2W5PA

Drae adhesin in complex with chloramphenicol succinate (monoclinic form)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
140
structure length
140
Chain Sequence
GSFTPSGTTGTTKLTVTEKCQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPTDNSAWTTDNGVFYKNDVGSWGGIIGIYVDGQQTNTPPGNYTLTLTGGYWAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structural Study of the Interaction between the Dr Haemagglutinin Drae and Derivatives of Chloramphenicol
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords DR HEMAGGLUTININ STRUCTURAL SUBUNIT
total genus 29
structure length 140
sequence length 140
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 2w5pA00
2JKLA 2JKJA 2VERA 1USQA 2IXQB 2W5PA 1USZA 1UT2A 1RXLA 2JKNA 2BCMA 1UT1A
chains in the Genus database with same CATH superfamily
1R19A 3G6JA 5DMIH 4AL8L 4X42A 3TZVD 1DQDL 3ZQXA 1XEDA 4LCYB 2H2SC 1L0XA 4UM9A 3PU7A 3WUZA 2O5XL 2EXYC 3S3BB 1K4DA 3T6XA 3BAEL 1EVUA 1S78D 2Y5TA 5KSUB 4QXUH 2FX8H 3ARGB 1LO2H 3HZ3A 3BAIA 3L4CA 3N1FC 3JBG7 5AB0A 3EFDL 4MLSA 1A6AB 1KJ2B 3MX0A 4LCCC 2H1XA 5ACMA 1G7MB 4BYHA 2W8CA 3FUJA 3PABA 4QHMB 4YLCA 3FF8A 1NCDL 2HJLB 4ZNEE 3VXNB 1PW3A 2WBWB 3AB0B 1Q4NX 4HPYH 3U4AA 2CO7B 5AOKA 2WOBA 1RZ8A 1KGYE 1QSZA 4I9XA 1A4KB 2V3FA 5DZPA 1JZ3A 1NBYA 5C0RH 3P3TA 2ZIDA 4O51A 4Q56A 2PO6D 1E4KA 1T4WA 5DR5L 5BRZE 3JWDL 1J8RA 3APMA 4FQQA 2VZVA 3K2UL 2QVKA 4LQ1A 5D7HA 4ZNEA 1T0MB 4D0DA 1PX3A 5B39B 3W5MA 4LVEA 1NCUA 1TZOA 4FTVB 4XX1E 1I8MB 1BSIA 2E47A 1IQWH 5T33L 2PUQT 3ARFA 3OL2A 3CHXA 2AEPH 3UTZA 3O45B 1HNFA 4LCCA 4R0LA 4Y4FC 3DX7A 4GLRI 3RVVD 4GPVA 3B2DC 1FL6A 3WN6A 4NHCH 1KIQB 4BQBA 3CSYB 4LOEA 7CGTA 5J6GB 4GRWB 3N40F 4P59H 3B2VH 5AOMA 3RVUC 5IVXF 3TA4D 5E1GA 3VXTB 4WFGD 3E8VA 1WGVA 2YD2A 3I3EA 1JP5A 2H9GA 1UZGA 2VDNH 2D4DA 3DA0A 3SQOL 3Q8BA 2BIIA 2I07A 1PEWA 5ANME 4IIQA 2BY3A 4R5TA 1KGJA 1UD4A 1VESA 5CWSB 3VXUD 4DW2L 5I66A 1S7UA 4BUHA 3ZTDC 4GRMA 4AGOA 2FR4A 1WD8A 3OKDA 4YSRA 2CXGA 5D96C 3P0YL 3MUY1 4XR8C 1GMIA 3BP5A 4XO4A 2X4NB 4OZIA 1E30A 1YNLL 1ZY9A 1TLKA 3RWEB 4BWTA 2ZX6A 4XBGA 4K8RC 2I9TB 1JV2B 3U48A 4HT1L 1KPVA 3B2PA 1BQHA 4O4YL 1IBGH 4PRPA 2D7MA 2R2HA 3UYPA 2X2IA 3EGSB 3TT3L 4AQEB 4F7TB 3MNVA 2PO6A 5ID0A 2XZCL 3F83A 4CILA 3MLUL 5G55A 2W9DL 1HXYB 3INUL 5GSVA 4OZIE 5KAQG 5EOQL 4W6WB 3UCQA 4AENA 4OZGE 1QBBA 2W0KA 5JLZA 3MOBH 2AC0A 5GGSA 4BZ2H 1FVCA 4M4RA 1EPFA 1ZTMA 3DRQB 4UT6H 2WW8A 3MLRH 3L5HA 2P5WE 4FZEH 2VXVL 5AYQA 1EMTH 4HIJB 3OAYK 5F7DB 1FWXA 4XMKH 1YUKB 1ZT1B 1A1NB 3OLEA 4XPFL 4Y9BA 3II3A 1QA9A 3BKML 1TQBC 3QUYC 4DUWA 5C09A 3MLTB 1XCQA 1XR8A 4LE8A 4PS7A 4Q6IC 1WT5C 3AS3A 3IFNH 5GJSL 1P5VA 2IGTA 1ZSHA 4FQPA 4R7NA 3WFHB 5ESAB 5GGUA 3ZYOA 5E9NA 3EYFB 1J8HA 1HQ4B 4ODSL 2AK1H 4ALAH 1IARB 2F53E 3DOIA 3EHBD 4HIEB 3IMBA 2YXMA 4DP8X 2WJ5A 3IMSA 1I7ZB 1QEXA 5KVFE 3UZVB 4U4IA 3D2UB 3NJMA 4NBYB 1TZIB 4YDMA 5DVOA 2XA3A 5GRVL 3SE8L 3SPVB 3WKPA 1R5WA 1U91A 3CN4A 4NWUL 3VWJC 2APVA 2WLIA 4YDNA 3IVKB 3AY4A 1TEFA 1EHKB 4DK5A 2H0FA 4RFEB 1C8PA 5D1QE 1INEH 2WUBL 3RY5A 1QTSA 1WFMA 4DEWA 5HHOB 4XNQA 4WV1B 3GXTA 1JWMA 2CGYA 4M8QB 4AKPA 5DEZA 3RL2B 2A4EA 4XHJD 2CDEB 4HDIA 3VB9A 4FC3E 1NPUA 1T83A 1I8LA 2PWEA 1A6AA 3V4UH 2EADA 3BSZH 4Q4EA 4F8OA 1BQRA 2FIRT 1QRNB 5SWZD 4XNXH 2CO6B 3DX1A 1UWEH 2V5YA 3OKMB 2OX5A 3V52H 2I5YH 5I23A 2A4CA 4OCMC 4DF9A 1WCBB 4U6VH 4N2HA 2AANA 4YIQB 4IKKA 2AEQH 4CADA 3MJ6A 4Z6AT 4BELD 4Y1TA 4HOMA 3ARDC 2BW4A 2VC2L 43CAB 5AD0B 1A7RH 5EULV 4O51B 1AOHA 4GG6A 1RK0A 3JZ7A 2WQUA 4G5AA 5I74B 3QO1A 1FGNH 3HFML 1A6VH 2WTRA 5D5MB 3ZDWA 5DA4A 4WFHE 1QFUL 1DBJL 1HN1A 3VCLA 1OTTC 3I3DA 4FTVA 3QIWD 1UATA 2J88L 2R9HC 2Z7UA 4EE2A 2I5YL 4D0CA 1U8JB 2X1QA 4XP1H 5I8CA 1CXEA 3RG1C 1ML0A 2DIEA 2J6EH 5B3JF 5DJ0B 1HHGB 1QACA 4LCIL 1CK0L 4BZ2L 3LKNB 2HT4D 4KK5C 2J6WA 2RACA 5ETUA 2RH0A 1JK8B 4BSVA 5B38A 1W91A 3U9PL 5D93B 5J6GA 3TCLA 1G1KA 1KBWA 2VR5A 3TO4C 3JV0A 4P57A 3LH8A 4C56E 3KD4A 4EDXB 1CE6A 1HU8A 4LSSL 2XG4B 2KLRA 1IAKB 5DZAA 2JCCE 3Q9QA 2XOTA 1N5AA 5BVJB 2C1OB 2GHWB 2FGZA 3N50A 1LDPH 2YJLA 1HILA 3NZSA 1ZE3H 3AJ7A 4X50A 4Y2OA 4I13B 3KDMB 2B7DT 3OAWA 4N3TA 5I1HL 1V05A 4JQVA 5KBPA 2ALAA 4WV1C 5T3ZE 5I66B 3VVVA 1G6RB 1RFDL 5GGVL 4NNYB 4QCIB 8FABB 5ESVB 4YO0A 4OAWB 1HQRB 2A74B 1TVBA 4M6OL 3BIKB 4M61A 3QUZA 5EIIA 3BP5B 3DXAD 5IB4A 3RL1B 2QADB 2HT4C 1ETJA 2I60H 1BIHA 4X7FC 2I32A 4N2GA 1EHXA 3TURA 4Q9QL 5E08H 5I30H 1KGUA 1MFUA 5LAXA 4CC1A 3WS3B 2CK2A 3HS0A 1X5MA 3O8XB 3SKOA 1CBVL 1MIEL 3GI9H 4L37A 1IFHL 3NRFA 3W56A 4HCGA 4S0TD 2NUPB 3OAZH 3TH4T 3PWUA 5IMLB 1MNUH 1P1ZA 1PLGH 4X5XA 2NY7L 3V4VA 2Y7MA 4R6UA 3T2NL 1AXTH 4DESA 1U93B 1V7NL 3VSQA 4XVJL 5AQ0A 4LSPH 2J8UB 2CBOA 1CUOA 3L5JA 1S7SA 2LFGA 5K9QG 5F3HA 4L4TD 4I18A 3UADA 2CRYA 3V5KA 1W72L 3LZNA 1V27A 3DO3A 3K8MA 3LHPL 1XCQB 4K7FA 4PTUB 5LVEA 5KJRL 1RURH 3HG5A 1T20B 1VLXA 2EKSB 1CLOL 3MCLL 3P02A 4R4NC 5KVDL 2QQKH 3RE0A 4N2MA 4U1GC 5ESAA 5GGUB 4LPTA 4Y1AD 1MAML 2N7SA 2Y0SA 4Y9EA 2IAAC 5HJ3A 2NNFA 1D6VL 1L5GA 2AJSH 3RVXD 5IREA 3B9KD 4MNGA 4HD9A 4MBRA 5F0LB 3D4ZA 1N5YH 1QBMH 1WUNT 3LEXB 4LPWA 4AW4A 1FNEB 3GYRA 4P2OD 4M6ML 3QIBC 4WENB 3D2UA 4M5ZH 2LTQB 1FYTB 3JTTB 2ZTBA 3VJ6A 4BCYA 1RURL 1D2PA 1XSIA 3UABA 3WIHL 5FHBH 3RWHB 2ZOKB 1X6NA 1KPRB 2DAVA 4HIXL 4TVPD 1BVZA 4NZRH 2GBAA 2EO7A 2WBJA 2GT9A 1BBJB 3C6LC 5TFSL 3WXWL 3JV4B 1S9XA 4GG8B 43C9B 2R8SL 1AS8A 2ZWYA 4UU9A 1I1AB 4ZUTB 5KBLA 4EBQH 3QJVB 3DNKA 4E42B 5KSAC 3FBQA 1NIFA 2G30A 5EC1A 2DQDL 1D7BA 3BPOB 1EFXD 2EH7H 2DH3A 1ZS2A 2PR4H 4H13C 1W8OA 3EZ8A 5FLVA 4YL4A 5CBAB 4OM0H 1V10A 3QJSB 6CGTA 2PTTA 4K23L 3DHPA 1X3DA 4PR5A 4JG9A 5EU6B 1IGTB 1JRHI 1MPAH 1YDPB 3P2TA 3MBED 3STLB 3W0WA 3ZUNC 4XHJC 1HAWA 4D9RD 4YIQA 4YSSA 4UTAL 2I25N 5F9AC 2VLKD 1CF8L 2ITFA 3NVQA 1L4IA 2K70A 2X10A 2ZG3A 3KPOA 4KVNH 2F5BH 3X3FL 4KOBA 4GP8B 4PBVC 5CR1A 5HHMB 3TEZA 1E6OL 2GVYA 3LYRA 4GBXD 4QHNA 1LO3H 5FV2A 5C1MB 5JXAH 3T8XB 1BG9A 1WRFA 1GGIL 1U21A 5E2JA 3VCLB 1Q1JH 1U6AH 2Q3XA 2D03H 1OLLA 1U8JA 4DGIL 2NCEA 3P0VL 3FQWB 5H37A 4F15C 4BFJA 4G8IA 1UWGH 5E6IB 4YOKA 3IWUA 3MRFA 1UXLA 4XBPA 1S3KH 3B6SA 2OZNA 5DJCB 2YAHA 4ZW5A 4RH4A 4JVWA 4ZO8A 4Y5YB 1IV8A 1JHKL 1UEYA 4UMGA 1R9FA 3CMGA 4KDTA 2WKOA 3MFGB 3VXOB 1JZ8A 1TJIH 1KCRL 3L3OA 4BDVB 4MAYC 2BSEA 3ARGC 3MLYL 3DYMA 1EDYA 1RSFA 3LZLA 3QRLA 5HD8D 4HC1H 3W39B 4MTMA 2WLHA 1T5XA 4ZMQA 5I0ZA 3KXFB 1QLFB 4R0LC 4Y4FA 1VPOH 3VM5A 1FVEB 3ULVL 2W91A 2FO4B 5C0IB 3L6FB 1RUKH 1A1OB 1BXVA 2B5IB 1LHZA 3G08B 3B8SA 4JANB 1RPUA 3KPRB 4NNYA 3DX2A 4QCIA 8FABA 5A1AA 1EZUA 3HAEG 3P30L 1R6VA 2WWMC 4XPTH 2AV1B 3H9ZA 2AEIT 1VB9A 4QPEA 4A2HA 1MCJA 3EFFA 4PD4K 2PYEB 4ELMA 4XNBA 1I7TA 3C12A 4MRCA 2PCFA 3F01A 3LKRA 3OKLB 4LKXA 3ZE0B 6PAZA 5DO2D 2WC7A 5DVMA 1AI1H 1KLFB 3ALXA 4JQVC 4H1LG 1ZHBA 4DT2A 3ZL4L 3ECWA 4B3EA 2XKUA 2QTEA 5MEND 1SOQA 2ADJB 2N0MA 3BWZA 4ZODA 1W8EA 3QDJA 1H0DA 1G1YA 3GMMB 4IU3B 4N2DA 4K3GA 3ZL1A 2RALA 2IBBA 1BF2A 3S37H 4BH8B 3CH1B 4P5TC 1LP9E 1K5NB 1YZZA 4K9JA 1F4HA 3W0WE 2N7BA 4GMSL 3U0PA 2VLKB 4NO3B 4NUMA 3GINA 2DD8H 4IHOB 5SWQA 4PRBB 3ZDYE 3QB7C 3KDPB 1N8ZA 3TLRA 5C3TA 2HB0A 3S5ZA 5FB8B 3VXUB 4RBPH 4BD4A 3VWKA 4WFGE 5KYYA 3V2AR 2LABA 4L29A 2J44A 2X9YA 2MTPA 5I76A 1FA4A 4PB9L 4Y4HD 4IHBA 3U79A 1F4YH 2HT3C 5C0CA 3WTSA 2J4WH 3V79C 5I6MA 3IJEB 4WHTA 3BC9A 1PU0A 4QMEA 3UO8B 4TUJB 4XTRD 4ODHL 1G9NL 3N41F 4YHZH 3UFIA 3FUNA 5DD1L 3LDBC 3UAJC 5CN2A 1IGIL 4ES9A 3PPEA 4L1TA 1RAMA 2VW4A 4IJ3B 1JRHL 3V5HB 4LAQL 3PJLA 4HKJA 3OMZA 3WO4B 1C5BH 2FATH 4H0HB 2QZ5A 4WSGA 4G6AD 4PGDA 1TG8A 4Q6IA 5CSZA 3LXCA 3I6LD 1QFUH 5CXPA 1ID2A 1Z0MA 3D50A 3EJJX 5D6DA 4KC3B 1R3HB 2E7LA 2ZX9A 1BAWA 3Q1SH 2VZ3A 4GSQA 4D8PA 1NPJA 1E6JL 4FLQA 3RJQB 1E4XH 3ZE2F 2Y06L 2A9BA 3V7AG 1J87A 3LV3B 3UAAA 3B4NA 1ZJBA 3DROB 3NABH 4PY7A 3HOGA 2IMNA 4TNVK 2FT7A 3QH3B 5JHDA 3LHPH 3VFGL 5DT1H 1QD0A 2PTTB 3HZYB 5E51A 2WQAA 3QEQD 2VGLM 4EZJA 3CSPA 5EU6A 5KS9F 1XGRA 4KH2A 4L5FE 2XWTB 4AJYV 4RMWA 3ILEA 1X7QA 3ES6B 4YEEA 4A68A 2Q7YB 3WHE0 3KPPB 2YUXA 4RGOL 2EIMB 3NQIA 3QUXA 3CFBA 1S9YA 4PRDB 5EC2B 2JELL 4PJIA 3K6FA 1S5HB 4OQTA 2O93L 3ZKXB 1IKFL 1CICC 4WTWA 5DJDB 1QFHA 4HS6B 3ZSSA 2FJGB 4G8AC 3CTTA 3GMOA 3OAUH 1LD9A 4IBLT 4HFUL 5GRZA 1KN4L 4CKQA 4TVUA 1E9PB 4PI2A 3CNKA 4Q14A 4XHQA 3LZFL 1DEEA 4FNUA 4UM9D 1QOKA 2A0LD 1K2DA 1BZ8A 4FKEA 3GHBH 3T6VA 3QQ3B 2JI1A 4IDJL 4S1QH 2VXQL 3WNLA 1E7UA 5SX4H 2LLNA 1ODAA 2D7NA 4NENB 5ALBL 1E50A 4NWTL 4NXKA 4ODSH 4OUUA 4LQFH 3MXWH 1BW8A 4QTHA 5GS2H 3HN8A 2KT6A 3MDJA 3IRCA 5E24E 4HOZA 2QKIA 4JHWH 4Z7UA 5E70A 1XAKA 5T3XE 3DYOA 4P5TB 5HDQL 2FVNA 3GJFK 4U1JA 4JY5H 3BD4A 3VXOA 3MNMA 4N8CL 4HJ0D 4MMXA 2BW5A 2UZYB 1JDAA 2MRYA 3TO2A 2YIHA 5KOVC 4DQOL 3EADA 3EJTA 4M1CC 3G6JB 4GMTL 3L2MA 4NWUH 4PIBA 4D8OA 1WG3A 1UD2A 5GSRA 3PXHA 1UC6A 3LB6C 4WHYH 5A3ID 2EIKB 1LTXA 4JANA 5A2CA 1FO0L 3GRBA 5E7FA 2CALA 2ZYSA 15C8H 3K81A 4HJTA 4OUOA 2ICEC 1MFAL 4U1NA 1QBLH 4LLMA 1FLRH 1ZIBA 1BAFL 1M05B 1RHFA 4ZMVA 3MAWA 4LASL 4AT6A 4F8QA 1IM9A 3QFJB 2XXMB 3AM8C 2A9NH 3A24A 2AJSL 3OMIB 4R7XA 4E68A 4GMTH 2R4RL 5DD0L 1MJ8L 4XNYH 4BK5A 1MFBH 4LSRL 2DBLH 2CUHA 2ZAIA 2BVEA 4KQ3H 1ZLEA 1GPOL 5AKTA 1E4JA 1EXGA 3W11C 2ZSWA 4N2AA 4PJXE 2EABA 4JPIB 4PRNA 4PRAB 5JXAL 4JJ5A 1RZJC 2VC2H 3L5XH 3P0YH 2DIJA 3QDJB 3FRUB 5HYQA 1CC3A 4XPHH 3G5YB 3MNDA 5EU6E 5ITFB 3WS6A 4AQ8A 4DP9X 1V8HA 3F6LA 5AL0A 3O2WH 1FG2B 4KKLC 3VA6A 2RA1A 4J3OH 1I8MA 1AYRA 3U9UB 2JIXD 4IHOA 4QOKD 2VZSA 1JGVL 2UV3A 2XPYA 3L5WB 5CCGE 1IGFL 2EP6A 4S1RH 4ZFGL 4KJYA 3FT3A 2Z35B 4FERA 5DWUL 1E2VA 1EZSA 3L3IA 4YGVB 1HSBA 3D52A 3JWNE 3KHQA 1AO7D 3OKOA 4J4PC 1Y0LB 3LRKA 4LSTH 1ZPLA 5GRUL 1MI5B 1YNTF 1A02N 3K6OA 1GJUA 2WXIA 3FU7B 2ITCA 2XQYA 3RBGA 5FM5M 3TVMC 4EAEA 5C2BL 2OI9C 3PL6D 1IO4C 3H9SA 2LHAA 5CGYD 5L9DH 4LQFL 5DZLA 3SE9H 2EXWC 3QPXL 2M26A 3E9UA 4YHKH 1SOSA 3L45A 2I07B 4UV7L 3RNQA 5BRQA 3NZ8B 2D7OA 2DJUA 3O41A 1FUNA 1AI1L 1EEQA 4JRFA 3R0NA 2VLRD 1AE6L 4UOQA 3MLSH 4B3VA 4IGBA 3ARZA 1AG6A 1PFCA 1BFTA 1NCAH 2HFFB 1NDGA 1H9DA 3MRJA 4MD4B 5I17B 1IQDB 2LFEA 5DMKA 4ANUA 4PH8A 4RESB 3PWVA 3MRKA 2V5TA 2VH5H 2WM0A 3NSYA 5E9AA 2E46A 1IC7L 2XI9A 2BP5M 5EZOH 4EI0A 3BCDA 4YFDB 4R83A 5TE7L 3HB3D 4WJ5A 2PO6B 2VB5A 1CLYL 1PAZA 4QRRA 3P73B 2BM3A 3BP4A 1K8DB 3QG7H 4LSUL 5K1VA 1WFJA 1KCSH 2C9VA 4X7SL 4AZ8B 5KTEL 1AZVA 5DI8B 3EYSL 1YN6B 2CJTA 3E8UH 1E2WA 4X6BA 3DC0A 3DRQA 4FKHA 5C07E 4F33B 1G9NH 1XXFC 1H8SA 4J3UA 3L1OH 4EO5A 5I6PA 4YHZL 2VT0A 1WSST 2WANA 1AQMA 1SEBB 2O6FA 5EOTB 5HI3C 4F7KA 4ZFFA 2VN3A 1E5BA 4MAYB 4UOZA 2DYRB 3RY6A 3MBWA 3UJIL 5F96L 1IEBA 3V9CA 5EUOA 1KZQA 4KROC 1RZJH 3N85L 1PBYA 1DEEB 4LNRB 5FYLD 2FCBA 5DURD 5E9DA 3S88H 4K71B 1GCFA 2IWFA 1JZ6A 4JE0A 1GGBH 1SJHA 4ONHA 3NPZB 1VGEL 4ZOEA 3OG4B 1CG9A 2O4EA 3WY4A 4GG6E 1JFQL 4FL4C 4KKCC 5JPMC 1A64A 5JHAA 4OUUB 1QWHA 1QSFA 1CFMA 5IFJA 3FBKA 2YC1A 1DBAL 2YRZA 5GRWA 5F93C 5KG9B 3F7PC 1NCHA 1YEGH 3BMWA 3HR5B 1YVLA 1BZQK 3D5OF 4P5TA 4WNQB 2BWIA 5E1HB 5C71A 3MKGA 1MLBA 2OAAA 3D85A 3ML8A 2HLFC 1AZBA 4J8QA 5L9DL 1XGUB 1U8KA 4HMDA 3VD1A 5B1BB 5JOFB 2BXZA 4OZHB 3JTBA 1YNTB 1GJWA 5HXMA 2BK8A 4K9EC 2Q8BH 4UOW0 3ZL2A 3KYNB 4E9SA 5AAMA 4Z76B 3ZTNH 1CFVL 4M02A 3SQRA 3DUSA 2OCJA 1NUFA 5HGAB 4Z7UF 5HVWA 4FTVD 3O4LE 1RZFL 3U0WH 1EZVX 3R4RA 2QQNH 2H41A 3AU1A 2GJZA 2P28B 2CLVA 4Q74A 2VM9A 32C2A 1L9NA 3UBXA 2X89A 5EHFA 4NJAH 3EJQA 5EH1A 1WFUA 5E8OB 1XF3A 4NN5B 2R2BA 4XXWC 5I71B 4JPIA 4PRAA 1YPZA 2X9ZA 5DR5H 3QUYD 4L5FH 1WD9A 3OF6D 4GUOA 4AE1A 2EE3A 5MEPB 5GZND 4IOSD 4KNQA 3AT8A 1BJ1H 1YEIH 2BO0A 3LZQA 5D70H 3X1NA 2GY5A 5MHSD 4FXKC 3UERA 1GS6X 1RSYA 3O11B 3F84A 3QPQC 4MMZA 4DZBB 3S9DB 4HIQA 5HDOA 4KTDL 5CNHA 1DCLA 1B0GB 4KJYB 5CIPH 1FO0B 3PHOB 1OZTG 4FLRA 4JDEB 2ZOUA 3DXAA 4EIUA 4HZAA 4X98A 1JZJA 3OX8B 1T66D 3TN0A 3K74B 3MLYH 4IKLA 4WEEA 1JCVA 5IQ7H 4G7VL 3US0A 3ARWA 1FCGA 1OGSA 2GHZA 1H6UA 2QPSA 2P24A 2Z93A 1TYRA 1KXVC 5I73C 2NX5E 3G5VB 4MA7H 4UT7H 5JUEL 3LPOA 5F1OB 1UH4A 1JHLH 3B9EA 2XG4A 4PJGE 2R4SH 5BNXD 3CDZA 3BRFA 4HUNB 5KBDA 4JCMA 4NEHB 1X6LA 2PXYB 2X87A 3RB7A 3EXJA 4QXGL 1QSFE 4PLKD 4MAUH 5TH2A 5JR1L 2O72A 3ULVD 3IGKA 3U2SA 2BVOB 4JZJC 1SOKA 3SDXA 2ZF8A 1MHHA 1PG7L 2E59A 2PR4L 2DQIL 4H7VA 3ZTCC 4J27A 1VPOL 4ZJ9A 4GUQA 3L81A 1OP9A 2FL5A 3A21A 3J7HA 4ANWA 4XMLH 3NJXA 5EIIB 2JCCA 5I17A 2XICA 5IBTH 5GPRA 3LEVL 1Y1UA 4HK0A 4ORGB 2ICWA 3SJVB 2YSSA 3FSWA 4PJBE 4ZQKB 5HI3D 5JO5B 5C08E 3U9PH 3EG9A 4YSAA 1KJMA 3RVVC 4XP4L 3O6FD 2H4EA 2G9HB 1KGCE 1XIWC 1K3ZA 5F9WB 2G5UA 3O4LA 4F20A 2XIIA 2JMRA 5DD3H 5CCHE 4P2QA 2HWZL 3KCWA 3KYOA 4KQ4L 3H53A 2VM4A 3V6ZA 2V37A 3X11B 4ONFH 5GRJL 5JDSB 1A6ZB 1KBGH 2CKNA 5IEHA 2ZUYA 4X7CC 1G9EA 2HG5B 1KLGB 1M3JA 2ODHA 3DBXA 3ZDXF 4FABL 3S8WA 3NRPA 2IXQA 4OU3A 1SDDB 1D7FA 2VAJA 4XXDA 4LLAA 5AW3B 4IOIA 4I1NB 2K1MA 1DQLH 1Z9OA 1SXAA 2NZ9D 3UEZA 3B7YA 5EU5A 4YR6A 3DVGA 1M2OA 4NI6A 1XWVA 3SBWC 1PD0A 2VKWA 5K39A 1BOGA 2ROYA 3LKQA 2RMNA 3MBEB 3JT0A 4KY1L 5HJ3B 2FBJL 1OF0A 5DEGA 1C8QA 5F9JA 3D9AL 3U6XA 2X5PA 2HSIA 1OQOA 1RJYB 1YHPA 5L0QC 2PW1B 3RJOA 1JPTL 2PP8A 3S2AA 2EXYD 1VJSA 2BOBA 3A4AA 5BXFA 5FUOH 4XVTL 5GS1B 1A6WL 3QE5A 3KS0H 4NQVB 3NACL 4CA4A 1YEHH 1OSPL 4LMQI 5CGTA 2IH3A 5I1IL 1PX8A 1TMCB 4G7YL 1U6AL 4RAVB 4RA0C 1F58L 5E4OA 1DLHB 3LXAA 3EGDB 4ZMOA 3RX8A 5M95B 1NBZB 3S97C 3ARDB 4L23A 5DVPA 1MFCH 2WTOA 3GS7A 4PJ5D 1BBJA 2NLJA 2PYED 4Z76A 4OJCA 1S9WA 2AKRB 2N4IA 1I9EA 1MCRA 1B0RA 1XD0A 2NDGA 3RTQA 3SCMA 4N2FA 4LSQL 1MKFA 2L3BA 1LEIB 2EEFA 5EC1B 4ZFOL 2LT9A 3HS9A 4G6FB 4O5LH 4D7BA 3TPKA 5EEZA 1FI8C 2E75C 4KKAD 3Q3GA 1QLRB 4ZFZA 4HISA 1X5IA 1IGMH 3GI8L 5D5MF 1FH2A 4W6YB 1UM5L 1M53A 3QWRA 4AUYA 2CLRB 2UXGA 1JFHA 4Y1AB 4ALAC 5AW2B 5CEYA 4PJBA 3CQPA 3SDCC 1CFNB 3WN5C 3OM3B 4BK8A 1F3RB 5I5IA 1NICA 2BNRE 2EE6A 3PY9A 2OL3A 3DI3B 5B21A 4XX5A 2OMTB 4BFIB 5MEPA 3EGXB 3QZNA 1IU1A 2V2XB 2KDGA 3PNRB 2W60B 3GC3A 3QXUA 4YAQB 1N2RB 2ZPKL 5F7WC 1DZ0A 3NGBB 1Q9WB 4PGEA 3IFOB 3WKYA 4L3EB 3TEUA 2YARA 4Z7AA 3S8FB 1WICA 1F3DH 4J28A 4UNVA 4MMZB 3VD0A 4C4BA 3IDXH 2F58H 2GBVA 2KMWA 3KYKL 2YPVA 4X7TB 4P4KB 4YDVB 2YPLD 2QEJA 4DGVH 4U6YA 3Q6GL 2FUQA 3MJ8A 1FV1B 4IW4C 3EH1A 4F27A 3CVIH 4JKMA 1ZWIB 5A2LH 5MI0C 4WSKA 4U1MA 4ZS6C 4EF3A 3IJ9A 1U0QA 2XETA 4ZYKB 4XGZA 1AZUA 4KX9A 4Y5YA 3V10A 4MDJA 5ID1A 1DN2A 3O2DL 1QBAA 3Q5TA 2OMVA 1NPNA 2KI6A 4Y5YC 3TV8A 5I1AB 5SX5K 4M5TA 1MFAH 4X0KA 2XZAH 2WXQA 3DVIA 1BJMA 2VWEC 4FLOA 3RWGB 3BAKA 2OMNA 1SJXA 2R29A 4U1SA 3QEUB 3RI5F 4ZMZA 5I1GL 2JJSA 2OULB 2IFFH 2VDNL 3CIQA 3EO0A 3M1CA 1N0XH 3MYJB 1UT2A 3SQOH 2G2PA 1DQKA 1KEML 1MG3C 1GIGH 5E8DH 3BIBX 3WFBH 2NW3B 2HVKB 4QF1A 3EO9L 4ZXBA 3QQ4A 4K94C 2J8UF 4MD0B 2C7FA 1K6QH 5GRXG 2DQMA 3ISYA 3WJJC 5TQ2H 3HBPA 4ZQKA 3TIDA 3UZQA 3Q2WA 4OCXL 3ETBF 1QKZH 3LKRB 4J3OD 4S11A 1OB1B 4HXBL 2QHRL 2UVFA 5ICZB 4OGZA 5C0FA 2GEQA 2JTYA 3VH8B 2Z8SA 3KGSA 3O4LB 4N2NA 3WJMB 3IDUA 1IAIL 4FFYL 1ZVHA 3HPJA 3LH2L 4NM8L 4UAOB 2M1KA 3C9NB 1ZLWK 3E6HB 1JGVH 1O0VA 4UT9H 1Z5LA 2IANE 3PHSA 4Z7OE 3MCKA 1B9KA 2IV8A 3GMMA 4IU3A 3SHSA 2I26N 2A73B 4J3SA 4JFHD 4NYLA 1EFXA 3D25B 2HG5A 4RIRA 3VXME 3B37A 2NY4D 5GGVY 3U0PB 1B2YA 1QR4A 3ZKMC 1DFBL 1U3HC 1IILE 3U36B 4MA1C 1B0WA 1S7TA 2EDEA 4GAJH 4PV9B 3OXRB 4NZ8A 4TLSA 2EEBA 3IMUA 3IDMA 3JWNG 4IMKA 3DJTA 3LPGA 1IC0A 1J18A 2XTJD 2Y1YA 4LLYA 2ZOWA 4U7KA 4PJFB 4LESA 5ISZB 4IKIA 2ICEB 3VU1A 5E8NA 4Y2LA 4HG4K 2PYFA 2G5BB 5C6TL 4ECNA 3LX9A 3N3EA 4UBDC 3MACL 5TK2A 1DN0B 3IJ7A 3L9EA 1K5WA 2DRUA 1P4IH 5ISZD 1HJCA 1UZ8B 3QP3A 4ZSOE 2YQ2A 1O6SA 2X40A 2YEZA 3TBTB 1S8DA 3V4VH 4RSVA 2ZWKA 2J55A 4F24A 3ZHLA 4Q6IB 4TOYH 5LG6A 2WQSA 1CGSL 2EEXA 1TFHA 4FYQA 1FHGA 4JO8A 2QVIA 4GFXA 1DVTA 3W2DH 2CRMA 4WFFE 3OHMB 4L8SA 5AENA 2ZKXA 2CGRL 3BZFB 3H3KA 3UL4A 2CXKA 4YDIL 1M4KA 1W72B 4B5EA 1PSKH 1L7TL 3SO5A 3ZHFA 4ZTOL 2BSRB 5HBBA 3MMEB 4KZEL 3CAFA 4U6VL 2H5UA 3M45A 5IQ9A 2IPUG 2NW2A 3HZYA 3NTCL 4IDJH 2JKWA 1I3RA 2OSLA 3IMRA 3WTTA 4QWWC 2Y36L 5CEYB 3DIVA 1U4EA 3KLHD 4M5YH 5AW4B 1RFDH 1C5DA 1D6EA 2Y2YA 3C2SA 4XNAA 5B39A 4MS6A 3ZRSA 5EC2A 4A2MA 1OSZB 2DQEL 3ZT7A 4C56B 1PZ2A 4G9FB 1BREA 1F6AB 1JTTA 4XCNA 5E8EB 3TNNA 2UZIL 4C83A 1A65A 3TXAA 4PSPA 2A83A 5FFLA 1A7NH 1LWHA 1OAQL 3MV9A 3T4AB 1A6WH 4HZLB 5CZVL 4WKZB 2K9UA 1QPXA 3QXDA 1DJZA 3WNKA 3RVXC 1MI5D 2EYTA 4M6NL 1GTNA 6TAAA 2FNBA 5TF0A 4Y7OC 2ZJSL 3CSYA 1AP2A 4OZ4B 4R4BB 1T4KA 2FJUB 4JFOA 1OAXL 3FUKA 4U6YB 4OFQA 1LGVA 4Q97A 1JOIA 1FNSL 5K69A 3MLUH 1JZ7A 4PJCB 4NBZB 1ASQA 4IGBC 4TUOA 2R1WA 4FI8A 4BKTC 3SKNB 3RFZC 3BXNA 3L2LA 2XX0A 5JW4Q 5CWSA 4KVCH 4M3KB 4Z18A 4NM4H 3ABLB 1RIVH 4PP1D 3WIAA 4KXDA 4AV0A 2VUKA 4E9TA 3FSAA 2AERT 4PGBA 3E1ZA 4NQDD 1HNGA 2W9LA 3MBXL 1YEKL 3T3PE 2R0LH 1IC7H 1ZE3C 5T3ZD 3PCYA 4Z0BH 4ZX5A 5E2UH 4AY0A 1CLOH 2VMFA 3MCLH 2BP0A 4TLTA 2HTKC 3QEUA 5DDHB 5EPMA 3DVNB 4LU5H 4C8XA 3AS2A 2BS8A 4ZTPH 2J71A 4AH2A 3P4NA 4QOKA 1OGAE 1MWAL 3T65A 3PL6B 1EV2E 2AJVL 4A7QA 2VWEE 4JHAH 2YA2A 3QFJA 1HXYA 4MASA 4TMPA 3CU1A 2NQCA 2Z8RA 1BQLL 4I4WA 3TT1H 1QWNA 4TUKL 5JLZB 3RIFF 1MXDA 1R5VA 4ZO9A 5LGKA 3KGRA 1I4FB 4HPYL 3MA7B 4QJ3B 5FIEA 1CBVH 5DSCB 4PFEA 3LTVA 1Q0YL 1YY8B 2VUYA 2QPEB 2NZ9C 4HPHA 1BFVL 4X5WA 5AVQB 1Z9LA 1MELA 1VKXB 1LJMA 1FG2A 3CWGA 4AYID 5D6CB 2CHWA 4EZKA 2IOIA 4MLIA 2IH9A 4R7NB 1AC6A 2CIIB 3NTCH 2GC7C 4JFEE 5I8EB 1WAEA 4NQCD 4I8DA 2VDNB 1E43A 3EDKA 4HOWA 4IRJA 3F6JA 5C0GB 3HC0A 4LK4A 4PJDB 4UTAA 1AQDB 1Q9OA 4R96B 1Q94B 1KFAH 3L4ZA 4XMTA 1Q0YH 4YSEA 4XMZA 1WVZA 4AEHL 1BD2A 4PG9A 3KWVA 1UXSA 3TFBA 5KSBF 3FTUA 2B5IC 4UQIM 5EU4A 5JR1H 2NY2B 1P7QB 4XOEA 1QG3A 1DN0A 5DO8A 2AQSA 4CC4A 4OZIF 1HKLH 4CSPA 3LEYL 4Y19B 1XFPA 4FHJA 2JSFA 4NN7B 2X2JA 4JJOA 3BISA 4BFEA 2X9WA 3DETC 4FS0A 1Z9MA 5CP7B 1VHPA 3CH8A 1GAFL 1O75A 4GB9A 3AXLA 3N0AA 4ADIA 5SWSD 2AK1L 3NPSC 4RCAA 1W0VA 3CVHA 4MXVF 5DT1L 5D8JH 4Z0BL 3BLPX 1NDGB 5CSGA 4HIPA 3P4MB 5HPMB 4ZUSB 2XWCA 2ZXBA 1UFGA 4W9FC 3FH7A 3IFNL 2WQXA 3I6KA 5GJSH 1L9SA 5HDBB 5BOPA 3T6QC 1TDQA 2EYSA 3EH2A 4RMBA 2VZTA 4AGLA 3GF8A 2VDRL 4ZMAT 1EUUA 3MSPA 4V11A 5GGTL 2EEDA 2J3SA 3HAEB 4P05A 3U1SH 1FCCA 4XPAH 1MLCB 1TNMA 2Y72A 4IK7A 3MNWB 3BP4B 1I9IL 4U2YA 3ILPA 4CNIB 4PG2C 1D5BA 1QI4A 4AZ8A 2NR6C 1JV5A 2CJ3A 3V0VB 3GPSA 1YMHB 2Z4QB 3CZGA 4MDIA 1KB3A 3D3VE 1DBKL 4ACTA 3O81A 5CEZE 3ROOA 5BQDA 5AZEH 3UPRA 5I19H 4RAUA 4WDIA 3EXLA 4OW6A 5IK3B 2Z65C 2NY0C 2APXA 2D31A 2HTKD 3BKCH 4GY4A 3UYOD 5BO1L 1V3MA 4GXUM 1KENH 2IADA 4LNRA 2FT8A 2EO9A 1SJVA 1C1EH 4PV8A 3K8LA 3CXDL 4DN4H 2WLMA 3ARDD 3NJNA 4MNHA 5LCVL 5CBEA 2Q87A 3P4OA 2GTZB 2F5AL 4U33A 5BV7H 4ONHB 5J13B 1WAPA 2Q6WB 3FT2B 4WTZG 1GXEA 2YD7A 4FNRA 5DLLA 5IHZB 3KLLA 2BWQA 5LKNA 1B2WL 3QUZC 3IDNB 4GSRA 4R7VA 1KYOK 1NA8A 4GINA 5LN4A 3CN2A 2YBGA 1YN7B 1IBHA 3X12A 2AABH 4PJIF 4KKRA 4GS7B 3CK0L 4GRLD 1AZCA 3MV11 1J0YA 1BGXL 1G6RA 2WOYA 2ZKYA 3GXIA 4Y16B 1T2QL 2DI7A 1TPXB 1XGQB 4KK5D 2OXGA 4BUQA 1L6XA 2GTQA 5FECB 3JT2A 4HAFA 4N9OB 4DEPB 5KVGH 4YBLB 1Z3GL 3IXTB 3QI9A 1CI3M 2XNAA 4UT9A 4X9BA 5E6ZA 3DUSB 5AUMB 5BQ7A 1GPOH 4JFFD 3WJLA 1YY9C 4O2CB 1U8CB 3EJPA 5LAXB 2H47C 1UA6H 4JAMB 3C8HA 4E9XA 3E3QE 1JMZA 3WLWC 4HJGB 4ENED 4FMKA 2K4WA 3H9YA 4H2AA 3IBEA 5CCKL 5TDNB 1SY6H 1MW3A 1MAMH 3MRCA 5BVPL 2EE9A 3OHXC 3N06B 4QYAA 2R2EB 2V7HB 2BHYA 4C4KO 5KYWB 1PLBA 4GIOA 1F4WH 2CKBH 2HAZA 3FSOA 2WCPA 3BKJL 4UDUB 5GS1C 3U7WH 2BFGA 1B6DA 4PRIE 3DWTA 4OT1L 5F9DC 4OLUL 4ZW3A 3QG6A 3WIHH 3PP4L 1J8KA 5J8OA 4PD4J 4PREA 1NZRA 4WUKH 4RRPM 2ZCHH 5D7JB 5LAPA 3SJVD 3GMRB 5C0NC 3B1TA 1LK3H 1EXUB 1RZFH 1F8TL 4RX4A 2PCPA 5T1LD 5KYXA 2R56H 3RPIA 2VR4A 2VLRB 1JCKA 4X6DB 3AQYA 4OLXH 3SGKC 4TSAH 3G6JF 2VE6B 1E2ZA 4ICXA 3BSGA 3CFEA 4P2RD 3EYUL 4YHNA 5BRZA 4AMKL 3V6OC 2H3NA 1WZ1H 2V3EA 1HZKA 2ORBL 1C16A 4NZRL 3BWAA 4OY9A 4PWFA 4MMXC 3BT2H 5HSFA 5HHXH 5HI4C 4NLAA 3RURA 3DJZA 4WO4B 4XVSL 5KS9E 4AYEC 1B4LA 1LE9B 3QJHA 4TQHA 3WKNA 2R1XA 1FGVL 2MKLC 3VRIA 3OAUL 3K8KA 4LIQH 2JV6A 4N2IA 4TSCL 4GXFA 5EO1B 4TL5A 3ZO9A 1GIGL 4LKCB 4WO0A 4LDLB 3RB5A 1S46A 2BSBA 3CXDH 3PAZA 1S7QA 1K6QL 4XWOC 1PIGA 4AQ1C 3HVDA 4Z78A 3CIAA 4G6MH 3MUGA 1HHJB 2Y24A 3ZE0E 2R4SL 4KO5A 3QQ9C 4WI2A 1COBA 4XZUA 4HS3A 2DLFH 3COOA 4DH2A 1VEOA 3KEHA 3O9WB 2NRDA 3CN0A 4LCWB 4P9HH 4R26H 5HHOD 2DQCL 4V33A 5ICXB 1NC4A 4TLKA 1YRKA 1AHMA 1NSNL 1PY9A 5D7KE 4MJID 1XQ4A 4RLDA 1KJMB 4HGWA 3TWCH 4HJUA 4NZUL 4JFDD 2I60L 1CXIA 1KPUA 5B4MD 3U4EA 3R06B 2RR3A 2ZKMX 4P46C 1U42A 3GTNA 3MGTB 5LB1A 3PNWB 1BVKB 5JQHC 3ECBA 1IMHC 3CZNA 4NO0B 4ZPVA 5E94B 4MJIB 2DQFA 4X7DC 3D06A 4FI6A 3FHEA 2EUWA 4AM0A 1PF3A 3FJTA 3KMDA 2YZ1A 3WFEH 4OD2A 3N91A 1UXWB 3OR6A 3R1GH 1PLGL 1TCRA 4GO8A 5J11C 1I8UA 1NC2B 2OW6A 4GXUN 1IM9D 3C6SA 1PCSA 4NZDA 4XVUC 4KTGA 4B6ZA 4MRBA 1I7RA 2JK5A 4LNVA 4JPKH 3FMGH 1JZ2A 2CK0H 2OM5A 3O6LL 2HLEB 4QD2E 4OLVH 4PVNA 3W9DB 4DGYH 3DVGB 1PFOA 4XRCB 3FT1A 3FSZA 2FHBA 1M42A 1Z3RA 4AGPA 2WCGA 2DM3A 1A7PH 5J56B 1UCBH 2YN5A 2ZXWB 3M17A 2OR9H 3SDAC 3B9DA 3F7QA 3L3OB 4HKZB 1RJYA 1GC1C 1HXMA 2DKUA 3O6FB 4QJ5B 2KQMA 4UV4H 2H1PL 4CU8A 1AY1L 4X6DF 2G2RB 5F70A 1EHAA 3OB0H 2CGZA 5FKAB 1RZ7L 3BDYL 3IEAA 4QHUB 1P4UA 1JPFB 2V5MA 1L9TA 2XV2A 5FX3A 1F86A 1AYOA 4YH6A 1KJVA 3QJRB 3NFSH 1E6OH 4HEPA 1A3RH 3WGVB 1CICA 2Z91A 4A7TA 1KBPA 2ZNWA 2NYZA 1UJTA 1ETZA 4KBPA 5CHNB 4HQQH 3LB6D 5KUMA 3WS6C 4Z7WE 3UBGA 2WWMD 3L54A 1OSPH 5IQOA 2OTWA 4U1LA 3U46A 3WV0A 2OTUB 4R8WH 1CFSA 1UOLA 1MJJB 3ZMEA 1JWUA 2RFXA 1FNFA 3KJ4B 1BEYH 3HW7A 3OGOE 4KTYA 1OV8A 2PPDA 1IEHA 3C5XA 5I5RA 2UWEA 1NLDL 4UQ2A 1EANA 5D1QA 3C5JA 4QRUA 4EN3C 5IY5B 5DFTA 4X6CF 3GIVA 4ICWA 4ODXA 2BVPA 4PWKA 3GD1C 2VRAA 3GSWB 5D7LB 4DTGL 4E5XG 5EBWA 5KVFH 2XYBA 2NXZC 1MI5E 1T0MA 2ZOLA 4BH8A 4NX0A 2YBRB 3BGMA 3EJCA 4U3SB 3AAZB 3GS0A 2XZQL 2YN3A 4OGXL 4PRHE 4P5KA 4PJ7A 4HP5A 2VLKA 1RJLB 1OGAB 4NO3A 5FS5A 2XACC 3V0HA 1UUNA 1VFBB 1ZV2A 1FRGH 4BFIA 2WLJA 3OG6B 5JPMB 1ZHKA 4QO1B 1CL7I 1L7IH 1T03H 4GO6B 5EF1A 4G5ZL 1XB6A 3GMRA 2HLAB 2Y25A 3F7YA 3IFOA 2DN7A 3RPIB 5IMOA 1JS4A 1YQVL 3QJFB 1MCLA 2COQA 3VWKD 4ANVA 3QARA 1OB0A 3U0WL 4NKMA 5FCUL 1M7UA 2F53D 4XAWH 3L7FB 4AI7A 1JIBA 4YMPA 5EA0H 4ZZFA 4YLQT 1KCVH 3SO3B 4XO5A 1VEPA 2OKMA 2YPLE 3KH3A 5IZ7A 1KGIA 4L9LB 1EA9C 1J05B 4FJ6A 7FABH 3N43F 5CU9A 3TA3C 4Z3GA 2EIEA 4YBQC 2BLFA 4IS6B 4LDCA 1A9BB 5F72S 1L9OA 3C60B 4PRPD 3NK3A 1URIA 1VA9A 2ZPKH 4H5SB 1D9KC 5F1SA 1MDTA 3LH2H 4Y5VA 4JFYB 3BP6B 2I9TA 1PG7H 5EU7C 4L2LA 3FZUC 5DC2A 3IRPX 3D09A 3C60D 4PRPB 1A3RL 2K0RA 2CO3A 4PRHB 1TITA 2IF7A 3QDME 5K9JL 4G2AA 4I18C 3HC4H 4ZS6D 3WY3A 3KWTA 4QRSB 1KC5L 4RMUA 5AW9B 2J5LC 3QQ4B 2D3JA 4XNZB 2C3HA 5GSVB 5DJAA 4WHYG 1AGDB 1T80A 4AENB 5IHLB 4LCUB 4N2OA 1XGRB 2NNXA 1IL1A 2WINA 4HWZA 3RZCC 4FEIA 1I82A 2FEEL 3Q5OA 2F19H 4EUPG 1W8NA 3AGVA 4NO0A 3RGVB 1O7DE 1XF4B 1FZJA 4PJIB 4B9ZA 2DJSA 3IU4H 1EFQA 4HS6A 3MCKB 4K3EH 2YPKA 3SDDA 2OSYA 5I1GH 2W0FB 3IK2A 1SM3L 3VXSE 1E9PA 1NGQH 2KYIA 2X1PA 1NC2A 4DP1X 4W9EC 2D7TH 4QRAA 2P5PA 4XMPH 5HHPB 3BAWA 5KS9A 2E27H 4H0LC 4LEEA 2BMKA 5JYMA 5E6UB 4P59L 1CGSH 3WE6A 4RMVA 1SXSA 2H6PA 4LP8A 5FYKH 4KX7A 5KVFL 4NGHH 4UIMA 4LASH 4OFPA 5EOCH 5GGSY 4WHCA 2CQVA 2VMJA 4LHUG 2XQ0A 1QZNA 3CZKA 1VCBC 3LNEA 1VENA 4KJPC 5AW0B 3P9LA 1H5BC 5DMGC 3SPVA 5FO9B 4P3DA 1THCA 2BSDA 1L7IL 2E27L 1T03L 3VFMA 5D8JL 3DXAE 2ZYHA 1NM9A 4RFEA 2N1KA 2ATKA 1IGIH 5I16A 3DHMA 4OSUH 5HJGA 2JJWA 4RZCB 5CINH 5DJ6B 3BVTA 2IBZX 4ABVA 3KR3L 4O9HL 5FHAH 3ARUA 2EIBA 4M8QA 4JFXB 5ICUA 4LHQB 1Y1DA 1S7VB 4J6RH 3MTRA 2QT6A 4U1NB 3T4YB 2FHFA 3S35H 1AGEA 2NY3D 2WLLB 2YR3A 3UTPE 1M05A 3MXWL 5IBUG 4DK3A 4BEIA 5EEXA 2BC4B 2E86A 4DSYA 1XEUA 3VNYA 4U1LB 1KIPA 3NFPA 4O5LL 3LNFA 2CG9X 3FO2B 3TH3T 2VJ8A 4MBOA 1CB4A 3MOAH 5T33H 1HHIA 3QUKA 2BSRA 3GI8H 3ZL4H 2A9ML 3BUIA 3U0TB 5HHXL 2CZNA 2LGNA 3PQYE 2BNRA 4PJBF 3IFPB 4AGNA 2V6HA 3D7PA 5I0WA 1I3RB 3NABL 4H25A 3MLVL 1XF2B 4JJ5B 5HYQB 1X44A 5EBWB 5I6LA 1JSYA 3CFKB 2WTRB 5D5MA 3DO7A 5TF1L 2YBRA 4Y1SA 3C2AH 3AC0A 1UHVA 3TBBA 1AD9B 3UP6A 4M8VA 4JEGB 2XTJB 4XNUL 1P6WA 4LBEB 4F5CE 5L7XL 1ROCA 2IQAA 3QA3B 3TWYA 4ONGH 2ZUQB 2EDMA 3H42H 1HH9B 5D1ZC 3S34L 3VXSA 2F58L 5J9PA 1AD0A 2RBLA 5B38B 2L04A 3WIIH 4B9PA 2X6MA 4GXVL 4KHXL 4EI5C 4L3CA 5I2IA 3A4DA 3PUUA 3L17A 4MA7L 5HY9A 2AGJL 3CFTA 2VCOA 4IRSD 3H2QA 3MUUA 2BJMH 4JCLA 1OGTA 3NN8A 1E8YA 4KKZA 2I9LB 1AXSA 3D33A 3RTLA 5MEOA 2DB8A 3UJTL 5GZOC 3D0VB 5INCB 1ED3B 1NCOA 2VDOB 25C8L 2ADYA 4WK2B 1W0WB 5I15L 4M5ZL 3Q8CA 5AWNL 4GOSA 1UWYA 5DUBB 5DZ9A 3QAZC 3SKUD 3TO4A 3BUTA 3MLXL 3ZTJG 3IJYA 4IGBB 1KTJA 2WZAA 1KJ3H 1WHOA 4PUBH 4RFNB 4NFBA 1ZLUH 4Z95L 3PYCA 4ZUUA 1A7OL 4J2QA 1C5BL 4PW3A 4TQIA 1IAMA 4JR9L 5IROA 5AAMC 2DLEA 3NCFB 3QZOA 3PWVB 4WJG3 5DDHA 4M43H 5KVGL 3VDBA 4XP6L 2WIMA 3MRGB 4DP7X 1CDBA 3FQUB 3NIGE 3U7AA 1S7RA 4AC4A 4LMQE 3ZE2B 3KYAA 5LDUA 1B4JH 4ZDHA 1JYNA 2X4RB 2WO4A 2VLKE 4UDTB 4KUZL 3DGDA 2GY7B 2EDFA 4WWOA 1OPOA 2XA8H 1E9QA 3VI3B 4U3HA 3QIUA 1WA2X 3QPQD 3M86A 4X5XB 1BX2B 5T5NF 4IIZA 1LEKA 1J1XH 1OGAD 1F90H 4OGXH 2CUMA 3T0ED 4FD0A 3CBRA 4QGTA 3A6CH 4KX8A 3FRPA 3HB3C 2YAMA 5TE4L 5C0BE 4M1DH 3H9SD 3ULSB 3VFTA 1M2VB 3WLBB 4OLXL 1CDUA 4N0UE 5KSAA 1S5IH 1LL1A 3NEOA 3IXAB 1WWBX 4MAYA 4DIXA 1NCJA 1U8NA 4R2GC 2W0FA 4OM0L 2UZXB 4LSQH 5FA4B 5C2UB 2QZQA 5IROC 2VDML 1S7WB 4WWNA 2CA4A 1FC2D 1LQBC 3FAWA 2PPCA 3I75B 4HHGA 4WFED 1WTGT 4OJYA 2IFFL 2K3HA 4ODWB 5AYUL 2BMKB 4U1IB 3KCPA 2N59A 5J1TC 4WI8A 3UROR 4N8VG 3HE6D 4FTDA 5T1DH 1TETL 5GJTH 3NCWA 4ZSOA 5D1XD 4P46B 4MNGB 3DKHA 2JQZA 1QSFB 1QNZL 1W16A 3DVFA 1F18A 1CT8A 1I1RA 1N12A 12E8L 4OQTL 2R15A 3IGAB 2XWDA 2X05A 1RUML 5I1HH 1MLBB 3STBA 3STZB 2HTLD 3CVBA 1G9NC 4JZOA 3N42B 4P3DB 1EO8H 2VLJA 4PJHA 1DJIA 2KL6A 5F3BB 1KNOB 1JI1A 5DFVD 1A9VA 5D55A 5FGBC 4I5BA 4QRQB 5I16B 25C8H 1UKTA 4PJ7F 4TOYL 3QXTA 5FYJD 2XCMC 1BVNP 5BRPA 2ICCA 4FG4A 3IDXL 3ARBA 3KPSB 3FCSA 5AZUA 2WAQA 3APFA 3IJHA 4JO2H 4DZ8B 3F5WB 2AK4B 4EIZC 3RIKA 2NYYC 4ZAKC 3NGBC 1KB5L 1G84A 4NO5B 1CXFA 2NY6B 2XWJB 3BPCB 4RWYL 4QTIH 4WLCA 1F4YL 1IT9L 4GI8A 3S2CA 4J1UB 3LSOA 4LPUA 2JKXA 3HZMB 2JXMA 4L8CA 1AXTL 1F4XH 1CLVA 2WMPA 4WNJA 2DDQL 5ANHA 1N19A 1XF3B 4LSPL 4NRXB 5FR3A 2FIKA 3OJDB 1P5UC 5TE7H 1P84J 1YPZB 4CNIA 3FUEA 5F6IB 1JV5B 4TKWA 3ZHDA 3Q43A 4CVWA 1T89A 5C3IA 1WFIA 1HYRC 1M1XA 3T8XA 1PY4A 4Y4HA 4MNQA 3F04A 4E9WA 1JD7A 3W5NA 3ULUD 1CU4H 4PWJA 2CKBB 2OJEA 4BQCA 3L5XL 3FQWA 3D3VD 4PLOB 3O45A 4QY8A 1CS6A 1DBKH 1FFRA 1RV6X 4TNVF 4HOXA 2FZ3A 1DSWA 2BP8A 3WAKA 4GRWF 4UIKL 5DVKA 2X3AA 4OCWL 3RI5K 1NJ9A 4YHIA 3U4BL 3VXSB 5J9PB 3BZEA 1AY1H 2J8UE 2D7QA 3QWQB 2Y7SA 4PJDF 4KZCA 1GCYA 2YGVA 3N85H 4S2SB 3QDJD 2Q6WA 5HY9B 2ED6A 4BSJA 2Y7LA 1EZLA 3MA9H 1UCBL 1TFPA 1AMXA 4NOBA 2NXZD 1J86A 1H3WM 4OM1H 4LGSB 5A6LA 3W39A 1BECA 1PMYA 4AQZA 4RDQF 1A6TA 4GFTB 3SE8H 5I19L 3ULVE 1H19A 5EDSA 3HG1E 1CK0H 1H3UA 4O02A 3TBYB 5FWQA 1HKFA 5IKCB 4NUGL 3IKCB 4M1GH 5DUBA 2EXWD 2FWOB 4KAQH 1O9WA 5EU3A 1K8IB 5DZOA 2FL5B 4JY4B 2WK2A 3WNPA 2DTML 5FECA 4HUXB 2Z7ZA 5EUOF 2AMGA 2RHEA 5DHXB 4Y1AE 4A7GA 4U7MA 3BD3A 3SJVA 1HSAB 1RUMH 1I7TB 4LL9A 3Q2CA 1C5CH 3HE7C 4JAMA 1X4ZA 2WP3O 2X4RA 4G72B 3C08L 3DTXA 3N44B 4OH2A 1CQYA 2QBWA 3ATDA 1GGTA 1P5UA 5D2NB 5D7IB 1ZA3A 1OARH 3T3ME 2PF6A 3KS0J 1KLFA 4NWTH 4JDZA 1MCQA 2E9JA 2WHVA 4NKDB 4GKNA 3KYOB 5JHBA 5DGQA 4QT5A 1C08A 5EZOL 3AMKA 1QR1B 4QKTA 1F1GA 4PPTA 1Z32X 4GNKB 3L3OC 2MSPA 3B5HA 3ZIYA 5IEHB 2VL5A 4XODA 5C8JA 1OOWA 3FRPB 1AGBB 5ICYA 3SDCB 2I27N 1YLBB 1LO4H 5B1JA 1E27A 3TEXA 5CZVH 4UNUA 3VO0A 3X13A 1ET7A 4ISVA 2WXGA 4IKNA 4EN3D 5F7UA 1B4TA 5DLMH 1T3FB 2GPZA 4IRSB 1R17A 5AOIA 4APXA 2VLRA 5K39B 4GKZB 3PPSA 4Z1PA 1UACH 3IJEA 2HWZH 4NRYA 3WE1A 3IWVA 4GSDL 3FN0L 2XTJE 1YEFH 3ARYA 3QUXC 3IU3B 3ATAA 1GS8A 4FNPA 4XP4H 1H15B 4C4KT 1ESOA 3D08A 5C9KA 4Z7QE 4NQVA 5DJYA 4Z7VA 1PPIA 2W9EH 1IB5A 3VGHA 3STZA 3QWOB 3EYUH 5IVOA 1OVZA 2IJ0C 2J6EL 3UC0L 1P1VA 3W81A 5HGBB 1SBBA 1D5MA 3F3HA 3ARDA 2E5EA 4CVUA 1S7QB 4UM8B 1F8TH 5JIMA 4XNZC 3TTSA 3SDDD 4PBWD 4WTQA 3VX0A 2FBJH 3AG3B 1T6BX 4LSSH 1QBML 3L95A 5ERWB 1SBSL 1E4KC 1T04B 1ZAGA 2XC8A 1YNKH 3KAAA 4G6JL 2ZONA 3KBPA 4IRZH 4JPVL 5KEZA 3HZVA 5IV2B 5KAQF 3GLDA 3JVGC 1PZCA 5LNGA 3TCTA 2A0LC 4XB3A 2NT1A 1BYOA 2EDOA 4I3SH 5AL8A 3QZMA 5EMYA 3EOYG 3G04A 3VI4F 4JGNA 4P2RB 4PGJA 2ENYA 4MHHG 3MGTA 3RU8H 3DMMA 4PB9H 4MDRA 4NRXA 4JUTA 4ZPVB 5E94A 4BV1A 1PAMA 2VDPL 4UTCA 2Z31D 2YAFA 3L5IA 4HLJA 5IMKA 2CA3A 4GG6B 4OR1A 3H0TB 2FJGA 3QO1B 4JPSA 4UAOC 1CYXA 1T1WA 1X7SA 2HFTA 1DDHA 1TCRB 2EDRA 3MV8E 4LXFA 3VWKC 4UQ9A 3B7UX 4NJ9L 3OBAA 1KYFA 1IGML 3P9MA 4NI3A 3TJHD 3U7YL 1K2DB 3I6GA 4B95C 1IBGL 3CHPA 5AW1B 1S9VA 1CMOA 1AJ7L 1DJWA 1T0PB 1NMBH 2AVFA 2HKAA 1TEGA 2X3BA 4RNRA 4X7TA 4YDVA 2BRQA 2WSDA 3D39A 4L05A 3QGVA 2QL1A 3DPDA 4XI5D 3HI5L 1AOZA 2FWLB 1AGFB 3V5DB 3O4OC 1BCIA 2A6DB 4BSVB 5KYUA 3OB8A 2RAMA 3ZVVA 1O6TA 1GC1L 2E3VA 4ZYKA 2WN2A 1XB3A 2YLKA 2OR7A 1DYZA 2X4UA 1NCIA 3HI1B 2IH1A 3S4SA 1T7ZA 5DHVB 3P1VA 4K0OA 2C1OA 3JWNC 3P2BA 1T1ZB 3PGDB 2E8YA 3Q1EA 3VD9A 2W59A 3CN1A 3QWRD 5EBLA 3W0WD 1HILB 1G4RA 3GZQA 3VFUA 1E8WA 3VI4E 2AQ3A 3FL7A 3PFUA 1IC5L 3F65A 3NJGA 3FK3A 2WGXA 5DRWA 5KSBB 5ESVA 2ENPA 4N68A 3NIFB 1CICB 3I2CL 5CAYB 4OLWH 1R0AH 3GSOA 4G9DB 1XGPB 1I1FB 1U58A 4QTIL 5IF0B 4H1LB 4MA8H 3I9AA 1AHKA 1KCRH 3ZU8A 1FF5A 2R0WH 4H26A 2CKBL 3BAYA 3DOSB 3MLVH 4Z23A 2FYYA 3PJSA 2OTUA 2CLZB 3R4DA 3QUXD 3LIZA 3P11H 1P5UB 5EZJB 4WRLA 1SY6L 4N2LA 2PWDA 3JUYA 3M8OL 5IMLA 2H6UA 5FW6A 1T5WB 5EZPA 3TPUB 3BKYH 4PIRF 3L4WA 1PZDA 1VZHA 5KVEE 1Z9NA 1U3HB 1F2QA 4X4YA 4M7JL 4UTBL 3FRUA 3I3BA 3IBOA 3LOWA 3HLKA 1QW9A 1AGCA 3CFJA 1HH6A 2YK1L 1A4JB 5H37H 1KIUA 1AMYA 1MJ7H 2NX5B 4P5KB 4N8VA 4PJ7B 4FFWC 5T1KB 3U1QA 5A2FA 5AKVA 2VN5A 3CVCA 2P3YA 2NUTB 3AITA 4JO2L 5H35B 4JREC 4YC2B 5BUPA 3P9WB 5JPMA 4TUUA 3D1MC 3T0XA 1TZGH 3HMXH 4LLWA 3L3IB 4YGVA 4E9VA 3MQIA 4GKZA 4U7SA 1MI5A 3E38A 4UNTA 4WW2B 2PYFB 3UG5A 4KO9A 3HRZA 4OTXH 1NLBL 3E1F1 1A8ZA 5J11B 2BWDA 3H2WA 3WIHA 1SQ2N 4KNTA 1ZLDA 5F7HA 2Y1ZA 4WUUA 5GISL 4DP4X 3BAJA 4HXBH 4PGCB 2B2XL 3IM1A 3L7FA 5DHEA 3UGEA 1DQJA 3QSKB 1GHFH 4FQ1L 4GI9A 4O58L 1CZ8H 2H3XC 5IGXL 3O4LD 5T5FH 1NEZB 2SEBA 2ZP9A 3GQFA 2ERJB 4ZMLA 3CDCA 1MVFA 2EJ1A 2Y7QB 3BHBB 3FQ2A 4Y8DC 2JKRM 4KJWD 2JKJA 5I1CL 3GB7B 3VYPA 1J9CT 1ZLVK 1IQDA 3QJQB 4KOCA 2Y4SA 3O8XD 5JW5A 1FP5A 4L8SB 3BP6A 2OS7A 4AEIL 3VAEA 5IHUL 1NMCC 1QUNA 1YMMA 3GO1H 4J3OF 1DJYA 1I1AA 4F8TA 4HZ1A 3KNBA 1GSMA 1W72A 2EH8H 1DVFC 5L2JB 4FTVE 1L0QA 5CJXA 2AQRA 1E5YA 5GS0H 4WI6A 2GG1A 1S3RA 4ERSH 5IQ9B 3JV5A 2GITB 2YUZA 1U8PB 5K59E 1B90A 1RUPH 4I3GA 3RWCA 2OSLB 3MYZA 1KB9K 3WFBL 1VAHA 2BNUA 4NN7C 4UF7C 1JG9A 4LCUA 3VFPB 3QJUB 4D9LL 1UA3A 3ZE1F 2FECL 1EAPA 3OQ3B 4CMMA 2Y9RT 5MHSE 4H88H 5FPIA 1SFHA 1DSYA 3KR3H 4U0RB 4CKVX 4JFEB 5EBMB 4G9FA 5E8EA 4C47A 2C9SA 1FFOB 1CD0A 5IMKB 1SEBA 3HE7B 4IEFB 4PMFA 5E9DD 4JO4L 2JKLA 1U8IA 1SMDA 2IDSA 5AAPA 1DDHB 1X5KA 3S3DB 5FYKU 4BM7A 3B43A 4G71B 5JIQA 2ICWJ 5C07B 3PLYA 4BZ1H 1NEPA 4RFNC 3VW3L 2MIZA 5ABAA 2AJZB 4L8BB 3LRMA 4NKOB 4A7GF 4JB9H 4JFFE 2KPNA 1TVDA 2VSKB 3CVIL 4XOCA 4NM4L 3EOAB 5CIPA 3MJ7A 4ELKA 4ADGA 1MSPA 3UDWA 3LNGA 3MBXH 3OKKA 5D93C 2JLPA 4XMXA 1WYJA 3UACA 4AKQA 1PDKB 4G8EB 4U1HB 1BF8A 4G43B 3FT4A 1Z6JT 3WIFA 1OAUL 3UC0H 1DEDA 3NP4A 3P9LB 3ZDZE 4TN9A 2X4UB 2NYKA 2Z1KA 3H1ZA 5E2VL 3CLWA 4P4RB 5G2NA 4Q2ZA 1EEZA 5FO7A 2VM3A 1YNTA 4HSQA 3T3MF 3ZXAC 1SEQH 4K5OA 2VJXA 3SCMC 4FMFA 4PRID 1U3YA 4LEXH 2FO4A 4CSSA 3MNZB 5ALCH 3GMQA 5HGAA 1BFVH 4KI5C 3OPZH 4OJEH 3KPRA 5IESL 4MB5A 2F54A 1MG2C 3HUJB 5DJXB 2IPKB 2PTVA 3BYYA 3P4NB 3SDYH 4FXLA 4L1BA 5IF0A 1A5FL 1GR7A 3UMTA 5DQDH 5E00A 4WK4B 5CKAA 1G7MA 4NPYB 3DOHA 1NGPH 1KIPB 4JY6B 3MRHB 4B9CA 3D3VB 4MQXD 5TE4H 2B1AL 1G7JB 4WU7A 1KELL 3MFFA 4TVPE 3ZRCC 3GXMA 1ZJAA 4Y89A 3FSVA 1F4XL 3KLAB 4A38A 3QEGL 4KMQA 5F7AA 4BA0A 4DW2H 5CFHA 4ZBJA 4HWEH 2DIAA 4HX1A 1SXBA 2MFNA 4OF7A 1H9VA 1YY8A 4ZTPL 5EFIA 2TRYA 4WY7L 1D5XB 1MCKA 3AG1B 1GC1H 3GMNB 5JXED 5ILTH 1ND0A 3GBDA 3PS6A 5I5JA 1AQ8A 4WI5A 3ZDZB 3MRMA 4DCQB 4K7PY 5DJ8A 2QGBA 4FQXD 5FB8A 2WN3A 4GT7A 4ATTA 1OPGH 1I1YB 5FUZH 3SDAB 3QA3A 1MQKH 1RULL 4CMHB 4JS7A 4PJDA 2GK2A 4WEMB 3TASA 4FQXB 4ZFQA 4B41A 2DWEA 4FYTA 3BUQA 3CZLA 1QMUA 5TGBA 5EU4B 1IJNA 1JTOA 3GBMH 4UT6L 1RU9H 1UM6L 3QJTB 5BPPA 4M9PA 3VXTA 2M2DA 1AXSB 1T6VN 2XZCH 4TVSa 4X8GA 1U36A 3FU0A 3PWJB 3WMQA 2V8MA 3OXSA 4IJ3C 4PBXA 4OM1L 2XZZA 5CP7A 1FSKC 4GXVH 4KHXH 4DGWC 2ILLA 3OJVC 2J1XA 2BVOA 2ZOOA 3JWOH 2EC8A 2WBJC 3CX2A 1XSKA 4JPKL 3VFOB 3LPFA 3LQZB 4NO2B 2ZQKA 4K94H 5DRXB 2YD5A 3BUBA 5EEUA 3IJSA 3GB7A 3T8VA 1OARL 4FP8L 1SMOA 3PJNA 3WMPA 3V4PL 2NY1C 3OAYH 1WWCA 1S5IL 3D05A 5K1JA 4L1SA 5JO5A 5J3HC 3BH8A 1S7RB 3GTVA 3I9PA 5DGRA 5K9JH 1HYSC 3LV3A 3KPRE 3DROA 1A5FH 1RZKH 5E7BA 1MLCA 1X5ZA 1KCUH 5C0CD 3N40P 4M7LL 4ODVL 4NSKA 5I1EH 3EBGA 1MAKA 2ZXCA 4HIIB 4XWGL 4A6YA 2YMXL 2J20A 2WLYA 1OD7A 5JDSA 3QVAA 4K3DH 4PSRA 5IB5A 4QRTB 1DL7H 2GB2A 3HLAA 4CBPA 5JHLH 4YFEA 3CHRA 4NZJA 1RZGB 5LCVH 5IK3A 5I0DA 2VLMD 4WAFA 5D96B 5KSAB 3CZUB 4JZNB 2F2HA 2Y36H 3QJOA 1U8NB 4JRXE 4QRPA 4O58H 1MOEA 3RAJH 4AYFA 2Q9OA 2DL9A 3N43B 4L0ZA 1P5VB 2VXVH 3LAFA 2XJKA 3Q8AA 3WMSA 4WEBL 2Z8WC 2O5YL 4FA6A 3FZUD 3WHXA 4U1IA 3BPNC 1J8HB 1IJ9A 2AJ3A 4XXWA 3OMAB 4N6QA 2IANA 2P8LA 2R2CA 4RRPG 5F9JB 4NENA 3JV6A 3C8KA 1HCZA 3CSFA 2X0VA 4TXVB 4NQXB 4PQXA 2X1WL 2DM7A 1HESA 4OLVL 3CZJA 3OKNB 3UBXI 3QRGH 4I48B 5IWLC 3FPYA 2Y6SC 2QQNL 4JZOB 3HZKA 4G8FA 1ACYH 2OQJB 2R0LL 1A22B 4K3JH 1UH3A 1XZWA 3MRDA 4Q7DA 2YUVA 5F1IB 4OQTH 4I5BB 4ZXBD 2CR0A 3Q6GH 4H88L 4URKA 5C3LD 3C08H 4TYUA 1GY1A 3AREC 3D6GA 2CDGB 5B8CC 3B7RL 1KYDA 4GQ9H 3RGHA 5D7SH 2IDTA 1PZBA 1CQKA 5FGCE 3AQXA 1BMGA 1IE5A 1IBYA 1KV3A 2HJFA 1VGKB 4KI5E 2EXTA 1A2YA 4I89A 2V7HA 5J5EA 3TS8A 3F85A 4F7PA 2AS5M 3L08A 3H8NA 4AJ0A 3GXDA 2VIRA 3TM6A 4F9LA 2D9CA 2HP4A 1KBGL 5E2WL 1YO4A 4NERA 4YHYC 1QSFD 3MHZA 1INEL 2WUBH 3HMXA 4RQQA 3FYEB 3BUYB 4HX1B 1KEMH 1RK0B 1FGVH 1GOHA 4PRHD 3MROB 3GHEH 3SJVE 1JAEA 5ITFA 5IHWA 1DDTA 4YAQA 3TBWA 1DE4B 3B3IB 4WNSA 1IVLA 4JFQB 1CGVA 1URZA 1UKSA 3AWEA 3MRMB 3PUCA 3QIUD 4NBXB 4APQB 4CN6A 4M7LH 4ODVH 4D0CB 4QKXB 1FNAA 2G3ZA 4ETQB 2NY5H 4LRIC 1WO2A 3FU5A 4TNWF 4J3XA 2V9TA 4DUXA 3UEQA 4JRXA 2FZ3B 2O6EA 1IE4A 3GM8A 4L4JA 3T5WA 4K5LA 3BZEB 3OR7A 1TQUA 1FL5A 2E56A 3FCTA 2Z92A 5TGBB 2HUEA 4NRZB 4MDJB 4EDXA 5DUML 3K0YA 1KXQA 4WO4A 5E5UB 1HDMB 1RUKL 4N1CA 2OMVB 5DWPA 2JJVA 4WCYH 3ELQA 3Q01A 4LLVA 4O00A 4PP2B 4JRYB 3N42F 3I02A 3JTSB 2P5EA 4LOUD 5K5YA 3CXHJ 4L18A 4U1SB 1V3KA 4DVRH 2XTSA 1NFIA 2EDTA 4N0YH 1FLRL 1JK9A 2QGCA 1UQSB 1XCTB 2X2YA 4NZUH 2AABL 1HQRA 2XBTA 4ZX6A 1CURA 2O1AA 3WSQL 2XV3A 4F2ME 4N26A 2X3CA 3FO9B 5KSVB 3KL3A 4XC3L 2C3XA 2CNZA 2E7MA 3MRKB 3QIWB 2KZ1B 1NCGA 1UOWA 1BQUA 4XMUA 4FHBD 2AJXH 4YQXL 4JFDE 3QHFL 1OB1A 3WS3A 3HI6L 3P3UA 2CCLA 3VG9C 1ZA3B 5FGSA 3PNWA 4NKDA 3B1UA 4NSKB 2JCCF 3CBJB 1IFGA 4HEME 5ADOL 5K9QI 3RZWA 4LSTL 1F90L 2X6AA 2XKNA 1U93A 2DTSA 4DFHA 1F3JA 4HUWA 1MIEH 3GI9L 5IB5B 4F33A 2DMCA 1P4BH 5FA3B 1ZTXL 3B2XA 2ROXA 3BN9D 4XN8A 2BIPA 1U8OB 2ZG2A 3N6YA 5EUKA 5HYSG 4NC0B 1E27B 5AKSA 3U36A 4LF3B 2IQ9H 1S7TB 3V5KB 1P2CA 4P23C 2H0JA 1P7BA 1TYEB 2R7EB 3JYCA 3KG5A 2Y5QA 3OF6A 3OXRA 4JG0L 3ZMRA 3U6XS 3DYPA 3OZLA 3BX7C 3PIQB 5F2FA 5SWZB 3H2PA 3UTQB 4L0PB 2IEPA 4XRCA 3B2UD 1ZANH 5SX5H 5PAZA 3ARFD 2OZ4A 5ISZA 3Q9PA 3LN9A 2JB5H 3GSNL 3IDIA 3P40A 4OKVB 5H4YA 3WHXB 1D5ZB 2IOMA 2FB4H 1CGTA 1LK3L 3HNSH 1U8HA 2X70B 3RIFK 2AJ3B 2G60L 1UADC 3L4UA 3WTYA 1CG9B 3M88A 4F2MB 3G5XB 1FL3A 5IFJB 3NH7H 2R1YA 5B1AB 1FIEA 1C1EL 3GSXB 2FWSA 2FJHB 4S1DC 5CGMA 3ARPA 2YEZB 4NQXA 4FX5A 1H6TA 4K5MA 1TXKA 1JHLL 3L9RB 4J3OG 3WY1A 2NSMA 3HZKB 4G8FB 3TCXA 3DIFB 2H2SD 2W95A 3DX9A 1QI5A 5JOEA 1DVFB 2Z91B 2X4PB 4ZMWA 3RX7A 4HCRH 1RHHA 4FNSA 1X5LA 4UM8A 4ZZKA 3S34H 2GQHA 5IWLA 1GYAA 4ZW6A 2X7LB 4JKKA 3R19A 2JJTC 1E6JH 1T6WA 2MPVA 3GXPA 1JF1B 1LO5B 3JWOC 1Y6MR 3O6ML 3CC1A 4PTTA 4JFWA 4X4ZA 2BNQD 4PJAB 1NDTA 4LIQE 1VF5C 4ELDA 4MSWB 4YQXH 5GGRA 5AAWA 5IFAH 1F4WL 2PXYC 2PPFA 4FJZA 1L6PA 3Q8FA 3CC5B 2A6IA 4HD5A 4KUCD 2ADFH 3GRWH 4YZFF 5KSAD 4JFDA 2GIXA 4F3FB 3WEMA 2ZOLB 2P44B 2MKWA 3NT0A 1OSZA 1XB8A 3ARTA 3WUWA 2G4GA 3HG3A 3K91A 4YSPA 4RQQB 1AE6H 2XN9E 4N87A 2GK0B 4HJEA 5EDXA 5I9QC 2Q20A 3SPCA 1NGYA 3TJPA 3S98A 4WKZA 1TJGL 3NSFA 3CU7A 5ANMB 2DYSB 3GHPA 2EYTB 4N25A 2Z64C 4XXCC 3I9IA 3ARRA 4A37A 4IJTA 1NLDH 2RCSL 1RPKA 2PLTA 4FXKB 1T4KB 5IMMB 4Q8BA 3BZ4A 2WZPA 2P80D 4BE5A 4JRXB 4W9LC 2EILB 1MWOA 4QDGA 1NUNB 4S1QL 4M8UA 3MR9B 4KKQA 5FF6B 1BEXA 1MCNA 1PJ9A 3AG4B 3H6JA 2Z92B 3QR0A 4O2FB 5CEXA 1Q38A 3IDJA 1JN6B 3FCUB 5L4FA 4X6EB 3HI1A 3S4SB 1KSRA 5K93A 2F7QA 4JFHE 2XDHA 5IB2A 2IOOA 5C9JA 4GKLA 1NH6A 3MU3A 4LLVB 4K9EL 4N5EC 3VFUB 1ZDSA 5C0BD 3KXFA 4TPRL 1HCVA 1F42A 1QLFA 4JQXC 4Y4FB 4ZAKD 3FUDA 3PWNA 2J21A 1NGWB 3L6FA 2Z31B 1MFMA 2L4OA 5I9QB 1MUJA 4JKWA 4AH2B 3S88L 5M7QA 1RJZB 3QYCA 1OWRM 4DKAA 4L5FL 4P9ML 2UWEF 2YEVB 2AMUA 3BVVA 3MXVL 4W9IC 3B2MA 4WZ9A 1N6QH 2ED7A 4B60A 5E6IC 3QIWA 3NSXA 1EH9A 4ZW8A 4R4FL 3SE6A 2QMJA 2YQGA 2P48B 1F97A 4AJWA 8PAZA 3DX6B 4XCYB 1WFNA 3LPPA 5BV7C 3WJJA 5PCYA 2B9BA 3BQUD 2BHZA 5FYKE 3FU6A 4I0PC 1BF5A 3VB8A 1T5WA 2ZX7A 2BNRD 3ECVA 5DSCA 3V0WL 1FZOA 1V7NH 4RFOL 3X11A 2DEXX 3VXQB 1XCWA 2AITA 1F3JB 2KZWA 3QJZA 1GZPB 1VSCA 1ZT7B 4WWID 3ORJA 4MCYA 3UTOA 1J48A 3VFRB 1R5IA 1VADB 5JIIA 4FQLL 3WAJA 1T21A 5BMFL 4PJ9B 1G7IB 1QYGH 5KVMC 1BD2D 1EMTL 3F7VB 5G4MA 2QDVA 3G6JE 5E99L 5AOJA 2RTTA 4AWJC 4NM8H 3W9DA 3NDYE 3N1QC 3UTQA 2DKSA 4N1HB 2D9QB 1Q94A 3LVEA 5I76B 3ZYJA 3V0AC 4HFWA 1BD2B 1G7LA 1XGYL 1MDAA 3GO1L 3IB4A 1DZBA 1I1AC 3VFWB 4DOHB 5I6KA 3M1BA 4OF6A 5IBLD 2OYMA 4ZD3H 3S3PA 2A77L 1J5OH 4W9DC 3OLIA 1U4FA 1Y18B 4HHWA 1RUQH 4APQC 4CN4A 2BOBB 1E5ZA 3IF1A 1PZUB 2AQTA 1CDGA 4GKOA 3L4TA 5C86A 2O6CA 5LLIC 4IMKC 2C4XA 2JKNA 3CZSA 5I1LA 5CSZB 5IBLC 1OT4A 1XGTB 1G9MH 3ATBA 3IFLL 3O2DA 2HT2C 3DX9B 1ZHLB 3FB7B 2RQ8A 4DN4L 2G9KA 4TVPL 5FO8B 3FFOA 1R3HA 4LHUB 3WEXA 3MX0B 4KU1A 1WZAA 2NNAA 5LO7A 2UXVA 5CJ5A 5ESQA 3QEHB 4XP9L 4F7MA 4MJ2A 3QUZD 3GIZL 2WB7A 1N0LB 5CUSH 3J8F7 1OE1A 1PTZA 2DWSA 3ETBJ 4I88A 1BBDH 3TU6A 1G6VK 3B2VL 3T3PB 5DS2A 3KPMA 3VFNB 1QKZL 2W0PA 1MHCA 2VDPB 4Y4KA 4NHUB 1FFPB 1Q0XH 1GKEA 1IX2A 4RMSA 3TIEB 2FDBP 1CFNA 2HJKA 1M7DA 1LO0H 3VXMD 3CFBB 4PRDA 4DWHA 4HSAC 5JTWA 5F7LB 3DI2B 5HHQB 1LVEA 4NO0D 3WUWB 3ISWA 4RAUB 1FFOA 2BERA 4JG0H 2GK0A 4CGUB 4EUPB 3LCYA 3N55A 1QHOA 3U7WL 2WXJA 5DHYB 1YC7A 3GTTA 2W60A 5ANMA 2IADB 4YXLH 4U05A 3BJLA 3RRQA 2Z7YA 4BJLA 4OJDH 3OKEB 4QXUL 1NC2D 3NZHL 1AD0B 1U8MB 5D1XC 4FQXC 4PJ5B 3P4OB 1SPDA 3FFDB 3FQTA 4OGYH 5TQ0L 2R23A 1NBCA 1ZS8A 4A55A 4G6JH 4K4KA 4L2YA 1NGZB 1EO7A 4M93C 1DFBH 4NUPA 3FT4B 3SGJC 1TJMA 3IDJB 3DPBA 5EG6C 3VVWA 1CO1A 4A6YH 1SHMA 1W0WA 1ZLUK 4J3VA 3EJZC 4X6EA 3T0AA 2FGWH 3QZPA 2DM4A 5CJBA 2YQBA 1JDCA 2VYRE 3IJYB 3QAQA 4Q2ZB 4XC1L 5FO7B 1MFCL 1TO5A 2F0CA 1RK1B 2NPLX 5GSRB 2X4NA 5TF1H 1RPQA 4PJDE 3SKJL 4G6FD 2WXKA 4MS8D 3VTAA 1ZD6A 1AR1B 2A9AA 2GCYA 3VI3F 1E8XA 2IFGA 2V8LA 3AVEA 1FORL 3SYCA 2OW7A 3GMQB 4L9DA 1KCKA 5DMIL 4AL8H 4QEGA 4XPHL 4Q9QH 1JZEA 2QSVA 3I2CH 3T0EC 1KEGL 4XAKE 1A4BA 2PP9A 3A0OA 5JW4M 3GSQB 5HGDB 5EN2B 1SF3A 4X83A 4KFMA 3GEFA 2DLGA 1KF9B 2IGLA 1ZRUA 2HA1A 3BD5A 2MQGA 3QIUB 3TYGL 1SUHA 2Y2TA 2IPTH 4M6MH 4YNYA 1R3LA 3LIUA 1BX2A 3MODL 4NHCL 1QSVA 2ZD0A 4GMSH 3GXNA 5C97A 3MFFB 2XFXA 3EDJA 2CO1A 1YEIL 2PPAA 3L7EB 2AFNA 3H4HA 5G4NA 4PJ5E 2ZSWB 5L4JA 4UDUA 2A99A 4PRNB 3HPJB 1A14H 3SPHA 3SGEI 5LWYH 2EIJB 4EN2A 3QG6B 1JVLA 4NC1E 4F58L 4G70B 3UGXA 3REWB 4PVBA 4Z7WA 1QA9B 3TH2T 4ACPA 2A73A 4NCDA 1JPGB 4GKSB 3CDGA 1GZPA 1V5JA 5D7JA 4HC1L 2D3NA 3GUTB 4RIRB 1VRSA 2CO2A 3RDTB 1IGYA 4MNQD 5DJ8B 4GH7B 5I6NA 4MFHA 4LO9A 1HOCA 4GUPA 2QPDB 2W65A 3IDYC 3MCYA 2OJZH 1KG0B 3TYFA 4BFRA 3QS3A 1I85A 1CLYH 2WLZA 3FMGL 1BJ8A 3IDMB 4HT1H 3ZKSD 3MV9D 4UB0L 2DYPA 1LM8V 1MVUB 2ED8A 3FW6A 3KLQA 5BRZB 5ES4B 1UOKA 3WEOA 1X4YA 3DX0A 5F6HJ 3ILDA 4KMTL 2L8AA 2YLHA 4D3CL 5IQLA 1TZIA 2NQ3A 2ITCB 3NJLA 2CH8A 3M1BB 3H9SB 3LIZL 5HHVH 3SBQA 2QFPA 3CHQA 3E0GA 3HCVB 2MHAB 5FLUA 1DQDH 1KNOA 4KHTH 1TZAA 4MMZC 3RWFA 3BZDA 5CEZD 4LKCA 1J88A 2TSAA 4QRQA 2BJML 5FYJE 7PAZA 5DJ2B 4KK6D 2ITEA 3B83A 5HHOA 2XZQH 1JGUH 3C6LB 4AQ1A 3EUUA 4YEFA 2R0ZL 4U3XA 2YAEA 2EE2A 1ILUA 1VFAA 1HEZA 3FCSB 4C57C 4MA1B 3RL2A 3SE9L 4U1KA 4FFWD 2HFFA 4MCZB 1EZVY 4FDWA 3REVA 2DD8L 4LHUA 4RMRA 2P46B 5HHME 3VQ2C 1AR1D 1BZ9B 4PJ8C 2X4TA 4KQ4H 3G6DH 3MV8B 4K23H 2H1PH 5JNYA 2YA0A 3LSOB 1J5CA 4GAGL 4PJFF 3HZMA 4K94L 1N0LA 2X4QB 3GT6A 4UIKH 3T2PA 1ASPA 2GC4C 2VABA 3CGTA 3R06A 5GS0L 2Q0ZX 3HUJE 3OPUA 4W9ZA 1BVKA 1MHPH 5IG7B 1AIFB 3A67L 4UQ3A 4X9IA 5ABZA 3RDJA 4PW9A 2K78A 43CAA 4CDHA 3QBTB 1MW1A 1O5DT 1PNCA 3OJ2C 4FA8A 2XZAL 4N1EA 2ERJC 3LVTA 3MV01 1UXWA 1UUSA 2HJKB 3OR6B 4J4PD 2DLIA 2VNCA 2NY3B 4ZMPA 4QRTA 1MWAH 4CUCA 5C0CE 4K73A 3RVTC 4PS3A 1Z5HA 3EIFA 2P52A 4F7EB 4DQAA 4EUPA 2OJEB 4JZNA 2HH0H 5LGJB 3W57A 1KXHA 3Q8EA 3MODH 4PS4L 2ENQA 1FLTX 3T4AA 4Z7OB 4HZLA 2WKOF 2VDPH 1HHGA 1RCYA 3FPXA 1WEJH 3LS4L 1DL7L 3S3JA 5GHWH 1XD1A 5DTFA 3BUDA 4DP2X 4N0FA 3DTDA 4FE9A 1U3HD 2Y69B 2XN9B 1F11B 3MRQB 4KY1H 1NFAA 1NGZA 4JM4H 2OMUB 4OLZH 4OZHE 5K9OA 2NY6D 5H2BA 1DBMH 1H3PL 1UWEL 4MCMA 4AQAA 2CHDA 1RIUH 1FO0H 1N6UA 1HL8A 4MCNA 3LNHA 3CVHH 2VISB 4OCRH 1U9KA 4ZPTA 1M7XA 1KTRL 4YHMH 1T7WA 4KDTC 1LLAA 1NFKA 1WEJL 1YEJL 1J9RA 2JIXB 1IC5H 4ZUVB 4OCNC 1M9WA 3BIKA 2QPUA 1I53A 1Z5YD 2X4OA 3QUZB 4YBHA 1NCWH 4KZDL 4NN5C 4V1DD 1G0YR 5LNDA 2XU9A 1H6EA 1GGCH 2NY7H 5B39G 4P2RE <