5D7KD

Structure of mr1-reactive mav36 tcr
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
199
structure length
197
Chain Sequence
EDKVVQSPLSLVVHEGDTVTLNCSYEVTNFRSLLWYKQEKKAPTFLFMLTSSGIEKKSGRLSSILDKKELSSILNITATQTGDSAIYLCAAYNTDKLIFGTGTRLQVFPNIQNPDPAVYQLRDSKSKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MAV36 TCR Alpha Chain
total genus 39
structure length 197
sequence length 199
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7kD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7kD02
5FDWA 1JWMB 1CBVL 2RQ8A 2VDMH 1DBAH 1W72H 1XGTA 2EDXA 3HTLX 4IM8A 2HG5A 4D0DA 4OIAA 5MEOB 3QXDA 3W9EA 1QFOA 2R29L 2WBJB 3BEWA 2GK2A 5LWYL 5IBTL 2FJFA 2P5WA 2DBLH 3PJSB 1WUNT 4XVUC 4BH7A 4EUPH 1MUJB 4JKPH 4OCMC 4EI6A 3PWNB 1S9KC 1JGEB 4FFVD 1I7RA 2E9BA 4X9FA 2R2BA 4P4KB 1UB5A 3K2UL 3LHPL 4QHMA 1NAKH 2L7UA 1X6NA 4DCQA 1NGXA 3QIBA 2R0LH 2OJZH 3JBG7 3STBA 4MS8D 1U2CA 4U2YA 5JW5B 4HJJL 1MCFA 1UZ6F 2A0LC 4JDZB 4BFBD 1YN7A 3VFOA 4M4PA 4MJ5A 5IHZB 3UO1H 5C07D 5E8OB 4QHUA 5IBUG 5DJCB 2OM5A 1Z0NA 3MV01 5CP3H 4PLNC 3IJHA 1BLNA 5D5MF 2A6DA 2ICWJ 3H3BC 2VLJD 4R0LB 4OV5A 4YXKL 3CDFA 1INDH 1BZ9A 2CLZB 4ZUUB 3BP7A 1KJ2H 3AREC 4YWGH 3U9PH 4KUZH 4MA1C 3VFNB 1D5BB 1A64A 1F13A 5I0ZA 1CBVH 1ES0B 3H8NA 3RA7L 4D0DB 5EPMB 2HFGH 3WXVH 1Z2KA 1IJ9A 5T33L 1SEQL 1D5XB 5T1LD 3V2AR 1QEWB 2DN7A 4FZEH 3MRDB 1M71A 4JDTL 2I9TB 3RGVB 1AIFA 1RUAL 2KZWA 1QLFB 5B3JF 1YQVH 2QEJA 5JHDB 2XNAA 1VPOH 3OQ3B 5EOCH 1FFPA 4JFXA 2OYPA 1L7TH 4MJ2A 3VFTA 3UXFA 4R4BB 3RWHB 1T04A 4YDLC 1H3GA 3T09A 4RFOH 3FQTA 3RGVD 4Z7UE 3CLFL 2PCPB 1OB1B 5INCB 2X1XR 5FK9B 5LCVL 3SPVA 2ADFH 5DMKA 5IBUB 5ALCL 3U4AA 4AG4H 2M26A 4QRPE 3AM8A 4RAUA 4NUJB 4MMXC 4I77H 2FJGB 5BO1L 3QPQC 4O2EB 5C7XH 4YGAB 2L7JA 2HH0H 1D9KD 4KK5C 4JREC 3RWCB 4XPGH 3BQUD 3OF6D 3VD9A 3KYAA 2ZUQC 2I5YL 5E9DB 5FYJL 3MA7A 3G5VA 2OZ4L 1AGCA 1FC2D 3P77B 3PHOA 1GOHA 4PB0L 5IW6B 5IVZA 1N4XL 4AYFA 1AO7E 2ITDA 4Q6IC 1KEML 2WW8A 1N6QL 3GIZH 5C09D 4TVPD 3QG6A 5CFHA 2H6PB 1P4BH 2VLJE 2NR6D 3QFDB 5F89B 3TFKD 4JHBA 4AIZA 3GHEL 2W60A 3QJHA 2AEIT 1JL8A 3QDGE 4EI5A 5CZVL 3BVNA 3DRQB 1KN4H 4M62L 3TBTB 4F9PA 4HXAL 3T4YA 3EFDL 2MQCA 5JZ7D 4PY7A 5KANI 3K46A 3EO9L 4ZSOE 3QCUH 5C0AD 2DD8L 1R3HB 1TNNA 2AJ3A 4OZFH 1IQDA 3MC0A 5JOEA 2JIXA 4TTDD 4I3GA 4R4BA 4OZGF 3QA3A 1JNNL 5I30H 2VDLH 1QFWI 3GIZL 2HTLC 1EHNA 2V2WA 2CKBH 5ETUB 1U8PA 5IV2A 2WWMC 4HKXA 5FA3A 1W8NA 1T7WA 1KTRL 4MA3A 3FQRB 5MHSD 2FHCA 3C8DA 3CFEA 4OD3H 4E0RA 5EUKA 4KUCF 4P99A 2W65B 4MXQC 4M1CD 3WUWB 2DLFH 5FYLL 5HY9B 1UADC 2DKMA 3CZFA 3BO8B 1YA5A 1CTOA 3BPNB 3MLRL 3Q3GA 4R97C 3PNWB 4G43B 4JPKH 1YC7A 3DLQR 4KTEH 3BE1H 5JW4N 3VE0A 5KTEH 1I3RA 1IC4L 5DK0B 4YHZL 4XBGA 2X4PA 5E2VL 3WFEL 2K3TA 4XNQA 3ARGC 5MEPA 2JCCA 3B9DA 3HUJA 5L8LB 3HR5B 2VLMD 4MLIA 5HVGB 3ZE2E 3GSOA 5BJTB 3S34L 3GMOA 4PPTA 3NCFB 2LTQB 3OKOB 2AW2A 1V3JA 3P4OB 3QI9B 4UNVA 3V7MA 4OD2B 1MHEA 2XZAH 3BIKA 1FGVH 4XP6L 1HE7A 3SCMD 5JOPE 4KTDL 2E6PA 3PWPD 2VR9A 3QDGD 4IOIA 2EC9T 3CH8A 5IB2B 2BNQD 1KCLA 4UT9L 1QBBA 3EYSL 4Y1AD 4XB7A 3FB5B 1N59A 2K1MA 4FQXD 5IJKC 4ONGH 4LEOB 2VZSA 3WHE1 2CRYA 3B43A 3BEWB 3D2UD 3VFMA 4IOFD 4IDJL 2IPUG 4KRPC 2I27N 3P30H 4OD3L 4BH7B 4XP5L 5I19H 1G7IB 4JFFB 2Y5TB 1DQJB 5E2WL 3GSVA 3RVTC 4PGDA 5DMGD 4Y88A 5JQ6L 3BGMB 4ELMA 3TN0C 1F4YL 5I0DA 3C6SB 3PWUA 4PTUA 3MV8D 3E6HA 4LAQH 4JY4A 1CG9A 3MRJA 5T5NF 4WO4C 4PJXA 2VIRB 5SWSE 5B38A 3KPNA 1NBZA 1EJOL 2HJKA 3PABA 5FGCB 3QI9D 4PLJD 4MS8C 1PY9A 2V7HA 1MLBA 1UG9A 1F00I 4P23D 1MREH 5DHXB 1V3KA 1CF8L 1GSMA 1YY9C 5TJWK 1E4XL 1HHHA 3IAPA 1FN4B 3LQZB 4MGXA 1VFBB 1N0XL 1G6RB 5E6IA 2EDTA 2XFXB 2FD6L 4TVPL 3MLWL 1YNTB 3OJVC 4GRLC 2IMNA 1F8TL 4LF3A 4JHZA 3QDJD 1EHLH 3FO2B 3HC4H 3QIWA 1AD0A 4OGZA 3TO4A 4QCIA 1BOYA 1EBPA 3PDOB 4XBPB 5DR5H 1ZK9A 1XCQA 3CIQA 2YA1A 5AAWA 3EOBB 2ZOLB 5ENWB 3HHRB 4JVWA 2WANA 1U8JA 4WUUB 4PRIA 3TF7C 3WJJC 3JV6B 4P3WA 2BRQA 1F11A 1NL0H 4GBXB 2VQUA 43C9A 1EAPA 4GG8B 3I3EA 4NRXA 2BNQA 5DJ2B 1J10A 2BVPB 4UTBL 2RCSL 4PJ7F 4GMTH 5CHNA 2VDRL 2YD8A 2K7QA 2X7LA 1S7VA 2EYTA 3HC0A 5K9QG 1OB1A 2A74A 2WINA 1JNHA 1YY9D 4L4VD 4N0CD 5I16A 3PL6B 1OLZA 2EKSA 1HHHB 2PW2B 4NDMA 3FQNA 4ZFOA 1TLKA 4Q0XH 2ZUVA 4HC1H 1FDLH 4RIRA 5F1IB 4AIXA 3GIVA 1DUYA 4IS6A 1DL7H 1AXTH 1DQMH 2PXYB 5FHBL 2P44B 4XH2A 4WEBL 2O5YH 4AEIH 4DKAA 3HFML 3VXRB 5CBAB 2CDEA 3D0VB 4LSQH 3V7AE 5I1KH 4MAYC 5DYOB 3LQAC 4OFKA 4WU5A 2PTVA 4NUGH 1S3KL 4RX4D 5I1EL 3QDJE 5K9QI 1ZA6A 3BPLB 3G04B 4DQOH 1ZGLP 3W0WD 5HJ3A 3IU4H 4X6FB 4XNMA 4GW1B 4YHMH 2VISA 5DJZA 3TBVA 4OZHE 4RGNE 4XMLH 3U6RA 5DT1H 4DVBA 4PBXA 1WICA 1JE6A 2CIIA 2BFVL 2W92A 2J4WL 4HUWA 2GAZB 4NZRL 1LGVA 4XAWH 4WDIA 1WZKA 2VDQL 3C5SB 4LSRL 3RUGF 1ZKAA 5LQBH 4JFPA 4D0CA 1D3CA 4G42B 2DQEH 2F53D 3GIVB 5GRZA 4HUUA 2OK0H 5IKCA 4AENA 4WW2B 4X9BA 3SOBL 4JFEA 3QWRD 4IDLA 2PO6B 3VE0B 1FO0H 2AXGB 4JQIH 5J57B 2HVJB 4N0UE 3U7AA 3VFOB 5LGKA 4FP8L 2D7OA 1ETZB 1JI1A 3IJHB 4NCDA 4UU9B 5J89A 4S1QL 3TN0D 3EFFA 3BISA 3F6LA 2ZG2A 3BN9D 3ZE2F 1A5FL 5GGTA 4NNXA 1T1WB 4ZDHA 1XR8A 2XZQL 4JG0L 1A6VH 4HF5H 2YRZA 1RHFA 3IRPX 5B21A 3FO9A 4S1DD 3MV9E 4YC2B 4WTXA 1CR9H 3FT2B 3A6OA 1I8MA 2HRPH 1OGAA 4B0MM 1J0KA 4OI7A 2WUCH 3H42H 2VXVH 1H3WM 2ZKHH 4O2FA 5A2IH 5EO9B 3TIEB 2E7LC 1SMAA 1EERB 12E8H 4JJ5A 5FKAB 1FFPB 4JFXB 1U8IA 1MCPL 3MBEB 4X6EB 2R4SL 5EIIB 5DZNA 5E2TL 4Y8AA 4PUBH 5D1XA 3CCHA 4I4WB 2ARJB 5E1AA 3X14B 3QXWA 4G6JL 4N90E 1P5VA 2HJFB 3CFBB 4KDWA 2WMPA 1QFUL 3B5TA 4WHCA 5J11B 4K55A 4WVRA 1I1AC 1L0YA 1DQLH 1WBZA 3OWEA 3SKJL 1FLRH 3L3JB 5E4IA 1KF9B 3WS6A 1AJ7L 5EWIL 3CXDH 3UBXG 4MNQE 5GZNC 5BOZG 1HI6A 4Z76A 3P9LA 5DEFA 4GRLB 3UPRA 1JPTL 3H9SB 1JYXA 1JGLL 1VFOA 2XXCB 4M8VA 4XWGL 4DGVH 3SKNA 4TSCH 3EOAB 4UNUA 5E8EB 3K81A 4OCLC 5KSBF 2EDLA 2ZG3A 4M8QA 3P0GB 1YJDH 2I9LB 3VRIA 3T1WA 2CUMA 3MLSL 4HUXA 2LAAA 3EYUH 4YZFF 4L4TD 4CAGA 1AJ7H 1GC1H 3QUXB 4QYOB 4K8RH 2JJWA 3REWB 5KSBB 3PDGA 1ND0B 4NM4H 1FNAA 3MV9D 4PGBB 4P46B 1YEHL 1FPTL 2CLRA 1NFDF 4MNGB 4M1DH 1LNUB 4I13B 1T3FA 4AQOA 5ISZE 1X7QA 1AY1L 2JIXB 3DJ9A 3RDTB 3X14A 1J7VR 1XZ0A 1I8LC 2C3VB 1KNOA 3NA9H 3QUYD 1AXSB 4MAYD 3WLBA 1UZ8A 4PJ5E 3T2OA 3QUZD 1XIWC 5ID0B 4KK9C 4H88H 3ULVH 4L29B 1KCUH 4YHPB 2HT4D 4R7NB 1VA9A 4OLUH 1A4JA 4H0HB 4P2QE 8FABB 1GC1L 3DX8A 1Q0YH 5KSAD 3VXOA 2DLIA 2UVEA 5DEGB 1M7IA 2APXA 4G6KH 3LEXB 4F7CA 2NXYB 4NQDB 4OLXL 4PJDF 1OAKL 2PKDA 3E8UL 3KXFA 1VCAA 1Z3GL 4WWID 2OL3A 2NW2A 1GXEA 2AEQH 4ZPVA 4I9WD 1C16A 4L8DB 4EOWL 3PV6B 3RVUD 4G8GB 5E9DE 2CDGB 3OJDA 5BVJA 3PGCA 3VXQB 1AP2A 2EYSB 1F4WH 3QRGL 1RUAH 5FYJD 1R3IH 2W1NA 4A6YL 5LG1A 4U1NB 4X6DA 1S7WB 2F19L 1OP5K 3F7RA 1A8JH 1T21A 1B0RA 2AJXL 1VHPA 2B20A 4JANA 3JWDH 5EU4A 4ZSOA 3O6MH 2GI7A 1BAFL 1LNUA 3VWKD 3IKCB 3K4ZA 1A6ZA 1OGAE 1SJXA 3GSNA 5DK0A 5IW3A 3V5KA 1HHIA 1PY4A 2IALA 4L3CA 1TCRB 4F3FA 4DVBB 1JRHL 4ELKB 3ZT6A 3H9SD 4XRCA 3GO1L 1CIUA 4JY5H 4FQ2L 4HQQH 1S5HB 5EZIH 4BKLB 4F58L 1CDBA 4W6XB 3ULUC 1EZVY 3CFJA 1JZ8A 5GGSA 1S7UA 5KVMC 4X5WA 1YEIL 5DEGA 4PB9H 1AGEB 2AJXH 5IG7B 2F54A 4G42A 1T22B 1ZA3A 2AJSH 1MCIA 1F3JB 1B88A 3U83A 1ORQA 3D1MC 4ODWB 4XNYL 5I17A 2AABH 1K6QH 3D3VB 3MV7D 3UJIL 4C58B 4PJXF 4R2GC 2Z8RA 2JIXD 3RI5K 2DQDH 4FQXC 4W70A 1NGQH 5GGRA 3G5XA 4P9HL 1MQ8A 5AD0A 5J13B 2C1PA 4Y4KD 1A6UH 3FL7A 1KC5L 3B5GA 4E41B 1MHHB 1FZJA 5IHLB 4JO1L 2FBJH 1I7TA 5ELIA 1YMME 2HJLB 4U1LA 2IAMC 5B8CA 5BCAA 4HLJA 3N85L 1ROWA 4J6RH 4H25A 3N9GH 3IFPA 1OGAD 3LN4B 1KCRH 2F5BH 1XF3B 4KRLB 5T3ZE 1FNEB 2O5ZL 3S5LA 3D2UA 1KIQA 2VN4A 4LSRH 3S37X 3STLA 1OW0C 4DAGL 3ME0A 2Z4QA 5JXEC 3WL9A 4HPYH 2IH3B 1JHTB 3RTQA 2QQNL 3D3VD 1P5UA 1EA9C 4JVUA 3TPUB 1F8TH 1MJ7L 3PP3K 5DJ2A 4X4YB 2YRPA 1A1MB 4Z0XB 1BVKA 4HX1A 1T1XA 4LPXA 4NHCL 3UJTH 3MRFB 4WI5A 3GMRB 3G08A 3NFSH 2Q20A 4X83A 1QQDA 3PGFH 4KVNH 2AEWA 3VRLF 3HNSL 1WK0A 4WI2A 1BBJA 1IAKA 4HAGA 4XNUH 3ZYZA 2IWGA 5D1QD 3PWVA 5ALBL 3S3JA 4PFEA 5F1IA 3WJJA 5DK2B 3CSGA 4YBLC 3ZDXF 1A3LH 4U1SA 3RGHA 4V2BA 5D1ZB 3GHBH 2HRLA 1SYVA 1YPZF 5AZEL 1TETL 1I8IA 8CGTA 1CDJA 5IWLA 4OZIE 2FGZA 4M7KL 5E8EA 5JIHA 4ZFGH 1FYTE 3ZHDA 5TE6L 1T4KB 3P4MA 1IGIH 1Y0LB 3PGFL 3D39D 3VRJA 2NR6C 4XPHL 3WFCH 5EUOA 5LWYH 2OMNA 5KSBE 4WTZG 1J87A 1MF2H 4YE4H 2G60H 1SY6A 3TA3B 1IFHH 1UCBH 4MNHA 3HI5H 3RZCA 2GT9A 4LHUD 1K4DB 3VGFA 3LKNB 4UT7H 3WS6C 4AT6A 4L8CA 5I74B 1YEFH 1FVDA 2DQJL 4L1HA 3TCXA 1T6WA 4NQDD 3DHMA 3LN5B 3QFJB 1QG3A 2Z93B 2GJ6B 3WNKA 4JM2C 1SJEB 4OSUL 5DMKB 1AIFB 3MGOB 1HIMH 1XIWD 4PJAB 4TSAH 3V6FB 4QXUL 3ZYOA 1G6RH 3BPOB 3G6JA 5BS0B 3O2VH 2UZIH 2PF6A 4K94H 1H3PL 5EBLA 4G8IA 1A7RL 1QR4A 3EYOA 1BJ1J 5KN5A 2H3NB 4YXHL 3RDTD 1HQRA 5B39B 1U95B 3ZYJA 3SDCA 3PQYE 2PYFB 1UT9A 3DXAB 1UH2A 3ZDZF 2EEBA 2ZCKL 2OSLA 2YUWA 2BVOB 3MBXL 1EEYB 3D9AL 1Y6MR 3QXTA 5LXGH 1QA9A 3MQIA 4F37K 3QWOA 4L9LA 4WV1C 1NCCH 1Q72H 3T0AA 2DQCL 1J0JA 5IR1B 1NCAL 1XEDA 4LLVA 1FYTD 1A9BA 4FXGA 2Q7YA 3DIFB 3D69B 3S9DB 3L1OL 5D9SA 1JGDA 4S1RH 1H3PH 1YEHH 1NLBH 4LBEB 3PXHA 1DL7L 4AT6B 4LOUC 4KKCC 3U4BL 4KY1L 3MZTA 1AGDB 1JWSA 3HPJA 4OV6F 1GGBH 2VLJB 1JF1B 4JEGB 2JCCB 5HHOE 4ZAKB 3SGEI 4FMKA 3MBEC 1N6VA 2YPLA 4XTRD 4PJAF 2LTQC 4LLWB 1QKZH 2ED7A 4GJTB 1R3KA 1WZMA 4RRPA 4JCMA 5F7WC 3VGBA 1QSVA 3KPRD 4G7YL 5ANMB 1HXYB 3C09B 1JMXA 1ZTXL 1KLGB 2I5YH 1JUFB 3MRRB 3C08L 5DD0L 4N0UB 4KJPD 3K74B 4JO2H 1NGZB 3WJLA 3WFHB 2NTFB 4KK6C 1J1XL 1MHCA 1TTFA 1U41A 2PNDA 1AQDB 1DSFH 4JPIA 4GMSL 2CH8A 1TQCC 1FZKA 4NRZA 2VOTA 4DVRL 3GI9L 1UQSA 3WO4B 1ED3A 5ILTL 5JW4Q 5K9JH 2CDFA 4LNRA 3CD4A 1G0YR 3BQUC 5GGVL 4NQUA 1LK2B 4FXGB 1A9BB 4WFGE 1B90A 1PEWA 4LAJH 3EFDH 4Z77A 2A6JA 2A38A 3O6FC 4QRRE 5HYSB 1UACH 1HNGA 4Z95L 5D2NE 2K9UA 4JLRB 3ULUH 2WP3O 4PRNB 5EUOE 2R23A 3QEHA 3KYMA 3OKNA 1DQLL 4P2OD 5C0GB 1I1FA 4RQQA 3BP6A 1FO0L 2H1PH 2NY5C 1YMMB 4M7LH 3UTQA 3GSXA 2ADIB 4PRIE 3IFPB 4Q2ZB 4WHYH 4OCWL 3B9AA 4CVXA 3D85D 5ESQB 1JYVA 3GMLB 2W9EH 1M6OB 3KPOA 5FYLD 1JUFA 4DGIL 1C5DA 4H1LB 5C08E 5C08B 3L5JA 1XGQA 4OF7A 3OG6B 4R2GD 3AREB 3RVVD 3PUCA 3ESVF 4GXVL 5F8QC 5DS8A 5JDSA 2VIRA 3KS0H 5E2VH 4EN3C 4D8PB 3VXNA 1XGPA 5IESL 2C1OB 1KCVL 1INQA 2HYMA 2G75A 1OD9A 1GYAA 3H9HA 1U3HC 2AI0H 3NIGE 1FNSL 1YEGL 5E7BA 5FAAA 3B2VH 3OL2A 3LZFL 2GITB 4EUPA 3EYVA 2MFNA 5FKPA 3BW9A 1RZIA 2SEBA 2VE6B 3GSQB 1BFOB 5IW1A 5B38B 4FFZL 1HDMA 2Q8BL 2OS7A 3BMWA 2XQYG 4M6OL 4FZ8L 2E7HA 3QDJA 1YN7B 2DM4A 5IB4B 1YPZE 3O3BA 3OKYA 1FGNL 1P2CA 1RPQA 4G5ZH 4JKPL 3BKCL 2VXVL 5FUZH 2X4OA 4E41D 4RNRB 3EJYD 5J3HC 2FWOA 2WWKO 3CMGA 4NOBA 2HA1A 3U46A 1DJSA 5CJ5A 4HWEL 4R4ND 2YD2A 4PP2A 1OD7A 4R0LA 4BUHA 4KJYA 3QDGB 3GSNB 4RWHA 5F1NA 5I73C 4RISH 2ICWI 2YSSB 1MOEA 3O4OC 2YD1A 3HZMB 3J8F7 1WWWX 1IEAA 4YFDB 4D9LL 1JV5A 2DWEB 2AEPH 5FYLE 4YFLI 1VFUA 4LQFL 3VFGH 4UDTA 5K33A 2FR4B 3F7PC 3QXVA 2YD9A 4K7FB 5F1SA 3T77B 5IESH 3B83A 5IBTH 1ACZA 3P30L 4X7EC 4KKAD 2ZZUT 3I6KA 1RZJH 5HDQL 4NN7C 5I2IB 2X4UA 2Y72A 2ORBL 1IILE 5CZXC 1CDCA 3FHQA 3PF2A 3VWJC 2VDPH 3B2VL 5F7UA 5HHQB 4HZAA 2YUZA 4OZGB 1I8LA 2B4CC 2B7DT 5BZDA 2BY1A 3RFZC 3B3IB 1GZQB 5DQJB 3S36X 2BVQB 1WF5A 2R69L 2V7NA 5CBAA 4L4TE 3JWNC 4L3EB 1R5VA 5C8JB 1UH4A 4PJBF 4PP1D 3QEQE 3X3FH 3NCBB 4ACPA 4QRRA 3C5SA 1D5MB 3CDGA 4TNVF 2G5RA 3L3KB 4I0PC 3ZKMD 1OF2A 1G7MB 3QULA 5ISZD 5EA0H 4HMDA 2EXYD 4GT7A 2EDNA 4GS7C 3KR3H 3FOLB 1X5KA 2IJ0C 2KH2B 1M7DB 1X5AA 4ODHL 5EBWB 4YHYB 4PJGA 5IIEA 4QHLA 4QRPA 4DGYL 1QSEB 5HPMA 2DQJH 5KAQG 2CMRL 3H9YA 3QG6B 1UWGL 1LE5A 3KNBA 4MVBD 2WQRA 1X5FA 2W60B 5J1TC 3KGRA 1IL1B 1AC6A 3AXLA 4GSDH 3MUHL 1MCRA 3MMEA 5C09B 5AG9A 3RNKA 2QSTA 2HMID 3MRPA 3C60A 3DPBA 5DMGC 4DOHE 1JPSL 4LCWB 4C59B 5GGUA 5EFIB 4X4YA 4ODHH 5T1MA 1MCEA 3OPZL 4U6YA 3O45B 4ZUWA 5FYJE 4RZCA 3RX5A 1TTUA 4WU7B 1NBVL 3QFJE 2MQ3A 1BJ8A 1VACA 4Y5YA 3EKCA 4JHAL 4GW4B 4JY5L 4G9FA 3DROA 1FNEA 1R3JB 5FM4A 3CNKA 1NUGA 2PO6C 4XNXH 5E8PB 3VFSB 1ZHNB 5SWQA 3HI6L 2X4SB 3MJ9A 3TPKA 4CRPA 4KI5E 3IDGA 4MXQD 1MI5E 4I4WA 2Y06H 1OM3H 2QHRH 4UB0H 1RK1B 3O6FD 1N7ML 3RY6C 5GISH 4XX1E 5T3XE 3OAYK 3G5YB 3O6KH 3QISA 4W4NA 2VQ1A 2H41A 5EORL 1TTGA 4JFDB 3ZKXB 5EUOF 2B1AL 1S3KH 2W0LA 3BZFB 3KPQA 5C3TA 3SE4A 3BP4B 3DV6B 4XCFL 1QFWM 3PWVB 1HNFA 2XWTA 3WKMH 4IRJB 3VDAA 1K9TA 1FYHB 4P23A 1A3LL 5FGBC 1FG2A 3FB7B 1Q94B 4OF3A 2E8ZA 4LCYB 4OFIA 3HG1B 5EIIA 1T5XA 1YNTA 4NOFA 3HLAB 4XPBL 2EDRA 5BMFL 3BE1L 4M43H 4ZO7A 1H15A 4ZTPH 3LKPA 4U7SA 2Q86A 3B8YA 2FL5B 4APQD 1NH6A 1PBYA 5GS2D 1BQUA 2KBGA 4WWKB 2GJ6A 4UUJB 1IZKA 2IQ9L 1XF1A 3SGKA 3ALWA 4RGOH 5ICZB 3K0WA 3LPFA 4DVRH 5F88B 3QNXB 3KPSA 4DTGL 4F57L 1X4YA 4IOSD 4K7PH 2X1QA 2KDGA 4LLYA 4HK3N 3HCVB 4IRSC 4J12A 3WKML 4JFFA 1T83A 4OLEA 4X4XA 2DIJA 1NJ9A 3RVTD 4CW1A 4JO3L 3IDIB 5KS9B 4QY8B 3E6HB 3OAUL 4OZIA 4LAQL 2GEEA 4HCRA 2YD3A 4PJ8B 2R9HC 3PP4L 3ET9F 4M8QB 4KH2A 4KI5D 3WEXB 5TDPB 4JHWL 2YPLD 2ICEB 5IMKA 3RKDD 2V7HB 4V1DE 4K9EC 5DJCA 2E9JA 1CXKA 3BUTA 2ZKHL 4TNWK 5GHWH 3O41A 5E2UL 1KOAA 3LEXA 4F7CB 3C9NA 4FQHB 2ZUWA 5KVFH 3TNMA 3QQ4A 3R4DA 1BQSA 2OI9C 5HDLA 1G7HB 3G5ZA 4FXKB 3TBSA 3IJSA 3GNML 3QDGA 2OSLB 3GBNH 2Q86B 4HF5L 3U0WL 1YEJH 1EIBA 4UV7L 1CLOL 1KTDA 2C3WA 2LVEA 4JDVB 5DJ0B 4JZOA 2X4QA 3RUGB 5F9DC 1HHJB 1KELH 2FX7H 1YEKL 5T1KB 1Q9LB 1RD6A 3B5HA 1LO3L 2CLRB 4MNGA 4OFDA 3CXHK 4MXVF 3IKCA 4HPOH 3QIUC 3TN0A 2YUXA 3LZFH 1IVLA 2P5EE 2P49B 4KQ4L 4HIHA 4Z78A 4HWZB 3B9VA 2I07B 3MFFA 1WAAA 3RWDA 4M61A 1JWMA 5CUSL 4KZEH 1ORSA 3EZJB 1SEBB 3DVNA 4HCRL 5EIVA 3FZUC 3OMZA 4LHJB 5BV7C 1EUTA 1A3RL 3SDDA 3RL2A 1TVBA 4DN4L 3O6LL 3T0ED 3T4YB 3CFDB 5CAYB 1S7SA 1MEXL 3C5ZD 1D5MA 2VDKH 1I9JL 1AGFB 5DHVA 1KTLA 4PJFF 4CU8A 1RZFL 2VXSL 2ARWA 2DDQL 2FYYA 2A6IB 4FNLH 4HC1L 3T3PF 5E8DL 3VWKC 32C2B 3Q3GB 5DUBA 1LO0H 3KXFB 1ORQB 3MCLH 2XRAL 3TZVA 2R23B 3CK0L 1FYTB 3ARTA 1E6OL 1ZSDB 4MA1B 4OCYL 2KZ1B 4ZPVB 5CP7A 3ZDYE 1CFNA 4FZEL 1YN6A 4N0FA 1FORH 1TMCB 3KPSD 1WCQA 1KJMA 1LE5B 2ADIA 1FFQA 4CMMA 5DHYA 4U31A 3BEVA 4FQCH 5DD3H 4YUEL 3SDYL 4JZJC 5JXED 5IFAL 1Q9OB 5F21B 1YYMH 4BZ2H 2HMIC 5GRVK 3UYRH 2Z35A 5DT1L 4PGZA 4OIIH 3MBED 2ERJB 5T3XL 1T0NA 1BFSA 3DVNB 1S9YB 3Q5OA 4TQEL 1YECL 5IV2B 1DANU 3FO1B 3D2UB 3N1QC 1ZANL 1LWRA 3NACL 4RGNB 3FT4A 4DGIH 2VERN 4NFCA 2V2TB 5SWSA 2YPKB 3L7FB 4S0SD 2AK1H 1H3UA 2V2XA 1UXSA 4KMQA 2O26U 3VA2C 2DQFB 4O5LL 1G9MC 2Y7QB 1WV7T 3UTOA 4F7TB 1UC6A 2VLKB 3PHSA 3MXWH 4HULB 1P9MA 2V9RA 3TFKC 4MAUH 4F7MA 1WBYB 3JV0A 4NO3A 3WSQH 4OF8A 5IQ7L 5HI5D 4NJAL 3GMOB 4M6ML 3QUKB 1CL7I 1WC7A 1AKJB 3L95B 2V5MA 1IGCL 1OCWH 4GSDL 1DEDA 3H0TA 4MD0B 5J6GB 3T4AA 1IMHC 1QP1A 4O51B 5ERWA 3CZJA 3FQXA 1C5BH 3IF1B 2H32B 3OKKA 3TZVC 2E5EA 1AHWA 4OFYA 2V17H 3IS1X 1K6QL 2VNCA 1W0YT 2VL5A 4LFHD 2D03L 2G9HA 1UJ3A 3RKDC 4OZFG 2IBZY 3ARPA 3KLSA 2VZVA 1H3XA 4FQJL 2FWOB 1MSPA 3S34H 3RL1A 3VMPA 3O3EB 1NCUA 4F7EB 3FT4B 3B8SA 1IGYB 5EO9A 4LPWA 4LLYB 3DX6B 3MRQA 1UVQA 2OXHA 4I0PA 3WLWC 3BPNC 1JNLL 5IJVA 3QNYB 1BP3B 4DCQB 2Y06L 1OM3L 2Z31B 3I6LD 5L9DH 4OLVH 5T1DL 2J88H 3QXDB 5IEKB 4MDJA 1R5VB 5C8JA 4LVNC 1MI5A 5KVDL 1DBJL 1NANI 3CVHH 4NN6B 4F15B 1U93B 5M7QA 2CXGA 4IRJC 5IOPA 5DK2A 3LHPH 3S4SA 3QAZC 1BZ9B 2CLZA 2XFXA 5B39A 4XWGH 4QHNA 1KPUB 3RX8A 5ICXA 4FXLA 4W4OA 4EUPG 1PYWA 3GMNB 3FFDB 2A74B 5CJQH 4YHLL 4HIJB 2J88L 3VG9B 3BKJH 4WFHD 4YGVB 1EJOH 2HFFB 3QYCA 3HUJB 2NNAB 4X6DB 5EBMA 3KPRA 3FAXA 5J56B 5M95B 3EJYC 4TSBH 1UB6A 4P5TB 1GZPB 5IB5A 4HUKB 3BT2H 4GBXA 2VUYA 4OZHB 4LSTH 4ZS7L 3L3HA 4NN5B 3V5KB 2MWCA 5GS1A 2EYRA 5E2TH 2BVPA 1J8HD 1H0DB 3V52L 2HT2D 1FO0B 2JKXA 3UEZA 3QIUD 5FOJA 5DYOA 2LFGA 1FNGB 1EHLL 4IMKC 4XMPL 4Y5YB 4MXVE 1S7VB 3HC0B 1KPRA 1JPFB 1JK8B 2IBBA 2HWZL 4WNQB 5D72L 1RIHL 1FV1A 5BXFB 2BHUA 4QHKI 4FMFA 1TVBB 3MREB 3I6LE 4Z0BL 4PJ7A 4KROB 3A6BL 1YDPB 3DTXA 5CEYA 2X4SA 3QQ3A 1KIRA 1W0WB 1XGUA 4IMLA 1NL0L 1NAMA 4N0UA 4QHKJ 1AY1H 5GRJH 2I60H 3RWFB 4NQVA 1F5WA 1P7QD 3GNMH 1NMCC 3JSSA 3NFNB 2AEQL 4G9DB 3ZLQC 1MJJA 2DOCA 4PRPE 2NQCA 1A21A 2HVJA 3T3PE 1R0AH 4NQSB 1TZGH 4N0FB 5DUPL 4ODUA 2CUHA 1UGNA 2C1PB 5C6TL 2YZ8A 4GG6B 2VSCA 4EJ1C 3HI5L 2PR4H 1KB5L 1HSBA 3ARYA 2VLRD 4ZD3L 5C0RH 4PV8A 3KPPA 3A6BH 5C0DA 3LAFA 5M94B 4TRPH 4F37F 1FN4A 5D6DA 1FDLL 4OAWA 3VXSE 2R1YA 4U1LB 5CSGA 3U6RB 3R8BB 1XR9B 3GMMB 4MD4B 4KHXH 5D70L 4NHUB 1GPOH 1RJYB 2QTEA 4JFFD 4XPTH 3HZYA 4YHNB 2F74B 1QVOB 3PGDB 3GJEA 5GSVB 4F8TA 2DI8A 4I3SH 1R3IL 3K80A 3QR2A 1ED3B 4PJEF 1MCDA 5L2KD 4O2FB 4UU9A 4I0KA 2BMKB 3LIZH 4JN1L 2AV7A 5JMRA 3IDJB 3MLZH 2IG2L 2VAAA 1A7RH 3DMMC 5KOVC 3MRRA 4HV8B 4LSVL 3O9WC 1AXTL 3ULSA 3I3DA 5MEQB 5C6WH 5KS9E 3VD4A 3BQUA 3OF6A 5IBLC 5EO0B 3QO1B 3WFHA 3WIIH 1DN0B 4Q6YA 1XT5A 5AYQA 2BRRL 3PL6D 3X13B 4K8RC 5F8RC 5F7MC 1AR1C 4WEMB 1IGJA 4NQEA 1YEDB 4NZRH 1EEUA 1W72B 1WZLA 3LKRB 4UMGA 3GM0A 4KROD 3FRPA 1ZGLM 3GSOB 5BJTA 5L2JB 3G6AB 1OVZA 2PUQT 4ZO9A 1MVFA 1HWGB 3C6LC 4XXDB 3BO8A 1KC5H 4LVOC 2EIZA 4YUEH 1QFPA 2IG2H 3N1MC 1BAFH 2AV1A 1IGML 3GJFH 3PNWA 4G43A 3W0WA 1FFNA 4PJCB 5EO1A 5I76B 5GGSY 3W5NA 3OHXB 1CDHA 1MCOH 5D2NC 4K9EH 3GJEB 5GSVA 2H2PD 4J8RA 4JM2D 3HMXH 4YDKL 4X4ZA 4M62H 4DZ8B 1HN1A 3FQWB 2DYPD 3TA3D 3TWCH 3LN4A 4M48L 1U0QA 1U8OA 1P9MC 2RAMA 4XCYB 4JFFE 5LGHH 4KDVA 4HV8A 3GM8A 3NCJL 5LGJB 4YDIL 5DQDL 3D6GA 3DX6A 3TCLB 3HMWL 4Z95H 5EB9A 1IGMH 3HZMA 1N59B 2BXYA 4GMSH 1JPGB 1F4XL 4ZMAT 2R1WB 3RWGA 1IKFL 1OAXL 3ARFB 3F65A 2B1AH 4NO2B 4P9HC 1JHLH 4D9QE 5CBEB 2MTPA 4HWNA 3DBXA 3L3GA 5CP3A 3UDWC 3EYOB 2OJEB 2VAJA 4KZDH 4EVNA 4R90H 3HG1D 1CT8A 4HS3A 4J7RA 3GBML 1E6JH 5E9DA 1UACL 4X4MA 1PZ5B 4YQXL 2AV1B 2XKSA 5KTEL 3AUVA 4NJ9L 1DTUA 3LRSB 5I1IH 3WMSA 1BFOA 5IW1B 3C60D 2YSSA 5BV7H 1I1AB 4GRMB 4RAUB 5H37H 2X9WA 4L1DA 4Y4HD 1A4JB 1RUMH 3IETB 3HE7B 1RZ8A 3MNZA 4MLSA 5KG9A 3P73B 1DBKL 2UWEB 4ORGA 4CJ0A 2ZOLA 5ALBH 1AGCB 3PHOB 5ENWA 2DI7A 3REVB 3PHQA 3IDYB 5A16A 1QSEE 4EKXA 2VUOA 1FJ1B 4DGVL 3CAFA 3OAUH 4KUZL 3FO2A 5I1IL 1NQBA 2HFGL 3WXVL 2BVQA 2V7NB 3RZCD 2X1WL 3QA3B 5JA9A 1J1PH 1CDYA 5IVXA 2ESVB 3FOMA 3GI8H 4HBCH 1FZMB 4LIQL 5I16B 3CVHL 3MXVL 3S6CA 4PJIB 3GMQA 4WUUE 5E8NA 3L3KA 3DWTA 4Z7VE 2BVUA 2VC2H 3JTTA 4X5XB 1CIDA 1HEZA 3C60B 1J05A 4FA8A 1NBYA 4X9HA 2HKFH 5GS2H 1T1YB 3QHZH 5CIPA 1PSKH 1I1YA 3IDNB 3CCHB 3D3VA 2DJUA 5DDHB 4PJGB 5EU6D 2X4TA 3E2HC 1NC4D 3AAZB 1NEZB 2XYCA 4NGHL 2X4PB 4HCRH 3CFEB 2NY2B 4JM2A 3MJ7B 4M7ZB 1MAKA 4MJ5B 1OP3H 3IB4A 4XHJC 2YD5A 5IB3A 4K8RL 3MLVL 1D6VH 2ADJA 5GJSH 2IC2A 1IBGH 2VDOL 1Q0YL 3I50L 3VXMD 1FSKB 1FZJB 2ORBH 4P4KA 1F3JA 3QT2A 4OD2A 2AXJA 4YXKH 5CINH 5DK3A 3GUTA 4Z6AT 4P2RE 1KT2A 5B8CB 3BP5B 4WUKH 4Z7OE 2A73A 2AK4D 3RZCC 5I75B 4LGRB 2AEPL 4JDZA 1HH6A 4EOWH 1RJYA 5E08L 3VRIB 1OTSD 1VESA 1P6AB 3QUMB 4OD1L 3GI8L 2GY5A 1JCKA 3MRDA 2A9NL 4PRHB 5FB8B 3KS0J 4EBQL 5I8CA 3QUXA 1CGYA 1VDGA 4I8DA 4X6BA 1WEJH 2CLVA 5KVGH 4Y5XA 1CK0L 3RKPA 2WWKT 4QTIH 1WAAF 4KJWD 3SDYH 3MV11 5CMAA 1MQKL 5BVPL 1D5BA 1KGCD 4PJEE 1DQML 4WW2A 3IDXL 5DDHA 2NW3A 4ZG1A 4WCYH 5IEKA 1T03H 4X8JA 1JRHH 5C9KA 4N0CC 4Z7WA 4PJ5A 5CZVH 5KS9F 3HE6D 4WW1B 1TZGL 1C12A 1U8MA 1UM4L 2D4FA 2B2XL 3FO0H 4K7PY 5DRZA 1LE9B 4JKWA 1H5BC 4Q9BA 5CINL 5K9KA 5D7IE 1T5XB 1SJHB 1KLFA 1NFIB 1UYWH 4QXGL 2UYLB 3T0EB 3QUYB 4GAJL 4MDJB 1NLDH 5H2BB 3D39A 5GRXG 4N0RA 5IB4A 5CLTA 1I7UB 3ARDB 2ZNWA 4GKOA 1EVTC 1CDIA 2JTDA 1GAFH 5I1LB 4HUVA 3N06B 4XBPA 3DGCR 1EO7A 1O7VA 5GIRB 3GSWB 5EU4B 5GGRY 1MLCB 1G9ML 35C8L 1FIGH 1DEEA 1IAOB 2QHRL 1C5BL 4HMEA 2MMXA 4JO2L 3TZVD 2VABB 3VXMB 4NC1E 2AK4A 1T5WA 4FQPA 3TO4B 3LMJL 1CLZL 1QQDB 1JJUA 1H5BA 3LQMA 1NPUA 4M5ZH 1DVFC 1FE8L 3MR9A 2OL3L 3O6KL 1U3ZA 4XC1L 3SE3C 1ZLSL 5C1MB 4LPYA 3HZVB 3BRFA 5C0BA 3BD4A 5C0BD 2GT9B 3RBGA 3TP4A 4FQJH 1LHZA 3MO1B 4HFWB 4X98A 3I75B 2EDOA 3RTQD 1F02I 4N90D 5F96L 4PJHB 3KXFD 2JB5L 3RWFA 5A2JH 1C7SA 2AJVH 3DX7B 1DCLA 2E3VA 4AM0A 1BECA 1NFIA 2GJJA 4GAJH 5IBLD 1IC4H 5C9JA 1CFQA 3TO2B 1T2JA 2IAMB 3RVXD 4XZUA 3V4UH 3FRPG 4HIEB 5DD6A 3QEGH 4MMZC 2CK2A 3PL6A 3CXDL 4NNYA 1DBJH 3P40A 3UBXA 1HOCB 1AKJD 1MJUL 5MENB 5BRZA 1GH7A 3OKMB 1LO5B 1UM6L 1LO4L 2BERA 2QBWA 2YK1H 4URTB 5D93C 4AL8L 1ND0A 2PTUA 4OCNC 1UWEH 2NY6B 5IIEB 4UQ3A 4FFYL 4PUBL 3MNWB 4W6YB 1A7NH 4C4KO 3OJMB 2QV2A 4N68A 3WS3A 4O9HL 1CLZH 5T1KD 4BQCA 2AVGA 2XA8H 3QWOB 1F90L 4L9LB 4RGOL 5IEHB 4GG6A 4DOHB 1ZA6B 3QPXH 4W68A 4Y4KC 5L7XH 2XWJB 2PR4L 1KCVH 1R3KB 3BZ4B 5GS0D 3LH2L 3RNKB 1CCZA 4XP5H 4YEFA 4K07A 4KV5E 3RPIA 2H3NA 2CKBA 4NQDA 2B1HL 4JKLA 3VI3E 1T6VN 1VERA 1WIOA 1JZ3A 3FONA 3QQ9C 4M03A 4F33A 1N6UA 3VWJA 4KKCD 5JOFA 2GHWB 3MYJB 5F9JA 1QFWH 5EWIH 1CFSA 4L8SB 1VADB 2GJ6E 4GAYB 2B4CL 3Q6GL 4JPWL 1F6FB 3IDJA 5K59E 4WFFE 5L2JA 3TVMC 3S35L 2Z9TA 4HGMA 1AFVH 4Z0BH 2QADB 4LKCA 2HTKC 3ELAT 5IFHL 1PVHA 5EA0L 1G7JA 5E70A 2YPKA 4YR6A 5IF0B 2BC4B 1QRNB 4WRLA 5HYSA 1W2KT 3FOLA 5HXMA 5D2NB 4CMHB 4GXUM 3W0WB 1KPVA 2BK8A 5E9DD 2FLRT 1I1RA 2O5YL 1D6EA 2C3XA 3TV3L 3PWJB 4G8GA 1QPXA 4XPAH 3I2CH 2ATPA 2V9TA 4HS6B 3QIWB 3VGDA 4WV1B 4YXLH 1TNMA 1BQLL 4DUXA 4HIXH 3IU3B 1A3QA 5I6XB 4WWKD 3EYQD 1DLFL 3KYOB 4LCIL 2IBGA 3S36H 4UT6L 3DO7B 4KGJA 1FQ9C 3KYNA 5SV3A 1MRFL 4LVEA 4PJ9D 2QADD 3MRCB 3F12B 4NSKA 2C4FT 4ZO6A 1FFNB 4PJCA 2XTJC 3LEYH 4I18A 4MB5A 2B5IB 4PRPD 3EYFB 2XPGA 1V7MH 1P7QB 2GTZB 3W2DH 4HHAA 1XGYL 4XXCA 4L8CB 3C2SA 2H9GA 5C0CA 1GGBL 1ZHLA 2VDRH 3ISWA 1WAAE 3L5XH 3BH9A 1OHQA 5C7XL 2VLRE 3JV4B 4G9FB 1WZ1L 5T1LB 4UINL 4OT1L 5I1HL 1KG0B 3VXSD 1YYLL 1UFUA 1FNHA 3OKLB 4Z7VB 2DAVA 3BXNB 4LKXA 1MNUH 3RJDA 1ZTXH 1K5NA 4OB5H 2Y36L 1ZGLB 2BNQE 2YD6A 1N26A 3LRSA 4YH6A 5HHNA 3S4SG 1DLHB 2AXFA 1NCBL 4PJIE 2P8MB 5L2KE 1QTYT 1FORL 3RWIA 4Q97A 1X5GA 4RDQG 4C55A 5D7IF 4E5XA 4ZAKC 1RIUH 4JJHA 1J1OH 2GSIB 4P0DA 3QQNA 5E94A 5AUMB 2DWDA 4XCFH 5D7IB 5JW4R 1BQHA 1RUQH 1IGYA 3EUUA 3M17A 4JO1H 1DE4A 1I7TB 3D25B 1XGQB 5FHAL 2EH8L 2H32A 3WN5A 4GG6E 4V2CB 4U1KA 2IFFH 3BN9C 3VXRA 5BMFH 3VXRE 5TE4H 1A1MA 1Q0XH 3CFCL 2X70A 3LS5H 4GKNB 4N8VB 3C5ZA 1D5XA 4OLYH 1XGPB 3FN9A 4HDIA 3ZKND 5CEXA 5HHOA 3L9RB 4PLKD 5ISZA 2R2EB 2Z8SA 5DGRA 4NUJA 3OTTA 4U05A 3TT1H 1O5DT 4KU1A 3VXTA 4ZFOL 4X5XA 4PGEA 3SQBA 4I48A 1QSFD 4PJFA 1A6TB 3W82A 3NPSB 3O8XC 3WLBB 1BVKB 3VH8G 4JY6B 2VJXA 3MRJB 5HHNB 2A9MH 4TVPE 1KPUA 2RHEA 1DDHA 2V5RA 2VH5L 1NLDL 2ICWB 1NC2A 5DFVD 3QAZB 3HPLB 1MLBB 3SDAD 5IQ7H 3CFDA 4LLAA 1HK6A 4N9GB 4RGMB 1P2CB 3GSRB 5BV7B 4P9HH 4Y2DC 3MRBB 5L88H 1U93A 2J8UB 4NQTA 2P24B 4MA8L 2IPUK 4XCNA 1OT1A 1EBAA 1WSST 1PX3A 3H7LA 4NQXA 2HT3C 2FB4H 4AEHL 4LL9A 1NKOA 4NO0A 4QHNB 2C7UB 5A2KH 4JRWA 3OR6B 1EJ6A 1FIGL 1KENH 4Q58C 3GBNL 3TO4C 3VCLB 5IFJB 4P4RB 5L9DL 1E27A 4P5TD 4DFHA 3P0VH 1HHIB 4HIJA 1WISA 4Y19D 1AE6H 1LDPH 3MJ6A 1FVEA 5GGVY 3WE6A 3BGFC 5EU3A 4PJCE 5F7EL 5SWSD 4JZOB 1J8KA 4X7CC 1A7OH 4LLDB 3CU7A 3HNSH 4JZNB 4JQVA 5DURB 2DM7A 4K94C 4C83B 4MA8H 3OAZK 4PLOB 5HYEA 4RMTA 3QWQB 1Z5LA 4G9FE 3NIFE 2JB5H 3RA7H 1JN6A 4YLQT 1BIHA 1QNZL 3JTSB 4TULL 4PRAA 4NZJA 1KTKE 3W11D 4KVNL 2GCYB 4Y5XC 5D7JD 3MLXH 1KEGH 1QLRB 4PJAA 1DP0A 1CFSB 4QXUH 4XMKL 3KHOA 1QSED 3U7YL 3BIAX 4KPHH 1RZJL 5DJAA 1F3DJ 1CFVL 2XZZA 1MJUH 4Z18A 2J8HA 4RMVA 4UBDD 5GZOC 1NGXB 4J23A 2PTTB 4A2LA 4LSTL 5K59F 1P84K 2QLVB 1XH3B 1YNKH 4U6HB 5JO5B 4IOIB 1CGWA 3T0EA 4YEEA 5TQ2L 3BKYH 3RIAF 1VGKB 5GS1C 4P4KC 4QGTA 1I7UA 3FB5A 1G7LA 4M5YH 1C5CH 5E8PA 3VFSA 4JDTH 1S9VB 1MF2L 2Q87A 1VGEL 1FVCB 2GFBB 3AB0C 4LLQB 2EE6A 3KDMA 1WFOA 2VZ1A 4PV8B 5F1OB 4L4VE 4X5LA 2WV3A 1CFVH 3OXRB 2R1YB 3U9PL 1FHGA 1ITBB 4OI9A 1QHOA 4XVSH 2RIKA 4OF6A 4X6CF 3G5YA 4LSSL 3O3AA 5TPWL 2F74A 4ZPTA 2VDNL 4L29A 5ADOL 4R26L 2QR0B 4TQEH 2EKJA 4TSAL 5D1XC 4QYOA 4JFPB 1VPOL 1WWBX 4HLZH 5GIRA 4P2YA 2AQ3A 1KB5H 4UDUA 2YBRB 5IFAH 1EEQA 2NLJA 1U6AH 3LQZA 4CMHC 1LK3L 1YC8A 3SE3A 5BVPH 2VDLL 3U36B 3OPZH 3TH3T 1E6OH 4RGND 4F9LC 4NCC1 2XICA 4MYWB 4HQQL 4F2MA 5IB1B 2P8MA 4QXWA 3MUGA 1S9VA 3B9KB 3IXTA 3TBYB 5CGMA 3R06A 3WFBH 3TA3C 3VDBA 4A6YH 1ZANH 2QKIB 3EW3B 4WI3A 4BUGA 3ULVE 5F6HJ 1DLFH 2DYPA 2AJVL 4CNIB 3OXRA 4OI8A 3Q1SL 4JRXD 4K3DL 1OQOA 1BX2B 4U1IB 3UAJC 4AZ8A 4PS4H 2YMXH 1U6AL 2CO6B 3QH3A 3GK8H 3WFDH 2ZUQB 5D70H 4WCYL 4LCCC 3AS0A 1OSPL 4Y16D 5I1CL 4EI5D 1QEWA 2N56A 2C1OA 3BPOC 3NPSC 3CFJB 4MNQD 3GKWH 5JR1L 3EOBA 1KJ2B 1I85C 1TZHA 4QT5B 5FYLH 4U1GB 1WFTA 3ARFC 2EDQA 2ITCA 5EZLB 1YZZA 2NXYC 1CGSL 1GL4B 1KXTB 2EICA 4HEME 1I1CA 4YDJA 2HJFA 1E4XI 3CFBA 4L8SC 5F7NC 1TIUA 3ZT5A 3S37H 4C57C 2F58L 1CQYA 3T8XA 3T2NL 1C7TA 1MI5B 1KCRL 1YPZB 4PJ7B 3V0VB 2HVKB 4P5KB 1RIUL 3UYOD 5GJTL 4OKDA 1OAUL 2XZCL 5I1JL 3DV4B 4ETYA 4PJ9A 1K8IA 4LSPL 1JTOA 1BWMA 5F3HA 3EZ8A 3LB6D 4Z78B 2MPAH 1ONQA 2E7CA 5KSVA 3N0PB 3BRDA 1QR1B 5D6DC 4F33B 4NZUL 2VE6A 3BDBA 4EDXA 1ZT1B 4MWFA 4QNPE 5EH1A 2F8OA 1WJ3A 5MEPB 4JZJA 1WGOA 2QQKL 3QQ9D 4ODUB 3QJFB 3V4UL 4KJQC 1MAML 4M7ZC 4APQB 4DN3H 1U2HA 1B0WA 1EGJH 4OQTA 1JFQH 4QRUB 2D0GA 4JFHD 4L4VA 4X6DF 5D9SB 3LPGA 4BSWB 1MCPH 3ZSTA 1A47A 3THMH 1PQZB 4MCZA 3F12A 4NSKB 4RFNC 3OG4B 4U4BA 2FO1A 5ID1A 4FFYH 2DM3A 5ICYB 2X41A 3IFNH 1IEAB 3BUYA 4ZFFA 1NSNH 3NN8A 3GSUA 5BZWB 3VFGL 1KJMB 4NP4L 5IMMB 4G6MH 2DLTA 3L3IA 3VI4F 4CADA 4RGMC 1RZJC 5KVDH 5SX5H 4XVJH 4C54A 1TJGL 5IHUL 3GSNL 2NX5D 5E8NB 5AAMA 3DUUB 5HGHB 2V2TA 4TYUA 1KJVA 5EUKB 4NC1C 3HCVA 4FFWC 4WWKC 4MJID 4Y5VA 1L9MA 3QIBD 1W0WA 1AI1L 3DHJA 4B5EA 1K2DB 3SJVA 4CVZA 3DGGB 3QEQD 3AB0B 1KENL 3ILPB 1QRND 2EC9U 4G8FB 2H8PA 5HGGS 4O4YL 3IXAA 5D72H 1N0LA 3S7GA 3MRNA 4PJ5D 3VFVB 2Q76B 2GJZB 2XKNB 3Q6GH 3KWWA 1DBBH 3AXLB 1MEXH 1SYSA 3T0XA 3RIAK 3O2WL 3KR3L 5C07E 4EXKA 4EZMA 4WGWB 4F8QA 3D25A 5E8DH 4P2CG 3F7VA 4GKZB 3WNMA 5E6ID 1XGRB 1QSEA 5D1XB 3F58L 4KKBD 4JFDE 3Q48A 3MJ8A 1OY3B 4NWTL 5T5NG 4E5XB 1K3IA 1NCWH 2A1WH 1GGIL 1FNLA 3CUPA 5DR5L 5J06A 4Y7MA 4X6CE 2FEEI 1WLHA 4ERSH 1HQ4A 4HXBL 1RJCA 1X4XA 2WSKA 3CX2A 3MSPA 2YWYA 2GSGA 3NFPA 1F58L 3B9KD 5DD3L 2VDPL 4ZUUA 3AY4A 4X7FC 1UB5B 4QHMB 1URLA 1KFAH 3QFJD 4MA7H 1KEMH 2W91A 1N6QH 1BJMA 5ACZA 1WT5C 3C6SA 4WJ5A 1HYSD 3CFCH 5TF1L 1JGUH 2EO9A 3UX9B 4L3AA 4RBPH 3ZE1E 3AU1B 4DGYH 1WFNA 3W39B 3R1GL 4GBXC 3O3DA 4MZ3A 4ODSH 4IIQC 3SE8L 4MJIE 1EEYA 5I1KL 3V79C 1KCSH 2BJMH 1HKLH 1YECH 1IM9A 4LHUB 4D9RD 3CPLB 5C0JA 4H5SB 5C0FB 1QYGL 2GYSA 1YUHA 4NO0D 1QRNE 4PREB 3NACH 4JN2B 1NUDA 3QCVH 4HJGB 2FYYB 4PJHA 4S1RL 3H9SA 1CDGA 3UTZB 2BSSA 3SKOA 1RK0A 1BBDL 3FQUA 2NY5L 1ZT7B 4LGSB 4ODTL 4Q6IA 1ACYL 5C9JB 2Q1EA 5KAQF 2BFVH 4PJBB 1HXMA 5EZIL 4F58H 2ERJC 2NYYC 4LCCA 4Y16C 3W9DB 1I4FB 3ARGD 3WNLA 2JK5B 2Y25A 4QXTB 4TUJA 4D0BA 1U8NA 4NN7B 3RWCA 4YDKH 4N1HB 4PV9B 3RWEA 3FQWA 1ITCA 2XNAB 4OTXH 1KB9K 2VZ3A 3LIZL 1IGTA 1YJDC 3IAGC 1WCBA 3TH2T 2BVEA 3GGWB 1S8DA 1F11B 3LV3A 2Y6SC 1H15B 2DJ4A 3SOBH 3UJIH 5HDBF 2AK4B 4I9WE 3T2QA 4PRAB 2VB5A 5GISL 2BRRH 4EEEA 5CILL 1QFHA 2R2HA 1JPFA 2WM0A 3TO4D 1ZHBB 1S9YA 1PAMA 1FG9C 1P84J 4R7NA 3FFCE 5J3HD 2D7NA 4NNYB 1M4KA 4ZXBD 4KXZI 1PKQB 5EU5B 6FABL 3P9MB 3V8OA 2ZUSA 1EMTL 5DRWA 1IZJA 3L3HB 3VWJD 3QNZA 3L5IA 5DJYA 4AMKH 3GZKA 4JANB 4QRPD 3L7FA 4LCUA 5JQ6H 1RK0B 1NGZA 4X9IA 4N5UA 1HINH 5ICXB 1QOKA 3S98A 5D93B 4JQIL 2NY6C 5DFVC 5JHLL 4FQQB 2HFFA 5F9JB 1Z9LA 1ZLUK 3BAEL 3CSYA 1I4FA 4XPFL 4M6OH 4C56D 3O81A 4APQA 3RAJH 4ZS6D 1BD2D 4PJGE 1F3RB 3QUKA 5CZXD 1TVHA 1EPFA 2VLME 3LKSA 1HSBB 1BJ1H 5KG9B 4P59L 3CVIL 2OZ4A 1B0RB 2FRGP 2VKWA 4R90L 1P1ZA 4NM8L 5SWZE 3GUTB 5SWZB 3EYQC 5FO7B 2F8XC 4AMKL 4ISVA 4XNMB 2FO4B 2P8LB 1AD9B 2X9XA 3AM8C 3HMWH 5K93A 4MXWL 5GRUL 1FNGA 4KAQL 4RMSA 3GFUA 3VGAB 3P0VL 2LU3A 5ETUA 2DBLL 4P2OB 3SDDB 2FGWL 2GAZA 3I3BA 5J1AB 4GW4A 4MA3B 1KLUA 2IANA 4K7PL 4NN6C 3RAJL 5CEYB 4F15C 3UPCA 3DO7A 4YHKH 2MCPH 2Z31D 5DJYB 5SWQB 1QO3A 3SGJA 2XTJB 4H20H 4ZYKB 5T1MB 3VDCA 4NQVB 1J05B 2C4XA 3LDBC 3EYVB 4G6JH 4MD4A 5KBNC 4YQXH 4YPGB 4XC3H 2W0KA 2EZ0D 4GW5B 1FLRL 4UV7H 1ZHLB 4X80L 5JIIA 1R3JA 1E4WL 5DVLA 1S7RB 1OAYL 3VGGA 5A3IC 4GAYA 4ETQB 1I9IL 1MFNA 2HLFC 3IXAB 2DIBA 1IC5H 4LLUB 1JFQL 3WCYA 3SN6N 1G6RL 1RZFH 1LE9A 5IB3B 3QIWC 1U58B 3KPRE 5E2UH 1JIBA 3LN9A 1GOGA 2EDKA 3BXNA 4OLXH 1SYSB 4BH8B 3D3VE 1IBGL 2VDOH 1NMBH 5C2BH 3CX5J 3EHBC 4PJDB 3NZ8A 3MYZA 2CIKA 3TLRA 1EUUA 4C56E 5I8KH 2NY4B 5D7LD 5EN2B 1RAMA 5J6HA 1LP9E 5E6IC 1B0GA 5CJBA 4FQ1L 5DJ6A 1YNKL 1SM3H 2VN7A 3CFIC 2XTLA 5CP7B 1F90H 2EC8A 3ZL4L 4KMTL 2VZTA 1DQQB 1EXUB 1NGWB 4UDTB 3U1SL 2HWZH 5H94A 3FO9B 1E4WH 3EJZD 1QSFA 4CDGC 4CVUA 4JPWH 4RNRA 1QLEH 1TPXC 1BM3L 1D9KB 3REWA 1EFQA 2DYPB 5KW9H 1MLCA 4M1DL 2ID5A 5IFHH 3NFPB 1E4KC 4YHML 5ESAA 2FX8H 2ZUUA 4X7SH 2R2BB 4U0RC 1JYNA 5GZOD 1T83C 4OCRL 2GTZA 4YPGA 1MWAB 1X44A 4TN9A 1R3LB 5SV4A 5TGBB 4OZIB 4J8RB 2IGFL 4L3EE 1HH9B 4QRTA 3RVXC 3ZYIA 5HYJE 4HBQA 3JV4A 3QRGH 5DGQA 1IAMA 3U82B 5C6TH 2V5SA 1CD9B 2YD4A 1RZKC 2CUIA 3O8XA 4N8PA 1N5AA 1B2WH 5IHZA 1A14L 1XIWB 15C8L 3DMMB 2PO6D 4AM0B 1JPSH 1ZGLA 4QOKE 2PXYA 2Z91B 3NCCB 4GRLD 3VXSA 2EDEA 4J3TA 4NQDE 1G7HA 3UTPE 5DMIH 5DJXA 4EIZC 4KROC 3SE4C 1A6AB 3ARFA 2BSTA 1I9RL 1BQLH 2HVKA 4P5KA 4Y16A 4UOW1 2BY0A 3NH7L 1SQ2N 2RFXB 2YEZA 1KN2L 1NMCB 3RY6A 1CU4L 2XG5A 5I1LA 1BQHB 4FTVB 4I3RL 3VXTB 1KIUA 1PZUB 3WLWD 5KSBA 1A0QL 2CGRL 1TJHL 1BWWA 4NNPL 2W9DH 2O93L 4PRDA 1J18A 4JPKL 4ELMF 2QQKH 4GKNA 2QQQA 5D4QA 2CPCA 2IFGA 4HMCA 4U6TA 3O6FA 4JPVL 3ZT7A 4MNGE 4YHNA 1X4ZA 1SEBA 4L9LC 1OTUC 4LIQE 3SGDH 1V3LA 2ZNXA 3HI1A 4M7LT 1EAJA 3ILQC 2AAVA 3NTCH 2A6KB 3QUZA 3PXJA 5A16B 2XZAL 4XPGL 1C08B 3FO0L 1DUYB 4IS6B 2Y36H 5DRNB 3DVGB 4GS7B 5ITFB 2OZ4H 4ODWA 5ICYA 1S9WA 3TYFB 1P69B 4JE4B 4N0YL 4J3UA 2JELH 3X17A 1UYWL 4WU7A 1BF8A 4HW6A 1BOGB 2PO6A 2NW2B 5HVHB 2VLLA 4OUUA 3JWDC 1ZSDA 2DKSA 4QTHB 4KDTA 1FZKB 4HG4K 3ZTJG 4JG1H 4J3SA 4U1JA 1LEIB 4LMQI 1G7PA 3GKWL 3QCTL 4P9ML 4IJ3C 5EZOL 1G1YA 5BRZB 3L5WA 3R0MA 2HFEA 5TDOB 4FQXB 1UWEL 1ADQA 2YS4A 4PJGF 3AMLA 1LD9A 3T65B 1JNLH 3ZTJH 4G8FA 1SBBA 1JPST 4NHCH 2CIIB 3HE6A 1ZLVH 2AJYL 5GRYA 4WGVB 1G9NC 5IMOA 4JPVH 4OGAD 3ORJA 4ZXBC 4ZAKA 2JF1A 1CLYH 3U9UA 1CXIA 4FZ8H 1MWAH 4AY0A 1JHLL 1MCHA 1MREL 3S5LB 5I19L 1I3GH 1N2RB 2A6KA 3O2WH 1YEEH 4HS8H 5A40E 4Y5XB 4NO5B 4H0IA 3FMGH 1KJ2L 5HBBA 1DFBL 4OZGA 4RFEB 1SMOA 3JVGA 4HH8A 5ITFA 4ZOEA 3CMOH 4ZDHB 2A6JB 1WT5A 5ACZB 3P2TA 3DETD 2B5IC 1MAJA 4FFZH 1HH6B 3MV8A 4HGWB 5E5RB 1AR2A 4JM2B 1QFWL 2OTWA 4WIQA 4PRID 1NDMB 3FTGB 4Z7NF 5FGRA 4I5BA 3ZKXC 4LCWD 2Q6WA 4HWEH 5FYKH 1AKJA 3L95A 4M93C 3VW3L 1L7TL 4YHOL 5CJXA 5EU6A 2VC2L 1UZ6E 4BH8A 2ARJA 1MY5A 5E1AB 5EOTB 5AG8A 3OKDB 3VH8B 4HH9A 3H9ZA 3ZTNL 2VZUA 3CMOL 4UTBH 5ACLA 1ZWIB 4G9DA 1B0GB 2DQHL 5LCVH 1E4JA 4HWBH 4Z7WB 3EJJX 1CLOH 5D5ME 4BJLA 3MODH 4HK0A 1U8KB 3WFCL 2OR8A 1LP9F 2X4QB 1FZOA 1T20B 1XF4B 1A1OB 3MXVH 5TQ0H 1HHJA 1N2RA 2VXSH 5HI4D 2UWEA 4ORGB 1M7XA 3GB7A 4K3JH 3HB3D 4G8GD 2MOVA 3F5WB 3HMXA 3TBSB 3KLHC 5FA4A 1AHWB 3QIBC 4R4FH 1FVDB 1D5IL 4HIHB 5B3JE 4JQXC 1A7PH 3J7HA 3VG0H 4LCCB 3T08A 2DJSA 3HZYB 9CGTA 25C8H 3UZQA 3ES6A 4DFIA 4CN1A 3OSKA 5IMLA 1EHAA 4W81A 4LLMA 3BYYA 3ZO0A 4B53A 1IGTB 2IMMA 4AEFA 4UT6H 1KJ2A 4G8IB 2WZPD 5KANG 4LSVH 1FH5L 1A6TA 5GRVL 5EZLA 4OCSH 3VMOA 3C87A 2MNUA 1IE5A 3WYRA 4HUNB 1DSFL 4KY1H 3P11L 4XP1L 3MR9B 2C26A 4DK3A 1HDMB 1YEDA 3TEUA 4O00A 2ZPKL 1A6AA 3BZEB 1OTTC 4BFEA 1LEKA 3V5DB 4NWUH 3SDXB 3HS0A 1P7HL 3ILQD 1X3DA 1D9KC 4KK5D 1TVHB 5DA0B 5LBSH 4XP4L 1KTLB 4YNYB 4NQXB 4OQ1A 1X6LA 4NKMB 3LSOB 3DSFL 5BW7A 4PRIB 2C7UA 2OBGA 1DQTA 4UQ3B 3CJJA 4Y2DA 4R4FL 3VXUE 2GUOB 3QUYC 1YYML 4BZ2L 1EAPB 4GG8A 2IAMA 1KNOB 4YDJB 3WN5C 3MTRA 4QXGH 2WIIB 1NCBH 4PP1C 5TFSH 4PRHE 1L4IA 5GGQL 4K9EL 3RVUC 1A02N 4KQ3L 3A67H 3C5ZB 2OQJB 4BZ1H 2YPLE 4UIMA 2IADA 2VDQH 3BJ91 1A1NA 4Z7QF 5HHVH 3DO3A 5DHYB 4ELME 1OCWL 4Y4HB 1F2QA 4N9OB 4UNTA 4OZGE 1RV6X 1U42A 4QT5A 4U7KA 1P4IH 4U0QB 1GJIA 1H0DA 4PGCB 2P8LA 4PD4K 4PG2C 4KK6D 4UB0L 4I2XE 4K3DH 1NCTA 4O5LH 2IH1B 3MRIB 3TM6A 3VFPB 5KSAB 5JOFB 2D03H 2M8XA 3L3IB 4D9QD 3F7YB 2OTPA 2VLLB 4OUUB 3E1F1 5FOBB 4M1CC 5C0CD 3MACH 5I8OL 4JRYE 5B4MC 1C12B 1U8MB 4M6AA 5LAXB 4YX2H 3CSPA 1U3HB 4LSUL 3EOTH 4PRPA 3LSOA 1FAKT 3MRGB 3Q1SH 4CN6A 4Y19B 2NXZD 3G5ZB 4FXKA 3DX9B 3TNNB 5I66B 1JGDB 3H3KA 1CQKA 1FJ1A 4KHTH 4NNPH 4CKVX 4U3CA 3HAEH 3F6IA 4MDIA 5BV7L 1PKOA 3QUYA 4R96A 3FFCD 4RA3A 3TGXA 1U91B 2X4RB 4WV1A 1S5HA 4BKLA 5IMOB 3C8KB 3IETA 3SKUD 4DTGH 3FKUS 3PGDA 4N8CL 3WD5H 3MZGB 4PG9B 3GJFB 3TVMA 1D9KA 1LO2L 1IFHL 1RURH 1NUNB 5DQDH 5L6YH 5J4MA 1MI5D 1MCQA 4JCLA 3UTTB 4GRWF 5ID1B 4MJIA 1FL6B 2DQIL 4LP5A 4N0YH 4ZFGL 4D9LH 5IQ9B 5C0CB 5JHLH 4EQ3A 3NCEB 3AAZA 2DQGL 4L4JA 2AJZA 3E3QC 1QSFB 4XXCC 1IKFH 3SQOL 2FIRT 4FABL 1PJ9A 4HJ0C 4OCXL 3ZKNC 3E6FB 4BQ6A 4FTVD 4B7IA 4BSJA 3VFUB 2Y5TA 3MV7E 3U79A 3DECA 3JTTB 1KB9J 2EXWC 2BC4A 1HWHB 1EO8H 4GLRH 2XPGB 1TJIH 3WNOA 2FB4L 4N1EA 2WBJC 1A4KB 4KGLA 4Z7NE 1OARL 4WW2F 2W59A 3E3QE 4NKOA 3AU1A 3EDJA 2A73B 4JLRA 1BQHG 5I76A 1RHHB 5ALCH 2IQAB 3SKMB 2DF3A 2EE3A 3IU3A 5C0GA 4HKJB 1IM9B 5MENE 1YMMD 1X5YA 1S9XA 1YQVL 2GSIA 1OGAB 4PY8I 1XF3A 1DBKH 2V6HA 4M3JA 1A1OA 5F7DA 4K94L 1HQ4B 1WVZA 4KTYA 1R24A 3T0EE 3BT2L 2P8PB 2P47B 2B1HH 5D2LE 1OL0A 1J86A 3CGTA 3Q6FB 2VR4A 5I71B 4X4XB 3V52H 1NSNL 1AD0B 5JLZB 2LU7A 4Y16B 4AIZB 1Y0LA 3SQOH 2ILLA 3QDMD 5I18L 1JZ4A 3MRMA 2FHBA 2NTSP 1RIHH 3ZSSA 1JI2A 2N7BA 4HKBA 1TZHB 4DQOL 3VFUA 1JGEA 5F72S 4P3CH 4PY7B 4FQIH 2BDNL 2QADC 3DBXB 3L3GB 4G80A 3S8WA 4R4NC 1MFDL 5F7KC 4U2ZA 4F7TA 4OCRH 5FKPB 5JW5A 1BEYH 3VWJB 3PQYD 1KPRB 3ZL4H 5CEXB 1MJJB 1WBYA 1WWAX 3L3JA 1R0AL 4HIXL 4LPCA 4X4ME 4XNXL 3RP1A 3KG5A 3CPLA 4HUXB 4R9HA 2EKSB 2J8UA 4HXAH 5HD8C 3B9KA 3P9MA 2HP4A 5D7IA 3LRHA 4MSWB 4HJGA 4OGXH 2VRAA 1S9WB 1KB5B 3MX0A 1F42A 3D39E 1WCBB 3MRLB 1EEZB 1PW3A 4K2UH 3MLRH 2P5ED 3E0GA 4POYA 4M7JL 2ZUXA 4NN5C 2UYLA 4ODVH 1KPVB 4WENB 5HPMB 3ARBB 3T0VA 3DUHA 5C0AB 5D2LB 3O8XD 1V3MA 4LSSH 5DZOA 1TCMA 1VFAB 1V05A 4ODSL 3SE8H 1OGTB 3T2PA 4OZHF 3WFBL 1VEPA 4LNVA 1A1NB 5FCSH 4HJ0D 1GAFL 4QOKD 1UXWA 4ZTOH 2LU4A 4Y4HA 1FFOA 4IHOA 3JWOC 5J11C 3TJHD 3V5HA 1MFAH 3GGWA 3SDDD 5A2FA 4P5MA 2PN5A 3K3QA 3MLTB 4PGCA 3ULUL 5HHQA 1CGSH 5DVNA 5D7LA 5I9QB 5JNYA 1AXIB 1DVFA 2NXYD 3JTSA 3RUGE 4HKZB 3MV8B 2GIYA 3NIDF 2EH7H 4LVHC 2YWZA 3X13A 4JHAH 4MAUL 2NCMA 4QF1A 1P4BL 1NGQL 2WP3T 2OTWB 4TNVK 2FJGA 1UQSB 3I9GL 5ESVA 4ORZC 5JA8B 3TC9A 2FEDC 4NO5A 1ADQL 1WBXA 2VLRA 1MCJA 1AGFA 1HEZB 4MSWA 2XTJD 4ZYKA 4XGZA 5FHAH 3H6JA 3W5MA 1EEZA 1E6JL 5B8CC 5FECB 1ONQB 2BHZA 5KSUA 3VCLA 5IFJA 2VWEC 2GCYA 1ZT1A 4MWFB 1Y18A 3KPMB 4GFTB 1IAIM 4OJFH 4HIEA 4H8WL 3RVWC 2PETA 4DUWA 4UILH 3BP6B 2MJWA 3CC5B 2AXHA 2CKBL 2YPLB 2O5ZH 3DRQA 3V0WL 1MRCH 1BVLA 1S7TA 3NTCL 1VEMA 1KLUB 2P7TA 4ZUVA 5CGYD 3RNQB 3VFWB 5HHOD 5CGTA 3C6LD 1CYGA 5FO7A 3HE7D 1EMTH 3GDBA 2DI9A 2Y6SD 3UCRA 3RPIB 5F96H 5E6IB 3UTSB 3GHBL 4UQ2B 2OI9B 4JO3H 4XAKD 5T1DH 5C08D 1YJDL 1T0MA 2YOCA 2ZUTA 4AQ1B 2X05A 2FDBP 4XRCB 5CJQL 5HDOA 3N1PC 5ADPH 4NP4H 3HNVL 3MYJA 5E03A 3MV7B 4MCYA 2HLAA 2Y4SA 5CJOH 5ESVB 4PJ5B 3PIQB 3QCTH 4LIQH 2J12B 4E0RB 1MJ8H 1UCBL 1FPTH 3A6CL 4NQED 5F71A 4LSUH 3NCYS 3AS3A 4U7MA 2DTSA 3MGAA 5HGAA 2HAZA 3MOBL 1M1SA 2EECA 4RA0C 4KTDH 1RZ7H 1BPVA 1FL3B 2DTMH 4KHTL 4D2NA 3FQXB 3PP3H 1U92B 5F6IB 4GW5A 1U36A 4WFGD 2AJYH 4DKDC 2ICEA 5H35A 3EDDA 4PYHA 1LDSA 5HGBB 1CXFA 4XWOD 5TDNB 3SKMA 1A7OL 3H9HB 5DJ8A 4IRZL 1I9JH 3BGFB 5I8EA 4G6KL 2YC1A 2P7TB 1U58A 2WUBH 5F7DB 3B6SB 4E41E 1LO3H 2HKFL 3OX8A 1E0OB 4L4TA 4M6NL 4KJYB 1FG2B 3FB7A 3BW9B 2XRAH 5L6YL 1RU9L 3HC3L 4YZFE 5L0QB 1XR9A 4XP1H 1J5OL 2GK0B 5JW3H 5DJ6B 3KVQA 3ARED 4PRBB 2DQIH 3U2SA 3ARDA 1J88A 3HE6C 5D2LF 3MJ8B 2HT2C 2YRLA 4D8PA 4NYLB 1OAZL 2QHLA 3HNVH 4K7FA 1NFDE 3DRTB 3HA0A 5JDJA 5HD8D 3CUPB 1C1EL 1UENA 1BZQK 5EG6C 5D7JB 2APFA 5CLWA 1TZIA 3VW3H 1PLGL 2RB8A 2DDQH 2P5WE 2IANE 5EBGA 2GITA 3JVGC 3BQUB 2Z92A 4S0TD 5FCUH 5LJYH 1GGYA 3RWHA 5JQHC 1T7XA 3U7WH 4GXUN 1FBIH 3AROA 4NQEE 4ZODA 1HYSC 3HZVA 4KWUA 1F4AA 3VA6A 3QDMB 3TO2A 2V9QA 5E95B 5KJRL 3CU1A 5JHDD 4Z7UF 5EUOB 1UA6H 3QNZB 3QHFL 4Z7VA 4LQ1A 2A6IA 1PX4A 1KACB 2NY7L 1PGRB 5I66A 1J8HE 1G6RA 4MA7L 1BZ7A 3CFKB 2HT3D 3NMEA 4OZHA 1IM3B 5IW6A 1N3NA 2AJUH 4HFUH 4LOUD 1IM9D 4GMTL 5F97E 3VXQA 2HFTA 5DQ9A 2H6PA 1T4KA 3P4MB 1G0DA 4U1JB 1LEIA 4YX2L 1QLEL 4BELD 1Q8MA 3HI6H 4EBQH 4P2RB 4PRPB 3S36L 4FTVA 3ARZA 3JV6A 3MRPB 3VXRD 3CSBA 3DSFH 3TESA 2OTUA 5DRNA 1S7XB 3WIIL 4E42A 3BKMH 4HT1H 5IP4A 4ZTPL 5JORA 4K71B 5DTFA 1JHKL 1JPGA 3NN8B 3C2AH 1T1ZA 2AJUL 3KNBB 5E7FA 5KZCB 4LP4A 4R7DB 5CS7A 5C0IB 3MOAL 4KDTC 3S5LG 3WSQL 2OMBA 4PG2A 3X3GH 3TVMB 3ZHKA 1JWUA 3H3PH 1YY8A 2B8OT 7CGTA 1CL7L 3G6JB 3NIDE 2HH0L 2P42B 5EU5A 5BS0A 3QHFH 5SWSB 1MNUL 4ESKA 1G9MH 1R5IA 3QXUA 3CZFB 3SJVD 2KL6A 2DQFA 3LQAL 2HG5B 1SJHA 5D2NA 3DGGA 1H8OA 5J12C 3FB6B 4MQXD 4FS0A 4ZUTA 1PD6A 4NQCD 1I9RH 3A67L 1IGJB 4RRPG 5E1HB 5T3XD 5IB1A 2A77L 3HR5A 5AD0B 3RIFK 4M48H 5HGHA 1HI6B 1PG7L 5JPNB 4BSWA 4R8WH 4JAMB 4JRYB 1BVZA 4PJ8D 3TYGL 1NBQA 4LSPH 2VISB 4OM0H 2VAAB 3FB8B 3F7VB 1KLGA 4KKBC 2YUVA 1N8ZA 4ZNCD 3BUYB 1D5ZA 1Q0XL 4MB3A 1BD2B 1H8SA 4O9HH 4WY7L 4L8BB 1NC2D 1P4LA 3UTSE 1IQWL 1MPAL 3NCYP 4MCYB 3QNXA 3P0YL 3FTGA 2Z4QB 3H7BA 3AGVA 4KVCH 3NZHL 5T1LA 1OSZA 1ADQH 1PG7H 1T2XA 1BIIA 1T66C 3VD5A 3VXME 1NBYB 1DQJA 2ENSA 3RJQB 3TPUA 2FNBA 5FA4B 1QBMH 5IGXH 4OM0L 3LKPB 2H9GB 2Y07L 3N1GC 4P2RD 3VRLE 1Q38A 4U0RB 1BFTA 4YDVB 4NCC2 2X4TB 4DJMA 2AK4E 2GY7B 2QQLH 4OM1H 4WEUD 1A6VL 3QB7C 3ALPA 4KI1A 2FGWH 4G5ZL 5E4EB 1G7LB 2A77H 3ZDXE 5IMKB 2R0ZL 5DMYA 1A7BA 1OTSC 1YMMA 2UZIL 1IC5L 3QIUA 3HUJE 5D1QC 3OKMA 3OZ9H 1J8HA 2ZSWB 3CVIH 4LVNB 3U0TA 3U0PA 3JUZA 2I60L 2PTTA 2D31A 1DFBH 1VFBA 3BX7C 2R4SH 4PJDA 1DE4B 3QHZL 1AI1H 4B50A 5ERWB 1WTLA 1DLHA 5IM7A 3ARBA 4LDOB 3SHSA 2NPLX 2VZOA 3AREA 3D85A 4FTVE 1OAYH 5BO1H 5BVJB 2N4IA 2HRPL 2JK5A 1EXUA 5BS0D 4MNQA 4XVJL 1WITA 3NABH 1NEUA 2XWJA 2JCCE 5HHOB 1YEEL 4HS8L 3P73A 3LPWA 3MA7B 5D7JA 3QPQD 5JUEH 3HRZA 4Y0GA 3VG9C 1KXQE 3HG1E 5IVZB 1MRFH 3MLYH 1AO7B 4WO4D 4UIKL 5DHVH 4Q9RH 4DKEH 3GRWL 4W6WB 3L3DB 4GQ9L 4KMLB 3TV3H 3FONB 5IJVB 2JJSC 1MIEL 3U36A 5T3XH 4ZFFB 4GLRI 4MQXC 5CHNB 1EV2E 1UWGH 4I3SL 5IMMA 2R1WA 1FV1B 5BXFA 1RZGA 3EO1B 1X5HA 1ZVSA 2YXMA 4PJ7E 1BM3H 4OZ4B 1K85A 4KUCD 2AS5M 3DVGA 1F58H 3CH1A 4V1DA 2FX8L 4I0PD 2I26N 4NKMA 5IOPB 3O9WB 4QTIL 3UJJL 4V1DD 3RWDB 4N5ED 3MOQA 3D39B 1F6AA 4HWBL 4QTHA 5F93C 4IIQB 4NQSA 3MCKB 4U1MB 2A9NH 4M00A 1EZVX 3NABL 5DD5L 2FX9L 3HE7A 4ERSL 5TQ0L 2RFXA 3LKSB 3WV0A 3I02A 5B4MD 1V7NL 4GAGH 4XBEH 5KVGL 4CU7A 3DVIA 1BGXL 4OAWB 4P5TA 2PXYD 4U1IA 3KXFE 1OP5H 3UTSA 3P3YA 4PJAE 4LEXH 3HPJB 1A7PL 1QHPA 1N7MH 4RFOL 3KJ6H 3DETC 2A0LD 1CFNB 3P11H 5A2LH 2H1PL 3ULVL 2R9HD 4A2MA 3MV7A 4XTRC 1J1OL 4NZTH 1ZS8B 3ROLB 4TOYH 3LCYA 4X7DC 5KSAC 4Q9QL 3SO3C 3O11B 5KVEH 2X4UB 4U1HA 4F9LA 5J12B 1NEZG 2XIDA 1QZ1A 3ULSB 1S5IL 5J9PB 2P5EB 3O9WA 5FYKD 3S96B 5IKCB 4LU5L 3S3PA 1FL3A 4EDXB 4OQTL 4P46D 4IIQA 1XH3A 1NGYB 4U6HA 4KFZC 4NQEB 1QLRA 5H35B 4F80A 3OJDB 1EDQA 2CDFB 2W38A 4YPJA 1KN4L 2FX9H 2HTKD 2YPVL 4LHUA 1J12A 5I73B 3D18B 3GJFA 4YDLB 4Z77B 3BZDA 4XXDA 4LPVA 3H0TB 2R8SL 5EOTA 3O6ML 3DI2B 1U3HD 3KLDA 3NZ8B 4L5FL 5GQBA 5F44A 4R2GB 5CKAA 3EBAA 5FF6A 1AD9A 2EH8H 1L7IL 2GQHA 1KXVC 3DOSA 4PJEB 4R6UA 4RMWA 4S1SL 1PDKA 2NZIA 3C6LB 4POZD 3STZA 5DLML 2J8UF 4ZUWB 5IEHA 5TE6H 1H9VA 4WI6A 1FL5B 5DUML 4L8BA 1CF8H 1DUZB 3BKCH 3U9UB 3I9GH 5HHVL 4PG9A 5JR1H 3HE7C 2J5LB 2FECL 3H3PL 4JFZH 4UV4L 3TA3A 5HYJA 4Y1AA 4J3XA 4XCCH 4Y89A 3OR7B 5E4EC 2MKLC 4KTEL 3QNYA 3DURA 1T89A 3QIBB 4GH7B 2VABA 1NCNA 2G9HB 3ARWA 3NIGF 3ILPA 1W0VA 4K23H 1IC1A 1GIGH 4P2OC 1OAXH 5FYKE 2G5BA 1INQB 3V4VH 3BDYH 5GGRB 2H2PC 4Y2OA 3MRNB 1MUJA 4NPYB 4HKBB 4EI6B 1JGVL 2VXUH 1LO4H 4LDEB 3TBYA 4N8VG 1KJVB 2VR5A 1FGVL 4XP6H 4E41A 2OR7A 5GZND 4I48B 2PYEB 4S1QH 1ZLUH 2BNQB 3LDBB 4H20L 2MSPA 3C60C 3K4DA 3OKKB 2AQ2A 2DICA 5F9OL 1L0XA 3RPKA 3HUJF 4XMPH 3L5HA 4M43L 3ETBF 1ES0A 1W72L 3STZB 3UBXI 1U8QB 1JNHB 4UTAL 4B41A 4LK4A 3VGAC 1DANT 4YGVA 2XN9A 5I71C 2IQ9H 3UTTD 3X12B 4XMKH 4LHUG 3EOYG 1NCCL 1Q72L 2UV3A 3O2VL 3Q5TA 3ARRA 1TJGH 3B2UC 1AGBA 4Q0XL 1UB6B 2ZUYA 1RURL 4U1GC 4C83A 5IB5B 3S4SB 3MLUL 5GRJL 1P1ZB 1NMBL 1UVQB 1EO8L 4NO0B 3EYFA 7FABH 5HYJB 5I1AB 2JCCF 3ARBC 1RJLA 3IFNL 3V6BR 5IGXL 4J4PA 4RSVA 2ESVA 3RHWK 3ES6B 4PTTA 4S1DC 1SBSH 5CSZB 3VXUB 1I3UA 4P2OA 4GKSA 2VDKL 4RAVA 5F3BB 4HXBH 5EC2B 3M07A 1B4JL 4ZAKD 4Z7WF 4FFWD 2ENYA 4RBPK 1B3JA 1NLBL 5JZ7C 3S88H 4MJ6A 3FCTB 4JKMA 4YHOH 5E00B 3C08H 5DD0H 1N0XH 3VFRA 1VKXA 5DJDB 4OCSL 4OF0A 3TNMB 3QUXD 5JW3L 4LARH 1QR1A 1F45A 2LVCA 2NTFA 4ZUTB 4ZOAA 4HIIB 4NGHH 1FBIL 3WEXA 4U33A 4O2CA 4PJDE 1NCWL 1UJ3C 4L8SA 1AP2B 3EJZC 3V5DA 3KPRB 1GGTA 2OP4L 1U8NB 1DBBL 3KPLA 1WBXB 2ADJB 2VLRB 5JPNA 4PLKC 3RQ3A 3MLZL 1RZ8B 3MNZB 3I50H 1T2QH 2D7PA 4DZBA 1PLGH 4LKCB 4UT7L 5T1KA 1JZ7A 1IC7L 4WFHE 4TUKH 2BSSB 2NY2C 3SKOB 5H37G 2D3VA 3QQ4B 1V7ML 2GW5A 1BREA 1R6VA 2CKBB 4KK9D 1B9ZA 3O2DL 4XVSL 1HZHL 2ADGB 1VSCA 2KQMA 3BDXA 5D2LA 4DW2L 3NA9L 2IALB 3WO3B 4MVBC 3BSZH 3QUMA 1MCOL 2OCFD 4HS6A 4M7LL 5KJRH 3D9AH 1ZHBA 1DR9A 1A3RH 3NH7H 5IVXB 4YBHA 3OKOA 1BFVL 3KLAA 2EDJA 5C0DB 4IRSA 5ESQA 2XI9A 4RCAA 3RRQA 3U4EB 4LPTA 4CN4A 3MFGB 5E00A 2EXYC 1EFXB 2WIMA 1S8DB 1G7JB 4YR6B 2JJTC 1HQRB 5DVOA 5D7LB 1MCCA 5TE7L 3WFDL 4GBXD 4Z8FH 3LMJH 3MCLL 1MFBL 1ACYH 1CR9L 1R3LA 3MRKB 2E27H 4QF1B 1F6LL 4BZ1L 2D7TH 2R1XA 3OGCA 5DXWA 4HKXB 1YN6B 3EO0B 5C71A 2AQ1A 5K9OB 3MOAH 4I5BB 3MNVA 1F4WL 3SGDI 5A43C 4PJXE 2D9QB 3BN3B 1RFDH 2I25N 5HI5C 3MJ9H 3FT3A 3VXPA 2RGSA 1Z0MA 3UPRB 4ZTOL 5JW4M 2APWA 4Z5RB 1XFPA 4TUKL 4AK1A 2EIZB 5HGAB