EA 2BC4A 5IMKA 5IROA 5CJOH 3MCYA 2CCLA 4PREB 4ZUSB 3W5MA 4MS8C 3B7SA 4KGJA 2FE0A 1FG2B 3MV9E 2CA4A 2MEJB 3NFSL 2EXSA 1N0LA 5E1QA 5IIEA 3GI8H 3QHFL 1ZHLB 1D5ZA 3FT2A 3KLQA 3T6QC 1EZVX 4AG4L 5ERWA 1GHFH 4QHUB 1XH3A 3I9GL 3OZ9L 5AW4B 2FB4H 1KY6A 1GJWA 4L8BA 1H8OA 4WW2C 3Q8CA 5IHUL 3BI9X 1K6QL 3LQAH 2P9RA 4JN2B 4M93C 1HHKA 5LXGL 5A40E 1G1CA 3H53A 4MQSB 3UXFA 4AGOA 3B7RL 5EF0A 5T1LD 1I8LA 1KIQB 4RMBA 4HIEA 5L4MA 4LOUC 3VRLE 5BJTA 4G6AC 5DQDL 3VE0B 1UWGH 4PGDB 5FYKH 4FHBD 1HNFA 4N2AA 3D07A 4G3YL 4YGVB 2E4TA 5DRNB 4HK3N 1XF4A 5FOBB 3MUGB 3QUML 4M1DH 1JRHL 5CKAA 1KJVB 5E5UB 4LRIC 2JQMA 4EF3A 3QCTL 1J8HB 3Q2CA 4YXLH 1T2QL 1ANUA 3TVMB 3VXRE 1MFDH 2XFGB 4TSAH 5GGTL 4D9RD 1U91B 1IMHC 4CU6A 4IOSD 3RVTC 4JZOB 3C5ZA 1E9QA 1M1XA 2H9GB 3PDOB 3DX7A 2X40A 3FYIB 1X7SA 1J11A 3MLWH 2IADA 2D3JA 5DD0L 4P4KD 4KQ4L 1IKNA 1JZGA 2YRZA 5F7UA 1BA9A 1KPUA 2ARJQ 1OK8A 5I71B 4XVJL 4S0TD 4A2HA 3CPLA 3U48A 4IRZA 2FIKB 1RLWA 3DHUA 1GPOH 3PP4L 1NCJA 4PJ5B 3DX9A 3WUWG 1TOXA 3JYCA 4MJ2A 3J07A 3QG6A 5H8DA 1EO8H 1NEZB 1P4UA 4NO5A 3QRFM 2Y5TB 4FQIH 4QGTA 2JB5H 1BVKA 2AJZB 3H7BB 4JM2B 1ITCA 4AQAB 2CDEA 2OYLA 1JWSA 5ADOL 4XMXA 1ZLVH 2DAVA 4FFWD 5T1KD 2BNQB 3FRPB 2Z7ZA 1FZMA 1O0VA 3TF4A 5ETUB 3VXOB 5KJRH 1JGEA 2EYTB 4PGCB 2VZ1A 2PUQT 3FQRB 1E2ZA 1L9OA 4NT6A 3WE6A 1WAAA 1MVFA 2CPCA 1OW0A 5ESVA 3RWEA 4F9PA 1CN4A 2D7TL 4AM0A 3QNFA 4B50A 2P28B 4W4OC 4L5FL 4LSQH 5AQ0A 5JUEL 4NKIH 3LEVL 5D6CA 1RIHH 5L9DL 3C2SA 1FIEA 5EO0B 1ZLSH 3H54A 4JAMA 1FL5A 2XPZA 2DTMH 4P5TC 2R1WB 3IJHA 3KXFD 3M1BA 4WJ5A 1HEHC 1ZVNA 3N1GC 2YK1H 4L05A 3AGWA 3DMMD 3IU3B 3JYBA 3KLHC 2LLNA 3CDZA 3FUFA 3CQPA 4G6JL 1ZJBA 3WI9A 5FAAA 2B5IB 3F6IA 4N2KA 5JPMA 2C3GA 3K6IA 3OKLB 2FJHB 1SJEA 2XWDA 4S1DC 1XZ0B 4N8VA 2SODB 3REWB 4IBLT 1LLAA 2P48B 3D51A 2WLLB 2R4SH 2XWEA 3BKJH 2O26U 1BZ9A 1MFEL 1XO8A 3AXLB 4JKNA 3BW9A 1XGZA 1TQCC 4B9FA 1VZIA 4PY8J 5FS5A 4BWWA 5I0ZA 4PB9L 5F93C 3CLEH 4NM4H 5EIQA 4HJIA 1ES0B 5HY9A 5G2NA 1GJUA 1QVOB 1HAUA 4WHTA 2HJKB 4S2SA 3PNWB 4KRPD 5I1KL 3FQTB 4JM2F 3P0YL 1N67A 4YH6A 5PCYA 1G6RB 4J12A 4U1KB 2ZAHA 5GGUA 4AZUA 4L3AA 1Y1UA 4QRBA 5GSRA 3TV3L 4H0IA 2NMSA 2BZ7A 5JMOC 2APSA 3PWPB 2AFNA 3QWOA 2RH0A 4S1QL 4KQ0A 4P3WA 3WFCH 1UURA 2FWSA 3LVEA 5ACLA 4M5YL 4O58L 2R2HB 3QJXA 4K5NA 4BK4A 3FUEA 2OMUB 3GSNB 1RZIB 1D5XA 4DN3L 4PB0L 3MV8D 1RZJL 2E7DA 2I24N 2O30A 6TAAA 5GIRA 3OPZH 3QDJA 4M7KL 4OZ4B 1PX3A 3OGCB 3WSQH 2GJZB 3R0NA 4ODUA 2J55A 3TU6A 2FT8A 1CG9B 2HX7A 1INQB 3CHSA 2EVHA 1MEXL 3CFKA 3BGMA 3GBNH 3V6BR 1IGTA 2IV8A 3AMKA 4PJAA 2GAZB 2OSYA 4F7EB 4Q7DA 2DWEA 3UABA 2AKRB 5LCVA 4L29B 2KLSA 3DOSA 1P2CA 2WLIB 4WWID 4YPGB 1J9TA 2QFRA 2MOVA 4LSDA 2VCOA 4D0DB 4JY5L 5C2BL 3NSCA 5L4FA 1GY1A 1R3KB 4FQCH 5HTSA 2ENYA 2PABA 3GRGA 2KZBA 2XQBH 4QXGL 4XE5B 2A4ZA 1U8NA 4KVPA 2YD2A 3RBSA 3ULUC 4AZ8B 4YIQA 2NTFA 5SWSB 3VFWA 2AJUL 1T1XA 2CRMA 2G2PA 5L2JB 3K8KA 2YEZA 2A6JA 4RGOL 3T3MF 3G5WA 3W3BA 3UBXB 2AEIT 4TSCH 2NRDA 3PJSA 1JDAA 4FGMA 2FHCA 4MMZA 1D5MA 2VXSL 1H3PH 2Z9TA 5JA9A 4DESA 4H8PA 5DJDB 4LF3A 5JHLA 3HMXA 3PUUA 4Q6IC 3WHE0 5IGXH 5B7FA 2PXYB 4TVPD 3NOIA 4GXUN 2E8ZA 5JIIA 1NCCH 2I07B 2YGNA 4BE6A 2A99A 4YSEA 3W37A 4GXVH 5D5MA 4OIIH 4I0CC 4HIPA 4ONHB 4P59L 1DBMH 1QSFA 2ZWYA 3PRZA 4N0CC 4RFOH 3BFQG 1W2KT 2VM4A 3UTTB 4H1LB 4ZMYA 1SVCP 3WTTA 4G8EA 1FFQA 3BAJA 2GBUA 1W80A 5LBSH 1T80A 1GGBH 4D3CH 1A7NH 1SEQH 25C8L 4FJZA 5KVMC 3X13A 5EC1A 5C08A 3BD4A 2G75A 4GS7B 5K59F 2YPKB 1TLKA 3LEXB 4PJ9D 1M6OA 3DV6A 4DP4X 2B8OT 1UD3A 5GGVH 2P5WB 3SGDH 5DWUL 3WLWD 1KJ2L 1INDH 1G6VK 1ETB1 2GTWB 5IFHH 2IQ9L 5D70L 3RTLA 5J4MA 3RGBA 5EEXA 3QNZA 5TJWK 3CHQA 4NO0B 2ZG2A 4H4NA 3STZB 4GUCA 3WNIA 4Q9RL 2JIXA 1Q9OB 1A3RH 2IFFH 3G04A 4LVHC 4POZD 3ZE1B 3N44F 5CZVH 3L1FA 5FC9A 1CDHA 1I9RH 4C56D 1BFVH 1YNLL 1I85C 4N6RB 2FLBT 1FSKC 5HHOB 3KMDA 2FNWA 3FB6B 3C8KB 2EXYC 2VSMB 1YY9D 4U1SA 4ZRGA 4PJ8C 3QUMA 3D25B 2VDLH 3QH3B 2P45B 2Y25A 5DC0A 4X4XB 4WTXA 2WBWB 2BMKB 1GYWA 3NACH 4ELME 3PWJB 2AK4E 4OZHE 2ADYA 3GI9H 1CURA 3BUIA 3BSZL 4YHPA 1M9WA 2LLGA 1F41A 3HR5A 1R24A 5A2AA 2NSXA 4Q0XH 4LAJH 3V7AG 4DZBA 1C5CL 3T2QA 3G6DL 4BFRA 1JWMB 3EO1B 4RAVA 5E8OA 1MG3C 4U2ZA 1L5GB 3ZW3A 5IWLC 3OQRA 4XP6L 2OW6A 4HG4K 2WINA 3CSYB 2FEEI 3O45A 3NGBB 3HE6D 2EEDA 4WTWA 5E2UH 5HPOA 1YMHB 3K80A 4C47A 4X8CA 2WTOA 4KXZI 4YUEL 3ARDD 1UXWB 5E94B 5C1MB 1AO7A 3Q8AA 1PKOA 4LSUH 1U8CB 3ZOAA 5A2BA 4JZNA 4YC2C 1EUTA 2VO5A 3QAQA 1QEWB 1IBZA 3CVIH 1X5FA 4N3TA 4KVCH 3VXUA 3AM8A 2MOGA 3AU1A 4CMMA 2BJML 5EBWA 4G6KL 4PJEE 3ROOB 1FGVL 4GFXA 5BRPA 4KMTH 1U8OA 3GKWH 1JV5A 4XGZA 1X9QA 2GSGB 3NDZE 4P4RA 5MEPB 4CU7A 1JPTL 3OAWA 1OSZA 3QE5A 4KDWA 1U8PB 4GEIA 2DM2A 3T1WA 4HKZA 1R5WB 2IPTL 2QPUA 4UOZA 5D9SA 5B7MA 4OZFH 3JT0A 3VD9A 5GZNA 1G7PB 2CJTA 4TUKL 4NAMA 5CJ8A 4KV5F 3QXVA 1M57B 4KBPA 3FPXA 5B8CC 5AAWA 1J87A 3QXAB 4GQZA 4DP1X 4JRYE 1ZS8B 1ML0A 1FP5A 1I8IB 3MNVB 3K2UH 5IW3A 1Z32X 2P7TA 1BVLA 4NN7B 1QFWI 2OMWA 3P3SA 2VDMH 1VCAA 2ZTBA 1MCQA 2XWCA 3IGFA 5FDYA 3GEWB 5JW3L 5DT1H 5HYJA 1KN4H 2JCCB 5A2KH 5HHPA 3FH7A 4XCEA 1BZ7A 4TULL 1MOEA 3ZZQA 1KYOJ 4UILH 3LPGA 4DK5A 5IESH 3RZCD 1I82A 4KKBD 2HT2D 1QACA 1W8EA 3N9GL 5AVTB 4HCRH 3OB8A 2F5BL 5CJQL 5FHBH 3PHSA 3QUHA 4A6YL 1U58B 4H7VA 5DHVB 1XX9C 1LEIB 4WDIB 3UPRA 1CU4H 5GZOC 3HC3L 2QMJA 5IG7B 2YAHA 3GPEA 4LSSH 3NA4A 3T4AA 1TF4A 3SOBL 4JDEA 1S7UA 4OQTH 4OCXH 2R1XA 4PJBA 4HW6A 3QHTC 1QLFA 5ITFA 1FC1A 2IDUA 2BWQA 4AKPA 1R9FA 2NDGA 4GQPH 5DO2D 2DQTL 2Q1EA 1Q90A 3QQ9C 4JKWA 3AXIA 1UA3A 1WVZA 4BFGA 3WU1A 1SOSA 3NAAL 4ZODA 2Y06H 3E3QC 3VG9B 3T8XB 3VFTA 1A4CA 4IGBC 5T1DL 1NC2A 5DR5L 3SPHA 1ZLVK 3GMOA 3B2PA 5HJ3B 1DDHB 3VXQA 1IC0A 3AWFA 2VDPH 1P1VA 2G5UA 3GMQB 1URLA 1JP5A 2X9ZA 4ZTPH 3SBPA 1JRHI 1MHPL 2MNUA 8FABB 1MFCH 4J3BA 4AYEC 3MRDA 4HSCX 2NY5L 2WVSA 3GWJA 3IKKA 1UD5A 4W9EC 1RY7B 4XO4A 5E95B 5CBEA 1MFBH 1SJXA 1OSPL 2OP4L 4ZFZA 3WFDH 2CKBH 5DD3L 5A2CA 2ZCHL 4ANKA 3P73A 4CVXA 3VGBA 2JCCF 5AVSB 4CUCA 1LO3L 1XSOA 4PP1D 4ERSH 5DD5L 5MP6H 1JNNL 4Q6YA 1J5OL 5D2LA 1I53A 3SKOB 2DOCA 2FX9H 4Q9BA 4WJKB 3WUZA 3O6KL 4LPXA 4X9BA 5FYJE 5C7ZA 3ABMB 3S8WA 3X1FA 3KPMB 1EEYA 4TTDC 4NN5C 5D2NB 1UXLA 3ZTJG 3OJMB 5L6YH 4FKKA 4JK0D 4MFHA 2YAEA 2Y2TA 4E9SA 3S3JA 3X3GH 4AIEA 1KB5A 4W9ZA 2Y07H 3MFFA 5D7LA 2QVIA 3S8FB 4LFHD 1RZ8A 2L3BA 4PWKA 1AQKH 4KKNA 1SF5A 3NVQA 4ZNEA 3K6NA 1NFAA 1R5VA 4P9HL 1GAFH 4YVUA 3ATEA 3CLFL 3JWDL 3PPEA 4A39A 4PGEA 3D48R 4X98A 1DLHA 5JXAH 2Q86A 1JWUB 2UVEA 4IBSA 3SDAC 2YFNA 4KZDH 1P5UC 1FRGL 3IF1B 5GHWL 4OU3A 1P4IL 3QJHA 2ENSA 2YAOA 4KXCA 3T6XA 4WWKA 3ZJAA 1J7VR 1FHGA 3HHSB 4MJ4A 1TPXC 1U95A 3F5WB 3PWVB 1HNYA 3JTBA 2FWLB 3L4WA 1J8HE 1GH7A 1NM4A 1XEUA 2HFFB 2XU9A 3JV0A 5D96C 5E8NA 4E41E 1AR1B 1BAFH 4U1HA 3GJFA 1XT5A 2H1XA 4ZS6D 2OSXA 5FO7B 4BEIA 4Y8DC 3F05A 5F8RC 1F3RB 1A5FH 3QJRB 5JHAA 4NOBA 4Y19D 1P69B 1VB9A 2WSDA 3VFRB 5KSVB 1HI6B 3SGKC 1EWHA 5KSBB 4DEPC 2C3WA 4NQXB 2YXMA 2X4NA 1DJSA 5CMAA 5JZ7D 4MNQD 1QX1A 5IKCA 1KJ2A 4AEFA 1CFBA 1PKQA 1CR9H 3VW3H 3N6YA 1I8KA 1C9SA 4HXAH 2V8LA 3WFBH 4QHKJ 3OJ2C 3G5ZA 3PIQB 3ISWA 3WNPA 3KE0A 3QUYD 4CDHA 4PJ5E 4F7KA 3SD2A 5KVFL 2CBTA 5CEZD 3VI4B 3S5LG 2VLJD 3DXAB 3GO1H 3K91A 5EH1A 3L3KB 1NCHA 3SE8L 1T03H 3RA7H 3R0MA 1LDSA 3B2VH 5E2VH 1AR1C 2NXZC 2EDQA 4XWOC 2XN9D 4HQQL 3BLKA 4G7YL 2BNQE 3ARSA 1UWEL 2EJ1A 4Y2LA 5KBNC 5JW4M 4OM1L 3VNZA 1U92B 5FKPB 1KCUH 3ZT5A 3VFGH 5DK0B 1SN0A 3CVHA 5DS8B 3K8LA 4ZPVA 1DJHA 5JORA 3BO8B 1AZVA 2V3FA 3VGAC 2NY4C 1FN4A 3RJOA 3DIVA 1DFXA 3KS0J 4A2EA 4LLYB 5TH2B 3O9WC 3U9PH 3TV8A 5IJBC 1FUNA 5JDJA 4KO9A 1EO5A 2VR8A 3UIYA 1W8OA 4AVJA 1LVEA 3HAEA 4DUVA 1BECA 1T89A 4NJAH 1NCAH 3JV5A 1MCJA 1U42A 3L4UA 3QI9D 4XP4H 4GW5A 1ZGLA 1UXSB 1IGFH 3ARQA 3SD5A 4R96B 4NNXB 3KPTA 5KVEL 2Y6SD 4IRSA 3TJHD 3II2A 1MZYA 5DUPH 3WXVL 4U6TA 4Z7VB 5HHVL 4KXZH 4TRPH 1IQWH 1PZCA 5ITBH 2DMCA 3OJDB 3QEQB 4XRCB 5K9JL 2FSEB 5KSBF 4K55A 3IDNB 2MNJB 5D1ZI 3S36X 4CNIB 4P2OD 2D7OA 2AAAA 1F56A 4YBHA 3WY3A 3Q5YA 1FF5A 1QW9A 5DO8A 4KMQA 1FO0L 1ZE3H 3UCRA 5L88L 1QBBA 3IN2A 2XSKA 1O75A 1QA9B 2WQRA 2VDNB 3QC5X 4NZRL 3VNYA 4X8JA 1CIDA 3T3ME 3OF6A 4A7QA 2GC7C 3UP1A 3VI4F 1Z9SA 2R2BB 2IPKA 5CFHA 5ICZB 1WZMA 1Z66A 2FR4A 5ANMB 4PLJC 1O6TA 3QAZB 3NK3A 5FKAB 5J56B 1KENH 3HI5H 3B7YA 4FQLH 3L16A 5ICYB 1AHWC 2BK8A 2R59A 3P3YA 3ZKXB 3NJIA 3ZZSA 3BYTA 2XWTB 4R97B 2NXYD 3PWPE 3OKMB 4TQIA 3SBQA 3QUKA 4BZ1L 4IHOB 1M42A 3OKNB 3VFSA 3FO9B 5B1BB 5DS1A 4MNHA 5DUBB 3BPOB 1G4MA 2FTAA 4ECNA 4HA1A 1CXHA 1I7RB 1QHOA 4NNYB 1P4LB 2FHFA 2BZDA 3HN3A 2VMDA 1WBZA 1UEYA 1CDUA 5BV7C 1YN7B 3S35X 2ESVD 4Y4FD 4GRLB 2KKQA 4FNSA 3N1FC 4PRPB 3GXDA 5AD0A 1GS6X 2QKIA 5K59E 4ODHH 1R5IA 2R2CA 3UAJD 3FOLB 5GS3A 2IMNA 3PGFL 4Z7VF 5L4JA 2WSPA 3Q3GB 1P6FA 1ORQB 4UU9A 2EKJA 3U0WH 4L3EA 3QUZB 1B0WA 5I8CB 2F19H 1JMZA 2P8PA 1TTGA 2DQCH 4ZAKB 3V7MA 2HLFC 3LS4L 3WTVA 5ISZB 5C07A 1Q9LA 2PWFA 4JFYB 4Y2OA 5SWSE 3VFVA 3C6LD 3DROB 1PEZA 3BXNB 5LNEA 5C0AB 4XCNA 4A2GA 2JH2A 4L3CA 2WLYA 4L23A 4HHGA 4QHKI 4NC2B 3RL2B 3FO0H 1F3DJ 1MCDA 2V5SA 3VI3B 1WITA 2XY1A 4Y9FA 3MA9L 1Q0EA 3ISRA 2B59A 3C60A 3ILQD 3G7TA 3EDJA 1HQRA 4PJDA 1T7ZA 5DD6A 2X4OA 4BFEA 4NPKA 3O6FB 4NQED 3IDXL 1VGKA 2OXGA 5I1EL 2J21A 1JXDA 1ROCA 1RH8A 2F7RA 2B1AH 3N40F 5D1ZC 2NZ1A 3RWFA 3UTTE 3WN5C 2GTQA 1E5BA 4WWPA 1IBGL 4F27A 2MNWA 1PIFA 1ZLWH 2VXQL 5CUSL 5D1QB 2DEYX 4RGMB 2C9PA 4GUPA 4XNUH 5LBGA 5EO1B 3S2AA 1WK0A 4KJWD 5FYLE 4D0CB 3CVCA 4U49A 1DQJA 4XMUA 3EYOB 1NLDL 1WV7T 4JVWA 1A4KB 5TPWH 5IEKB 1D2OA 2AITA 3IMUA 4QXWA 2X1QA 4WO4D 3RWJA 4BQCA 4PJFA 1RVFH 3QXWA 4PGJA 4E0RB 4JR9H 4N2DA 2E47A 1ZDSA 5HGAB 5BZXA 4NQVB 5JQIB 1FNGA 2R9HD 3U1SL 4K94C 2WZ5A 1AS6A 4GUQA 2XZQH 3MV7A 3QORB 2I26N 2P5WE 2WN3A 3AWEA 4WV1C 5CLZA 3TGXA 4H5SB 2EH7L 3JUYA 3EBIA 3VFNA 1UZ8A 1I3GH 4Y16C 4I4WA 1NPUA 5F9JB 2X6AA 4WI2A 1J18A 2E0PA 3QUXA 3FU7A 4X6EA 1KELH 1BZ8A 3AITA 5DFWH 3TBBA 1GXEA 1D9KA 2LE9A 3LN4A 2QQLH 3O41A 4TM9A 3AS3A 4CN6A 1YEKL 1T5WA 2AF2A 2NY3D 4XCYA 2JE8A 4BCXA 4J4PD 4IOIA 5DJCB 4M7ZB 5BW7A 3EYUL 5HHOE 4AIZA 1XGUB 5AVZB 3DETD 2BH0A 1WGVA 4KV5E 4PJCA 3VI3F 5CNHA 4FNUA 2BWIA 2HSIA 4H13C 4HIXH 4WVRA 2NY7L 1E90A 3ESPA 3UAFA 2PW2A 4HBCH 3IS0X 5FWRA 2MQGA 2ZUWA 3UC0H 1LO2L 4AUJA 2H6PB 3NTCL 2ZAGA 2BHZA 4AT6A 4TLUA 4G8AC 1XIWD 1FIGH 3ABGA 4NWTL 2JJTC 1KBGH 3WKYA 3AAZA 3NP3A 3FHQA 3MNWB 3PY9A 1EAPA 2P46B 2VABB 1R1CA 1VPOL 3RTQD 4AQ1A 2X1XR 1QUNB 1OT4A 2WLMA 1JXFA 5ABAA 4XC1H 3WNKA 1AKPA 3SODB 2XXFA 4Z77A 5CP7B 3TO4C 2QQNL 1AZRA 3P4OA 2KYIA 1ZK9A 4MXQD 2OX5B 2HFGH 2AJ3B 1QD0A 2G9HA 2DB8A 3HG0A 5AW1B 1V5JA 1MVUA 4PG9A 5IJVA 3V6FB 4J3XA 3R06A 5BV7H 1KDJA 3PAUA 1PYWB 4G43A 5ALBL 4WHYH 3EHBC 2C3VB 4HUNB 5CHNB 3IDJB 1NFIB 2BNUA 5DJ6A 1NAML 5IFAH 4PSRA 1WBXA 1I9IL 3QS2A 4TQEL 1X5LA 1Q94A 1L6ZA 1RMFH 2EINB 1YYLH 1F90H 4YQXL 3P3TA 4ZQTA 4E9QA 1GGIH 2DPKA 3THML 5KTEL 2EVJA 2JF1A 3GHPA 3HCVA 1FG9C 3BPLC 4UYPA 3SCMC 3EFOA 2BCKB 1CC3A 1JCVA 1KBPA 1G9NC 2PR4H 2XN0A 4JHZA 4KY1L 3PAVA 1JZJA 4YSTA 5LNGA 4R4NC 2V5MA 4F2EA 1L0QA 1QQDB 1JERA 5IMLA 3GXUB 5IHHA 4Q6KA 3W9DA 3CLWA 4YLBA 5L2KA 2IWEA 5F1NB 2XA8H 2XZCL 1ONQA 2J57A 4AEHL 4UM8A 3WNMA 2APTA 3PGDB 1BFTA 4AYID 1JF5A 4AK1A 4MNGA 4DVRL 1IJNA 2C1OA 2AHIA 1T0MB 4Z7OE 2ICWB 2QADC 4AE1A 4HPHA 3TIEA 2K9UA 2Y1ZA 2ZNWA 1BOGA 3NZSA 3FQXB 3I6GA 3BVUA 4LCWA 1ZSDA 1YEFH 2WBJC 3CJJA 4CVWA 3MNMA 2JCCE 3E9TA 3K6SA 4WEEA 1ZXQA 2HFTA 2ICEC 3I2CH 4OLXL 4L8CB 4QRPD 3BQVA 3SQBA 5AVXB 2KC0A 4JPQA 4LKXB 4ORGA 4F7TB 2AEQL 4LNRB 3V0IA 1EX0A 2FRGP 1KFAH 3IGUA 3IFLL 3TN0A 5C0FB 2NR6C 4OZGF 1OT2A 1JPFB 1C16B 4OKVA 1IFRA 1PZ3A 6PAZA 5HYIA 3LKOA 3MJ8B 5F9OL 1BXVA 3VWKA 4IRJC 3QA3A 4OLZL 1FFPA 1EZVY 2BSDA 1I9JH 3OKDB 4OIFA 1O6VA 3UGXA 1T0PB 3VWJD 3M07A 4OIAA 3AB0C 4OLYL 1EHKB 1ADQH 1OWWA 3QO0A 5ACZA 5CF3A 1KB5H 1ZV5A 3HE7B 3B8SA 2F8IA 2GT9A 5LGYA 5CGTA 4IKKA 4PRBB 4ZMPA 2BP5M 3LY6A 4JQIL 4Y4KB 2VB5A 2NY1D 2DY2A 3TM6A 4XPTH 3BX7C 3ZSTA 1G9MH 2CG9X 1BOYA 5F0PB 5F3FA 4MSWB 4FMVA 1A6PA 3U6XS 4HPYL 4N2OA 1XAKA 2CMRH 5E6IA 2OMZB 3GSRA 1D5IL 2V0AA 1UJTA 3HG1D 3G5YA 1RD6A 2MPVA 3D52A 4JO3H 4C8XA 4BZ1A 3WTXA 1F3JA 1CICD 4U6HB 3T2OA 3TFKD 4QNPE 1XR8A 5D1XC 3WFZA 3MBEB 4MJ6B 3MLZH 4H20H 4OD2B 4ZFGH 2R8SH 1ND0B 4XO3A 4F7MA 4AK2A 1P9MC 4EQ2A 1KNOA 3CCHA 3GLZA 3HRZC 3ZE2F 3S48A 1D7CA 1Z9PA 5CCGE 4OZIB 4KZEL 1H3XA 4N90D 3QZBA 4U7SA 2R56H 1XR9B 2Z7YA 2KS0A 3QZWA 1OTSD 1TZIA 4JHBA 5E08L 3KPSA 1ODUA 1AZCA 2Z8RA 4WI7A 3UPCA 1G7QA 5K5YA 2Y7SA 5CCHE 4ZUTA 2WOBA 4N8UA 5IJDC 3WFHB 1F13A 3PREA 1ED3A 1OCOB 4ZW7A 5JPNA 2FCBA 3ZO0A 3T2LA 4HOZA 1MJ7L 4IKJA 3O0RH 1WS7A 3TBTB 5IQ9A 4UQAA 3X1EA 1BQUA 4P2RB 4LESA 3M7OA 3DTXA 3SKMB 2X88A 1SYVB 4M5ZH 3GM0A 2Q3ZA 2GK0B 2F68X 4YXHH 5D2NE 4J3VA 1INEL 1DE4B 1TYRA 3QEUB 3HBPA 4XVSH 3WMPA 3CSFA 1T66D 1KPRB 2GBTA 1SEBB 1SVZA 3C09C 3LIZA 3ZRSA 3MFGB 3T0EB 5EWIH 2ZUYA 5J7CC 1AGBB 4AV4A 4YL4A 2PO6D 3MRQB 4LP5A 1TIUA 1EUUA 4GMTL 2WXLA 2NNRA 4LSVL 2EEAA 3P2DA 3ARED 3UJJH 1WC7A 1A64A 3HS0B 4XXDB 2DD8H 1EEUA 5I18L 1T0OA 3QWQB 5FYKU 3BAEL 3MGTA 4N9GB 5JXEC 2IH3B 3RY6C 3B4NA 4JM4L 1OP5H 4QRAA 2BP8B 2QVTA 4QPEA 4YBLC 4YJZL 3MLTB 4JY6B 2WUBL 3CVHH 4XWGH 1G9NH 2TAAA 2C4XA 4KX7A 1RHHA 4EN2A