2W5PA

Drae adhesin in complex with chloramphenicol succinate (monoclinic form)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
140
structure length
140
Chain Sequence
b'GSFTPSGTTGTTKLTVTEKCQVRVGDLTVAKTRGQLTDAAPIGPVTVQALGCDARQVALKADTDNFEQGKFFLISDNNRDKLYVNIRPTDNSAWTTDNGVFYKNDVGSWGGIIGIYVDGQQTNTPPGNYTLTLTGGYWAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DR HEMAGGLUTININ STRUCTURAL SUBUNIT
publication title A Structural Study of the Interaction between the Dr Haemagglutinin Drae and Derivatives of Chloramphenicol
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 29
structure length 140
sequence length 140
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04619 Adhesin_Dr Dr-family adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1570 Mainly Beta Sandwich Immunoglobulin-like Dr adhesin 2w5pA00
1USZA 2JKJA 2JKLA 2W5PA 2IXQB 2VERA 2BCMA 1USQA 1UT2A 1RXLA 1UT1A 2JKNA
chains in the Genus database with same CATH superfamily
1HEZB 4QXTB 4GAGL 1KN2H 1KBPA 5D2LA 1PZBA 2IAAC 5T5NG 3H55A 2WQUA 4P2YA 1ZVHA 4EDXB 3MQIA 4W81A 4XXCA 3DUUB 2BZDA 4G72B 1YYCA 3LVTA 5GGRA 4XCFH 4LAQH 3B3BA 2DWEA 3FHQA 1KJ2A 4ZZKA 4OCLC 2PPDA 2VZSA 4P06A 3MCKB 1QBAA 2DQGH 4OD1H 2C3VB 3J8F7 5BQDA 3DO7B 2AJVH 4JVPA 5JYLA 4EAEA 2H2SD 1NGXB 4AGLA 4AGQA 4LOEA 4JKMA 3BVDB 2IXQB 3O4OC 3U4KA 2P8PA 2QMKA 1G1CA 4N2BA 4A2DA 1BZOA 1LP9E 4MXVE 5CKGA 3T3MF 2EXYC 3ML9A 1HH9B 1HXMA 2VRAA 2XDHA 1H3TA 5HD8C 2D4DA 5E4OA 2J72A 3FT3A 5B3JF 4KXAA 4ZSOB 1FUNA 4IJ3B 1HQ4A 4Y4FC 5JDSA 3RTQA 4S1DC 1TTRA 3EGXA 5I1JH 1F4YH 5F72S 2Z31C 2WNXA 3DHJA 4CMHB 3DHMA 2CD0A 5JXED 2BVPB 1CL7I 2G75A 1CTOA 3MLRH 3N85L 4PQXA 1DE4B 5DJCA 3IPEA 4Q6IB 3I2CH 3GSXA 3LIUA 2ZQKA 4HUXB 4EZLA 1UASA 3Q8BA 3AXIA 3ULUE 1ACYH 1MY7A 3ZHNA 4Z76A 2BVUA 3AXHA 3K0YA 3AU0A 4NM4H 3RX9A 4FTVA 4XBEH 1OW0A 5DD3L 1F6AA 5E08H 1BZEA 4PHZA 4ZYKB 2ICCA 3G5YA 3US0A 3NSCA 5SWQA 2H2PD 4MRBA 1AO7A 1IAIL 2CDEA 4KO7A 2H3NB 5C3TA 2NRDA 4PGCB 4R2GB 1ZVSA 2B2XL 2FGZA 1LO0L 3B2VH 3PWLA 5C09E 4XPGH 3QYNA 1V05A 1ASQA 5ID1A 2N0KA 5EFIB 1HSBB 1QABA 2FD6L 1IGJA 3OB0H 3GTNA 3C5ZB 2R4RH 3WHXB 3DMMC 4L2YA 1CD1B 3HZKB 3SHSA 4NZTL 1IIIA 4JRXA 4TVSa 3QYMA 5FUCE 5JLZB 3BPNC 1FO0A 1KPRB 2PTVA 4KH9A 3WELA 3HG5A 5E8EA 5E9DA 4MQXC 3TJEH 1LO5A 2EYSB 2VR4A 1H3PL 3DV4B 1X7TA 1URIA 4YHNA 4NUMA 1S9YA 5F7WC 4BBWA 3TNMA 4AK1A 4MA1B 3KLAB 5SX4I 3CMOH 5FW6A 5F0JB 3OAUL 1OLZA 2ZXEB 4NZ8A 3L9RA 3JZ7A 4FF9A 4GKSA 3LV3A 4YX2H 2ZSWA 2BP5M 5EDXA 5D7KE 3BP4A 1ILUA 4S1QL 1G0XA 2YSTA 1MFDL 4ZZFA 1YPZF 5E8OA 3BWAA 2GSGB 1QI4A 4DCQB 1BEYH 1CDCA 3EYVB 5C0DA 3S3DB 1AH1A 1G7IA 2LU4A 3D4GA 3RX7A 2W8CA 2EIKB 1BX2A 4JZJB 4XN4A 3VE0A 5HPMA 1EXGA 5KVDH 1JWSB 2LHAA 4X4YB 1U33A 4XNYL 3QRFM 4U0RC 1CI5A 1C5BL 5IBUG 3VRIA 1TTUA 1NGZB 1EZVX 4Y5XB 2V2TB 2WCPA 2DF3A 3E3QE 3E7JA 2XWJA 3OR7A 1RJYB 2DQDH 2IWKA 1RHHA 2VDNL 4ZXBA 2W80C 3PPEA 5FYKU 2HVKB 3BW9A 4BH8A 3G5ZA 3MBWA 4NWUH 4WK0B 2BZ7A 5D7JC 1OTUC 4OJAA 5TK4A 3WIHL 4K2UL 2ZYSA 2VMDA 5H4YA 1JCKA 1FCGA 4L4TB 3DUHA 5D1ZB 4OFQA 1V27A 1MY5A 1U8PA 1A7RL 4BSJA 1LGVA 1NLDH 2LT9A 1OARH 4UQCA 4Z7UE 5CCGE 4ZMLA 1EZSA 2EE9A 3QORC 4OGYL 1OT4A 3TV3L 2LOEA 1BM3L 4ZTPL 1Q94B 4MMXA 3LH9A 5E99L 1SDDA 1TVBA 2FAUA 2F74A 5CUSH 2HCZX 3ARBA 2W81C 4LDCA 1IAIH 3APFA 3L48A 5EBLA 4L2LA 2GJZB 4JFPB 4XPTL 3I9PA 3VFPA 1NCIA 1E42A 2HFGH 5AALA 2I32A 1HT6A 2XG4A 1QBLH 3V0AC 4GG6B 3RUGB 4WEEA 3VXRD 4A7UA 3BAIA 1I8KA 2V2XA 3QI9A 3T2OA 2WLZA 3QUML 2WOYA 1EUTA 2VL4A 1UEYA 2WWNA 3NIDB 4DZ8B 1FL5B 4OM0H 1E6OH 4DN4H 2UZYA 4N90D 4TUKL 5ABAA 4O9HL 4DTGL 5CBAA 1UD3A 3IFLL 3BWZA 1X4ZA 4X6DB 4RBPH 2VB5A 2X3BA 1OQXA 3KPMB 4UANA 2F54A 1IMHC 5EU6D 3MJ9A 4HFWB 1H3PH 3GGWB 3TEZA 2GUOA 1N8ZB 1Y7VA 2VXUL 4LBEB 3RWGA 1NFIB 3RILA 1QFHA 4U1JB 1QOKA 3UGEA 1SEQL 4XOBA 4HKZA 3CN3A 1ZGLP 2VLMD 3V0HA 3L3KA 1NIAA 4BZ1H 5BS0D 1JK8B 4YHZH 1X5AA 2EEDA 4R7LA 3E2HC 1KTLA 1JSYA 2H2SC 2QGDA 4NQEE 5C0EA 1SHMA 2WCGA 4S1QH 2Q3XA 5CEYB 3P11L 3LDBC 1VADA 3ARED 3SKNA 3K6SA 1O6VA 4DOHE 1GGTA 4OJEH 3G5XA 4A7QA 1WG3A 2Y5QA 5E8NA 1ZHBB 2YAEA 4N0CD 3T0EB 2FIKB 2NXZC 3CTTA 2JKLA 1PF3A 3VXSB 5E8PB 2VM4A 1IZJA 2X40A 3UZEC 1JHKL 3RDTA 2BRRH 5F7LB 3GO1L 1PNDA 5JXEC 1G7HA 3ARRA 1ZCRA 4PJEE 3PJLA 1IC1A 3FUJA 4X9GA 3PDGA 3VGEA 2XVLA 2XU9A 1EZLA 4NM8L 5DRXB 1UXWB 2XN9B 5FO7A 4JCMA 4ANWA 4H25B 4B5ZA 5C0IB 4N20A 1HH6A 1V10A 2VUYA 3MV8A 4XMPH 1U8OA 2LTQC 4OCNC 4UZSA 2JXMA 3UTZA 2ZUQC 2X42A 4GNKB 2O5YH 1KPUA 5AZEL 5FUCC 3EJCA 3SPGA 4TNVK 1WFTA 5HHPA 5HHOA 1BYPA 5DHVA 4DPRA 3LN5A 5IM7B 1LQBC 2W1NA 2FH6A 2J44A 3KL5A 3QXVA 4HIQA 4OGYH 4OF7A 4ZTPH 1JV2A 2EICA 2BOCA 2ALWA 1MJ7H 5BO0D 4KKQA 4OD3H 3MLPA 4ECNA 2EUWA 4JUSA 5GRJL 2AJYL 4PTTA 3C2AL 3HN3A 5FGCB 3BVVA 4BH7A 1ZSHA 5AAPA 3RZCB 1TNMA 3FAWA 2WB1A 1FFNB 3N9GL 4AZ8B 5ESAB 5IESH 3S9DB 4H8WH 1OGSA 2OCJA 1S7WA 4HWNA 4XMTA 3CK0H 3K2UH 4JFFD 3MRHB 4HJJL 3QUMH 4FEMA 3FFCD 1ITCA 3FCSA 1AZNA 2NX5D 5I8EB 2VR6A 4K71B 2YXMA 3BUQA 1UH4A 4HWBL 1NCHA 5HY9A 4TUKH 3U79A 4O9HH 4DTGH 2XN0A 5JZ7C 1T22A 1VPOL 4AW4A 2Z92A 3MBEA 1GTNA 4MNQB 5CCKL 4PW3A 1EAOA 2F53A 2YARA 4M93C 2QV2A 4MASA 3RWDA 1VKXA 2UUDK 3SGEI 4YDNA 2QDWA 3WKYA 2CKBB 1KN4L 3L7FA 3IRPX 3ROLA 4J3OD 1U3NA 4FZ8L 4WU5B 4G83A 4WUUB 3E3QC 2MTAA 4U6TA 2YPLB 3OKNB 5CR1A 4GG6F 1SEQH 4TVPH 1AFVH 4YZWA 2NY7L 3STLB 2IH1B 4QXUH 5IV2A 5E24E 4TOYL 5H4ZA 4G8AC 3KS0J 4EIGB 2GTQA 4JFYB 1F18A 4YSPA 1DJSA 4X99A 3HG2A 1FZJA 4X6DF 4WGKA 4XN7A 3P11H 1DVFB 1ID2A 4MAUL 4PJXF 1GS7A 2GTWA 3EFFA 3O3EA 4Z78A 2KZ1B 1XR9A 2BNQB 1G7JA 1DANU 3IJEB 4U1HA 1BZQK 1JD7A 1KACB 4YXKL 3TWYA 3D3VA 2EVFA 5F88B 1G9ML 1KBBA 3F5WA 5C0BE 2P7TB 4L8CB 2QHLA 2Q7YB 1RMFL 2X2UA 3QC5X 5F96L 5I8CA 2VQTA 1AQDA 4QYOA 1JHKH 2F7PA 3MLTA 5T1DL 4FTVE 3O6FB 4L8DB 3RWJA 5ICZA 4Z1PA 1KXVA 1TPXB 1FFRA 1OGAA 2HJFB 3TCLB 2YD4A 3UP1A 1BA9A 3ZSTA 3DTUB 4XHQA 5E2JA 3ZTEA 5J13B 3MLVL 4PRNA 4Q14A 3PY9A 2OMZA 1J87A 4KK8D 5I5MA 4BM7A 1E2WA 1DSWA 4AJYV 1JDAA 5J57B 4OZGA 3J27A 5GZND 3GSNB 2PLTA 3MRJA 4YC2C 2XJKA 3DGGA 2I24N 1H5BA 3NIFF 1B4LA 5EF1A 3NJXA 1QTYT 1P69B 2L7QA 5BZWB 2VNCA 2V3EA 3X1FA 1CLZL 1H9VA 4JB9H 4WV1B 2TAAA 1U8MB 1IE4A 1EJFA 2R51A 3VFGL 1E4KC 4KH2A 1I1CA 5F3HB 5GZOD 4JM2F 2PTUA 4NFBA 4PWFA 4B96A 4BFGA 4P9ML 3F7PC 1TJIL 1E50A 1UA6H 2GK0A 2XQ0A 4YSUA 2NY4D 4H5SB 2X2IA 2MQCA 5K59E 1QEWA 1YEJL 2APSA 2B3RA 3PP3K 3PV7A 4JREB 1U3ZA 1U8KB 4LESA 3DO4A 2CPUA 4G80B 32C2A 3FXIC 4L37A 2DWDB 2NW3A 2AS5M 1ZRUA 2VLKB 1IILE 2DM7A 4TTDD 3LIZL 3MV9B 3ZZLA 1RZJC 4ZUWA 1HI6A 5DMKA 4ZQTA 4NT6B 5KJ7E 5E5UB 2A2QT 2H8PA 1G0YR 1KN4H 1ZD6A 1U8HB 2NZIA 1K2DB 1MFBL 4KNSA 2JWYA 2DS4A 2YQ3A 4H26A 3VXPA 3AS0A 4Z0BH 1EEUA 1PS3A 4Q9CA 5J7CC 2JKIS 2Y1VA 5IB2A 4YDIH 5GGTA 3AREC 1ZA3A 3QNZB 4QOKA 1MFAL 2NY7H 4E41B 4X5WA 3WXWL 3POCA 2ADGA 3GZPA 5KZCD 1RU9L 4N0CC 4F8PA 1ZGLA 4I4WB 4ZO8A 2IQAB 4LLUB 2X2YA 1Q9OA 5GS2D 3V4VH 1SXNA 4YXKH 4PJ5A 5AVSB 3WKPA 1HXKA 4LB8A 2HN7B 1UGNA 1OP3H 4XNUH 4JHWH 5T1JA 1YNLL 3U1SH 3IGUA 4Y4HA 6PCYA 4PB0H 3FUHA 4JRWA 1AZCA 1F56A 4P57B 3BISA 5T1DH 3QAZC 1CLVA 2BSRA 4LPXA 1UA7A 4CU6A 2NTFA 4QRFA 2R39A 1YSOA 4RISL 2XKUA 5HHMD 3X14B 3U30C 2OMWB 2X0WA 3RURA 5AUMB 3WLWD 5HVWA 3ZOAA 5DTFB 5KVGL 2X4OB 4HPYL 1MW1A 4XN8A 5DHDA 3RWCB 1FYTD 4N3UA 4MS8D 4CW1A 3NJNA 1DUZB 3P73B 3FHAA 4N0YL 3H2WA 5T1LB 3K71A 2ROYA 2KDGA 4AXWB 4FQJH 1FPTL 2A9CA 5CEXA 4F33B 2YEZB 3GI8L 3I6GB 5HHME 1JMZA 3OWRA 3B9KA 2Y6TE 1CLZH 5DUJA 4AV0A 3Q8CA 2FX9L 3ZBMA 3TH2T 3VFGH 2AZUA 3MR9A 1WD8A 4RGOL 2P5EB 4H0IA 1OAJA 1EVUA 4HJUA 1FCCA 1FV1A 4KKCD 4XZUB 3HA0A 1TJIH 1B4JL 1I75A 3P3TA 2C9QA 1SLVA 2ESVB 2WQAA 3BN9D 5DXWA 1QG3A 3FU7B 1PZDA 3HBZA 1ZHKB 4J3OC 1IBHA 3TBSA 2VDMH 5ALBL 3N3EA 1C12B 1AGDB 2PYED 3QFDA 3LIZH 3D39D 1XL6A 3ABGA 3WHE1 2VDKB 2YAMA 3U36A 2BW5A 3R06B 1XQ4A 5KVEE 4KV5F 2XY2A 1D5MA 1T5WA 3ILQC 5HYEA 3UADA 4HF5H 4UM8B 2WJ5A 3VDCA 5H35A 3L2NA 1JTPA 5CZRA 1H9DA 4H8PA 1J8KA 4BFEA 1N2RA 1K4DB 2MPVA 4PRHB 2LLLA 5D7SL 4BFKA 1CFTA 3CHQA 1RU9H 2JKRM 1BVNT 2J8UE 1CIUA 1XF4B 1KCBA 1CFSA 3DYMA 2YEQA 4NZJA 3H0TB 5DRNA 3UAAA 3WLBB 3D0VA 1SXZA 3EGSB 1BQKA 2ZIDA 4PD4K 1SRDA 3EOAB 4RESB 3MACL 2EEFA 3VX1A 1QMUA 1QA9A 4JRLA 2E7HA 2M8XA 5I5RA 3CN2A 4D8OA 2A6DB 3IYLW 1EXUA 2BWIA 5DDHB 2G9KA 2E9JA 1BXUA 3CBJB 3EYSH 3S0PA 1NDMA 2I9LA 2KH2B 2R4SL 3ECUA 1A3QA 4LEXL 4KK8C 1F1GA 4PJAE 3GC3A 4RISH 4YZFF 2QTVA 2DTML 4OIIH 4D2NA 3CNKA 3EBHA 2JKSA 5DQJA 3IDMA 4ZNCD 3ORJA 3KNBA 4ZOEA 3STZB 5GZNC 4O00A 3CHSA 1BZ9B 3ZYZA 3S5LG 1T4KB 2G0LA 3WEMA 4IDLA 4ORZC 3DSNA 3ZZ1A 1U3HD 3N06B 4HPYH 1NGQH 1RQ5A 5DJ0B 2XIBA 4GI6A 4UT7L 1BECA 5T3XD 5CEZD 1HHIA 4N0YH 2B1HL 1Q1JL 4KZ0A 4YDJB 5BRZD 3GIZL 2F53E 4HDIA 1OCRB 3S34L 5B22A 4NJ9L 5GZOC 2HLEB 1G7PA 4W6XB 4N6QA 3LQAL 3VG9B 2MNUA 3HR5B 4PV1C 5J56B 5IJKC 2NY4C 4G8GA 2WC7A 4F7PB 2FX9H 4YHIA 1S9VA 2VDLB 2AAAA 4NCC1 4RGOH 3QPXL 1Y18A 3KZ8A 1QHPA 5ISZA 1JYWA 5E23A 4TTDC 3HI1A 3PHQB 2MQ3A 4I2XB 4AQ8C 1WAAF 2C8NA 1TO4A 2OK0L 1CXFA 3ZT6A 4YWGH 3NCEB 1RK1A 4G7VH 5MI0C 3UC2A 2GAZA 1N8OE 2XTLA 5AD0A 1G7LB 5F9OL 2Z4QA 3TL5A 5AVVB 2JI3A 4DW2H 2B5IC 1I9JL 3QUYB 4W9CC 4PJBA 5GGRB 4Z7UF 5CLZA 5IGXH 2FQEA 4JFOB 5LN8A 3OZ9L 5TQ0L 1ACXA 2FVNA 3GRGA 3I6SA 3VI4B 2QPFA 4ZOBA 1KJ2B 1YUHB 3VYOA 2E75C 3WNOA 3EYQD 4PGZA 2F8OA 2X4TB 1A6AB 2WLHA 5E1QA 2X12A 5D55A 2ICWA 5IF0B 1ZY9A 4Q2ZA 1ZLVK 4AMKH 5F7YC 1TZHA 5C86A 1F97A 4KOBA 3WNNA 2NNAB 1CDYA 4F20A 2ZOOA 4GJTB 4DGVL 1XTLA 3P1VA 1AG0A 3QIUB 2X4RB 4EQ2A 3QQDA 5I73B 4PJ9A 2YXFA 1OALA 1R3KB 2FEEI 4NFDA 3JTTA 5IB4A 5AW4B 1I7ZA 3FT3B 1C16A 1CK0L 1L0PA 2C3HA 2R2EA 3NEEA 3MACH 4M4RB 3P9LA 1F1AA 5LUMA 3RTQB 1O7DC 3D2UA 3TXAA 2VLLA 1TQCC 1XH3A 3EGXB 1DDTA 3U2JA 1P7KB 5J6SA 1IC7L 2WD0A 3DOSB 2R4SH 2G75B 3NCJH 5EZJB 3OHXB 4LEXH 2XQBL 5DJCB 1JFQL 4NOBA 1PX4A 3C9NA 4JY6A 1JGEB 3BH8B 3QUZA 4FQ2H 4MS8C 5EO1A 3P4NA 4TPRL 2Y07H 4Z76B 2BNRB 2MOVA 2QQKH 3Q05A 2DMBA 4PMFA 3PGCA 2DM3A 3OAWA 5TE6H 1PQZB 1A3RL 3H9SA 3I50L 3KJ4C 4UT7H 3WJLA 4XNAA 2KUTA 3GEWB 4ATTA 4BDVA 1IFHH 3MMEA 1AO7B 1IQWL 3LKOA 3IU4L 3GIZH 4P4KB 2N7SA 3TLRA 2E0PA 3S34H 3SCMD 3WEXA 4A2GA 2EIDA 3PWLB 5DJAB 4NJ9H 3I84A 2VCOA 5ID1B 3A47A 3DYOA 4AY0A 3VXOB 4APXB 2UXTA 3BN9C 3MREA 2GPZA 4LRIA 4PJCB 2YAPA 2Y23A 4J4PC 1S9XA 3SKJL 4AJ0A 5DRWB 3SGDH 1DQLH 3WGUB 2OTWA 3DOHA 1XCQB 2F08A 5TGBA 4QOKE 1FO0B 3LS5L 1BIHA 5TE7L 4Y1AE 1JGIA 2PABA 3UMTA 5JOPE 3QDGA 5E8EB 5E9DB 2VXSL 5EA0L 2UY6A 2NNRA 2R69H 4NQCA 4HK3J 4Q6YA 5A2BA 4CJ1A 7FABL 3TNMB 4JFZL 1HVXA 4IGBB 4OSUH 4UV4H 3CX5J 1KLFA 5A2KH 3GDCA 3TT1L 4MD4A 1KENH 4LPTA 1DEDA 5DI8B 3L9RB 1DEEA 1IGTA 5CJOL 2FL5A 4XNQA 4HLEA 1DQQA 1I9JH 3BVTA 1MCHA 1DVXA 3ZR6A 4B7LA 2ZSWB 1B4RA 3QWOB 3OZ9H 3O9WB 2B39A 5IBTL 5T33H 3BWAB 3KDMB 4PRIB 3ZJAA 3JVGA 1KB3A 1G7IB 3F84A 2X4UA 3ZDZE 3F12B 4PV9A 2FJUB 3OAYH 1N18A 5FYLH 4DGVH 1ZA6A 5D2LF 1Q0YL 3UYRH 4JPIB 4PJFB 4WWKA 3PP4L 4ANXA 5C71A 3S96B 2WYZA 3C09C 1A21A 1LD9A 3G6JE 4L8BA 1T1WB 2IJ0C 1VJSA 3NABL 3KD4A 2F5BH 3PFUA 3L54A 5AL8A 1CK0H 1ETJA 1D6EA 3MUHL 3VI4F 3I3EA 4AMWA 4IBYA 5I9QB 3GSVB 3BW9B 1I7TB 1OSZB 3G5ZB 3GRWL 3VXNB 4ODBD 3WUZA 4OTXH 4WDIA 2ENSA 2Z93A 2C7UA 4FLRA 5J12C 2BP8A 3RTLA 1G9NC 3FUDA 4Y4KA 3UYPA 4WHYH 3NMEA 4XBGB 1TFPA 1IT9L 4MLSA 4OI9A 1U8PB 1U3HC 2CO2A 3K1DA 2YAOA 2RACA 3MO1A 4HCRL 3GXDA 1D3CA 1HQRA 4AEIH 1S3KL 5IY5B 3FDWA 4ZUVB 1H3WM 4PSPA 5AAMC 3EG9A 1R5IB 1YEDA 3MFGB 4P23B 4LQFL 3I50H 3LEYL 4WHCA 4U1NB 3U4BL 3UTSA 4DQOL 3JV4A 4JCLA 1I4FA 3M1BA 3QIBB 3SZ6A 3IU4H 2APFA 3WAJA 1LEKA 1GS6X 2DKMA 2Z1KA 3L3IB 2HKHL 1I7UA 1KEML 3IRCA 1FFQA 2LR4A 2CG9X 3DOIA 1V3JA 3E1ZA 3NCBB 5LBGA 3HHSA 2D2CC 2EDHA 1OB1A 3S3BB 5KSAA 4LHUB 3C6LD 3ELQA 5ICXA 4OLEA 3D4YA 3FRPB 3ZE0B 2XXGA 3AABA 3LS5H 5GSRB 3X11B 3UCQA 4UUJA 2W9DH 5EG6C 1S78D 2X4SA 5JZ7D 4JFXB 2J25A 2WHVA 1BF5A 1XD1A 4A68A 2ZOLA 2BC4A 5DSCA 4ZSOE 2GUOB 5JXAH 4U1MB 2ODHA 5EOCL 3K6IA 3RWGB 5EV7A 7FABH 1M53A 2VDRL 4FQIL 4L1TA 4PB9L 5I19H 1DVTA 2CH8A 3BMVA 5HI3C 3L3KB 5CJOH 3ZT5A 4PJCF 2KPWA 4BFRA 3V4PB 3PIQB 4BEIA 5AAWC 4R2GD 3AY4C 4EIZC 3NEXA 1O9ZA 1U91B 2VMCA 3DX4A 4MX7A 2MCMA 3HE7C 1CBJA 3ATFA 1KB5B 3ILPA 5CZKA 1F8TL 1IGFL 1CGWA 2A6IA 3NBNA 2ZX7A 4U6XA 5B3SB 3G5XB 1E9QA 2VDPB 3C5ZD 3EYOA 5BVJA 1MHPL 4TSAL 2I26N 2FHBA 4P4RB 2F6AA 4FL4B 4C4BA 3BCDA 2JKXA 4WEMB 2W60A 2DQCL 5D7LB 4BK4A 1MNNA 2DYPA 2YQ2A 5FYJD 4X6CE 1FNAA 5DQ9A 4JFEB 1F1DA 4WEBH 4TRPH 2YRZA 4PY8J 5CFHA 3FQUA 4KRPC 1GXEA 1A0QL 1L7TH 3OR6A 3UTTB 4IRZH 3VGHA 3MV8B 2A6JA 1CFNA 3LXBA 2OM5A 1SFHA 3UTZB 1FE8H 1QUPA 4OB5L 3M1CA 1IT9H 5AOZA 4A63A 4G8GE 5HI4D 5HHOB 2SODB 1DFXA 2ZP0T 2CLRA 4HCRH 2R56L 1NFKA 4P5TB 2I27N 4CNIA 5ISZE 2PETA 4MA7H 4GBXA 5C6PB 2BOCB 2C3WA 2WO2B 5IEKA 3CXDH 1RV6X 2P3YA 2KMWA 4ODUA 1J11A 1B2WL 1N0LB 3SPHA 5LXGL 3FQTB 2F8VA 4CVUA 5LB1A 4KHXL 3GXIA 1ROCA 1E65A 3MROB 1FNHA 2Z9TA 4UAHA 4MYPA 4QHUB 5DLML 5AVYB 2R1WA 3T6ZA 2GJ6A 2A74C 1KEMH 2HRPL 3PV6A 4TUJA 3R4RA 4PJBE 2DQHL 4ZODA 3QXAA 2WSKA 3FCSB 2BY0A 2HLFC 4PLJD 5HVHC 2X09A 1OQOA 4NCDA 5HY9B 3GMMB 2L7UA 4LLYA 1T22B 4L4TD 1CVRA 4OLWL 3C12A 4DGIL 3F58H 4BUGA 5JHDD 3SBQA 5IW1A 4H1LB 3TH3T 3MNMA 1ADWA 2D9QB 5CS7A 4EQ3A 1KIQA 2JELH 4G43B 3U0PA 2BWDA 2FGWL 6TAAA 4HH8A 3W9DB 4DAGH 1OD7A 5D4JA 1BFTA 2PUQT 3O41A 3ULVL 3OSVA 2FJHA 4PJ7B 3RJOA 1E4WH 5MHSE 1I1RA 5IV2B 1AANA 4F58L 1WFJA 3OVUB 4FI7A 1MXDA 4KQ4L 4R7VA 3EJPA 4L3CA 5I1IH 3U6XA 1MAJA 4A2MA 3ZE0F 3IXTB 4I8DA 1QSZA 1EDQA 2NQ3A 3P69A 2OSWA 3KGTA 3MNVA 2GTWB 3MV7B 3O3EB 1ZSDA 3TVMC 1G7JB 4U1HB 3WIHA 2FQFA 4HP5A 3D3VB 4D0DA 4URKA 3QQXA 4TSAH 5HYFA 2VJ0A 4UQ2A 1W72A 1AI1L 2HZHA 3F5WB 3RWFA 4R0LB 3W57A 2YA0A 1UOVA 1UT2A 1P5VA 1TXKA 3VB9A 4QYOB 4N85A 4I48B 3U83A 2IPUG 4O51B 2KQMA 4UQIM 4ZMWA 4I18B 3RWJB 4Z3FA 3RUGE 4ONFH 1MZYA 4IU3A 1TEGA 2QDVA 1UD2A 4EMZA 4CUCA 1EHAA 1A0QH 3SKUD 3NIDE 4FHJA 5C9KA 3ES6A 3T4AA 1S7SA 4AVJA 5KBKA 3SPIA 1XSOA 4F9PA 1CXIA 4OB5H 3OB8A 3F7VA 1EMTL 1BZDA 2YFOA 4K8RD 4RMUA 4QRTB 3FU0A 2OMTA 3DROA 4OZGB 3SKMA 2VT0A 1YNKL 3T4YB 1M7UA 3NFPB 2WAHA 4Q4EA 4X8JB 1YEKL 2P5WA 3T0ED 1OTTD 4LLMB 3SDDA 4B3EA 4IJ3C 3B7UX 1GZPB 5AYUH 3BKJH 5C7ZA 3V79C 1MCWW 2WLJA 4M4PA 1B2WH 4GQZA 4YDMA 4F8NA 1M05B 1BZ8A 4P2QA 1PW3A 1TEFA 4KHXH 4O2CA 4A38A 2O5NA 2XXMB 2DN7A 4ZW6A 3ZUNC 1XHHA 4CMHC 2XOTA 3D69A 1HZHL 5DD5L 5DLMH 4M7KL 3HUJA 4KPHL 2EDMA 5C0GA 1YECH 2HRPH 3MV11 5AQ0A 1YYLL 5KOVC 3RU8L 2E7BA 2MEJB 5CJXA 1E67A 4Q58C 4Q6IC 2XN9D 2DQHH 5EC1A 4LKCA 1S78C 2PR4L 4HZLA 3ZKXB 2YZ8A 4JX0A 4PREA 4OLZH 2EUXA 4E0RA 4JM2D 3VXSE 1HI6B 2XIIA 4TQEH 4A1RA 5D8JL 1TU2B 4PTUA 1K4CA 3IAQA 1KCRH 1K85A 3VH8A 3LXAA 3BVXA 4PP1D 3D30A 4G5ZL 5DVKA 4AVIA 3VXPB 2BP0B 2ZWZA 4R2GC 4ADIA 1UM6H 2W95A 2X7LA 2BVOB 4D0BB 4UOQA 2AJUL 2Y2TA 5IREA 3N04A 3ULVH 2ICWI 4PV8A 2Y5TB 4L5FL 3RZCD 5DMGD 1S8DA 4ZFQA 1QPKA 3C5ZC 3R0MA 1LEIA 1C08A 2L7JA 4L9LB 4LDOB 1MNUH 1Q9OB 3BD5A 2BY1A 5CXPA 2EDRA 2D7TH 1F13A 4NLAA 5EOTA 4L0ZA 3UACA 4D9QE 4PJ5B 1EXHA 1KGXA 5DUBA 3GINA 3P30L 4M5ZL 5BV7L 4JFSA 3FOLB 2JJWA 5TDPB 1AI1H 3ZTNH 4MNQD 3QDMA 4MA1C 3MRCA 4NIYE 3WNMA 3ZTDC 3UC0L 3L08A 4FP8L 5I82A 4YSTA 4JG0L 4Z7WA 5GJTL 5E1AA 5IB5B 3JUZA 4Y8DC 4PIBA 4WUUD 2NTFB 3UTSE 4Y2DA 3IDJA 1K8IB 3E80A 3V0WL 5CGYD 2XBDA 5DJXA 3O0RL 3VXUA 3RB5A 5F1NA 3EYUH 5HI4C 1FGNL 4QRRA 3ABZA 5D4HA 4X5XB 1T7VA 1P7HL 4JZJC 2LLNA 5BJTB 4K94H 2IWEA 1MKFA 2DH2A 3S8FB 1N10A 1P7BA 4GMSL 5GGUB 1YNKH 4TSCL 3ZU8A 4ENEC 3BQUB 2BNQD 4WIQA 1ETB1 4AT6B 4GAJL 2WBJA 4NQDA 4MJ2A 1WZKA 3NN8A 4XRCA 4Y5XC 2ZT9C 3T0WA 4HWBA 2FR4A 1YEKH 1TLKA 2YPLE 1HYSD 1GKEA 3CZNA 5TH2B 2M1KA 4LO9A 4DUWA 1DN2A 3B9KB 4IRSA 3K91A 2CUAA 2VR3A 4HV8A 2JNZA 5T8IA 4H0GA 4B5EA 4BRVA 4LARL 3O6FD 4PLJC 1UZ8B 3VVVA 1N0XH 1PY9A 1QBML 3PHOA 1HZHH 4PJDA 5HDLA 4M7KH 1QVOA 4KPHH 1U95B 5D1ZC 3SJVB 1KSRA 4OZGF 5DFAA 1YYLH 3D12B 4GXVL 4F5CE 4HMEA 2BNQE 1VCAA 3D9AL 4UNUA 5DA0B 2YUZA 1K8DA 3RKPA 3KPSB 3TBSB 3FFDA 1Z66A 4C59B 4XAKD 2GSIB 4MD0A 3COOA 1QFWM 3MUJA 5FYKD 5E2WL 4HIHA 1ZTXL 4R3SA 1RIVL 5KSVA 3BT2H 5EDSA 4OLXL 4EUPA 4EN3A 1D7FA 2ED9A 3QUXA 3QAQA 5HYJB 2AVFA 3A4FA 2DOCA 5HPOA 1T5WB 3GJEA 4TQPA 5H37H 4NZDA 4N22A 4MQTB 3DX6A 4KAQH 5CZXD 3IWVA 2AJUH 2EE3A 1QO3B 3GS0A 4CC4A 4TNVF 5ELIA 3P0YL 1NCWH 4GEIA 1YC8A 4ETQA 2OX5A 2Q2LA 4UNIA 4XAKE 5DMIL 5TDNA 3R8BB 4MAYB 1U2HA 2APXA 4DERA 3HG1E 3S3JA 3NP3A 4KBPA 4NN5B 5GRZA 2AHIA 1J9RA 3PWUA 1R3HA 5DO2C 1O75A 4M5ZH 1G1YA 3QHZL 4DN3H 3IE9A 4FFVD 4C58B 1Q0XL 1XGPA 2B9AA 2O61B 3OQRA 1FWXA 3LMJH 43CAA 5F7KC 3MV9D 2WKOA 1HHJA 2VDQB 1L0QA 5IFHH 2R1XA 3NA9H 4JO4L 3UC0H 1YY8A 5DMJB 4JZOA 5HGHB 4JG0H 2NTSP 1F6LL 1QWNA 3EUUA 3HFFA 5LO7A 4Z23A 1IJNA 2I9LB 1NDMB 2CMRL 2WZ6A 4UIMA 1NIBA 3K2IA 2ZONA 3BT0A 2AEOA 3MKKA 4IU2A 3V0WH 3RBSA 4EI5A 2XZCL 2NUPB 1LHZA 4L1LA 3IDMB 3O0RH 4P5MA 5DQJB 5AZ2H 4J7RA 1UCBL 3D18B 1FGNH 4WTZG 4QXGH 1GAFL 5IHLB 3BGMB 1RSFA 2VLKE 1A5FL 1JPTH 1T66D 3NOIA 3TN0A 3T0EC 1KCVL 2OTUA 1HHIB 3QJQB 2AV1A 1PD1A 3HS0A 2WO3B 3UAJD 5GS2H 5C8JA 3LHPH 3O45A 2EIBA 2VDOH 1UM5L 3BEVA 3CPLA 4QHKJ 3CSYA 1G7PB 3L4VA 4RX4D 1JGVL 3W3BA 3NIGB 3LRGA 2NR6C 4PJ8D 4YHIB 2NLJB 4YGVA 2PPAA 5F3FA 1UB6A 4D8PA 4E41E 1L7IL 2XA8L 5I6OA 1KFGA 2Y5EA 1UWFA 3PWPD 5D7IE 2AV7B 1LO4H 3MRLA 3CFKB 1Y0LB 1A9EA 3HI1B 2RHEA 4ODXB 3H3PH 4QTHA 3LKQA 4BD4A 4NNPH 4NHCH 1BSIA 4E36A 2DICA 3DX8A 1FNGB 3WN5A 1JRHL 2X4QB 2F8IA 1D5XA 3D9AH 3CMGA 1KIUB 1OAQH 4MHHI 3QJUB 5ENWA 4RA0C 3JYCA 5L2KA 4PP1C 1MCWM 1SJVA 1TQUA 4ZX3A 1RK1B 5JIPA 2YD5A 3FU6A 4MFHA 7CGTA 3GMRB 5E2WH 2ETWA 1ZTXH 3HC4L 3U6XS 2Z4QB 4URTB 3VWKD 3L45A 3KVPA 3RZCC 4DP9X 5T1LD 2W59A 4ZAKA 5DMGC 5CIPH 4NCC2 2FLRT 2NY5L 2VZ1A 5I1DA 2BOLA 1QNZL 4YJZL 2VIRA 2ICWB 3H42H 5A2JH 3P0YH 5I8KL 4K71C 3R8QA 2P5ED 2PP8A 3MPCA 5DMIH 4M02A 1WUNT 2DEYX 4R26L 4UOZA 3CFCL 4EZJA 3MFFA 1XBRA 4KTGA 1NAMA 2VSCA 1M9SA 4QHLB 5IB4B 1MELA 4HIJA 1C8QA 5EF2A 3D4CA 3GFUA 5AKSA 1T21A 1X7QB 2VC2L 3RBGA 2VLLB 1LVEA 3OPUA 5CGMA 2CZNA 1XH3B 1A7PL 5EBWB 6CGTA 5AW3B 3R19A 1Q1PA 2CE6A 1CVSC 1J9TA 2NDGA 2FNWA 2CMRH 3B6SB 4LSVH 5CSZB 4HIXL 1MG2C 3U48A 1ZS2A 3SDXA 2ESVE 4ZUTA 2XZCH 1MCFA 3C9NB 1DVFC 3KPTA 3QULB 4JY6B 1N6QH 2YBGA 5EO1B 3L5WB 4C4KT 3P4NB 1UCBH 1EBAA 3II3A 2Q2EB 4HC1H 2YPVL 3KPRD 3A21A 1PY4A 4M5YH 4PRHD 3FB8A 1GAFH 1XB6A 3SE3A 4CVZA 1JZFA 4YN3A 3PGCB 1HYSC 3SE8L 1WF5A 2YQGA 2E7MA 1INEH 3HC3L 4KROB 3EKCA 5L2JB 3LKOB 4OLVH 3QZOA 4HISA 4YXLL 2FX8L 3GBEA 4U1LB 2IBBA 2IDSA 3WJMA 3O6FC 3WEXB 2DL2A 4NUQA 3IU3B 2DPKA 4NO5A 4L0YA 3QR1A 3CVCA 2EILB 1UATA 4DO6A 3KH4A 3IN2A 1TPXC 3BH9A 1JGVH 4PRHE 1AGFA 5IW6B 2H0PA 5FHBL 2BJML 1I9IL 1S9XB 2BIMA 2XA8H 5J13C 2ZWLT 3IMVA 3WFHA 2PW1A 2JJTC 3H6JA 2X2HA 5D1QA 1KLUA 1A14L 1YQ2A 4PJGA 1YQVL 2BP3A 4KFMA 4UB0H 5MENE 3X3FL 3EF4A 2UXFA 3JWOC 5E8DL 1JRHH 8CGTA 4M48H 4NQCB 4X7EC 2QZQA 2ENJA 2ZXQA 1U8LA 5ICUA 5JNYA 5IMKB 2GIYA 2CO3A 3PWNB 4UIKL 3SBRA 4G6ML 1NANH 4UTBA 3LZNA 2QPSA 3ZDXE 1M1SA 1J7VR 3ZRCC 5CZXC 4Y9CA 3NIGF 5SX5H 4AGMA 1IGTB 3QQ4B 3NZHL 2ZUTA 4XNQB 1J0ZA 5CEZH 1YNTA 1AXIB 1F3JA 3V5HA 3T2NH 3S6CA 3FCBA 3RPIB 3QDME 3PDOB 1S5IH 2C26A 1IBZA 3E6HB 3UPAA 5JR1L 3QZWA 3FKUS 3LD8B 2Y7QA 3TJPA 1QRKA 4NC2B 4QRSA 3RPBA 2CLZA 3MZTA 3IAGC 5FV2A 1O5DT 3TZVA 2UZPA 4N8PA 4Z7NB 5I8KH 2O6PA 3Q6GH 4JFHD 3QDJB 3VW3L 4YLBA 4WWKB 3CFCH 2NSXA 3IGFA 4FNPA 5KYWA 1DL7L 1LWJA 4PM1A 3B9DA 2HX9A 1HWGB 1D6EB 4A04A 2YD0A 4ZUSB 3LY6A 1DN0A 2JKNA 4LIQL 2XPZA 1H3XA 3IF1A 2VC2H 3ZHKA 3B8SA 4X50A 5A16B 3N2JA 2PPFA 2Q6WA 4FQLH 4WDIB 3QEQA 2VXTL 2Z93B 3QUYD 1CF8L 4JFHE 5B38A 3LPWA 1UB5A 4Y4KB 3GB7A 1AR2A 5FC9A 2E9WA 3BQVA 3CSBA 4GY4A 2Z7UA 1E9OA 3NDZE 1TETL 2CM5A 2XZQH 2AK4A 4G1EA 4W9HC 4L29A 4ZO9A 1KYUA 2YPVH 4XTRD 3UAJC 2ICEA 4AUUA 1KBGL 3UO1L 1I8IB 1GZHA 2X28A 4Z3HA 3CH1A 3HC3H 3QIUD 3DTXB 2C9UA 4M8QB 1JV5A 1I4FB 4MB5A 4PS4L 2DQTL 4YXLH 2CIKA 1OZUA 4U3XA 3PFQA 2EINB 2F8XC 5KBLA 1I7UB 3ZX1A 3HNVH 1WCQA 3RTQD 1XGRA 2KC0A 4PRAB 5IKCA 3VDBA 1E5CA 1RVFH 3CVHH 4KGLA 4AQ1A 1A1OB 1I9IH 2P49B 1CLCA 2YIHA 4BFIB 5L6YH 2EACA 1T5XA 1JFHA 1YQVH 2WQXA 5EMYA 1R0AH 2X4SB 5E8DH 5JUEH 3V10A 3TF7C 3QXUA 5F2FA 5DSCB 1N3NA 1BJMA 2BC4B 2CRZA 3EDEA 3HAEA 3TGXA 4G6MH 4JHAL 1A25A 3N6YA 1SPDA 3KVQA 2JE8A 2WWOA 2WLIA 1U8CA 2VE6B 3FC8A 4JQXA 4LGRB 1RLBA 4FQXA 1XF5A 4XBMA 5DLLA 1QW9A 2AXFB 1VGEL 5FO8A 3NZHH 4XB3A 4EUPG 3FQNA 1AO7D 3TA4D 4LSQH 3E6FA 3T3PB 4DUXA 3DGDA 3IGAB 2WBKA 1JN6A 4N2HA 1FFTB 3KM2A 3QRLA 4P4KD 4UU9A 4R4NC 1HZKA 1EUUA 2FT8A 3RGVA 2EXSA 4HBCH 3I75B 5E6RB 2GKIA 5CINL 4G8FA 3FNKA 5I17B 5SWZB 3DO3A 1OT1A 4L3EA 2XSKA 3ZTCC 4BYHA 1MIML 1J1PL 2BNRE 3S97C 1KV7A 2JKWA 5BVJB 5IP4A 2GEQA 2BOBB 4BQBA 4JRXD 5HVFB 3VW3H 4J2QA 5JIKA 2C4FT 4P5RA 2H1XA 1GC1C 1QSFA 5E9DD 3NAAL 2P52A 2OKMA 4HEPA 5DQ9B 4OGXL 5EBGA 2Q3AA 2W65A 1U0QA 3LQZB 4EI6B 4FLHA 1NAKL 5C0NC 4IGBD 4L9DA 5ES4B 5EUKA 3DX9B 3FQUB 2WINA 3HPLA 3GS7A 4GW4A 4Z5RB 3GSWB 2VXTH 1UOWA 4B9GA 2A6JB 5T1KA 5B39B 1KTDA 3GTVA 1JF5A 4X6BB 5CD5D 4EEEA 3PS6A 2BIPA 2V7HB 3TNNB 3MLSH 4WFHD 4CC1A 4D0CB 4PRID 1TETH 2V33A 2ZPKL 2R29L 5KYYB 4CMMA 4XODA 3VFTB 1Q9LB 1YA5A 4CNIB 5IQ7L 1O0VA 5BMFL 1H8SA 1KBGH 4ENZA 5FK9A 2G3ZA 3PPSA 1JZ7A 5IEKB 1R5WB 2CPCA 2XUWA 4LSRL 4ODUB 3N43B 3O8XA 4OQTH 4ODWA 1CZ8L 3BE1L 2Y06L 3UJIL 3TF4A 2DWSA 4POZC 4ZXBD 3TURA 1ECZA 1XEUA 4DUVA 2AW2A 4B0MB 2B4CL 1WWWX 4WFHE 3BIBX 4Z77A 1G6VK 1BBDL 2NOYA 2DI9A 3PV6B 5EU3A 5BO1L 4JAMA 1YEIL 3SE6A 4P8QA 3MLZL 3I6KB 5ITFA 4BCZA 2ZWKA 2ZE0A 3MUGA 4PJFE 1KY7A 2CO4A 3SYOA 1Q0EA 5F7DB 2GEEA 2LQRA 2XA3A 1B9ZA 4ZG1A 4TLSA 2OZNA 4BGLA 3BWUC 5JQHC 3JT2A 1NJ9B 3LVEA 1PZCA 1JGUL 1QFOA 2B0SH 2DAVA 4O4YL 2KI6A 1C1EL 4UQEA 3DIFA 4P23D 4Y16A 1BQSA 1VGEH 2EH8L 1EO5A 1TSRA 3VG9C 3IWUA 3KGRA 3M86A 1OE1A 1RZQA 2XICA 4AYDC 4L3CB 4G71B 2VW6A 4X80L 3NH7L 3Q5YA 3RY6A 2HB0A 4FXGB 3GRWA 5JW4R 3MNVB 3QI9D 3ARGA 1MHHB 4FG4A 5CINH 5K39A 2OLDA 1E9PA 1II4E 1KF9B 1MIMH 1RZFH 1J1PH 2EKJA 2IEPA 2VL5A 3CZKA 4LHUD 1E6JH 4JKKA 4OUUA 5IMOA 1OPOA 1CDUA 2Y7SA 4NQUA 4F2EA 3RWFB 5C0FA 4E5XA 3WTUA 3AU1B 1JK9B 4Y7MA 1D5IH 1ZV2A 3UG3A 2ZX8A 4P49A 3APNA 2QMJA 3ESMA 2M2DA 3NPZB 4NZRH 5EF0A 2E9GA 2IFFL 5I30L 3QUYC 3CFUA 3AGVA 3LCYA 1OAKL 1AVAA 4F91B 5ACZB 1AQ8A 3LEXA 4NDMA 3S3SA 5DC9B 1T7XA 2ITCB 3AM8A 5F21B 4NBXB 2JCCB 1J5IA 4ONOA 4PH8A 3D0LB 1PZ5B 1S7SB 4XTRC 2O6FA 1CIDA 3OC5A 3NFNB 4BGDA 5EUOA 2IAMA 5KUMA 2OJZH 1LDSA 4W93A 4R4FL 5FA4B 1LMIA 3DROB 3QIUC 5DK0A 5I73C 3QUMB 1YLBB 2ZPKH 1XH1A 2R29H 1YN6B 2WWKT 3K8KA 2F19L 3GZQA 4R4BA 4XXDA 4XN5A 4CL7A 5IQ7H 3U9UB 1YCSA 4BKTC 1HAUA 1OM3H 4NO0A 1WFUA 4CDHA 4EOWL 1I8MA 4R7DB 4RSVA 4KY1H 1X9QA 1YMMB 2MHAA 5FWQA 3SDDB 4YXHH 4KI1A 1A7NL 4WI4A 3RTQC 1J1XL 1ZWIA 2QFPA 2VO5A 3QXWA 2H1LM 3NPSB 5FYJH 35C8H 4MXQD 1ZLWK 1CZ8H 5CF3A 2Y06H 2X6UA 3SDYL 3WEOA 5C0GB 2B4CH 2HH0L 3M1OA 3OHXC 2JCWA 3OTTA 1ZAGA 4M9OA 4I3RH 4LKCB 3EH5B 5EN3A 3UTTD 2CO7A 2JB6A 3APCA 3MV8D 3MLZH 3O4LA 5KANG 5IQ9B 1LILA 2YOAA 3EJRA 1LDPL 1HHKA 1VFUA 4E0RB 3L1GA 4TUOA 2EKSB 3HS8A 5D7LE 2EDBA 2OS7A 2WXHA 3N43F 4EVNB 4PTUB 4WW2B 1WZMA 5HHOD 4HFUH 2FLMA 4JFEE 4RZCA 3VH8B 2YOCA 1LE5B 1J1OH 1BYOA 4ZK8A 4P4KC 4XBPA 2X7LB 1BVLB 1N59A 5KYUB 4OT1H 4PRBA 4F57L 2IANB 4AQZA 2I9TA 1HHHB 1TEYA 3KWWA 3ZLQC 2UZXA 3VA6A 1S8DB 3SQOL 4E2OA 5JA9A 5LGJB 4GKNA 1C08B 1UJ3C 2WSPA 5AFAA 4FMVA 3VFWB 4KDWA 2CDFA 4LCCB 1YY9D 2FUQA 3OKLA 2UY7A 5EOTB 1N64L 1BQUA 4Z3GA 4XXWC 2J57A 4WO4A 3QQNA 1IKFH 3AG1B 5DUBB 2WTRA 3AGWA 2NZ9D 3P2DA 4NNYA 3MBED 3U4EB 2AK4E 4IGBC 1CDBA 3JTSA 5CLXA 4NUGL 2X38A 3NP4A 1TZ8A 4Z7WB 4LL4A 4J1UB 1JPST 5E1AB 5F6HI 3DRTB 4UQ9A 3BP6B 3L3GB 5I30H 5JW3H 4JMXA 5F1OB 1OAKH 4PBDA 3PLYA 4Y2DB 3IDJB 1U2CA 4Q52A 2ICES 3WEBA 3O9WC 2VH5H 4P5KB 1Z5LA 3BUTA 4JDVB 4QXWA 3VXUB 5KJRL 5FDWA 4PGEA 3C6SA 3HI6L 4BELD 3BUYB 1GGYA 1W8NA 4ISVA 1UXLA 4QRRB 4WWOA 5B38G 3BHBB 3O3DB 5AWNH 3G04A 2PW2B 2E3VA 2XWEA 1R5VB 4U4BA 5HHVL 4R4FH 1DP0A 5G5DB 1IZKA 1QATA 1P5UA 1QP1A 2WBJB 4NQDB 1ECYA 3BSZA 3D3VD 4XRCB 1KXTB 1WIPA 1U3YA 3H7LA 4Y5VC 3LPOA 2CLVA 4FG0A 1QQDB 3ZHDA 4FJZA 3ZN6A 3BKYH 4XC1L 1UWXK 5I9QC 5KYXA 5C07B 2X4NA 1P7QB 4PJ7E 1L0YA 1J1XH 2P24B 5I1AA 1HL4A 1MCEA 2CIIA 5KANI 1GCYA 2VZUA 1AZZC 2FX7L 3EGDA 4G8IA 4YL4A 3PHOB 2V2WA 4PJDB 2FTAA 4X9HA 1ERNA 1T03L 1WCBB 4XN1A 2HH0H 5GGSA 3MV7E 3SE9H 3FHEA 3V6FB 3GXNA 4L0PB 4QGYA 3MI6A 1Z9SA 4DSYA 1KGYE 5EN2B 4QDGA 3FFDB 4Q9RH 3K5SA 1LDPH 4V33A 1UCTA 1FF5A 5D6DC 1T1XA 1EEZA 3K5RA 4DPCX 4HIHB 5I18L 3T6WA 5I1CL 4Z7OF 4P23C 5EOQH 4XVTL 4K8RH 3V4VB 5AOJA 4EN3B 4APQA 3BIKB 3QUXB 3QIBC 3MRMB 1XGYL 4HIEB 1CR9L 4A6YL 1M1XB 4BFOA 1LEGB 3EFDL 3WOVA 1JOIA 2P44B 3HUJF 4EF3A 1G9EA 2G2RB 1QSFE 3DX6B 3QPKA 4YHPA 4JNXA 1JTTA 4IBWA 3LRHA 1CTNA 4LF3A 4F57H 5FGRA 3SGJC 2OJ1A 1PYWB 2HWZL 3SQOH 4ETQB 1CLOL 2OX5B 4KXCA 3RA7H 1P1VA 4KY2A 4F2FA 4G70B 1YDPA 4K73A 2ZF9A 4F2ME 2IBZY 2VXQL 3GHPA 3PWUB 4H8UA 4ZFFA 1U4FA 4D9LL 5CNHA 1R3HB 2X53A 4LK4A 4K0OA 3ZY7A 4KVPA 1T04A 3WTWA 1A6TA 1MWAA 1RK7A 1CL7H 2W91A 4WLCA 5L8LB 3TJHD 1UA3A 1R3IL 2P8LA 4NUGH 3E8UH 1YY8B 4HEPG 5A2FA 1JBJA 3LSOB 5IWLA 3CFBA 4AI7A 3B83A 3K6OA 1ADQL 3NJFA 5K33A 2HX8A 2X9ZA 4NP9A 1B6UA 3KCPB 2WWMD 5KJRH 1RJCA 7PCYA 2VKWA 4QHMA 4KHTH 3HI6H 3DURA 3S8WA 3RVXD 1FNEA 3RFRA 1ZXKA 3G9AB 5CJQL 5IUCA 1TZGH 3DV6A 2XTJB 4HLZG 3TN0B 3ULUL 4V1DB 1HYRC 4FL4C 4G42B 5HHVH 3HKFA 3S35X 3LKNA 2OTUB 5JORA 1A4AA 3O6KH 2MCAA 4Z7WF 2OMNA 2B77A 3SD2A 3HS0B 4W9KC 3O6LL 4PJ5D 1AD0B 1EERB 5C0JB 4U31A 4KMTH 4MXQC 3WTVA 4NS0A 3T2LA 5E6SB 2A9NL 2BSTB 4KKBD 2ZXWB 3C60A 2WVSA 3FMGL 2H41A 1KIRA 3TEXA 4XB8A 4YGVB 5JW4Q 2YKKA 3GK8L 5LBSH 1UB6B 2PCYA 5H2BB 2GT9B 2FX7H 4HBQA 4Z3IA 3SPVB 3TBCA 3ZDYB 1GYVA 4QTHB 4HS3A 3LKQB 5C9JA 4NI3A 2B14A 2QGBA 2XZAH 4NOFA 5BZZA 3SKOB 1D5XB 5SX4H 4TNWK 4QD2E 1TYJA 3FU8A 3GJFA 5HDOA 4OAWA 2DD8H 2AJ3A 4AC4A 4P5TC 5L2KB 5FKPA 2XG5A 4M7JL 1QFWL 2RGSA 3IFNH 5C0CE 3UJJH 4DF9A 1QD0A 3CFNA 4TN9A 4PRDA 3BQUD 2IALB 3F7RA 1KGCE 3ZL4L 1F4WH 4OGAC 4PJDF 5TDOB 3CV5A 5LCVH 1A6ZA 3K1KC 4MNGB 3MRRA 3TA3A 4ONGL 3B9KD 4R8WL 3H85A 3KLQA 2H1PH 4CA4A 2B1OA 1RURL 3BZ4A 1G43A 5IHUH 3DI3B 3N44B 2FYYB 1TVHB 4JFDA 1VCBC 2F2HA 1UEMA 3SJVD 3MFFB 3ZXAC 4JO3H 5GS1B 1C5CL 1SEBB 2XFXB 3QS2A 5EO0A 3OXRA 4OZIA 4Z7VB 2BNUA 1BVNP 3LH2L 5EUOE 2DQUH 1MCBA 5E2UH 1BVKA 4MJJA 1HILA 4E5XG 2E8ZA 2W5PA 4HOXA 1T21B 3PCYA 3PUUA 5HYSA 3FPXA 1RZKL 1R3IH 3P9MA 3J7HA 1PKQA 3X1BA 1QSEA 4AQEB 4NKDB 1DJWA 5DVMA 3TV8A 5HYJD 2QSCH 1Q90A 1S7VA 5DEGB 3UGXA 5EC2B 1JXGA 5D9SA 3WDJA 1A9BB 1DQJA 2APWA 3HE6A 1AXSB 1KJVA 4ZS6C 5I8OH 5DYOB 1ZT4A 5JMRA 3KWXA 4LP5A 2Z8SA 3KPSE 3NQIA 1XGTA 5DR5L 1IFRA 2EDNA 4W9JC 5CJQH 1SUHA 1EX0A 4FKEA 4BFFA 3VB8A 4S2SB 2B15A 4R0LC 4U3SB 2V5SA 4TM9A 5F0LB 1M71A 3CZUB 4LLQA 2V9RA 4HUVB 2ZWYA 1P2CB 3H2PA 4B53A 4J12A 4I18C 3D4ZA 4FHBD 1NM9A 4N6RB 2F18A 4RIRB 4UM9A 4WY7H 4FC3E 1BOYA 2Z8RA 1LE9B 3FMGH 1AGFB 3QG7L 4XT1C 2OW6A 5AVUB 4Y19E 3TBTA 5HYIA 3IMUA 1WFMA 1JZDC 1XB3A 2SEBB 4FNLL 5D6CA 3WFHB 2PW1B 1KXHA 1PG7H 4Y2LA 5KWYC 8FABB 5H8DA 4PJGB 1L9QA 3ZYJA 1JZ8A 4OKVB 5A2LH 3ZMNA 1Q9WA 4FQ1L 3RAJL 1IEBB 3IKCA 3ME0A 5PAZA 1DUYA 2QVIA 2Y22A 1IVLA 4XC3H 2KERA 1E4XI 1SMDA 1P84J 1TJMA 4XPFL 5I0VA 3TBWA 1M2OA 2Q8AL 4KI5F 1D9KA 3MRFB 4WWPA 1V5JA 1F3JB 1QTSA 1TCRB 4IKKA 3RY4A 1DHKA 1W0VA 1SZNA 1A2YA 1WC7B 3FB6A 3N42F 3ZL4H 1WWAX 4EZMA 3T0AA 3QZWB 4BXSV 4ONGH 2ODIA 2P9RA 3SIKA 1A6WL 2Y7QB 3CSPA 5BUGA 3JWDL 2JIXA 2CLZB 5K9KB 1HNGA 1RURH 3TZVB 1BOGB 3KMDA 2E27H 4HSCX 2IADA 4ZQKB 1SHXA 5AKRA 3WUWG 3ZKXC 1CFQA 3WIFA 1A7OL 3VFSA 1RAMA 4BWTA 2OZ4L 3C5JA 2CR6A 2X9WA 5I28A 4GINA 2R23B 4WUKH 1OXYA 1RZJL 2DQIL 4KMQA 4XVUD 3QEUA 3NCMA 3GLZA 2YXWA 1WT5A 5FLUA 3L3DB 4IS6A 5EU7E 1GGCL 1Z5HA 1OSEA 3EJZD 3REWA 4I9WD 5IHBA 2L8AA 1JNNL 3IF1B 3MGAA 3KYAA 4HWEH 3PDDA 3UPRA 1RZKH 3TBVB 1B0RA 1BQLL 1UTDA 2ZKHL 3IDUA 2FE0A 4IOIB 4MCZB 3VNZA 3GB7B 5KOMC 4XNMA 2GVYA 1IKOP 1MVFA 1CFMA 4QNPE 1E9OB 4L9LC 4OCSL 2HKFL 4Z7VF 2W9LA 3QJXA 5IFJA 3CDCA 2ICEB 4JZNB 1YC7A 3OF6D 4DNLA 2R2HA 1BGXL 3KLDA 2V9TA 3UPCA 4K9EC 1OWWA 1JVKA 2W9EH 3HHRB 4RMTA 3SYPA 3L4ZA 2G3XA 5DEFA 5KS9A 2CIKB 4HEME 5J9PA 5DRZA 5LGHH 2RFXA 4ZT1A 4AYGA 3BEWA 1BD2A 1XCTB 2VAAB 5EPMA 4HKBA 3SDXF 4GP5B 4FABL 3D2UD 1XGRB 3ZKND 2ADIB 2DLIA 4GUCA 3RX8A 3QG7H 2V37A 5A1AA 1BF8A 4MZIA 3QYCA 4MWFA 3SGEH 3GNML 3FCUB 5T3ZE 4FNLH 4PI2A 1FNLA 1NPJA 2P80D 4XCYA 4FQQB 1SN5A 3U82B 5EF3A 5IVZA 1Q8MA 3T09A 2A6KA 4YHOH 1FLRL 1TQSA 3BQUC 3FO1A 1NCOA 3HAEB 2W38A 1ZEAL 1T2XA 5FHAL 3O2DH 4OM1L 2JQZA 2WLIB 3ULSA 5HP5A 5A2IH 4KROD 1XF5B 4B3VA 3P4OA 5A2AA 5FO8B 4OLUL 3EO0B 4RMQA 1J05A 1XGUA 1IC4L 1JIBA 5EZIL 4ZS7L 3WTXA 4JRYB 4IDJL 1NPNA 4JEGB 3RWIA 4PJGF 2VSKB 5ANMB 3FONA 3MRIB 5F9AC 4G8FB 5DZAA 3U6RA 3JWDH 1N7ML 2WP3O 3GUTB 4L3EB 1HOEA 3D2TA 2X1WL 1WH0A 1VIWA 2P47B 4CVXA 1A7OH 1F42A 2FSEA 1J0KA 4JANB 1IO4C 1HSAA 3VXMA 3MA9L 1KTKE 4ESKA 4HKXA 3QDGD 4UV7L 2HG0A 2QLYA 2DQIH 3K74B 1L9TA 1AQKL 3QFJA 4NN6B 4NQCD 4PHXA 1MCLA 1RULL 1XH0A 3CAFA 4UYQA 3MBXH 1E5BA 2CJSA 3LOWA 3FK3A 5HGAB 3V0VB 1KGIA 1PSKL 4ODHL 1T5KA 5TTRA 2VLRA 3SB3A 1UADC 1N9PA 5FOBA 5GISH 3SY6A 1EANA 5CGBA 1QAWA 1BG9A 5GRYA 3W1ZA 4WWID 1VGKB 4H8HA 2WMPA 4MAYC 1HU8A 4YHLH 3TIEA 3CFEB 3LNGA 3ZIYA 2GABA 4MJIA 4OCSH 1SXSA 3N40F 1H3UA 2BFVL 4NN5C 4A39A 3VWJA 1U93A 2AJZA 3FZUD 4O02L 1HJBC 5F6IB 2JTDA 5FK9B 3MRKA 4BE6A 3LKRA 3U7AA 4WWKD 5DK2A 3MLWL 2VZTA 3MLYH 1L9NA 4J28A 4Y88A 2VISB 4WKXA 2WUBL 1BHGA 2ZXBA 5FM4A 3EXLA 1BAGA 5PCYA 4IIQA 3OD3A 1ZV5A 4FDWA 1WBXB 5EU4A 2D0FA 2FJGA 1AIFA 2R0KH 1ZDSA 2WK2A 3FTVA 2MQGA 3S98A 3RZWA 4XO9A 4Z7NE 2VN5A 5BNXD 4ALAH 3QDJE 4Y4KD 4WI0B 3IETB 2C34A 4YHKL 3VD5A 2Z1PA 1ID5I 1KJ2H 5CWSA 3FOMA 1FH2A 4Y2NA 1NC2A 4FRWA 1J0HA 1ZE3C 3QJFA 2EE6A 4JW3A 5LNDA 3CC5B 3UP6A 1XF2B 1OAXH 4JFDE 1WA2X 1ZPUA 2QLVB 2GFBB 4MVBC 5EU7C 3UTPE 3WS3A 4MDRA 1YEHH 4MSWA 5IHZA 4DKFH 4YSQA 4XPAL 4RFNB 1X7SA 2AQPA 4EKJA 1IC4H 5C08B 4ZNEE 1AHWB 4B9FA 3RFZA 4ZPVA 4XMZA 5EZIH 1XH2A 4ELME 1P1ZA 4X4MA 4S11A 3PGDA 2JB5H 1BLNA 1INDL 3BPCA 1W6WA 3ARGB 2V5TA 4LLDA 1I1YA 4DEPC 4AENA 3MNWA 4XVUC 3TIDB 1QFPA 2VL5B 4OUUB 4WJ5A 4HXAL 2K3HA 5SV3A 4ZMTA 4OFIA 3SSGA 3AB0B 4OUOA 3GT6A 4DKEL 2PTTB 3V5KA 1XZ0B 4UV7H 3FQ4A 2HFEB 4JQVA 4POUB 2WKLA 1AAJA 1ZV9A 5SWSA 4OF5A 1RULH 1R3JB 4IKNA 4ZDHB 3AXLA 1CT8A 3K8MA 4XNXH 4LOFA 4WHTA 4XWOD 1IGYB 1S7UB 3ZR5A 4DKAA 5KEZA 4BFNA 2Z7YA 2FJFA 3SDAC 1M57B 3X12B 4XGZB 1QR1A 3FT0A 1OK0A 3NEOA 3QS3A 3OJDA 4XAWL 3IDGB 1AGBB 1PZ3A 5DUPH 5ID0B 4GSXA 1UM4L 3W37A 3ARUA 4CAGA 3L4YA 1PDKA 2MMXA 3U0WL 5K9OA 1TTAA 4NKOA 5SWZD 2BFVH 4KJYB 3UCRA 3VFMA 1QYGL 5KVDE 4QUOA 4QRAA 1PAZA 1TQBB 1O6SA 4HKJB 1TG8A 4NKIL 5K9QI 4LPUA 2XVKA 3IDIA 1KMGA 3ECVA 1OK8A 4LEEA 3MLWH 3MJ7B 2FT7A 1FN4B 1FO0H 1ZLDA 2DYPD 3T3PE 1V55B 4HCFA 3ZKNC 2DL9A 2WUBH 4NUJA 2Y0SA 4IHOA 1RUMH 1VF5C 1MEXL 3KYMA 4I0PB 4N8VB 3IDYB 5SWZE 1CYWA 3V9CA 3A6OA 1T1YB 2AQ1A 3IXAB 4L4VE 3O4LB 4WQOA 4Z95L 3KWUA 3V4UH 3NJKA 3E9UA 5HDBB 4YHKH 1B3IA 4MMZB 1AMYA 2M26A 2QR0A 4OCXL 5DWUH 1NEZB 5BQ7B 5DJDA 1NCCH 5GGVY 2WLMA 2IH3B 1OSYA 1DCLA 2CBQA 3HN8A 5DS8B 1NOAA 3NTCL 3ARTA 2ZJSL 4BZ2A 1AGEA 4GKZB 4X7SL 2D3VA 2XPGA 2EVGA 3UG4A 2FWUA 1A66A 1TZIB 4FA6A 4XPAH 5I24A 1PTZA 2GY5A 4HXBH 2FEEL 5EU6B 2CJ3A 2J1YA 4GKNB 5IMMA 1J8HA 2GJ6D 1YEFL 4QO1B 2H32A 4B9IA 5D72L 5C7XH 2OMUA 3VUAA 3ZE1F 1FFPB 5DZNA 1FZOA 1A6VL 3TO2A 3EOBA 1DYZA 3RNKA 5E5RB 4ES9A 5I1HH 3QJZA 4DP5X 3RL1A 5BW7A 4JQIA 4KKNA 1SLUA 2F9BT 2PXYA 1KJMA 2R29A 2W0FB 1X3DA 4LVOB 4M8UA 3T65A 1OAYL 2IBZX 4YBHA 4ERSL 1S7QA 4AQAA 2A0LD 4YLCA 2XXFA 2Y1YA 1T4WA 1PBYA 3KWTA 1T2QL 4N8UA 3B7SA 3GYRA 3LD8C 4HIIA 3L1EA 4ISVB 4K9JA 1C5DA 2OPCA 3QO0A 3FZUC 3T2QA 4OFYA 1NC4A 3OJMB 5EWIL 2ENQA 3Q8EA 1FRGL 4FQHA 4UILH 4WWKC 4Z7QF 4OD2B 3US9A 4L18A 3KE0A 1DANT 4IBUA 3PAUA 1AQMA 1S9WA 2YWZA 1X5YA 2DIAA 4GSUA 2NY3B 4DP0X 1YAZA 2WBXA 1YUKB 4GI9A 4NKIH 1N4XL 5KYXB 4ZFGL 1G6RA 4YH6A 3WO4B 3IJ7A 5ABZA 4M43L 3QJTB 3TIEB 1MCDA 1A6PA 2DBLL 4JR9H 4XCEA 2CIIB 1C7TA 1QKZL 3MJ9H 3HLAA 5BCAA 4Y4KC 3BPOB 5EBMA 1XIWC 5F9WB 4MBRA 2MJWA 4KQ3L 5GGSB 1DDHB 1N26A 1QRNA 1ZLSL 3BSHA 4TF4A 1CICB 3KG5A 1T80A 2IDCA 5DJ2B 3D85A 1XMWA 4Z95H 2V3DA 5IG7B 1A6UL 1H8NA 2YA2A 2WGXA 4O2FB 1UOLA 3VFVA 1DVSA 4HHWA 1HHGA 4C56E 2ZCKL 2ZYRA 4OCXH 2AAVA 2K8MA 4APQB 4ZO6A 2YAHA 1E2VA 3MUUA 4DQAA 2P5WD 2VDPH 2F61A 2PWGA 4JJOA 4NKMA 3SDDD 1YMMD 3LB6D 5F9JA 2MKWA 3DPBA 1AJ7L 1P4IL 5SV4A 1R46A 3VX0A 4LF3B 4TSBL 3LRLA 4AITA 3K2MC 4GW1B 1URZA 4P9HL 1PZUB 2HVJB 4N2GA 2AEQH 3KEHA 2VQ4A 1JYXA 3OMAB 1SYSA 5J8OA 2UXVA 3PG2A 2OI9B 5D2NE 5HDBF 2QELA 3S37X 4EXPX 1YDPB 3L7EA 1C9SA 2OSXA 1G1OA 2DMGA 2AITA 3UBHA 5FM8A 1FH5L 3WNJA 4W4OA 2A9ML 2V5MA 3L95A 4N86A 2CO6B 4FMFA 1A6VH 1Y6NR 4JFUA 1D2OA 1YMME 1YEGH 3PNRB 3DVNB 4ABUA 4MJIE 4IK6A 2AQTA 4FXTA 5J6GB 4KTEL 4XWOC 3EO1A 2P8LB 5D70L 2A5UA 2IDUA 2H5UA 3CFBB 5K1JA 3T1FB 3EHBD 3FQXB 4GEJA 5DHVH 1XMEB 2L7EA 5LKNA 4PJHA 4JN1H 1UWEH 4TVPE 3BWSA 4FADA 4Y4FA 1QWHA 2J1XA 1Y07A 1QHOA 3EXJA 2JK5A 2W94A 3GSRA 2IAND 4KVNL 1J9QA 2ATPA 1ND0A 2JJVA 5BXFA 5CD3A 5KVFH 1HEJC 4TULH 5ABDE 3HZYA 2Y6SD 1PNCA 3PYCA 1E28A 2EADA 4QKTA 3U2SA 1A4BA 4FYRA 2NY6B 3KL0A 4HJGA 3S4SB 4PPTA 5BOJA 5KSBB 5L0QB 1DQKA 1N4XH 2XWBA 4A2EA 5FGSA 4PGDB 3C60B 4E9RA 3AUWB 4M43H 1IL1B 4NHUB 3TONA 5DVPA 4LEOA 4DO5A 2A73A 4N3TA 3HNTH 2ADJB 1LK2A 4NRZB 3ARDB 3WJJA 1JPSL 4Y2DD 4HS3B 1JTOA 4KQ3H 5E4EB 3P3RA 5C9JB 2V6HA 2WXRA 4QLWA 5EZOL 3VXUD 3VD3A 1MF2L 5GGTL 1PJWA 4QRRD 1CE1L 2DQMA 2BSDA 3GBDA 4LZKA 4ZOCA 3KPOB 4OJDH 4H0LC 3PQYA 2FO4B 4R90H 1WJ3A 2AMGA 2VR7A 2WQ8A 2R9HC 3CHPA 2BZCA 1R24B 2QQNL 2H26B 4PRDB 3JV5A 5IT2L 4BRJA 2WBJD 4NQDD 5BV7B 1NCUA 2YMXH 3H7BA 3BVNA 4F3FB 1AKJA 3CCHB 2FDBP 1H8OA 2J1WA 4HCGA 4YVUA 4GB9A 1VACA 2OJEA 3ULVF 1JNJA 1P7QD 4UTAA 4LLVA 5FCUL 2V5RA 3BZ4B 3BZ5A 1LNUA 4P9HH 4H13C 1MCNA 3AC0A 4GG8A 2CHNA 3GKWH 1XB8A 1FVDB 3MTRA 4MJ6A 1ES0A 2BDNL 1KLGB 2VQ1B 3QZNA 5HBBA 2LW3A 3NSYA 4WI8A 4JKPL 4NO3A 3TX4A 3KCWA 4DP6X 4BQ6A 3OXRB 4OZIB 3J2PA 5B7EA 4Q0XH 2A9MH 4X42A 5IVXA 2R8SH 5A7BA 1EA9C 2A0LC 1DQVA 5C07E 3GHEH 1IBGL 4I7ZC 3P4LA 2VLJA 1J5CA 1GW0A 1PKQB 4YR6A 1DO5A 2JV6A 4PYGA 4EN3D 3QUXD 2CO1A 2VDOB 5I15L 3RVWD 4X7CC 2ZD0A 3B34A 4Y9BA 3VQLA 2A38A 2DJSA 1VFBA 1NBVH 3CQQA 4R5TA 1ONQA 4FXGC 1ED3A 3GSUA 5B1KA 1KJVB 2JLLA 1V7ML 1ANUA 1ZT4B 3H4HA 4R83A 5AENA 2EYRA 4KQ0A 2QPEB 2VN3A 3LZRA 2AKRB 3QEHB 3KXFA 4ANUA 1K5WA 4PLNC 3QE5A 1E0OB 4U4IA 1OE2A 2H6UA 2E6QA 3FTGA 3IM1A 2P5PA 4PRPA 3ABKB 4MDIB 1MPAL 1P4LB 1M71B 1BMZA 1Y6KR 3OSKA 3LNEA 2R1YA 2ZF8A 3QORA 3ROOB 3A24A 3S36X 3VGDA 5IOKA 5ESVB 3ZL1A 1JWMA 4AYFB 4UM9B 3DXAA 4Z8FL 1ZOXA 1FJ1A 4F37K 4HMCA 1A4CA 2ORBL 2A99A 1A4KB 4ZI8A 4YAQA 3VG0L 5I1KH 4LASL 4QCIB 5CIPB 4A6YA 5EULV 5IB1B 5KBMA 5JTWA 3MXVL 3DX1A 4WTQA 4P3DA 2WIIB 2PCFA 1PCSA 1Q9WB 4QF1A 5CR8A 5HDQL 1ZLEA 2CGRH 2UWEA 1FAIL 1MF2H 3HG4A 2LVCA 1GL4B 3O0LA 1CE1H 2AQQA 5GGTH 1JYNA 2OCCB 4G7QB 1HAWA 5KSBF 1MH5B 1GZQA 1I3VA 2OSLB 2XTJD 3TN0D 5DD6A 4V1DD 5ESQA 1LWRA 2DLGA 5CP3A 3LB6C 4OFKA 4KNTA 3SDDC 3TBWB 1J88A 3M6DA 3ZDWA 4J39A 2VXQA 1RFDH 3ZVVA 5BOPA 3KPQB 4HETA 1TFHA 3O3AA 2UUDH 2AERT 3NPSC 4RA3A 4I3SL 1LP9A 2EC8A 4GLRI 4PW9A 4YSDA 4CADA 2R2BA 4LVHB 4NZFA 4EPSA 1F6FB 3Q44A 4OZHB 2P43B 4KI5D 5IMLA 5E1IA 1EVTC 3T0XA 4RQQB 3L9BA 5F97E 2NY2B 1OGTA 3J07A 1ADQA 2XTJE 1CFQB 3WIFB 4V1DE 2F15A 1G4MA 4KITB 3SBWC 1ZS8B 2XKNB 2DDQL 4JKPH 5IBLD 4LLWA 5I6MA 4WW2C 3TFKD 3SYCA 1SJHA 3CPUA 2B1AH 4HPOL 5CILL 1MLCA 5L2KD 5J6HB 5F1IA 2AF2A 1BQHB 3OV6A 3ARPA 3T6VA 2QFRA 1UG9A 4QRPE 5EORL 4Z6AT 4HW6A 5ADPH 2DIJA 2OL3L 3IK2A 5JO5B 3UZEA 4N9GA 5LVEA 2CJUL 2BSSA 3ZUCA 5J1AA 3TM6A 5JXEA 4HT1L 1NSNH 3VQMA 1MIEL 1KTJA 2X0VA 3U7YL 5IJCC 4C4UA 4OZIF 4LCCC 5EEYA 1AQHA 2R0ZL 3F8UB 5E1GA 2IFGA 4NSKA 1ZT1A 5AB2A 4HD9A 1PD6A 3F3HA 4N0RA 2R7EA 1MCOL 5DQDH 2E7LC 4F7EA 5KS9B 3Q2WA 4NYLA 5FFGA 5F9DC 2MQ0A 3GSOA 4U1IA 4LSTH 2RFXB 3LTVA 2WXMA 4MNGE 4Y2DC 3IAPA 4I1NB 4PG2C 3MOBL 2YC1B 1U6AL 4OI8A 1IX2A 4MWFB 3AW5A 1SHWA 1U58B 1NDGA 3NCFB 5FB8A 3MJ8A 3VMNA 1WZAA 3BH4A 3OWEA 3B7RL 2QHRH 4NZUH 5DJ8A 3F7LA 1WTLA 1EFXB 4XP5L 1R17A 5KSUB 4HS8L 3U4AA 3CFTA 3CZEA 3FO1B 3TESA 4AIZA 2WBJC 5L7XL 2JFCA 3TEWA 2J71A 5JQ6L 1WE5A 3L2LA 5D7EA 3PP3H 2HJLA 2ZSVA 4H88L 1K6QL 4QYAA 3ZO9A 3P4OB 3A23A 2X44D 2LABA 1IGCL 1N5AB 4R96A 5B1JC 1XGUB 5G2NA 4MZ3A 4RGNB 5B4MC 4I3SH 3VJ6A 2AGJH 4X6EB 3EOYG 3RWIB 1HESA 2NT0A 4WKZA 2IQ9H 2VC2B 3TASA 4DP7X 5I16A 2WM0A 1WICA 4L3AA 3BRGC 1ZTMA 2VDQH 1SXAA 1KCSH 1RUAL 3ALPA 4PJHE 2BWQA 4B6ZA 4C8XA 1KUMA 1BFOA 2WZPD 2YJLA 1MFEL 1GS8A 2UZIL 1NFAA 2DDQH 3C6EA 4HKXB 4Y2OA 2EDLA 2K6WA 1J9SA 3A22A 4LE8A 5IB3B 4W68A 3QFJB 2H7WA 2D2OA 2ZZUT 4WFGD 4EN3C 3QUXC 4DP2X 1OCWL 3U0TA 3SZKC 4NGHH 3LKSA 1NZRA 3QB7C 2VLRB 2EP6A 3AMLA 3H2QA 3UXFA 4TNWF 3IVKB 2WUCH 1JDCA 1DR9A 1SYVA 2J3SA 2CJUH 2W07B 4M1GL 4F8OA 2CDGA 1DBBH 1M6OB 3BZEA 3KR3H 4WW1A 4GRWB 1IV8A 5E5MA 1TDQA 4YSAA 4B7IA 2DQFB 1NIEA 5DT1H 5F1SA 1NUFA 1JHTB 4DK3A 3RG1C 3TZVD 1U93B 5G4MA 2Z8WC 3UTQA 4DJMA 5IIEB 2IWGA 4P05A 4X7FC 3L17A 3MRKB 4WSJA 3ZE2F 1FVEB 2WQVA 1DBMH 4N2EA 5DK2B 4ZFZA 1UXSA 1G84A 3ATBA 1HKLH 1Z0MA 3HJEA 2HLAB 1CJYA 1IBYA 1AOZA 2XWTB 3BGAA 2PYFB 4IIQB 1Z7JA 4YNYB 4M62L 1R9FA 2FJGB 3MRQA 2FNBA 4TNFA 4NRYB 4OFDA 3KW7A 3OKMA 1UGKA 1EBPA 4MD5A 4OV5A 4UNVA 1X5ZA 1PJ9A 4N9OB 4PGBA 5C0AB 3WMPA 4OZ4B 1E4KA 2BSEA 3LXUX 3PJNA 4X6FA 5KN5A 2E8YA 1XSJA 2XTJC 4DVRL 4IM8A 4PCKA 4GFTB 5KS9F 1PZAA 4NQEA 4M1CD 2Q86A 3QT2A 5G4OA 1E3FA 2Z0UA 5CZVH 1NGWB 3NRFA 5L7XH 5I2IB 1WDAA 1LM8V 1MJJB 2GITA 1ZJBA 5JHBA 2OZ4A 4IBZA 5IVXE 1Z6JT 2EIJB 3DRQB 1OF2A 4KI5C 5FKAA 2ICWJ 1VZGA 2LU7A 1TTFA 2XTSA 3RFZB 4FHKA 3KW8A 1HXYA 1P1ZB 1GGUA 3WYRA 4NAJA 4M6OL 5DHYA 5CHNB 3EYFA 1L5GA 2HJKB 4G9FE 4LLDB 2ZCLH 3P4MB 4PJEA 5IBLC 2VGLM 5E4AA 3IDXL 3AREA 4O58H 4BK5C 3QCVL 1HCYA 4WJ5B 2Y2WA 3TFKC 4MZ2A 2FQGA 1RIUL 2NQDA 2OQJB 1H0DB 2XRAH 3BAKA 2FH8A 4FNTA 3QG6B 4CU8A 4LEBA 2KS0A 4M7LT 4YDKL 2BCKA 4F93B 1Q72H 3FQWB 1XGQA 3RVUD 2WTPA 2OA9A 2YGQA 3UBXB 2Y36L 3AXLB 3NJMA 2CGZA 4ZW5A 4WHTB 3V5DA 1M3IA 1U8JA 4FQXD 2GQHA 2OMVA 4N5ED 3IJ8A 4MA3A 5I76A 4HGWA 4S1SH 3K0WA 4XMXA 3DK2A 4X0KB 5AG9A 3MRNB 5IJVA 2RJMA 4PD4J 5B21A 4GRLB 3T6XA 1QZNA 1JZ3A 4ZTOL 1D6VH 1PDKB 4XMKL 3KLKA 5GS1C 4NKOB 3VI3E 5K9OB 2QSVA 2AK1L 3BZFA 4L3ED 4PY7A 3ESPA 4W9EC 5FYLE 1X5MA 5IUSA 3ETSA 1RXLA 3MRDA 2CJTA 1W9XA 2QQLL 1LK3H 3KLLA 4JL1A 1GA2A 2UWEE 1EHKB 3EBAA 4XNZC 3G7TA 4Q9QL 1L3WA 3PNWA 4ZBJA 2KQNA 4GRMB 3G6AA 4HUNB 2HRHA 1RJLA 4IHOB 3N55A 4JRYE 5CSBA 3RKDD 3S35L 2J2ZB 2X6BA 3F7YA 4GRWF 4N2CA 3NZ8A 3P0VL 1OGPA 1F02I 4M62H 2CR0A 4YO0A 4X8CA 3FO9B 1NH6A 1PLCA 3RNQA 3V6ZB 1BLIA 3Q1SL 3RWEA 4F27A 4RMRA 5ILTL 4JFFA 3MTXA 3P40A 1PEZA 2I7OA 4A7TA 1EHXA 2Q1EA 4AL8L 2NX5A 3OGOE 4M5TA 4QRQA 4QXVA 5MEPB 1IBFA 1INQB 4NQSB 4G1MB 1T1ZB 4ZX6A 3Q3GA 5C0RL 1DQML 4U6YB 2QR0B 3QCUL 5I66B 1AY1L 1ZHNA 1OAUH 1MAMH 3PABA 4MA8L 4YDVB 4HOWA 3LNHA 3ZRFC 4AOFA 3C6LB 2X1QA 3GMQA 3QH3A 1DJIA 4XP4L 1MVYA 2V7NA 2XPGB 3O8XD 1QUNA 5C0BA 2FWOB 1FFOA 1UACL 3LNFA 4Z3JA 3A6BH 3NFSH 3DGCR 5ITBH 3FT4A 4YIQA 4WHYG 1A1NA 1RERA 3RL2A 1J8HB 1XZWA 1JPFB 2O5ZH 3B2UC 3Q5OA 2H32B 1PLBA 3K6DA 2WLLA 3HCVA 1M7XA 2H6OA 3QA3A 5JA8B 3HJ0A 1FZOB 3TO2B 4HS6A 4JO1L 3MRBB 1ZLVH 4K7PH 3IJSA 1MHEA 1RZIB 3K72A 5E94A 3QDHA 3QQ9C 3RY5A 4K3DL 2N4IA 1L9MA 5E1HB 5FGBA 2ZNWA 3T65B 1KELL 4LSDA 4OZFA 4O02A 2G5BA 2AP2A 4H20L 5MERB 3CZLA 2Q0ZX 2B20A 1DTUA 2C3XA 3IN0A 4HG4K 5L8KB 4LCWB 2ZX5A 4MQSB 1JGDA 1AXTH 1C5DB 3ENEA 5C08D 1I7RA 3QO0B 3ARWA 3TYGH 2HXAA 1GKOA 3K8LA 4JCWA 3D48R 4WNQA 4ZFOA 1NBZB 1NC4B 1F2QA 5F1KC 2DQJH 4GUQA 6FABL 4GAGH 1FNSL 1AIZA 4IMLA 4IOSA 3ARGD 3ATAA 3C5SA 4K7FB 1YHPA 4MDJA 4OKDA 4Y5YA 1FAKT 4D9RD 4R6UA 2AK1H 3CLEL 2QSQA 5JIIA 2XNAB 3HZMA 5ICYA 4Z9KB 2FHFA 4ZPTA 2N59A 3D25B 3W39B 4JDEB 4BCYA 1HIML 4AH2A 4UAOB 2QJDA 4HVBA 3G08A 3QC6X 4LCUA 2IIJA 1KC5L 3AVEA 4XCEB 5C08E 1DBKL 5L8JB 3D09A 3HLAB 1SJEB 3DVGA 4GUOA 3CDZB 2GJPA 1H6TA 3MCG1 4XVJL 3P0VH 3SE4A 3TPUA 2IV9A 5HSFA 1QRNB 3CFJA 3KYOA 3MLXL 4UF7C 2GI7A 1IB5A 2OR9L 1DJXA 1SOQA 4M1CC 1NCDL 3HPJA 5IJKA 1F4HA 2X87A 4AL8H 2IAMD 1DSFL 2EE0A 4LXFA 2O6CA 4FOMA 1BIIA 3MOQA 5C0RH 3F05A 3QCUH 1AY1H 2B59A 2CCLA 1EAPB 2J56A 4MA8H 4AQ8A 4OU3A 4MCYA 4NKMB 2R2CA 1XTMA 4YE4L 4L05A 3REVB 5MEOA 3DPBB 1Y1DA 1W72L 3B3IA 1ESOA 4XP4H 3N85H 3QXDB 4CKVX 5JHDB 3EADA 3N1MC 1TLMA 2ADFL 1UACH 4OGZA 1U8QB 2B9BA 4OVVA 3VDAA 2AC0A 3CBKB 2Q76A 4PIRF 2ERJB 3KPPB 2FRGP 1YYML 2H47C 4HJ0D 4IBQA 4I0PD 3QGVA 5DD3H 3BXNB 5C3LD 5MEQA 3FT1A 3D06A 2EVHA 4MJHA 5CP7A 3O4LD 3RVUC 4PJIB 1MCCA 4RAUB 5I26A 3WSQL 2E86A 3VRLE 3TO4B 2B2XH 4PN6A 4JJ5B 4BQCA 1LO0H 2WBWB 2ATKA 3SO3B 3WE6B 5HHXL 4MNHA 1KELH 1SM3L 3UIZA 4PWHA 2FD6H 5IOPA 4L8SA 4NQVA 5J3HD 1AMXA 5JHLL 4NZTH 3DIDA 2K9FB 4KMLB 2OSYA 3GXPA 1IC0A 4E42A 2O30A 2WZ0A 1RIHL 4PJXB 5CN3A 3ECQA 4XP9L 3EFOB 2AVGA 4MAZA 5CD3B 4TMPA 1UWYA 4LFHD 4W9LC 1RK0A 1JNHA 4RRPM 2DTSA 6FABH 1E28B 3VXRE 2KLRA 2BY3A 2YBRB 3OAUH 3S5ZA 5IHWA 1FYTA 1GC1L 4H8VA 1J10A 4WO4D 5L4JA 2VDKL 4LKXA 2YMOA 4N90E 2D7NA 1QFWI 5FLVA 3RKDC 2OMYA 3G3LA 1EDYA 1EDHA 2IG2L 1HIMH 1UT1A 2ZYIA 4N8VG 1TJGL 1MFDH 4HH9B 1KC5H 5D71L 4BWUA 1UQSB 5EU6E 4KK6D 1NOLA 4Y0GA 3VGAC 2GI0A 1O5PA 4NI6A 4HU8A 4M6ML 3HG3A 1WZ1L 4LHQB 2YEVB 4P2RB 3ULAB 2H6PA 4LCYB 4XVJH 3FCTA 5GSVA 4KK9D 3MLXH 1KPVB 4KZEL 2VLME 3UGUA 4U05A 4XOCA 4XNYH 4CU7A 4WWNA 3OKEA 5BS0E 1N5YL 1C5BH 1PLGL 2QKIC 1U8NA 4ICWA 1DBAL 3JZYA 4J4PA 5F6IC 3NIFB 4UBDD 2WXKA 3VFNA 1J0YA 1IAMA 1G7MA 3QQ3B 3V7AE 1F11B 3Q13A 5GQBA 2VDNH 4JRFA 5F89B 3BPNB 5A3ID 2BHYA