5D7KD

Structure of mr1-reactive mav36 tcr
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
199
structure length
197
Chain Sequence
b'EDKVVQSPLSLVVHEGDTVTLNCSYEVTNFRSLLWYKQEKKAPTFLFMLTSSGIEKKSGRLSSILDKKELSSILNITATQTGDSAIYLCAAYNTDKLIFGTGTRLQVFPNIQNPDPAVYQLRDSKSKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAV36 TCR Alpha Chain
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 197
sequence length 199
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7kD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7kD02
4EUPH 1J18A 5B22A 3B9AA 5DO2D 4JKKA 5C0DA 4J3UA 5F1NB 4OZ4B 2OZ4L 4NZUH 5KVMC 1K4CA 3EO9L 3JTSA 2JIXA 3PP3H 2H2PC 4PJAB 3PUCA 5IHUL 5IQ7L 1UWEH 1VA9A 4BZ2H 1RHHA 3WO4B 3QDMA 2HT3C 3QCUL 3HR6A 4H8WL 1GIGH 2YA1A 1CD1A 4XPHH 4M9OA 4PJDF 2DQFB 2E8ZA 2JB5L 3U4BH 1A1OA 1UEMA 1HDMA 4JHBA 1I8KB 4OGXH 4QEGA 2D7MA 2A2QT 1FV1A 4JRYB 4UT9L 3ARRA 3GSXB 2ICWJ 4GXUN 1G7IB 4J4PD 5J7CC 3SGDH 1X5JA 1KBGH 4UIMB 5BRZA 2GYSA 2EECA 3FKUS 4ENEC 2PO6D 4OV5B 1QFHA 2PTTA 4NNYB 3V4UH 1WGOA 2GTWB 2V9RA 2DYPA 2Y72A 3UTTD 4JM2C 5CJXC 4NN5B 4M6OL 4QXGL 4MJIE 3SJVA 1GOGA 3F12A 3KPPA 2NY4C 4YO0A 4G6ML 5CMAB 5T3XD 1JWSA 1CDJA 5C9JA 3FOLA 4K94L 1Y6KR 3GSNH 1QOKA 5DWUL 2YD3A 1X5LA 3QDGA 2CK0L 3IJHA 4LHUG 3MRJA 4E0RB 1CGSL 2NX5B 4HGWA 4G7YL 4S1RL 5CJ8A 4LOUC 1MCIA 3DURB 3JWDL 4NHCH 2IC2A 2AGJH 3NFSH 1NMAH 3MV7D 2ZUYA 3AS3A 2I07B 3BP5A 1RZJH 4GKNB 1A5FL 5DA4A 4MXQC 5B38G 4EI5C 2VE6B 4LPTA 4X80H 4HC1H 4P4KB 3G5VB 1V3MA 3HC0A 1YEFL 4JZOB 3C6LB 2JJSC 4YBLC 3VG9B 2R29L 4Y19B 1BX2A 2BNQB 4Y5YB 5D2LB 4PJ9D 3WKNA 4XPTH 5L2KA 1V3JA 1XF3A 3RPIA 4U1IA 1WSST 3TVMD 4ZOBA 3ZDZF 5DRXA 1IQDA 4KK6C 2Z8WC 2NXYC 1YN7B 3WFHA 5DHVB 1UWXK 4Z76A 2DQDH 4TSBH 2JIXB 5EU3B 1OW0A 5TFSH 5IB3A 1RHHB 4BFEA 1S7UA 5C0GA 5KSBF 5ITBL 2SEBB 2ED9A 1CD1B 5BJTA 2B20A 4FQ2H 1J1XH 1HCFX 3PQYD 3O3UN 1QLRA 2NLJA 1N5AB 4XNXH 4TUOA 1FV1B 5EN2B 3F7PC 2DLTA 3HMWH 3L95A 3MRRB 2J12B 1RD6A 3HNVH 3OKKB 1NC4D 5IBUG 4JFHD 4DQOL 2NY0B 3WYRA 2GQHA 5E9DA 5D1QD 5BRZB 1CU4H 1QBAA 2FD6H 1JPTL 4GFTB 2GK0B 2W91A 5FKPA 3PWVA 2PTTB 1SEQH 5T3XE 3LPGA 4M93C 2DYPB 2VDML 1NEZA 4JO2L 2HP4A 1BOGB 4OM0H 2VWEE 3OJMB 3O6FA 3TCLB 4KTDL 1CD8A 2X40A 3X3GL 3F65A 5FCUL 3ZKMD 1U8NB 4UINL 1G6VK 2FLRT 1Y18B 3H9HB 4YJZL 1JWSB 5C9JB 1DQQA 4UQ2B 3MV7E 3FOLB 4GKSB 3WMSA 3LEXA 4R96A 3S35H 4JM4L 1A3QA 2EDDA 2QL1A 5F1OB 4JZJC 4PRDB 3WKML 1RZ8A 2VQ1A 4HBCL 1OCWL 4DGYH 1EAPA 1UM4L 1ZEAL 1TMCB 1ZVSB 4L9DA 4HGWB 4OLUL 4G8GD 1RU9L 4ELMA 2HLAA 4CVWA 1B2WL 3GMRB 3AMLA 3C2AH 3BP5B 4JREB 2AJXL 4J3SA 5CKGA 1C5BL 1JMZA 4YDIL 4CMHC 4XBPA 2OZ4A 5T1DH 4UDTA 3H0TB 3HC0B 4K7PL 4QGTA 4UOW1 1YJDC 1MIML 4V1DB 1OAUL 2O5YL 1BX2B 3OGOE 2CLZA 4U7MA 4F9PA 2OTWB 4OZFG 1Q9OA 4P5MB 3GBMH 1L0YA 2VXUL 1XF3B 2ITDA 15C8L 3STZB 3T0WA 1CGXA 4I4WA 3GI9L 1KYOJ 4X5WA 3VXOA 2FEDD 3MMEA 4TRPH 1IQDB 2K7PA 5D6DA 5IFAH 4MHHG 2A73A 2DM4A 2C1OB 3WFHB 3EYSL 4W68A 4TUKL 2V5MA 3VD5A 4ODVL 5TQ2H 4P57A 1GXEA 1S7UB 2B5IB 4NP4L 4QTIH 4XWOD 4DZ8B 5HHMD 1CIDA 1SMOA 1BIIA 4YWGL 4ALAH 1QLRB 4YHKH 3VXRB 2CXKA 5EO1A 3T8XA 3VWJD 4P2YA 4JY5H 3OB0K 3N06B 1CZ8H 4NM4L 7FABL 2QQQA 2Q7YA 1MFCH 5C70A 2NYYD 5CD5D 3I6GA 1K8IA 3O2VL 4OCWH 4HW6A 2NY5H 2DLEA 2XN9E 3MJ9H 5MP6L 4FP8L 3MBEA 2AEPH 3RWEB 3U1SL 3I84A 1ZHNB 2FHCA 5FCSH 4HHAA 4M6AA 2ZUWA 2AJ3A 5CBEB 4Z7QE 4LCYA 5E6IB 2X1XR 4OCRL 1PY4A 5K9KA 3FCTB 5F6HI 1LNUB 1U6AL 1MJ8L 2XKNA 3O6FB 2JTDA 4HF5H 4IRSA 5L2JA 4CADB 3O8XC 4QHMA 4G8GE 3ARFC 4HKZB 1HHIB 3MJ7B 1DQQB 2BRRL 1YY9C 1TJHL 3BX7C 3K1DA 1M4KA 1Z9OA 4R96B 1JFQH 5CINH 4LKXA 3VFMA 1O7VA 4D9RD 1JIBA 2I5YH 4UV7H 2CRYA 1BVZA 4FFWC 5F1IA 1RZ8B 2VQ1B 4PJDA 1EAPB 2X4NA 2ZOKA 3WIIL 1NAMH 3FB7A 2B1HL 1PYWA 2M1KA 1X5KA 2QADD 1OAXH 1A9BA 1UJ3C 5F9DC 1Q1JH 3CZFB 1XGPA 2HLAB 4ZXBB 5E8OA 4EI6A 3RU8H 5JOFB 4JDVA 3WL9A 5LXGH 1OHQA 1J8HD 1FNAA 2YUZA 2X7LA 1HNGA 1LWRA 4L3CB 2C1PB 4KK9C 3RWIA 4WWID 2CJUL 3KR3L 1N2RB 3DSNA 1Q9OB 3QIBA 3TZVB 2ITDB 4X5WB 3LMJH 4BZYA 4Z7WB 5IM7A 3MMEB 5BW7C 3RVVD 5HHME 4ZFZA 2CKNA 3HUJF 4UT6H 3BMVA 1UYWL 3MGTA 3OV6A 3RZCD 4O9HH 1RFDL 4O58H 2AABL 1WFTA 5J6HA 4G6JL 4EDWH 2Y4SA 1NSNH 3LDBC 3HS0A 3VXSD 2W59A 4BYHA 4UV4L 3TYGL 3GM0A 3L9RA 1K3IA 3IFLH 4QYOB 3T8XB 4JKPH 1L0XA 4NDMA 5C0CE 1B0GA 4JVWA 2W0KA 3T0ED 3VE0A 2OYPA 4R0LA 3EO1A 2EH7L 3BAEL 3CVIH 1WCBB 3I6GB 3O2WL 2HH0L 1WICA 2XYCA 3P9LB 4P48A 4P5TD 4PV8A 3VXUD 3W0WE 4UTBL 4UNTA 3LQZB 3E6HA 4H20L 3IDJA 5ANMA 2BOCA 1KIUA 4Z0XB 3S8WA 4PJHE 4D9RE 4X9HA 1HIMH 3L5JA 3QQ4A 3ULUF 4XVUD 1W8NA 1T7XA 3ARGD 4UNUA 3DTXA 4Z9KB 3B4NA 3FOMA 5AD0A 4APQD 2XKUA 1NGQH 5EIVA 4N1CA 4O51B 4KGJA 5BS0E 4XX1G 1UH2A 2AK4D 4EEEA 5BXFA 4LKXB 3VFMB 5KSBA 1L7IL 1J1PL 1IC5H 1J8HE 3QIUD 2X4NB 2FECL 3FB7B 3RVUC 1DFBL 4QRRE 5L6YL 5AYUL 3BGAA 4NWTH 2PTVA 1A6TB 1VESA 2K7QA 5EUOF 3IJYA 1XGPB 4AMKH 3ELAT 5E8OB 1P9MA 3VXPA 4X7FC 2NZ9C 1MQKH 2EDXA 4JDVB 1F45A 1RZFL 1K3ZA 5GGRB 3ARXA 3QHZH 5DJCA 2EZ0D 6CGTA 5MHSD 4LSVL 1EFXB 2BSED 4NQCB 4IRJD 5M94B 5IIEA 4FFZL 2HVKA 3QBTB 1NL0L 4P59H 3KPRD 5T1KB 4K3EH 3QUYB 3ZTJG 2UWEE 3QIBB 5HPMA 3WNNA 3CMOH 2H32H 1NGYA 2XRAH 5TDNA 3VFGH 1H3VA 3VXSE 4CVZA 4EBQH 1LE5A 4MHHI 4AL8L 2D0FA 1TJGL 3LN4B 5D7SL 1CL7L 2EC8A 1ZA6A 5C0AA 1HN1A 1D5IH 1QLEH 4MMXC 3T0EE 2DWEB 1VFAA 5GISH 1QA9A 3VXTB 2BVOA 4QHKJ 2OJZH 1A7QL 2A9NL 2YBRB 5T3ZL 3T2NL 3BGFB 1LO4H 3ULUL 3H2WA 4PJEF 2BHUA 2KDGA 4WV1A 1OGAD 4HS3A 2ZG2A 1JGLH 4WFED 3ES6A 3ROOB 4BFBD 2WSKA 1NGWA 1ZT7A 3VE0B 5F7LB 4R0LB 1ZOXA 1U8JB 1J10A 4GSDH 4PV8B 3FO9A 2PYEA 4M3KB 4WW1A 1I1AC 3E2HC 4LVHB 1ZHLB 4WEBH 1BHGA 3FZUD 2VIRA 1Q94B 3IDJB 5ANMB 1E4XI 5MENE 2R0LL 1WAAF 3TCXA 4HPYH 1NBVH 1QFWH 3KPNA 4PG9A 1FIEA 2Y5EA 5HJ3A 4HS6A 3AREA 1G7PA 2LE9A 1AH1A 4Z5RA 1WWWX 3HZKB 4PGDA 3EOTH 3MJ8B 1NEZG 4NQXA 4LCWA 5IB1B 1UWGH 4JRXD 2R1XA 1YEIL 5EZOH 3AAZA 4NFCA 3V52H 2VKXA 3P11H 5BXFB 3AROA 1A6ZA 4XAWH 2I60L 5DEGB 5MHSE 1CF8H 4FZ8L 3D3VB 3GB7B 5FYJH 5CJOH 3MCKA 1KF9B 2XTJC 4FTVA 3EDFA 4MAYB 5E00A 4YHIB 1M71B 3WHXA 4BFIB 1TDQA 5DD3L 3IJYB 3SDAD 1RJZA 5CSZA 4F8TA 4DN3L 3VXPB 3O9WD 2F53D 4WY7L 4GJTB 3KYMB 5DUPH 5FB8A 3D87B 3ZYOA 4KHTH 2CMRL 2FX7H 2VDKL 3E8UL 2ESVA 4ZD3L 4Z7UE 5IIEB 4J1UB 5D2NE 4EN3B 4HUNB 5FO9B 5IEHA 1BBJB 3BGMB 2GHWB 5FA3A 2BDNH 4OIAA 4KPHL 3VD4A 4KQ3L 2X1OA 3LQAC 5CP7A 5C07E 4CVZB 4JPWH 2A77H 4ONFH 4IS6B 5DGRA 4WENB 1OQXA 1LE5B 3L7FA 3TV3H 2XG5A 1K8DB 4WFEE 4X7CC 1ZA6B 4U1NA 1H3WM 4PJ7E 2FL5A 1Z3GL 3P0GB 1N5YH 4RWYL 2RAMA 4GOSA 1VFAB 3R4DA 5I16A 4MGXA 1QA9B 2Z91A 1R5WB 4X7TA 1OLZA 1A14L 5E4EC 4KKBC 1WZ1H 4LOUD 1MAML 2W9LA 4P2QD 2C26A 1R3JA 2VL4A 5INDA 1DVFC 4L3ED 1LEKB 3JBG7 5HGGS 3VWKC 5LJYH 5CCKL 5ACLA 1NGWB 1ZT7B 4GO6B 4DVRH 4PGJA 4OLWH 1AI1L 1CXEA 4U1LA 1ITCA 4PBXA 3NTCH 1OPGL 2BX5A 2J4WL 2PYEB 4JRXE 2DMCA 4P4RA 1QZ1A 2YS4A 3DSFH 3JV0A 4NNXB 4QXUH 3SGKA 1YMMA 1IEHA 4YHOL 3VGHA 3KPNB 5D9SB 4LVEA 3MV11 3MA7A 5EUKB 5HJ3B 2AQ2A 4M62L 3I50H 3KPSD 2NXYD 4Z5RB 5CAYB 4NC1E 5GPRA 5D5MF 2APBA 4WO4D 3HUJA 3MRFB 2C3WA 1RIUL 3UTSA 3BQUA 1DDHA 2R1XB 2DICA 1Z5LB 3H42H 4Q9RH 3BPOC 4AY0A 1IGJB 4UTAL 5DJ0B 1RULH 5E7BA 3GBNH 3F7YA 1AGDA 3UDWC 4GMSL 2H26B 2ED7A 4G9DB 3MCKB 5SX5K 3UJTL 5C08B 1U8MA 3MLRH 1DLHB 5E03A 2VR9A 4Y0GA 1RJZB 5CSZB 3EKCA 3BDBA 3KPLA 5DK3A 5C3LD 1JGDA 1NBZA 5GGTH 2RFXB 4ZOCA 3A6CH 1NCUA 1QVOA 1M7XA 3DI3B 5I76A 3CD4A 3TT3L 4YH6A 3W9EA 1JNLH 1CGVA 5KTEH 2ESVB 5EWIL 4OKDA 4M7ZB 1IZKA 5IEHB 1XGUB 2OTUA 5FYJD 3MLSL 2EDYA 5KSVA 1RUPL 3HNSH 1XGRA 4K71C 2IMMA 2JELH 1UGNA 4POYA 4MNQD 4FXLA 5IB2A 2F5BL 3B43A 5FF6A 4LIQH 3N9GH 4FXGA 5D8JL 3LIZL 3BT2L 4U1NB 2GY7B 4R4FL 1PSKH 3LOWA 4M1GL 1CBVL 2FL5B 5ISZE 5HDQL 3RGVC 4ETYA 5L0QC 4OCYL 2YRLA 2VLKE 5KS9B 4X7TB 5JXAH 1L4IA 2DB8A 5IVXF 4CAGA 4EDXB 3TN0A 3SEPA 4LAQL 5EUOA 5EDXA 5INDB 1W0VA 1KIPB 3EOAA 2VABB 4YDVB 5IV2A 1I7UA 4MX7B 2HLFC 5D7LB 3ARDA 2D7QA 1ADQL 5C0IA 1CFQA 3SDCD 4U1JA 3HB3C 3P40A 2JCCE 4H26A 1SYSB 1HXMB 4PRNA 4OZHE 3I2CL 1UT9A 1BAFL 2WLZA 3TT1L 2XA8L 3HUJB 1QR4A 1JRHH 3UTSB 1FVEA 3BQUB 5ACMA 1TZHA 1DDHB 2E7HA 1S5HB 3GBLA 3LV3A 4H1LH 5CGMA 1J0KA 2XWJA 1XCTA 1UADC 4KJQC 2BSSB 1A6UL 4FFVC 5EC1B 1VGKA 4ZSOE 1JZ8A 1ODAA 4LCIH 3TPUA 2X4RA 4YPGB 2APXA 4PJEA 3RNQB 5AZEH 1KN4H 3DLQR 5JNYA 1FORH 1U8QB 4O2EA 4GAJH 1U8MB 3F5WA 2UZYB 1W8OA 1CG9A 3D9AH 2APFA 3QXDB 3MODL 2ADJA 3DRQA 3KVQA 4XXCC 3MXVL 4B7IA 1F4XH 4F37F 2XTLA 1N64L 2HG5A 3GGWB 3R06B 4K23L 3W9EB 1LO5A 3MLPA 2BXZA 1CYGA 3IETA 1WAAA 3GI8L 4ELKA 1KPRA 5CWSA 3UJIH 3RL2B 2V5YA 4G6FB 4YNYA 4CVUA 5IB5B 3HMXL 1R3IL 1KLUA 1VFOA 3QXVA 4I0PC 3VFPA 5IB2B 1IQWL 1A02N 4NUJB 3ARFD 3SQOH 5FF6B 2EKSA 1F3DH 3B8YA 1SMAA 1GJIA 4M6ML 4FXGB 4U7SA 3EOBA 1FHGA 1NBYA 1PEWA 4MLIA 1CDYA 1KJ2H 5ALCH 4YIQA 4XBGB 2EEBA 4Z95H 3VU2A 3QUML 2Q6WB 3TN0B 3Q3GB 1TZGL 4DVBB 4F15C 4GKZB 5EUOB 3U9UA 3ZYJA 5IT2H 2L7UA 3EOAB 4OZGE 1J11A 2ICEB 2Y23A 4OD1L 4IDJL 5SX4I 4S1QH 5JIHA 2IALA 3UZVB 5LVEA 5KZCD 3RBSA 2ZZUT 4OLVL 4KK9D 2NY4B 3ARDB 3D25A 1UZ6E 4XHJC 4KK5D 1CD9B 2VMFA 5JPNA 2YD6A 1NKOA 4U1JB 5DJ8B 1OSZA 4MNGA 4G8IA 4H26B 4QRPE 5B21A 4KKAC 5C7XH 4PRNB 1J1OH 3VFWA 3C5JB 4GG8A 3P30H 3OKYA 3JTTA 3ARQA 1UXSA 2PXYC 3HC3L 1II4E 2XNAA 2RB8A 4GXVH 3WE6B 2FYYB 3PWPD 1WLHA 3IYLW 2BY1A 2R8SH 3LKQA 4L29B 3LV3B 2XWJB 1NGPL 4M3JA 4WWKB 5KSAD 3ESUF 3CX2A 4JHAL 2YR3A 4Y4FA 1VGKB 5JTWA 1EXUB 4PRIA 5ESQA 5BV7H 1WBZA 5KSUA 3HI1A 2X4RB 4D3CL 2BRQA 5DRWA 3QEQA 4HS8H 2P8PA 5JNYB 2NW2A 2AQ3A 1CG9B 2AKRB 3EOYG 3QHTC 2BMKA 3NZHH 4LGSB 1WEJH 3DRQB 1H3PL 2D9QB 4TQEL 5D71L 3BRFA 3LRSB 2X70A 3DVNB 1LO5B 4XNYL 3WFEH 1HSAB 4PTUB 3IETB 5DQ9A 4ELKB 4OLYL 1KPRB 4X9IA 3SPVA 3BO8A 3C2SA 5DI8B 3VFRA 1TCRA 3CK0L 1F58L 5D5MA 3JXAA 4G9FD 4RMSA 5ECJE 1CWVA 4N0RA 3RIFK 3VXNB 1KLUB 1AO7A 2YXFA 5TE6L 3FONB 2H45A 1LK3H 3ZE1F 5SWSD 1CLZH 3EOBB 2YPLA 5DHYB 5IK3A 5JZ7D 2AS5M 5ADOH 1ADQA 4YIQB 4FQIL 4K3JH 1AD0A 2DKMA 5KVEL 3GUTA 5EBLA 4EJ1C 3NFPA 4P3WA 4E9LA 1SJEA 4A6YL 5CZXD 1QFUL 43C9A 5GS1A 2Q3AA 3B9KD 2HTLC 5DD0H 3VFUB 3OAUL 5E95B 3CDFA 4XP1L 4PJIB 4PLOB 4NQVA 2IALB 1OLLA 4XP5L 1P5UA 4XP9L 2BP3A 3DGCR 4YEEA 4OLZL 1UVQA 5ESVA 2VYRE 1JYXA 1AR1C 4NUGH 1MCPH 5HDBF 4KZEL 5JPNB 1AKJD 1OSZB 4MNGB 5F88A 1MHCB 2ZG3A 4FXKA 4QHLA 4KI5F 1KELL 1QR1A 1KSRA 4ZO7A 5C09D 1ZLWH 1JHLH 1R3KA 1M1SA 1NFDE 1N7MH 2AJVH 4RGOL 5EORH 3N85L 1PG7W 2XNAB 3V5HA 2X89D 1T0MB 1EPFA 3KLAA 3OAYH 5DMIL 1Q9WB 5IBLC 3IDMA 2WNGA 4XMLL 2GIYA 3EYQC 3MLWH 2DTSA 1BVKA 3OKMB 2VXSH 5JDSB 4DW2L 4X6CE 2RCSH 4JHWH 1YEJH 3C08H 5IVXA 3ROLA 4HUXA 3HI6L 1JPGA 4NYLA 4PRIB 1RSFA 1WBZB 1S7RA 4DN4H 3HI1B 4WHTA 4NZTH 2P8PB 2EDBA 3HMXA 1PLGL 4HIIB 3H9SA 1L7TL 3QNZB 3VG0H 3MLUL 4J2XA 1A1MA 2BMKB 3NACL 2MTPA 3B5HA 2X70B 5HY9A 2V17L 3DV6B 3SCMA 2ADIA 3VFNA 5E08H 2V9TA 2AI0H 5SWSE 4H88H 5EZLA 3VFRB 4NN7B 1FJ1A 2AP2A 1WZMA 3QUMA 4XNZC 2GSIB 4D0DA 4W6WB 5F44A 5FO7A 3RTQD 4NC1C 4Z7OF 1MF2H 3UO1L 5I18H 3F62A 5EOCL 4HGMA 2E8YA 5CGTA 4CW1B 2YKLL 4Y5XC 3UBXA 2AEIT 4NO3A 2YPLB 5IK3B 4MS8D 1X3DA 3KXFD 3K8MA 5GXBB 2AJSL 3PGDB 4GRLC 4JQIH 1T1WB 1AD0B 3WS6C 4FQXC 3GUTB 2EKJA 3NFPB 4GW1A 2P44B 4HFUH 3VDBA 1AFVL 1JWMB 3BXNA 5GS1B 3PF2A 4FHBD 5DQJB 4RGMB 2YOCA 3QUXB 2FH8A 1JPSH 4K07A 5HHOD 1NLDH 3ARBD 1B6DA 2QSQA 4NQVB 4F7TA 3S88H 2F58L 3C5ZC 4LSUH 5KVGL 5F7EH 4NC0B 1UVQB 1I75A 2BC4A 5ESVB 3ETBF 5M7QA 5D7JC 2H6PA 1FBIL 1M6OB 2MQ3A 4GMTL 5GHWH 4X6EA 4WUUD 3AXLA 4FXKB 4QHLB 2WINB 3GSRA 1YY8A 3QI9C 4KRPB 4YFLF 4L3AA 1R3KB 2OL3H 3SKMA 1JYVA 4BKLA 1R5IB 2P8MA 3EJJX 4QXTB 3D39D 4GQPH 4ODUA 3PWUB 5DVLA 2FRGP 4DAGH 1MNUH 1GVIA 3HAEA 5GS0C 3EDDA 3VW3H 1QKZH 2DDQH 3OF6A 3C60C 4L8BA 4RAUA 3BWUC 3LH2H 4HUXB 4NZUL 1E6OH 2X44D 3FQNB 1S7RB 3AB0C 4GAGH 4WHTB 3DXAA 2ZP0T 1GH7A 4BZ2L 1JE6A 1IGIH 1HI6A 9CGTA 2AVGA 3NIFF 1U95B 5C0BD 3BIAX 1GIGL 4MWFB 4NKDB 1UJTA 2V7NA 1MREH 1WT5C 4IM8A 4LHUD 4H0HB 4OZFH 1VGEL 3U4BL 1A21A 3TH3T 4IRZH 4OGXL 3TJHC 4PGEB 2DLIA 2W9DL 1F02I 3S37X 1CGTA 2ADIB 3C9NA 4U2YA 3LKRA 3VXMA 1BP3B 1MLCA 3KXFE 2Q7NA 3QWRD 4XCCL 5F89B 3V4PL 4D0DB 4A6YA 4TYUA 3V4UL 4ZUWA 1RAMA 2ZUTA 1CQYA 5J3HD 2GT9B 3UBXB 1J0ZA 1S9WB 4TTDC 2VO5A 1U8KA 3JUZA 5GGUB 2FJHB 1BD2A 5HHOE 2IH3A 32C2B 3ARPA 2YSSB 3MRCA 3PHQA 5A3ID 1SJXA 3HNTH 2XQYG 1R5VA 4HUVA 1MVUA 4LLWB 1UB5A 4JQVC 4GS7B 3GSNL 1LMKA 1ZA3A 3ZHKA 1CGUA 4MCYA 1G7QB 3MZTA 1KCRH 4WUUE 4PY7A 5I1EL 3TP4A 4EXKA 4AT6B 2EYSA 2LTQB 1CN4A 1TVHA 3QAZC 3BP4B 2C7UA 4L9LC 2HKHL 2AGJL 1CDIA 3NFSL 2BC4B 2NY3B 3WIFA 2H6PB 1WIPA 3D39E 4X6EB 5KOMC 1QSFD 3CFCH 3AXLB 4X80L 1S7XA 3P4LA 1OQOA 4HC1L 3GZKA 4GW4A 1FG9C 3ZKXC 4NQED 4J4PA 2ZNXA 2H2SC 4FQCH 1H0DA 3TA3D 2CSPA 4Y89A 3LCYA 5K9QG 3CLEH 3L3GA 1A6WH 4PJBE 2VQTA 2VJXA 3IB4A 5IJVA 4RGNC 1BQSA 4I77H 5C0BE 1HQ4B 3UTTA 3HAEB 5IW1B 2FECI 3RGVD 2X4UA 3PG2A 4JFOA 1F3JA 1AXSA 4HQQH 4RAUB 1K2DB 1GGUA 3CLFL 1IAOA 1XIWC 3HA0A 2DQDL 1ZLWK 4GRMB 2OR9H 5K33A 4JCLA 5TFSL 2MCPH 2VH5L 1HI6B 1CFNA 3QO1A 1NCDH 1RK1A 1FZKA 2E3VA 4L8CB 2V7NB 2UWEF 4TNWK 3GMQA 4MJIB 3THML 4FQ2L 1J1XL 3VH8B 4DZBA 5IHLB 2HLFD 3NFNA 2PYFA 3LZFL 2IANE 2N56A 5F3HB 3DMMC 3Q6GL 3C9NB 3MV7A 2J8UE 3V5DA 3HNVL 4O4YH 1MLCB 1CU4L 2FD6L 2ICES 4M48H 3VGAB 1C16A 2WK2A 4YHMH 4IEFB 1G9MC 2EEDA 1WQVT 1UZ8A 5H2BA 3TBWA 1IEAB 3ZT5A 3MV8D 3IAQA 2NW3A 1YEKH 3BPNB 3U0PA 3M8OH 4L8DA 1U8KB 4KJQD 4J3TA 5D1XA 3TBVA 2IH3B 4KAQH 5DUMH 3DBXB 3MRCB 5GRJH 2OSLA 4ZFGL 4WCYL 4XNQA 4HUVB 1TFHA 3B8SA 3PL6D 4Q97A 1MVUB 2VLMD 1UB5B 2W38A 3EYFA 3D69B 3GJEA 3PWLB 2VRAA 1A22B 1GC1L 1FPTH 1T7ZA 4OAWA 1W2KT 1QSFE 4ZDHB 4RA3A 4UU9A 1KGCD 4DGYL 1U8LA 2MPAH 1VDGA 4NQEE 5FHBH 4LSTH 1TVHB 1MJUH 3G5XA 2C7UB 4XVTH 4G5ZL 1CICA 2DN7A 2ZCLH 3PJSB 4NSKA 3C2AL 3PQYA 1PJ9A 2MOVA 4ZFOB 3VCLA 2X1QA 4EUPA 1NKRA 3BWAA 5HDLA 2G5BA 4WUKH 3K0WA 1S7XB 1P6AB 3MX0A 2XT1B 4F7PA 1AIFA 3O0RH 1NC4A 4LFHG 4X4MA 1CR9L 2K9UA 5D1QA 4JEGB 3T0XA 2PO6B 5I9QB 3L3GB 4FMKA 5IJVB 5GIRA 3UTTB 4TRPL 1OY3B 2X4UB 4PPTA 3S34H 4WW2F 5DVMA 3U2SA 2O5XL 1YQVL 2R2EB 4GBXB 2XA3A 1GGBH 5KVDH 1IAOB 4K9EL 3IS0X 2VXQH 3QWOB 3IDNB 4F2MB 3ARWA 5TQ2L 2YWYA 1EBPA 4POZD 2Y5TA 5DJDA 4QTIL 2VZSA 5I71B 1JN6A 3NGBC 2QEJA 4M5ZH 3WSQH 3IDYB 3GMQB 3O4OC 3RKPA 3LHPH 2PYFB 4ALAL 4YHKL 5D96C 3L5HA 1Z0MA 4G8GA 4TSCL 1F4AA 3MV8E 4KDTA 4V2CB 1CZ8L 3UZQA 1MFCL 3MV7B 5I8EB 1MI5D 2UUDH 1T1XB 3V5DB 3OB8A 4MQXD 4MVBC 4ETQB 5E70A 1OTTC 3GSNA 3HE7C 4GG6F 1C16B 5J13C 4I9WD 4ZUVB 3TBYA 1UZ8B 2VLME 2AEPL 5JDJA 1Q38A 4M6NH 1RJYA 3C8KA 4POUB 2KPNA 4WDIA 3S37L 3TBWB 4OIBA 2NW3B 3BN9C 4NO5B 3VWKB 4KKLD 8FABA 1LK2A 4PJ9B 1FN4B 1U2HA 3TBVB 2P5WD 3EJZC 4ERSH 4PJAE 2CR3A 3TVMB 3T3MF 4HF5L 2R1YA 5DDHA 2G60H 3HZMB 3ZMRA 4XNQB 2JE8A 3OAZK 3EYFB 4TSAH 1JNJA 5GGVL 4HC1A 1KTDB 1EV2E 1JFQL 4OAWB 1IGTB 1DEDA 4UV7L 3CSYA 5FA4A 4HKJA 5DFWH 4RMQA 3HG1E 3MLVH 4UU9B 1U0QA 1CK0H 2QBWA 2QHLA 4YHYC 1NAML 2UYLA 4CJ1A 1GZQA 2MHAA 1Q1JL 4Y16D 1MCJA 1X5XA 4NSKB 4AZ8A 3W2DH 2F74A 3OWEA 5EC2B 3VCLB 3RU8L 4EUPB 3BWAB 1RMFH 5K9OA 1BFSA 5LXGL 3X17A 2YPVH 4JPVH 5I73B 4KXZH 3WFDH 4ZTOH 5JR1H 4PBWD 4D0BB 1NC4B 5SWZA 5D1QB 4ZPTB 3FN0H 2GJJA 1UCTA 4G8EA 4OD2A 5K9QI 5DT1L 1TITA 4NIKB 3LMJL 5GIRB 2IBZY 1AHWA 4OCNC 3V95A 1EO8H 2BOBA 3ZLQC 5D1ZC 3U2SB 1IKNA 4AENB 1PKQA 4UT6L 4Q0XH 3K81A 4WI2A 2GI7A 5HHVH 5C0FB 1QNZH 1VACB 4HWUA 4R7NB 2XN9B 4O58L 4Z7VF 5IQ9A 2XI9A 3V9FA 1UQSA 4FZEH 1A0QH 3GSQB 5JMRA 1MI5E 2Y5TB 4EDWL 3EDKA 5DJDB 1HH9A 1MEXL 1JN6B 1A3RL 2VLJD 2E7LA 5BVJB 3BZEA 3EO9H 2EIDA 1BMGA 4I9WE 3B6SB 5GS0H 5IHUH 5HYIA 3KDMA 3IFLL 5LAXA 4G8GB 4JKPL 2CD0A 3GNMH 1V05A 1QO3A 5F8RC 1G6RL 3IXTB 3CVIL 4U6VH 3BESR 5DRZA 5L0QB 5GZNC 2JB5H 2P5ED 1DLFH 2FH6A 3FAWA 3OGCB 1RJYB 3SGEI 5L9DH 1X44A 3OKOA 3QNXB 1HIML 1LK2B 2GITB 5FO8A 1T89A 3T3PE 2EDKA 4DKDC 4QRSA 4TVSa 1KT2A 5DDHB 4ZAKC 5DD1L 4U6HA 3V6OE 4XCNA 3CC5A 4NRXB 3QDME 3PDGA 5IW6A 4M6OH 1UM6H 2B7DT 4XPBH 5EPMA 3CFJA 4PGCB 3RZCA 2HJFB 3DX9B 1GGIL 4LEOA 5A1AA 2UWEA 2YPKA 1IC5L 4HKJB 4HKBB 3SE4A 5CHNA 4OZHF 1NCNA 3H6JA 2UVFA 4S11A 4WFHD 4Q74A 3VXSA 5ADPH 5HHMB 4K94H 4NWTL 2IADA 5I74B 1JUFB 2E7BA 1MQKL 3VWJB 3UTZA 4OFDA 3KS0J 4QT5A 4BELD 3QHZL 5L8JB 3L3IB 4LPUA 1CGSH 4X4XA 3KNBA 2A1WH 3WHE1 1I8LA 3JWDH 4RWHA 4P5TA 3BH9B 4P59L 1AGEA 3VXUA 5FIEA 1MSPA 3K2UH 2VN7A 3SJVE 3TBTA 4XX1E 1A5FH 1CXLA 4LSRH 2F54D 2VN4A 4W4OC 3GRWH 2XRAL 2FX9L 4LRNH 5C0CB 1AHWB 2XIDA 3VFGL 1UFUA 1F4HA 1YEFH 2BOBB 3RVTC 2VLJE 4ZS6C 3CGTA 3ARGA 2VZTA 3P9MB 2C3VB 2Z8SA 4XMKH 1RZKC 4JPIA 4ZYKB 3U4EA 3QDGE 4APQA 3A6OA 5IQ9B 1D5IL 4R97C 3DETD 1QLEL 4RMRA 2XXCB 4WFGD 1RUMH 4X8JA 2AK4A 2CKBH 4UAOC 3MJ9A 5E2VH 5B8CC 1HH9B 4D0CB 4PJHB 3TJEH 4BQ9A 4U0RC 4Y5VB 2CPCA 3UXFA 2ZOLB 5D7JD 3S5LB 3LRGA 4HZLA 3OPZH 4XB7A 4N9GB 1JGLL 4LSDA 3ILQD 4FQQB 3KDMB 2YK1L 2ZPKL 4K3GA 4LSPH 4NN6B 1P4LA 2GCYB 5FECB 5BS0B 4LLMA 2BY2A 2CIKB 3V4VH 4MDJB 5I1KL 3CPLB 5DRZB 3AY4A 3EO0B 1VKXA 5HYQB 1EA9C 3WN5A 1J8HB 2ZJSL 5L2KE 3GKWH 4WEBL 4BH7B 4NNPL 5DFVC 4QOKD 4IRJA 2WWMC 1NBVL 1QFWL 1I3VA 4QRRB 3LB6C 3KPRA 5TE4H 5B4MC 3VRIA 5GS0D 3RDTC 1NAMA 2Y06H 4HV8A 4DQOH 4Q6IA 4LVOB 4WTWA 4WW2A 4YDLC 2IAMD 3EYOA 4QRSB 2QR0A 3EOTL 3BSZL 4WFHE 4F57H 4S0SD 1UWGL 4U6HB 4GAFB 4M1DL 3T4YA 5EZOL 1B0WA 2VDMH 4O2FA 3UBXI 3WUWB 4PR5A 2KZWA 5IW6B 2R1WA 3T1FB 3V52L 4JO2H 5D2NA 5EPMB 3RZCB 4G6KL 2AK1H 3LS5H 3X11B 2UWEB 5JOEA 3MA9L 4KTDH 5CHNB 2R4SL 3X3GH 4X5LA 5FYJL 2WIMA 5CJOL 1IC1A 3MNWA 3VXSB 4N8CL 5ID0B 4FQJH 4F9LC 3MRKA 3BKCL 5E9DE 1OGAA 2OI9B 3WKMH 1T20A 1BGXH 4NO0A 2EO1A 4HBCH 1OCWH 4Y2DC 4IMKA 1NJ9B 3T0EB 4GG6A 2FX7L 4OLUH 2PCPA 4EUPG 2AXFA 4P5TB 4HJ0D 3DVGA 1B2WH 1AGEB 1QHOA 2L7JA 3VXUB 2BXYA 3GMMA 3FFCD 1C5BH 2BDNL 1WTGT 5CFHA 1WJ3A 1ZHBA 2NY1B 3T65B 4WFGE 3U7WH 1U58B 4WNQB 4LPVA 3HRZB 4JPWL 1MWAB 3DX7A 5I30L 5EU4B 3RVXC 1MIMH 3ARGB 4GW5A 3S4SA 1OAUH 2O5YH 1C08A 4U6XB 3PXJA 4U1MA 4JPIB 3TV3L 1UB6B 4XRCA 2ZKHH 3WIHH 4JRXA 1FO0H 3FO1B 4Y4KD 15C8H 4UDUA 4MA3B 2VAAA 5MENB 4K7FA 2NCMA 4ORZC 4X8JB 3IFPB 3V8CA 4RFEB 4ELME 1WZ1L 2EE6A 4XVSH 5IF0A 3EJYC 3EYSH 5EBGA 2E7CA 3QH3B 4ORGA 3QIUB 2VSCA 4HZLB 4QOKE 4JFXA 3L6FB 2NY6D 5B39A 2GUOA 2Y9RT 2XFXB 1P4LB 5F9WB 4WU5B 1DN0B 3SDAA 2HT4C 4DVRL 3QB7C 3QULB 4ONHB 4IMLA 4EKXA 2F53A 2XZZA 2BSTB 1LEGB 3NTCL 1VKXB 5J6GA 4L8SC 1F8TH 1GPOL 3DSFL 3TO4B 5IMKB 2H9GA 1EEZA 4QXUL 4IRJB 3UAJD 4NM4H 2CO7B 1IT9H 3FO0H 5CJXA 1NAMB 2BFVH 2OS7A 5IFJA 3DPBA 4PY8I 1AJ7L 5TQ0H 2ICCA 2WIIA 4FP8H 5MP6H 4N8VB 3MOBH 3T4YB 4JZNA 3V2AR 4Z7VA 4Z7UB 2R1WB 3G6AA 2NXZC 3H42L 3MQIA 5D2NB 3HZVB 1EX0A 3ARSA 3PNWA 1OAZH 4OCRH 4OCSL 4XI5C 1RULL 1MJ8H 3ECBA 3Q48A 3GBNL 4Q2ZB 3EDJA 3CUPB 2RQ8A 5I1LB 3RWHB 3MLRL 5C07B 4P2QA 1ZWIA 3J7HA 1MRCL 1HINL 1MY5A 3MRKB 4PJ5D 2GFBB 4YX2H 4L3EA 4YC2C 1R3HB 4HH9A 3TFKC 1T20B 4PJ7B 3EAKA 4OGAD 3A6CL 2LFGA 1FC1A 2VDOL 1BREA 2EYTA 3WXVH 1JNLL 2PCPB 4NQDD 1OP9A 4Y4HD 5KTEL 4PJFE 1FCCA 4KMTH 1QSEA 4NGHL 5IESH 2AXFB 1QFWM 2JJSA 3GMMB 2X41A 3TNNA 4JY4A 4X8XA 3VGGA 2ZUUA 1AGCA 2GJZB 3E3QC 2JELL 2Z8VC 4MD0B 4CN1A 3C5SA 3ULSA 1ZAGA 3KPSA 4PGZA 4LIQL 1J12A 2CJUH 2HN7A 4GW5B 3S4SB 2QSVA 3KR3H 3WO4C 1RJLB 1OP5H 4XRCB 5A2FA 4JRXB 3MRQA 4PJDE 2GTZA 4UDUB 4YGVB 4C58B 2VAAB 1JTOA 5A2JH 3DGGA 4OZHA 5FM5M 2UVEA 4M7KL 2IEPA 3M1BB 1KJVA 4ZQKA 2Y6SC 1OAQH 3IFOA 5IKCA 3CCHA 1OGTA 3Q5OA 2PR4H 1HEZA 2E9IA 2R4RH 1DUZB 4HAGA 2G9HA 3N50A 2YWZA 3SDAB 3G04A 3ZL4H 3O9WB 2F53B 3BUTA 1FCGA 3HC4H 4HWNA 1TJIH 2ZCKH 3ARZA 4GRLB 3TYGH 4NN5C 1RK0A 4Z77A 2V2TB 3NCJH 2H9GB 1EEZB 5E94A 1KIRB 3QPQD 3BAEH 1BM3H 1KC5H 4OFIA 2M26A 1YYLH 1MH5A 4MNQA 5FM8A 4G6AD 1JRHL 4I3RH 5I0DA 4XNMA 4X83A 2WV3A 1F5WA 1DR9A 3HR5B 4W70A 1MUJA 3SE9L 3NH7H 4LCIL 5ETUA 3NBNA 5J9PA 3ECBB 2WAHA 5C0AD 2A38A 1ND0A 4NQDE 5AZEL 1KN4L 4DUVA 4X4YB 1FORL 3P77A 1MCWM 1Q0XH 2XPGA 4PJCF 1ZWIB 5CGYD 2H32B 1OTUC 3KHOA 3RVWD 3L5WA 4P4KC 1LE9A 3AM8C 1L7IH 1J1PH 3C6LC 3F7VB 3DYOA 3VG9C 4YBQC 5ISZB 1OTTD 2OLDA 3PGFH 2O61B 2XWBB 1T2JA 4Y5YC 2VLKB 5L6YH 4QHNB 2IPUK 3ZDZE 4M8VA 3K46A 3CMGA 4QHUB 4WI7A 1FDLL 3SDCA 3TNNB 4ZUSB 4ZUTA 5DYOB 1I3UA 3EJZD 2AEWA 2ENSA 2F5AL 4LSVH 5JO5A 3C5SB 2VDQH 1UKSA 1DZBA 3JV5A 4I5BA 4B53A 3KPSB 5EO0A 5MEOB 5KW9H 4WO4B 4PRPA 5KSBE 3ARED 3KPTA 3QIWD 1HYSC 2RJMA 1ORQA 5MERA 3MRQB 5JW4R 1KJ2L 3CAFA 2JCCB 4D8PA 3PDOB 3BOVA 3DGGB 4OZHB 4JFYB 1HQRB 4JFED 3LVEA 5EO9A 2CIIB 3IFOB 3B9EA 1CL7H 5IT2L 3SGDI 5C0JA 4NQSB 4WI8A 1GL4B 4P5KA 3V0WL 1RZ7H 2CUMA 3U79A 5SV4A 2NY0C 3QUKA 3I3EA 4S1QL 1FGVL 1A6VH 5TDPA 3G04B 5T3ZH 4FTVD 4Q7DA 4PLKC 3L3JB 4ZSOB 1X6LA 2ZUQB 4BK5A 3OXSA 5ALBH 3W9DA 1YNKH 1W0WA 1ZXQA 1UXWA 3QQ9D 1HYRC 1N3NA 4JY6A 3LAFA 3V0AC 1CLOH 2KQNA 3QFJD 4YFLI 4LGPB 3QRGL 2CQVA 5CP3A 5C0AE 2QKIA 1MH5B 1V7ML 4GXVL 5HGAB 4IOIB 3F58H 3O8XA 2R0LH 3ARFA 1AD9B 3LRHA 5GGTA 4PFEA 1I1YA 4RAHA 1YECH 4C83A 4XZUA 4NQTA 1LQSR 2FIKB 2C3XA 4JREC 3T0AA 2BSRA 5DTFA 2VXVH 3ALWA 3RFZC 1UJ3A 2J5LB 4X6DE 3WS3A 1MCQA 4U1KB 2BHZA 3NZHL 1WEJL 2I60H 2CLRA 2NZIA 4KK8C 5DLMH 2PYEE 3DHMA 3OR7A 3EFFB 4TULH 3QDHA 4DKEH 3OHXA 5IEKA 1IM9D 3TH2T 3WFEL 2V2WA 5DD3H 1RVFH 4XMPL 5F1SA 3NAAH 3SDCB 4OZGB 1IRAY 4ZUTB 4MDIA 5T5FH 2X4TB 2R0WL 4RMWA 4LCWE 3CXHK 3LPFA 5JO5B 5EO0B 4ZD3H 1XGTA 5EH1A 2B5IC 2GEEA 4OF0A 3PWPA 4HUWA 3CXDL 1KJ3H 1ORQB 1KB5H 5DUBA 3S4SG 1F6AA 4D8PB 4K3JL 4FTVE 1TQCB 4KQ3H 5KSAA 3SDDD 2EDHA 1Q9KB 3LS4H 4JDZB 3SY0A 1VFUA 3Q6FA 2QQLH 4QWWC 4RRPG 5T1MA 2WBJD 1OP5K 4S1DD 5TDPB 2G5RA 3GO1L 1A14H 4YK4B 2W0FB 5B39G 2ZUXA 4H1LA 1T5WA 4NUGL 1MCPL 3KS0H 1K5NB 3OXSB 3W9DB 4X4ZA 3CNKA 2HFEA 1N3NB 4JY6B 3O6FC 1JF1A 3DO7A 2X1WL 1FFPA 4XTRC 1V5JA 1Y6MR 1JHLL 3I85A 4KTYA 3MXWH 5DK2A 1N7ML 5EORL 5IVZA 4G9FA 2C4FT 1CTOA 4LPXA 5T3ZD 1QBLH 3A67H 3L3HB 1FFOB 4YHOH 4N90E 1ED3B 1I1YB 1XH3B 4DKFL 2R2HB 5J1SC 5SWSA 2RCSL 4JHWL 1YEJL 4XZUB 1TIUA 1QHPA 3S6CA 2MKLC 2FZ3A 5DSCB 2OXHA 4DN4L 4LP4A 4ZXBC 2OQJA 4NZTL 1E4KC 1S7WA 1RIUH 2HFGH 1MFDH 2ZCHH 3ZT7A 1DQDH 3ALPA 1P69B 1S7TB 2VERN 4XCEB 4P2OD 4MCZB 2Q76B 1S3KL 1DANT 4RISH 3B9KA 5JPMA 1G9NC 1TNNA 3GSVA 1M05B 4YDKH 4U05A 5EZJA 5KZCB 4H8WC 1P7QD 1YMME 2VTFA 1D5XA 3OHXB 3GMPB 3TZVC 4K3DH 1KJ2A 2V2WB 5C2BL 1YNLL 1X4XA 3H9ZA 3EDEA 3EHBC 5B4MD 3IKKA 4M4RA 3HPLA 5ENWA 4DGVL 2AXGA 5D6DC 1RPQA 2FATL 3TT3H 2R2CA 5C09A 1H3TA 1MF2L 5EU5B 5I18L 1WVZA 4CU7A 3O4OB 4JG0L 2A6DA 2HT2C 1XGTB 2X89A 4R6UA 3T0VA 4MA1B 3MLSH 2H3NA 4HUWB 1A9EA 1RZIA 1QBBA 5CD3A 1N8ZA 4G8FB 1F6AB 5GZOC 4JQIL 2F5BH 5KSAB 3BUYB 1L9MA 1U8IA 3MJ6A 1G1CA 4HFUL 3SY0B 2ATPB 1NFDB 4PJCA 5A16B 3Q6FB 4RCAA 3MRPB 5FGBC 1JPSL 3OXRA 5HDQH 3GSOA 5EU7E 3H7BA 1NLDL 1J86A 5IG7B 3FQWA 4F7EA 1FVCA 4HKXA 4LSUL 1D5MA 3MBEC 4WJ5A 5CKAA 4X6CB 3NCCB 1CGYA 1I85C 4AM0A 4EVNA 1U92A 4D9LH 1EAJA 5T3ZE 1C5DA 5JW3H 3ULUE 25C8L 4HEME 4URTB 3MRLA 4JFDD 5LBSL 1A1NA 4LVNB 3D85D 4WGWB 2ID5A 1JF1B 1QSVA 3DO7B 5IMLA 2KH2B 4TOYH 2D31A 3MR9B 1WFOA 3QXAB 1YN6B 2IPKA 3HFML 1OTSC 1H3GA 2OL3L 2R23B 1KTLA 1ADQH 4HH8A 3VFTA 4YHYB 3DX8B 2D7TH 3RTQA 1AQKL 2L4OA 1D7FA 4DAGL 1MNUL 3WLBB 1LEIB 2BNUA 2DDQL 1ZLSL 4Z0BH 5SWSB 3RWDB 1CVSC 4FABH 1E6OL 5E6ZA 2XA8H 3KXFA 2FZ3B 1B0RA 2OQJB 3EYVA 3X13B 1S7WB 2DWDA 1L6ZA 2D0HA 4JGJA 3VFSA 1IGIL 4OF3A 5LKNA 5LGJB 2FBOJ 5BO1H 5ERWA 3V8OA 5I17A 5IR1A 2HT4D 3MRNB 2AJUH 1MFEH 3B9KB 3AU1A 3KJ4B 4QRUA 2QQKL 5HHOA 3GSVB 1S7QA 2J8OA 2LU3A 5JHDD 4LLYA 3R8BB 4IRZL 1JYWA 4JVUA 5EZJB 3QUYC 1D5XB 3QIBC 3KG5A 3CFKB 1KJ2B 5I8KH 4X5XB 3ZE2F 1DQJA 5HYSB 2DQIH 3NZ8A 4MAUH 1AKJB 2AXGB 3D48R 1EVUA 1IC7H 5EB9A 5DMGD 4MJ6B 4KROD 1HOCA 1B4RA 1TETL 2NR6C 5CEZH 4OTXH 2QSCH 1JZ6A 3OKDA 3GI8H 1NCAH 1I9EA 5TE7L 4CMMB 1X5AA 2I9LA 2I9TB 1HHJA 1X5ZA 2H3NB 3H3PH 5IHZA 1XR8A 3K7UA 3BGFC 4PJEE 5CD3B 1N8ZB 3BW9A 1TQBC 5J8OA 5ICZA 3RY6C 2XV6B 4PJCB 5DHVH 1KCRL 4IIQA 4R0LC 4PJBA 3TFKD 3GSOB 1RHFA 1JPST 5IFHH 2L0DA 1FVCB 4KUZL 1WAAE 5HD8C 1FSKB 4LHUA 4WJ5B 1U8PB 1PKOA 1U92B 3ARTA 4ZAKB 1F11B 3D0VA 1X5YA 1MJ7L 2EH8H 3CFCL 1A1NB 4K2UH 3BP7A 8CGTA 5BV7B 2Y07H 3L1OL 4PS4H 4HK3J 1ETZB 4FQCL 2IPKB 3IU4H 1RUAH 1XZ0B 2ZSWB 3QWRA 3RJQB 3VFTB 3FB6A 5CEYB 3U7AA 2KBGA 1DE4A 1JHTB 1J88A 3CLEL 3RTQB 1A6WL 1KJMA 2D7PA 1MOEA 3MBXH 4I77L 2HJKA 5IMOA 2BNUB 3TNMA 1KXTB 3U30C 1ROWA 2XQYK 4HQQL 1JPFA 4MAYC 1Q9LB 5JHDE 3KXFB 5FUOL 2OR9L 1B0RB 3NCEB 2MCPL 4M7LH 3IDXH 5JW4M 4JHAH 5IR1B 1WZKA 3AU1B 2BCKA 5HHOB 1S7QB 2EDOA 3ARBB 2VLRD 1XR9B 3MV9D 1SY6H 1ZE3C 3U9PL 3KYNB 2YMXH 1DQJB 2DIBA 3GFUA 3G5ZB 4TPRH 5J0BA 3T1WA 1QSFA 1H8SA 2IQAA 1H3PH 4WUUB 1ITBB 4M48L 5D71H 4YHML 4DOHE 4LFHD 4O2CA 3EW3B 4NQEA 3KLDA 1P7KB 3R0NA 5FGRA 3RL1A 4QCIB 1G7JB 3TA3A 3QZWA 4HWEL 3W39B 4LSSH 4OLYH 5FDYA 1YEKL 4M61B 4P0DA 1HHJB 2CDEA 3CK0H 3D39B 2NX5D 3RX5A 5DUML 3ZSTA 3CVHL 3QEQE 5DJAA 4YDJB 3RGVA 2VR5A 4R2GD 5F97E 2EE9A 3L3KB 5ICZB 1NPUA 1KACB 1FPTL 1SQ2N 5CEZD 4IIQB 5A43C 4P4KD 4PJBB 4OF7A 2OL3A 3RHWF 3C6LD 1T4KA 5FHBL 2MPAL 3CU7A 5C0BB 1X7QB 4LSTL 1MJUL 3VMNA 4XVTL 3V6FA 3IKCA 1DQLH 1QFWI 4LHUB 4D9QD 4A6YH 2ZCLL 4HJJH 3K4ZA 1SJHB 4WUKL 5D5ME 2ATKB 4XB8A 5DR5H 1AO7E 3L7EB 4G43B 3MREA 4H1LG 3FRUA 3ZT6A 3ZYZA 5B38B 3GMOA 3S9DB 2DL9A 1MFAH 3FB6B 4A2MA 3O11A 5TDOA 5BQ7A 4Q9QH 4QNPF 2IANB 4U6YA 1I7ZA 4JFFD 5GSVA 4OZFA 2HJKB 4N9OB 5IMOB 5FDWA 1CT8A 4NC2B 5F9JA 2J8UB 3TNMB 1GOFA 2A6KB 2E5EA 5EU6D 1GGBL 5KVDL 4RGOH 4PD4J 3QJHA 3FTGA 2VL5A 4HXBL 3KWWA 1TTGA 4JVPA 3RNKA 3MV9E 2DLHA 5ICXB 2EIEA 1OF2A 4MJ5A 4KJYB 1FFNA 5F7NC 1U41A 1VHPA 2A0LD 1INEH 4M5ZL 2JF1A 3NABL 3WSQL 2BCKB 2CLVA 1FL5A 4GQ9L 4P9HH 4YLQT 3LHPL 3OKLB 3I02A 4M7ZC 3X12B 2R9HC 5KOVC 5E8DH 4AEIL 1PLGH 1N59A 2F8OA 2B1AH 1GSMA 1LD9B 1D6EA 3MLUH 3NACH 1QSFB 4M1CC 3UZEA 3D2UD 4TVPH 5IBUB 3CFIC 4NQEB 4PLJC 3DJ9A 1S8DA 4M6NL 3PGCB 3TA3B 1G9NH 1EEYA 1V7NH 3MUY1 3QEUB 2BY0A 3G6JF 5H37G 5IVXE 5A2LH 2CDEB 5FKAA 4C56D 1S78D 4J8RA 2G60L 3QFDA 1MPAL 3UO1H 1NDMB 5DJ2B 3AFLA 1F2XK 3R0MA 3H9SE 4TSAL 3WCYA 4ACPA 3ORJA 5DC4B 2DJUA 1A7PL 3MLTA 1NCWH 1I8MA 1BECA 3P4MA 3MLVL 1CK0L 1MHHA 1T4KB 4S1SL 4G42B 4GKOA 2LU7A 4V1DD 1IM3A 4JKWA 3DUHA 2HRPH 3V6FB 3IKCB 1AFVH 5GSRB 5GRUH 3QPXL 3W2DL 3DRTB 5CILL 4JFFE 1FZMA 1RMFL 4UOW0 2EIZA 2WQ8A 2CRMA 1JZ7A 4JPVL 4ZTOL 4LPYA 1MI5A 2F58H 4DK6A 1I9IH 3BQUC 3FN0L 4DK3A 3PDDA 2PXYA 2Z31B 2R0KL 3HI5H 4DFHA 5BQ7B 2ZUSA 2VAJA 4LKCA 1I7ZB 3VDCA 1A7NH 2HTKC 1H15A 5B3JF 2YC1A 1MCKA 5C0EA 4OZFB 3MV8B 1MAKA 3DUUA 5FDWB 3HE6D 1CT8B 1EO8L 4YGAB 5F9JB 2J1KA 3VXRD 3GM8A 2P5WA 3QEGH 1KB9K 5HHVL 2W0PA 5HXMA 1QNZL 2IG2H 3U6RA 3B2UC 3RNKB 4MJ5B 4PJFF 2DI9A 3PL6B 1NGXA 4FZEL 1A0QL 3B9DA 4DCQB 1FFNB 3RJDA 5I1AA 4LLAA 3CFDA 1PX3A 3RWFA 2WUBL 5L8LB 1JGEB 2CLVB 1FL5B 5GS0L 4LP5A 4OI7A 4DUXA 5E2JA 2HMIC 3V6OA 2E27H 1UEYA 3GNML 5E6ID 4Y16A 4F37K 1KN2H 1FYHB 4U6VL 4C56E 5HHQB 1QRKA 3WO3B 5KBNC 1MFBL 1VGEH 3BJ91 1U3HD 3HG1B 1CGWA 1DLFL 3SKOB 1U36A 3BFOA 3QA3B 5IGXL 2W9DH 1SBSH 5HHPA 5H8DA 4LCUB 5L9DL 1EEYB 4HIEA 4PRAB 2OMBA 5GGSY 4XCCH 3V4PH 3JUYA 3GHEH 2R69L 3FN3A 1BBDH 3DXAE 2A74A 4H0IA 3TN0C 5K59E 1ZVHA 1CXFA 4ZXBD 2IH1A 4ODHH 1S9XB 1CDHA 4TVPD 3EGSA 4L4TD 3IAGC 1UM6L 4LU5H 4XPBL 3RWCA 4KDVA 2EXYC 5A40E 1I8MB 1NQBA 5DMKA 2ITCA 3MOAL 3QT2A 4H25A 4H5SA 2FSEB 2YUVA 4ONOA 3ARDC 1R24A 2RHEA 4U6TA 3OTTA 2IBGA 1NUNB 3V6BR 5ADPL 2VLJA 3VXME 4PG2A 4LQ1A 1SEBA 4PGBA 1I7RA 3QQNA 2EICA 5I1EH 4JANB 3REWA 4P23D 1JRHI 3NIDF 2A1WL 1MI5B 1CVRA 5DJ6A 4JLRA 2HKHH 1T21A 1T3FA 3JV4A 2DI8A 4JJ5A 1BWWA 4KI5D 2P5EA 1R0AH 5FUCE 3K2UL 1BD2E 4WWKC 4HD9A 1T0NA 2R39A 4LSRL 2DM3A 3GMNB 2YC1B 3GRWL 4LRNL 5TH2A 3QJFA 3MNVA 4MLSA 5JXED 4R3SB 1A4KB 1KCLA 3O2DL 1U91B 4XMKL 2O26U 1KNOA 3TBSA 3ME0A 1ZANH 2JJTA 5D1XD 3ZZ1A 2HKFH 3QUZB 2IQ9L 1KTKE 5I1AB 3KLHC 1RUML 1F2QA 2CKBL 2A9MH 1T5XA 5E2VL 3RWFB 1WWBX 3RPKA 5C0DB 3FB8A 3TJEL 5D7IF 2W9EH 3CLFH 3ILPA 4CDGC 5JLZA 1K4CB 5E5RB 3B3IA 3JTSB 3OPZL 3RWGA 4XPAL 4I2XA 4LSPL 2VH5H 3QDMB 4Y16B 3FAXA 3GKZA 4WTXA 2WW8A 3RKDC 1J87A 3V4VL 4BZ1H 4PYHA 2OK0H 1CICD 1FE8L 3THMH 3ZE1E 5E4IA 1A1OB 3LZFH 1HDMB 3IJSA 3GKWL 1BLNA 3MFGB 1CE1H 3TGXA 1L6XA 2B4CH 3UTTE 2H8PA 4L4TE 3Q6GH 3MLZH 5TE4L 2FDBP 4HIEB 2Y06L 1ZGLM 3Q5TA 3LPWA 4W81A 3H9YA 3MRDA 2F54A 5AAMA 5JOPD 3QZWG 2A74B 4LBEA 4F57L 1HILA 1Z6JT 3WS6A 1BJMA 4P49A 1FLRH 1VFMA 3EGSB 5C71A 4JAMA 1G9ML 1KPUA 1OL0A 2AK1L 3SJVB 1BFOA 2XZAH 3LS5L 1OP3H 4XXDA 3F12B 3KPPB 4H5SB 4NQCD 1BPVA 5HDBE 2CGRH 2FIRT 4YO0B 5AUMA 4WCYH 5T1KD 4ZFGH 3QUYD 4DKAA 2VLJB 1FLTX 4KI5E 1NGZA 4FQJL 1GC1H 3V6ZA 1SEBB 3MUZ1 5D7JA 1I7RB 1KG0A 5GRXG 3CSGA 3QDGB 4P3DA 1BGXL 4PJXF 4N0FA 2YD1A 3IJHB 3S96A 3MRJB 5DJ6B 4JLRB 1T21B 3KYOA 4TNVF 4G5ZH 2MJWA 3JV4B 1H8NA 3ARUA 1U8HA 3D18A 3G6JA 4QOKA 2GAZA 5F3BA 3PHOA 3U7WL 5H94A 4X6DF 3MNVB 2DS4A 2DQUH 2MCG1 3C6SA 3VFOA 5I1CH 1CR9H 1ONQA 2IAMA 1P84J 3C60A 3K4AA 1KNOB 4U1HA 4KJWC 4PJ8D 2ZKHL 3WIHL 3ISWA 1FAIH 5L2KB 1FO0L 3RPIB 4U1IB 3VGBA 1WWAX 5DRXB 2PW2A 1VCAA 4MXWL 1GGYA 2O5XH 4OGZA 4UILL 4XVSL 1YQVH 3FB8B 3W11C 4BUGA 3PQYE 1WT5A 4K9EH 4NM8L 4Z76B 1WTLA 2WBWB 5BOZG 4JG1L 4KTEL 4NN7C 3JVGC 1WWCA 5IB3B 2O93L 2FLBT 5C0GB 3Q5YA 3LQMA 4JFHE 4X4ME 4Z7OE 2ADFH 4OF5A 2FHFA 1NCTA 5BJTB 4KU1A 4CJ0A 1R3LA 1F8TL 1E4WH 2NLJB 4OIIL 3ULVC 3IJSB 4X9BA 4LSQH 4TUOB 4P46D 4TSCH 4NKIH 2H8PB 3L95B 3PP3K 5HI4C 2ED8A 1M7IA 1IT9L 3FO0L 3FFCA 3MRIA 2BFVL 5M95B 5DC0A 1WIOA 5SWZD 5E9DB 3T2QA 1WZLA 1I7TA 3RZWA 5FKPB 3PWVB 5TQ0L 4LBEB 4OBRA 5GS1C 3MYJA 5BZWA 4RGMC 2X5PA 3MOBL 3S37H 3QUXC 5F1KC 4PJFA 1NEZB 4JQVA 2YA0A 3UPCA 5ICYA 3ZE0F 1OAZL 1BFOB 5GRVL 4Y4KA 2P7TA 4XXDB 1QEWA 3EFDH 2VUYA 3ZDXF 4EN3D 5AUMB 3SDXE 1OVZA 4L9LA 1EEQA 3GRWA 3LEXB 5GGVH 4YX2L 1S9KC 4KKCC 1E4JA 4KRPC 5CUSL 1VADA 4N0FB 4YXKL 5JUEL 5ACZA 3S96B 3CFEA 3WXVL 3FL7A 1I8IA 3E0GA 4KMTL 2YXMA 1CTNA 1O7SA 1G0YR 5IESL 4ELMB 5F96H 2CKBA 3DROA 2XZCL 3AC0A 4QOKB 3NPZB 5HI3C 4XBPB 3T77A 3U0TA 3PHOB 5H94B 1HWGB 4UDTB 5L7XH 1CD0A 4CL7A 4QHKI 3SDYL 3QYCA 1H3UA 1L0QA 3BJLA 1ONQB 3NIFE 2IAMB 3BKML 2CLZB 4Z6AT 5JA8B 5DT1H 4I4WB 5J56B 3VXOB 4KH2A 5IHBA 3P4OA 2A73B 1OAQL 3SCMC 4LARH 3UEZA 3MOQA 2PR4L 3TM6A 3QG6A 1PZUB 4XNUH 2R4RL 1KCSL 4AEHH 5IWLC 4UT7H 4P57B 5E6YA 1UC6A 4Y88A 2FX8L 3DMMA 3NN8A 4PJ5A 3ZL4L 1MEXH 1RIHH 5SWZE 4LHJB 1A3RH 3HC4L 1TJIL 2ZCKL 1BIIB 2ERJB 2M2DA 2AJZA 1QPXA 1R3LB 3ZKSD 2F15A 2X4QA 1OT1A 2EDWA 5EO1B 2X1PA 3NCJL 4HWZA 2V2XA 4NQDA 1A3LL 4Y4HA 1FL6A 4X99A 4N0UA 4Z7NF 4RX4D 2Q7YB 1G6RH 5J89A 1M7IB 4NJAL 5TPWH 1PKQE 1K8IB 5GRZA 1X9QA 2AV1A 1BM3L 1KC5L 2FNBA 1YYLL 4GS7C 5C08D 2NY2D 4NZRH 3TH4T 5F9AC 4I3RL 3MBEB 3MYJB 5BZWB 4OLXH 2Y36L 4HHAB 4PJFB 1IBGL 2AJ3B 5ICYB 4C54A 2LTQC 4LCYB 2DQTH 5K9KB 3O45A 3NH7L 4Y4KB 3ZKNC 1LO3L 3KPQA 1M7DA 5IVNA 2XKNB 5D7IA 2NY3C 4IRSB 5L2JB 3FHAA 4QHMB 1S7VA 5DD1H 5C2UB 2VLLA 1Q0XL 3N1PC 3VRLF 1FNEA 3IGAA 4PB9L 1YUHA 3MSPA 1D9KD 4OZIF 4AEFA 2NY6B 1GGIH 2FGWH 3D6GA 2Y1VA 5F1IB 1VADB 5AYQA 3UYOD 4PJDB 4J12A 5ACZB 2ZOKB 3PGFL 2EIBA 3CFEB 5I1DA 1PYWB 4UOJA 3WIHA 4F58H 4PLJD 1A47A 1I8IB 1FO0A 1YMHA 1OP3K 2X10A 1A9BB 1MY7A 4U0QB 1JI2A 3KPMA 4LEXL 1JF5A 1BIHA 2CKBB 5E2WL 4EI6B 1CFBA 3WL9B 4UQ3A 2P8LA 3U0WH 2X7LB 1HWHB 4QF1A 2C5DC 2VDQL 3RWIB 2BJML 1QRNA 2P46B 5KW9L 3V7AG 5D72L 2BHYA 1OT2A 4FOMA 5T33H 4OKVA 1C12A 3GMLA 1RQ5A 2FX9H 5IM7B 4Q58C 1TZIA 4ZFZB 1AXTH 3P4OB 1RY7B 4LCCA 3WFBH 3MGTB 1C7TA 1RZ7L 1PY9A 3WFCH 2W60A 4YUEL 3UYRH 3X14A 2DQGH 1YEDA 5J6HB 4PJXA 1A6VL 3VGAC 1DEEA 3HS0B 3VXUE 3IAPA 3VD7A 5BMFL 4KV5F 4PTTA 5ALBL 1TQBB 3BPNC 1YNKL 3L9RB 2YK1H 2ZPKH 4NO0D 4NQDB 4Y4HB 4NDMB 1UKQA 1B0GB 1WK0A 2H41A 4X99B 2VDRH 4N0UB 3WUZA 4L4JA 2NQCA 2CO6B 1KLGA 1MIEH 3EO1B 1CLOL 4GUPA 4OD3H 3NA9H 4X6DA 5I1KH 4RDQF 2AV1B 5DO2C 1NC2D 4C55A 5DRNA 2ZJSH 1OD7A 3E6HB 4NNPH 3RUGF 1MCFA 3F58L 2BOCB 4BH8A 5LQBL 3HCVA 2AK4E 2NPLX 3C87A 2HAZA 1YECL 1PQZA 3H3KA 1KIQA 3QIWA 4QTHA 3QQ4B 1AC0A 3O45B 4W6XB 3KPQB 3DTXB 1M7DB 5AEAA 3BSZH 3FOMB 5AD0B 1S7VB 2H2PD 1G7MA 4M1DH 4M8QA 3TIDA 2VLLB 3O3DA 5EA0H 2VXVL 4JFEA 1OARH 3IGAB 2HT3D 4KZDH 4G6KH 3C8HA 5KSBB 3MA9H 1NCCH 5DLML 3BRDA 2P43B 2R4SH 1SVCP 4HDIA 3GHBL 3U30B 2PO6C 5I9QC 1IEBA 4TULL 4DKEL 4N8CH 1FO0B 1RI8A 3KPRE 3IVKA 1RVFL 3BKCH 2YEZA 3IRPX 5HGDA 3NAAL 3LKSA 1ORSA 1F6FB 4UQ3B 5T5FL 2P8LB 4GBXC 4ENED 2OR8A 5DJCB 5INCA 4LRIC 4Y8DC 3IT8D 1EHXA 1L9NA 4QF1B 1A6AA 3QFJA 2MFNA 4TN9A 2W92A 2HVKB 3OSKA 5DD6A 4JM2D 5I71C 2EXYD 1KJ3L 2DQJL 5HPMB 1KB5L 3IDYC 1ZSDA 3GMLB 1NGYB 3BDYH 1Q72H 5TDNB 1KUMA 1TNMA 1VENA 2NY4D 2VWEC 1TZIB 4DGIL 3LS4L 5I30H 1D6VH 4NZDA 5EFIA 2HA1A 1OGAE 4LCCB 1AGFA 5C0AB 2QQLL 3MGOA 4HPOH 4NCC1 1DUYA 1EUUA 1YJDH 1BJ1J 4XVJH 3DWTA 3X14B 1YEDB 4GG6E 4M00A 1G7HA 2BVOB 5FYKH 6FABH 4J3OC 4WV1B 4HS3B 3KAAA 1TTFA 5KAQF 3ES6B 4WWKD 4PJ9C 1IM9A 4MXQD 3T3ME 4EI5D 4FQHA 3TVMC 2WQRA 5DEFA 3U36A 1FH5H 1MCCA 4NO2A 4X6DB 3MXWL 1QSED 5FHAH 4IOSD 1HXYA 3FO9B 4C59B 2DQEH 3BYYA 3L3OA 4JO3H 2YUXA 5KG9A 4WW1B 1QBLL 3A67L 1GPOH 2VIRB 4BH8B 3TF7C 3B2VH 4Z18A 2CDGA 4Z78A 4PG9B 3BKYH 4HS6B 4KK6D 3AREB 3QIWB 1G7PB 4QTHB 3ULVH 3I3DA 4V2BA 1MCBA 3QEHA 3BP6A 1AJ7H 4FS0A 4PGDB 4L1DA 4NQXB 2X09A 2ZCHL 4LCWB 2HFGL 1MFDL 1P4BH 3SDDA 1DQDL 1G7MB 4RZCA 3P73A 3O3DB 4BSVA 3H8NA 3LKOA 3AGVA 3AAZB 2F53E 1FYTA 5I73C 1JBJA 1QSZA 1A6ZB 3GJFA 4RISL 4JFPA 4OCSH 2WBJA 1BZ9A 5HYJA 4OI9A 5D1QC 1IGCH 1FRGH 1KFAL 4P2RA 4YDKL 3VGDA 4OI8A 1YEHL 4HDIB 43CAA 4I13B 3KYKH 2WLYA 3EUUA 4FTVB 5HHXH 2WM0A 5E00B 5CP3H 4K3DL 3WHXB 1MRCH 1HINH 5SWQA 2YEZB 5FYLH 5HGDB 1RURL 4E42A 4OT1H 4K3HA 3ET9F 2VDOH 5FB8B 5INCB 2KKQA 4Z7VE 3QFJB 1U3YA 3Q0HA 4NGHH 1NBQA 1U2CA 2EDQA 5DD6B 4N0CC 2FBJH 5FA3B 5ITFA 4R9HA 5JW4N 1ZSDB 1E28A 3P4NA 1XGQA 3FQUA 5DJXA 3SO3B 2YN3A 1IC4H 5CP7B 1TCMA 3L3DA 4P2QE 5B8CA 2A6JA 4ZUUA 2LVEA 4L3EE 3L7FB 4KDTC 3RX7A 1EK3A 4AQOA 3MGOB 4IBLT 4HIHA 1IL1A 1TPXB 4OZIA 5E8EA 5B3NA 4H0GA 1JF6A 3O3EA 1G0DA 4P2OA 3UMTA 2ZWLT 5I16B 2D4FA 1G7HB 2Z91B 4M7KH 1QSEE 1CFSA 1F42A 4MA8L 1R3JB 4D9LL 5JW3L 1Z9SA 3Q1SH 1P7QA 1T6VN 1IM9B 5I75B 3KHQA 4FQHB 4PRHD 5DEFB 3U36B 3KPSE 4TOYL 2FEDC 5E5MA 1HSBA 3NCYP 1RZJC 4U1LB 3RDTA 3MNZA 1HXYB 3RP1A 4LLVA 3L3OB 2D7TL 2E6PA 5KG9B 3S36X 3U46A 3EBAA 4P4RB 2IPUG 1YA5A 4UB0H 3S3JA 2D03L 2CDGB 4Z78B 1YMMB 1MCEA 4WU7A 1ZLUH 1DBJH 3GSUA 3MA7B 1D5ZA 2FCBA 4Z0BL 3U82B 1CDUA 4FABL 4PRPD 3BP6B 3SGJA 1IKFL 4RFOL 2HJLA 2V7HA 5I74C 3SDDB 4E5XA 1QG3A 4RZCB 3NCFB 1BVLA 3VWJC 4BSVB 4ODXA 3MLYH 4KXZI 3LKOB 4HGKC 1T22A 5BO1L 1DTUA 3ESVF 5TGBA 3UPRA 2AJUL 1MRFH 1MFEL 2NYYC 4WHDA 3S98A 3SE9H 4ZODA 1BZ9B 4OUUA 2B8OT 1T1YA 3F7YB 1AGDB 2AW2A 1S9YA 3ULVD 1H5BA 4XAKD 1A7RH 1KB5A 3DIFA 5I8KL 4PLNC 2QJDA 5FYJE 5SWQB 2DQIL 3K1KC 3KPLB 1AHWC 1CS6A 4MAUL 1JGDB 1NBZB 1WITA 4JFDA 4U31A 5GGSA 4MNQE 1IC7L 3D85A 1QVOB 4YAQA 5I76B 5J4MA 3TLRA 3FT4A 3ARYA 3DX6A 5CEZL 1T2QH 3MCLH 4OTXL 2QSCL 3RUGA 4JPKL 4YBHA 1XCQA 1NCAL 1JHKH 3F7QA 3QUXD 1ZT4A 4BQCA 4AIXA 3K8KA 1FDLH 2OTUB 1VSCA 1JNNL 5KSVB 3H3PL 2E7LC 5DGQA 1XGRB 1YEGL 1E28B 3P4NB 4Y5VC 3FQUB 2F5AH 1INDL 1XGYH 3PHSA 5DJXB 3O8XD 1C7SA 3UC0H 2IWGA 5HPOA 4XH2A 3L3DB 4QRQA 5A2IH 2A6JB 1DBAH 4ZUUB 4NN6C 1YY9D 3F8UB 3BPCA 1CDCA 4FFWD 3O3EB 4PRHE 1VEPA 4P2OB 4MZ2A 5IFHL 2XXMB 5I66A 1BZQK 5F7DA 2DMKA 5H37H 4DTGL 5C6PB 5JHDA 1W0VB 5K59F 5J12B 5LGHL 4L8SA 1T83A 4F3FA 3V0WH 4AH2A 5DVNA 2EH8L 1T89C 4LVOC 4K2UL 2Y07L 1FGVH 4PS4L 3MRMA 4HK0A 4EZMA 5IV2B 1I7UB 1HSBB 1QBMH 1Y0LA 3IU4L 4OB5H 1RUAL 2PW1A 1O0VA 2FJGA 3RVVC 4PRPE 5D70H 3RAJH 4LLVB 5C0IB 1CFQB 3O6MH 5FM5O 1BFVL 5IMMA 4NCC2 3RZCC 3MBXL 4HCRH 4WU7B 2QLVB 4J7RA 4ZPVA 4LNRA 3GSUB 3QDJD 1D5ZB 3UTQA 1UACL 1SHMA 3QRGH 3S97C 5BVPH 5GGVY 2FO4A 1V7MH 1LHZA 1FVEB 2OI9C 4XAKE 3W5MA 1TZHB 2GJ6D 4G80A 4J3WA 4M7LL 4ODXB 1XCTB 2A83A 3O3BA 3IDXL 3T0EC 4XWGH 1FVDA 1VB9A 3DUSA 1I8LC 1UWXH 4P5TC 3QQ3A 1NANH 3TPUB 1T1YB 1K4DA 4HMDA 1MHEA 2MKWA 4NT6A 4PJEB 5F7MC 4WHYH 1SY6L 4O2EB 3F5WB 2NY1C 2YMXL 3SE8H 5HGHA 4WTZA 4TPRL 4IHOA 3SO5A 2ADJB 1A64A 1C5CH 4XVUC 2XICA 5GGSB 1CXHA 3VI3F 5FGCE 1GZPA 3ARGC 2HG5B 3FT4B 4OZ4A 1LDPH 4U7KA 3VA2C 1IAKA 1XCQB 4HLJA 3UROR 1XEDA 4LSSL 4WI3A 3FHQA 3I9GH 5CWSB 4XMPH 2NY5C 4YNYB 1F00I 2R0WH 4LNVA 1S5IL 2AV7A 1EZVX 2F19L 4HAFA 3QIUC 2DQFA 1LP9E 3VFPB 2UZIL 1I8KA 2EKSB 5F9WC 3GSXA 2DQHH 2WWKO 4LIQE 2OTPA 1NBYB 3CXDH 1G7IA 5E8NA 4EOWH 4B0MM 2OBGA 1MCNA 4MXVF 1JP5A 2ARJA 2EZ0C 3RVUD 3TO4C 1DQLL 4I0CC 1IAIH 4NNYA 4IRJC 2GTWA 4BSJA 4J3VA 3BPLB 4HJJL 3U9UB 5JHDB 2VLRA 3LQAH 3MV9A 2NZ9D 3QXWA 4Q6IC 5DR5L 4ZNEA 3QDJE 3QXTA 3GO1H 4Z7WF 1JK8A 1Y0LB 1BF2A 1MFAL 5CMAA 3D25B 3PWPE 4ZS7H 4NPYA 4WI6A 4X98A 4YHNA 4KROB 5D2NC 2GJ6E 4Q9QL 4G8IB 3PP4H 4ODBD 4MJID 3VFWB 4XBEL 2NMSA 2J8HA 1EIBA 4GG8B 2D7OA 5MI0B 1EBAA 3JTTB 1D5BA 3SBWC 1UXSB 2NX5A 3UTQB 5JORA 2IFGA 2PKDA 1LO0H 3DURA 2OXGA 2I27N 3IFNH 2FO4B 3S36L 2CDFA 5D4QA 2IPTL 4DOHB 1RUKL 4F7CA 1A6PA 3LKQB 4MJ4A 4G80B 2BZDA 4DKFH 4IMKC 1Z0NA 2VE6A 1INEL 3KLSA 1FVDB 4Y4FB 4P4KA 4CRPA 4JZOA 5ESQB 1P84K 1I3GL 3C6LA 4P9HL 5KSUB 1K4DB 1MHEB 5DRWB 3QEQB 4I48A 5E8DL 2NW2B 3NIGF 1YEEL 3CZJA 4Y5YA 1KYOK 2VR4A 2B1AL 4B50A 5HGHB 1S3KH 3FQTA 3U4AA 4G9FE 4Y7MA 4I18A 4TVPL 1GZPB 5C6TL 1YN7A 4FQLH 5DHVA 5AG9A 1I1AD 4LASH 2N7BA 2P42B 1EJOL 4JGUA 3OB0H 1IAKB 1G9NL 5EU3A 5DQ9B 5C2BH 1YNLH 1V7NL 3SPVB 3BO8B 5D6CA 1TCRB 5JW4Q 4DGVH 1KEGH 4JFFA 1QACA 5D5MB 2SEBA 2FATH 1AO7B 2AV7B 4LPCA 3VFVA 5F6IB 1I1RA 4YHZH 5E8PA 1B3JA 2QQNL 1N5AA 5EU6A 4JG0H 1R6VA 4ODSL 5EN2A 1U9KA 4J23A 1NCWL 3SDAC 3MRRA 1G9EA 4U1SA 3O9WC 5E8NB 3OKKA 2WZPD 1SM3H 3BHBA 5EBLB 5BOPA 2ARJB 2GK0A 4U4BA 1BF8A 2HRPL 4XCFL 2XTJD 1PDKA 1SJEB 5GRUL 1A7BA 43C9B 2VLRB 3WJLC 3MV9B 4UIKH 1UM5L 4OQTH 5C09E 3SKJH 1BOGA 2DOCA 4GBXD 5C3TA 3TCLA 1HNFA 1JK8B 4YXLL 1I9IL 5L8KB 4PIRF 1N6QL 3UJJH 1U8NA 3D2UA 1Y18A 1PBYA 3H9HA 4UQ2A 3FRPA 1F4WL 3HI5L 4NPYB 4X98B 4YHNB 4GKSA 25C8H 1JV5A 5DJYA 5F88B 5LBSH 3SDXF 1A7NL 4PRDA 1QR1B 4MB3A 1RJCA 4UUJA 3HFMH 1ZVSA 4JFZH 1D5BB 1SY6A 4PJCE 3BI9X 4C56A 3QEGL 5JORB 1CFTA 3V5HB 4OFYD 2CR6A 2IG2L 1AQKH 3KLAB 1MCOH 2CDFB 3GMRA 3IDMB 3BISA 4XP4H 4F7CB 4R2GB 1T04A 1IGFL 1BVKB 1ZLSH 1QFOA 3H0TA 4KKBD 3ROLB 5IVXB 1JPGB 4NYLB 3QXUA 2PNDA 1MCLA 1BJ1H 1HHHA 2MQ0A 1DVFD 1K6QH 4V1DA 4I1NB 1J05A 4I48B 3VWKD 3I6LD 1DSFH 2E27L 2OTWA 3DNKA 4P5MA 3BE1L 1B4JL 2WUCH 1KN2L 3STZA 3RBGA 3H9SB 3WJJC 4BA8A 1EHAA 4IJ3B 3FQTB 1A1MB 2QQKH 4I18B 4LDOB 4HZAA 2E9BA 2C1OA 4WO4C 5F71A 1SBSL 4N8PA 5HY9B 3SCMB 5FV1L 3VFNB 5I8OH 1BZ7A 4RDQG 5GJTH 2VDNH 5EZLB 1NFIA 5D6CB 1FJ1B 3QUMB 3RIAK 4DZ8A 4JFFB 4KVCH 3GHEL 5FO7B 1BBDL 2AXJA 3HE6A 1TETH 3VFVB 3VMPA 1AQDA 5E56A 2XTJE 4ODHL 5GJSH 1IGMH 3VXRA 5E8PB 2DI7A 5EU6B 4J3XA 5TE7H 4LU5L 1WCQA 2IMNA 4U1SB 4NO3B 4MQSB 1UCBH 2WANA 3OZ9H 2ZUQC 3TEUA 2X42A 3BHBB 1F4YL 5I19H 1EO5A 4GW1B 3S3PA 3RWEA 3BXNB 1ZHNA 4I8DA 4QKXB 4S0TD 5HHNA 2Q3ZA 5I15L 5CBEA 3RY5A 3RI5F 1T80A 5E6IA 5MEQA 4BUHA 4X7SH 3FCTA 1LNUA 4F7TB 4KUZH 4UMGA 4CADA 4Q9BA 1JNHA 5IBTL 5CSBA 2XN9D 3D2UB 4OGYH 4HKZA 1R0AL 1HHIA 1U3HA 3MJ7A 2V9QA 1WFNA 4WEUD 4N0CD 5DFTA 4YZFE 3NPSB 1ZVYA 1JV5B 2Z93A 1MJ7H 5DJYB 5EZIH 3QCVH 4U1GB 4L4VD 1JZ5A 3L1OH 2CUHA 1F97A 3GSRB 1YY8B 4HXAH 4UUJB 3O3AA 2AXHA 4C56B 4MMZC 3SKMB 3GK8L 1CFTB 4BKLB 2P8MB 1ZANL 2J5LC 1JL8A 3CZFA 3I6LE 4NKOA 4ZXBA 1E4KA 2HKFL 4ODUB 1T04B 5JOFA 4L4TA 2A9ML 4JB9L 1LO2H 4L8BB 3VGFA 1YC7A 2JJVA 2W9EL 3FO2A 4L3CA 4MZ3A 2C1PA 1NUDA 5FUOH 1HHHB 2X05A 3DXAB 1J05B 2W0LA 5E24E 3SDCC 1N2RA 1A8JH 3TZVA 3OAYK 5C1MB 3P0YL 4BZ1L 4Z7WA 2OK0L 1OD9A 2J6EH 5KAQG 3I3BA 1FL3A 1NEUA 4P23A 5FYKU 5F7HA 1CE1L 4WTZG 3U48A 3HB3D 2B4CL 4KKNA 1B88A 3U9PH 3MLZL 2J88H 1PG7X 3LKRB 4HBQA 1BZ7B 3VXMB 1HH6A 1NFIB 1TQCC 4XPGL 4RFNB 1CL7I 4A6YB 3HE6B 4ZUWB 5JXEA 1AQDB 5DQDH 4HWEH 4EIZC 1FLRL 1MWAH 4QYOA 4JN1L 4DFIA 4KWUA 5CEXA 4YK4C 1BD2B 2XZAL 3OBAA 4FFVD 2VNCA 3NA4A 1F13A 1WCBA 3PHQB 5FGBA 1YC8A 3CVHH 3P9LA 1AR2A 1JGUH 2CGRL 1R5VB 1P7HL 1DN2A 3LQZA 1ZA3B 4Z0XA 4MCYB 4B5EA 1I85A 2Z4QA 4M5YL 5C0CD 5HHNB 4PY7B 4L4VE 3WHE0 4CVXA 3ZDYF 1F3DJ 1NMCB 5MEQB 2EYSB 5LWYH 2VSDA 4PUBH 4M43H 3W0WD 4KFZC 5CJQH 5C0RL 5HVGB 1JNHB 3MRBA 5J11B 3WV0A 2VOTA 2Q8BL 4FRWA 3WIFB 1ZKAA 1U3HB 4O51A 4M02A 4JJHA 3M07A 2Z93B 1GOHA 1XFPA 4GW4B 1I3RA 2DQUL 4Y1AD 3BD5A 5I1CL 4I0PD 5KS9F 5I2IA 1H0DB 3O3AB 5HVHB 1CDBA 4FFYH 1PFCA 1V3LA 1A6TA 1FAIL 4NKOB 5BS0D 4RMVA 1QLFA 1H3XA 3BIBX 3TYFA 4CKVX 2HWZH 2ORBH 4L4TB 5GGRA 4JFOB 1F3JB 1AXSB 1EFXA 3FO2B 1EERB 4MSWA 4NQCA 4HXBH 4QRRD 4KK5C 5T1KA 3QUYA 1CFNB 4OCXH 3MC0A 3QO1B 4LHQB 1RK1B 1FZKB 3PABA 5D93B 5I1HH 2ADFL 5FK9A 3NABH 4DZBB 3NFNB 4GQ9H 1E4WL 1FL3B 4P23B 4XHJD 3DVIA 4LSQL 4JFQA 4MA1C 5GRYA 3LN4A 1IMHC 3GDBA 4AEIH 1KEML 2VQUA 4NKIL 4Y2OA 3SDXA 4KKAD 1HH6B 2DWEA 2C9AA 5KSAC 3T0BA 3T08A 3VXTA 4JR9L 2YBRA 2FEEL 1MJJA 2PXYD 4W6YB 1BEYL 3J8F7 2X4PA 5H2BB 4L5FH 1FGNH 2EDTA 4YXHL 3SOBH 3ROOA 4KVNL 1YPZE 3MLXL 4PJ8A 3RY6A 2RBLA 3U0PB 5CEXB 4L8DB 1KGCE 5D1XB 1U8JA 3PV7A 3EFDL 4E41D 2OSLB 1MPAH 1ZHLA 3OQ3B 3GJEB 1Q94A 4PYGA 4LVNC 2NY1D 2Z4QB 1A7PH 3WNKA 2WBKA 2YD8A 2APTA 3RX8A 4WIQA 4CVXB 3HZKA 1U8LB 4S1SH 4LQFL 4Y1AE 5SX5H 3HKFA 3G5XB 4MD4A 1DJSA 3MJ8A 5IROA 1QFPA 5IB1A 3MRBB 1CICB 3QPXH 3PQYB 1AP2A 5F96L 2FHBA 5MEND 5CILH 4GLRH 5IJKC 2G5BB 2NNAA 4P46A 1KCUH 2ZNWA 4JO4H 4M7JL 3EYUH 4NFDA 5JZ7C 2IGFL 1I3RB 5L7XL 5DZOA 4F7PB 1AIFB 3FRPG 4K55A 5DEGA 2YN5A 5I2IB 3D3VA 3GB7A 1N26A 3LD8B 2R0KH 4MAYA 4YHIA 1M71A 5CZXC 4BFIA 4ZFFA 2OP4L 1I9RH 5LCVL 3B9KC 1QLFB 3KJ4C 3TYFB