5D7KD

Structure of mr1-reactive mav36 tcr
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
199
structure length
197
Chain Sequence
EDKVVQSPLSLVVHEGDTVTLNCSYEVTNFRSLLWYKQEKKAPTFLFMLTSSGIEKKSGRLSSILDKKELSSILNITATQTGDSAIYLCAAYNTDKLIFGTGTRLQVFPNIQNPDPAVYQLRDSKSKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MAV36 TCR Alpha Chain
total genus 39
structure length 197
sequence length 199
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7kD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7kD02
3TIEA 1RZIA 3NCYP 1VFAA 4JO3H 4DFIA 3I6GB 3VXTA 1T0PB 4XWGH 4OLUH 1NGYA 2BNUA 3RIAK 1QEWA 5D2LE 3T09A 1XF4B 4H26B 4DN4H 5F9JB 4G9FB 4MHHI 4MJ2A 4NRXB 4R90L 4OZGE 4N0CD 4XVUD 4JFZL 3U7AA 4S2SA 5JUEL 3SEPA 1NC2D 2VKWA 3BJ91 3GJFK 2X10A 3QEUA 1N59A 4MA7H 1I3UA 3OAYH 2EDBA 1J0IA 3OJDB 5T5FH 1RFDL 4EN3A 4F37F 5JZ7C 3EFFA 5E4EC 1I85C 5J6HB 1I1AD 4LPVA 4HUVA 3ULUH 5DHVH 4XVTH 3FQWA 1BM3H 4YO0A 4P59H 5E9DE 4KJPD 2P44B 1JGVL 2VXSL 3QIBD 4R7NA 1XF5B 5IIEB 3B2VL 1JHLH 2HT3D 3GRWA 5B8CC 4E41B 5C6WH 1QBAA 3QG6B 4R4FL 3KPQA 4U1MA 2VH5H 3KPPB 1BOYA 2OS7A 4LSQL 2VDNH 5F3BB 4U1NB 4PY7B 1CFQA 3RTQB 2UVFA 3BEVA 3REVA 3INUH 5CJOH 4L8DB 3O4LE 4P2RB 1Z3GL 2EE9A 4NWUL 2AJUL 1NEUA 5IGXH 2B20A 3RBSA 5IHZA 2H8PB 4WDIB 1EDQA 1G7JA 3C5SB 3GMNA 4CN1A 5L88H 4L1DA 1FFPB 1Q1JL 3QO0A 3BEWB 1E4KC 1EO8L 5DS8B 1FYTE 2MNUA 3VD9A 5E94A 5E4IA 1S7SB 5DRZB 2IWGA 3P4OA 1NDMB 5J12C 2OR7A 5F8QC 1X5JA 5CAYB 2OZ4A 4QRTB 1TNNA 1ZA6B 4S1QL 5K9OA 1A7RH 3MBED 4HKXB 1FGVL 1LEIA 2OL3A 4NM4H 4PJXE 2ZUXA 4JPIB 1T1WB 5DK2A 4N1CA 2Q8AH 1NEZA 2Y9RT 1A6ZB 3ZKMC 3GM0A 5IMMA 4ZFFB 2HWZL 1ZK9A 1MCOH 2AW2A 3V6FA 3O3AB 5T3XL 1DVFB 2OZ4H 4Y5XB 1S9KC 3EDKA 2H26B 1KTLA 1JYWA 3RA7L 4JPKL 2L7UA 3MV9D 1RJCA 4KI5F 4AJ0A 5FO7B 1XZ0B 1J9CT 4Y1AE 4JFOB 3FN0L 1H8SA 3MX0A 3GSXA 4MA1C 2FB4L 2Z93A 3NACH 2VISA 3OL2A 4LEOB 4D9LL 1GGBH 3ARTA 5FYJH 2JK5A 1OAQL 2W9EH 3F5WB 4ZS6C 3RKPA 3M8OL 1CVRA 4HV8A 4KDWA 2DYPD 3IDIA 4WHTB 5CLWA 3A6OA 3BDYH 1K6QL 1MCFA 4V1DB 2JJSA 3V7MA 2ADIA 4Z76A 4YHOH 2AJVH 4HPYH 5IVXF 4NQEB 1HXYA 3VFMB 1C5CH 2QLVB 4YXKL 4ZOAA 3QNXA 4L4VD 2FATL 5C3TA 5ICYA 3O2DA 4X80H 1HI6B 1F4YH 1WK0A 3QDGA 4NBYB 4U31A 5CCKH 1CL7H 3Q5YA 3NCBB 1MHCA 4LHJB 5J6GB 5HSFA 2JCCF 4OKDA 5D1XB 4W4OC 4FQXB 3LPWA 2BVEA 2W92A 5GGUA 5HVGB 5IHUL 1DQML 3NCEB 2Z91B 1FBIH 4NC1C 3IRZA 4XP6L 3VFVA 4MLSA 4K3GA 4MZ3A 1N5YH 3PV6B 2ZUQC 2HLAA 3T0EA 5MEPA 3F8UB 1YMHB 2HRPH 4NNYB 1OM3L 1FZOA 5SX4H 3JUZA 7FABH 4RMRA 1FAIL 1NLBL 3QIWC 4FZEH 2GTWA 3CFEB 1J18A 5SWSB 3IAPA 5HDQL 5EOTA 3ARGD 2R0WL 1JI1A 2ZCLL 1OAZH 1I7RA 2DAVA 3KYAA 2D3VA 3TVMA 3V0WH 1BAFL 3LPFA 3TBTA 3OWEA 3HNTL 1OARH 4UI2A 3NIFF 1X7QB 1BM3L 3U7YH 3W0WB 4Q2ZB 3NH7L 3RWCA 4I5BB 3DI2B 1TJGL 4P3DA 5JA9A 3HAEH 4OZGA 5BQ7A 4NHUB 4XPAL 1QZ1A 3TNMB 2A6IB 3QIBC 3C5ZC 3MLTB 32C2B 2EXYC 2NLJB 2ADFL 4HWBH 4MAUH 4PJ7A 1DQTA 1U8KB 3O3UN 4RIRA 5E7BA 4IM8A 3QEQB 3PNWA 4KV5E 4RMTA 5CJOL 4OGAD 5IBLD 4HT1H 4M7JL 3EJZC 4JRXA 5E95B 3MV9A 5TGBA 4ISVB 5TDNB 1KULA 1KN2H 3PWUA 4OTXL 4S0TD 2VXSH 3JV6A 1U91B 2BVPB 3FO2B 4V1DD 3SKJL 3N1PC 3X3GL 2CGRL 4L3ED 3OX8B 3ARYA 1VPOL 3HC3H 1AJ7H 4AL8L 1CZ8L 1UZ6E 3ROOA 4HWEH 4MX7B 1OSZB 1R0AH 3KYMA 2E6PA 3VRIB 3RQ3A 3MRBA 3ZMRA 3PUCA 5I8EA 3ULUL 3HRZB 3MNVA 1CLYH 3RVTD 4R4ND 3SO5A 5H94B 2AK1L 4XTRC 1B0RB 4F2MA 4R4BB 3BE1L 1E4KA 1FDLH 3U6RA 4XPTL 3PJSB 4HKBA 3AROA 2LAGB 4UV4L 3D0VB 3Q6FA 3QWRD 3FRUA 5MHSD 2Z8VC 1IEAB 3JWOL 4X9FA 3ZTNH 1K4DA 2DM7A 3EUUA 5C1MB 2VZOA 3JWDH 3QUZD 25C8L 5IW3A 4DFHA 5H35A 2BVOA 5EOQH 4HIJB 1B4JL 1ETZA 3MBEB 2Q87A 3VFNB 4TSBH 4D9LH 2V7NB 1XAUA 2VWEE 2IPKA 4FQQB 5FUOL 4LIQL 3V5KA 3FZUC 2PYED 4M43L 4YEEA 4LSVH 2WBWB 1PKQA 1UB6B 2R1YA 1OAYH 5HPOA 4UOW0 1ORQA 3ARGB 1FYTD 5I1JL 2EDDA 3SE8H 2R0ZH 1YMMA 4LRIC 2M26A 1FHGA 1EV2E 4P23A 4RAUB 1KLGA 4BELD 2HT2D 4IRJD 2YKLH 3QFJD 3EYUL 1LK2B 3TO4A 3V4PH 3SDXE 2RJMA 4YPGB 4HJJH 3Q48A 5J89A 4HKXA 2CJUL 4P2OC 3TVMD 4M02A 2OL3B 1LEIB 1Q94B 2Q8BL 1G7MA 1MH5B 4JO1H 2R15A 2XN9A 3IFOA 1ZT1A 2GK0A 4QHMA 4GKSA 2P5WB 1W2KT 1XF2B 1ZOXA 2QHLA 3ARBC 4OFVA 1IM9D 5D7SH 3V6FB 1RZJL 3GMLB 4MA8H 3QDGE 3FO0L 4UT6L 3RWEA 5DRWB 2XTJD 4MVBC 1IT9L 4LLWB 4PRDB 5DHXB 4Z7UB 5E08H 1KIPB 4MMZC 4ZUUA 3LKPB 3CSYA 4P5KB 5EC1B 1XZ0A 4JHWH 4K7PY 4PJAB 5DI8A 5ISZE 5DQDH 3QDHA 4RAVB 1DN2A 1MVUB 3SHSA 5DMKA 4EI6A 3HR5B 5BJTB 3BDYL 2O5ZH 3MJ7B 3BO8A 4ZFZB 1D5BB 1NC2B 1JPGB 4X6CF 2W65B 4UOW1 2PCPA 4QYOA 5TDOB 4NN6C 2YD3A 3QPQD 3ARBB 4X0KA 4NO3A 1RIVL 1K2DA 4V1DA 2YRZA 3QIWA 4M48H 4JZJC 3SBWC 3NABH 4L5FL 2ARJQ 4BQBA 2IBBA 3GSNL 3L7EB 2IAMD 5INDB 4OF8A 3QNXB 3LB6C 3QAZB 3LSOA 4LVOB 2D0GA 3ZZ1A 4YHYC 3NFSL 4NP4H 4YR6B 2Y25A 5H37H 4ZXBB 1NGZB 4JRYB 4X98A 4QRSA 3UTPE 1QUNA 2PO6D 5DJAB 4IRJA 4GH7B 1X5KA 2XQYK 1YJDC 4Z78A 3DSNA 5DVKA 1RK1B 2CDFA 3O4OB 1IVLA 2GSGA 4HLZH 3GK8H 7FABL 1D6EA 1J7VR 1H3PH 2HJLB 3RUGB 3ZE0E 3MOAL 5BRZB 4Z7WA 5AAMA 3W11D 5L7XH 3BP6A 1YEDA 4WHCA 1M6OB 3VXSA 2AI0H 2OXGA 4KJWD 4XCCL 1C8PA 3UZVB 3P4NA 1I1FB 4HXAL 1FSKB 5BVJB 1VERA 2MJWA 3HZKB 2FH8A 2X9YA 3NCJL 3GDBA 3N1QC 1T7YA 3KHQA 2OK0H 3QUKA 4GBXC 1IQWL 4RGOL 2UWEB 1LO4H 2OL3L 4JQVC 3SDCC 4WV1C 2VQTA 3VXRD 3PWLA 3CMOH 3R0NA 3D87B 1F13A 2CLZB 3DXAB 4U1JA 4R9HA 2AK4D 5I1AB 1UA6H 2XRAH 3LZFH 4F37K 3TN0C 1R24A 1MCWM 4OZIB 3TZVB 4ORGB 2A6IA 4ZFOL 3O2WL 1G1CA 4PJEF 3HMXA 3VI3E 5GS0C 2D31B 3VI4F 5KS9A 3CU7A 5IEHB 2XQBL 5F21B 1FH5L 1K8DA 2ZNXA 4QXWA 1KYOK 2W07A 4KH2A 2AQ1A 5B39B 1OP3H 4OKVA 1ZGLA 3MYJB 3RFZC 1VADA 3EO0B 2WBJA 4U6VL 1MHHB 1RZKL 1S7QB 3RHWK 3TT3H 4PJIB 5ITFB 3GMRB 3UJJL 1NJ9A 4N0RA 4OGAC 4UV7H 5IBLC 2CLRA 1XGPB 2E7MA 4OLYH 5SX5K 2J2ZA 4DZBB 4KGLA 3PWUB 5CFHA 4CJ1A 3IETB 5KBNC 3VFPA 4OM1L 3KYKL 4TSCH 5KSBA 3LKRB 3H9YA 4G42A 5D7LB 4C56B 2A6JB 4DVBA 3IJSB 3O6ML 4B53A 4JM2C 3DMMB 4LSPL 1TPXC 2R1XB 5I73C 1MSPA 1XH3A 4K71B 3IDNB 3MRMA 1XMWA 2I9LB 2CJUH 5CIPA 2ORBL 2B1AH 3JTTB 1XGTA 3WFCL 2Z35B 2UZIH 1R3KA 5CEZD 3DPBA 4U1SA 1D5XA 3QXVA 2AJ3B 2ED7A 4G80A 1A1MB 4CUCA 3O6FA 4HIIA 4MQ7B 4N0UE 3QUYA 2IPTH 2XWTB 5HVHC 3IVKB 1MCKA 4JREB 3GMQA 1MQKL 2CRYA 3BGMB 1V05A 3RVWC 1AO7D 1KCRH 4POZC 1R3HB 5C0AD 1CVSC 5C3LD 3F6LA 4WI5A 2J88H 1JPSL 4QRQA 4Z7VB 3GSUA 4HIJA 5HI3C 1WFNA 2QHRH 3ULVF 2ICWJ 4NYLA 2OQJB 4Z0BH 2I24N 3X3GH 3KXFA 2GJZB 3Q1SH 1M1SA 1BIHA 3QPQC 3ARDD 1DUZB 3WBDA 5CJXA 4OLVH 5D1XC 1FE8H 2FRGP 3I02A 4O2FA 3QUXC 3O6FC 1WBZB 4NQCE 1MWAL 3WN5A 1YEJH 4HJ0C 2YKLL 2K7PA 1P7QB 2ZPKH 4M61B 1D5MB 4BFBD 1I8LA 2CDEB 1OAUH 1CE6A 2BVQB 3SDXA 1FO0A 2OR9L 3A0OA 3NFSH 3W0WD 4NNPL 4JQXC 1L0QA 4ENED 1NCCL 1OAXL 1YYLH 4LCCB 5D7JB 3BWAB 4AQOA 3PDGA 4J3WA 3P4MB 5KANG 1OPGH 3TVMC 5EA0H 4WEBL 1M7IA 3GSRB 2YSSB 3T2OA 5HYEA 1PKQE 4LPUA 5BOZG 4OD1H 2P7TB 3FT4A 2XKNB 4S11A 1AKJA 4Y5YB 3WFHB 5T3XE 3EYQD 4W81A 5IQ9B 2FECL 1NCBL 1ZE3C 43C9A 1P6AB 5DD1H 5GGSB 5DC4B 4P5KA 4OCYL 2G75B 3CMGA 2YRLA 1HIMH 3CJJA 4RAVA 2W60B 4TSAH 4FQ2L 5EZJA 3H3PL 5BZDA 5D6DA 2NY0D 1JN6B 4NQCA 5HYSG 4TNVK 2BP3A 4MJ6A 4GSDH 3AM8A 4JN1L 4YQXH 4NQDA 2IBZX 3LD8C 5DURD 3KNBB 5K9KB 5I2IA 3WV0A 3MJ9H 5CMAB 3S5LG 3P0VH 5ID0B 2I60L 1JZ2A 1BQHA 3TA3A 5BMFH 4GG6A 4NP4L 1TVHA 4ETQB 5DEFB 2KUTA 5INDA 3FRPG 2XNAB 4PJDE 4O51A 1RMFH 4OSUH 3RWHB 1AQKH 3FTGB 4YHML 3SKNB 1FVEB 1WBYA 1UCTA 2VZUA 3V8CA 1UWEH 3BSZL 3RVVC 5F9WC 5FOJA 5IW6A 3DVGB 3CFIC 5ID1B 1YQVL 5C6TH 3IJHB 4B50A 4JY5H 4Y4HB 4MJ4A 1RZJH 3T3MF 1A6TA 2GYSA 3H3BC 4LVNB 4F15C 4YDVA 1HHJB 1KB9K 4YDLC 1RJLB 4KGJA 1XGQB 4MJ5B 4Y89A 2R0LL 2APTA 4DN4L 5D2NC 4M7ZC 3QI9C 1MFAH 3FJTA 5C0DA 2A38A 3NFNA 4JFQB 2X4UA 1YEDB 1P4BL 2XRAL 4Z7OE 5I0DA 3EJJX 3RGVD 3BAEL 3FMGH 2RGSA 2E8YA 3MA9H 3FB7B 3GRWH 3LEXB 3RL1A 1FZJB 4MNQE 4K3DH 5CILH 3QCVL 3KYNB 4D0DB 1P5UA 4FQHA 1IQWH 1FL6B 3PWVB 4ODVH 3UTTE 4P3CH 1YJDH 1G6RH 5L88L 2CKNA 3QXDB 4XB7A 4NRYA 1QR4A 4MDIA 2BSED 4UV7L 4KDVA 2OTUB 2UWEA 5JNYA 2CRMA 5MP6L 1WISA 3P4LA 5DJ2A 1KFAH 3DUUB 5DVNA 2Q6WA 2DS4A 1JP5A 1ZVYA 2XQBH 3WJLC 1RZ7H 5DK3A 1IBGH 5EU6E 3RWIA 3VGAC 3BGAA 1FGVH 4NRZA 3RU8H 1NUNB 2ZJSL 4NM4L 1G0XA 3U9UA 4S0SD 3C9NA 4CADB 3SJVB 2BNRE 4HH9B 3V5HB 1VSCA 2DLIA 2AP2A 2QQNH 3MYJA 2VDOH 4PLJC 4MNHB 1H3TA 1JZ6A 1ZGLM 3T8XB 2F19L 2JJVA 3QI9B 1Y18B 5B3JF 3LN9A 4GW4B 3U4BH 4WI9A 3QWRA 1MAKA 1CDUA 4Z0BL 3MOQA 3O4LA 1Q0XH 4PJGB 4FQCL 1BD2A 2J5LB 4O2CB 2HN7B 4PV8A 5I16B 5AD0B 3STLA 3HI5H 4XX1G 5LCVL 5FFLA 4YGVB 5TE6H 4WFGD 3KPOA 3MREB 4KRPD 5IVXB 2A9MH 4M4PA 4I0PD 3PQYD 3PL6A 4MNGA 2BX5A 4PJCE 1ZKAA 2QJDA 1ZTXH 2ZCHH 1UM6H 3B2VH 4JM2D 2QQKH 5IESL 5ACZA 3EOBA 5E8NB 3G6DH 5DYOA 4D9RE 1HYSC 1KSRA 4MJIB 3VA2C 2DLFH 3OZ9L 3VD3A 1BOGB 1FJ1B 4Y4KD 1ZA3B 1JGDB 1UA6L 3SKOA 3CDCA 5F7UA 1C5DB 1D5XB 5EBLB 2AV7A 3V6OC 3RNKA 4HZAA 5E00A 4PJ8C 4YGAB 1ZHKA 2R39A 2V2XB 1JF1A 1TCRB 2UWEF 1DQDL 4QRPD 4YHNB 4R96B 3C09C 2DQIL 4JANB 2YC1B 2ATKB 3ARDA 2FEEI 3X12A 3BH8A 3MRHB 5CZXD 3S5LB 4G43B 3RDTC 3QA3B 3QULB 3OG4B 4FQ2H 2MQ3A 2VC2H 2MCPL 4XCYB 2DQJL 4TPRH 2IAND 4OLVL 4LPCA 1VFAB 1YY8A 2BRQA 3D0LB 5K9JL 3I6GA 4JDTL 5KG9B 3O6MH 3ZHDA 1CE1H 1NGYB 2BNUB 3GMMB 2XZCH 2ATPA 1K9TA 1BBDL 3Q3GA 1ED3B 3EYFB 4BH7B 1WBZA 1I85A 3QH3B 1FPTL 5C07E 4NRXA 3RWJB 2Z8SA 3CLEL 4OZGF 4X99B 1G7PA 4WHDA 4HH8A 4I3SL 1T22B 5D2LF 2FATH 1J0JA 4ONFH 2X4PB 3P73B 3BKJH 1LE5B 1RZGA 1OAXH 4ETYA 1DQMH 2I9TA 1M7IB 1E0OB 4CVUA 4HDIA 5IKCA 2BSTA 5MI0C 3AAZB 2VAAB 1C5BL 5FO9B 1I7ZB 2RR3A 3K2MC 4X7SL 3QEGH 4QT5B 3GMOA 4PJ7E 1MFAL 5T5NF 3VE0A 2AGJH 2XZQH 4N90E 5E0QA 3OTTA 1T1ZA 3DRQA 3GFUA 3B8YA 5E99H 5AG9A 1N5YL 3RTQD 3HE6A 4JDZB 4QTIH 3SY0B 4OIIL 1XR9A 1FL3A 4NKMB 4RBPK 3AXLB 3W5MA 5DJ8A 3GNMH 4L8DA 2X09A 4AH2B 2IALA 4FNLH 3EYVA 4ZNEA 1F4AA 2ZUWA 1JHKH 3DTXB 2ADGA 1MJ7H 4PJ9C 1DUYB 3QO1B 1JZ4A 4ZPVB 4UT9H 2DQUH 4BSWA 1PYWB 3NA4A 3DX9B 3H42H 3RAJL 1OAUL 3DX6A 3QUXD 4NOFA 5EIIA 3QZWG 4U33A 3QIUC 4MQXC 5I73B 3RWHA 3UBXI 1ES0A 43CAA 5CILL 1K6QH 5CGYD 4KK8C 4CN4A 2NCMA 5CBAB 5I71B 4QTHB 3W9EB 2R8SH 1OWWA 1CG9A 4M7JH 5D8JL 3MBXL 4LHUB 4PD4J 1A6TB 4BZ1L 3LS5H 1LDPH 4FQJH 3HAEA 3TF7C 2VLRD 4JPVH 3T1FB 5F97E 1U93A 4X9GA 5FYKU 3U4EA 5SWQA 4NJAL 1RJZB 2DQCH 4FQCH 4PY8J 1GHFL 3W39A 4KK6D 2X4UB 5HHXL 3F7VA 4X7TB 4H1LH 4Y5VA 3WIHH 2IANA 2CIKA 1KTLB 1BVKA 4NWTL 4YDJA 4IOIA 2DQGL 2OTWB 1KTRL 1RZJC 1U3HC 1FL6A 3PWVA 3QCVH 4P2YA 5E03A 2ZCHL 3C6LA 1V3MA 3U4BL 3P0VL 5I19H 1HYSD 1JFQH 2VISB 2YMXH 2E7HA 2H1PL 3ARGC 4UMGA 4X6CB 4WI2A 5D6CA 5DQJA 3VGGA 4ZO9A 2F8VA 3BMVA 4C4KO 4PJ5D 4UV4H 2HJKB 4YC2B 4QY8A 4WHTA 4TUJB 1DBAL 3AS0A 3HFML 1ORSA 3O6FD 2BFVL 1B3JA 4HJJL 1CGYA 3O45A 2B5IB 4NQVA 4TNWK 2DKUA 5BS0D 4RRPA 3OKKA 2DN7A 5IWLA 4KUZH 4HUUB 2V2WB 1HWGB 1JNHB 5M7QA 2HFGL 3VXMA 3VWJA 4K8RH 5ACLA 2EDKA 4Z7NF 4Q74A 3RVUC 3SCMD 3B3IA 4JFED 1S9YA 1TDQA 4JFYA 1CFTA 1BP3B 1D9KC 3BEVB 1AY1L 4PJGE 4P2RA 3SDAA 2Q86A 3SE9H 1NC4A 1IAKB 1LP9B 3KLAB 3CX5J 5DJXB 5AUMB 5MEPB 4YHZL 4DCQB 4LKXB 5TE6L 4FZ8L 4LRNH 5DD5L 5FGRA 3EIFA 3BEWA 2Z31B 4PJFF 1FG2A 1AI1H 3NCFB 2IH1B 4MNGE 3OR7B 1R0AL 1AD0A 4AT6B 5C09D 5GGRB 5IB2A 3BPNC 5CSGA 4WWKC 1ZHBA 3MMEA 4XMKL 2CRZA 1FNLA 1J1XH 2J1KA 3UTQB 2DQDL 3HMWH 3S37L 2VXTH 4M1GH 4GMSH 3T08A 3RWCB 5EO9A 2EDHA 3PABB 1KPVA 1YMMD 4LSRL 3ZL4L 1N26A 3QNYB 3HZMA 1KBGH 4BQ8A 1IZJA 5GISH 3UDWC 3QIBB 3FFCE 5FXCH 2AV1A 1CGVA 3MQIA 3PWPB 4LBEB 1OCWH 4JFDA 4MNQB 2DWEA 5E5RB 3ARZA 3GJEB 2BNQB 1HHGA 1NBZA 1I8KA 5IOPA 2GKIA 4JRXB 3RVXC 3C5ZB 4Q6IA 3OKLB 5DDHA 1YY8B 3MRKA 4MSWB 4CVXA 2A74A 4PJCF 2CR6A 5CS7A 4PTTB 3ZE1E 2XFXB 4IOSD 5C9JA 1PLGL 2YZ1A 4O58L 4UINL 4BH7A 3AY4A 3LRHA 3HG1B 4J4PA 1R5VA 4HV8B 3AB0C 4MA8L 4NUGH 1UZ8B 3FL7A 4ZUSB 4Y1AA 1MJ8L 3BPOB 1IC5L 2ADIB 2P47B 1HHIA 4I4WA 3P73A 2UZYB 4XBGB 2NY3D 3FQTA 2DQTH 4F2MB 4K2UH 2FBOJ 1ZLWK 5JXED 1AXSA 1HI6A 5F7EL 2SEBA 4XBEL 5E6IC 3BUTA 1QTYT 3QAZC 3ZSSA 5CBEB 3BN3B 2EXWD 3C2SA 4XCEB 5ESAB 2VDMH 2MCPH 4LSSL 5CHNA 4H0IA 3SY0A 2Z91A 1E4WH 2H41A 4L4TB 1FLTX 2DQGH 3MXWL 4J1UB 1E28A 3PV6A 2M8XA 5CGMA 1NUGA 1W0WB 2MPAL 4EVNB 1U3HD 2HYMA 3TBYA 3OKNA 1QBLH 2BVYA 4WY7L 3SCMA 1JF5A 5KAQG 4PJDA 5EIVA 5I30H 1WVZA 3T2NH 1HCVA 4L4VE 3QDJD 4U6YB 1RHHA 4RFEB 4I2XB 3O2WH 3C60B 1BQHG 1I3GH 3PGFL 4FQIH 3HFMH 5KSUA 2P1YA 3WJJC 2A1WL 1BEYH 3LS4L 2VABB 3DVNA 4GAGH 4XPBL 3UYPA 5L2KA 3U48A 4U3CA 3D1MC 4B0MM 4KDTA 1LK2A 4WFFE 3TO4B 3H2WA 2P8MB 1X5XA 1GGIL 1JPTL 3OKDA 1U8OB 3IYLW 3L3DB 4KKBD 2F54D 3NPZB 2E9IA 3RPIA 3MR9B 4P23C 2NX5D 2CR3A 4QHMB 2NLJA 1MQKH 2PF6A 1XF2A 2VYRE 4FQLL 4Z7WF 3MJ8A 4JFHE 4ZYKA 5IJVA 3RVUD 3SCMC 3E1F1 4POYA 3FB8B 4F7MA 2RFXB 4PRDA 3T04D 4I48A 1KIPA 2CQVA 4UDUA 2B0SL 4NNXB 5ENWB 2F58L 1T3FB 3UJJH 3K2UH 1BD2D 1MVUA 3OX8A 5EBMB 4IRZL 2APWA 2BHZA 2VXUH 4XXCA 3DX8B 3IXAB 4J3SA 1VEMA 4KKCC 4AEIL 3U30B 3BMWA 3TYGH 1U8MB 1D5BA 4KQ4L 4HFUL 5F7MC 5GIRA 4U7KA 5E8PB 4X6EA 2YHGA 4PBVC 1A6WL 3OHXA 5D1QD 2A9NH 4PJBA 3QQ3A 1H5BC 1DFBL 4PJAF 4HKZA 1X5FA 4BFGA 1REIA 3DIFB 4FTVE 1TPXB 3BN9D 3EHBD 3HZYA 5J06A 2VIRA 1X5HA 1LDPL 2EIBA 5DUBA 1GRWA 4M3JA 1CD1A 2VDNL 2FX8H 2BY3A 3CK0L 3QUML 2NY3B 2XG4A 4Y4KB 1CF8L 2J8UB 1CR9H 4FRWA 1OCWL 4M1CC 4KUCD 5JHDD 4Y16B 1WEJH 1ND0B 1RU9H 4L8CB 5T3ZD 3WS3B 1HHKB 5EU7C 5K9QI 3IU4H 5E5MA 1JNLH 1U6AL 2YA1A 4MMXC 3ROLA 1FE8L 3ECBB 1QRNA 4KI5C 5J13C 3M45A 2NY1D 1I3RB 3KJ6H 4LSUH 3MV9E 4HAGA 2BC4A 2H3NA 1RUKL 3QJFA 2CUHA 1DSFL 4MA7L 3MV8D 3E0GA 3HB3C 2VDKL 1AD0B 4KI1A 3G5XA 4X7DC 2F74B 2EYSB 4Z9KB 1DBAH 2EDNA 4OZIE 1UG9A 1U8JB 3ESUF 4JY4B 1GC1C 1S7VA 2VE6B 4GBXB 2LVEA 4WEBH 4GKNA 2VSCA 4JO4L 1S9WB 3NPSC 4ZQKB 5B38A 5E6ID 2LU7A 4MQXD 1HILA 1WZMA 4GKSB 4NNPH 5E2WL 4HK0A 5I1AA 5IEKA 3MJGX 1S9VB 2PW2B 2AEPH 2PTUA 3O0RH 4LLYB 2ZUSA 1NAMB 1OTTD 4X4XB 2X4OA 1K3IA 5DURB 2W0FA 3MV7B 1CS6A 4Q6IC 1JNNL 5GISL 4KVNH 1K8DB 4KKAD 4HC1L 4U1IA 1MHHA 4JDVB 1N3NB 1J0YA 5GRUL 5DDHB 1L7TH 5DVMA 1QRND 4Q9QH 1PD6A 3GMRA 3MRKB 1OTSC 2V5MA 4MSWA 4O9HH 5F6IC 5BRZE 3HE6D 2Z4QA 5DLML 3RUGE 4K07A 3OAUL 4LEXL 1AQKL 1YDPB 5SWZA 1SVZA 4YBHA 1UVQB 1AI1L 3MO1A 4R97C 4OUUA 4DZ8A 2BY2A 5D7LA 4C56A 5DT1L 1TQBC 4ZODA 3PP4H 3TYFA 4FFVD 2VMFA 3QIWB 2PYEA 2KZWA 1HHIB 3RWDB 3U0TB 3UAJD 4NKIH 2VR9A 3ZDYF 4HIEA 1CGTA 2BVTA 1D6VL 3N9GL 3P9LA 4RSVA 1AGBB 1V3LA 5EA0L 3PGDB 5D72L 1PG7W 4P49A 2GITB 1URLA 4UTBH 1BVLA 5JPMA 4I3RL 1AR1C 5DJ0A 1X44A 1XGUA 2GSGB 1DQQA 3MFFA 3KYOB 3RNQB 1BLNB 3MJ9L 4H88L 1IFHH 3FB5A 5I75C 1J8HD 3FAXA 5DR5L 4O02L 3VXQA 3V2AR 3DVIA 2VB5A 2G5RA 2VZ3A 3BWUC 4QRQB 4Z7VA 2Q1EA 5HI5D 4D0CA 1OW0C 2EKJA 5JR1H 2G2RA 3WHE0 5D2NB 2FL5B 4PGDB 3UMTA 2GJ6B 3GHBH 2ITCA 5SV4A 5HPMB 4WWKA 1RZ7L 1IQDB 1H3GA 2IPUG 3QUYC 2HVKB 5ALBH 1U41A 1BAFH 3HZVA 3H9HB 4M9OA 3I9GH 5DMIH 3MLYH 5IHLB 5KSUB 4XPAH 5LAXA 5JTWA 4MA3B 1YA5A 3CNKA 4GAJH 1OB1B 3WN5B 2FYYA 4X4ME 3BYTA 4PJ8D 4GXUM 3S88H 4NOBA 2DKSA 3PWLB 1OF2A 4M61A 3NCCB 1D5MA 1F4YL 1YEFL 3G5VB 5IR1A 4U1JB 3WXWL 5ISZA 1BFVL 3NA9L 1W0VB 3K4ZA 1JTTA 3BZ4B 5IP4A 12E8H 1NAML 4EUPA 1RI8A 3KLHC 5DUMH 1P2CB 2NY4B 4UAOC 4NKQB 5AZEL 7CGTA 1AKJD 2ZUUA 5KSAC 4JFEA 4F7MB 2A6DA 3H9SD 4K9EL 2EIDA 5F7NC 1NDGA 4BZ2L 1FVCB 3MRFA 3K2UL 5KSVB 1RIUH 5C07D 4WIQA 3VW3L 5L8KB 1G9NL 2CLRB 3QNZA 4UUJB 4HBCH 3EOAA 4WEUD 3D85A 2CLVB 4NCC2 1KC5L 2NW2B 1T2QH 3KPNA 4X6DE 3T2NL 2VERN 1FL5B 3EYSH 4UDTA 4JGJA 1ZANL 1KB5H 3RWGB 3VFTB 3CFDB 4GG8A 1QSEA 4YX2H 2O93L 2Z0BA 2AJSL 4YPJA 5T3ZL 1UENA 1CICB 4XP9H 5CMAA 3VRLE 1S5HA 3B43A 1BQHB 1H3VA 3TA3B 5DRXB 3JTTA 1XGTB 4GG6B 3WO3B 1UXWB 1GGIH 1DANU 1JPTH 1NSNL 1UM6L 1UH2A 4NFDA 1R3KB 3ORJA 1KT2B 1MFCH 2XKUA 4LDLB 4KHTH 3C2AL 4RGNE 3EO9L 3GSQB 3IVKA 3HI5L 1FNEB 4QGTA 3GMQB 4HMCA 4QWWD 3NBNA 4Y16A 3RVVD 1C5BH 1UH4A 1R5IA 1AGDB 4PRPA 1G6RB 4L8CA 4EI5C 3QEGL 4TOYL 1FP5A 1IAIL 3P9MA 4ZFGH 3MLZH 4RNRB 1ZTXL 3QUZC 2X4TB 5DD6B 2ARJA 3ZO0A 1WUNT 5EUOF 3UJIH 4PTUA 5I1JH 4DGIH 2WM0A 5IMLA 3H0TA 3ILQD 5HDBF 2X6MA 4TQEH 4EOWL 5DMYA 4LIQH 4A6YB 1FNSL 4Y5YC 15C8H 1PX3A 3SDAD 2YPLA 3DO7A 3ME0A 4U1KB 3TIEB 4E5XA 1EH9A 3QEQE 3WJJA 1DUZA 4PG9B 3JWDC 5KN5B 2NY2B 1BF2A 2BOCB 1A6UH 4KXZH 2F74A 5HHOE 1EEZB 4HG4K 5HYJA 4EI5B 2VDQL 1H9VA 4OBSA 3V95A 2A73A 4J3TA 4CU7A 5GS2D 2XZQL 3IDGB 2Z31D 4PIRF 1FC1A 5IB5A 4KUCF 3BWAA 4AG4H 2DM3A 2JB6A 4JZNA 2ZG3A 4HHAB 3FAWA 2X05A 3GSRA 1NBVL 2YSSA 2PTVA 1NAMA 4X4XA 5E6YA 3QISA 3RWFB 3LKNB 2WZPD 5E9DD 3ZKMD 1KXQE 4MJID 2DQIH 5C08E 2E27H 5C0JA 2W91A 4PRPD 3S36X 1YECL 1JHKL 4JFFA 2HTLD 5IIEA 4N9GA 5CEXB 3K8LA 1GIGL 4WI7A 3EOTH 1WLHA 1XT5A 3AMKA 4M43H 5I17A 1A2YA 3MODL 2GAZA 2XTJE 5EZJB 1BD2B 4IBLT 2CDGA 2WMPA 4UTBL 1CXHA 3O8XB 4JKKA 4JZOA 4L4TD 5C0AA 4MJ6B 3DUSA 3FQWB 5K9JH 4A2MA 4OLEA 1OGAA 2D7TL 3OKEA 2LFGA 2G60H 1P53A 2H2SD 3WNOA 5DVOA 1MFEH 1N8ZB 4X5LA 1FNGB 4YGVA 2AEIT 5KVGH 4F7CB 5BV7H 5DF0A 4XH2A 4P2OA 2XWBB 4DGVH 3PDOA 1WC7B 3K8KA 3UXFA 1IM3A 1S7SA 1Q38A 3QG6A 3U0WL 5DRZA 5FA4B 5HVHB 4PJ5E 5I1LB 5DYOB 3H42L 1T0NA 5EORL 5AYUH 3RAJH 5CEZH 1J05B 5IV2A 3A6CH 4Q9BA 5DUML 1U36A 3KPRE 4N0FB 1C5DA 3MRGA 2R56H 3VG0H 5TJWK 2W59A 1A1NB 1KTKE 2AXFA 2EH8L 2GT9A 2IFGA 4OB5L 5HGBB 5GJTH 1X5AA 3G04A 5D7LD 1CFNA 3K3QA 4C56D 1QYGH 4CU8A 2R2BA 3OG6B 5D8JH 1N2RA 1RJLA 1BMGA 3IDXH 4CDHA 1A9EB 1XIWB 3MGTA 4LSQH 2GSIA 1A3QA 2EC9T 2KL6A 3WDJA 3IAQA 1J88A 1KC5H 3KG5A 3QA3A 1IGCL 3BZEA 4NZUL 5IQ7H 3JV5A 4H25B 4PGBA 3G6AA 3K74B 4TULL 2DLGA 3RL1B 1FZJA 4XCYA 3WFBH 2VSDA 5D1ZB 4DKAA 2P5EE 4NDMB 3T3ME 2WP3T 4P99A 4DEPB 2AVGA 1CLZL 4WWKB 4Z0XB 4KI5D 5KVEH 2CIIA 4FNLL 3R1GH 2HA1A 1QPPA 4LNRA 3GSOB 1JWSB 2V9QA 1T7XA 1G7LB 2ATPB 1XEDA 1EO5A 5LAXB 3O6LL 5JUEH 1DVFA 3TFKC 3RWJA 4JE4B 3O41A 4NBZB 4FABH 1PW3A 3S88L 2FHFA 2BSSB 3SDDB 1D6VH 3N9GH 1K4CB 4HK3N 3SQOL 5A2FA 4OV5A 4WFED 3TJEL 1DTUA 1DQJA 4XWGL 4QHNA 3DI3B 3GSNB 3BKCH 3HPJA 4BSJA 1TZGH 5JDSA 3MBXH 1AE6L 3BKYL 4R4FH 5MHSE 4KK9C 1IGMH 3ZT5A 2RHEA 1IKNA 4WUUD 5I19L 5LGHL 1F90L 2HJFB 3DO3A 2IQAA 5HD8D 3TWCL 1MCJA 1DR9A 4KROC 4NCDA 3ARED 3OGCB 3WUWA 1JZ3A 5KOVC 1CWVA 5HHNB 1FNSH 1RIUL 5GRJL 4O2CA 1U8NA 5TQ2L 2LVCA 2VLJA 4BH8A 4DUVA 2P5EB 1IKFH 4U05A 1HXYB 3OF6A 5FCUH 4UDTB 4AEEA 5E2TL 1QLFB 3ARVA 3EYSL 5IM7B 1U2CA 2ZOKA 4JFZH 3HE6C 4V2BA 1MHCB 1RD6A 5J6GA 1FYTA 3MRIA 4G8EA 4IOFC 5GZOC 4GFTB 4C57C 1GC1H 4ALAH 3OKYA 1ZMYA 1PYWA 5I1EL 3D69B 1HKFA 1AFVH 3DX6B 3OJVC 2Z31C 5FYKD 3DROA 4X6BB 35C8H 3TV3H 5C70A 5FKAB 1AY1H 4F3FB 3GJFA 3FCTA 1GH7A 1IAIH 3KPRB 1X7QA 2BSRA 3SE9L 1HHHA 3B9KD 1WSST 4OGXL 4PJ5B 4UOJA 5JW5B 5ABDE 1I8MB 3OPZH 4HSQA 1CGSL 3QR2A 3X13B 2D0FA 3LEYH 4LSRH 3TVMB 4XP6H 4M8QA 4PB9H 2E8ZA 3U4EB 1KELH 3GB7A 3AC0A 3JZ7A 4WW2F 5E7FA 3DYPA 5FUCC 3IDUA 2CIKB 3PWJB 2AJVL 4F9PC 4HS3A 4L8SC 4IOIB 2XTJB 3S35X 1GGTA 1HH6A 3QUXB 5KG9A 4P4KA 4P3DB 3NAAH 4LHUG 5DO2C 5HHPB 4PREB 5B8CB 2YUVA 2VUOA 3TNMA 1G1YA 1Q0YL 2P5WD 3HNTH 32C2A 1J11A 1IC5H 1MIML 1G7PB 1EFXD 4AENA 3GIVA 4ZS7L 3ZT6A 1RZFL 3A6BL 3VXPA 5F7DB 1LO5B 1OT2A 3TBVA 4Y4KC 1A7RL 3L3HA 5ITBH 1BGXL 2WINA 2HLFD 2YN3A 4QY8B 3BP4B 4ISVA 1H3WM 2ZWLT 4JZNB 1ORSB 3ULUD 2V7HA 3ARFB 1A7BA 1N0XL 4Y7MA 4XVJH 4RMWA 3EYOB 3GM8A 2Q7YA 4JM2A 3K8MA 1KCRL 4QHUB 5EUOE 5DGRA 3V4UL 3UYOD 5C09E 2HWZH 3DUHA 4G6KH 1JMZA 5HYJD 5FA3B 4D3CH 3MA9L 4E9LA 2FX7L 3QZWA 3GKWL 5B39G 4EKXA 5I8EB 2GAZB 2IGFL 2X4SB 1KN2L 3B3IB 5F9DC 3I50H 1BWMA 5HDQH 4FQIL 4QRUB 3KJ4B 3FT3B 4DGVL 2CUIA 4KU1A 1AGEB 2J6EA 3AREA 5T1MA 4P9HH 1IMHC 1JIBA 3PJSA 1FNGA 4RISL 2V7NA 2C5DC 4P9ML 5DJZA 1Y6NR 3W11C 1BZ7B 3HLAA 2DL2A 3M1BB 1T5WB 1WCBA 4Q6YA 1IEAA 3CC5A 3ARRA 1P1ZA 1U8HB 4FQXD 3UTPD 1K4DB 2IFFL 1UQSB 3UYRL 4EJ1C 3SQOH 4LSSH 4YHMH 3P9WB 1L6XA 1DBKH 2VQ1B 1A3LH 1MWAB 5JQHC 2X1OA 1F2XK 5CKAA 4O2EB 1RPQA 3U7WL 3MRGB 5JXEC 3H8NA 5BXFB 4L8BA 4KMLB 1IGML 1Q94A 3LQMA 4FQQA 1XGRB 3T1FA 1B88A 2XN9B 1AHWB 3BPNB 3IFOB 5IF0B 4C83A 3EO1A 3PWPD 1ORQB 2RCSL 1QFPA 3MNZA 3VFGH 3LH2L 4AEHL 2GSIB 3GSWB 1H0DA 3G5YA 4P23B 1ZLUK 4RAUA 2IEPA 5DXWA 4QXUL 2A0LC 4JJ5A 1PY4A 3NZ8A 2NQCA 4HZLB 3UPCA 3VI4E 4XP5L 3SGKA 2MOVA 4X6DB 5CD5C 2OTWA 1CZ8H 3QFDA 3F7YA 1FV1B 4P4RB 4Z0XA 4X4MA 4PJAA 5DI8B 1MH5A 1EXUB 2ESVA 3S3SA 2GK0B 3SGDH 5CWSB 2DYPA 4GUPB 3VCLA 2ENSA 4KRNA 5F96L 1G7LA 3NPSB 1IL1B 3IDMA 3PL6C 3HS0B 4N5EC 2VDKH 5IK3B 4ZFZA 1MLCA 4WVRA 3HCVB 3FN9A 2CUMA 5E8OB 3MV8E 3RWEB 2Q76A 2W65A 1LEGA 2OI9C 4LLWA 4HWUA 5JXAL 3A6CL 1SYVA 1MFBH 1Q9LA 5KZCD 4H8WC 2HT2C 1UB5B 4UTAH 1RU9L 3ZKSD 4OZ4B 4NQVB 2NMSA 4QHNB 4YXLL 3L7EA 5I1GH 5JDSB 2DTML 1Y0LB 2J12B 3LSOB 1QYGL 2FIRT 3OKKB 2VOTA 5FUOH 4NC0B 3U46B 1UGNA 2NXZC 4F7TA 3ZE0F 1NC2A 2ERJB 3TGXA 1WJ3A 2X9WA 4FFZH 5GSRA 4K7PH 1OTSD 2MHAB 4XNUL 3N1MC 1RUMH 1RUQH 2WUBH 2NY4D 3MNWB 5DEGB 1T4KA 5H2BA 3I3EA 5EWIH 3JWOC 4BH8B 2G5BA 4U3XA 1DFBH 3KHOA 3B9AA 4GAFB 4NSKB 3HI6L 3B5GA 5C8JB 3TCLA 1B4RA 4BSVA 3OKNB 2LAAA 4JGUA 1NGXA 2WW8A 2YD7A 4EBQH 5FDWB 2WNGA 3VFOB 1WV7T 1KIQB 5DJAA 1T5XB 5C0RL 3OAZH 3EJYD 5E2WH 1QSED 1SMAA 2YD4A 4RFEA 2JJWA 3FQUA 5D1QC 1ZHBB 1UKQA 3FHQA 1IEHA 4M6NL 3TJEH 2VDLL 3VRJB 1I1YA 5IFHH 1AO7E 4ZUTB 4JHAH 5KJRH 1T03L 1IE5A 5MEQA 1D9KB 2HG5B 4QRRB 4I1NB 2YUZA 4OCSL 4XPTH 4PJ5A 3EBAA 5GRUH 3B9KC 3J7HA 4Z5RB 5EU5B 5E8DH 3RPKA 4CBPA 4QOKA 4ORGA 1EEYA 5J1SC 1J0HA 1LWRA 3PGCB 4ZDHA 3VMPA 1I4FA 1EIBA 3WIIH 4TTDD 5JLZA 2QADC 4LAQL 3OKOA 3WO4C 5A2LH 1FRGL 3D39B 4PJFB 4JM2F 1JNLL 1U6AH 2FJHA 5C0AE 4Y5VC 1R3IH 2H2PD 2MKWA 3D3VE 3OKLA 4WJ5B 4HS3B 4XX1E 4YWGH 1QNZL 2A74B 5FKPB 5FOBB 1KTDB 4XNZB 3T0VA 2FX7H 2X1PA 4IHOB 2D31A 4M7LT 3LKRA 3UEZA 2BRRL 5F7HA 2NXZB 3IXAA 4OQTL 5FUZL 3F12A 2CK0H 4WU5A 2BOBB 4ZUSA 3CX5K 4LGRB 3NGBB 4HJ0D 2FHBA 4JFPB 1MF2L 4LVOC 3CMOL 2HT4D 4DQOH 3CH1A 3FRPA 5LJYH 2APVA 5ITFA 1KEML 1BGXH 2HKHL 5EZOL 4XP4H 2G9HB 1OL0A 4V2CB 5CZVL 4NQSB 3WS6A 2NY6B 1LEKB 3DIFA 3BT2H 2IBZY 3QXUA 4PS4L 4H8WH 1P4LA 3MCKA 5C0CA 1S8DB 4GW5B 3CSGA 3ZSTA 4XCEA 1PKOA 4Y4FA 1KCKA 1CYGA 5TH2B 3CLFL 3QHZH 1IRAY 4KV5F 4CGTA 2AEQL 2VUYA 4H88H 4EVNA 3ECBA 5B3NA 4G5ZH 4B5EA 1NGWB 3S6CA 2PUQT 5T1MB 2AJ3A 2OQJA 4HIIB 1YN7B 2J8UF 4JM4L 3QJFB 2GJZA 1NFDE 1WWAX 2EDFA 4OD2B 5D72H 1C08A 1RHHB 3QFJA 4IDJH 4Y19E 4LKCA 1HKLH 2HVJA 5F9WB 5E4EB 1N5AA 1R3HA 2JJTC 5D7IB 4G9DA 4JPVL 5SWZD 2X44D 3CU1A 5D7KE 2J8UE 1Q9KA 3MLSH 1CE6B 3MBEC 3DLQR 3NFPA 3LH2H 4FTVB 4X7SH 3KXFB 3CVHH 3GUTB 3MR9A 4IJ3C 2APXA 4KMTH 1RZIB 4Q7DA 1NGPH 5IEKB 5I1DA 4NO2A 2JF1A 3MRPB 5EULV 4P2CG 4Y2DA 3GSWA 4APQC 3NIGE 3CPLB 1J8HE 5I8CB 2AJZB 1JGUL 5FYJD 1IGIL 4I48B 1U8LA 4UNVA 3G6JB 3RGVC 4UDUB 4Q58C 5F96H 4TQEL 4HS8L 4PGEA 2GQHA 4WW2C 3CXHJ 5K33A 4KKAC 15C8L 2G75A 2ESVB 2FEDD 3ETBF 1V7ML 5TE7H 1FFQA 1GOFA 1TZIB 3B6SB 3CFBA 1JHTB 1HK6A 2YMXL 5J6HA 3ILPA 2Q7NA 5CEYA 5IWLC 2PO6A 4I18C 3C6SA 2N4IA 5E8OA 2ICEB 2Y23A 1B0GB 3GBML 3MC0A 3RY6A 4HFWA 5D1XD 1CQYA 4I0PB 5LGKA 5J11B 2DI9A 4YEFA 3I6LD 2C3VB 3TYFB 4XNQA 1JMXA 3I6KA 4BZ2H 1CLOL 4K3JL 2PR4L 3QQ3B 4PGCA 5CJQH 4K8RL 2EDLA 4XB8A 3HZYB 1MCRA 2VLKE 4HX1B 4O51B 3SGKC 5FEBA 1QLRB 4UU9B 3S3PA 1UC6A 3OB0K 3SKNA 2VLJE 2R0KL 4U6HA 4PJHF 2J8UA 3JXAA 3REVB 3L5JA 4I0CC 4XNUH 1AGBA 5JHDE 2UYLA 4Y4HA 2BY1A 1U8IB 1Z0MA 4XWOC 3C5SA 5FYKH 4I2XE 4TUOB 4NKOB 1T6WA 4WWID 2IADB 2UUDH 3DETC 5CP7B 3SJVD 1INDL 4R2GD 5E94B 4EQ2A 1BREA 4K3HA 3LKSA 4GQPH 1TTUA 2X7LA 4DK6A 1UCBL 3UTSD 1MWAH 4UT7H 1FN4A 3QIWD 5D2NA 5L0QB 1E27A 3VFOA 3EO9H 4L4TE 4FQHB 5HGGS 3T65A 5FYLH 1R5WA 2N7BA 5IHBA 4GW1B 1O7SA 5MENA 3HZVB 1OSPH 1NEZB 2HKHH 3U36B 2GY7B 3I3DA 1I7UB 1RUPH 4ZUTA 3VJ6B 5BV7B 1NKOA 1TFHA 5MEQB 4LNVA 1MJJA 5EU4B 3C6LC 4NQCD 1FZKA 4X5XA 1QR1A 4JPKH 1GIGH 4ZTPL 1JV5B 3WDHA 3FKUS 2VDML 4Z5RA 1MCOL 3KYNA 5JW3H 2WQRA 3UO1L 4QWWC 4DVRL 1IJ9A 4O00A 3L5HA 2OX5A 1T04A 2XKSA 4FFWC 2GFBB 4KJYA 2A6DB 1XIWC 3ZTJH 2D7PA 3PE9A 4RMQA 4LGPB 4NGHL 2QHRL 3QJHB 5FGBA 1A7PL 3LV3B 2DICA 4WJ5A 3UPRB 3EDEA 2YD5A 2Z4QB 3K4DA 1PSKH 3D3VA 2NY6D 3AY4C 3KPMB 4PJEB 5FYJL 3SO3C 3B8SA 1JZ8A 1X4ZA 1EX0A 3GSVA 1RIHL 2XXCB 4NRZB 3T2QA 3AB0B 4IHOA 4NZTH 4R8WL 3MLUH 3U9UB 4FTVD 5AD0A 4L3EB 5GRWA 4PR5A 1JZ7A 1QFOA 2WWKT 4CAGA 2HFTA 1F58H 3QDJE 3FFCB 3CFDA 1V7NH 4R7NB 3TZVD 1LK3L 1TJIL 3PL6B 5JQ6L 1UH3A 5IFHL 3W5NA 3O11A 5D4QA 4U1MB 3DV6B 3LQZB 4HKJB 4C55A 2R9HC 3PP3H 4XP1H 5A2JH 3PGDA 5I16A 4YDLB 4ELME 4OFPA 1M05B 5F88A 4NNYA 4XHJD 5HHME 5DJ0B 4EIZC 1FNEA 2B39A 4JFFE 3R4DA 1QBLL 3MRLA 1FFPA 4WY7H 5D71H 5E2UL 2PW1A 3KPTA 5IBTL 1DQQB 5CJXC 2B5IC 4MNGB 1QFUL 5DS8A 4APQA 2C4FT 4K7PX 3K0WA 1YECH 1MAML 4TNWF 3EOTL 1KCVH 1PG7X 4D0CB 2AXGB 2JJSC 5DFTA 1MCCA 4PLKD 4UQ2A 3GRWL 1NBQA 5FM4A 4P46B 3MLXL 5FYKE 5E00B 4L9LA 1DVFC 2E9JA 3H7BB 2KPNA 2WQ8A 2Y06L 4U1KA 4IOFD 1KCSL 1P7QD 3VFSA 1GJIA 3H9HA 2V17H 5FECA 2BK8A 1SEQL 1AGCA 3MLVL 5KVGL 4OD3H 3QHFL 3BH8B 2IC2A 3ZYIA 2VN7A 5CJBA 2P24A 5T1LB 3R0MA 2F8OA 1NMAH 3PQYE 2EO9A 1U3YA 4G3YL 1TMCB 4Z7VF 4H0HB 4FTVA 1W0VA 2C3HA 4GBXD 5TDPA 5JORA 1XR8A 4LVHB 1LO0L 3A67H 5LXGL 4EQ3A 5DD3H 4OT1H 5IROA 5D5MF 4WI3A 4JCMA 2VLLA 1WGOA 5LCVH 3QQ9D 3OPZL 2JB5L 3ELAT 3Q3GB 3DNKA 3DYMA 4NZRH 5L2JB 2VL5A 4P57B 1FGNH 3ARBD 5B4MD 4KVCH 3RDTA 1O0VA 2H32H 1HEZA 3X11B 1BZQK 4J6RL 2BNRD 2CXGA 4BFIA 3ZTJG 1OSZA 3UTSE 4UUJA 4U49A 4N9GB 5CEXA 1EGJA 5F1KC 4PGEB 5GRZA 3EOAB 1NCWH 3BVNA 4NKMA 2R4RL 1XCTA 2EDOA 4G7VH 4ZNCD 3GBMH 1MNUL 5LBSH 4L8SA 2AS5M 1NKRA 5K59E 4KKCD 2O26U 2Y07L 4XXCC 4TRPH 3DTXA 4GRWH 4QT5A 1I7TB 3GHEH 3BE1H 3O6LH 5CP3H 4P2OB 3Q6FB 5DRXA 4P4KC 4CNIB 5GGUB 4HUMB 1JYVA 5E1HB 1FL3B 2ZZUT 3LIZH 3QG7L 1QLRA 4HIXL 4UU9A 4JPWH 4K94L 3PDDA 4WI4A 1MY7A 4WW2A 1UM5L 1YMHA 4KK5C 1B4JH 3EKCA 1FQ9C 1FZOB 1YEIH 3PHOA 1EUUA 3BP5A 3AS2A 1XIWD 4KRLB 1U8PB 2ADGB 5GXBB 2BDNL 3QO1A 1DUYA 1J8HA 1G7IA 2QR0B 3CFCL 1GAFH 1UM4L 4WU7A 4DOHE 5ICZA 3D5OF 2OCFD 2X4TA 5DD6A 4OZIF 2R1WA 3TBTB 5HGHA 5E2VL 5I66A 1E6OH 4RWYL 3OZ9H 1AGFB 1ONQB 3NCMA 4POUB 3LKSB 3I50L 43CAB 3V8OA 2VC2L 3CSBA 2YK1L 3VDBA 1YN6A 3EYUH 3D18A 1JGLL 3BZEB 1KB5A 5EU6D 3DXAD 4E5XB 3BRFA 3SE8L 3SOBH 4I5BA 1BJ8A 1LO2H 2A9ML 4JKWA 1WZKA 3U0PB 4WO4B 1RJYA 2JIXD 3P0YH 3HR6A 3BZFA 5C07A 4O4YL 4HQQH 1R6VA 2ADJB 3L7FB 4LNRB 5HYJB 4LCUA 3ZDZF 4PJ7B 2YWYA 3LEYL 4MD0B 5ELIA 5FV2A 3QEQA 1MEXH 5LQBH 1RUPL 2HJKA 1MJJB 5EU4A 1VA9A 2B4CH 4YHKL 4ZSOA 2IANB 2HH0H 1HE7A 4NZTL 4X7EC 5TGBB 2JE8A 2EE3A 2BSSA 3SDDA 1IGTB 1TCMA 4D8PA 3JWDL 1JRHL 5EO0B 3O45B 1DEEA 2A77H 4UIMB 1DBMH 3HC0B 3NAAL 2GFBA 4PYGA 3P3YA 3C6LB 1EAPB 4XCCH 4EI6B 4G8IA 2VLRE 4PRPE 4WTXA 3ROOB 3VFGL 5J1AA 2H9GB 4K55A 5BOPA 1S3KH 2KH2B 4MAYA 3VRIA 3QJHA 2CRIA 1BF8A 2DBJA 4NCC1 3VH8G 3ULUE 3WUWB 4KAQL 1EEUA 4PRHB 1MJ7L 1QVOB 3VXUE 2OK0L 4P9HL 1ZXQA 1FLRH 1NC4B 5BS0E 3KLAA 1DQLL 1NLDL 3OQ3B 4Y8DC 4F80A 2DQEH 5BVPL 3BI9X 1Q8MA 1X6LA 4YC2C 3PDOB 4X6FA 5C0IA 5EUKB 4P2QD 3L5IA 4YHIA 3UAJC 2FZ3A 1S9YB 5JPNB 3S36L 1QSFD 1U0QA 3MOAH 1IAIM 1WQVT 1D6EB 1UYWH 3DROB 4X6BA 3AVEA 1T83C 3UTQA 2JCCE 4WCYH 4O02H 4WTZA 3WN5C 3KPRA 1VACB 4C4KT 5INCB 2IAMC 2ZKHL 2YOCA 4LASH 1I1FA 2Z31A 2B1HL 1G9NC 2NY2D 4Q9QL 2W9DH 3W2DL 3RHWF 5CD3B 2AV1B 5IVXE 3WNMA 4M8QB 4H25A 2WV3A 5JW4Q 3QPXL 4P46A 1EA9C 1FIGL 1MPAH 4N1EA 3H7BA 2DOCA 4HUNB 4Q6IB 1ZT7A 4PRHE 4PLKC 1B2WL 4S1DC 5DC0A 2CIIB 4TRPL 4CVXB 1ZT1B 2CLZA 4BZYA 4G3YH 2FNBA 3GMPA 4LCWE 4DKFH 5T3XD 3IFNL 1WZ1L 5IEHA 3EFDH 4XVUC 3B9EA 5FYJU 2YUWA 5C08A 4P2RD 3T0WA 3GI9L 3LZFL 4KK5D 3S37H 3VXPB 2NY5C 3LKPA 4M1GL 3E6FA 5EPMB 1ZGLB 3UTZA 1VADB 3EO0A 1PQZB 2F53B 1XR8B 5JA8B 3MRJA 2XT1B 4NZRL 4Q0XH 3IFPB 4A2LA 2X4QB 1KB9J 3V79C 1EPFA 2R23A 4ZAKB 5GQBA 5EOCL 3WE6B 2OSLB 2UVEA 2AJXL 4LMQE 1UWXH 5I18L 3FQRB 1P6FA 3T4YB 3T77B 4JB9L 3HMXH 1E6OL 4KJPC 2X89A 3B2UD 3IJYB 2R4RH 1MAMH 5HYJE 3BGFC 1FRGH 5HHNA 2VWEC 4GMTH 1VCAA 5TPWH 3BVNB 2XY1A 3ZYOA 4XGZA 4YIQA 4XAKE 3MRRA 1XCTB 5ALBL 4M1CD 3U82B 4PRIA 4EN3C 2EKSB 3F58L 3L95B 2HMID 4PUBH 1QQDA 1D5IH 3M8OH 2DIJA 2FGWH 1QP1A 2V17L 3VD4A 5ANME 3U9PL 4PJBE 3SCMB 3CUPB 4YX2L 1FZMB 3HI6H 3D2UA 4ZTOH 4MQ7A 1BX2A 5DJZB 2CK0L 1IGJA 1DBBL 4NQXB 1UWGL 4N8VA 2GEEA 3GHEL 1WCBB 3Q0HA 3OSKA 4JHBA 4YXKH 4DOHB 1RK1A 3KPSA 4JO2H 1GPOH 4FFVC 4H5SA 1B9ZA 2HJLA 3RUGA 4LHUD 4DKEH 4K7PL 4LU5L 4DQOL 1Z5LA 4UBDD 2BSRB 2XYCA 3L3JB 3GBNH 2Y6SD 3JSSA 5FYLD 5BW7A 4FZ8H 4LRNL 3D6GA 1JRHI 2FJFA 2IG2H 4Y1AD 5ICZB 4KZDL 1NBYB 2VZVA 2WUCL 1GAFL 1UM4H 3JVGC 2B4CL 3KLDA 3GB7B 1T89A 3C60A 1QFWI 3P77A 4S1QH 3W82A 4X4ZA 4KAQH 3QCTH 3FB8A 2X70A 1GOHA 1AH1A 2CKBH 4NT6B 4F33B 3S34H 4LAQH 4P46D 1XGYL 2NY4C 5GS1B 1TVBA 4OCSH 3TNNB 3QUXA 1EO8H 2FB4H 4QHKI 2YEZB 2CO6B 4XP4L 1SM3L 3MA7A 1N6UA 4WFEE 3UTSB 3V5DB 5GGSY 1WT5A 4JFXB 5EBMA 4LCUB 1S7RA 4GUPA 3VCLB 3DURA 1MF2H 3EDDA 1NBVH 1MQ8A 2EDWA 4NKDB 4P5TB 5GZNC 5B39A 5DFVC 3VXMD 2FLRT 2RFXA 2BRRH 3C08H 4P5MA 4ZSOB 1ZEAH 2QQLH 3HPLB 3BT2L 2J6EH 1NJ9B 3ULVE 3EYOA 4PS4H 3C60C 1F4XL 1C1EH 4Y4FC 1KJ3H 3BPLC 4I77L 4OCMC 2H45A 5CSZA 4OCRH 1T3FA 2D7NA 2B1HH 4KPHL 4ZAKD 4QKXB 1CD1B 1NCBH 3LB6D 5IVZA 1S7WB 1L7IH 2I25N 3IJSA 4JN1H 2X9XA 4H1LG 2VITB 4XCNA 2DWDA 4OQTH 2W0PA 2BXYA 4GAYB 1A7OL 4HPOL 1G6RL 5JMOC 4P5TC 4G5ZL 3I85A 3VGFA 1YZZA 2MHAA 4GKOA 3CDGB 5D93C 3MNWA 5DEGA 2Z35A 5IW1B 3BJLA 1NLBH 5F7EH 4U2ZA 2IMMA 4LPYA 5JO5A 5DA4A 1BEYL 4BSVB 1KEGH 4YHYB 3GBLA 1VENA 4Y2DD 1T5WA 1MFDL 4DK3A 2ZJSH 1HDMB 1QFWL 3QPXH 4MHHG 1I8IA 1HHKA 4ODHH 4MD4A 5HHMB 1MRDH 4PP2B 4YDVB 3BKYH 4JY5L 3MGOA 3GSUB 4P2QE 4UNTA 4PJ7F 1S7VB 1TLKA 1DDHB 2VE6A 3S96B 1EBAA 3NIDF 5ESVA 1VACA 1CD9B 2VLKD 4D94A 4WCYL 1NMBH 2OI9B 1CK0L 1MRCH 5DGQA 1AJ7L 4AL8H 4FOMA 4LCYA 4JFDE 4WI8A 5DTFA 1IGIH 3QIUB 5GS3A 3T1WA 2VR5A 1S7XA 4NZUH 5IQ7L 5D7LE 4GSDL 4C56E 4HZLA 1P7QA 2ICES 4JLRA 1L0XA 2AEQH 3D39A 4UB0L 5DZLA 2IQ9H 4ONOA 1EMTL 4CDGC 1B6UA 1K8IA 1YNKH 3Q2CA 4ZQKA 4XNXH 3IKCA 2APFA 3HMXL 2F58H 3P4MA 5DHYA 4PJIE 5L0QC 4HWEL 4NQED 3IDMB 4LLYA 1RURH 1A6PA 3O3EA 4ERSL 4X7CC 1GPOL 1TIUA 4YO0B 4MA1B 3S4SB 4OZFG 3C9NB 2P7TA 3HB3D 2NYYC 2VXQH 4TUKL 3GI9H 3UTZB 2Y6SC 1CDIA 2PYEB 4BFEA 3T0ED 5JW4R 1JCKA 3DXAE 4MCZA 2WIIA 4HIEB 1LNUA 2XIDA 4BM7A 4XNYH 1DN0A 1LEKA 1KJMA 1YDPA 2UWEE 1UVQA 5LGHH 3IJYA 1L0YA 4OM0L 4HJGA 5IVNA 4KROD 1H8NA 3SGJA 3HAEG 3OKMB 3BIBX 4OIBA 1T21A 3G5ZB 5H2BB 4ZG1A 1EVTC 4MB5A 5DEFA 5FYKL 3MRNB 3S35H 5F71A 5CUSH 5J4MA 5FHAH 1JWMB 2DF3A 2HFFA 1OP3K 3WFEH 2R2EA 1SHMA 1UXSB 5FDWA 3DX7B 1OAYL 2R0KH 3N1GC 5DFVD 4ZTOL 2HVKA 3GSNH 1TCRA 3M07A 4L3AA 2XPGA 4PGJA 3MFFB 5EOQL 3T3PF 1XGQA 4MJ5A 3L3KA 1CFSB 4R0LA 4N8PA 1CL7I 3L3GA 2QSVA 5TQ0H 4MA3A 1S7TA 1TITA 3MRHA 1R3LA 1JF6A 3D3VD 3BUYB 4IRJC 2H6PA 3NFPB 5DK0B 3E3QC 1CR9L 2VLKB 3SPVA 2R0ZL 2ITCB 4S1SH 1NMCB 2RQ8A 4ZTPH 3PGCA 1J86A 4ZDHB 5IFAL 5GS0H 1KENL 1RIHH 5JW3L 4RRPG 1IT9H 4RZCB 1MREH 1JYNA 1N4XL 4JG0H 3E6HA 3O9WD 2CPCA 5J8OA 4PJFA 4LEOA 3HNVH 3N85L 5A40E 2X70B 2GIYA 2OTUA 2XTJC 4OJFL 1NC4D 1FVCA 1LD9A 3BZDA 4GRLC 1RUKH 2NZ9D 1H5BA 5FKPA 3A6BH 5FOBA 3VXRA 1XCQA 1W72H 3ARDC 4PJAE 4PJBF 3O2VL 3EGSB 3D85B 2H32B 4EN3D 3VA6A 3V5DA 3K1DA 3VU2A 1AFVL 4Z7UE 1RULL 2UV3A 2ZG1A 4OFKA 3MV7D 2F5AL 3V4PL 1RZFH 4LU5H 2YZ8A 5B3JE 4JY6B 3FFDA 3TCXA 2YS4A 5E24E 3VE0B 2OM5A 1OGAE 4D3CL 3L6FA 3THML 3I6KB 3KPRD 4NQSA 1F11A 3MZGB 3B9DA 3HE6B 4JDZA 5IG7A 3QUZB 1Z0NA 2NW2A 3KPNB 2Z9TA 5DD3L 3G6JF 1OQXA 4YUEH 1FL5A 3WIHL 4L29A 1UKSA 5CLTA 1VFOA 1CXKA 2MWCA 1EZVY 5DJ8B 3GGWA 3VG9B 4M6MH 5D7IE 1Q9OA 4L5FH 4HXBH 4JKPH 5E2JA 1KCVL 4PRNA 2XACC 4JDTH 5GGVH 4NPYB 5IROC 5ACZB 3VH8A 1Z9OA 1NFDB 1SEQH 4PPTA 1O5DT 2HP4A 3LEVH 3FQXB 2CH8A 1KT2A 3IF1B 5AZ2H 4DGYH 3GI8L 2V2XA 4J7RA 1JF1B 4QTHA 3RZCA 2AK4E 1FN4B 3BHBB 3GK8L 3BKJL 4UTAL 1R5IB 2J4WL 5LWYH 5DRNB 3TJHD 1J1PL 1OQOA 4OV6F 3HC4H 3MLTA 3H6JA 1N0XH 4WWKD 3KPLA 1ZLVK 4L9DA 5IB3B 4XNXL 4HXAH 4RIRB 1RJZA 3MV11 1NANI 1R3JB 5C7XL 3OB0H 3IDGA 4KPHH 4X7TA 1FZKB 4WTZG 4XRCA 3CD4A 4YDJB 2NXYC 4JKMA 4TOYH 4HS6A 1CDJA 1NUFA 4FHBD 5EN2A 4PG9A 3MROA 5K93A 4AEHH 3QIUA 1MNUH 5LBSL 4NO5A 3LMJL 2V5RA 1WFTA 4QXUH 1T7VA 4Z8FL 2FSEB 4H20H 4F8TA 3VXNB 4RFNB 2X42A 3CVHA 4XMPH 5DQJB 1EK3A 3B9KA 4QRPB 2AK4B 1T22A 1IGYA 4UIKH 1BHGA 3RVXD 1NSNH 3O4OC 5IB5B 1A2YB 3IKCB 3NN8B 3HRZA 3KYKH 4TSCL 12E8L 1NAMH 4TUJA 5IMOA 1ZVSA 1NCNA 3B6SA 3D3VB 1ZHNB 2P5ED 3IDJA 4XPHL 3FB6B 4JZOB 2W1NA 5C0AB 4ZS6D 4WO4C 4ODSL 2D7QA 5KAQF 3LKNA 3MLYL 5GSVB 3UC0H 3CZFA 4JAMB 3BDXA 3K1KC 2WAHA 3Q6GL 3FFCA 1IAII 5HXMA 1BJ1J 1LE9B 1G9NH 3LY6A 3T0EE 5FA4A 1U92A 1J0ZA 1T2JA 4YBQC 3DV6A 3LQZA 4HKJA 5DJYB 4JFYB 4HULB 4JRWA 1OT1A 3O8XA 3IGAA 4JVUA 1EFXA 4LSPH 2VL4A 2X1QA 1OGAB 3OKEB 3BN9C 3EHBC 4OLUL 3VFNA 1N8ZA 2GY5A 2OLDA 4DCQA 4XXDA 1LO2L 4ZPVA 2EEAA 1GL4B 5EZIL 3MODH 2J88L 3ARGA 2VLMD 5SWSE 5K59F 2ZSWA 4Y16D 1T0NB 1MCWW 4X5WA 3QG7H 1J0KA 4RWYH 3E3QE 4AG4L 2OYPA 1DEDA 4NFCA 3VGAB 1YPZA 4HQQL 4U6XB 1T03H 2I60H 4NDMA 1A1NA 2GT9B 3MJ9A 1UWXK 1AP2B 2JLLA 4KXZI 4WFHE 4D0BA 5GJSL 4RX4A 2DQHH 3FT2B 2Y4SA 3PV7A 1CFNB 3SOBL 1G84A 1R5WB 3VFSB 3V6OE 2C7UB 1FYHB 4HC1A 5C0BB 5I76A 4KWUA 2RB8A 3DYOA 1A9EA 1HOCA 1DBJL 4F7EB 1CFSA 2Z8WC 4R0LB 1S9XA 2F54A 4KTYA 5J7CC 3VWJC 1S7TB 3GMLA 4GT7A 1SQ2N 1W72L 2NYYD 2EYTA 4AZ8A 3O41B 3WIIL 2J8HA 3BOVA 1BVKB 4MNQA 3UBXA 2JIXA 1JV5A 4EDWH 2EH8H 2UZXB 4OV5B 5E8DL 3VI3F 4FFZL 5EC1A 2LTQC 3F7PC 3GSNA 4V1DE 3RZCC 2DDQH 3V6ZB 1SJVA 4YQXL 5HYQA 2V6HA 3TN0B 5GS0L 5I8KH 2R0WH 3D25B 1QPXA 1O7VA 3K7UA 1BFOA 2IQAB 5E2VH 3HG1A 3LV3A 1HSAA 4HF5H 2C26A 1HEZB 3Q1SL 4HPYL 1LO3H 3VRLF 4BFIB 4OF0A 2B2XH 1A4JB 4W4NA 3EGSA 1U8NB 3VGBA 2DM4A 1IARB 1DQJB 5I9QB 3WS6C 2P5EA 4M6ML 3HPJB 3V9FA 1MCLA 3ZKXC 2WBJC 5HHMD 1HWHB 1QRKA 5GJTL 1MELA 2JELH 3C8KB 2VNCA 2YBRA 1MCPL 3VWJB 4QRSB 4IRSA 5SX4I 3HE7D 3ZE2F 3O11B 1TQCC 2I5YH 1RMFL 2NZIA 4OSUL 4XBPA 1OGAD 4M03A 1OPGL 2CSPA 1LMKA 4ELMF 4CNIA 4PJXB 3TH2T 5DFWH 1CFTB 4CVWA 2P8LB 2GCYB 2NY1B 4XBEH 1SJHB 4ZOBA 4QF1A 4MQTB 5FKAA 4OI8A 1A7QH 3V0AC 3BP6B 1CICC 2EEBA 4ONHB 4LARL 4F58H 4HK3J 3EZJB 1TVDA 3FONB 3TBYB 3PHOB 1E4WL 3MRLB 3F62A 1L9NA 3LEVL 1PBYA 4JB9H 5BV7L 4LF3A 2HRPL 3QQ4A 2M1KA 1DLFL 3NACL 1FYTB 3MRIB 5E9DA 4JREC 2VDPH 5AZ2L 4DGYL 5EBGA 1KLFA 4LLQB 3D69A 5TE7L 3L5XH 3WLWC 5C6TL 5EU6A 5GGQL 3RJQB 1HXMB 2MKLC 1I9RL 4WO4D 3LQAL 4ZUWA 5CJ5A 1WFOA 5FUZH 1MIEL 4CMMA 3PWJA 4HG4J 1CN4A 3MOBH 3SDAC 4U1GC 4HGMA 5KVEL 3PABA 2P8MA 5JMRA 1OTUC 3SE3C 1AGCB 4OZIA 4X8JA 3BP7B 1MI5A 3P2TA 2LE9A 1DJSA 1KIUA 3QIBA 4UIKL 1F90H 5IB3A 5C0GB 4YXHH 3PWPA 4LBEA 2EDQA 5GS2H 3H7LA 3QHTC 4JFDB 3WIFA 1ZGLP 3GIVB 5HGDB 1G0DA 3HI1A 1DZBA 1F02I 4XNZC 4OKVB 5EUOB 4J2XA 4XI5C 4YLQT 1VHPA 4URTB 3BP4A 1RQ5A 5EO1B 5I18H 1DE4A 3D48R 4PJ8B 4P2QB 4D8PB 2YPVH 1OGTB 3GJFH 4P4KB 5CEZE 4KC3B 3WD5H 4HEME 1CD0A 4JM2B 2IG2L 3ZYZA 4QHUA 4ODXB 1A4KB 1LILA 5IB1B 1FAIH 1OAKL 4FZEL 1A8JH 3TH4T 5F9AC 3JTSB 1IC7H 4KZEL 4P46C 1BJMA 4RFNC 3Q5OA 3RY6C 3AUVA 1GC1L 4G9FE 5BW7C 5F7DA 4PY8I 1IGYB 3WKNA 2A83B 3L3HB 5E1AA 4JM4H 1G7HB 3NN8A 1XGYH 4PLJD 1ZVSB 3FQTB 1QVOA 3B5TA 1HCFX 3EYQC 1EFQA 1AXSB 3FT3A 3VGEA 3AREB 2F19H 2ZOLB 1INQB 2ILLA 4JAMA 1EHLL 5M95B 3JWOH 3GBNL 2GI7A 3KGRA 3VD7A 4PG2C 1UEYA 3VWJD 5C0IB 5CHNB 5B21A 3ULSA 4MS8D 1UQSA 1RSFA 2DI8A 3WHE1 3EDFA 3K46A 3EOYG 4JR9H 4DKEL 5TF0A 5L6YH 1VESA 1U58A 5K9QG 5JIPA 3FOLB 1OP9A 1I3RA 5BXFA 4LPWA 4L8BB 1II4E 1J5OH 1YNLH 3GIZH 5IHZB 4NC2B 2NXYD 3GMNB 3ZDYE 1G7IB 2QR0A 5DJ6B 3OAZK 4C59B 1AHWA 1G9MC 3FFCD 1JJUA 1YNTB 1VPOH 5DA0B 1T2XA 3IT8D 2ED8A 4ZS7H 5LGJA 4GMTL 1ZLVH 3TYGL 2EYSA 1KNOA 1YC8A 3UPAA 4HFUH 1GGYA 3NABL 1ADQH 3EW3B 4MNQD 1JVKA 4X6DA 5EC2A 1MIMH 4OCXH 1AP2A 1XGRA 4J12A 5L2KE 1WTGT 4PBXA 2XXMB 4ALAL 4HK0B 1RVFH 1M7XA 5L9DH 3MNZB 1IKNC 4WUUA 3BESR 3O3AA 2QTEA 3ALXA 4XC1H 2Q76B 4LLUB 2W0FB 3MV7A 4L4VA 2FCBA 4WUKL 4KKNA 4QXTB 5IQ9A 4R26H 3V6BR 3O2DL 4U1IB 4OZ4A 5IB4B 3QFDB 1NCTA 5FO7A 1GGCH 4KVNL 1EXUA 4M62H 2X4QA 4P48A 1I9JL 2XG5A 1EAPA 2EEDA 4GKZA 2OSLA 3DX8A 3PIQA 5J1AB 3HS0A 3VDCA 3L5XL 4RCAA 3MACL 3F5WA 1MHEA 1CFVL 4QTIL 1ZS8B 4NQDB 5I6XB 5K9KA 3D2UD 3KNBA 5I1IL 4OFYA 1VFMA 2EE6A 1INEL 3SDYH 4Y8AA 4PJBB 5ANMB 4HPOH 4XGZB 3U0TA 4JZJA 2XNAA 4YDIH 1QBML 1AD9A 1MCSA 4NSKA 1YEKH 1E4JA 3H9SB 2Q3AA 1ITBB 3DMMD 3C8DA 4Y4KA 3W81A 5HGAB 1QD0A 4X6FB 3CUPA 4LCIH 3BD5A 4OIIH 1MRDL 1CK0H 1MRCL 4PRAB 3REWA 3WHXA 5HYSA 1KJ2B 3WS3A 2OJZH 2H2SC 5JPNA 2X4RB 4LRIA 3BKML 3NTCL 3SE3A 3TBSB 3KYOA 2R8SL 1F2QA 4IMLA 5T33L 2L4OA 1P7KA 2E9WA 4LSTH 1A5FL 2F53E 3L3JA 4ODUA 4HBCL 1AXTL 5SWSA 3OR6A 1YEGH 1KIQA 1T5XA 5EU5A 3CCHA 1P5VA 1EEYB 2IF7A 3QEHA 2E3VA 4W6WB 2Y06H 3IXTA 3UX9B 5HI3D 1A47A 1X9QA 4LCWB 4CMHC 1DBKL 4TYUA 3KVQA 1RZKC 5TE4L 1U8JA 4YFLI 2D0HA 4R8WH 1I1YB 3P30H 2JKXA 2FJHB 1J8KA 5SWZE 1D9KA 2HG5A 4QRRA 3S7GA 5D7KD 2YPKB 1CXFA 3ILQC 2ZP0T 3DUUA 1BD2E 3TO2B 3KWWA 1NFIA 1LHZA 3MCG1 1YYMH 4JCLA 2PW2A 3NOIA 4DTGL 3CFKA 3RJDA 1GHFH 1N6QL 1PEWA 1MI5B 3JV4B 3MZTA 1T0MA 1P2CA 1QSZA 2NR6D 4U6VH 1RUAL 1ZHLB 2BNRA 5C08B 4MD5B 5I1KH 4G6JL 4KKLD 4G8GD 4OM0H 3RX5A 2V2TA 1MFBL 5HY9B 1KBGL 1H15A 1M71B 3SGDI 2JCCB 5EO1A 5C9KA 4B7LA 5HDOA 3P0GB 4K9EH 4ZAKA 3WE6A 4JN2B 1P9MC 2YXFA 3JV6B 4PJXF 3JV0A 4WENB 2WUBL 4PV8B 4NO0D 2NX5E 1CTOA 4N90D 5DWUL 4N5UA 1CTNA 4LOUD 2HTLC 4MDJA 3S35L 1N6VA 3NIFE 3MRBB 4JR9L 5D2LA 4GAYA 4YWGL 2AJUH 2F8XC 1GZPB 1KIRA 4LDOB 5DMGD 1CBVH 1IGFL 5H94A 5BS0B 3TH3T 4JHAL 3UROR 5KJRL 1MCQA 3L95A 3W9DA 2H1PH 5FYLE 3VXUB 5DD5H 1NGWA 5GGTL 1INQA 2DL9A 5D6DC 5EBLA 2AV7B 2DRUA 4KI5E 5L8LB 1P4LB 3MCKB 1EHLH 1ZHKB 3DSFH 3NA9H 3GSQA 3G9VA 4DUWA 3O9WA 4H1LB 5EU7E 2XA8H 4NZDA 3ULSB 4XVTL 5TH2A 5EDXA 2VLRB 3B83A 4ONGL 1TJHL 2VDRL 4GXVH 2E7LC 4G9DB 4FP8H 5IT2L 3VXQB 4PP2A 4RGNB 3WNKA 3FOLA 5D1ZD 4OI7A 2WLYA 3MBEA 1CT8B 1DDHA 3S96A 1JPFB 4NN7B 2IANE 3VD5A 4ACPA 1YN7A 4GG6E 1N4XH 2BERA 2YD2A 4LCYB 2YD1A 3HG1D 5I1IH 3TEUA 5HVWA 3LKQA 4LKCB 4F9LA 3QDGD 3DHJA 5D7IA 1QFHA 5LGJB 2PN5A 3CPLA 1DQLH 1EEZA 1NLDH 4POZD 3CIQA 3OF6D 3QCUH 2DI7A 5L8JB 4N8CL 3C8HA 2R29L 1MHPL 1SEBB 3CVIL 4JG1H 4GRWE 2HMIC 5F9OH 3MXVH 4M93C 1XF1A 1WIOA 5F7KC 1NQBA 2AJYH 4IDJL 1KXTB 1KCUH 5DHYB 1YMME 5HHQB 2FIKA 2OJZL 1QA9B 1KENH 3QWOB 3AAZA 3WJLA 4PJGF 3HC4L 5I8CA 5FO9A 1I7ZA 3CXHK 1FORL 3MRFB 5KSVA 3LN4B 1FO0H 3ALWA 1VDGA 3HPLA 3TFKD 1G9MH 2VXVH 3N50A 3MLZL 2QL1A 4HUWA 4HX1A 5IVZB 2CDGB 1P84K 3LCYA 1DN0B 1P69B 5DHVA 3ILPB 3X14B 1HIML 3VFTA 5GGVL 5JIIA 4HIHB 1MJUL 3C6SB 4PV9B 2ICEA 3EYVB 3C60D 2PCPB 4QYOB 5TDOA 4HJGB 4NM8H 3EZ8A 4KHXL 2DQEL 1YEKL 3J8F7 2X89D 4XH2B 1T21B 2XWBA 3BQUB 1TJGH 3WCYA 3OBAA 3LRSA 4N68A 3SKUD 2XA3A 4JZJB 1RY7B 5IW1A 2D7MA 3GI8H 4XMLH 4ODBD 1ES0B 4QHLB 4DKFL 5C92A 1J05A 3EFDL 4N1HB 2XZAH 1NGZA 5CINL 3IDYC 4DW2L 1NGPL 4LHUA 3MGAA 5AYUL 1KJ2A 2F5AH 4J4PD 5CEZL 1E6JL 5F6HI 4TUOA 3OXSA 1A9BA 4RNRA 2DQTL 3PXJA 5CSBA 2JJTA 1LVEA 3ULUC 1UYWL 5KOMC 4Y19D 3H0TB 1D5ZB 3UZEA 3W39B 5AG8A 5L2KD 4BQ6A 3CSPA 3VXSB 4OCYH 4HWBL 3AM8C 2DTSA 2O61A 3CH8A 5DK0A 2EO1A 3SPVB 1ZLUH 2YN5A 5DMJB 5BCAA 2GHWB 1HKLL 3QEHB 2ZUVA 1T04B 4LCWA 4LSDA 2ED9A 4OZHB 4RZCA 2CD0A 4J3UA 4ODSH 3GSOA 4EI5A 4MXWH 4P3CL 5IFJA 1C7SA 1X5ZA 3IFNH 2CGRH 1F6FB 3WKMH 3S97C 3KWWB 3RU8L 3I75B 2JB6B 1T89C 3C5JB 4HHAA 2P8PB 1CF8H 3CFKB 5FYLL 3GSVB 1TQBB 4FQXC 1TZGL 3JV4A 1AE6H 4GG6F 5KS9B 4YE4H 1VB9A 3ZKND 4L3EA 4RAHA 3T0BA 3LMJH 4IEFB 3IU4L 3MV7E 2F9BT 4LVHC 3O3BB 1VGKA 5I6XC 4HUUA 1IILE 2Y7QB 3U1SL 3WUZA 1Q0XL 3VXMB 1FDLL 4R4NC 4ELMB 2JCCA 3KXFD 1TTFA 3L6FB 4PB9L 5C0CD 5DWUH 5GGVY 2PTTA 1KXVC 4OI9A 1SYSB 1CCZA 1DLHB 1YEGL 5KSBB 3SDAB 1MCIA 3MLPA 2GTZB 4G42B 5AUMA 1ROWA 2IH3A 1QLFA 4Y4HC 5FM5M 4F7CA 2YA0A 3U9PH 2QQKL 5IESH 2ZOKB 3G5ZA 3BPCA 1A7NL 2R1XA 3QDJB 1XH3B 4FQ1L 1CQKA 2V5YA 3STZA 1IM9A 4OLZH 4EI5D 5BS0A 4IJ3B 4L3EE 4AT6A 5C86A 5IV2B 3VDAA 2QQQA 3B4NA 1WICA 1ZAGA 3IF1A 4AQ1B 1DQDH 4LDEB 4M7KL 3OB8A 1FFRA 1CLYL 4BKLA 1TJIH 2IAMA 1PDKA 4CW1A 3SE4C 1HHHB 3BHBA 1U3JA 2R2BB 2DD8H 1FORH 4UNUA 4JVPA 1WIUA 2XPGB 4YK4C 2PETA 1S5IL 3HZMB 5C2BH 3QRFM 5CJQL 3QIUD 4OIAA 2VDOL 4EDWL 5E99L 5CGYC 3L3IA 5T1LA 4WFFD 3ULVL 4PGBB 1LP9F 5E6ZA 5I74C 2AEPL 5DSCA 1TETH 3VXOB 1CE1L 1UACH 4OQTA 5FUCE 3V4VL 2QSCL 4RA3A 4OQ1A 3VXTB 4JJHA 5GJSH 5FECB 5GRYA 3MROB 2P43B 5E2TH 3OJ2C 2AK1H 2E7BA 4I3SH 5DQDL 2P24B 2FSEA 4PJ9B 5FM5O 5CZXC 3V52H 4U6TA 4Z6AT 3CVHB 4S2SB 1H5BB 1YPZE 1XCQB 2AK4A 5DMGC 4YAQA 3TBVB 3UYRH 3CLEH 2WP3O 5D7JA 5D1QB 5T1DL 1Y6KR 2ZUYA 3MXVL 4RGMB 1QSFB 4QCIA 3GZKA 3ARFA 4I3RH 2HFEA 4NM8L 4QO1A 4HC1H 1QA9A 3IDYB 1OSPL 4OCRL 2JTDA 5GZND 4ONGH 2AQ2A 2SEBB 2EICA 4XP1L 3FT4B 2XKNA 4JO4H 4Y5YA 1DBJH 2X40A 1YEEH 3RDTB 4A6YL 5ILTH 4FN0A 5CBEA 1F4WH 4NC1E 1LE9A 2ZG2A 2R2HA 3VMOA 1C12B 2QV2A 4U2YA 2VN4A 3B9VA 5IG7B 4JO3L 4LQFH 2VLJB 2J3SA 1EZVX 1T66C 4YDKL 3KPQB 4FS0A 4PRHD 3MV01 3UCRA 4BQCA 4U1NA 4OFYD 1VEPA 4PP1C 3RVWD 1A14L 2W38A 3ET9F 4JHWL 5BV7C 2Y5EA 4PV9A 2DQUL 3S37X 2FJGB 4I18B 5F3HB 1I1RA 5JQ6H 5D71L 2JELL 4WDIA 1I7TA 4XXDB 2XY2A 1F3RB 3ESVF 3CZJA 3M1BA 1FPTH 4KHXH 5I75B 1U3ZA 1JTPA 3I6LE 3LRSB 1I1AB 3V7AG 3N06B 4FFYL 4NIKB 1NMAL 4U1LA 5F9OL 1AGFA 4NFBA 4JVWA 3FTGA 3C5ZD 4ODHL 4D9RD 4TN9A 2BFVH 3GHBL 4FG6C 4OD3L 3P40A 1KB5B 3WLBA 4GLRH 1H3PL 2CMRL 4AMKL 1MFDH 1YPZB 3RRQA 3G6JE 3C08L 5SX5H 4AEFA 3AU1B 4MCYB 1CDYA 2DTMH 5DR5H 2A2QT 5J56B 5E08L 3H3KA 1S7UB 3I2CH 4I8DA 4BK4A 5DK2B 2FO4B 5A16B 3PWNB 4C83B 3KPLB 1PZ5A 4N0YH 4R97B 3WKML 1ACYL 4LP4A 1D5ZA 5C0DB 3NFNB 2NPLX 3KXFE 5F6IB 1G7QA 4QEGA 4JRXD 6CGTA 1WIPA 1AIFB 4HLZG 2FD6H 4OUOA 4K3EL 3VFWB 1OAKH 4HS6B 5EN2B 3U0PA 5B8CA 1CICD 1BFTA 5HHPA 5LKNA