2W5PA

Drae adhesin in complex with chloramphenicol succinate (monoclinic form)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
140
structure length
140
Chain Sequence
GSFTPSGTTGTTKLTVTEKCQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPTDNSAWTTDNGVFYKNDVGSWGGIIGIYVDGQQTNTPPGNYTLTLTGGYWAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DR HEMAGGLUTININ STRUCTURAL SUBUNIT
publication title A Structural Study of the Interaction between the Dr Haemagglutinin Drae and Derivatives of Chloramphenicol
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 29
structure length 140
sequence length 140
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 2w5pA00
1UT1A 2VERA 2IXQB 1UT2A 1USZA 2JKJA 2JKLA 2JKNA 1RXLA 1USQA 2W5PA 2BCMA
chains in the Genus database with same CATH superfamily
2UYLA 2PMZA 3VD3A 2AVFA 5I8CA 4G8EB 4NM8L 2OCCB 2ZPKH 2N7SA 3LKSB 2IWGA 3MRLB 3QC5X 1NAKH 5DT1H 5B1BB 4YHNB 2JB6B 3ATEA 4LLDA 1JGLL 3CXHJ 4OCWL 4OZGA 2OKMA 1U3HA 1S46A 1CDBA 4KUZH 1BM7A 4TUKH 5B21A 2NYYC 3X11A 5K9JL 1R5IA 3QO1A 3IKCB 4DQOL 4ZD3H 1GY2A 1HEHC 4OZFA 3L3OA 2K8QA 2W0LA 3QEUA 4H20L 3PY9A 5E5MA 2XN9B 4BFOA 1EGJH 3IGAB 1RMFL 2J2ZA 2VZOA 3LQZA 4POUB 4Y2DB 4N8VA 4S11A 2GTQA 3HBQA 3BSZL 1QO3A 1H3PH 1Q90A 3HR5B 4QMEA 5EA0L 4BQBA 4HWBA 5IMLB 3V4UH 4X8GA 4GXFA 4I9WD 1L3WA 3BP7B 4O9HH 1IM9D 2OMYA 3S5YA 1T5KA 4JZJA 3SPCA 4HPOH 4NKDB 4I48B 2CKBH 3D39E 1DANT 4LSVL 2Y06L 3VACA 2QPEB 3NIDF 3MKKA 3W0WE 3QA3B 4PJXB 1PY9A 2YR3A 3U46B 3UBXA 1XCXA 3C6EA 2J43A 4XC1H 2XZZA 3GI8L 3V6FB 1S9WB 1N9PA 4L0YA 2BDNL 4NWTH 4PJHF 5GGUB 2GEQA 1CLVA 1YPZA 3OVUB 2VM4A 1W8EA 2R2CA 3TO4B 3ARDB 3FUHA 2V37A 3N1PC 4Y5VB 2UWEA 5K5YA 2C3VA 4L05A 2X0VA 4Q4EA 4FQXC 3WNKA 2OXGA 5DRNA 2HTLC 3U1SH 5D1QE 5EU5A 3FK3A 3PWPE 4PD4J 2FT6A 5JORA 3MMEB 4EIGB 1IEBB 1I8LA 1INEL 1NL0L 1XSKA 5M95B 2AXJA 5C0DB 4YFLI 4MJIB 2CCLA 3SO3C 1CFQA 4HH8A 2PO6A 5CSGA 4IOFC 4WGKA 1S8DB 3QXTA 1W8NA 3L5XL 1BQRA 2COVD 1UACH 4PJ9D 1BG1A 1YEJL 1H5BB 3ZDZF 3ECUA 3OKKB 5I1IH 1QTPA 4M6ML 2YXMA 5DJYB 4B9ZA 4YN3A 2WQRA 1R19A 1BVZA 1E8ZA 4G2AA 5DF0A 5EG6C 4LSSH 5DLLA 4I2XE 3WOVA 4BV1A 4QD2E 4HJ1A 4ZFZB 3JUZA 3D0VB 3RTQD 1UH2A 2KKQA 1HDMB 1NBCA 4Q58C 5JPNC 3ISWA 3T3PE 1PTZA 2BY1A 3VH8A 2E7BA 3KNBB 3CIQA 5HGDA 4YSTA 3KPLA 3Q1SL 1U21A 4HSQA 2GTZB 4MJ2A 12E8H 2XVGA 4ZMXA 3WLWC 1FAIL 2WWKO 4Z7NF 3FUEA 3T5WA 3DPBA 1G6RA 2YXWA 1HU8A 4Y19D 4WJG3 2HFEB 3EYUH 1G6RH 1EV2E 2OMVA 4QIRA 1H15A 2W07B 3HC0A 5G5DA 2Y4SA 1NCAL 1EH9A 1FL5A 1YDPA 4HWZB 3QJVB 1RI8A 5J7CC 4NZRL 4AJVA 1CTMA 4P5TD 5CSBA 3CFJB 1H0DB 1TT6A 1OOWA 4POZD 3VFVA 4W9HC 4LQ1A 2ETWA 4FQPA 3Q9PA 3MJ9L 3V2AR 4EI6A 2GSGA 5DD3L 4NN5B 2ENSA 3IDGA 4NQCD 1F4YL 1UCBL 1O6VA 2J44A 1IFRA 5D7JB 3RWDB 3AG3B 4NNYA 1K4CA 1SLXA 1U3NA 1S5IH 3FOMB 3N1MC 4L4VB 1QLFA 3UXFA 4ALAC 5HGAA 4JFDD 1UT2A 2GC7C 1VPOL 2AEQL 2PTUA 4DGVL 2EXYD 5DRZA 4WWKB 2VDMH 3FH8A 1IO4C 3A6BL 4YHPB 2DMHA 4MB1A 2OX5B 3ZUNC 1YPZE 3QORC 4WTZG 1PD6A 4YX2H 5AD0A 1E9PB 1B0RB 3U0TB 2NLJA 1SBSL 3M1BA 3QZNA 4XNAA 1TO5A 2UWEE 4S1RH 1RZFL 3QPXL 5T1KD 3WDIA 1JXKA 3QH3B 3IBEA 4ZFGH 2ALWA 5FYLH 5H94B 4IEFB 1MCPH 4LDCA 4EZKA 2UXGA 3BO8A 1S7WB 1KWKA 4G43B 3K7UA 1MFEL 1ZSHA 4LKXA 3T0AA 4MBRA 1W0YT 4JR9H 3K8MA 1GTFA 3SKOB 3GZOA 4FHBD 1AR1D 4LSPL 4AKPA 2G9HA 1YEFL 2UX6A 4JN2B 3FAWA 2CDEB 4LEOB 1RZ7H 4K94L 1U8JA 1UASA 4EKJA 1N26A 1K5WA 4R3SB 4EZMA 1PZCA 2V7NB 5D7LA 2ATAA 3KJ6L 4NBYB 2Q2LA 5IWLC 1VF5C 5GS1C 4YC2C 3UC2A 1MHEB 5HI5D 1XO8A 3MV8D 4OM0H 1CE1L 4N28A 4DERA 1TITA 1HHKA 2JH2A 4K5NA 4MNQB 5FYJE 3P40A 4B5EA 3BUYB 1IGML 3ZRFC 2YA2A 5IBUB 1XXDC 5GRVK 3NEEA 3O3DB 3SPVA 3KPQA 4Y4KB 4Z8FL 3GMQB 3BFOA 5GGSB 2HRGA 4GPVA 4K7PH 3V0DA 4LHQB 3FU0A 4QY8A 3CVHH 4WEMB 4XPBH 4LDOB 4FXKA 4LB8A 3LQMA 3ZL1A 4PV8A 4WJ5A 4LRNH 2FWOB 4GKZB 2F5BL 1EXUB 4B41A 3ZSTA 4AG4L 4XP4H 3TOPA 4JB9H 3G6AA 3F64A 4YSAA 4LOFA 1OQOA 2R7EB 1T20B 4WWNA 4Z78A 3E80A 3VO0A 4PJIF 5D7HA 4BZ1L 2XRAL 4X4YA 1YUKB 3QIWC 3H9ZA 4PRBA 2BP0A 1OF2A 2X89A 3I9GH 3TWYA 1JPGB 1IZKA 2Y6SD 5KSBE 3KVDD 1FL6A 5J12C 3T2NH 2VJ0A 1ORSB 1IGIL 1QTSA 2YGPA 4BRJA 3IMBA 2BVPA 3W2DH 3DHJA 5HI3D 2VAAB 3JZYA 3PP4H 3GMRA 5EFIB 2PXYA 1T1WB 1OK0A 3UTPE 1KG0A 1EFXA 2GK0A 3WKMH 1Q9LB 3ARTA 3B3IB 3M07A 3MR9B 1ET7A 3D7PA 1PVHA 2ZXBA 5IQ7L 3QR2A 5BQ7B 3S3BB 1XCQB 5I1HL 5A3IC 3MV11 2BS8A 2A5UA 3K6DA 5GGVH 3BVNB 1YJDC 4ISVB 3D85B 2DQGL 5JHAA 3QIBA 5LAXB 3QQ9D 3VJ6B 4P2YA 3AREC 2CJUH 2GBVA 5E5RB 3ARSA 4JO1L 3VXRB 1A6WH 2KS0A 5TQ0H 2QKSA 4UTBH 2CLRB 4J12A 1WCQA 4LXFA 1JZIA 5IBLC 1KTLA 1QQDB 4XMPL 5FM4A 4J3XA 5K9QG 2V3EA 5BZWB 5I74C 4DO5A 4NEHB 2R23B 3E3QE 3ZE1E 5DU7A 1IM3A 1KZQA 1TCMA 1GC1C 2IQ9L 1MPAH 2OMXA 4Y9BA 3LIZL 5CLZA 1YSOA 5MI0C 4RAVA 3L8QA 3QIUD 5JPMB 4HAGA 5E6IB 2NY4D 3FQUA 3HMWH 3V6ZB 5D7LE 4RQQA 5D71H 3BPNC 3NZSA 1E43A 3FB6A 4UYQA 2YMXH 5EHFA 1MW2A 4HUVA 1P0SE 1F2XK 2WMPA 2NCMA 3FBQA 3B2VL 1R3HB 3V5KA 5JOFA 3RWHB 3GB7A 5IHUL 5EO1A 4AJYV 2EH7L 3HMXA 5G55A 2WBJB 4E9SA 4HS8L 4HJIA 4ZMAT 4QI3A 1M56B 4U6VL 4J39A 4P48A 5KS9F 1ODUA 3SHSA 1BQSA 4HK0B 4V1DD 1WUZA 4BHUA 1JWSB 4J3OG 4BKLA 4CU6A 3ECBA 5C6TL 1TZGH 5JHDD 5D2NC 3QZWG 4OFQA 4S2SA 1HSBB 5E4OA 3WY2A 3VNYA 3V8OA 3JT2A 4OR1A 5DZNA 1EO8L 3CZSA 1EZSA 3BGFB 4Z0BL 1LO5B 1F97A 4AQEB 3HLAA 1KIPA 3MOBL 5D7IB 2BW5A 2Z1PA 3G5XB 1P6WA 2FT7A 4DP5X 3N9GH 2FO4A 3N0PB 2X10A 1YEGL 1D5RA 1YQVL 2FX7H 3B37A 2WINA 1B6UA 3EF4A 3ZMRA 2X09A 3APMA 2DBLL 4FABH 2YXVA 1CFVH 3SDYH 3UH8A 5ITBL 2NNAB 2EDXA 2C7UB 3QJHB 3D25A 4R4BB 5AW1B 4G80A 4CSSA 1HL5A 2JIXA 3DTDA 3EBHA 2LAGB 4LK4A 3T6WA 1A7PL 2X88A 1J1PL 1JBJA 2Z34A 4KDTC 2ZKWA 4UAOC 3FT3A 1MW1A 4TL5A 3KDPB 1XV8A 1DQML 3FB7B 3FTWA 2WB7A 3L3KB 3BUDA 4B9PA 2X28A 4V2CB 3VGAC 3VWKC 4EI5D 5CD5C 1W0VA 1UZ6F 2HT3C 3IU4L 3DIFA 3GI9H 3AZUA 5GRUH 3SYOA 3L4WA 2IWEA 1EEYA 4ODWB 5EEXA 5BVJA 2ZXDA 4FNTA 4YSUA 3ABGA 3DNKA 3QUYD 3L95B 5FECB 3KPMA 3VI4E 5E51A 3L3IA 4FFVC 2VERA 1OPGL 3LRGA 3I6KA 2X7LA 3E0GA 4KQ3H 4TRPL 2VLJD 4HKJB 2OMUA 3GGWA 2XBTA 3OMZA 3SPGA 1EAQA 1OHZA 4J4PA 1C08B 3KZ8A 4XBPB 2HN7B 3UYPB 4IGBD 4ZFOB 4GP4B 1X5LA 2UY7B 1OTTC 1OZTG 1FFPB 3DRTA 4LAQL 4KKZA 4XVTH 4BINA 2JKSA 3SCMD 2R4SL 1HXMB 2YAQA 1NDGB 4QRUB 2JMRA 3VXMA 2Y25A 4J3OF 1WC7B 2D9CA 4OF3A 1MG2C 5E1AB 3CDFA 1QFUH 4FE9A 4JG1L 4PJ8D 4X7SL 4Y16B 1EAPA 4ICWA 1PZUB 4WW2B 1LEKA 1MHPL 1LTXA 2Y36L 1P9MC 5E9AA 3B8YA 4XPTL 5CZVL 1CF8H 2ZONA 5L2KA 2IAMD 3S4SG 4LCCA 4U1NA 1EXHA 1MIEH 5F7DB 1IAOB 3ZE0E 1KYUA 2BOBA 5EC2B 5J1AB 5L0QC 3N40F 5AOIA 4B7LA 3I50L 1OAZL 2Z6FA 1Y6KR 1I82A 3P4OB 1LP9A 3NFNB 2WQAA 2AJSL 4QOKB 4LVEA 4AYID 1KB9K 5TPWL 3UAFA 3ARGC 4CN6A 1E9QB 3WYRA 4WKZB 3S3JA 1FFOA 4A2MA 2OTWA 1IC7L 1XGYL 3REVA 2GABA 4KROC 3PGFH 2CD0A 4GMTH 5I6OA 3VXOB 3O6ML 4M62H 5I23A 2DLEA 5D2LF 1NCCH 1IBFA 3V4VA 2WN2A 4MZ3A 4X9GA 5IJKC 5C0IA 1RUQL 4BWTA 4CKVX 3V4VH 3V4PL 3WCYA 4BRVA 4QWWC 4FXLA 5CINH 4X9HA 2QLVB 3KLLA 4D8PA 3BP4A 2AQPA 3DO4A 3LIUA 1WAEA 2EDBA 4XCNA 1GTNA 1SY6H 4TNFA 1N0XL 5CCKH 4KJYA 3KPOA 3ILDA 4L3CA 4QXGL 3TCLA 3FCSA 4ZNEE 1O5DT 5ISZD 1WH0A 2ADGA 4RX4A 3TYGH 2EE9A 3KYAA 4GLRH 1OM3H 4ENED 2HRLA 2GJJA 4FP8H 4NCC2 3B9KC 4ZFQA 1HZHL 5GRYA 4R8WL 4UQAA 5I1GL 3BWUC 2X0UA 4MJ6A 3DETC 1KTCA 2WLLA 2EIBA 2HLAB 3RGVD 3RVXD 5EN2A 5AB2A 4GG6F 4GLRI 3BAWA 4EVNB 1X4YA 1LEIB 3B2PA 4UQ2A 4PJFB 1NEZA 1R75A 1U58B 2AF2A 3GJFK 1HXYB 1NIEA 1D2OA 1FFNA 2EUZA 4MX7A 2GG1A 4ODUA 2B1AL 3PL6D 1IFHH 2AMUA 2WUCH 4EBQH 2NZ9C 4FQCH 4QO1B 2OJ1A 4P59H 2BP5M 1X5HA 2CMRL 4XXCA 1OB1B 2X4OA 4X4XB 2N7AA 2NY6B 4WHDA 1AH1A 3CC1A 4DGYL 3GO1H 1UWXH 3GMPA 3OAYK 5IIEB 5I1DA 1MY5A 3FC8A 1IC5L 5C08D 3UTSA 3AG1B 3X3GH 2J5LC 4UIKL 1T89C 2VQ1A 4NSKA 4N5EC 5DDHA 5JXED 1ZGLP 2UZYB 3B2XA 1UADC 1BOGA 2DI9A 1TENA 2DWEA 1PZDA 1NSNL 3GZKA 4X6DA 3VXME 1KELH 4YXLH 4BA8A 1CGVA 1J7VR 1HINL 1E4WL 3ILEA 2A9ML 3W11C 4CGTA 5IJVB 3V79C 1H3GA 2ZYIA 1GY1A 5L2KE 5ICUA 3UZQA 3O6FD 3ESUF 1RFDL 3D52A 3AWFA 3C8KA 5IMKA 5EZOL 1DQJB 3OPZH 4NZFA 5E2TH 1OAYL 5HDBE 1AG6A 5HHVH 4GJTB 5ILTH 1GGYA 1YEWA 1EJ6A 1LP9E 2DJ4A 1XL4A 2VMFA 1JPSH 2BY0A 4KTDL 2A6IB 4IRJA 3EJRA 2WZ6A 4L37B 5FKAB 1ZLWH 4EAEA 1AIFB 5IK3A 4HGWB 3OJDB 1XGTB 1Z3GL 4MD5B 1MJ8L 1DVZA 1L0XA 3X1BA 3GSWB 2WWMD 5D96C 4NO0B 3ETSA 1J87A 1X5JA 2NXYD 4LSQL 1JPFB 3TH2T 3OB0H 3O0RH 4PJGF 1BZ9A 4XMWA 2H1LM 1GGCH 1NJ9A 3QG6B 2OSWA 4Y9GA 2LU5A 3SJVE 5C92A 4JKMA 3HN5A 3MNWA 4BGLA 3CN3A 1R24B 1USZA 5CJOL 3AXHA 5F1NA 2WCSA 3L48A 2G2RA 4L3ED 3ULSB 3MLRL 1RURH 2HX8A 3CSTA 3C60D 4IRZL 4ZPVA 1BDYA 4LESA 4PJBA 2Z65C 4RH4A 4YDJA 5AZ2H 2VLRD 3FMGL 5FIEA 3CK0H 3KVQA 4OAWB 3CMOH 4AJ0A 1CD1A 5GS2H 3T65A 3D48R 5AB0A 4P5MB 4JRXB 3G9VA 5TJWK 5ITFA 2WZPD 3A6CL 3ZTJG 5D93C 3V0JA 3BQUD 1FYTB 1AQDB 1JHKL 1AFVL 4H8QA 3C2AL 1N3NA 3HBPA 3NZHL 1RVFH 5G2NA 2YD7A 4GW4A 5ADPL 2F68X 1NFIB 3CHXA 1B0WA 4RAHA 3VFPB 2HLFC 3QAZB 2NY0D 1MIMH 4RMRA 2AJVH 2KH2B 1MOEA 1B2WH 3IMRA 2W0PA 3A23A 2ZCLH 1CLZL 3QFDA 4JM2B 3MA7A 3KPRD 4M1CD 5EO0B 2B4CL 3RAJH 2CO1A 3O6LH 4P2QB 4WFGE 1NAMH 1IBBA 3BC9A 4FF9A 4ADGA 3WMPA 4IOSD 1BM3L 1L7IH 3LKRB 4G8GA 4PY7A 4N0UB 4OKVA 5DJ8A 1GOGA 1S7TA 2XUWA 2F1BA 5EU6A 3U1QA 3UTSE 3ARUA 1ZHBA 3QUHA 4BH7A 5EOTB 2GIYA 2W91A 1KCBA 3FQXB 5DS8A 3TF4A 4FJ6A 2FQDA 1SHMA 2CALA 1YA5A 4ODXA 5L4IA 1JG9A 3LKNA 1EEZB 5AW7B 2VL4A 4X6DE 2RIKA 3BP5B 3U4EB 2AI0H 4F5CA 2Z64C 4EUPG 2BZCA 2WM0A 3TZVD 1QEXA 1E5YA 4MSWB 5EEUA 4C56D 4FNLH 5BZXA 2HP4A 4R26H 4Z7QB 1TF4A 5JR1H 5K9OB 2J1YA 4HUWA 5FO2A 3SY0B 3CCHB 2BIIA 3MLXL 4DWHA 3L4YA 1RUML 3UMTA 1J8HE 4PYGA 3KYNA 3CDYA 4KZCA 3V0VA 3VX1A 1GPOH 3VMPA 5K9QI 3UZEC 3TA3B 3SZKC 3PAUA 5BJTA 4D9LL 1QBLL 3JWOC 3B1TA 2NX5A 1A3RH 4RDBA 4LHUD 1JYNA 5J1TC 1IC0A 5EDSA 4GXUN 2JQZA 2OXHB 1YYMH 3SKJH 3IMUA 4QRPA 5IB2B 4YHYB 4M8VA 4YHLH 2VUKA 5CNHA 3MNMA 4AQ1A 4ZUSA 3ATDA 3ROLB 1V55B 3MGTB 1FGVH 3S36X 2VR4A 5ADOH 5I15H 1BGXH 3WDHA 2J6EL 4XGZA 3MV9D 3S37H 4JANA 3FT4B 3DMMA 4GP8B 4J3OH 2VB5A 4HS6B 2VH5L 2D0GA 2IFFL 2WCGA 4Z77A 5C97A 4R84A 1I1AC 3QPQD 4UM8A 2Z31B 3IJYB 4AMKH 2FD6L 1WA0X 4TULH 1NGYB 3QW9A 2P47B 2VGLM 3D05A 4ODVH 4N0FA 2HJFA 2HB0A 4O5LH 2BWIA 5KBKA 2WTRA 5EOCJ 5FFOA 1CICD 4K9EL 1U36A 3TN0D 4URTB 3WE6B 3KXFB 1ND0B 3DVNB 2AJZB 5CBAA 4KZDL 1ECZA 3A24A 2B1HL 3FU8A 3GHEL 3MREB 4XVSL 5D7SH 2J8HA 2OK0L 1LO0L 5KW9H 5AVQB 1GJIA 2F54A 2FL5A 4YSQA 3II2A 3CFUA 3IDIA 3JZ7A 4MNGA 1DBJL 1XGPB 5BOJA 1CFNB 1NKRA 1PG7X 3F65A 4PWGA 5FDWB 4D94A 1G6VK 2XPGB 1WAAA 1OSPL 1FG2B 5K69A 4K2UL 5F89B 5CCHE 3MXWL 1F0LA 2ZXAA 4Q9BA 3B2DC 4CU8A 1NLBH 2BNRB 1F45A 2PYFA 2KPWA 2I32A 3TBVA 4NKQB 1WBZA 3RVUD 1PEZA 4S1SL 5IV2A 5DJXB 3X14A 1GOHA 1NCOA 3GRBA 1UA6L 2P28B 5GRZA 1CBVH 5IB4B 3DX1A 4MZ2A 4PJ6A 2AW2A 2MQGA 5EU6E 1RIUH 1QA9A 3L9RB 5I76B 5L7XH 4C4BA 5EOCL 4KWUA 1AQKH 2BIPA 2P8MA 2VR5A 4KVNL 4CSPA 4PGJA 4FTDA 3ZDXE 1FI8C 3K72B 3IAGC 1E4KA 1NCDH 4TUOA 2W81C 3WJLC 2KYIA 4YDVA 1Q1PA 3LRSB 1TJHH 4ANVA 4F5CE 2COQA 1Z9NA 2PYEA 1CL7H 4XPFH 3D3VB 3W0WD 1JRHL 4JO8A 5SWSD 1TQVA 4IU2B 2EDHA 1M9WA 1PSKH 1UOVA 4MQXC 4PGDA 3N1FC 3MLZL 4AX3A 1OD7A 4GO6B 4DH2A 4O2FB 5ALCL 3SDAD 4R7DB 3QUMA 3Q8CA 5AVYB 5JLZB 1CL7I 4HQQH 4TLKA 5KJ4A 4QHLA 5DR5L 4ODBD 4BYHA 5FKPB 2AXGA 4FG0A 2B2XL 2EKSA 1P1VA 5JXAL 2X2YA 3AG4B 1FVDB 2EP6A 4APQA 1AC0A 2J12B 2NX5E 3MRGB 5D1QD 1BV8A 1BF2A 1D7BA 3LXBA 5C7XL 4YFDB 1C16B 1M42A 3BN3B 4QRPE 1ICTA 1OLLA 2X1PA 2QSVA 3RVWD 4KFMA 3EDEA 3IVKA 1RIHH 4TQIA 2ZICA 4JDZB 3FAXA 4PJCB 3WNOA 5CEXA 3KYOB 1F00I 2BVQA 4B7IA 3MRQB 2H3NA 4XVJL 3QT2A 1HKFA 3X2QB 4HETA 4LBEA 3KMDA 2O61B 4PVLA 5KYYA 1MN4A 3M46A 1I31A 1TKWA 4KI5C 3AQZA 3CUPA 3EFFA 3FFCA 4FQXB 2OR9L 5AAMA 3UJTH 3QDMD 1TTCA 4Y1SA 4XO4A 4XN5A 2YQ3A 3QEHA 4TNWK 4BFJA 5B38B 1XQ4A 2DQCL 2PCPA 1JGEB 3UERA 3TF7C 5CHNB 2V2XB 3JUYA 4GIAA 1RHHA 4PMFA 1U41A 2QBWA 3WDJA 4LOEA 4ZOCA 5C0ND 2IV9A 3DROB 4YSDA 4W6WB 3SO3B 2GTWB 3S9DB 4OZ4A 1MVFA 4QRRE 4GP5B 2F54E 2XZAL 3S96B 3KBHE 1HIMH 4MNGE 3W9DA 4CMHC 1N64H 1ZVHA 4W81A 2ZPKL 1U3HD 3ULVH 4JJOA 1BEYH 5JA9A 1NAKL 1MCBA 3KDMB 2DYPD 4HIJB 4AH2A 2KHAA 3DPDA 4A38A 3QNYB 4NYLB 1B4RA 3SKMB 3MBEA 2NW2B 4FFZH 1ADQA 4BE5A 5DZPA 4IKIA 4KUZL 3UTZB 4TUKL 3QZBA 1U8MB 3H3KA 3DX9B 1ACYH 1YN7B 4PEEA 5DJ2B 4ZD3L 4DPCX 5DI8A 3BPCB 1RHFA 4KZEH 1NINA 3QP3A 3AQDA 2WY3B 3PAZA 3RDTC 1EGJL 1IGJA 3P4MA 5L8LB 1FNFA 4PPTA 1FVEA 3QUKB 2MCAA 4G83A 1H3PL 3L3GA 4WHYG 3V4UL 1KGCE 3D0LB 3UEQA 5IEHB 4OIBA 4EN2A 2PYEE 1XIWA 2WQVA 4O9HL 5H4YA 4URKA 2JELH 3WIIH 2YIHA 5E4EC 3QQ4B 4HPOL 5EOQH 2WVSA 3GUFA 1KMGA 2CKBL 1QWNA 2CUAA 1A8JH 5EUOF 1TVHB 1N7MH 4JFFD 3CH1A 3QNZA 2Q8BH 4HIHA 2WZAA 1X5IA 5B39A 2Z91B 1UB6A 4H25B 4NWTL 1MAML 2Z3FA 1XTMA 1HHGA 5D5MF 2VERN 3K6OA 3QFJA 1SMAA 5CLWA 1LILA 2BSSB 1V54B 2ZOLA 1ID5I 2FRGP 3T6XA 1SEQL 2WTPA 4YBQC 1M3IA 4P2OA 3WGVB 3IBOA 2W9LA 2X6AA 4HD5A 3U1SL 3EYFA 2PO6D 2ZOKA 3GBDA 4BFEA 1I9RH 4LCIL 2A0LD 4C47A 1CLCA 4LNRA 5T3ZH 1CUOA 3QORB 4WW1B 4D0DB 1KPVB 1M7IB 3PGCB 3P3RA 5GXBB 1INDH 2LGNA 3EGSA 4A7GA 1MCEA 1HE7A 2QJDA 1XTLA 3O3EB 3PQYD 1L7TH 1RJZB 4N90D 1UACL 4NC1E 1JWMB 3CFDB 4PRNB 4RMWA 5IROC 2ZX9A 4NO5B 3FFCE 3LMJH 5I1IL 1PZ2A 2XJLA 4ZQTA 4ONHA 1G7HB 4WGVB 1KPRB 2JXMB 5AVXB 4G9FA 5E2VL 3VTMA 3DOSB 5KSUB 2NUPB 1Y07A 1D5ZA 3K2KA 4U1SB 2X42A 1EFQA 3CFKA 3PHOB 3RWJB 3CHOA 1KJVA 2WYHA 4OBSA 1UCTA 4MVBD 2BSEA 1G7LB 3ILPA 1EAJA 1KEGH 4MJHA 3HZMB 4P57A 2K8MA 1OXYA 5JIKA 4TUUA 5DD6A 1I85C 1RPQA 4IK7A 1L9SA 2YPVH 5GS1B 4LVHB 3Q2NA 4YC2B 4KUCD 3PE9A 3OKEA 2P80D 2APTA 2XZQH 1MNNA 1JERA 4Y4HC 2IH3B 1RZIB 4XNQA 4IBSA 3TTYA 4MCMA 4DETA 4JO5A 3RUGF 4WFHD 1DJZA 3VQLA 5DS2A 3SBRA 1SJEB 5CBEA 1ZLVH 2G2NA 1ZHNB 5DSCB 4GQ9H 4JRYD 4Y1AD 1S3RA 3NEXA 4GH7B 2V8LA 2VM9A 4YHOH 3KR3H 5HPMB 1HQ4A 3ZTJH 3VE0B 4P8QA 3QISA 1T6BX 3TX4A 4YQXH 1BIIB 2F74A 3TA4D 3UTPD 2QADD 2JB5L 2NUTA 2EQDA 1JYXA 2Q76A 1N59A 1TQUA 1JF1A 3T0EA 3ME0B 1KNOA 5DUBA 5GRJH 2VDKH 1KJ2L 4LEBA 5KSBF 4OV5B 3VXPA 3MRNA 3MJ7A 4TS6A 2HFFB 1QNIA 1IEAA 2BSRB 1YECH 1S5IL 3EOAA 3QIWB 1BVLA 1CDUA 2XLLA 4U1MA 2V5RA 4F91B 3MUUA 1J5IA 1BVKA 4F7MA 2A83B 1DQQA 2V3DA 2VDML 4WK2B 5J12B 5DUPH 4L8CB 4YHIA 3SPIA 3VG0H 3Q43A 1I3UA 3RWCB 4X7TA 4EQ2A 3QFJE 1VEMA 4YX2L 2BIQA 2CK2A 1HFUA 4FA8A 3PAYA 4S1RL 1N2RB 1PAZA 2YJLA 3NSCA 2R59A 3EBAA 3O2DA 1QSFD 2RR3A 4EUPH 5FYLL 5I73B 3FQNA 5CJXA 1MCPL 1PKQA 1SQ2N 4FX5A 3O2DH 3L4XA 1IGYA 3DURB 1E8XA 4EXPX 5DVNA 5F0JB 4ZW3A 1UJ3A 4IJ3C 1KXTB 3UO8B 4X99A 1SJMA 3L3JA 3Q6FB 2BOCA 3EYOB 2B14A 1HCYA 2VN5A 1P7QB 2RHEA 3QUXD 3MU3A 4C57C 4BCZA 5LKNA 3ZHNA 2CO2A 4M61B 5CZXC 1VFAA 4K71B 4G9FE 4MGXA 4OM0L 3BDBA 3MO1B 1AO7B 2ZTBA 4YPGA 3V6BR 3PHQA 2GVYA 2OMBA 1MDAA 2VQTA 1G7QA 2B77A 4LLWA 2BZDA 5MI0B 4TKWA 3HBGA 3UMNA 4XO5A 3V0EA 4K7PL 4OIIH 4NJ9H 4MAYA 1L9QA 2EIDA 4W4OC 2E6JA 3MBWA 4RZKA 4TVSa 4HBCH 5T1LB 1DEEB 5CHNA 4MMXC 1O9VA 4U1LA 1YEIH 4HLEA 2XQYA 3CVHL 5KSVB 3M8OH 3TBYB 1LJMA 2D73A 1FNGA 3FQRB 4HAFA 4LRNL 5DMGD 5FF6A 3T1FA 4YIQA 1H19A 4XP4L 3Q3GB 5I1LB 1UKSA 3NJVA 3WKPA 1JZ7A 1J5OH 3G6DH 1H3XA 4R4NC 3M45A 2ODHA 4XPGH 1G4RA 3W82A 3N55A 2X89D 2MTAA 4X5LA 5DK2A 4XNUH 3UROR 5IFAH 3MNDA 2OA9A 3GRWH 3QR0A 2C8NA 5D2NB 2E9BA 4N9GA 1J8SA 3I9GL 4LSUH 2O5NA 4KHTH 3T2NL 1K6QH 2PXYD 2OP4H 1I8IA 1EVUA 5EMYA 4RZCB 4GUCA 4UUJB 3W2DL 5T3XE 2CAKA 3HS0A 2BJMH 5ICXA 2EVGA 2WAQA 3PNWB 4ODSH 3T0EE 3TVMA 4X8XA 3DX6B 5TDOB 3ZMEA 2DIJA 3UDWC 2CBTA 5F1KC 1P7BA 3NSXA 3VGFA 1C12A 2ITCA 2EDTA 4NQVA 1T1ZA 3HC4H 4JKLA 4DAGH 2FLMA 3QQNA 4O4YH 2OQJB 3J8F7 4XP1H 2VXUH 1M7UA 5E94A 4JUTA 5AB9A 3KLDA 1QUPA 3MRHB 4GSUA 3F2LA 2CJUL 3VXQA 3HCVA 3WUWB 1FG9C 1QASA 3JTBA 1UUNA 1A6WL 4PWFA 5TQ0L 4RWHA 3GUTB 1MHHA 4UTBL 5F8QC 4KBPA 3LXUX 3MHZA 3I75B 4FQ2H 1ZHLB 2AKRA 4F1ZA 4UAOB 2JCCB 5JHBA 1IC4L 3UCQA 1PKQE 1T4KB 2AAVA 2KPNA 3NOIA 3OL2A 4HK3J 4UQ9A 5JO5B 3KEDA 3LD8C 4YDNA 4QRQB 1ZAGA 4M56A 2FEDD 3K8LA 3VWKB 1R0AH 2X9YA 1MPAL 3CDCA 1I8MA 3N0AA 3VI4F 1OLZA 4ZJ9A 5C8JA 3ARRA 2Q7YB 2BC4A 4UM9B 4PJ9C 2X4QB 4A39A 1TTBA 1BBJB 3HMWL 4I5BB 4XHQA 1I3GH 4EKXA 1KOAA 1E27A 5BS0B 4DESA 4F9LA 1SOSA 1WBXA 4NNXA 5D71L 2YMXL 3OKNA 1AOHA 3W9EB 1WZ1H 2ZP8A 5JMRA 4F33A 2IJ0C 1OP4A 4DSYA 1HYSD 3VCLA 2G75B 4HOZA 1X5MA 4IMLB 4Z3IA 2OSLB 1V27A 1AS8A 1XT5A 4L8BB 4A6YB 1QI3A 2XNAA 4Y4FD 4DNLA 3MRFB 2C5DC 4Q9RL 4AV5A 5KANG 2ICWB 4AE0A 1I3RB 1TZGL 5D6DC 3WFDH 1HHHB 5DZLA 5IJBC 3EYVA 4JFEE 2ZG2A 4NUQA 4G9DB 4GFXA 3CQFA 1FJ1B 1I8KA 3S98A 2ZZUT 1VEOA 3IU3B 5JOPE 3BUPA 2X6CA 2OJEA 2O30A 2PW1B 5HJ3A 2CO6A 1FHGA 3HUJA 2AV1B 3I74A 3N9GL 3BUBA 4R96A 1OE3A 3SKUD 3ASOB 1NFDB 1AZNA 1JIBA 4PY8I 4UZUA 2GI7A 2P5EB 3N6YA 1XZWA 1IEHA 3MYJA 5HJDA 4YXKH 4P5TC 4QF1A 4L4TB 3NJJA 5L0QB 2ENYA 1CFVL 2L4OA 2H9GB 1BZDA 4POZC 3SDYL 1BLNB 5KN5B 2JIXD 1UFUA 2YRBA 4ZDHB 2AJ3A 3RP1A 1MLCB 5DJ0B 2OTUB 3AVEA 3RYMA 5BO1H 3G08A 1IGFH 3DUUB 3S88H 4YK4C 1KIUA 4XXDA 2V2WB 5DRXB 4EIZC 4HVBA 5J6GA 3VQMA 1R3LA 5L6YH 4QHUB 3IDMB 4HHAA 3DUSA 4KROB 5KUMA 4IJTA 2BP8A 5LG1A 3WMQA 4PJEB 2R0LH 3U6XS 1X9UA 2EXYC 1IQWH 1QZ1A 2BVEA 3BRDA 3MUGB 4LPWA 1FFQA 2FBRA 3KW8A 4N6RA 3X3FH 1NQBA 2ZKMX 2FEEI 4LASH 1OE1A 4K23H 2UUDK 3VGGA 2AFNA 1L6PA 1NCWL 2IGTA 5HDWA 2WVVA 3GI9L 4XOCA 1BMZA 1E2WA 4K8RH 5HGHA 3U6XA 1YY8A 3ZYJA 4ESKA 3AM8A 4WHYH 4AYEC 5DWPA 1MELA 5F88A 3G6JA 5AZUA 4WO4D 4J4PD 2YGOA 1I7RB 4DK5A 1O9WA 2L3BA 1JUFA 1W6WA 1QUNA 4DTGH 4KQ3L 2V9QA 2WXRA 1P5UC 4NS0A 5C07B 4LIQE 4C8XA 5D1ZI 2JJVA 4H88H 4DVBB 1A9EB 1F3JB 2UXTA 4QDGA 3MRCB 3ULUF 5DVPA 1DHKA 3WEXB 4M5ZL 1MVUB 4XVTL 3GZPA 3MVSA 2PCFB 5HI5C 3PIQB 3GEFA 1VRSA 1ZY9A 2KT6A 4F7PB 5DMYA 5CD3B 5DQJB 4MA8H 4QRFA 4W9GC 3SQBB 2P48B 2XXGA 3PWJA 1QFUL 3IXTB 4LFHG 3UIZA 3VSUA 3ATBA 4WFFE 5KVFH 3MV7B 3TT1H 1BFVH 2VLLB 3HNSH 3CE1A 1K9TA 3JXAA 4JFPA 4Y5XC 5FYJU 1CF8L 1CU4H 2Y23A 3OD3A 5DO8A 4DFHA 1KGIA 1MIEL 3SKNB 2DPKA 3NJXA 1FNEA 2WQXA 1M6OB 2J5LB 2VMJA 3SDDA 3OKLB 2KDGA 3BZ4B 1Q0YL 4GW5A 1L9TA 2OMWB 3ZZ1A 3SDXB 1MCDA 5E8EA 4P3DA 1I1YA 1B4JL 4PRID 4P3CH 1J9TA 5EORL 3HUJE 1WWCA 4XMLH 4BUGA 5LNEA 3JT0A 1AZRA 1B3JA 3F7VB 3M17A 1IGTA 3NP3A 3PDOB 3VSTA 2KZKA 4TXVB 1FV1A 5EZJB 5I1CL 5IBTH 4QLWA 3PGFL 3A67H 2F53A 3BZFB 3TJHC 3T2QA 2QFPA 1MCQA 1JPTH 4UILH 4GMTL 3WIAA 2Y6SC 4QLRA 3ECQA 2P8PB 5F9DC 3JYCA 1MFCH 3P9LB 3N1QC 2EH8L 1MI5D 2KBGA 1WYJA 3H7LA 2YD9A 3QDJB 3PJSA 3MRLA 4H2CA 4NXSA 2DLHA 1ZT1B 1T83C 5CINL 4O2CA 1UZGA 2VR3A 2AGJH 3N91A 4GOSA 1HAWA 1SY6L 4HC1H 3UC0H 2X2JA 2H2SD 4NP9A 5J57B 1QR1B 5CCKL 2WVTA 2YUWA 3H56A 4OLXH 4W9FC 4HDIB 1ROWA 4X5WA 3TYGL 1TQCC 8CGTA 3HA0A 2E9GA 3QQ9C 2BSTB 3OHMB 2WANA 3CFNA 3IGAA 4FP8L 1PEWA 4N0CD 3SYCA 1MWAB 2L8AA 4K9JA 5KG9A 2X4PB 3T77A 5IMLA 5C0BB 1Z9MA 4XE5B 3PWVA 3CSFA 1UXWB 4UQ3B 2QSCH 2BHZA 1CO1A 4WFGD 1HXKA 1G4MA 3MCG1 3VI3A 5B3NA 4I48A 5CSZA 4N8PA 1TQSA 4OQ1A 2A9DA 1IFHL 2WUCL 2O5XH 1Y1DA 2X38A 4FQCL 3UTSD 3EAKA 4XN4A 4P59L 4MA7H 5AW0B 4E9WA 4PJXA 5C71A 4Q74A 1NDMB 1C8QA 5D93B 3FSWA 3GO1L 3DHMA 2ICEC 5E9NA 5FGBA 5BW7A 3K0WA 1A6UH 1G9HA 3X3GL 3C5ZA 1CD8A 1DDTA 4AUUA 4JGNA 3TO4A 1RK0B 3HG4A 1ET5A 1AYOA 1BZ7A 3MJ8A 5HI4D 2Y22A 3MLPA 3DECA 3BYYA 5C0CB 1KC5L 3U6RA 1T7WA 4AITA 1KELL 1URZA 5LN4A 2ZWZA 4YXLL 3Q5OA 2AXWA 2EJ1A 3MMEA 1SMDA 5DMKB 2AJYH 3KCPB 3NACH 4LCWA 4NERA 2EUWA 3U7WH 2HUHA 4PTUB 4MJIA 5D7IF 5BV7C 1MJUH 4KK9D 1PZBA 3KBEA 2XKSA 3OPZL 1WFUA 4IRJD 2HG5B 1S8DA 4KQ4H 5E2TL 5CGBA 2EVHA 5HHVL 4AK1A 1SXAA 3PV6B 2C3GA 1JCVA 2Q7NA 5IW1B 4PLNC 2EDKA 1L9PA 5DJYA 4M93C 4HFWB 1F8TH 2G9KA 4DQAA 2I85A 5CEZH 1LO2H 2F53E 5MENE 2JJTA 2R2HA 4Z6AT 4ZO9A 1RZGB 5IW6A 3CFIC 2XHNA 2N3JA 3BKJH 4PWIA 3O0RL 3F04A 2FQGA 2IPTH 3ALWA 2QTEA 4FQHB 3SDCB 4M7JH 4P46A 3O8XC 3HG1B 1HEZB 4QCIB 2J56A 2OFQA 1IAKB 5KZCB 1DVFA 5IMMB 4KDVA 2IPKB 1CIUA 3PF2A 1RURL 1W8OA 3WENA 1S9KC 2GJZA 3NJHA 4AK2A 3WTWA 2ORBH 4JBSA 4F24A 3LZOA 2DQJH 4L48A 4P06A 3ZDYE 9CGTA 1X4XA 3CK0L 5LXGH 1DBKH 4MTMA 2C1PA 2A4ZA 2H6PB 5EIIA 5ACLA 3S35H 2EC9U 1H0DA 1VERA 3K6NA 1XCTA 2Y3NA 3EJYC 4LCUB 3LNDA 1MFBH 3H9SD 3QUYC 2H4EA 4FYSA 1RVFL 5AW5B 4Z7UF 3F84A 1MIML 1T4WA 3KS0H 2BFGA 1B2WL 4HMDA 5D7JA 1TJXA 3VI3E 4X6FB 2ZCLL 4G8GD 3RAJL 3U9PH 1AG0A 3O6LL 3TURA 2VMDA 1AGCA 1NAML 3CBRA 3FF7A 4PJXE 2TRHA 4WWKA 1L7IL 5SV3A 4K3HA 4YHPA 2NCEA 4DZBB 1MJ7H 1YAZA 2UY6B 4L9LC 1E9PA 1A21A 1J8KA 1M71A 4WW2F 2OV0A 4IBWA 3T8XB 4RGMC 3A4FA 2B9BA 2BP3A 3VXTA 5TD4A 5LQBH 4NRYB 3QH3A 4PJ8C 5H94A 1ZVSB 4YSPA 3S5LB 3T0BA 2ZX5A 1S7WA 4G43A 4HEMA 3L7FA 2IAMC 3D33A 3NP4A 2YC1B 4GRWB 4W9JC 1U8QB 3FU3A 3LTVA 3FUFA 4FNLL 4LCWE 3LEXB 4R26L 2R8SL 5JR1L 4YAQB 1DVSA 4TVPH 3D2UB 2NY3D 3UZVB 4LEOA 1CDHA 4B9YA 5IQ9B 5KYUA 2IWKA 1IV8A 4R3SA 5T5FA 2V7NA 1G5GA 1GPOL 4HOWA 3LHAA 1MHEA 4K5MA 4KITB 1PG7W 4MNQA 4MWFA 2CDGB 3M88A 3SKJL 3HB3D 4PCYA 4FLOA 2G3MA 3BUYA 4L29B 3ULUH 3E2HC 4YHLL 3DMMD 3O3DA 3MCKB 4Y4KA 5HGGS 1HCFX 2FGWH 5GGSA 1FGVL 1J5DA 1HL4A 4GUQA 1T6VN 5I15L 1ZLUK 5ADOL 3WFHA 4WHTB 1BGXL 3S37L 4IU3A 1RZKC 1X7SA 1F5WA 4JY5H 6PAZA 5DEJA 1WS8A 2EINB 2FWOA 4NZUH 2ZSWB 2KLRA 4AMKL 5CGMA 3H85A 2Q86A 3KM2A 4TULL 1U8HB 4KJPD 3JWDC 3OKOA 4HKZA 1KJMB 3OHXC 4ODVL 1TU2B 1ZLVK 3ARFB 5KANI 4KV5E 4PWEA 3VRIA 4O5LL 1OT2A 2E6QA 1T20A 2W0FB 3A0OA 4N2HA 3T4AB 2APSA 1AY1H 1KXVA 4NN7C 3MTXA 2F54D 3BUIA 3SOBH 1I1FB 3QS2A 4PP1D 4WUKH 3T04D 1KTJA 4PJFF 5I6MA 2VDQB 5JW3H 5KW9L 1LWHA 4WF7A 1XXFC 1O7DC 5IF0B 3T3MB 2VDRB 1ZT7A 4ZMPA 4JAMB 2PPDA 4J1UB 1ZS8B 1S9VA 5EFIA 1T1WA 3GIVB 1FZMA 2E76C 2WPGA 2EDOA 1Q9LA 3B3IA 1X9QA 3QDGD 3SODB 2YUVA 1NPJA 1XCQA 1PDKB 1E4HA 5DJCB 3IGKA 3WKQA 2AANA 3BVNA 4U3CA 1D9KC 1CBVL 4ISVA 3D85A 1EXGA 2WN3A 2PN5A 5LAXA 3RX8A 4E9RA 4UV4H 1RIUL 3VJ6A 2PPCA 3CZKA 4X98B 5TE7H 4CMHB 1WSST 5L7XL 1KGCD 2R69A 1AQKL 4QTFA 4DUVA 3LVEA 1FZKB 2PYED 3MGAA 5J8OA 3EJUA 1IBGH 2I69A 4GBXD 1QQDA 3RE0A 2WLHA 3NBNA 1CBJA 3PG2A 3ABLB 2ZXWB 4HEME 5BZWA 1CL7L 4Q52A 4XPFL 2EDJA 3QJSB 1SVBA 2B0SL 2VR8A 4PW4A 3VRLE 2O5ZH 3O6FC 1TCRB 2ZWLT 1PSKL 1X7QA 1NEPA 2QMJA 1N68A 2EEXA 5TDNB 2X87A 4PGEB 1JYWA 5B3JE 4WDIA 4AL8H 3TEZA 4AGPA 4PS4H 3RDTB 4HQQL 1CD9B 3FQWA 4M02A 2BS9A 2FZ3B 4P9HC 1JZ3A 4DKEH 4ZAKA 4JPIA 1KV3A 4DP6X 5HHME 4X8JB 3VTAA 1N6VA 2LVCA 5ESQA 3HPLA 3S97C 1ZT4A 3RPIA 4K3EH 4RBPK 1MUJB 2XFXA 3QJTB 2WWMC 5HXMA 1UGKA 5AKRA 5E4EB 1QRKA 2WBJA 5D1XB 2OZNA 1A3ZA 3II3A 2NXYC 1A14H 4G7SB 5HSFA 2P5PA 5DHXB 1XBDA 2CUHA 1A4JB 4XP6H 1RIHL 3VNZA 2CXGA 4WEUD 4HK0A 4RSVA 3T0WA 1RKRA 1VA9A 1UWEL 2IOIA 2JF1A 4JFYB 5JQIB 4YE0A 5AW3B 4HX1B 2XQYK 4GI6A 1TDQA 4MXVF 1CDYA 3P11H 1KFGA 3V5HA 3C60C 3VQ2C 2ZE0A 1AGFA 1F1DA 1LNUB 1O6SA 4FNUA 4Y5YC 3RX9A 2YAHA 2N59A 1E7VA 2NY2D 1M7DB 4I77H 1K3ZA 5I82A 3OKMA 4MNHB 1YEKH 3VA6A 5IVZA 1JSYA 3Q01A 4A7QA 2WLIB 1JV2A 1V5JA 1SDAB 1QYGH 2R0WH 1TZOA 1YNTF 1KJ2B 1ZSDB 5D9SB 3ULVD 2DKUA 4H13C 2ITDB 2NNAA 4M03A 5AFAA 3RWGA 4H0GA 5FO7A 3VWJD 4QKXB 1KTRL 3K1KC 3UAAA 3V6OA 3VB9A 4AM0B 4F8TA 5JIMA 2HRPH 1VCAA 1HIML 4N2DA 4IS6B 1E4XH 1E28A 1N64L 3FCBA 2VDMB 3BKYH 3FU6A 5L4FA 2PKDA 3CQQA 1BEYL 4G42A 4H1LA 4PRDB 4HF5H 4MD0A 5B8CB 3LQAH 4U05A 4F2FA 4KHXH 3GMMB 4FFZL 2PUQT 1ZLSH 4UOJA 5IVXB 4FGMA 1ACYL 2BO0A 1TJIH 4ADIA 5IFJB 2EEDA 4H40A 1NFKA 2XKNA 4BKTC 3SGJC 5KTEH 4KZEL 4A1RA 1NPNA 4JFQA 3BIBX 1MFNA 3VFTB 4FQ1H 4XI5C 4XT1C 3ATFA 2C9QA 4GIPD 1XIWD 2DB8A 4P0DA 2TRYA 3VXUA 4F7TA 4GQQA 2XY1A 1UYWH 3T9WA 1L9MA 3TZVC 4O51B 1QVOA 2FJHB 4YVNA 5F3HB 3UABA 4ICXA 4LT7A 3GMLB 3BPLC 1THCA 2DEWX 5KAQG 2JELL 1BFTA 3DSNB 3WIIL 1XVSA 1JZGA 1SEBB 3K4AA 1TOXA 5EOQL 4RFNC 3FDWA 2AV7A 4AGQA 4GKNB 2CIIA 3A5VA 1C08A 4D9RE 1AGBB 2XA8H 4UNIA 2HN7A 4ONFH 5T1DH 3RHWF 2DQFA 1N7ML 4NZDA 4R0LA 2Q8BL 2UY7A 2K70A 3CDGA 1FFPA 3QFJD 4G7YH 1U8NB 3EO9L 1S7XA 3G3LA 3W56A 2P7TB 1A6ZA 2IMMA 3OXRB 4A67A 4HFUH 5GGVY 1MZZA 2X4TB 1NDGA 4QRUA 2AXFA 1OANA 1E5BA 4HZLA 1O7VA 5E8OA 5K9KB 1X5XA 4K5OA 1A1MB 2MSPA 4Z7OB 2FLRT 5K39B 3EFOB 5JIDA 1HHIB 1MCIA 1ML0A 2XQBH 2XWBA 4Y16A 4F9PC 2D0FA 5T3ZD 1YO4A 3CVHB 5JHLH 1JF6A 4RGNE 3ARBC 4KKLD 1OD9A 4QHKI 3IRCA 4CC4A 3IWVA 2CDFA 3PS6A 2BMKB 4JS7A 5EC2A 2EICA 5J1AA 1R5WA 2O72A 1I9RL 3FQTB 4YSOA 3ZT6A 1SYSA 3GD1C 1Q9KB 3MUJA 5HYFA 2ZWSA 4CN4A 3P4OA 3QPQC 5EUKA 3IDJB 4UQDA 4QOKA 3ZKXC 4AQAB 3JTTA 3VU1A 5F0MB 1INDL 3IFPB 1O0VA 3TFBA 4G9FD 5GISH 1L7TL 4RAUB 3CFBB 4U33A 5DC9B 4FTVB 1H3WM 3LMJL 3P30H 3KL0A 5B38G 4HH9B 1KN4H 5ALBH 2NPLX 2BSED 5CR1A 1BWWA 2NY5H 1P6AB 3JVGC 3VFMA 4KC3B 3MROB 4MJJA 3RZCA 4PWHA 3FT9A 5I17B 3IF1A 4IJ3B 3U36B 4ZO8A 4MD4A 2FH8A 1KTBA 3I6LD 4ZNCD 2I24N 5EB9A 1A4CA 1J1XH 1DLFH 2LR4A 3V6OE 3FO0L 2VZSA 1ZLEA 1DFXA 2YAFA 3US9A 3QZOA 4ELMF 2YPVL 1ODAA 1T5XB 5CU5A 2ZJSL 3GC3A 1GYWA 1KN2H 2YRLA 5DA4A 3VG9C 1PZAA 4TLUA 1SFHA 2AP2A 5EULV 4UOZA 1FZOB 2CQVA 4G6KH 4HUXB 5A43C 4FQQB 4F8LA 5I0DA 5KVEE 3N44B 4YHZH 5KEZA 1H3VA 3JV4B 4Y2OB 2ICCA 4N68A 5F0LB 3TGXA 3AITA 1U4FA 4PP2A 4EOWH 3MSPA 4GQ9L 3ELQA 5EPMB 5I0YA 3SSGA 5J3HD 3L5WB 3QWQB 2D7PA 5I6LA 2HT4C 2FGZA 5T3XD 5IMOA 3H8NA 4YHOL 3BGMB 3KR3L 4MMXB 4N22A 3TJPA 5KAQF 2HLAA 1A6VH 2B59B 4KH2A 1LDSA 5CU9A 3VXUE 3BVVA 4R7VA 1LEIA 3FO2B 3U4BH 4JPQA 1JPEA 1CG9B 3FU7B 1U58A 5SX5K 1Z5LA 3GK8H 3LKQA 1HXYA 4L0ZA 3FRPA 3HFMH 4Y9EA 1SLWA 5C0AD 5DJDB 2D4FA 1MCJA 4JMXA 5GSVA 5GRJL 3ZHDA 2C4XA 1BXAA 3KPSB 3WKNA 1OB1A 2Z0UA 4XWOD 1YECL 3DGCR 3BP6B 3CDZB 2FWSA 1R34A 4R2GC 4H0LC 1G0DA 2X4RA 2F2HA 2YARA 1KCUH 1D5XB 2XVBA 4PJHB 4WV1C 5DUPL 4XX1E 3LZFL 3PGDB 3VG0L 2APWA 4XRCB 2IADB 4UQBA 4N2GA 5D1QC 2F08A 1IM9B 1U42A 3H0TA 8FABB 1RJYA 4PJDB 1G7PB 4PRHB 4PJCF 5FHBH 2D7NA 2E9IA 3ZUCA 4X5XB 1G9MH 4Y1TA 3IJSA 5IM7B 1TNMA 5IJVA 3H6AA 1LDPH 3QCVL 1OALA 4ZUTA 1DCEA 3HHSB 3AU1B 3EJZD 3F6IA 3B1UA 4WSGA 1DQJA 3T8MA 1BA9A 1V10A 1VACA 1QNZH 4ZUUB 5F7YC 2I9LB 3BPOC 1KUMA 3FTUA 2EILB 1WT5A 4WNQA 4Q9CA 1I7ZA 4NI6A 2OULB 3AT8A 2VR9A 4XXWA 1GZHC 2QFRA 4Y7OC 1A65A 3GSWA 1MFAH 4Z7VB 4DGIH 5ENWA 2ZWKA 2DMCA 3LD8B 3QB7C 4WNJA 1F4WH 2NSMA 2WLMA 2Y9RT 4AI7A 3HI1A 4I89A 4MAYD 1HX0A 3QG6A 5DRWB 2PTTB 3RU8H 3BEWB 4HIEA 4F20A 1SOXA 3ZHLA 2WQSA 4OIIL 2Y5EA 3ALPA 3R18A 4NJ9L 1HT6A 1U3HC 1R24A 1ZXQA 4ZUWB 4HBCL 2BHYA 3FCTB 1GYAA 1ZHKA 3E6FA 3OBAA 5DURD 1P4BH 4Z7NB 3F00A 4OLUH 5GZOA 4WFEE 1P4IH 2WCPA 3L3OC 3EXJA 4QKTA 2CBQA 2Z7UA 2WBXA 1JHTB 1J1OH 1J5OL 1OSEA 3DYMA 3G6DL 4NQDA 4PMEA 4P5MA 4XPGL 4XCFH 2GJRA 2Z92A 4XNUL 4CSZA 5IFAL 5MERB 3T4YB 3GRWL 5F9JB 3F83A 1WZLA 3DSFH 2W95A 3LH8A 1WWAX 3R7QA 4JZJC 2AQRA 1D5IH 2J21A 3EH1A 4LSUL 5AKSA 4KHTL 1RCYA 1K6QL 3WY4A 2AZAA 2C7FA 1UVQA 3K6SB 5FOBA 1FF5A 1LMKA 2YQ2A 2BJML 4JM2A 2JKTM 4AKQA 2C34A 3RBSA 2E7CA 3MX0A 5F96L 3C5JB 3PWNB 2Z4QB 5E1GA 4L23A 3U0PA 1U95B 3ZO0A 1MCLA 3KW7A 1A4BA 2P5WA 3G04B 1AZBA 4U1GC 1YEEH 2P4AB 3HC4L 4JFSA 5EOTA 4DAGL 2BCKB 4P23B 3OMAB 3FQXA 2QV4A 4LLMB 2OBGA 2FBOJ 4M3HA 4IKKA 4O4YL 2VXUL 4QRSB 4P2RD 4XP1L 3X12B 1J0YA 2IEPA 1DDHB 5AAWA 1EEZA 1Z3RA 4YSRA 2CHDA 3THMH 1E9OB 2X5PA 4X0NA 1HTYA 3U4EA 4POYA 3MA9H 1OV8A 4G8IA 4KO9A 1I8LC 1M9SA 3UTTE 4KK8D 5IJCC 4KMQA 1TTRA 2GUOB 1MW0A 1BPVA 2ZYRA 3L7EA 4FQ2L 4PM1A 1E8WA 5AENA 3WFBH 4EIUA 2PO6C 2X40A 1TVBA 5EIQA 1KBGH 4D8OA 1PQZB 4PY8J 4CL7A 2D3JA 1T5WA 4NENB 3CCHA 4QXTA 4TLSA 5JNYA 2Q9OA 5LBVA 5SV4A 3F85A 3DV4B 2EYRA 3ZR6A 2RCSH 3TA3A 2R29A 2H47C 4W9ZA 3AQXA 1I3GL 4N2IA 3IN0A 4OCSL 3IETB 3W3BA 1KULA 3P77A 4KQ0A 4GUPB 4OI9A 3PWLB 1WZ1L 4AM0Q 1JP5A 4HCFA 2O6DA 1OGTB 1G9NH 3ROLA 3MGTA 1WFTA 1P5UB 4AEHH 1HVXA 2Y7QA 3W0WB 3L13A 1CYWA 2BSBA 2VN3A 4JFZH 2O26U 2WXLA 1MLBB 4HIIA 3ZTCC 5CEYB 2CR3A 5EWIH 4E41B 3RGHA 1TJGL 3WFDL 4WKXA 2Z31A 2C3HA 2NNCA 1NCTA 1IE5A 1UD8A 4ZOBA 2JKWA 5G4MA 4YHKH 2BXYA 3BSZA 1S3KH 2EIKB 5F21B 3KXFA 4NQDE 2DIEA 3BSZH 3GSUB 5EA0H 4ZTEA 4Y5XB 3HAEA 4BH8A 5AL0A 5CS7A 4PJIB 2VW6A 3BIKB 5D70H 4AV0A 5CJQH 4DVRH 3UBGA 3MREA 4F8OA 3X1GA 4ELKA 1J9QA 2FDBP 3S2CA 2JKRM 5CF3A 5EF1A 2XZCH 4TLTA 1DQIA 1XGPA 2FECI 3OGCA 4N2CA 4RRPM 5HDLA 1H3UA 1TJMA 5ANMB 1Q38A 1PNDA 4P4KB 2X2IA 1FSKB 1UB5B 1FG2A 4Z7WB 1G7MB 5BO1L 1JDDA 1IGFL 5C9JA 3S88L 3OLGA 1P4LB 3NJIA 1MNUH 2XVLA 3VD9A 1Q0EA 4D0BA 3NRPA 2FEEL 2FUQA 4KKAC 3DX0A 4YS4A 2FHFA 1FO0B 3KLHD 2E46A 2Q6WA 2R0LL 5EBWB 2P5WE 1BZQK 1IQWL 5L8KB 3U2IA 4UDTB 3BQVA 4HUNB 3QGVA 4PCSA 1DQLH 4FADA 3B83A 5D1ZD 4K23L 5HHOD 2NQDA 1EHAA 3K72A 2Y5QA 1M2VB 4GKOA 1KEMH 3D34A 3UEZA 3ZHFA 4K8RL 1JXGA 3WUWG 3WU1A 4KJQD 2J4WH 3E3QC 4BK8A 3ZRSA 4DOHB 3D3VA 1BAFH 3ARWA 5TGBB 2LLLA 2CR6A 3LYRA 1XB3A 3K71B 4H26B 5J06A 4ECNA 4Z7QE 1MFVA 4FG4A 2C9PA 4WI3A 1FHNA 3QHZH 5F3BB 1TQCB 4DTGL 4L1SA 1SHSA 1ZK9A 4Z3HA 2H26B 2WOYA 1KXQA 1H6FA 3EJCA 5E2UH 3I02B 2F8IA 4ATWA 5FKPA 3VFUA 4H88L 4LLVA 2Y7SA 5H2BB 2BCMA 2LFGA 5HYJB 1TNNA 1NC4D 2JKNA 3REWA 1Y7VA 1RAMA 4QTHB 4X7FC 1AGDA 2IPUG 4MA8L 3RTQA 4MCZA 3CPLB 5KVFL 4JQIA 4KX7A 4JDZA 4KRPD 1P4UA 3SDDD 3TT1L 1BFVL 3L5IA 2AQ1A 2YQBA 4G7VL 4JQIH 4FXKC 1EMTH 1C9SA 3WJMA 4MMYB 3KYOA 4DW2H 3LZLA 3SD2A 1GMIA 4G8AC 4CUCA 4FA7B 3DXAA 1AVAA 3ILQC 4DGUA 1K5NA 4A2DA 2J8UA 5DMGC 1ET8A 4Y19A 3UX9B 1AZCA 1CGUA 4NZRH 4MS8D 4P3CL 5DFVD 4PGBB 2VXTL 5JA8B 3C87A 4U1IB 3SBWA 2F53D 4I0PD 1JGEA 2J1XA 2VLKB 4GEJA 3MJ9A 5MEND 1I7UB 3O3AB 4NM4H 4XMLL 4JPVH 1Z5YD 1EQWA 1MF2L 3DROA 5IBTL 1XFPA 2GTWA 5BV7B 5AOMA 4AENB 2GJ6B 4UILL 1F4YH 1AP2B 5LNDA 3G5VB 2ADIA 4ZMQA 2PXYC 5I28A 2Z9TA 2QPSA 3RVTC 2AEQH 2YBRB 2H32B 2FWLB 3EJSA 1N4XH 2CU9A 2DDQL 5FO8A 3LS4H 4HIJA 2EIEA 2IXQB 1J0ZA 4YDZA 3BAKA 2AGJL 2NW2A 2ZAGA 3BX7C 4FLQA 4HC1L 2ZYSA 3UC0L 4XMTA 3UTZA 5L8JB 1QLEB 1U8MA 2ZIDA 3QIBC 4J8QA 4A04A 3CG8A 4OLXL 4Y2DD 5TFSL 5DHYB 4WWPA 3V7MA 3QPXH 2Y07H 4NP4L 4JGUA 5A2FA 3P73B 4EDXA 1Q94A 1UOLA 3O8XB 3GM8A 5T1KA 3UAEA 4F2MB 1PZ5B 3PXLA 2O6FA 2VISA 5EO9A 4ANKA 4AC4A 3ARQA 2GCYB 2BW4A 1VGKB 2WUBH 1D5BB 5FK9B 5BO0D 2QSCL 3D3VE 3OGOE 4K94H 4PR5A 3BHBB 5B1JA 3QQ4A 4X83A 3MJWA 3MUHL 1UD5A 1C7TA 1ZANH 2O5XL 1KFAL 1KXQE 1UT1A 4CILA 3D07A 1CXLA 4N3TA 4RIRB 2AK4B 3BDXA 3TO4D 3ARDD 3KL3A 2XWTB 1DP0A 4OLWH 1T04B 3GSOA 4X6CB 4AYBA 4DK3A 2VQUA 1A6UL 3VD4A 4AZ8A 2BSSA 5BVPH 2XCMC 4H7VA 5BMFH 3FU9A 4Z8FH 2D9QB 4MS6A 1HYSC 1JE6A 1WV7T 5ICYA 4YR6B 2RFXB 5E8NA 4MJID 2K7PA 2G3ZA 1V3KA 3PWUB 3FHEA 3NCWA 3O45B 5AUMB 4MAZA 1ZS2A 2AJYL 3NACL 5AB1A 1X7TA 4DP1X 3U7WL 3JQOB 3CAFA 1BJMA 4DEUA 4NC0B 4AKOA 4D0DA 1MJUL 3GXDA 5J6SA 1KPVA 4LPXA 4BZ1A 3BAJA 3DX3A 3MRJA 1R4XA 3DXAE 4FDWA 1HWGB 2J8UE 3O3EA 4KQ4L 1RJZA 1JWMA 2XI9A 1XGQB 4Y19E 5CEZD 4BGDA 5LDUA 2IQAB 4LPYA 2JXMA 2F19H 4R5XA 1F8TL 3LRKA 4JZNA 3CIAA 4LO9A 1OAUH 4NAJA 5DLML 3RIFF 2CIKB 2YPLB 5J9PB 1D5MA 1G0YR 3QE5A 4PRAB 5JYLA 3G5YA 1J0HA 3H42H 1NANI 3RWJA 3SPHA 4GS7C 4CN1A 2D7MA 2PPEA 3QUZA 1UM5H 1LO2L 5BRZB 5CEZL 1G7LA 5D2LB 4P46D 4N2LA 2B9AA 3NH7H 4RA0C 3BKJL 3OJ2C 3WE1A 3KS0J 1BPLB 4NB7A 2IPTL 1DVFD 4AC2A 3I6GB 4M7JL 4PB9H 3PABB 2PWDA 4JJ5B 1TUPA 4CVWA 2LABA 4KNSA 4JFDE 5DJAB 4N8CH 3E1ZA 3E2HB 4M8UA 1F11B 5DSCA 2ORBL 2DQJL 5IFHH 1T66D 2VIRA 4XODA 5LXGL 1DJXA 2OJZH 1DBKL 4ZMVA 3PUCA 4F3FB 4C55A 2EYSB 2YD4A 4FFYL 1XZ0B 5HPMA 3AABA 4UT6H 3S35L 2ATKB 3ZKMD 3RIAK 4XE0A 3BMWA 3ZE2B 2ZKHH 3LKPA 5IT2H 3LIZA 4H8VA 5D7JD 1MFBL 1CIDA 3QJQB 5I16B 1J05B 3WTYA 4OZHB 2IIJA 4E5XB 4L4VD 3S36L 1KLGB 1ZV9A 3L6FA 4DFIA 2FBJH 4J4PC 1NCHA 3MFFB 4FFWD 4WWKD 1NICA 3C12A 1XR9B 3MRKA 4NN7B 5FUZH 4LLAA 3O4LB 3QIUA 4NUJB 1YYLH 3JWNE 1HCZA 4MZRA 4N87A 3QEQB 1T2XA 4QT5A 5DO2C 1HJBC 3ZT5A 3M7FB 2JKXA 3BVUA 4HS3B 4TTDC 1BHGA 5FO9A 4XTRC 1TQTA 1MJ7L 2FE0A 4HS8H 4JGMA 3RWCA 4G72B 3MOQA 4LSRH 4U6VH 1WWBX 1XSOA 3DWTA 3H55A 4IW4C 3IMWA 4FKKA 4I85A 3OQRA 4B9KC 2GK2A 4LCCC 4PJAA 3IEAA 3NIGE 4TVPD 2X9WA 3N43B 4DIXA 3BH8B 3MODH 2E6PA 4JQVA 4YDLC 4OQTH 1NA8A 3DURA 2NY7H 5JHDA 1J10A 1PG7L 1D9KB 4PV1C 5DMIH 2MHAB 3MPCA 4HKBB 4TVPL 2OL3L 2IBBA 5IHWA 5HHMD 4YEEA 2DD8H 3APCA 3MRIB 1AMYA 4MNQD 2DBLH 3ULUD 3MRBA 4M61A 5MEPA 1AZUA 3DX8B 5DQ9B 25C8H 2YEZA 3P9MB 3QJUB 4YLBA 2IWFA 5HDQH 3TLRA 2BVTA 3HC3H 3GSVB 1F58H 1FLRL 1XMEB 3QJXA 1AD0B 1ERNA 4GRLB 5CIPA 3VMNA 5B3JF 4Y4KD 4G7RB 5C3TA 3O6FB 1IU1A 4UIMA 1BJ8A 3FB5B 3ULUL 3DO3A 3HZVA 4J8RA 1ORQA 4JDEB 2H3XC 2ZG1A 4PJGB 1GC1H 4OI7A 1E90A 2GBTA 5T1LA 3CZLA 2NNRA 3MRPB 1XCWA 5B1CA 1MFMA 1SF3A 1RIVH 4G1MB 4JY5L 4RRPA 1LE5A 4WCYH 3TBYA 3VVWA 2VC2B 1N6QH 3GLDA 2PW2A 4NZUL 3Q3GA 3SE9H 3IU4H 3V7AG 5I1LA 3SYQA 2DWXA 3E7JA 2Y7OA 1T0OA 4X6EB 1XD1A 4QJ5B 3WIHH 1XX9C 4EI5A 1R3JA 3RVVC 1AY1L 5FA4A 1KYFA 3Q2CA 3SOBL 1UXSB 4N0CC 4WUKL 4PV9A 1OTUD 3EOTH 1KB5B 4GO9A 4NQXB 3F6JA 1AHWA 3VGDA 3KG5A 4F7EA 1ZTXH 4NQEA 3ZZQA 4K5LA 4XXCC 5IOPA 5I6KA 4Y5YB 5TDOA 2DICA 3AB0C 2VLJA 2BNQB 3CXFA 2CBMA 4MLSA 2Z35B 3HRZA 3EXLA 3FH7A 5SWZB 1YC8A 3JTSB 5HDOA 4L8SB 3BN9C 3D85D 4LRIA 2I07A 1TFHA 4IGBA 4NT6A 3MZGB 4Z18A 1KGWA 3IFOB 2H2PD 2QR0B 5KOMC 3VXRD 4X7SH 2VN4A 5K93A 4WENB 5MEQB 4HUUB 1WG3A 1WTLA 4UV4L 4CVXA 2ZWYA 3MRHA 5CZVH 4XPTH 5DD5L 2ARJB 2MCMA 1TYRA 4NUMA 5HDRA 1G7JA 5HI4C 4MJ5A 3QJZA 5JDSB 1FWXA 5TK2A 3GUTA 1LEGA 1ZDQA 2FJGB 2JK5A 3OF6D 3I75A 4PJAE 2F1AA 2F7OA 3I50H 4NGHH 2JCCA 4KOBA 5AVTB 3S5LG 1T4KA 3FBKA 5JO5A 3Q44A 4N2BA 5FW7A 4KZ0A 1NGZA 1XAUA 3FT2B 3L81A 5E6ID 5JHDE 5C9KA 5TPWH 1Q9WB 2JTDA 1FCCA 3AS0A 4CBZA 2OMZB 4FNRA 4IRJC 4UM9A 1DUYA 1E2ZA 1HILA 4IIQB 1TEFA 1IC7H 2X4QA 4PS4L 3SE6A 4AL8L 1AQHA 4I5BA 1CFMA 1A4KA 3KLQA 1F02I 5F44A 3Q5YA 1K2DA 2GC4C 2QL1A 4LDLB 3O6MH 4LFHD 4GAGH 4M8QB 2WBJD 3QFGA 4BFKA 4DKEL 1RJLA 3QR1A 1MHCA 1M7XA 4RGND 2JKIS 4FRWA 4PLJC 3BPLB 4K3EL 3NCBB 3A4AA 1FZJB 2X6UA 4OCLC 4BDVB 4RFNB 1XAKA 3WHXA 1M05A 2ALAA 2KLSA 4L8BA 4ZSOB 4Y9FA 1BYPA 4QYAA 4XP6L 5H37G 2X4NA 1FDLH 1N0XH 2TSBA 4A6YH 3C5SB 4IK6A 1I3RA 4QXGH 4NQQA 1OB0A 4NKMB 5EF2A 4G9DA 3BW9B 1ASQA 4TNVF 1S7SA 1FJ1A 3H7BA 2MRYA 2ILLA 1WJ3A 3FTGA 3FO9A 2OPCA 1QSEB 5GSRB 3P11L 1GGTA 4JPKH 4HYTB 4PUBH 1ZGLB 4UDUB 3CV5A 1NFDA 2ICWI 3X1EA 2ZX6A 4I77L 3ARBB 4LKCB 3VFSA 5C0JB 2XG5B 4H8WC 3H9HB 4HG4J 4FJYA 3L4VA 1A6TA 4L4TA 3EHBC 1QYGL 2R0WL 2H9GA 1RZ8B 1PFOA 2C4FU 5E00A 5I30H 2E7LA 3RGVA 1MFDH 2DEXX 2UZIH 3OKDB 3OMIB 3ZKXB 2CMRH 2OTUA 4AW4A 1JK8B 1ETJA 5E24E 5KYXB 2J55A 4FCAA 2HRPL 4OJEH 4B9JA 4NQEE 1SN2A 1E4XL 2V2WA 3PL6A 4K73A 1LD9B 2VLJE 4HCRH 3EGXB 4FI8A 3IDMA 4HF5L 2ED8A 3LQAL 4PJEA 4PIBA 1T0MB 4JLRA 4KHXL 4KXZH 5K59F 3D5OF 2FX9H 5IREA 3MUGA 2PCYA 5C08A 1ZLSL 4PYHA 5T33H 4L5FE 4QHKJ 1SXNA 2FQEA 4H0HB 1TJIL 3VXUD 4ERSH 3CX2A 3CVCA 1ZVNA 4M3KB 1S7VB 1U6AH 2ZUUA 4FQIL 5K1NA 4KXZI 1U2CA 3OXSA 4JY4A 4KFZC 3DBXA 4GRWF 4FQ1L 2Y0SA 5D6CB 4MMZA 3EO0A 1FGNL 4X6BA 4W93A 4KJWD 5EZOH 1R47A 1UYWL 4YDKH 2JCCE 3MOAH 2VABA 5CCJA 5IEKB 3S7GA 3FSOA 3N3EA 2NR6D 3QQDA 1FVCB 1IRAY 4K3DH 4NUPA 5AW2B 5I0ZA 1IAMA 1U8OA 3LN5A 2P24B 4JFOB 2XA8L 3QCUH 4ONFL 1Z3GH 2GBUA 5T1DL 1KYOK 2OZ4L 3MRCA 4BSWA 1MVUA 2BHUA 2AITA 4G7YL 4W4NA 3O81A 4ZFOL 2YD0A 2V8MA 3D39B 1FN4A 5LCVH 2Y2YA 4HFUL 4Y16D 3AJ7A 4AQ1C 2CK0H 3ORJA 1Y18B 3DGDA 3HB3C 3VB8A 1TZ8A 4K3GA 3IXTA 3KHQA 1CDJA 1G0XA 2XQBL 3DMMC 1WGOA 3EFDH 4FHKA 4G8FB 5JHLL 5KSAA 2FNWA 3TNNB 4IRZA 4JFHE 4PGCB 4R2GB 3SKNA 1QHPA 1M6OA 1U8PB 4G5ZH 2QQKH 4QOKD 2XV2A 4IRZH 1NH6A 2Z7ZA 3BZ4A 4WV1B 2JCWA 3HN8A 1CF1A 1YNKH 3SDXA 4L3EA 2A9CA 4N0RA 3PWPB 1EJOH 5JQ6H 3OM3B 2YSSB 3Q8AA 3IPEA 2VLRA 3FUIA 3UADA 5GISL 2YD1A 4JVPA 4NFBA 2R9HD 3TC9A 3ALXA 2C9AA 1NFDE 5FYKH 5GS0C 2WZPA 4JDVB 2LQRA 3T3MF 2HKFH 1KN4L 5ALBL 5C09B 4PVNA 2NY5L 2XC8A 3O11A 2BIHA 3BQUA 3D18A 4KI5F 4L4TE 1MW3A 5AW4B 1CLZH 2IDSA 5GRWA 1O7DE 1S7RA 3LPOA 1KDJA 2YKLH 1J1XL 1DLFL 2DZEA 4YBLC 3IJEA 3QDJA 1ZPLA 4N1EA 1ZT1A 4I2XB 1AXSB 1ZWIA 2K1MA 2A38A 3EG9A 2XWJA 1UG9A 1DVUA 4XNZB 1WIPA 5HYSG 4JDTH 3BAIA 5LWYL 1QR1A 3QI9B 1RZJC 3OX8B 4IOSA 1KN2L 4HDIA 4PJEE 3L9BA 3OR7A 3NZ8A 3D30A 5I8CB 1WUNT 3MFGB 4G6KL 5C08E 4ZUVA 4YHZL 1S78C 1T21A 4PLOB 1E4KC 5AOJA 4EOWL 5FLVA 4LLDB 3DGGB 1SN0A 2MKLC 4ZTPH 1T03H 1I4FA 3B43A 2NXZB 1MWAH 3FYIB 1A6VL 1R5IB 3EJQA 3SGEI 2DM4A 4EN3B 3QO1B 1UXWA 5A2KH 5EBMA 4OZFB 4TTGA 4C56A 4K7FB 3HG5A 3QEUB 4CJ0A 3HFML 3HZKA 5I0XA 3LQZB 3WG7B 3ZKSD 1Y6MR 1QFWI 3B7UX 1MXDA 3BT0A 4OUOA 1VZIA 3LB6C 4APQC 5LDSA 3P3SA 1C5BH 4B9FA 2TAAA 2OMYB 5B22A 5CR8A 1KCUL 1VHPA 4KTYA 4GMSH 3N04A 4M1DH 4LHUA 3NGBC 2J6EA 2YD2A 2ZUYA 2EO1A 3FZUD 4PD4K 2MOGA 2PF6A 4XC3L 3UAJA 4YLCA 1UEYA 5C0CA 3UBXB 5FHBL 1MZYA 2VH5H 3AG2B 5EU4A 1F1AA 5DMKA 1YPZB 3KCPA 3MV9A 3ZO9A 4PTUA 5F7BA 4U1GB 5CZRA 1S5HB 3MGOA 2UWEB 3FUKA 2C3VB 1IARB 4CAGA 2HG5A 5AAMC 3SD5A 1QNZL 2OXGB 4LOVA 1CT8B 1GXEA 3SDXE 5AOLA 5DC0A 4L3EE 2CNZA 1WFNA 3PV6A 4BFBD 1NPUA 5DEGB 3RDJA 3H6JA 4ETQB 5IW1A 3LNEA 1N5YH 3SGKA 1CICA 2VLRE 4LAJH 4NO0D 3BWZA 4HFWA 3TN0A 3U25A 5F9WB 3W38A 1OWWA 1FE8H 3F05A 1CFQB 4XBMA 2PO6B 4N2AA 3QC6X 1EK3A 1DBJH 1Z1WA 1MFAL 4WI9A 4XN2A 4DGIL 7CGTA 3ULVC 1A9BB 1DZ0A 2FSEA 2ZNWA 3IDNA 1DJIA 4IQHA 1DL7L 4FQHA 5JIPA 3FB8A 3RU8L 3SDCA 4F58H 1OGAA 3QDJE 2EYTA 3ASWA 4OGAD 3HG1A 4QCIA 4GUOA 1BXVA 3AXIA 4YZFE 1IKFH 3MBEC 5GZOD 2HMIC 5KJRH 1JGVH 1JK9B 1KLUA 1U8IB 3JWOH 4U3HA 4XOBA 5IVXF 4S0HA 1LHZA 1YG9A 4NQDD 1NMCB 1P4BL 2K4WA 4JRXD 4KY1H 3F5WA 4TUJA 4OLUL 3L4TA 1L9OA 1UQSB 1P4IL 2WXMA 5HGDB 3ZL2A 5IHZA 2UZPA 2EUXA 4XO8A 3RUGB 4Q6IB 1J1OL 1FYTD 3M86A 4XCFL 1HL9A 4MYPA 3LN4A 4MQSB 1NCBH 3AWEA 5BZDA 3DPBB 3L3HB 2VQ4A 4LCUA 4K4KA 1XIWC 3DSFL 4P4RA 2B15A 1W80A 2LW3A 4JM2D 1D5IL 5G5DB 3MLZH 4Z1PA 1H15B 3HC0B 4P2QD 1E3FA 1QR4A 4G11A 4L2YA 5SWSA 4BQ8A 4AVKA 4C56E 3VFOA 5TH2A 5L4JA 2Y6TE 3B2UD 4X6FA 5DR5H 5KSBB 3U2SB 2JKLA 5E7FA 4RMVA 3SDAA 1ANUA 3IS0X 3VFVB 2CZNA 6PCYA 1UD4A 2IH9A 1JWUA 5CLTA 2PP9A 4ATTA 5C7XH 1L6ZA 3EZJB 4U0RC 4DZBA 4EI6B 2GSGB 3DYPA 1E8YA 3WELA 2UY6A 1YEEL 3IDGB 4IBLT 1PKOA 1OPOA 3QRGH 4MAUH 3T8XA 4P2OC 1K4CB 1HWWA 1QLFB 3LV3A 3NCXA 5HGAB 4NRYA 4A68A 5C0CE 1HOEA 1ZVSA 3MA9L 4AGLA 1IE4A 2VE6B 5T1JA 5JQHC 3ZTEA 5TF0A 2X9ZA 1FC1A 3GTNA 4MYWB 5FWRA 4F8NA 1UH3A 4KKLC 4YNYA 5E9DA 1MJJA 5FUOH 3NESA 5IZ7A 3MV9E 3WFBL 2JE8A 3LEXA 3MUZ1 5AD0B 4UT9L 3WIFA 4GRWH 1KBGL 2OW6A 2IBZX 2VUOA 3G9AB 4GSRA 3TA3D 3UZVA 2B8OT 3WL9A 1Z0MA 4PCKA 1WTGT 4C4KT 1NLDH 4FOMA 1TETH 3BO8B 1MWOA 5F1SA 4LKXB 2RCSL 4WI5A 1ZCRA 2HKHL 3ZKND 3ZOAA 2WXQA 3ZE1B 2CDGA 4TQEH 2G9HB 4FYRA 2VO8A 3FT0A 4IKNA 4YO0B 3B9AA 1U8JB 3FONA 1PIGA 5I1JH 5JTWA 4WUUB 1G9NL 2WKOA 3MCKA 3ZKQD 1KF9B 1NMBH 5D7LB 4ZYKA 3VSVA 4X5PA 3K91A 4N2MA 4AEHL 1GSMA 1U2HA 2EZ0D 2BHFA 2Z31D 4JFZL 5H37H 4XN7A 2Z8WC 3ES6B 3KPTA 3VUAA 5EWIL 1OGAE 1H6UA 4HLZG 5F9AC 4KXCA 3KYKH 4AQZA 1IIIA 2DYPA 3N44F 3IGFA 4QHPA 5KVMC 1JXFA 1HSAA 4CA4A 2BSCA 2R56H 1JV5B 3KXFD 1EGJA 4QXUH 3H2QA 3ARFA 1WD8A 4YHKL 5I1EH 4ZI8A 3CVDA 4ANUA 1S3KL 3VX0A 5C0GB 3VTTA 3A4EA 3T0XA 1B6DA 3T4AA 1OARH 4DGWC 4OLYH 2X6MA 1QW8A 1WFOA 15C8H 2FECL 2NDGA 4FXKB 1BREA 5J3HC 5D70L 5CJQL 4DVRL 4LMQI 1CR9H 2X4UA 2MTPA 4YDIH 2CKBA 2FUTA 3EGDA 5FA3B 2VDQH 2ZUQC 3LHPH 3NABH 3T0EC 5AVSB 2XZCL 4CC0A 4UMGA 2OYLA 2BNRD 4JAMA 4J1UA 4Z78B 1GIGH 1HQRB 4AIXA 2VDRH 5AL8A 1I8AA 2H0JA 3GIVA 5SWSE 3UPRA 1DCLA 1LK2B 2QPUA 2XWZA 1FQ9C 2DF3A 4M5YH 5HGBA 4PRBB 4XZUB 1MNUL 4XWOC 1MAMH 2A9BA 1F86A 4LP5A 4DZ8A 4JFFA 1ASPA 4Z0XB 1PDKA 4NCC1 5DJCA 1WLHA 4J23A 4PBVC 5HHXL 4U7SA 2BVPB 1UM6H 4MDJA 1CE6A 4PJDF 2ZYHA 2G0LA 4BEIA 1SEQH 1BYOA 2MPVA 1BJ1J 3GMRB 5TE6H 2PXYB 3B5TA 4ZMYA 2RALA 1Z6JT 4FYQA 1EFXB 4ZXBA 1DQLL 5D4QA 5C70A 2EEAA 2G0KA 4BA0A 1XH1A 3D3VD 5CJXC 2NYYD 4NFDA 2WNWA 1P84J 1KEML 5LUMA 4LGRB 4LCIH 3C6SB 1JF5A 4Z3GA 4XB3A 3RL2B 2J4WL 1UJ3C 1BAFL 3QIBB 4I1NB 3RY5A 5E9DE 3LPFA 1T2QH 1NGXA 1SJXA 4JN1L 3EJZC 3QHZL 2BWDA 4JM4H 3MNZA 1S6NA 5TDNA 1LO3H 2B16A 2XTJB 5E2UL 2M26A 5E2VH 3VI4B 4ABVA 2Q8AH 3PQYA 3LSOB 4Z7VF 2HJLB 2BSDA 4OSUH 4XBGB 1QEWA 3GSXA 3QDME 1KZYA 3CX5K 3DRQB 2EDMA 4NAMA 4LSDA 1IM3B 1MUJA 1VFBA 3KGUA 2OMXB 3OR6B 4V33A 5CMAA 4YEFA 5D1XA 4RAVB 5DYFA 5HPOA 3N42F 2DMGA 3FOLB 4LVOC 1PW3A 1Y6NR 1CFTA 1JL8A 3V10A 4H0IA 3NA9H 4MAYC 4GO8A 2X1XR 3FB6B 1PYWB 2B7DT 3CSPA 4HUVB 3DXAD 3MCLL 1QW9A 4JQIL 4BQ9A 1EMTL 1OW0A 2WMPB 4OZGE 3HI5H 5JOFB 2VSMB 3GB7B 4W9KC 4DW2L 4HX1A 4FQXD 5EO1B 4L8DA 3GTTA 2NTSP 2P80A 2ZP9A 4HJJH 2CPCA 1LNUA 4BKLB 2PABA 3ECBB 3QQXA 4MNHA 4X50A 3LNFA 4AT6B 2RB8A 4JRYA 4Y1AA 1MXGA 1RZPA 4IOFD 1BAWA 2XIIA 3K3QA 4NM4L 4JPVL 2JB5H 1YZZA 1ZSDA 5D9SA 1KJ2A 4Q7DA 3MBXL 2OI9C 4FFTA 2R2BA 2ITDA 3UTOA 1N6UA 2BOLA 5HD8D 4FYTA 3WLBB 3HS0C 2WNXA 1KJ2H 2FO4B 1D6EA 3TVMC 4AM0A 4FL4B 2I9TB 1OK8A 4EMZA 1KXHA 2ZXCA 3L4CA 2WB1A 1F3DJ 2WINB 3C09C 5GGSY 2CHNA 4PRDA 3LPPA 4UTAH 1N4XL 5B8CA 1JNNH 5IVOA 1WICA 3LS4L 1PX3A 2WLJA 3RZWA 5IHHA 4JFXB 3GMMA 5I66A 1M4KA 2DWDB 4JFFE 3RX7A 4GS7B 3F12A 4PCTA 3TH4T 4G80B 2DH3A 1DVTA 3INOA 5F7MC 5IFJA 1V3LA 3H1ZA 2Y07L 1NBVH 3WLWD 4HPYH 5I6XC 3VVVA 2W1NA 3STLA 4QNPE 4ZBJA 2FSDA 4U1HB 2WXJA 2FIRT 4WEBH 3EZ8A 4XCEA 1FCGA 1Z0NA 3EH4B 1W6LA 4H44C 1HOCA 4HT1H 4EZJA 1QSFA 1ZEAH 2OL3B 4O51A 1L4IA 2FJHA 5I1AB 2WUBL 4KKQA 3ABMB 1V7MH 5DZJA 3UGEA 2QQLH 2R1WB 3GMLA 1W0VB 4S1QL 1WQVT 1WVZA 3DIFB 3LEYH 2X44D 3CZEA 1OAKH 3FTZA 2YJQA 5BVJB 1BZ8A 3IFNH 1B0GB 1BAGA 1ZANL 4MA3B 2X6VA 4F9LC 4EO5A 3ETTA 3FN3A 2GPZA 5K33A 3KPMB 2NZIA 2QZQA 3JBG7 1U8NA 3QUXA 3L3IB 3PQYE 4N90E 4OLWL 4DKFH 1JZ4A 3Q8BA 1ASOA 2X4TA 2X7LB 4NOFA 2J5WA 2Y2WA 2OMUB 3GGWB 5TF1H 2DS4A 3LPGA 5BVPL 1XF5A 1LLAA 5K9KA 5BMFL 1SXZA 3BXNB 1BQHA 1HHIA 1ES0B 5D1XE 6CGTA 3CVHA 2XIBA 3WJJA 2ZAHA 2ISDA 2FTAA 3DRTB 3EADA 4MA1C 4HXBH 4OF6A 4PSPA 2HH0H 1UFGA 3QDHA 2I7OA 2BMKA 1UWGL 5F6IC 4ALAL 4OZIA 3RL1B 3LRMA 3VXMB 1PZ3A 3T6QC 4QHMA 4HGKC 4GT0A 4M4PA 4C83A 4AQAA 1EAPB 5LAPA 4NN6B 1NM9A 5G4NA 1JGDA 1A8ZA 3FU5A 5L2KB 3CFBA 4U1NB 2X6BA 2DOCA 1AANA 4U6YA 3ST