5D7KD

Structure of mr1-reactive mav36 tcr
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
199
structure length
197
Chain Sequence
EDKVVQSPLSLVVHEGDTVTLNCSYEVTNFRSLLWYKQEKKAPTFLFMLTSSGIEKKSGRLSSILDKKELSSILNITATQTGDSAIYLCAAYNTDKLIFGTGTRLQVFPNIQNPDPAVYQLRDSKSKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MAV36 TCR Alpha Chain
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 197
sequence length 199
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7kD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7kD02
1PX4A 1R5WA 1TJHL 4GRMA 4WFHD 3RU8H 2BNRD 4NO0A 3QRGH 4RAVB 3V0WL 1JTOA 3QXAA 1KGCE 1IRAY 5E8OA 4Z7OF 2NXYC 5T1MA 3HAEG 1N59B 1K3ZA 3MGTA 5AYUH 1LEKA 3F7YA 5IBUB 1XH3A 3LKRB 5HVFB 3E3QC 2IPTH 3VFVA 1L7TL 2HG5A 5E8DH 4PJAB 2F5BL 3F58L 4CVXA 3VXSA 1D5MA 3OG4B 2VXUL 3O6MH 4YDJB 1VGEL 5CJ8A 1J18A 3STLB 4IMKA 3MCKB 4OZHF 4LVOB 5A2KH 3GJFH 5D6DC 3VG9B 2XNAB 2OL3L 4DZ8A 3BZEB 1M71A 5JXEC 4CGTA 4R96A 1L7IL 5E6IA 3SDCB 2AXGA 4PJFF 3DXAD 2DQCL 1ZSDB 3FO1B 3KR3H 3T4AA 3DGGA 5GRXG 5C08B 4ZNEA 4ZPVB 4PJ5E 1KG0A 2VMFA 3WNNA 2DIAA 1ZANH 2J8OA 3IETB 5CEZL 3BKCH 3PV6A 1BFOB 3WUWG 2J5LC 1I1RA 5GGTH 2WUCH 5KTEL 4G6KH 1YMHA 4AMKH 5KVGL 1BQHG 2ARJB 5JW5B 4HCRA 2AGJH 1WITA 3VD3A 2AJVH 4KK8C 3CZFB 2D0GA 3BVNB 3GMQA 3TNNA 1IJ9A 1YEEL 1CFBA 3GM8A 4K7PL 4MZ2A 1RULH 4WHYG 4YAQB 5FF6B 3BH8A 1S9KC 3KVQA 5EZIH 4F7CB 4OI7A 3BZ4B 4K7PX 5T3XL 4NQSA 3HE6B 1DBKL 3MROB 4HKJA 4YXKH 5HDQL 5JOPE 2Z31A 3WFDH 2GTWA 4XCCL 4PGZA 5EU4A 4P2CG 5DHVA 4HUUB 4XVJH 1DE4B 5D4QA 3VH8B 1HN1A 5JW4R 1GJIA 3CCHA 4QXTA 1T89C 3WFHB 5K9KB 3SGJC 4EN3B 1MREL 1MFAH 4F8QA 2AJZA 1IM3B 5CJQL 2NYYD 5ILTH 5GGSA 1NAML 5M95B 2OJEA 3JVGA 1NH6A 1LK3L 1IZKA 4YHMH 1I3GH 4FRWA 5DMIH 5EFIA 2R8SL 4JB9H 4IIQA 1TCRA 3QEQA 3QDJE 4HWBL 5BS0D 2D7QA 1IM9A 4M4PA 2X4PB 4WFFD 3IRPX 1IL1A 3I50L 1D5BA 4AY0A 5HI4C 3AXLA 3QUZB 4FQCL 4OM1H 1NGZB 3HHRB 1EK3A 3U48A 4P2QB 2ADFL 4WWKB 1KJ2A 4X5LA 5A16A 4WJ5A 1YN7A 4O9HH 1MUJB 3MRJB 3C6SA 4L3ED 3O6FC 1DBBL 2BSSA 1PZ5A 4PG9B 3FB7A 2NPLX 1TVHA 3TN0B 5I8KH 3VFNB 4Z5RA 2BRRL 2CRZA 5IVXA 2DF3A 4PV8B 5BVJB 1MRFL 5IB5A 1FLTX 1WQVT 1OAUH 4QCIA 3SE3C 4EZMA 4OGXL 1ZOXA 4JHAL 4XHJC 2ZKHL 5TE4H 1NCNA 1V05A 4K9EC 4NO3A 2P8MB 4PRAB 1CT8A 4F33A 1GZPA 5I17B 1NL0L 3HNVH 3LRHA 3VXQB 4O5LH 1SYSA 5I1DB 1J0HA 1CCZA 1P2CB 1RZ7L 2WINB 3JSSA 5GS3A 5DSCB 2FBOJ 4OGZA 5FYKE 3LV3A 2XWTA 4FXLA 2OP4H 4GKOA 4F9PC 2YKLH 2K9UA 2ADJA 4PG2C 4JPVL 4IRJC 5C08E 1S7XB 1BF2A 5D2LA 2HVKA 1XZ0A 1GPOH 5DDHA 4D0DB 3EJYC 2XKNA 2ICEA 3ME0A 5E2TH 4BSWA 5I1JH 4OLZH 4XAKD 1QLFB 1UEYA 4I0PD 2VZVA 1EERB 4OUOA 2MQ3A 3CXHK 1UKSA 3JWDC 3MNZB 5F7EH 4WIQA 5KVFL 1ACZA 1CU4H 4HS8L 4JEGB 3QJHA 3ZKQD 1MIMH 2J6EL 1FL6A 4MD0A 2AJSH 1FVDB 3CSYA 5HGDA 2H2SD 4XNMA 3RX5A 1X4XA 1LO5A 1B0GB 3MLZH 5FGCE 3EOAB 5EZLB 3OSKA 1OSZA 3OPZH 2YZ1A 3CDFA 1BVKA 3MJ8A 4KVNL 4ORZC 3V5HB 5ACZA 2XV6B 3QXDB 3B9KC 4KRPC 4OCXH 1U8PA 3WXVH 1RVFL 1CQYA 1FZJB 2C1OA 5AZEH 3VWKD 4ZSOE 1WC7A 5FKPB 3FHQA 5I15H 2J2ZA 2OL3A 2FYYB 4X5XB 2FEEL 4NQUA 3GBML 3R8QA 1EEYB 2QQNH 4I13B 4R4FL 2KDGA 3SGKC 1FVEA 2XWBA 3OJDB 4XNUH 3UTTA 3EHBD 3LB6D 2MPAH 2AJUL 4JY6A 1H3VA 5E99L 5KG9A 5C0BD 1RJZB 4YHIB 3LIZL 4LLDA 5IKCA 5T5FH 5ANMA 1B0WA 2YK1H 3MODH 1SMAA 4FQXC 1F3JA 4TUOA 5CCKL 3BPOB 2K7PA 1KFAL 4KV5E 3MREA 3D18B 3IXAA 1T04A 3O4OB 3TT1H 3B2VL 2D2OA 4NQEB 5F1KC 4ELMB 3OR6A 3DBXA 2X70A 1HEZB 3GHBH 5GGRY 4BFEA 4UQ2A 4LCUB 2B4CC 3S34H 3INUH 2P48B 2GITA 2DKUA 4WGWB 3F6IA 4WDIB 5C3TA 2J8UA 3V4PL 5F3HB 1MCOH 1FN4A 1VFBA 1PKQB 4APQA 4K3JL 2HKHL 4WUUD 4CU7A 3OJVC 4C56A 1OB1B 1CG9B 3OXRB 4QXWA 2P8LB 5FA3A 1IFHL 3MRPB 1CBVH 3QCTH 2XXMB 4LSRH 4EUPA 3T08A 1TETH 4KJQC 3UO1H 4HFUL 4JZJA 5HDBF 5DK2A 2W38A 3UJIH 2I9LA 1JF6A 2WBJD 5MEPB 5B38G 1GGBL 4QYOB 1ZGLA 2VWEE 3DPBA 2DQEH 3PL6B 3V0VA 2IH3A 4QRRA 4HWBA 2ADIA 3DARA 2YD4A 3OAUH 4P5MB 3CLFL 3L5XL 5D7IB 4JO3H 5DEGA 5D2NA 1IC4H 5DVKA 1EHNA 1NQBA 5FFLA 4JJ5A 4X6BA 4Z6AT 4JY5L 1URLA 1X44A 3CX5K 5CJBA 1O7SA 5IVXF 4I3GA 5ETUB 3QUYB 4ZAKD 4HPYL 2BVOB 4Y8AA 2V17L 3WO3B 5D8JL 2NTFB 3PP4L 3TZVD 5IHUL 1A2YA 4JN2A 5L88H 3F7VB 4V2BA 3TFKC 4YDVB 3Q6GH 2BSTB 4PLJC 5E56A 1ZLUH 4IM8A 1CGVA 2NY2B 2HTKD 5DZLA 2CLRB 1ZHNA 4Y1AD 1P6FA 4XRCA 1GGIL 2FECI 3ULUF 5CSZB 2H26A 1DUYA 1T21B 4U1LA 5DVOA 3UJTL 2Y1VA 4E0RA 4RNRA 3TO4B 1VDGA 3FMGH 3SDAA 1WT5C 3WNKA 4FXGA 2A6IA 2OXHA 3WO4B 5D2LF 4BSVA 4NN7C 5BOPA 2D4DA 5LWYL 4X98A 3BQUD 1NLDL 5TH2B 3VWJB 1PEZA 4R7DB 2ESVA 3IT8D 3Q1SL 3HB3C 1LD9A 3QA3A 2IAMA 1XIWD 1M6OB 3CK0H 3SO3B 5IQ7H 1U0QA 4ELME 4EUPH 5IVZA 4H25B 1BM3H 5EU6A 2J6EA 3E2HC 3DVNB 2HFEB 1TTFA 3MLWH 4OLYL 1NBVL 1J0IA 1NDMA 3G5XB 3UAJD 2PETA 1FZMB 1KIPA 1DANT 5I74C 3AC0A 1JHLL 5HI3C 2FIKA 2QADB 1QFWH 5GGRB 2IJ0C 3HE7A 3ARDB 4U6XB 1DVFA 1CFSA 4FZEL 4X7SH 4FZ8L 2ITDB 5F9WC 1UADC 2DLTA 4R0LC 1F4YH 3CC5B 4LP5A 3U0TA 4OZ4A 4U1MB 6FABH 4JM4L 4K3HA 3OKKA 5ICZA 1DEEB 1EAJA 1BFVH 3OR7A 1UA6H 4M8VA 4KRNA 4WW2C 4JN1H 5IW6A 5J89A 3LHPL 2OR7A 1BBDL 3IJHB 4K23H 5JIHA 3D9AL 2AQ3A 4ZYKA 4J23A 1NUDA 3MA7B 1WK0A 4TNVK 4LCYB 3RUGA 1MCWW 5FIEA 1CWVA 3O3AA 3MCLH 2EH7H 1FIEA 2XPGA 3GHEL 2DM2A 4X9HA 4ZFOB 4P3DA 3O41B 4NRXA 1KJVA 3OJMB 4K3EL 5ICXB 3HPLA 3S97C 1RZKC 2G9HB 3P9WB 3TO2A 5CD3B 1M7IA 4NQCD 2J8UF 2QQQA 3RVWD 4NQVB 4QO1A 1RJLB 5IJKA 3QHFL 1V7NH 3C2SA 1OP5K 4QHMB 3BIKB 3HC3H 4R8WL 3MV7A 4X7EC 1E4XH 4MJID 3FO2B 3T8XB 1WBXB 1FZKB 5C2BH 5EN2B 2BY3A 1UXSA 1CFQB 1JF1A 1CLCA 2VR4A 3FAWA 1K2DA 1CGSL 3NAAL 3WSQH 4LVOC 4Q74A 3RVTD 3SJVA 3VG9C 3CDGA 1X4ZA 5EORH 2NY6B 3DVFA 1A1NB 1F45A 1NUGA 3HI5L 3WXWH 1KT2B 4KJPD 3ARFA 1P9MA 4NKDB 1L9MA 3Q6FA 5KVMC 1BQLL 5HSFA 3QDGE 2VIRA 4L5FL 1T4KB 5H37H 3U0PB 2VRAA 3N1QC 4I48B 5D7LA 5GJTL 5GIRB 3P40A 5IR1A 1MLBB 4H1LA 3OKDB 3QIWC 1U8MB 4GQPH 3LS5H 5SWSD 2PYFA 3RWJA 2OTWA 2Y6SD 4UIKH 3TVMD 1FC1A 1KYOJ 3L5JA 3PHSA 4MA3B 2IBBA 3LOWA 5HI5D 1B4JH 3RL2B 2XG5A 1YEDA 4JRYA 5HVHB 5L2JB 1U8NB 3SGDI 2Z91A 3BEWA 1HINL 3ZE1E 4UAOC 3D39B 3VRIB 4ZD3L 2DBJA 3ARZA 3FRPG 5JA8B 1BBJB 5EPMA 5F7MC 2AS5M 4XP4H 5BJTB 2R2EB 2QR0A 3HE6C 5GXBB 2X40A 4B0MM 2C3XA 4DFIA 4K2UL 5T33H 1TQBB 2BSRB 2HRPH 3GJFB 5DVNA 5DRXB 4H26A 3O8XA 3MLRL 5E8EA 2CMRH 3TBVB 4PTUB 1Z6JT 3G5ZB 4LPTA 4U1KB 3UTZB 4EN3C 4FQLL 4BFIA 1YPZE 2ICWB 1I4FB 4LKCB 5LQBH 3DVGB 1XGUA 3C6LB 3MRMA 2OJZL 2F58L 1FCGA 1EGJL 1S9XB 4BSJA 3U0WH 1FPTH 1JWUA 2X5PA 1G9MC 1LDPH 2WBKA 4D9QE 3FT4B 1N8ZA 2IBZX 2E9IA 1UT9A 3H6JA 3NIDE 3EO0B 3O9WA 1A9BA 1FCCA 2V2WB 3QUZC 3MUZ1 3ZE0F 3PWVB 2AKRB 3HAEB 1AGDB 1N7ML 1NSNH 1YQVL 5AUMB 4WWKC 1CXKA 3GB7A 3X3GL 1OQOA 1DLFH 4KDWA 2NY0B 3O3UN 4M62H 1LE9A 5C0FA 1TJGH 3MLXH 5KANG 4QNPF 5IVOA 1KIUA 3L3DA 3PGCA 5H2BB 4RA3A 1E27B 3AAZA 2DLHA 2AEWA 4Z8FH 3QQ4B 3QEGL 2D3VA 5F9JA 4XPFH 5ESAB 3G5YA 1NCCL 2D0HA 2R2HB 3HR5B 1RHHA 1M7XA 3P0YL 4XVTH 2AK4B 3DRTA 4FQHA 3KYKL 4KROB 3QPXL 4HQQL 3V2AR 5IROC 3P4NB 2BNRA 3QO0B 5SWZD 1J1XH 1YDPA 5ITFA 5BXFA 1L9NA 2NNAA 2VZUA 1QKZH 2NX5B 5JDSB 1SBSL 1FNEB 43C9B 5JORA 4P5TB 3IRZA 4IEFB 3F12A 5E8OB 5ALCH 3TJEL 2VTFA 4MA7H 2BRQA 4G80A 4CN6A 2QSTA 1UVQA 1ZLVH 25C8H 2VWEC 5DTFA 2JJUA 4ZQKB 4XGZB 1JV5A 5GGQH 2VLME 3PV7A 4XCEB 4GRLD 5C0IB 5ADOL 4KJYA 4M1DH 1R3LB 1TVBB 3RGVC 1DQTA 4FTVD 3TCLA 3DXAA 1JHKH 2PW1A 5L6YL 5EBMB 3J7HA 3TYGH 4QWWD 4PS4L 3OF6A 2Q6WA 1PY4A 5ISZD 2VISB 3V6ZB 1RAMA 5MHSE 1IEBA 4L4VB 3VD7A 1J87A 1C16B 2PF6A 3D39E 4M1CC 4LBEA 5C0CA 2ATPA 2CIKB 2EDYA 3P11L 5C0DA 1LNUB 3C60B 2ZSVA 2CIIA 3PJSA 5D1ZB 3S37L 5DRNA 4P5KB 1CDYA 3T1WA 4C55A 3MLVH 2WLYA 2Y7QB 3VXRA 3O2VH 4J3OC 3GMQB 3MLPA 3U4BH 5C0GB 2F15A 1Q94A 4LLVA 4KAQL 4XWOC 2AERT 2YXFA 3JWNC 4LFHD 1JWMB 3EW3B 4OLUL 3O81A 4YHZH 1HI6B 3DVIA 1K8DB 5J11B 4Y5YA 3MACL 4LEOA 4PJBB 2IFFH 5FO7A 1CLZH 4FFWC 3W5MA 4NZDA 4NRZB 3EJZD 1T6WA 4PLOB 4E5XA 4NZUH 3BPOC 3NZHH 3OQ3B 4LSPH 3O4OC 1TXKA 3G08A 1X6LA 1ULVA 2ILLA 2PO6B 5FOBB 5SX4I 4OZFH 3ZKSD 5K9QG 1XF3A 2AXJA 5DQ9A 4BQ9A 1SJEB 2KL6A 5KSBA 1UQSB 3UTSD 1UWEL 1I9IH 4FQPA 1FYTB 4PBXA 4YLQT 4M00A 3SE9H 2G2RA 5DURD 1NFDE 3I6KB 3FO0H 3U9UA 4Y7MA 2QHRH 2ICES 1KLUB 1EO7A 4ZUUB 5JXAL 4K94C 4ZXBD 3WFBL 1AC0A 4K3DH 4Y4KD 4RBPH 3MRCB 3GSXB 2UYLA 4MD5B 4U33A 2QBWA 1CXEA 5F89A 2ORBL 4BZ2H 3FQWA 4X7TB 4R4BB 3K3QA 1FH5L 4P49A 1I7ZA 2X4QB 4GW1A 3W39B 5IVXB 1QR4A 2FGZA 1BD2A 4UT7H 4H5SB 2CUMA 1EGJA 3RTQA 5FB8A 2LABA 2PR4L 2ZG1A 3BI9X 1ITBB 4X80H 4QT5B 4PPTA 3SDXB 1CL7L 2DYPA 3QO1A 4LVHC 4Z7NE 1S8DA 5HYSG 3MLYH 4GKSA 3QI9C 1WEJH 3QH3A 2P24B 2B7DT 1YZZA 5DT1L 4NP4L 1KXVC 4UILL 4NFDA 1YYMH 4S1QL 2EXWD 4UT9L 4L4VE 4S1SL 5J9PB 4ONFL 3V5DA 1X5AA 3QUYC 1EBPA 4DTGL 2HTLC 5JQHC 3EGSB 2X4OB 4YZFE 1KEML 4U6YA 2DD8H 3L9RA 2EZ0D 1DL7L 3O4LA 1IGFL 3KYNB 1MCWM 4I18A 4I0PA 3BWAA 2GSIB 2MSPA 4FNLH 4BSWB 1DQJA 2NY2C 4EIZC 4PJ7A 1IGIL 3FAXA 4U1SA 5FV2A 1MOEA 2Q8AL 5ADPH 5EUOA 4M7LT 1EJOL 3S3PA 3P4OA 3TO4C 3I84A 1QVOB 1ES0A 1CDGA 3WO4C 3CFBA 1HDMA 2IPUK 1EFXA 4KGLA 3OGOE 5JO5A 2NY1D 4AJ0A 3VMPA 1TNMA 1RUAL 4PJBE 2VLJD 4UNTA 4LU5L 4KMTL 2QQKL 2WIIB 4F58L 1TJIH 5C0JA 3PDOA 3PNWB 1HHKB 2Z93B 4NQXB 1VFAA 3SO3C 3VW3H 5DJ0B 3KPPA 3QFJD 4U1JA 1GL4B 3SQOH 4OUUB 2EDKA 2FZ3A 4PJGB 4ENED 2WQRA 4LLAA 4L4TD 5C0BA 4FQJL 2HP4A 1FYTE 3BN9D 2JB6B 4W81A 4G9FD 3H0TA 3CH1B 4AZ8A 1T1ZA 4CL7A 5JUEH 5JPNB 5IFAL 1G7LA 1X3DA 4NKIL 4TOYH 3V6OE 4DVRL 2VR5A 4GO6B 2QADC 1TZHA 1IGTA 4KQ4L 4RZCA 5EOQL 2IG2L 3QEUA 2JCCB 3RNQB 5B38B 5J6HA 4NJAL 4Y19B 1YECL 1FZOA 4IOFC 3IKCA 2A77L 4PREA 5BVPL 4YNYA 4OCMC 3VGHA 5I1LB 3QPQD 5JQ6L 1CF8L 1G7HB 4M9OA 1Y6NR 4O58H 4O51A 3MV9D 4QHLA 4RWHA 4WUUA 4QOKE 2X89A 3MGOA 1OAXL 3SDXE 2XZQH 1G1CA 1NC2D 1Q9WB 4XNYL 4Z7UB 5I8OL 2AJ3A 3NPZB 4AIZB 1N6QH 4MNGB 3HZVB 2NW3B 4NSKA 3K7UA 4G43B 4YEEA 4CN4A 2P5WD 5I18L 1MVUB 5B8CB 3LEVH 4OM0L 2IALA 4P4RA 4L8DB 3G6AA 5GISH 1EXUB 4G6FD 5DK2B 1IQDB 4HWNA 3CFDA 5MEND 2UY6A 2A6DB 1S7RA 5KSAD 4QRTB 3MOQA 3ILPA 2MNUA 3D2UB 4YBQC 2EIDA 1BP3B 2BCKA 1ZA3A 4DKEL 2BNQA 3FQUA 1QR1B 4MNQD 5BMFL 5D71L 5C6TH 1LO0H 1YUHB 3RWIB 4KY1L 4ZAKA 2UWEE 3K8MA 1JZ7A 4PJEE 5C09B 4QRQA 5DFTA 5JXED 2DICA 1ADQL 4M43L 2NY6C 1NJ9A 2VE6B 2DB8A 2BNUB 1QBAA 5D7JD 4QTIL 1MHHB 4ZFFB 2I24N 3A6BL 5GS0H 3QUXA 3EOYG 1CR9H 3GSRA 4Y1AA 5B21A 1KB5H 4H20L 3LQMA 1T1YB 4EI5D 1A3RH 3MJ6A 1F00I 4G7VH 3VFMA 1KSRA 1XGPB 4MDJA 1IC5H 5SWQB 5FOJA 5C1MB 4IRZH 4PJGE 1HYSD 4KI5D 1IAIM 4NPYA 2R0LH 3QUKA 3EYQD 1FFPA 3MBXL 1C5CL 4U1HA 4X8JB 2EDLA 4RGNB 3U7YL 3VGEA 1KEGL 3OL2A 5C9JA 4KKLC 1AKJA 4QXGL 5TFSL 4OT1L 5GZND 1OAKH 5ID1A 1WFNA 1AIFA 5ID0A 4OFIA 2FJGB 4PBWD 1HXYB 2F54B 3MQIA 1OPGH 3FFDB 4QRPB 1FVCB 4YQXH 1GIGL 4LCIL 4F7TA 4ZPTB 1AGCA 3QAZB 5HPMB 1AI1L 4R4NC 2JCCE 3C08H 1J05A 5E4EB 3QCVL 1HHGA 5E8NA 5EUOF 2ITCA 4N5UA 2QKIA 4WCYH 5ABDE 4MAYB 3WFZA 1TQBC 5ITBL 1GGCL 3S36H 5KN5A 3RIAK 2IAND 4Y16B 2Z92B 4MGXA 4NUJB 3KWWA 4OJFL 3SKNB 1XCTB 3LN9A 3HUJA 4LF3A 4POUB 1BGXH 2DBLL 3C6LC 4XB7A 4Z7UE 5JLZB 4BKLA 2P46B 1KPRB 2DQIL 4MNGE 4HF5H 4LASL 3WBDA 3QXVA 1P7QB 2FO1A 5HI4D 4PB9H 4L8BA 4GAGH 1JF5A 3FQNA 2YPLB 2EKSA 5FK9B 1SYVB 4HS6A 4HEME 2W65A 3SCMA 4BH8A 4XT1C 2XIDA 4XP5L 4R2GC 3MRLA 5D9SA 4UDUB 5EOTA 2NY0C 4H8WC 4L1HA 4Y4FA 4JRXD 3V52H 1OWRM 4OLXL 3WHXB 1Y18B 4G8GD 3QUMH 3GI9L 3OR7B 1YEJH 1U91B 3QEHB 4L9LA 3NFPA 4JKWA 4Q9QL 4X9BA 1RU9L 5EH1A 2GHWB 2HFFB 4K7FA 4LLMA 2R0ZL 4ODXA 4JKPL 1FQ9C 2P5EA 1NBYA 4XP1H 4HH9A 4KJWD 2OX5A 1VB9A 2GSGB 1W0VA 4G8IB 4Z78A 1NC4B 5GHWL 1E4JA 4G7YH 3SDYH 4JFEA 4JKLA 3RAJH 3BGMA 5FUCE 3WJLA 1NBQA 4F9LA 5C09E 2ZP0T 3GMMB 4NQCA 3JV4A 3WLWD 2GCYB 5E5RB 1CGXA 1AGEA 1JYWA 1N64H 1A7PH 2G5BB 1MF2H 4NO2A 5E9DD 5JW4Q 3L3IB 4RAUA 1HXMA 2D03L 3KGRA 4MJIA 4UU9A 1F4WH 5CIPH 4GT7A 3WKNA 1DJSA 2DN7A 1E4WL 3TWCH 2IF7A 1DANU 3HRZA 2B8OT 3FN3A 3VXMD 3TA3B 1AR1D 1JUFA 1IGJB 4P9HL 4HXBH 4ZUWA 2XWJA 1PDKA 1ZT4A 2E6QA 3M1BA 1ZLWK 5I1EH 4GG8A 5D1QC 2GT9B 5E08H 3B3IB 3I9GH 3MV8D 4M48H 5BV7L 4KK5C 3IU4H 2VLKB 4NC1E 5DD1H 2X09A 3MMEB 1IT9H 4ZFZB 1HHJB 3AU1A 1U8HA 1WZLA 2GKIA 2NR6D 2F54E 2W60B 2DWDA 1P69B 1ZEAH 3GK8H 5IBLC 1T66C 2HLAA 3MC0A 2R2BB 1DN2A 1EEUA 5FYJE 4KRPD 3IU3B 1A4KB 3TYFA 2CPCA 4G3YH 4J3WA 4TSAL 2V5RA 3N9GH 3TVMA 1WWCA 4LSQH 2OLDA 2ADGB 1I7UA 4J3SA 5DK0A 3VFTB 5FECA 3DMMB 3W2DL 4KTYA 5E00A 1SJHA 2J12B 4AEIH 3BP5A 2V7HB 1U8LA 4XTRC 1M7DA 3ARGB 3C09B 3QFDA 4DGIL 1KNOB 3LQZA 5CZVL 3FFCA 3PWPD 3TH2T 4P2YA 4FQIL 4QKXB 2IADB 3ALXA 4JO1H 4LK4A 5A43C 3O45A 5F6HI 2FSEB 2XQBH 3JV0A 5T1KA 2GTZA 1ZWIA 3CFEB 5J11C 1X5JA 3IFLL 1F4HA 2A9NH 5LVEA 1MFCH 3GMLA 4B5EA 3GSVB 4XWGH 1U6AL 3AY4A 5IEKA 4LCCB 4OD1L 1W8NA 2LU3A 3VCLA 1EHLL 2CR6A 4ERSL 5IV2A 1H15A 4TULH 1X4YA 4O02L 1OP3K 1BLNA 4D9RD 3C2AL 4DW2H 1IEAB 1Z5LB 1RZIA 1YEIL 2VERN 4GAFB 5HYJB 2D31B 4N0YH 3HG1E 1OM3H 4FS0A 1G6VK 1CYGA 4PUBH 3WEXA 4KUCD 1H5BA 3MV01 3QWOB 2YD6A 5IMMA 1N4XH 3MYJA 2A6JB 3T77A 3ULVH 4Q9RL 4D9LL 2LTQB 1PSKL 1FNSH 2OR8A 3HUJF 2P42B 2C4XA 3H7BB 5AAWA 2FJHB 1W0WA 2DQJL 4I4WA 1EAPA 2H9GB 5F7DB 3O3DB 3L7EA 5T1DH 2EDJA 4TRPH 5EZOL 3UC0H 1MJ7L 8FABA 2SEBB 4B50A 5SWZA 5I8CB 4QRSA 4OB5L 1TVDA 1IBGL 4P4KD 3WS3A 1B3JA 2VLKE 3BEVB 1G9EA 2JJTA 1U8OA 4OZFB 3MOAL 2JF1A 5DYOA 2DLFL 2RHEA 3ZTJH 4HIXL 5J0BA 1FAIL 1MFEL 3GBLA 2VABA 1G6RL 4NJ9L 4CRPA 5DD6B 5GRZA 4P2RD 5KOMC 3WLBB 4RMTA 2RFXB 2B0SH 4J6RL 1LK2B 1FIGH 5C71A 1A6AA 4PFEA 3D6GA 3SY0B 4HJJH 4HG4J 1EEZB 4OAWA 1D6VH 1JGUH 4NZTH 5E6YA 2P7TA 3HC4L 4M7JL 2CJUL 1WIOA 1EBAA 4HBQA 2VZSA 1R5IA 3LEYH 5ISZA 4NNXB 4PGCA 5EU3A 5EG6C 3U7WH 5DJCB 1GVIA 1QNZL 4UT6L 5FHBL 1DSFL 3VG0L 1GCFA 1IGML 2APBA 1SEQH 5F6HJ 4PRIB 4J8RA 3VGFA 4O2EB 3HNTH 5EO0A 2ZWLT 4I3SL 5HJ3A 3S96B 1KLGA 1AD9A 1R3KA 3HRPA 1FNGB 1R3IH 4IRSA 5D1XB 3VE0B 1MCNA 5GGVH 4HZLA 3MJ7B 4M6OL 3REVA 5JMRA 3HB3D 1CDJA 3BD3A 2YEZB 2YPVL 2H3NB 5LGJA 1UM4L 1EIBA 1WZKA 2VAAA 4X6CA 5KSVA 2P49B 3IDJA 1KIRA 1UJ3A 2GK0B 3FQTB 4NC2B 1ZHLB 3ZL4L 1W2KT 5IESL 3SPVB 2AABH 1P4LA 1YN6A 1JTTA 3TCXA 32C2B 1TJHH 4RDQG 3B4NA 3QHZL 3H9SB 1CE1H 3RVVD 2R1YB 3MXWH 2BJMH 3O3BB 3OKOB 3UBXB 1AQKL 1UZ6E 3GSNL 4LNRA 4WO4B 1ZVHA 1QZ1A 4CNIB 4Z7VA 1PEWA 3ARYA 3BW9B 4PB0L 2F5BH 4P59L 4P46D 3L1OH 3TBTB 4ODBD 1KTLA 1SM3H 4KHTL 3GSQB 2FBJH 1UCBL 4OV5A 3VFOB 4WU7B 2HKFH 4UBDD 4NN5B 4WI5A 2WSKA 5I71B 1G7MA 43CAA 3S35L 4FFYL 3VFWB 3QDMB 3KPRA 5HHMD 4Y4KA 1KB9K 1AXSA 1MCSA 3UZQA 5ERWB 4ESKA 5JHDD 3QNZB 3SGDH 2L4OA 3HC0A 4L8SB 1DBAH 4QEGA 1KN4H 2Y9RT 3P77A 3CVHL 3MNVA 4R7NA 1QA9B 3S35X 4F8TA 1ROWA 1S5IH 5J8OA 1WBYB 3GIVB 5DWUL 4PJIA 5DD0L 4KMQA 4RCAA 4JDZB 4MQTB 3EDKA 5CEZH 1I7ZB 1KTKE 4JPKH 4KXZH 4MXVF 2G75A 4OZIE 5KTEH 1MJJA 5I66B 4KK6C 5DHYB 4QGTA 2PN5A 5DQDL 3RY6C 1KULA 3Q5YA 1QHOA 1A1MB 3CUPB 1YNLL 1NCDH 5L2KD 1E4KA 1CXHA 1VACA 3IF1A 5TDNA 1IC7L 2BOCA 1ZTXH 3MFFA 3VJ6B 4QHNA 4R3SA 1JPFB 3T3PE 5FUCC 3MUGA 3TBWA 1F2XK 1KJ3L 4XC1L 5FO9A 5HDQH 2PW2A 2NXZD 4JQVC 3SDCD 3NH7H 3V5DB 3DUUA 4XCCH 1CZ8L 2VQTA 3GJEA 1OD7A 4O4YH 1D7FA 1C8PA 3OKMA 2IMNA 1KC5H 3QIBD 4CUCA 5C08D 4LLQA 4MQSB 2QLVB 2OQJB 3WKML 4MX7B 4RFOH 1UJTA 4MVBD 1JGVH 1NGQH 5DK3A 2ZSWA 3ARXA 3I50H 1UB5A 3BH9A 3BHBB 4JQXA 4FQCH 3WIIH 4E41E 1XF5B 1PAMA 4HULB 3H9SE 4RGNC 2X05A 1HZHL 1T1WA 5CP7A 4Z76B 1PVHA 4XC3H 4NC1C 3JUZA 3QIUA 1GGUA 3L6FA 2FJFA 3IDMB 4O2CA 3VGBA 2ZCKL 1JGDA 1I9JL 1PG7H 5TF1L 2O5YL 4Q0XH 2ZPKL 3CMOL 3DWTA 1NCAL 3QAZC 3DV4A 5KAQF 2F8XC 1T5WB 5FYLH 3SQBA 1U2HA 2XTJE 5DJ2B 3KPPB 1T20A 2HJLB 2W9LA 5I76A 4MAYC 4D8PA 5GZOD 2R1WA 2V2TA 1HKLH 1KELL 3LH2L 3MRIA 1YMME 3MJ9L 1CFVL 1IAII 1JPTL 3GMPA 2DMBA 3O11B 5FO8B 2XQYG 4MA1B 5MEOA 5DRWA 4EN3D 4ZO8A 1CXIA 4Y16C 1C5BH 1S7WB 2PCPA 1INEL 3I6GB 4LCWE 4RA0C 4XCFL 5DA0B 5HY9B 1K5NB 3E6FB 5CEXA 5JR1L 2MWCA 2HJFB 4PIRF 3SOBH 4HGMA 1KB5B 5DC0A 4OQTL 4XMPL 3BPNC 1ZVYA 4JPVH 2Z4QA 5TDPA 5JOFA 1DDHA 5DJ8A 4ISVA 4ZO6A 4Z7WE 2FLRT 4LOUD 2CRMA 2YBRB 4X4MA 1YEFH 4P2QD 3OKEB 1OARH 2E27L 5EU5A 3THMH 1YY9C 1XEDA 4M5ZL 2ZUWA 5HHPB 1AO7A 3TN0D 4N90D 4G8EA 2DIJA 5KVFH 5F6IC 1HOCA 5MP6L 5K59F 2FR4B 1ZA6A 1OTTC 2Q7YB 4YHNB 4EDXB 1U8QB 4U6VH 3VI4F 2XFXB 1HQRA 2P5WA 4UINL 1U3HD 4MA8L 2OCFD 1WZ1L 1MH5A 2GY5A 3JWDL 4N8VG 4Z7VF 4U05A 3GSNA 3OGCB 3PP3H 1JHTB 3DV6B 3L95B 3RVXD 1F2QA 1XMWA 2XN9B 3BJLA 3LDBC 3BKYL 5INCB 2ZOKA 3GSWB 1FRGH 1YY8A 4GJTB 4KDTC 5L9DL 3BKML 2CDFB 4PY8I 1MI5D 2EDFA 1VESA 5MENA 1FFOB 3G6DL 2YD5A 4YHOL 1UH3A 1LEIA 4XCNB 3DLQR 5IHLB 3T0BA 3L3JA 4WFGD 4LPCA 1QSZA 5C0AB 4G8FB 5I2IA 4JZNA 4WVRA 1E6JL 2AEQL 4XMLL 3OKNB 4N0FB 1QQDA 4MNQA 3MJGX 1JZ5A 5D6DA 4XNQB 3TA3C 3CVHA 2I25N 2ZG3A 4PJIF 5JXEA 5GGUA 1VKXA 3G04A 3EYFA 2X4UB 1F42A 4MJ5A 2WP3O 4OZGE 4XBGB 3FT3A 1I1AB 3OHXA 5D7JA 3BRGC 2P44B 4PJ9B 1J88A 4BZ1L 4UV4H 4MQXC 2JIXA 3QUMB 5DMKA 3ZKMD 5DLML 4M1CD 4J7RA 4FP8H 1X5ZA 2GQHA 3BOVA 3U1SL 1XGRA 1XT5A 1C08A 1W8OA 3VFMB 3V4PH 3RWGA 2Z0BA 3DMMC 4HLZH 1K6QH 2HFGL 3EYVB 5GGSY 3C09C 2B4CL 4I2XB 1MCLA 1FO0L 4LIQL 3RZCC 3KS0J 1FFPB 1VERA 3LPFA 3T04D 3X3FH 1HH9B 5ENWA 4LSTL 1X6NA 3A6CH 2X4TA 4U1NA 3HZYB 1G1YA 3E6HA 5CIPB 2UZIL 2XA8H 4PYHA 1IAKB 4F7TB 2NY5C 1CLOL 1C12A 1OP9A 3FOLA 3KPOA 2Z35A 3DECA 3RWHB 2OSLB 2G5RA 5HGHA 3RY4A 4DWHA 3ARBB 4HXAL 4NQED 3SGJA 4HFWA 1MHCA 5D5MB 4LCCC 3VXNB 5EWIH 1LO2H 5ALBL 3PQYA 3K8KA 1NLBH 2BVQA 2QSVA 4LPWA 4K8RC 2VDPH 4JY5H 1Y6MR 4FN0A 2I5YH 5DF0A 3ESUF 1BZ9B 1JL8A 2L0DA 1OT1A 1QSVA 3VA6A 5J1TC 3W9EA 4HPYH 4PY8J 3HNSL 3O6FA 3CIQA 5JNYB 1TDQA 2M8XA 2VSDA 3MRKB 3FT2B 3LAFA 4DVBB 3CPLA 4CKVX 4G8GA 2J88L 1BAFH 2LTQC 5B39A 5E2JA 5F7HA 1SQ2N 5C0AE 4HKXB 3LMJH 2H2PC 4YWGH 3SE3A 1FBIH 1MPAL 4ODUA 4U1GB 5GS1A 5DI8B 3RWDB 4F7PB 1XCQB 1H3XA 2Q76B 1C5DB 4OBSA 3PL6D 2FX9L 3NABL 4V1DB 4OQTA 1JGEB 1OTUC 1FL5A 2EC9T 4HS3A 2EYRB 5EC2B 5IB3B 1RZ8A 2WWMC 1NLDH 4XCYA 3FQXB 3DYPA 2YN3A 5JOEA 4PRBA 3GDBA 4F9PA 4XXCC 4PG2A 4IRJA 3NFNB 4WY7H 2AQ2A 1Z2KA 3QUYD 4MNHA 2VQ1A 1PGRB 15C8L 3ARWA 4N5ED 3RWFA 2HTLD 2XQYK 1NEZB 4N9GB 3IFOB 3JWOH 4OKVA 4IS6A 5EIIA 2YXMA 1KCSH 4YDLB 2GAZA 3I6LE 1Q9KA 4OLYH 2VN4A 4YX2L 1QSEE 4MWFB 1ED3A 2C1PB 2NY2D 5C07A 5TQ0H 4LRIC 4UQ3B 1AJ7H 2AEIT 2P1YA 2IGFL 3MV8A 5DUML 3O6LH 3NA9L 2OK0L 1OTSD 1Q9OA 3ARED 3BO8A 3PHQB 3UYRH 1GC1H 3TO4D 3HS0B 1KPVA 1IGCH 1U8IB 4JFFA 3B9KA 3H9HB 1VFMA 1V8HA 4OLEA 3LKOA 3KNBB 4OGAD 2EYTA 3T0EB 2X4RB 3VWJD 2CUHA 3FJTA 5D1XC 5F1IA 3GMRB 4HGWA 4TUKL 1P1ZB 1OGTA 1JRHI 1RK1A 2NZIA 2VITB 3JTTB 3SGKA 5D5ME 2JJSC 1JCKA 4H0IA 4JFDD 4RFNB 4K7PY 2UUDH 1FDLH 2HJKA 2QQLL 4KTEL 4QXUH 4JR9L 1B0RA 5MERA 1QBBA 1PQZB 2PXYB 3AS0A 3GHEH 4UOJA 3PG2A 4I77L 3SE8L 3IXTA 3QG6A 1VHPA 4Z7QF 1BIIB 3D3VB 4FQXA 2VL4A 4X6DB 4YBHA 3RKDC 1VEMA 4K9EH 1JJUA 4JG0L 5HHOD 2VAJA 3W5NA 4NN6C 2EXYC 3KPLA 1DQDH 2XZCH 1Q8MA 2ZUVA 3FZUC 3O6KH 4WO4C 3STZA 3ARDD 1HNFA 1PYWB 1RZKL 1VFUA 1K4CB 5E1AB 1RMFL 2XTJC 5DUBB 5CBAA 5D7KD 5D7SL 5EC1B 4G6AD 5TPWH 3BRFA 2CD0A 4MLIA 3GRWL 4GAJH 1ZT1A 3MRDA 4XNZB 4XBPA 4NN5C 4WU5A 4V1DE 3T0DA 5I71C 4EVNA 2M2DA 4L4JA 1QRNA 1KCLA 5L8LB 2ICWI 5EZJA 4TTDD 4Z0XA 4NRYA 4EBQH 5DR5L 1KENL 2HWZL 1ND0A 1FNHA 1RIUH 1YJDL 1A9EA 2BHUA 3BPCB 1MLCA 1I1FB 2FX7L 1OGAD 4X7FC 2BVEA 4N9OB 1EAPB 4WEBH 1Q72L 1A7RH 1KCUL 4ETQA 2M26A 2LAGB 5IM7A 4X4XB 3DURB 3KXFB 3LPGA 3IDXL 4LRNH 1J8HD 3O0RL 2DM3A 2FD6L 4YBQD 1FFQA 3WE6A 1C1EL 1ZLVK 4Y4HB 1JZ3A 4DGYL 3ULVE 3I2CL 5LCVH 2VH5H 3VRJB 1KXTB 1OSPL 2VLRA 4LSUH 2A38A 1RUPL 1LQSR 4PRPB 2YRZA 3LVEA 5GRJL 3CD4A 4FQQA 5C86A 4P2RA 2UZXB 3VXOA 3PXJA 2PTTB 3U2SA 3WL9B 2FX8H 5IMOA 2PUQT 2J7LA 4ZMAT 5K9JL 2R0KH 2BMKB 3N1GC 4LPXA 3MSPA 2NLJB 4Z18A 1PD6A 4FQLH 1JWSB 2GJ6D 1P5UA 3ZE2E 4BFBD 1F58L 1A6WH 1WT5A 3KPSB 1J1OH 1QSFD 4WHTA 5IHZB 4X0KA 1V3MA 5F9DC 2E7BA 4Q97A 3NIGF 1TLKA 4J3UA 3D3VE 1N7MH 2W0FA 3EFFA 3CXHJ 4KKLD 2VDQH 3X3GH 3OWEA 2KUTA 1CICC 4MD4B 2WUBH 2AXFB 4PJ5A 2HH0L 1I8MA 4G6JH 4GG6B 4KKBD 4IDJL 3G9AB 2APTA 1YQ2A 3C8KA 1L0YA 3MBEB 1FG2A 5IJVB 1T7YA 4U4BA 3WFCH 3EOTH 3V4UL 4XI5D 1LO4L 3UTPD 1PFCA 4EOWL 3CSGA 4KKAD 1AC6A 5EIQA 3BPLB 2IQ9H 1MFNA 3P0YH 3QG7H 1N5AB 3D85D 1RZJL 3BUYA 4MA1C 5GPRA 4ZTOL 3MLUL 2CO7B 1NGXA 3LKQB 2ICWJ 1SBSH 3C6LD 5IB1A 1P5VA 3ZDXE 3KPNA 4PR5B 4D0CB 5B4MC 4MSWA 3VI3F 1X5IA 3K74B 1X5XA 4TVPH 3ARVA 1FL3B 3WHE1 1NAMB 3VFPB 4S1DD 4UTAH 4LNRB 4BQ6A 1G7QB 2PYEB 1FORL 1O7VA 4F7MB 2WMPA 3I3DA 1ZLSH 5IIEB 1KTDA 4WW2A 2CH8A 5LBSL 3C5SA 1A5FL 3KXFE 4P23B 3X11A 4U6HB 1MFBH 1HHHA 3NCCB 5IW3A 3BUTA 3MRBA 2MKLC 2W9DH 4EXPX 4JAMB 1FG9C 4OD2A 2DQTH 4NQDB 1J5OL 2AK4D 2J4WH 1RUKH 4LLWB 4KROD 4PRPE 3LQAC 4ZFGL 3P3YA 4CU6A 2FHBA 2NX5D 3RL1B 5TQ2L 1N59A 3S37H 4NO0D 4P5TD 4JKMA 4ZS6C 3GRWA 5E1HB 4ZOEA 2VXQH 1D9KB 3DUSB 3LKRA 3NFSH 1M4KA 1RZFL 4HMCA 4M5YL 4OFYD 1AY1L 2JB5H 4KUCF 1T0NB 4P2OC 5LG1A 4NBZB 3BZFB 4PJAA 3WIHL 1QLRB 5J3HC 1MWAH 2NCMA 1IAIL 4NZRL 2I26N 2GYSA 4YDJA 2NY4B 2V2XB 4JFPB 3STLA 1U3YA 3MCKA 1T2QL 3VXSD 3S3JA 4HT1L 3KPSE 2XNAA 3MUY1 3L3OB 5C0NC 3BZEA 2YC1B 1PJ9A 1LO3H 3SDCA 4FMKA 5CEZE 2C3VB 4KPHL 1I1AC 1ZSDA 2UVEA 1MCEA 1S78D 3FO1A 4PJ9C 4BQ8A 1XR8B 4KKNA 2RGSA 1TENA 2OYPA 5C08A 3OAZH 4ZPVA 2GUOB 4GG6E 3TJHC 2WP3T 3CX5J 1A6TB 1IKFH 3IETA 4OCSL 3MNWB 3C60D 1UWEH 1T80A 2Y06H 3ZDXF 2MTPA 4HUWB 4JFHD 1TNNA 5D1ZD 4LSSH 3BDYL 1YYLL 2ARJA 1X9QA 1N6UA 5JW5A 5GSVB 4XTRD 5T3XE 5I73B 3ISWA 3CZFA 2EDWA 1BWWA 4X8XA 3BVNA 2DLGA 4PJCB 1BHGA 2QL1A 2OR9L 2E8ZA 2NY7H 4YAQA 1HSAB 2DMCA 5FF6A 5HD8D 3QULB 1DBJL 4F7CA 3M17B 3ILQC 3D0VB 3BZ4A 1BEYH 3HE6A 3H3BC 3MROA 4FFZL 1NCWL 4ALAL 1BZQK 2X1QA 2L7UA 2PYEE 4HUUA 1DE4A 4HV8B 1U8JB 1XGYL 1A6ZB 3VH8A 1H3TA 4YHLL 1WCBB 1A3LH 1UYWL 3WFHA 1WGOA 3ARBC 5BRZB 2CSPA 5K9KA 2PO6D 4EN3A 4PD4K 1CL7H 3FN0L 1IM3A 3TPUB 5IQ9B 5TE6L 3ECBB 3EZ8A 4N8VB 1WWBX 4H88H 1A7NH 4DUWA 4NP4H 2EICA 2MMXA 4JFOB 2GJZB 2G60H 3QEQD 4S1SH 4NQDE 3QUZA 1UXWB 1NGZA 3H42L 2Z4QB 4PJHB 4P2QA 4WWKA 1JNLL 1MUJA 3MRJA 1AFVH 1JPST 1Q0YH 4PG9A 2X41A 2K1MA 2HLFD 1XGTB 3A0OA 3TN0A 3N1PC 3VFNA 4YK4B 3PIQB 5FYKH 4YDKH 4PV8A 1IGIH 4OF3A 5BVJA 4HAFA 4L3CB 4IMKC 5HGAB 4XPBH 2A74B 4U1GC 5E4IA 4XPGH 5DD3L 3IDNB 7FABL 3SKOB 4DN3H 2P8MA 3MRRB 1JNNH 4PRAA 5E6IC 5IROA 2YD3A 4JO2H 3ABZA 5I17A 4UOW0 4LAJH 3VXQA 2I9TB 2YWYA 1RUAH 5I1DA 2VC2L 1JNJA 1P2CA 2WINA 5DSCA 4WW2F 3U9PL 3ULUD 2EIZB 4LEXH 4AH2B 4OSUL 1CXFA 1BECA 3L7FB 5L8JB 1A6UL 4ELKB 1S7XA 4RRPA 4MCYB 3CAFA 3P0VH 3EYUL 4OIIH 1I8LC 3PGFL 4D0DA 4YXHH 5I19L 3ZYIA 3BIAX 1A14H 1CE6B 4U1IB 3CDCA 3WD5H 4FXKB 4YDLC 3N1FC 1QLFA 3O2DH 4JVUA 4X9IA 1OAZL 2BXZA 3AB0C 5CD5D 3MNZA 4ODSL 4U7SA 2YA0A 1OCWL 1SY6A 3QQ3B 4PJCE 3V6FB 3FRUB 4DVRH 1FVDA 3ULVC 3X14A 4JREC 3T1FB 3U30C 3TT3L 1B0GA 4M7KL 2IG2H 5JW4N 3EOAA 5D70H 5EZLA 2Z31C 3Q3GB 3V5HA 1G9MH 2R9HD 3QXDA 4RISL 5KOVC 1OHQA 3WIHA 2A77H 3T2OA 3U46B 3T0EC 4DKDC 5HYIA 1WWWX 3MZTA 3E8UL 2LQRA 1FZJA 1LP9B 1RUQL 2ZUXA 4N0RA 5FKPA 3AGVA 2FYYA 3GUTB 4X5XA 4G6MH 1EEYA 3AUVA 4AENB 3RUGE 1JFQH 4X4YB 1EMTH 5DD5L 3HI6H 3OJDA 4OF0A 2YD2A 4DAGL 4YGVB 1RJZA 4YHIA 2PXYC 2Q86B 3C8DA 5KJRH 3HMWH 3P73B 3UTTD 4Y89A 5J7CC 3VGDA 5AEAA 2H1PL 3OB8A 2XKUA 3HMXL 4ZOCA 1ZVSB 4PJHE 4PJXB 4YJZL 1DQQB 3D18A 3SKJH 5HHNB 1S3KL 2QSCH 2VXTH 3D69B 4NQEA 4ZFOL 5CUSL 4ELMA 5HGHB 3MV7E 4I9WD 5FM8A 1HEZA 2R0WH 2IBZY 1MCPH 3HZKB 4EJ1C 4LCUA 4Y19D 4ONGL 1T1XB 4NYLB 4DKEH 4HPOH 5FV1L 4WDIA 4XAWH 1CK0L 3PGDB 3WN5B 4HZAA 4U0QB 5F3HA 4XX1G 2MCPL 4PJ8B 4GKZB 1PKQA 4XNZC 4LHJB 2AJYL 1OB1A 4MS8D 1ADQH 4NWTL 1CG9A 3OXRA 1W0YT 1YEKL 2P8LA 2R39A 2XRAH 4C56D 4YIQB 4WI7A 3MRPA 5D7LE 5DS8B 3RA7L 1B90A 2D7NA 2R4SH 3TIEB 1NGYB 4DGVL 2BX5A 4OCYH 5A2IH 3VU2A 5MEPA 1NMAL 4QYOA 5CHNB 2HMID 1Y0LB 5IFJB 5E2WL 3PL6A 2VQUA 12E8H 3GO1L 1QYGH 3MRFB 1D5IH 3LPWA 1N26A 1BVZA 2A9ML 4P5MA 1Z0MA 3H3PL 4KV5F 4OF5A 3MBXH 4A2LA 4QRRD 3U7YH 5TE7L 1HIML 5I0DA 2CK2A 3D2UD 1BJ8A 4OT1H 3SEPA 1CFTB 4FQ1H 3U4EB 2EIBA 3KS0H 1ZS8B 4Y4HC 4CJ1A 3RU8L 4CVWA 2HVJB 3QBTB 4K3GA 5K9OB 5ETUA 3QUYA 2BVOA 4LARH 1UCTA 4BELD 1HILB 2NTFA 5AYUL 5IEHB 3F7VA 1HK6A 4YFLI 4YO0B 1WVZA 4KK9C 3AM8C 4YDVA 4UIMB 5DFVD 2IPTL 2BSTA 1T2JA 1LP9E 1V7MH 1OY3B 2CLRA 3O6ML 3F7RA 4OJFH 5C07B 5CSZA 1T21A 3N85L 4MDIB 5A1AA 1ZE3C 1A6PA 4NGHH 2IC2A 5AWNH 3TO4A 2DQIH 3R1GH 1GGTA 1W72H 4OTXH 3ZTNH 3MRGB 1HH6B 3ZLQC 1LHZA 3EOBB 4X7DC 1SEBB 3B9EA 3K80A 5J57B 5IFHH 5CJXC 2VDLH 2Y36L 4JFFB 3KR3L 4RGND 5TH2A 3VWJA 2BDNH 2CKBH 4R7DA 3ZSTA 4Z77B 3OTTA 1AR2A 4PJXE 4K94H 1ZANL 2FWOB 4HDIB 2ESVD 1M6OA 2YSSB 4QRPD 4HUVB 4HUNB 1XF2B 2Y72A 2IAMD 3K2MC 4UV7L 5BS0B 5GGTL 2WUCL 2EC9U 3MBEC 4H25A 4AMKL 2AGJL 3DVNA 1PG7W 4LFHG 4NDMB 4APQC 2HFEA 5IMKB 1CDUA 3BPLC 2Q3AA 3G5XA 5EU6D 1S7QB 2R56H 1RULL 3I3BA 4L3EB 2FO4B 1FZMA 1OT2A 3H3KA 3EO1B 3QG6B 2I07B 4FQXB 3G6JB 4Z95H 2BERA 1WIUA 1I7RB 4JZJC 5GGRA 4YXKL 3ARDA 5CJ5A 4U6XA 1GRWA 2UY7A 4XVJL 2ITDA 5HDOA 1DVFD 3CC5A 4FHBD 2YUWA 2CO6B 2YPLD 4U1MA 4PJDB 2WW8A 1F90H 1ORQB 1MFAL 4QLRA 1DEEA 2LVCA 5ILTL 5KANI 4YHML 3DXAE 3IJHA 5DMIL 4EDWH 4JB9L 1DR9A 4P23C 3VMNA 3NCEB 4I0KA 3HMXA 1OTTD 4AM0B 3MA7A 4Y5XB 4LCYA 5F3BB 1QFUH 2HA1A 3RRQA 4ELMF 5IWLC 3FB5B 4OM1L 3Q2CA 4ZO7A 4NUGH 4ZFOA 3OZ9H 3O41A 4J4PC 4LDEB 1HQ4B 3W81A 2E5EA 5ICXA 4O9HL 2G9HA 4OFVA 4LLUB 3RJDA 1NCBL 5CD3A 4BK4A 1ZK9A 5LGHL 3HKFA 4NQVA 4TSAH 1R0AH 5I8KL 4W4NA 3DSFH 1RJLA 3QXWA 2W91A 4M8QB 4QHMA 4ETYA 1KCVH 1D9KC 2DS4A 3BIKA 2V7NB 1AGBB 3NVQA 5CSGA 1TFHA 3FO2A 3V0AC 3T8XA 1WBXA 1FZKA 2FIRT 5TE4L 3RDTB 5EN2A 3V7MA 1CFQA 2KKQA 2C4FT 2NY4C 1F3DJ 5E8PA 3W0WB 3HNVL 1LE5B 3TA3D 4O5LL 3WMSA 4WFED 1FGVH 3FB8B 3B8SA 2VLRB 4WUKH 5FGBC 2AI0H 5FUZH 4DCQB 3SJVD 3IFLH 1A1NA 4OI9A 3VWKB 3I75B 1U8KB 2OP4L 1KT2A 5EBWB 2YKLL 4HK3J 4NKDA 1UM6H 4S0SD 2GK2A 4OF8A 3U2SB 1T4KA 3ARFD 3U0PA 4I48A 1GOFA 5KSBE 5GIRA 4LHUB 5E2TL 3MV11 1MLBA 5IG7B 3OKDA 5ACMA 5BS0E 5I1JL 4R26H 1U8MA 4WFFE 2B20A 4O02H 5F7EL 1I8KB 1CU4L 1NFIB 3DMMD 4MA3A 1MIML 3RL2A 2X42A 4LNVA 4LGPB 5I73C 2AJSL 3ARGD 5L2JA 4L3EE 1U8NA 3SDDB 2NTSP 3P9MB 3MLZL 1XFPA 4JRYD 3T65B 5EBLA 5EUKB 3D39A 3HCVB 3VRIA 3V95A 4DKFL 3IJSB 1BBJA 4QRUB 3RP1A 1MWAB 3UXFA 3WXVL 5BJTA 2R2EA 4P0DA 5L7XH 5JZ7C 5I1HL 4RIRB 1P7HL 5AZEL 1BF8A 2V6HA 5GS2H 1CDHA 2BSRA 3GJFA 4AG4H 5I15L 5DRXA 2I27N 4PJDE 5EZOH 2YD9A 4LGRB 1I1YB 2QQNL 2VJXA 3TBVA 5K9QI 1MCJA 4PTUA 3G5ZA 3I85A 1MY7A 4U1KA 3O8XD 4XNUL 3UTZA 2ICWA 1I4FA 4LKCA 2LFGA 2MPAL 3DVGA 3C6LA 1MAMH 3PDGA 4XP9H 1S9XA 5C8JB 2YK1L 2MOVA 1NGPH 3FT4A 2WBJB 4G5ZH 2EE2A 5I16B 3EO0A 1FAIH 4PP2B 1O5DT 2V2WA 1MFEH 5HYJD 4FFVC 1G6RH 3PWVA 5I30H 2AKRA 3HAEA 1AGDA 3FOMB 5GGTA 1H9VA 4R0LB 1SBBA 5AUMA 4DEPC 3ULUL 5IJKC 4J6RH 5CZXC 3GHBL 4PJ7E 5F70A 1TPXB 2F9BT 1ODAA 3SKMB 3S34L 5GRWA 5DZNA 4YK4C 5H2BA 3TNMB 2CJUH 1E27A 1RFDH 1MCOL 2JJVA 3B9AA 4J12A 3QQ4A 4WI4A 4YHPB 4EIGB 3MRHB 3UJJL 1NFDA 1QACA 1MEXL 5ESAA 3BAEL 4ODVL 1EH9A 1QNZH 2R2HA 3QDJB 3HR5A 3TZVB 1IGMH 4WEUD 4TNWF 2AK4A 3BXNB 3LCYA 1OTUD 4J3XA 2DDQL 4XZUB 4HC1H 1VEOA 3P4NA 3QO0A 1CBVL 3MOBH 3QCTL 4LSRL 2XTLA 2ZNXA 3IDGB 2C26A 2NX5A 5JDSA 1FNEA 1R5VB 4C57C 4BH7B 43C9A 1TETL 3UO1L 4P5TA 2FEDD 2B1AH 4NT6B 1G9NL 1KXQE 1QBLH 3UJIL 3MRNB 1YPZF 4OFYA 4JFQB 5KVDH 4MCZB 3UYPA 5C0BE 4F2MB 3V5KA 4ZQKA 3OAUL 5IESH 3NIDF 4XGZA 5ESVB 2ZZUT 3BQUB 4JO3L 1IC4L 4XCEA 5C0IA 1R3LA 2VDMH 1TVBA 4KMLB 5GJSH 1CDIA 1XIWB 5CGYD 5F7NC 5EBMA 5JW4M 1FAKT 4GMTH 2VISA 3BYYA 3V6ZA 2AQ1A 3KJ6H 4L4VA 1C16A 3OF6D 5L88L 3IS1X 1T83C 4PRID 2CIKA 3VXTB 3Q6GL 1LNUA 3C60A 3SE4A 4F37K 4HHAB 5C0CD 1EUTA 3NCFB 3QQ9C 1MJ8L 3QIWB 4WW1B 1F4XH 1UCBH 4WUUE 5D1ZA 4FG6C 3IDYB 3L5WB 3HAEH 4P5KA 3HFMH 5DJAB 5HTSA 4JQIL 4H8WH 2Y7QA 5C0GA 3VXRD 3VXUB 1JWMA 4UAOB 4JPIB 5FGCB 1HI6A 1QG3A 5DHXB 1K8DA 4JY4B 4POZD 4PJBA 4JFYB 3UEZA 5DMGD 1S5HB 4NRZA 4PLKD 3JWOC 1YEGH 1KJMB 3CK0L 5D96B 5IQ7L 2F19H 2EE3A 3FZUD 4U0RB 2PO6A 1X5HA 5DQDH 4XP6H 3CU7A 5F93C 5FOBA 4ZSOB 4WO4D 1BM3L 5CKAA 2KH2B 1SJEA 1UQSA 1YNKH 3MLWL 1IC7H 2JKXA 1GC1C 3S4SG 2BY0A 1WZMA 3DX7B 2XA3A 5DMJB 1FYTA 4WTXA 3WN5C 1MHPH 3I6KA 2OMBA 4PJ8C 1FJ1A 1KLUA 4ZUUA 1K3IA 1QFWL 3QDMD 4HBCH 3UYOD 2ZUYA 2X9XA 3MRCA 3GSXA 3CLEH 5FYJU 4MD5A 4WHYH 3K2UL 5HGBB 2E7LC 4Y1AE 4X7SL 3X17A 1F4YL 1U93B 4X7TA 3O3EB 1R3JB 4R4BA 5B39G 3RFZC 6FABL 2X4QA 4JJHA 3W39A 1WWAX 1UA6L 3QNYB 2W0PA 4JN1L 4H5SA 1A21A 2YHGA 4K23L 4P9MH 1BD2D 2X1XR 4QT5A 4UNUA 1FNAA 3SDXA 3RTQD 3FKUS 5E2VL 1D6EB 5F1NB 3MCLL 1KOAA 2DYPD 2P24A 3KPQB 1BOGB 4YHYC 3TBYB 5TF1H 4UDTB 2O5XH 1SMOA 5J9PA 1FFNB 1PLGH 5SWSB 4DN4L 1EVUA 2VZTA 4KZDH 5IBTH 1NFDF 3EGSA 2IPKB 2X4OA 1Y6KR 1V7NL 2AXHA 1AXIB 4S2SB 1VADB 3KYNA 3GEWB 5DJXB 2GSIA 3MJ9H 5GQBA 5C7XH 3IAGC 1E4XL 3N06B 5F88B 3O4LD 5A2JH 2VDNH 3KDMB 3RGVB 4XVUD 2DQHL 4ORGB 3WSQL 3BD4A 2F8VA 5L8KB 1DQLH 2E9BA 2YD8A 4HUMB 5EORL 3RZWA 3O2WL 1QVOA 3FN9A 3H7LA 4XMPH 3VXUE 3X14B 4GH7B 1CLYH 1X7QB 3WXWL 1IGYB 2XXCB 1FP5A 4R6UA 1KCRH 2E27H 3KLHC 4PGBB 1EFXD 1AP2B 2WIIA 2NYYC 3WCYA 4Z7NF 4KTDH 3PNWA 3OJ2C 5I8EB 1HHKA 2Z93A 3DI3B 4NQXA 2EDXA 4X6EB 5DJ0A 1FLRH 2HFTA 3LS5L 4HW6A 5MP6H 5I1KH 4UIKL 2CDGB 4OUUA 1DTUA 2Z9TA 4PJGA 4P3CL 2BVUA 3DX8B 1B4JL 1HE7A 1ORSB 1TZGL 1WZ1H 2JB6A 3CH1A 4YZFF 1XAUA 1GZQB 2V9QA 2FDBP 5JPNA 3BKMH 1UWXH 4O2FB 5GS0D 4RGOH 3BIBX 4LL9A 1MCRA 4LKXB 1B4RA 3DX6B 4MJIE 2JCCA 3RNQA 5B38A 2EC8A 4NNYA 4Y19A 2HRPL 4HJ0D 1W72B 1Q1JL 2CMRL 5I1LA 2FNBA 3GSUB 1G7HA 4L8CB 4CN1A 2A83B 4PJBF 4BA8A 2CKBB 3U0WL 1FPTL 1Q9WA 2CXKA 1SVZA 4Z7UA 3S5LB 5T5NG 3V9FA 2YRPA 1CIDA 1L4IA 2LVEA 1EX0A 4AIZA 2X89D 2EKJA 4Y5XC 4BZ1H 4MNGA 3HZVA 1OP5H 2NW3A 2AK1L 4G43A 1J0ZA 4NKOB 2Y07L 1MVUA 1UKQA 5B8CA 4HKZB 5DLMH 1NSNL 4L8DA 1DLFL 2XN9D 5SWSE 1EXUA 1N6VA 2AP2A 2C3GA 4KKCD 1BQUA 3ESVF 3MLXL 3B43A 1IQDA 3M8OL 5L0QB 4FTVB 4AK1A 1MVFA 3RY6A 5DJYB 2A6DA 3CNKA 4UMGA 5EOCJ 4QRTA 4Z8FL 5KS9B 4BZYA 2A73B 1FO0H 3D2UA 2VDKL 4LVHB 1HCVA 3N0PB 2H2SC 1M05B 3QI9B 3RDTC 4XVTL 1UH4A 1QR1A 4HIJB 4OLWH 1QLEH 1YUHA 3RWIA 2DQGH 4M6NH 3DJ9A 1QKZL 3PWJB 2DL9A 4YDIH 2BNQD 5C09A 2WLZA 1UZ8B 2DI9A 4JQVA 5DRZB 2VE6A 3RVUD 2R2CA 5E03A 1QPXA 3VWKC 2BNUA 5ALCL 1MHHA 8CGTA 4GKNB 4GSDH 5E94A 4WV1B 4ZFFA 5FCSH 3TV3H 3T4YB 3LRSB 2X4NB 3SDXF 4U7MA 4HXAH 2Z8RA 4ZTPH 3QUXD 5ALBH 1T1YA 3QRFM 5BV7B 3EHBC 2R69H 4UUJA 1RIVH 1XGPA 5SWQA 5GGQL 4XX1E 2K3TA 2AEPH 1RV6X 2D9QB 4M1DL 3I6LD 5IK3A 1GHFH 3IJYA 5I75B 1C7TA 1JHKL 5BZDB 2CR3A 3TYGL 2IQAB 4X8JA 1IKNC 4MHHG 5CINH 5DJZB 3NACH 3SDDC 3HNSH 4HMDA 1N0XH 3RPIB 1DUZB 4MXQD 2FJGA 5FUOH 1HXYA 2F54A 5CKGA 1AKJD 3FFDA 1RJYB 1FVCA 4QRPA 3QDGB 3MLTB 4LVNB 4ZS7H 2J88H 3UTSB 4ZPTA 1G7JB 5HPMA 4R9HA 4CW1B 5C3LD 5DURB 4CVZB 4RFEB 1QD0A 3HPJB 4MAYA 3LN4B 4MJ6B 4PJEF 4HH8A 3MLVL 4ZXBB 3NCYP 1ZGLP 3O2VL 4Y16A 2NY3B 2Z92A 3U4BL 4NUJA 4TN9A 3P4MB 4MAUH 3SKNA 5D6CB 3ZHLA 1XCTA 5JLZA 4S1RH 1A6VH 4YHZL 3GM0A 1KPRA 3BDBA 3N50A 2IFFL 1CLZL 1P7QA 4Q6IB 2WBJC 2DI8A 3P9LB 3VXPB 4NIKB 4NZUL 3NZHL 4L3AA 4MJ2A 2ZCLH 3B6SB 4PJGF 2QHLA 2YPLA 5DZOA 15C8H 3KG5A 1SYVA 3MYZA 5FK9A 3ZYOA 4DZBB 1T03H 2VDOL 4XNXH 1CGUA 3FCTB 2XT1B 4UDUA 3SCMD 1QRKA 4FTVE 3WHXA 1TPXC 1Y18A 3VFGH 3QEHA 1U91A 1I9IL 4AL8H 4OQ1A 4Y4FD 5KS9E 2C3HA 1YPZB 2HFFA 3SE9L 3OB0H 4H0HB 2QHRL 2GSGA 1FNLA 3LKNB 4G8IA 1NC4A 2JCCF 4HIIB 3TZVC 1YEHH 2P5ED 1B6DA 2CXGA 1MRDH 5GRUH 3HTLX 3GMMA 4JFED 4KDTA 3CGTA 2EDTA 2GCYA 1B88A 5DJDB 5AYQA 4X4ZA 1PX3A 1JYVA 4TPRH 2G5BA 2DWEB 4X6CE 3VD4A 3SBWC 2F8OA 3L3IA 2EDEA 3SN6N 4Z7UF 1CD8A 2W07A 3NN8B 3BSZH 4X80L 1EFQA 3QP3A 4BM7A 2Y5TB 2MJWA 3JV6B 4WEMB 5FYJH 3OXSB 5EBGA 3BZDA 4TUJB 3TA3A 4CMHB 3BQUC 1IGJA 3MLYL 1G6RB 2VLJB 5E8PB 5J56B 4F57H 1DP0A 5F96H 4HX1B 2GT9A 1Z9MA 3B3IA 5K59E 3D0LB 1YYML 1XIWC 4N0CD 3FRPA 2VLKA 1J1PH 3MMEA 4ZFZA 3ZKND 3GGWB 1HHJA 1Z3GH 2IBGA 2YUZA 3QFJB 3QQNA 5ICYB 1NMCB 2W60A 1F6AA 3TM6A 1SJXA 4F3FA 3UTSE 2R2BA 3CFKB 1U92B 4L4TB 4I0CC 5DO2D 3FL7A 2VLLB 4G9FB 3IU3A 1A4KA 3T0ED 5D7SH 4FNLL 3UAJC 2ADGA 3H2WA 3VFTA 1F8TL 3DMMA 5IMLB 3IDYC 2V7HA 1S7SB 4NM4L 3ARGA 5ADPL 1KNOA 2W0LA 4GRWH 5CEYB 3B2UC 1MCIA 5J1SC 2EH8H 2IADA 3FFCD 1CGYA 4XPHL 1ZT7B 5EBLB 3QXTA 2FSEA 1VSCA 3CFEA 5BZWB 3QHTC 1TJIL 3LSOB 3MV9B 5T1KD 4KXZI 2A1WH 3GSVA 3VH8G 1YC8A 3K81A 1KCUH 5D96C 1NC2B 3SQOL 4U0RC 4LCCA 1JPSH 4FMFA 1JTPA 1HYRC 4KFZC 3M45A 5LAXB 4JZOB 1OL0A 2PTUA 1NCTA 2X4SB 1DLHB 2MHAB 3MXVH 3I2CH 5GRYA 1IEAA 1Z5LA 1F3DH 4HG4K 5HYJA 2D31A 5JHLH 4TOYL 5IB2B 5GRJH 1E6OH 5AG8A 5AZ2H 5MEQB 3QWOA 3WFEH 5KSAB 3S98A 1P6AB 5A2LH 1TCMA 5K9JH 2A6JA 4R2GB 4BK5A 2B5IB 2ERJB 1RPQA 4KHXL 2CK0H 3TBSB 2IPUG 1RZGB 2R29L 3MR9B 4PP1D 1MCDA 3H7BA 2FJHA 2H9GA 5F7DA 2Z8WC 1B9ZA 3IGAB 1F4AA 2C7UB 3KPMB 3O3DA 1F58H 3HLAB 1ZHKB 3AS1A 1NFDB 2SEBA 2VLJE 4KJPC 5I8CA 2NZ9D 3ET9F 5CWSB 1UACH 5FDYA 2EDBA 1JYNA 1MNUL 1DFBH 3LEVL 3BEVA 4EI5B 1T22B 4XXCA 2I60H 4OZFA 5MI0B 3QFJE 5GISL 5C92A 4RRPG 4MXWH 5JMOC 2Y6SC 5DD6A 4L4TE 3WLBA 3WUWB 1EO5A 1LO4H 4LPYA 4OZIA 2RFXA 1BX2A 2RB8A 1LK2A 4G9FE 2YD7A 5HI5C 3BGAA 1T7ZA 5C0EB 2NY5H 3SY0A 1BQHB 3V5KB 1O0VA 3M07A 3OAZK 1EEZA 3B9DA 3MA9H 1F6FB 3EO9H 4YFLF 4LRIA 1D3CA 1JNHB 1NUNB 3VRLF 5IT2L 5D1QB 1S9YB 5C6TL 3RWCB 1D5XB 3ZT7A 2FL5A 4NNXA 3MO1B 1AHWB 3QJFB 5DJCA 1Q9LB 3EZJB 4K8RH 4PRIA 4O2EA 4HWZB 4X4ME 2O93L 3WDIA 5GS0L 4N1EA 4A2MA 3T0VA 3S96A 1CR9L 1WV7T 2IANB 1FNGA 4IMLB 4TSBL 5D1XA 5IOPB 2DKSA 3MV9E 3CVIL 3VE0A 1KB5L 4NKQB 3MJ7A 4KZEH 4PY7B 4EKXA 4LHQB 2YEZA 4IRSD 2H3NA 1A3RL 4G7VL 1IC5L 2OTUB 3X13B 3S4SB 4O00A 4IRZL 4J1UB 1I9RH 1NPUA 2GK0A 3FQTA 2R0LL 1ZHLA 2WBWB 2P5WE 1I8IB 2CDEB 4NWUH 3SPVA 1MHEB 1KN2H 2O61B 4WI9A 4XH2B 3F5WB 2YWZA 32C2A 3LZFL 4NO5B 3H9SA 1OAKL 1JZ2A 3REWB 2R1YA 4JRXB 5MENE 3O3BA 1OPGL 1S7TB 2BFVH 2KBGA 5FDWB 3OKOA 5F97E 4YQXL 3UBXA 5TGBB 2B2XL 5TQ2H 1FSKB 4H0GA 2OTPA 3C08L 5EA0H 4WO4A 1S7UB 1G7PB 1RZFH 1TITA 3MPCA 4XPAH 4CNIA 4WCYL 3BW9A 4NHCH 2X9WA 2FEEI 3PXHA 2VUOA 3H9YA 3TBTA 3S36L 4MNQE 3GSQA 3BKJH 5GSRB 3G5VB 3VFOA 2YN5A 4WU7A 5CP3H 3IVKB 2XY1A 4KQ3H 5E70A 5DMYA 2HT2C 1Q0XL 1BGXL 1ACYH 3VFWA 3QDMA 4P23D 1FJ1B 3S36X 1OW0C 1EHXA 2ENYA 4HF5L 5HBBA 5ERWA 3T2QA 2HT3C 2CLVB 4M9PA 4YE4H 2FATH 3KPRD 5E9DB 1MIEH 3QNZA 4L8SA 4L29B 4PB9L 3C5ZB 4RWYH 4GAGL 4ONOA 1QA9A 4X99B 4RX4D 2EDNA 1LEGB 2WM0A 4FQ2L 5D72H 4J4PD 5FYLD 3T3ME 1WBYA 1RIHH 3GIVA 2KQNA 1TTUA 4JDZA 3VXMB 4KI5E 4GRLC 3QUML 3UPRB 5I66A 1EEQA 1YEJL 5DHYA 5CBEB 1WICA 1S7VB 5L0QC 1N5YL 3PDDA 1H0DB 4Q7DA 1MAKA 4ZG1A 1A1MA 4QOKB 3CUPA 5JDJA 4QWWC 3C87A 1WFTA 1UZ6F 3DX9B 4XP1L 3IFNH 2OR9H 2ZG2A 1LMKA 2BK8A 4G7YL 1EZVX 3SDYL 2X44D 1P7KB 3RAJL 3VJ6A 5IW1B 1CN4A 5TF0A 2YR3A 1JPFA 1R6VA 4Y5VB 3LKPB 1FGNH 5HVWA 1I85C 2DM7A 1A7PL 2ZOLB 2GW5A 3LS4L 1MF2L 1ITCA 1XGYH 2VN7A 2KZWA 1MJUH 3U6RB 2IANE 2VKXA 2YPKB 4LQFL 3PWPB 3DO7B 4WV1C 2ATKB 1F4WL 1UYWH 4XXDB 2UVFA 2E6JA 4I5BB 3FO9B 3TWCL 4CMMB 4HMEA 2EYSB 5BV7C 2OQJA 4GFTB 4ODWB 4MX7A 1Z9OA 4NOBA 3ALWA 5I1EL 5I75C 4MQ7B 2CGRH 2WK2A 2R4RH 4XVSH 1HWHB 3EJZC 3BHBA 4M48L 2UWEB 4PJEB 5DD1L 1XF5A 4U31A 5F9OL 4OZIF 1IT9L 4Z76A 4JRXE 2ENSA 4WNQB 1ZEAL 1KACB 4G8GE 3IDMA 1XGQB 1AE6H 2RCSH 4HIEB 1FO0B 1TMCB 4LVNC 4RQQB 4WI2A 5JIKA 3QIUD 4LGSB 4G3YL 1T5WA 3N9GL 4LSQL 4HKBB 2DL2A 3N1MC 2H32H 5JZ7D 5DJ2A 3V4VL 2HJLA 4GUPB 4NM8H 4AEIL 3T3PF 1R3HB 1Z0NA 2JE8A 1ZHBB 3GNMH 5FGRA 4ZXBC 3L3HB 3O11A 5FO8A 5BRZD 1CD1B 1DEDA 5KW9H 3ZKXB 2NY3C 1S7WA 3I6GA 4PRHB 3NCYS 4JO1L 4RMVA 2AJXH 5HY9A 1K5NA 3NZ8B 3E6FA 4HK0B 1GAFH 2HJFA 5DC9B 5E9DE 1AD0B 1KB5A 5JW3L 1UB6B 3L3KB 5EB9A 4LVEA 1MFCL 4Q6IC 3TGXA 4MZ3A 1A1OB 3D87B 4XWGL 3EYUH 2YBRA 2DQDH 3B8YA 3VXME 4NNYB 3OKEA 3SGEH 3TC9A 5KBNC 3K4DA 4FABH 5BQ7B 3WYRA 5HHPA 4P4KB 4KUZH 5SX5H 1E4KC 2FECL 3FB6B 4AT6B 1UWGH 1MCQA 1AO7D 2FR4A 1F6LL 2Q7YA 4XBEL 4DW2L 4YHNA 2EXWC 4EDXA 1U8QA 2XFXA 3RIFF 1TIUA 2C9AA 4N0YL 1OM3L 3CFCH 3UX9B 4PUBL 3OGCA 2DTMH 1JHTA 3DV6A 3L95A 3RNKB 4RGMB 4XHQA 2XN9A 5AD0B 1R24B 1XR9B 3R06B 2EZ0C 5INCA 3GSWA 1N4XL 4GW5B 4U3CA 5DVLA 3ULVL 4PTTB 3VFRB 3QZWG 2R1XB 2CDFA 2EE6A 5GRVK 3X12B 1FNSL 1FFOA 1WCQA 1ZLWH 4XCNA 3PWPE 2NXYD 2VZ3A 4OFPA 1KIQB 4D0BB 4PBVC 3U4AA 5C0AA 1X5KA 4G8FA 4N0UE 1U95B 5T1DL 4TRPL 3P30H 1HSBB 1NBZB 4BYHA 3OKNA 3MTRA 4N0FA 4E42B 3PWNB 3LN5B 4DAGH 4XNQA 1QTYT 4CMHC 1OAYL 4Z7WF 2VYRE 2EECA 4CADB 4TSCL 5IB4B 1MCKA 4U3HA 2X4UA 4U2YA 5HGGS 4XBGA 1I1AA 6CGTA 5H94B 3W9DB 3ROOB 1RUMH 4JANB 4PJ9A 1CVRA 2APVA 2IH1B 2D7OA 3QUMA 3GBNH 1KCKA 5E94B 1NMCC 2GY7B 5DXWA 4HWEH 2JIXD 4ENEC 2B0SL 4LIQE 5DUPH 4FOMA 3WDJA 1JK8A 1A0QH 4X5WB 3D25B 1T3FB 3ZDZE 4JGUA 3GIZH 5CILH 3OKLB 3BN9C 4HJJL 4UUJB 1D6VL 3QQ9D 1NGWB 1ONQB 5KVEH 4NZTL 4XMKH 3EYSH 5CGTA 2MCPH 4J3TA 3DRQB 5IK3B 3EYVA 3IJYB 3LEYL 4I2XA 3U7WL 4KK8D 3KJ4C 4KGJA 4PRHE 1A7OL 1HH9A 4TQEH 3K4AA 4HIHB 1SEQL 1JGLH 2BC4B 5I0ZA 5E2UH 3HZYA 3HNTL 4P46B 2R23B 2VL5B 5CIPA 2NW2B 4M6MH 1R3IL 1IAKA 5GGVL 2VR9A 3BDXA 3PWLB 3QPQC 2FH8A 1OP3H 3T0WA 1J8KA 3RWHA 1QBMH 5E95B 4A6YH 1NMAH 2OSLA 3T2NH 3KYOB 3LQAH 1A7QH 1E28B 5T3ZD 3ARBA 4OCRH 5JHDB 5D5MA 2DQFB 3VXNA 3U83A 1AXTH 1H3PH 5EOCH 1HIMH 2RAMA 2AABL 5CMAB 2Q8BH 4JPWL 3PQYD 1CE1L 1BZ9A 4JGJA 3MXWL 1JMZA 4JCMA 4PJ8D 5HHXH 2BJML 4P2RE 1H3WM 3BPNB 4QY8B 1GYAA 3QXUA 1C7SA 5IF0B 1PY9A 3A67H 1B6UA 3HZMB 4PRDB 5KSAC 4R97B 4LPVA 5JNYA 5L2KB 4N8CH 1QEWB 3MRKA 3EYOB 3IDIB 3FT2A 2B5IC 3L5HA 2ERJC 3O6FD 1IC1A 4ZDHB 4GRWB 4DVBA 5C9KA 3BYTA 3L1OL 1SM3L 3ULSB 3VFUB 5C6WH 5BW7C 2FBJL 4HKXA 4NHUB 3N85H 2HKFL 4JO4L 4IOSD 5F6IB 1UGNA 4X9FA 3QYCA 5DI8A 3RWDA 4F7PA 1XCQA 2FGWH 4G9DB 2Q76A 1C5DA 2NXZB 4YHKH 2O5ZH 4V1DA 1JGEA 2BOBB 4XHJD 1IAOA 2RJMA 4FA8A 2OZ4H 2EYRA 5D7JC 3HG1B 5EC2A 1DBAL 3LDBB 5IB3A 1RURL 2Y36H 1KN4L 3OAYK 3QIBB 3FQXA 4OLVL 2XICA 3LKSB 1S5IL 3QCUH 4LQ1A 4QF1B 3EAKA 4EI5C 3CFJB 5MI0C 3NFNA 2Z8SA 1FV1B 1EUUA 3MZGB 1INQB 4JPKL 4UV7H 4DUXA 2F74B 4EI6B 1I8LA 1HYSC 4IRJD 4KI5C 5CJOL 2H8PB 3EYQC 1NEZA 2N4IA 4N9GA 3IFOA 1J0JA 3EJYD 5DJ6B 1NCDL 5B22A 4MWFA 2C1PA 3MLSH 1ZTXL 3I02B 4UQ3A 5GZNC 5KSUB 4U6TA 2VDRH 1JZ6A 3MRQB 4ZODA 4YPJA 5C07D 4LPUA 4LMQE 2GFBB 4TNWK 4ODHH 4JHWH 4YBLB 2P47B 1I3VA 3UTQB 3PHQA 4QGYA 1AHWC 3HS0A 2JTDA 1WAAE 3NH7L 3IFPB 1U8IA 4O4YL 2APFA 1F6AB 5JPMB 5I1IH 3H9HA 1RD6A 3KLAB 1KC5L 4F3FB 3KNBA 4PGDB 3T0EA 4JFFD 2X4RA 4GXVH 1G7IB 3B9KD 3NCJH 3KLHD 1S9WB 4AEHH 3K1DA 3GMRA 2JELH 1P1ZA 5HHME 1MRCH 5J1AA 1TQCB 2VITA 4PGEB 1P4BH 4RFOL 3JTTA 5JHDE 1JGVL 1NGQL 4JFZL 3RZCB 5DEFB 2X9YA 4DQOH 1PQZA 2PXYA 3WIIL 3QNXB 3FTGB 1FNFA 1INDH 4XC3L 1IAMA 4RAHA 1BIIA 3D3VA 4IOIB 4X6DA 3BE1L 2ZUSA 2YA1A 2W9EH 1NCBH 2BY1A 2YZ8A 1H3UA 4LP4A 3LEXB 5LGHH 1DCLA 1PG7L 4FQXD 4YR6B 1JZ8A 4Q0XL 1WTGT 3P2TA 5FYLL 1FSKC 4WI8A 1B2WH 1WJ3A 5L2KE 2VXVH 4KDVA 1PYWA 4PJAE 3WNOA 1K4CA 4GRWE 4JDVB 1NAKH 1U3HB 5E1AA 4HUXB 5GS1C 5DUBA 1PG7X 5F7UA 4P57B 4OGYH 4KJWC 1HKLL 1WFOA 5EC1A 4L1DA 4PRNB 2XYCA 1C5BL 3SKUD 1BZ7B 5F71A 3WLWC 3S88H 5I6XC 4QHUB 3ZDYE 1MI5B 4HCRH 1EDQA 3IDUA 3WIFB 3SOBL 4X6FB 4PD4J 2F53B 5HHVL 3W11C 4IHOB 3DTXB 1QRND 3V6OC 3C5ZC 4U3XA 5D5MF 3BX7C 1YEFL 2GI7A 1OARL 3THML 4NZJA 5AAMA 4KJQD 2KQMA 3BPCA 4F7EB 5LXGH 1AR1C 1I1FA 2MFNA 4M3KB 1WTLA 1OD9A 4KVCL 5DHVH 1FYHB 3GI8H 4M03A 5FKAB 1UM5L 4X4XA 3DURA 3KXFA 3GKWH 2VZOA 3OMZA 2RR3A 5IGXH 4U6VL 1J11A 4PV9B 5DVMA 4GQ9H 2NR6C 3RDTD 1CIUA 4Y4HA 1WISA 5HYEA 4TVPD 3VRJA 2E8YA 4DKFH 4XPTH 3W0WD 4Z0BH 1FRGL 5EO9B 5K33A 4PRPA 5J6GB 3GJFK 4IJ3C 4Y5VC 2D7TH 2VLRD 3U79A 4YFDB 5I1HH 2PTTA 4KC3B 3WL9A 3AM8A 1KJ2H 3EDDA 2LV4A 2XZAH 2A6KB 4OZIB 1BX2B 1KGCD 3DI2B 3TFKD 2BMKA 1LDSA 4I3RH 3BP7B 3Q5TA 2NLJA 4PLJD 1WBZB 3NIFE 1CL7I 1T2XA 1JWSA 4LHUD 5I1GL 1CTNA 1AQDB 1NMBH 4GBXB 3HI1B 4C83B 9CGTA 3KPSA 2FL5B 1P4IH 5IHZA 4P2QE 5CJXA 4UV4L 1IE5A 1KV3A 3SDDD 3L3GB 1L6XA 3ULUH 2FB4L 4R90H 5M7QA 4MD4A 4N90E 5J06A 2AXFA 4FP8L 2HN7B 4GG6A 3FQRB 4OBRA 4GAYB 3EFDH 4OD3H 5C0RH 2X1PA 4PJ5D 4JCLA 3WUZA 3MBEA 1IMHC 3PHOB 5HHQB 5IJVA 2RQ8A 5IP4A 3ULVF 4YXLH 4G42B 1K6QL 4ZUVB 5KZCD 3UJJH 1MEXH 3BAEH 4ODVH 1N5AA 4W70A 3X3FL 2DDQH 1NDGB 1MI5E 3A6CL 3AS2A 4JM2B 3ZKXC 4E41B 1ETZB 4WTWA 3LKQA 4HAGA 2F53E 3NTCL 4PR5A 4D0CA 1JYXA 1KPUB 2XA8L 3GMOB 4NN6B 4WFGE 3V0WH 1G9NH 5HI3D 1FL3A 1NAMA 3VFPA 3ZE2F 1EO8L 1MCHA 3CSPA 4M6AA 1G7QA 3B5GA 2AV1B 4IBLT 2PYEA 1L7TH 2XTJB 5JOPD 1XF4B 3F58H 2J3SA 5EWIL 2E7CA 4F7MA 2VXUH 1LO2L 5IIEA 1VGEH 1YMMB 1NLBL 4X6DF 4P4KC 4P23A 4U6HA 2X6MA 5HYSB 2V5SA 5E5MB 2VDPL 2OL3H 5DC4B 2I5YL 4LCWB 3K1KC 1L7IH 3SHSA 5IWLA 4JAMA 5F1SA 2DQCH 1YNTB 4RX4A 1K4DB 3QDJD 4J4PA 4NQDA 4EUPG 2H32B 2QJDA 3CSBA 4LLWA 4RGMC 2E7MA 1G0DA 4Z7WB 3RL1A 1BAFL 5IUSA 1MJ8H 1BWMA 2B39A 1S9VB 4GLRH 2BXYA 3LMJL 1D9KA 4YWGL 3DUSA 1FBIL 3AREB 4AQ1B 5HYQB 1T0NA 4JQIH 5KVGH 3BZFA 1QLRA 4OF7A 2YD1A 3U36B 1BJMA 5A40E 2V2XA 1YEEH 4JFPA 4K7PH 4Q9CA 2GEEA 1RK0B 4LSDA 3L3OA 5FGBA 2YC1A 3B5HA 2C3VA 4Q9BA 4ZUSB 1T5XB 5T3XH 4JFXB 1DBKH 4BQBA 4NQEE 3KYMB 2YS4A 4WY7L 4OI8A 1XR8A 4JFDB 5FYKD 5DQJB 2GUOA 2DQUL 3UDWC 4RMSA 3JWOL 1A6TA 1MREH 1D5ZB 4HK3N 1KCSL 5CJQH 1KUMA 3MNWA 4C58B 1NAMH 5T3ZL 3BP6B 4YPGB 2MQCA 1LK3H 1PKQE 4HUWA 1BVLB 5TQ0L 1U58B 1PZUB 2R8SH 3QIWD 1AJ7L 3RVVC 3TPKA 5HHOB 3O6LL 4HWBH 5GSVA 3VFSB 2EEDA 2KZ1B 4JLRB 3PWUB 3UYRL 1GC1L 4PJCA 4OZGB 3B2UD 4Q2ZB 4NNPL 1HSAA 5F7KC 3WJJC 1K8IB 2ADFH 1IGCL 5ESQB 1WF5A 3K2UH 2IEPA 3QULA 2X1WL 3QSKB 3M17A 1CICB 3VXUD 1TZIB 1DBBH 4P46C 3DYOA 3D0VA 2X7LB 2Y25A 5INDB 2V9RA 2BRRH 4UBDC 1I7TB 3JTSB 1UWXK 4NKMB 4RDQF 3FONA 1MRFH 3C9NB 4HV8A 1U8JA 3HE6D 1A6ZA 4MYWB 4NFCA 3DROB 4OGXH 1WCBA 3ARTA 5CLTA 4CJ0A