5D7KD

Structure of mr1-reactive mav36 tcr
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
199
structure length
197
Chain Sequence
EDKVVQSPLSLVVHEGDTVTLNCSYEVTNFRSLLWYKQEKKAPTFLFMLTSSGIEKKSGRLSSILDKKELSSILNITATQTGDSAIYLCAAYNTDKLIFGTGTRLQVFPNIQNPDPAVYQLRDSKSKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAV36 TCR Alpha Chain
publication title Diversity of T Cells Restricted by the MHC Class I-Related Molecule MR1 Facilitates Differential Antigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 197
sequence length 199
ec nomenclature
pdb deposition date 2015-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7kD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5d7kD02
4N0FA 5DQ9A 1XGPB 5C6TH 4KTDH 5T3XH 2NY2C 2QSVA 5I1AA 2NY6C 4L5FH 3QSKB 4JQXA 1NGXA 2CSPA 5JZ7D 3P2TA 4N5ED 1MCOL 3MCG1 1G7PA 1PY4A 4YFLI 4Y5YA 4GMTH 3E2HC 1N8ZA 4P3DA 4TVPH 3P4OA 4Y5VB 5EWIH 2F19L 3HUJE 6FABL 3SQOH 3DHJA 5FDYA 3QEQB 4X0KA 3F58H 4PB0H 3MBXH 5KSUB 4PRPE 4GW5A 4NZRL 4D3CH 4MLIA 4O51B 5GGSB 2CQVA 1O7VA 4LLWA 2J8HA 3KLDA 1ITBB 4YEEA 3VGBA 5MEQA 4K3HA 4XNZB 5D6DC 1NBQA 1NFDF 1KPRA 5IB1B 3ZDYE 1FL3B 3ES6A 1UZ8B 4Y5XC 3MGOA 3V5HB 5F1SA 1XCTB 3G5ZB 4KK6D 2ZOLB 4UAOC 4XPFL 4OF6A 1UM4L 5IW3A 5FGCB 1MPAL 2UWEA 3C9NA 3EOBB 5HI5D 3PWPA 4Z0BH 5GPRA 1MI5A 3SBWC 3AMKA 4GKSA 3MLWL 3ARDC 3LMJL 4UQ3A 4KRLB 5HHXL 3P0VL 2NR6C 1C16B 2YSSA 4F7MB 1ES0B 5ANME 3N85H 3T1FA 3RWIB 4LPYA 3B5TA 3UEZA 2JB6A 3OJ2C 1SM3L 2VQTA 3OPZL 4DW2L 1HCVA 5DSCB 1S8DB 2DAVA 5TH2A 5AUMB 3ISWA 5FFLA 2NNAB 2P8PA 4ODWA 4OT1H 2EEAA 5JLZA 3GHBL 5DJDA 3QRGL 1FNGA 4GRWF 5HGGS 2W9EL 4PLOB 4GKNA 2HT4D 1Z5LA 4RGNE 5EZJB 4U7SA 4K9EH 2GSIA 3FFDB 1AD0A 2DBLH 1KEGL 3MV7B 5C08B 2DQGH 1QBLH 4ZDHA 4GKZA 1EGJL 1IGCH 3JV4B 2W0FA 5JW4R 1S9VA 5K93A 3VJ6A 4KVNH 3A6BL 4DZBB 3P9LB 1PG7L 4XPBH 1HIMH 1I1YB 1KIRB 2ESVB 3WIHA 4BFGA 2NX5E 3EAKA 2CMRL 1RURL 1S7VB 2EE9A 4I0PD 5EUOF 4LCWD 3GB7B 3EZ8A 5TE7L 3VWKB 3EZJB 3OB0K 1NAMB 1MCSA 3RWJB 3V6FA 4LRIA 1I8IA 3SPVB 1AHWC 4G42A 2XWBB 5JPNB 3B2VL 4OCRH 4OKVB 5K9QG 4B7IA 2IH1B 1JF1B 1VFBB 4YQXL 4HZLB 4Y1AB 4KC3B 2OMBA 5FYKL 3KYOB 2IEPA 1EEUA 1IGFH 1UFUA 3DECA 2UWEE 4HK0A 3KR3L 5GGTA 3FRUB 3IXTA 3LKSB 4FMFA 5BZDA 3CSBA 1K5NA 2JIXA 4NO0B 3V9FA 3OB0H 3OQ3B 3C6SA 5IWLC 2HFFA 2RCSL 3DO7A 2NXYD 4UTAL 4P2QD 2FATH 4LHUA 3KLHC 4FQXB 4GW1B 4WENB 2GK0B 4R3SA 3C6LA 2COQA 3L3IA 4KJYB 1XZ0B 3LEYL 3SEPA 1JHLL 1T20A 3HZKB 1XGQB 4ONHA 2XQBH 4TPRL 4YX2L 3RA7L 2R1XB 5IMMA 1G6RL 3CDYA 2PETA 4WO4C 3HI1A 3Q6FB 3EFDL 4WUKL 1YQVH 4ZMAT 2XWJB 5KSBA 4LDEB 2EH7H 5IKCA 4Q9RH 5I8OL 2OZ4H 2UZIH 4FQLL 4QTIL 3TNMA 3P9MA 2FO4A 2MOVA 1AGEB 3ARGC 4KJWC 3SGKA 1FG9C 4QHLB 2Z8SA 1MCDA 2DKUA 1CDCA 5SWZA 3ABZA 4QOKB 2WNGA 1T22B 1DBAH 3BP5B 1IM9B 3GSUA 1RULH 2ZCHL 3T3PF 1OARH 1PAMA 1R3JB 4WHTA 1J1XH 1QSED 4N68A 3WIIL 4M61B 5GGRA 3TA3C 4JKLA 1CF8L 1C12A 4YHML 3KVQA 4XX1G 2WIIA 4LCIL 5ACMA 3VXSE 5HVHB 4L8SB 3BP7B 3ULUD 1DTUA 2QV2A 5FYJL 4Q6IA 4DTGL 2EZ0D 4OJFH 3LV3B 5SX5H 3VD4A 1KF9B 3W0WB 1AQDB 1QA9A 1NDGB 2VXTH 5EU6E 5CHNB 2X44D 4H1LH 4A6YB 5DMGD 4QRTB 1IARB 5F1NB 2XG5A 2LABA 4HH8A 4X6DA 3ROLA 3NIFF 5LWYL 1QFHA 5D1ZD 4UZGA 4H26B 5LAXB 5C2BH 5EBMB 1P5UA 4XWGH 2VRAA 1RD6A 2P8LB 2YN3A 5MENE 3FOLA 4LEXH 4K8RL 5T1KB 3WDJA 1DBML 4P46D 4PJEB 3BKJL 1N4XL 1W72A 5ICZA 3BD5A 3RL1B 4K7PL 1NMCC 3QUYA 4PJHB 5BO1L 2AK4B 4XB8A 1RJZA 1GGUA 3MRGA 2HT3D 4S1QL 4HK3N 2ICEA 4V1DB 5MERB 5KSBE 3ELAT 1NCDL 5D1QD 1NL0H 2OI9C 3MV9A 4N0UE 4WWKD 4NC1E 4HFWB 5IGXH 2I60H 5CILH 1TJHL 5F89B 2WBWB 3MLXL 2I5YL 3DBXB 3BSZL 1MFDL 4U7MA 1E6JL 1M4KA 2F8OA 4PTTB 5H94A 5SWZE 3WHE1 5GS0L 3L3OB 4FTVA 4E41D 2GCYB 1A7QH 1GGTA 5IMKB 3HMXA 2WZPD 3A67L 1JF6A 1XIWC 3HC0A 3LQMA 3TVMB 4LQFH 5BV7C 3QEUB 4TNVF 4L4VA 4M6OH 5D5MF 4XNMB 3U9UA 1RK1A 1MCQA 2XY1A 4NHUA 1AXTL 2VXQH 1VEMA 5CP7A 4GBXD 4YDIH 5FO9B 3G04B 2YPLB 1NGZA 1TJIL 2XN9D 3IB4A 1G9NL 3NFPA 1FV1A 2QQKH 2AJUH 5HYSA 1PQZB 5FKAA 1WZ1H 5F3BB 1BD2B 1U3HC 4S1RL 5IF0B 1GC1C 3SCMD 2Q6WA 4RNRA 1BIIB 2RB8A 1DVFA 3CFJB 5EBWB 3DUUB 1BGXH 3ARFC 1G9ML 1D6VH 3ARSA 4RFNC 3HC4H 2DYPB 5IB4B 4QRPD 4WFHE 4DUXA 1A9BA 1KPUB 4KRNA 1JGLH 5GGQH 3TJHC 4DKAA 1BQHA 1EHXA 5JQ6L 2HFEB 1V8HA 1CD0A 4I2XE 3CUPB 4Q9QH 1S9YB 3P11L 4NRXA 3UTPD 1FZKB 5D7JD 1QLFA 1DUZA 3GM8A 2D7MA 4L8DA 3L3DB 4G3YH 2IPKB 3RDTA 4OD3L 4C4KT 5IM7B 3HUJB 2DS4A 4V2BA 3FB8B 3MV9E 3S36H 4X9FA 4XC3H 4HPOH 4OD1H 1XR8B 4M7ZB 3ZDXF 4KTYA 4PV9B 4PRPB 1NCCH 4HGWA 5C6TL 4KTDL 3G5VA 5T3XL 1QFPA 2FX8L 4TRPL 1JYNA 4AMKL 1S5HA 2Q8AL 4L5FL 3WFHA 4OFYD 4AEFA 5ICXA 5IROC 1GIGH 2Y25A 3KPSD 5C09E 1V7NL 4L1HA 4Z9KB 1S7WB 3WN5B 1A6ZA 1V05A 4QRSA 1J18A 3V6ZB 3FOMB 4NNXA 3HN3A 4GMTL 1BOYA 3IDYB 2DMBA 5TF1L 1K2DA 2DRUA 4TVPL 3MJ6A 5EWIL 3WS3A 4HEPG 1OGAA 2OCFD 4OLZH 4WUUA 2H32B 3SQOL 4XHQA 3PWLB 5ANMB 4PB0L 3MBXL 5DUMH 3SJVE 5HI3C 1IM3B 4NZJA 4D3CL 5GS1B 4G8EB 2O61A 1J8HD 5H35A 5CGYD 1AR2A 3QQ9C 1KN4H 3KXFD 4OD2B 1UXWA 1IC5H 3S4SA 3IAGC 4G8FB 1EERB 4WFFE 1IEBA 5D6DA 4LEOA 4N0FB 1KT2A 4MMXC 5T33H 2H32H 1P2CA 2QR0B 4Y5XA 1HXYA 5CGMA 4HS8H 4FQJH 1DCLA 4RGNB 4JE4B 2E5EA 1T4KA 3IFPA 3MZTA 5TGBB 4JM4L 4IMKC 2XT1B 4I9WD 4UV7H 2J4WL 3CPLA 1ZHKA 1CGVA 3CZFA 3ARDA 3D2UB 4HDIB 5DDHA 4EUPH 4KDTC 1MHHA 2R23B 2VN7A 5MEOA 2A2QT 5C0FB 5EA0H 1I1AB 3P0YH 3ME0A 3ARBC 2NX5B 2X9XA 4KK5D 5CD5C 3GDBA 3RFZC 5ISZD 3WLBB 4GW5B 2APTA 2H3NA 4UB0L 4TSAH 4HJJL 1Z6JT 4KMTL 5SX4I 4XZUA 5SWQB 4XWOC 4UBDC 1INQA 5E94A 3HC3L 3VFOA 1JBJA 3C09C 1P7QB 3ES6B 3SDXA 4K9EL 4ZNEA 2OBGA 2DBLL 2GJJA 3PXJA 4R7DB 4NJ9L 2UWEB 1OAKH 1A9EB 4GKSB 3MLVL 1YJDH 4XPBL 3QQNA 2VIRB 1OGAE 4JO4L 1YEKH 2ATKB 4ZXBC 5I71B 1ZWIB 1HH9A 1P4LA 3DJ9A 4XB7A 5A2IH 1QSFE 2C4FT 1GL4B 4JQVC 2DTSA 3MRHA 4UUJA 4LSUH 3M17B 1RUAH 1R3KB 1PJ9A 3W9EA 1NJ9B 1YPZF 4LSDA 4X4XA 3EUUA 4PJBF 2P8PB 1AHWA 1CG9A 4LPTA 1N6QH 4JN1H 2DKSA 2D7TH 3EYOB 4P3CL 1YY8A 5GQBA 5HYJD 4XP9H 5DJDB 2CRIA 2HJLA 3DRQA 3VXPA 3EJJX 3GBNH 4OCWH 3VXUD 3O4LE 3X12B 5KOVC 4FQQA 1CVRA 1Q9WA 3VW3H 2XIDA 5BRZE 3RUGF 3ARWA 2C9AA 3LKNB 1NSNL 1TQCC 3TT3H 1P53A 4YHYB 9CGTA 1OAXH 5IWLA 2A83A 3VFSA 5BW7C 5E5UB 3UZEA 4G7YH 2C1OA 3FQWA 5DVKA 3SDCC 4DZ8B 3MUJA 5T5NG 3VFTA 3PP4L 4LVNB 4CU7A 4YO0B 2XQBL 4U1MA 2LFGA 1QFWH 2OTUA 3ARQA 3ET9F 4JY4A 1CDIA 3V6FB 2R9HD 3RX7A 4AL8L 32C2A 5I0ZA 3AREC 3FCTA 2WP3T 5KVFH 2P24A 2B4CL 1YQVL 4WO4A 5ITFA 5L7XH 4N9GB 4X4MA 1NCWH 3VXSB 4JFDE 1WT5A 4I3SH 3SDXE 3ZE0F 2EH7L 5EU5A 2XZAL 1HDMA 4Q9RL 2OZ4L 2UZIL 3BP6A 3QUXC 5HDBF 1RUML 4XPTH 5B38A 3ZDZF 4F57L 5CSZB 5KS9A 3E6HA 5IVNA 4M62H 1T1WB 5EU6B 4OBSA 3ARGA 3QIUC 3P77A 5JPMA 1KG0B 3RZCC 3IDJB 1GGIH 4NM8L 4F3FB 3SGJC 8CGTA 1LK2B 1RULL 4Y16C 1OARL 1GGYA 1ZT4B 5MENB 2B2XH 5ID0B 2HLAA 3O4OB 3OR7B 5GGTH 1R3HB 1AGBA 1ZLWK 3MUHL 3AS1A 3TA3A 3C60D 3SKUD 3D3VA 1KV3A 1NMAH 4OJFL 3UYPA 1WAAF 1N59A 4BZ1H 5KSBB 2BNQD 2HJFA 3DVFA 4HJGB 4K3GA 4N0UB 2N7BA 5ECJE 2J5LC 1S9WB 5T1LD 1BZ9A 1FRGH 3TNMB 2BVPA 1E4XL 5FYJD 4WI4A 1QPXA 2UUDK 1DEEA 3I6GA 2A0LD 5H2BB 3RWDA 4Z7WF 1ZLWH 4X6FB 4IRJB 4LK4A 1KIUA 5DVLA 4EI6A 5SWZB 2ORBH 4XWGL 5DEGA 4Q2ZB 1TIUA 1WTGT 1PFCA 4HS6A 4HWEL 1T03L 4LEXL 2VH5H 1A4KA 3ZKXB 3LSOB 1DQJA 3TF7C 2WWMD 4ZOAA 1F4XL 1U92B 3S98A 2F54A 1UJTA 2R0ZH 3GMPB 3GSQB 2WBJD 4LDOB 3D39E 3CLEH 4P99A 5I18H 1ORQA 1BREA 2ITCB 1CZ8H 2X4QB 3TPUB 4K8RD 5KSVA 2UUDH 3QDJE 3O6KH 3L7EA 1KB9K 5DHYA 3FO1A 1EAPB 1NL0L 4G6MH 2VDMH 5IGXL 4U4BA 2ZUUA 3WXVH 3SE3C 3AAZA 4Q6IB 4LF3A 4FQIL 3A0OA 5KS9E 2A73A 3O3EA 5JHLH 1BEYL 5FA4A 1X6NA 1BQSA 5H37G 3NOIA 4IDJH 1A6WH 1A7QL 3TBTA 5JW4M 3IDNA 1DUYB 2W9DH 2VLKD 4LQFL 4BFIA 3PL6C 1XIWA 1V3JA 2E6PA 2UVFA 2A6KA 4M6OL 4X7DC 4I2XB 4F7EA 3HE6B 3EYVA 5GS0D 3U30C 1UJ3B 4NZDA 3FOLB 4WCYH 5BVPH 3W5NA 3BI9X 4QHMB 3HR6A 4L3AA 2YBRA 3WJLC 4P57A 4DEPC 3QUYB 1UZ6F 2QQKL 2AJUL 4HEME 4BELD 4NQCD 3I6KB 1RJZB 2OR9H 4ZUWB 2PW2A 1WZ1L 3QWOA 4APQD 1LO2L 2ICEB 4DKEH 2Z31B 2LTQC 5HXMA 4ZO6A 3MRCA 3MV9B 3O2DA 1D5MA 3DI3B 1CFNA 2QHRL 1N0XH 1BGXL 1D6VL 3EW3B 3KPQA 5JXEC 3GMRA 5T1DL 5DZLA 3HC4L 3ARFA 1CL7I 1EO8H 1SMAA 5F97E 3K8MA 3DURB 5H94B 4WTXA 4BA8A 3HA0A 5C09B 3D85A 3BOVA 3AROA 5IUSA 4QCIA 3D69B 1IEAB 4ZFOA 1P4BL 1S9KC 3PWJB 1RZKH 2DQHH 4G3YL 2XACC 1AGCA 2A1WH 2ENSA 4KWUA 1FL6A 3O0RH 3LIZL 1T2XA 2X4OA 5E8EA 3CDCA 3CH1A 4XPGH 4J23A 1YNKH 3QPQC 4JM2D 3EDFA 4JPVH 1VKXA 1NUGA 3NFPB 2VLRA 4OD1L 5E4EB 3FRPG 1JFQH 2AJYH 2F5BL 3KPMA 3MFFA 4XCEA 1ZGLA 3QIWB 3HMXH 3O3DB 1VFAA 3OGCA 1NCCL 7CGTA 2IPUG 3QWRA 4RNRB 5F8QC 3QUZC 2PYEA 3ZHDA 3TH4T 1ACZA 1I3RA 5B3JF 3QAZB 1DVFB 3PQYD 5TQ2H 4P9HL 2K7PA 5AD0A 1H5BC 1WGOA 4DWHA 5IROA 4PP1C 4K7FA 1NAKL 5IQ9B 4M43H 4UMGA 1BJ1J 5T3XD 2BK8A 4OZFA 3S3SA 4Z95H 1BQHB 2FR4A 1ED3A 3BN9C 5IHZB 2VDPL 2QSTA 1TFHA 3JV0A 1DUZB 2X4RA 1FZJA 1Z3GH 3O6FD 3O8XD 4L8DB 5I6XB 4PY8J 5HSFA 1H3UA 4TSCL 5KZCD 3S6CA 4TVPD 2AEWA 4XP6L 2DI7A 1JWUB 2AK1H 5IW6A 3RWCB 1ZEAL 1KN4L 4U1GC 4MNQA 5DHXB 1G0DA 3G5YA 3WL9B 4H0GA 5C0IA 5C0CE 1NEZA 1CYGA 4YHOH 4D2NA 1S7UB 1AGDB 3F7QA 4HGWB 2VSDA 4NO3A 4ODUB 5CS7A 4Y8AA 3T4AA 4EQ3A 4TULH 1AD9A 4UI2A 5I1CH 4FQJL 3WFHB 2HWZL 1CCZA 2JE8A 5ICXB 1JL8A 2NY6B 4R96A 5EIIB 4Y4KD 1A02N 5C07A 1L6ZA 4UV7L 4WDIA 5DD1H 3ILPB 4IMKA 4WFEE 1I8KB 5FV1L 3BT2H 3KS0H 3MGAA 4QWWD 4TTDD 4UDUA 3DV6B 2H2SC 1ONQB 5DR5L 3UDWC 3VRJB 1K6QL 4LP5A 2CR6A 3E2HB 5EA0L 4EDWL 1Q9LB 3P0YL 1OGAB 4MD0A 1I1CA 3BUYA 1LD9B 4DJMA 2AP2A 1HKLL 4C55A 1OY3B 2VLRE 1FCGA 5FM5M 3ARBA 4WHYG 5FOBB 5E6IC 1QSFB 2G75A 1DQML 4PR5B 1N7ML 3U83A 1UGNA 3C8KA 2O61B 5B21A 1IC4H 4O9HH 1C5BH 3IAQA 1KLGB 3BIKA 3WE6B 2XTJE 4MNGE 3S4SB 1FPTH 1BWWA 1TVHA 1ZLSH 4KJPD 4LEOB 1MHEA 4YNYA 3IDXH 3BQUC 1P2CB 4LP4A 3UTSD 1OAKL 3O4LB 4UAOB 2NYYD 1VERA 3IFPB 2CRZA 2J8UA 5HHOE 5E1HB 3U4BL 2E8YA 3KWWA 3HE7D 4BKLA 3QXAA 5BRZB 3B5GA 2WUBH 3CZFB 3K46A 1YEKL 3KGRA 4FFWC 3ARDB 5LXGL 1YUHA 3HZMA 3N50A 4CVWA 4ZXBA 4D9LL 4LSUL 3RWGA 3L95A 4C56E 4JQVA 1OTSC 4G6KL 2O93L 4Z5RB 2BVUA 5LVEA 5F9WB 5F3HA 5L6YL 1UYWL 1N6QL 4JN1L 4UDTA 3T0ED 1R24B 2D7TL 1LILA 1HHJA 4NYLB 1N5YL 4ELKA 3IETA 2BFVL 3DV4A 1GOFA 1DANT 4ZFZB 4JFYA 2VDLL 5C0AA 3MPCA 4QXUH 4JFDB 5I75C 3SDXB 4LIQE 2QSCL 3LDBC 5C07E 3RWHB 3VW3L 3OBAA 4RCAA 3TWCH 1CFSB 1U8PA 4XCFH 2APWA 1KIQA 2VLJA 1OAXL 2I9TB 2M8XA 3ZTNH 4G8IA 3GUTA 3AY4C 3T0DA 5C0DA 1QPPA 2X4SB 3I75B 3QP3A 5BW7A 1QSZA 4WFGE 1D9KD 3NCMA 1X5ZA 25C8H 1QBMH 2R4SH 3KPPA 4L4TD 2OX5A 4BSJA 1A7RH 4UUJB 4C83A 3MREA 4LVOC 1X5JA 5KVFL 1B0RB 1XH3A 4BQCA 3V52H 1J86A 1A6UH 3E1F1 3AREA 4XTRD 1CG9B 4PJEF 1FFQA 1A6VH 1NCWL 1PLGH 4PJHF 1T7XA 4NO0D 1BX2B 3OZ9L 3INUL 3WIHL 1BM3H 4LLAA 1JNJA 3ZMRA 1JPTL 3JUZA 1TVBB 5FO8B 4RAHA 1KJMB 3VXPB 3VD3A 1XF5A 2R0KH 4LLUA 4M62L 4P5KA 4YC2C 4MWFB 3H3PL 4PJCA 4B7LA 4X98A 3ZL4L 4ZOBA 1WC7A 2A6IA 1F42A 3H7BA 3CVHA 4OCYL 4I18C 2X42A 1GGIL 3RZCA 5J06A 3KJ4C 4ZS6C 3SGJA 3FQWB 5LGJA 4Y16A 4JDVB 4P9MH 3VFTB 4YXLL 5GGTL 4HH9A 5CUSL 3SDDD 1MRDL 4MHHI 5IBTH 1ZVYA 1OTTC 3DO3A 3RJDA 1B0WA 4QO1A 2X7LA 2P24B 4D9RE 3D39B 1J0YA 2A6DA 1NMAL 3N9GH 4WO4B 4PGJA 3CFCH 4O58H 5KVGH 1KEMH 4YIQA 1JMZA 4X8JA 3EOTH 1EEYA 3QDJB 2FHCA 1CDUA 2IAMB 1H3GA 2V17L 5ADPL 2XV6B 4JFQB 1XF3A 5B38B 2HT2D 1RVFH 3QXVA 4PLJD 3BKYL 5KS9B 2P43B 1EHLH 2XKNB 2CXKA 4OZ4A 2VLJE 2ERJC 2ZWLT 4HUVA 1YQ2A 5JA9A 3P77B 4NWTH 4HIHB 2J7LA 2VH5L 5JHDE 4JZOB 3L6FB 1ZT7B 3SE9H 2DQJH 3QPXH 5C0NC 1I3UA 2HRPH 3MBEA 1C7TA 2R0ZL 5CEZE 2H26B 3CLEL 5I1HH 5I18L 1E4KC 3MRLA 4HBCH 1CZ8L 5I1LB 5GZOC 3W0WD 1UEMA 4Z18A 3O6KL 4HUWA 4MSWB 5FB8A 2XPGA 5IOPB 3TA3B 5D7IA 1JV5B 1CGXA 1F90L 2VDML 3TZVA 3WXVL 3S3JA 3WFBH 4X80H 3RNQB 4GO6B 2VZTA 1K85A 4NQED 4JZJC 2RFXB 4XP1H 5JHLL 1EPFA 2YD5A 2BSTA 4OIIL 3WDIA 3GI8L 4IDJL 1UKQA 4PJ7E 3I84A 3MLTB 5F44A 3WNNA 4E5XA 1MCRA 1BBJA 4CJ0A 4NN6C 4XVTL 4YXKH 2B5IC 1ND0B 1DEEB 5T1KD 4D94A 3RWDB 3NMEA 2W91A 1PBYA 4RA3A 3Q6GH 3PWVB 5DLML 5DVOA 1FH5H 3ZDYF 1MCJA 5I1JH 5DEGB 4DN4H 4KKBC 2AK4D 4WCYL 1A4KB 1WBXA 4OCXL 1NFIB 1VFOA 3KNBA 5ESAA 5HBBA 2OL3L 4V1DD 3UTZB 1FHGA 4H0HB 3JXAA 2BY1A 5I1IH 5L8JB 1X5FA 2V5YA 3CFDA 2OR9L 2DIBA 1NCNA 2ZOKA 3WJLA 2NY0D 4ZPVB 1NMCB 4LSTL 1T89C 1U2HA 3L7EB 5DURB 2FWOB 2N7AA 2CH8A 4LSSH 4F2MA 2MHAB 1XCQB 2D03L 2OI9B 3KHQA 4X6EA 4LF3B 3KLAA 5C3TA 1FYHB 1VA9A 4M93B 1BHGA 3O3EB 5FA4B 1BIHA 3MC0A 4HKZB 4ONGH 2FYYA 5GSVA 3TVMD 1W72L 4MQTB 3IYLW 2HVJA 3W39A 2P7TA 5FIEA 1RUQH 1KB9J 4YJZL 1HSBB 1OM3H 4XT1C 3UJJH 1N5AA 4JRYA 1XIWB 3G6JA 3HG1E 2ZG2A 2A6KB 4OAWB 5BV7B 2DQHL 3GSOA 4I5BB 2A1WL 1K8IA 4OTXL 4W4OC 4PLNC 4FFZL 3X3FH 3O0RL 1A1NA 3PGCB 4XPGL 3P3YA 5INCA 1NANH 5D7KE 3QZWA 1F3DJ 2CJUH 1W0VA 5D7IE 4LPVA 1EJOH 3HMXL 5EZLA 1U95A 2H8PB 4IIQC 2DMKA 5F70A 5IFHL 2CKBA 4ODTL 3MRCB 4S2SA 1D5MB 1U3HB 5BV7H 1EO7A 1VSCA 2W1NA 5TQ2L 4LRNL 3QUZA 1V7MH 1Z9OA 4OZHE 3VXQA 3KPQB 1CR9H 4HWBH 5GGVL 1T2JA 1B9ZA 3CC5A 1J1OL 4NZTH 3ARFB 4M43L 1TLKA 2FJHB 3WNLA 4HG4K 1H5BA 2IFGA 3O45B 3TGXA 2AEQL 4RFNB 5GRWA 2IBZY 3VXTB 3D85B 4X6CA 4OF3A 5HGAA 4QCIB 5IVXA 3U1SL 1U8NB 4FQHA 4MJID 4NKDA 4WTZG 1A6TA 4ZFOB 2UWEF 3O2DH 3F6IA 1GC1H 4PBWD 4S1DD 3U48A 4BZ2L 2H2PC 4YHZH 4JO1H 5E56A 3U79A 3VWJC 2EE6A 2X4OB 3BKMH 3SDAA 1U91B 1CICD 1F45A 3S7GA 1DP0A 2X1XR 4J3UA 2CLRB 2VLRB 2VUYA 5CINH 1ZGLB 4YHOL 3VD5A 1PVHA 1B90A 2EIZB 1RSFA 3QNXA 3G6AA 2XTJB 5I1CL 5IESH 1SJHB 4XBPA 1V5JA 4LCCC 2VQUA 3HLAA 3QEHA 5DD1L 3ULVF 1DFBH 1BBDH 5K59E 1X5LA 4RISH 1BJ8A 5E7FA 1PG7W 3MLYH 5HHOB 3VXNA 4EIGB 3UDWA 3DETC 5AAMA 1FZJB 1EDQA 3HHRB 1L7IL 4F7PA 2VL5A 2EKSA 3VE0B 4YDVB 3VG0H 5IP4A 5E6IA 2YUVA 3MNVB 1IC4L 2EDYA 4O9HL 1C5BL 5IW6B 4R26L 3TO4C 4OZFH 4WJ5B 4OCLC 3LZFL 1T5XB 4POZC 3TNNA 1FPTL 3M1BA 3BJ91 1ZLSL 1NEZB 2XXCB 1F3JB 3GMOB 1FNAA 3FQRB 2AJVH 4G9DB 4J6RL 1DSFL 1F4AA 2G9HB 3KYNB 3BQUA 5SWSE 3NIGF 3KS0J 4JHBA 4ZO7A 1M7IA 3GNMH 5C07B 2WIMA 1CS6A 1OAQH 5CD3B 4EIZC 1DN0A 4UDUB 1ZSDB 3JTSB 3BRDA 1R5VA 2UY7A 4WWID 2R0LH 4DCQB 4MVBC 1BF2A 3LH2L 5DYOA 4LCYB 2JCCE 3SGEI 2ZZUT 4J3WA 4LIQH 1OAYH 3BZEB 1ZVSB 5GGVY 3NH7H 2FJGA 5IFJA 4WV1C 4NWUL 3ULSB 4LAQH 5DHVA 2VDNH 1WEJH 3BIKB 3BPNB 3P4MB 5FHBH 2IGFH 3LKPB 3RVTC 4XAWH 4QXUL 5J11C 1TVHB 3PWPD 1MI5D 4NIKB 1DQQA 1LHZA 2CDGA 3PABA 3MJGX 3C09B 2WINB 3TWCL 2YPVH 3LEXB 4FP8H 4PJAA 3F7PC 4NFCA 1IAOA 3Q1SH 1S78C 1FYTA 3ZTNL 4PP2A 4WEMB 2NMSA 3KWWB 4BKLB 2FGWH 2IMNA 3DSFH 1QBAA 3AY4A 4JQIH 4P23C 3HNVL 3T0XA 1D5XA 2V5SA 5GRZA 1QBML 3ROOB 2NY4D 2R4SL 4Y2DB 3IXAA 3QDGA 5CMAA 3QNZA 5J1TC 1A7RL 4LHQB 1VDGA 4GS7C 4NC0B 5INDB 5E2WH 3V52L 2VITB 3T8XA 2D7PA 3CSGA 4UDTB 5DEZA 1A6VL 1PLGL 2NXZC 3F8UB 3IDGA 3H7LA 3VI4E 2AS5M 5EOTA 4WEBL 3DV4B 5I0DA 4JFYB 5HJ3B 1S7XB 3D25A 2R0KL 4D0BB 1F00I 1MQKL 3A6CH 4NUJA 4OZIA 3ESVF 3IRPX 1ODAA 1T7YA 2R2BB 1U8OB 4KI5C 4LPCA 5FUZL 2XNAB 1ORSA 1YMMA 3RTQC 3E0GA 5ILTH 35C8H 3MROB 2FEDC 2VLJB 5B39A 1TQCB 3S88L 2HLFC 5MEPA 3BEWA 4PGBA 1UM5H 4I18A 4Z77B 4OGXH 5FCUH 5TFSL 2HTLD 4P9ML 1Q72H 5JHDB 3KPPB 1EA9C 1FFOB 2VR5A 3SDCB 5IBTL 1RIVH 4C83B 5HHPA 4F58L 1JPST 4KRPC 5L8LB 1XH3B 1IQDB 3DI2B 4HWZB 3LVEA 1I75A 1OTUC 3CFCL 4O58L 1KEML 5DFTA 3EOTL 4L8CB 1FO0A 4OFKA 2OTWA 2JIXD 2A74A 4RDQG 5A3ID 4XP5L 4G6FB 3FB7A 2NTFB 3MJ8A 2GKIA 4KHTH 3SKMA 4XAKE 3CVIL 3LPFA 3QUXB 1XF5B 4ETQA 1VENA 4PJAE 4LLUB 4JANA 2DM4A 4LHUD 4E42B 1EUUA 2WUCH 3ZT5A 4B5EA 4MQ7A 1I8LA 4PJ7B 3VFUA 4Y19A 3C6LD 2A6IB 1U93A 5CZVH 3CFKB 3H7BB 4KXZI 4NWTL 5FF6A 4WW2C 1RHHA 4CADA 1F6AB 1NFDA 3QIUB 3V6BR 2EYTA 3SE9L 3N0PB 5DK3A 3RZCB 2XQYG 5ELIA 2HRPL 4NNYA 3C8HA 2J6EA 2V7HB 4P2CG 4Y16B 1P7KA 5I1HL 3EOAA 3QH3A 1CDJA 4J3XA 4PJ5A 1IGIL 4FQ1H 5KN5B 2NY1D 2CDEB 2EC9U 3MRJA 4X80L 1IL1B 1UH4A 3HZYB 3WIFA 1GHFH 3CVHH 2XWTB 5C0BA 3CLFH 4TQEH 4WI9A 2FECL 2GSGA 3HCVB 3M07A 1KXTB 1MIMH 3PHOA 4P4RB 2KUTA 4FZ8H 5SWZD 3R8QA 2J5LB 1NBZA 2BNRE 4OZ4B 2NLJA 4TVSa 4IOFC 3I6LE 4L3EA 3FB6A 4PJFF 5LBSH 3Q6GL 1ZT1A 3C2SA 3MA7A 5D2NC 2YWZA 4DN4L 1WWWX 4OM0L 4LHJB 4ZQKA 3U7YH 1ZA6A 2G60L 1CGTA 3MACH 4NQSA 2EXYD 4GKOA 5HVFB 1RQ5A 3HG1B 2YMXL 4GG6E 4NKIH 4U0QB 4C54A 1PYWA 2XZCL 3UTQA 4M4PA 4OKDA 3VFMB 1P84K 3KPLA 3IAPA 5T3ZL 2NY3D 2XPGB 5CAYB 5JUEH 5D7IB 1JGUL 1T89A 1PGRB 4HS3A 3QA3A 5EUOA 4M48H 1GSMA 3QUKA 4ODSH 3T04D 2BSTB 3OX8B 2BHUA 5A2LH 2R4RH 1A21A 4Y2OA 4Y19E 1A1MA 4OZHB 1BBJB 4E5XB 3CFEB 4MJ4A 3TYFA 5FXCH 5DWUH 3PDGA 1OM3L 3U0WL 3VGGA 4BJLA 3HNTL 3L3KA 1K4DA 4GAJL 3QUYD 3PL6B 3WLWD 3C8DA 1K3IA 4PRBA 2B0SH 2PF6A 4K2UH 1HQRA 1R3LB 3MLZH 4NKMA 2C3XA 4W4OA 2GJ6E 4JR9L 1A6PA 2GTWA 3MV9D 4JREC 1IMHC 5DJ0A 1RMFH 1EJOL 1LDPH 4MQSB 5GS2H 2PTTA 1UXSB 4XVJL 1EEZA 4QGTA 4ZUVA 5DEFB 3HRPA 4IIQA 3I2CH 2LTQB 2OJZH 5BV7L 2CLVB 1BP3B 2WLZA 4KAQH 4X6EB 4FTVD 5C9KA 12E8H 3DYPA 4TUOB 2WWKO 4LARH 3N06B 5GSVB 2Q7YA 5FGBC 1ZHLB 1JJUA 3UJTL 3RKDC 4PJDE 2P7TB 2BMKA 4L4VD 2ATPA 4OV5B 3EJZC 5C6WH 1X5KA 1M71B 2DTMH 1NGQH 3GJFB 3O2DL 4JRYB 4LLDA 2YD2A 1D5BB 1GC1L 1Y18B 4PV8A 3GSOB 3GSXA 4JO1L 3NFNA 4U0RC 4ODVH 2O26U 2PTUA 3LS5H 1M6OB 3LKRA 1BLNB 3BKML 5JW4N 4NGHL 2YUWA 3VWJA 1RK0B 1KUMA 2VE6B 1AXSA 3RL2A 5EUOE 5EZLB 5L2JA 5GRUH 5F7LB 3OKYA 3WFCL 4ZFOL 2HA1A 3GKWH 5BQ7A 1G7LA 4NO5A 5E08L 4OIBA 4J12A 3TBSB 3UTTA 4RWYH 3VXQB 3I9GL 4FG6C 2BHZA 4YDJA 1X5HA 1DFBL 1BBDL 2BOBB 4LCCA 3FHAA 4GH7B 3L7FA 4RISL 2W92A 4R7NA 5SWSB 5IB2A 5KAQG 3GMNA 5F1IB 3UAJD 4CUCA 3OAYK 3MCLL 3RDTD 3QI9C 4YDKL 2RAMA 4HX1A 1W0WA 2FX9H 4OSUH 5IVXB 4FQHB 5D1XC 2CKBH 1A6TB 1R3IH 2VQ1A 1CTOA 4OZGE 3SE8H 1TNMA 5EZIH 4JFXB 3B9KB 3HR5A 3VG0L 4HG4J 3MRMA 5BJTA 4H20H 4LNRB 4NQTA 4G9FA 3VFRA 4PGZA 3IGAA 3WUZA 2AJZA 4U1IB 5D96B 5I76A 4QF1A 4UQ2A 2JCCB 2VZVA 1FZMB 4BSVA 4U1GB 2NY2D 1FSKB 4K23H 1EMTH 4BK4A 3OAYH 1XGUA 3E8UH 5DD3L 4B50A 3G6AB 4YDLC 2VDRH 3VH8A 1LMKA 3MXVL 4M8QA 5D2LA 4XBPB 3GNML 3TBWA 1F3RB 1FE8H 2EO9A 3HLAB 3QEHB 2GITB 4PRIA 2Y6SC 5E6YA 1OGAD 3HS0A 1OAQL 2PCPA 4WUUD 1MWAL 2AAVA 4YAQB 2VDOH 3R0MA 3VXNB 1OCWH 3BH9B 1G7JA 4HJ0C 4AIZA 1KTRL 1YNLH 3NZ8A 1RIUL 2IALA 5DMKB 3GJEB 5GRXG 2VL5B 2CLZB 1VADA 4GUPA 3KDMB 5DJYB 1FN4A 4LAQL 1M7DA 4Z6AT 2VDNL 5I9QB 5L88H 3SO3B 4NKOB 2QLVB 2UVEA 4XAWL 5IBLD 1YA5A 3KYMB 1EVTC 5D5MA 4M7KH 4W68A 1KACB 3UTTE 3MXWH 3F7YA 4G8GE 2EDTA 4PB9H 4Q97A 1KN2H 3RY5A 4K3JH 2NR6D 4QRQA 4ZTOH 3O2WH 2Z92A 2L4OA 2FGWL 4PG9B 3DSFL 5ALCH 3S35X 4EN3C 1MHPH 1KELH 4J3TA 1YZZA 4HIEB 3T2QA 2HTKC 2ARJB 3JWDC 4P23A 2PYFB 5TDNB 4XVUD 3UBXI 1KTLA 3W9DA 2AVGA 4XGZA 4X5WB 4ISVA 5C86A 5E2WL 3OHXA 3JWOC 4I48B 3IJSA 1CT8B 1UWXK 1F4WL 1EAJA 4JPKH 4MMZC 1ZS8A 2X4PA 5E7BA 2ZUWA 4MB4A 3RI5K 3VFNA 4KQ4H 5DHVB 2VDQH 4TNWK 3ZTJG 4RMUA 5IEHB 4L8BB 2OQJA 1QLEH 1PEWA 3IS1X 4H0IA 5JNYA 5D2LE 4F15B 1DQQB 2CDGB 3A6CL 3N1GC 1I1RA 5DD5L 3G5XA 5I75B 1BQLH 3QDME 3S97C 1QKZH 3LDBB 3K3QA 35C8L 4DAGL 5ESVA 4BH7A 4LASL 4PJAB 1CDYA 5JTWA 2LE9A 3NABL 4ODBD 43C9A 1UWXH 5IIEB 4NM4L 1F8TH 3T4YA 1QO3A 5DHVH 1E4WL 4OGXL 1CBVH 2BY2A 1IGMH 2BSSB 1D5XB 4DGYL 3FONB 4Y4FC 4WNQA 4QRRA 3P0GB 5CMAB 4MNHA 1QLRA 4N8VG 3MRQA 5DF0A 5LKNA 2ZSVA 4IHOB 1HZHH 3WHE0 4ELME 4FZEL 2J88L 3OKLA 1MCEA 3G6DH 3T8XB 2C26A 1N2RA 2DF3A 3GSVA 4HPYH 5EPMA 3K1KC 4YUEH 2BVQA 5EOTB 4KHTL 4RSVA 4IS6B 4JFFA 3QEGL 1RHFA 5KVEH 4ZD3H 5CGTA 3U46B 3SO5A 2DLFL 3BW9B 4PS4H 3DX7B 1CFQA 1I9RH 2WUCL 4Z7OE 1BFVH 4JB9H 4YC2B 3VWKC 1YMMB 3WNMA 1UM6H 1RJYA 3UBXG 5CZVL 2BNRB 5IJVA 5KSAC 1Q0XH 5BS0A 5B39B 4UTBH 5AZEH 1G7QA 4I18B 4POUB 3CSYB 3RAJH 4JPWL 2WBKA 3GK8H 5SX4H 5C7XL 4RGOH 4WO4D 2VDKL 3IFOA 3L5HA 3BMVA 3B8SA 4XNQA 2EDDA 1KB5B 2VOTA 4GG6B 1GHFL 2F58H 2BOCB 2F74B 4DK6A 3CVHL 5EU4B 3CLFL 2H9GB 4TQEL 5F9OH 4NSKB 1FO0B 3OKOB 4QT5A 1MIML 2OTWB 4LLQB 2E9BA 2H6PB 4AYFA 3ARGD 2ZKHH 3FB7B 3VGAC 3O11B 4YHPB 5EU7E 3U7WL 1MJ8H 1GZQA 2R2HB 1PDKA 1HXMA 4KI5E 5LBSL 1KB5H 3VFUB 1YEHH 4Y19B 4LPWA 3PP3K 1U93B 1NGPH 5D2NA 1RHHB 2YD3A 2YZ1A 4QRRE 3GI9H 4TUJA 4KFZC 1FO0H 4AK1A 5JZ7C 5EZOH 1TZGH 3TA3D 2X2YA 4NNYB 4JRXE 5C9JA 3BEVA 3D3VD 4NKIL 1WWCA 1P7KB 3EOAB 3F7RA 2YR3A 1H8NA 5CIPA 4NRZB 3FMGL 1CFVL 3DPBA 5E1AA 2GJ6B 3TYGH 4X99B 3MRJB 2JK5B 3DMMC 4MJ5B 4JFFE 3UPRA 1F4YH 3PP3H 4NO2A 3CCHB 3PGDB 3FQTA 4F7TA 1R0AL 3MV01 4JZJB 5T3ZD 3PHOB 1OD7A 2R4RL 1S7RA 3BWUC 1IAIM 4Z7UE 4KRMB 3MTRA 1YPZA 2O5YL 3Q0HA 5DWUL 4PJBA 3WUWG 1WCBA 2R39A 1U2CA 3EDKA 5BS0E 5CJ5A 4NN6B 3SKJH 1OL0A 2B5IB 4PJDB 3RWFB 4EI5B 1FVCA 5D71L 3MA7B 2ICWI 1QACA 4KK6C 3KLSA 2F54D 2B0SL 4ZQKB 4M5ZH 4L8SC 1ZA6B 1UCBL 2IQ9H 3MLZL 4HFUH 2HRLA 2MMXA 2BNUB 2NW2A 4LNVA 3T65B 4I13B 2HKFL 4FFYH 2GAZA 1KSRA 1I8MA 4D8PA 5ID1A 2VSCA 4DN3H 4JN2B 1RMFL 1I3GH 1LDPL 2Y9RT 4JFEA 2JJSC 1OQOA 3C5JA 3CNKA 3GKZA 3X14A 4UILH 1OVZA 1T2QH 4XC1H 3W5MA 4KK8C 4PTUB 5IG7A 2V2XB 5EUOB 5DJ2A 1T83C 4LARL 5F1OB 2PXYA 5I30H 1XIWD 1LNUA 1P84J 2MWCA 1HSAA 3RKPA 3NZHH 5B8CA 4U3HA 3H9HA 1JYXA 3IU3B 2HT4C 4LLVB 4PGCA 1JUFA 1I7RB 1MCPL 3OKDA 2XRAL 2K3TA 4H8WC 1AJ7H 4R0LB 4RA0C 4JY6A 1UB6B 1HQRB 2YEZB 3LS5L 1MEXL 2GTWB 1CE1L 3WKMH 4OZGB 4JJHA 3U0PB 4OUUA 3UP1A 2Q3AA 3REWB 3RGVC 1C5CL 2PW1A 5FDWA 3DLQR 2SEBB 1JK8A 4KU1A 1FJ1A 3U36A 1CWVA 1IJ9A 2JLLA 3SN6N 3ARFD 3HMWH 1N0LA 1KNOA 1LEKB 4NPYB 4LKXB 3VRLF 2ARWA 4P4KD 2H45A 3TH2T 3Q3GA 4HV8A 1YPZE 2V7NB 3TJHD 3D85D 1GAFH 2Q7YB 1OLLA 1SY6A 4GFTB 4WFED 5KJRL 1QFUL 2ATPB 3P30H 3QHZH 3KPNB 5DA4A 4ESKA 2MCG1 5I1DB 5ALBL 1OF2A 4OSUL 2CUHA 2DMCA 2CKBL 4AM0A 3QI9A 3RU8L 3ALXA 1WFOA 4NBYB 2BSRB 2VC2H 3QISA 1HWGB 4HT1H 3SE8L 2IBGA 6CGTA 5EZIL 2XYCA 3T77B 4Z7NE 4ZUUB 3BRGC 2IANE 5D7LA 1AC0A 3LKRB 4H20L 4JFEE 4U6YA 4QRUB 4HMEA 5B4MC 4YHKH 2EDOA 1TITA 4YFLF 4Z7WA 3QWRD 4CGTA 2PYED 2F53E 2KDGA 2A9MH 4KKCD 4PJIE 5IHUH 1AKJA 4I77H 3MA9L 4OUOA 3E8UL 3OSKA 4QNPE 4KGJA 3L5JA 4XPAH 5L2JB 4JZNB 3QCVL 3V0VA 5D7SH 4LFHD 2XI9A 1H3PL 1U6AH 2VDRL 5BQ7B 5CBAA 3MNWA 1URLA 4P5TA 3UTTB 3D5OF 3D18A 4KZEH 2Y36H 4G8GB 3QR2A 5SV3A 4MDJA 3RVWC 3ZE0E 3OB8A 1QOKA 4R7NB 5E8PA 3HRZB 1T0MA 1X44A 2MCPL 2DI8A 2VDOL 1U8JB 3CMGA 2MFNA 5JORB 1OCWL 5JR1H 4DVBA 4HX1B 1W0WB 4JAMA 3VCLB 5EH1A 5JMOC 4M7ZC 3ILQD 3B3IA 4MNQD 3BGAA 4XBGA 1RU9L 3QQ9D 3S36X 3VFRB 4M9PA 1CL7H 3VU2A 1EV2E 4LU5H 2M26A 1HQ4B 2AJZB 3C08H 1OOAA 5GJTH 1D5ZB 5I76B 2EEBA 4QF1B 1P4IH 5EU3A 3LEVH 3WN5C 1J0IA 4BSVB 3TO4B 1QHOA 3MXWL 3H9SA 4UIKL 1CGSH 3WNOA 1PSKH 1CDGA 5C07D 4JGJA 1WICA 2CUIA 2F15A 4Z78B 3RIAF 1LO0L 3DXAE 4NDMA 5D2LB 3TBWB 3O2WL 2I25N 1KPVA 5TPWH 4YXHH 5ALCL 2DQUL 1KELL 3QDMB 2GYSA 1Y0LA 3HS0B 1HH6A 3QEQA 4MB5A 4EN3A 2I27N 5GS1C 4G80B 2JELH 4XCNB 5CD5D 3ARBD 5KSUA 1T7VA 1E6OH 4KHXH 1G7JB 2AJSH 4AY0A 3ZKSD 4DKFH 4PJ7F 3GO1H 1FBIL 4Z7WE 2VXUL 4FNLH 2IALB 1R5WB 5E5MB 5FYLE 5E00B 1FL3A 3CXDH 1UZ8A 4JPKL 3V5HA 4ELMB 1MFCL 3G5ZA 3OV6A 1M7DB 2ZOLA 4KQ4L 5E9DE 1TTGA 1CIDA 4P46C 3LHPH 1B2WH 4TNVK 4WV1B 1KXVC 4I3RH 5F96H 4Q0XL 3X11B 5ICYA 3LB6D 1HOCA 4QGYA 2ZNXA 1GZPA 1C16A 3H2WA 5CJQH 2CK2A 4WWKC 1ES0A 2A77H 3RWIA 4PG2A 4K94C 1QNZH 2VR9A 2YD1A 4ZXBD 3JSSA 3OJDB 1KTDB 2Z92B 5DSCA 2YOCA 1IRAY 2NY7L 1YN6B 3QJFB 3JBG7 1CFTB 4MA7H 2EDEA 3FN9A 2OXHA 4P23B 4DFIA 5F9JB 4UIMA 4HXBL 1KTLB 3W9DB 3RHWF 4FQCH 4R2GD 1A7PL 4ZAKB 1MJ7H 3IJSB 5D4QA 2O5ZH 5C0AD 3C2AH 1CGUA 1YMHB 2E7MA 3H9SE 3FT3B 4HPYL 2AXFA 4YUEL 3MV7A 5C08A 2BERA 3IU4H 4PJXE 5HTSA 1JE6A 2NXZB 2CDFB 3JV4A 1IAKA 4DZBA 1I9RL 2CIIA 2E7LC 1BFVL 1CXHA 4IRSB 1UVQA 3KPRE 1T6WA 3IFLH 4JVPA 4DGIH 3SCMC 1KFAL 1S7VA 4ZS7H 1LEIA 4ZODA 1S7QB 4BH7B 1JHKL 2J12B 3VWKA 4R90L 3RTQB 1Q0XL 1NAMA 3RWJA 1NC4A 2PNDA 3NIDE 1XGYL 1QO3B 4OZHF 3SPVA 3O6MH 1MRFL 5J13B 5JPNA 1KYOK 3MO1B 4PJ8D 4ERSL 2IH1A 1JF1A 1NCBH 1VFBA 4RGOL 4HZLA 3ARED 4WNQB 4QRRB 5TE6H 4GG8B 3MRQB 3V4PH 3ULVC 1YEIH 2ZPKH 3KYOA 4N8CL 2QHLA 4JRXB 3WS6A 5D7JC 4EDXA 2F58L 3VD7A 4KRPB 3U9PL 5I19H 1WQVT 3OG6B 4MXQC 3HI6H 1JI1A 1N2RB 2BVOA 5EPMB 1MAMH 3MMEB 4LGPB 4YHYC 3P4NB 4JFFB 5F6IC 3CFBA 4J3OC 2AXJA 3O41B 2CR3A 2ED7A 2WAHA 5GXBB 4RFOH 4PRHE 2GK0A 1ULVA 3RZCD 4LVNC 5C0GB 3D6GA 4KJYA 1XZ0A 4Z7UB 5HHME 1RJYB 4YPGB 4UNVA 3HZKA 4Y16D 5B3JE 2YUZA 4PJ9C 4J8RA 5BS0B 3BAEH 4XRCA 1FO0L 2R1XA 3SQBA 1KLFA 4WW2B 1G7QB 4MX7B 5EZOL 1AO7E 1XF4B 2YS4A 3CDGB 3Q6FA 3V0AC 2I24N 3CU7A 4PUBH 4U6TA 1LO5A 1MREH 1Z0MA 3LKQA 3IDMA 5K59F 5CKGA 5IB2B 3QG6A 5F72S 1MVFA 2BSED 4OIAA 1AGEA 1F4YL 3VFPA 5AAWA 3DMMA 4GLRI 3ZE1E 5EBGA 1WITA 2E9IA 5HD8C 3GHEL 5I1GL 3GSNL 1A7OH 4QOKA 2J6EL 3L3HA 4QYOB 1T22A 1GZQB 4QY8B 1IM9A 2V2WA 1A3LH 3SKJL 2BY0A 4JG1H 5I8CA 3HNSH 4M1DH 3O4OC 5CCKL 5HY9A 1XGRA 3MBED 5BVJB 4M61A 4NP4H 4LSVL 4FFYL 4L8SA 3BP7A 4MA3A 3TZVD 3BEVB 3EHBD 5FK9A 1C1EL 3LV3A 4B0MM 4NC1C 1I3GL 3R4DA 5CIPB 1AQDA 1NDGA 3AS2A 5E03A 3QQ4B 4OCSH 1YNTA 1DBJH 4XC1L 3D0LB 4HLZG 4A6YA 1S9XA 4HMCA 5F1NA 3JV5A 3VGFA 2ADFL 4NO2B 5FUOH 2P49B 4CDGC 3FQTB 4GRMB 4EBQH 5GGUB 2JCCF 3GBMH 4H26A 2BRQA 5GRJL 5I30L 3MRFB 5CSBA 5C3LD 3AB0B 1DBBH 3U0TB 4CN6A 3NZHL 1YPZB 5IV2B 4EQ2A 5CIPH 4ZOCA 3DWTA 3RVUC 1CXKA 4XNYH 4PJHA 1FVCB 4W70A 5H8DA 1NLDH 4DUWA 5FO7B 1FFNA 1YY9C 5D72H 5IMLB 5MERA 4S11A 1HYSD 1JI2A 4ONOA 5BCAA 5TDPB 2P45B 3MV8A 5HHVL 4HFWA 1JNLH 3WKML 3P73B 4GQ9H 4GAGH 5F89A 2IANB 4JFEB 5GISL 3RGVA 2VXVL 5DJ8A 2J2ZA 3VXOB 1PX3A 4KPHH 2F53B 3RZWA 2HVKB 4PTTA 4U1KB 4PJIB 4OV6F 3L3OA 5EO1B 3ARZA 5DJ2B 4XI5D 1GAFL 3QEUA 4YE4L 1CXLA 4JRYD 4HC1A 3V8CA 3RJQB 1LNUB 4XNXH 4KQ3H 1HSAB 3P30L 4TTGA 3ARVA 3H9HB 2WQRA 1F2XK 2VWEE 4JY5H 5GIRB 5FO9A 3G04A 2YPLA 4PGCB 4U49A 1YECH 2Y4SA 2Z31C 5E6ZA 1FGNH 1BD2A 2DLTA 5LCVH 5I16B 5EO9B 5IF0A 4X9GA 5K33A 4NT6A 4QHNA 3BIBX 4U0RB 1MLCB 3H0TA 1BIIA 1UH3A 1M7XA 3CFJA 1E4XI 3QXUA 5BMFH 2PW1B 1IFHH 5FDWB 3QUZD 1QVOA 1AI1H 1GOHA 3MJ7B 5CJBA 1DLFH 2DYPA 4CN1A 1FDLL 5D7SL 1U6AL 4UOJA 3V4VH 4P2OC 2VZUA 4JKKA 1KNOB 4U6VH 2HFEA 4PP1D 4XPHL 1IGYB 4M5YH 4XMPL 3Q3GB 2CD0A 3LRSB 4HV8B 4KZEL 2Y36L 4OCNC 1FZKA 3FFCD 3G9AB 2APXA 3V7AG 2WMPA 4CL7A 3BN9D 4O5LL 3RVXD 4QTHB 4X7SH 4RQQA 2QQLH 3L3DA 3DXAB 3GSRB 2CGRH 2DQDH 4LSRL 1L0XA 4MZ2A 1FL5B 4X83A 3SDAD 4ZFGL 4AM0B 3QI9B 4GMSL 3FB8A 3MV8E 4X6BB 3G9VA 3QIWC 3VGDA 4D9QD 1A2YB 5D1XB 4PRPA 3EFFB 1FNSH 3QAZC 2XZQH 3IF1A 4GSDH 4LU5L 3CAFA 3ZSTA 1SY6H 4Z7WB 5GJTL 5E70A 5ERWA 3LEVL 1WFNA 1AKJB 4HXAH 1CGSL 5CZKA 1S7WA 2YD6A 5E9DB 3WN5A 5T5FH 3V0VB 3PNWB 2HFTA 3MNWB 5T5NF 2QQNH 4YHNB 4YDLB 1U0QA 2H32A 2H2SD 3BVNB 1BVKB 1E27B 4MDJB 1J0JA 3MYJA 2JELL 2Q7NA 1QSVA 1E6OL 4KHXL 1K3ZA 1IM3A 3MLUH 3WNKA 2D3VA 4H1LG 4G8EA 4JAMB 4DKFL 5GS1A 1ZHBA 1U58B 1TETL 2RHEA 5E6ID 7FABH 4B53A 2GI7A 4OD2A 1IC7H 4FNLL 4P2QE 4YLQT 4XBGB 2QADB 4G8FA 3ZYJA 1K8DB 3HAEA 3SOBL 4F7CB 4X4YB 1MF2H 2ZJSH 4GXVL 3LHPL 2QR0A 5KTEL 4P0DA 2WWMC 4ODXB 5F96L 4M6NH 4OLXH 5EU3B 5FCSH 4AENA 3BQUD 4HW6A 5TGBA 1J10A 4AJ0A 1BF8A 2WBJC 2F5AH 5TF0A 3H9SB 3WD5H 5DD6B 4GG6F 1EEQA 4K8RC 4PJXB 1ERNA 4HDIA 3D2UA 5CJQL 1A64A 2R23A 3S35H 3VA2C 4R8WH 1QNZL 4E0RA 3RP1A 2CO6B 4NDMB 4WWKA 4PY8I 1KPVB 3KPRB 4WU7A 5C0FA 1I1AA 3B9VA 2NX5A 1A8JH 1C08B 1Y0LB 1NC2B 2LU3A 1HH6B 1KCSH 4MA7L 4H25B 4EN3B 5I1EL 4RRPA 1UACL 1IZJA 2ARJQ 2N1KA 1OTSD 3WLBA 1OB1B 5E2UL 1JHTB 3U7AA 4CVXB 3HB3C 1LO3H 3L5WB 4NUGH 5SWQA 1MJ7L 2JJTC 2O5ZL 3C2AL 3D9AH 3QG7L 1X7QB 4AEEA 1IZKA 1P7QA 5K9QI 3V79C 4OLVH 2EDFA 1RIHH 4HIIA 1QSEE 4R7DA 1TZIB 1A9EA 5ICYB 1FYTD 2DM7A 5MHSD 1HOCB 3JWDH 3ULUE 1A5FH 3GM0A 3IFLL 3VDCA 4DGIL 2VIRA 1GZPB 4G43B 1EJ6A 2ATKA 1ZWIA 4ZS7L 4TSBH 2FSEB 1G9NC 1CLOH 2M1KA 4CNIA 3STLB 3JWOH 5J12C 3QDGD 3DGGB 4PRHB 1RY7B 1WISA 3M17A 3ECBB 5F9WC 5I8EA 1R3KA 2D9CA 4NZUH 5HHMB 3RGHA 1JGVL 1G1YA 3QXDA 1NJ9A 2HH0H 2R8SH 1CLYL 1YYMH 3M8OL 3BESR 4PJDF 4UIMB 5DS8B 3EYOA 3BRFA 3V4PL 1SJEB 1WBZB 1G9MC 1P6FA 1AO7B 1YEDB 1YEIL 4Y4FB 2PO6B 4FRWA 2C3GA 4XXCC 4I0KA 1OSPH 5TQ0L 4DVRH 4N8PA 3X12A 2QQQA 1JZ5A 5CSGA 5I19L 1IKFH 2GFBB 1QRNA 4JVUA 2AXFB 1T66D 3K2UL 3LKNA 1YMMD 2BJML 1IAKB 2AQ3A 1DQTA 2OR7A 2R56H 3LRGA 2CIIB 4RFOL 1UVQB 1KC5H 2IADA 3MFGB 2DI9A 1LEIB 4DZ8A 5JW3H 3SGEH 4YO0A 5DJ6B 3S3PA 1N6UA 4ZS6D 5K9JH 3BAEL 2DQEH 3R1GH 1HHHB 1JPFA 1NC4B 1DZBA 2P42B 4MA1B 2ZUTA 3S5LA 5KSAB 3CK0H 4O02L 4JFHD 4PJ9A 4H88H 4F8QA 1G7MB 1NUDA 4M7LL 1A0QL 5DO2D 4E41E 4PUBL 1OTTD 1JRHL 3GMLB 3JVGC 3GSWA 4N9GA 3VXSA 2DWDB 1F4HA 2ZSWA 1V3LA 2I07B 1JPSH 5EBLA 4DGVH 4DFHA 5ACLA 4EDXB 5IJKC 5CSZA 1SQ2N 3O6FC 1AGFA 2R15A 5JW5B 4QHKJ 1T1WA 1NAMH 5E2TH 5EU6A 2XN9E 4OZGF 1KYOJ 3P40A 2BVOB 1A7OL 5EN2B 3WFEH 3CFBB 5J7CC 1KG0A 3IDJA 3AVEA 3VGAB 4F3FA 1LK2A 3WJJC 2DLGA 1ZT4A 5MENA 5ID0A 5C0ND 4PD4K 3OAZK 3OR7A 3ZHLA 1R3HA 2FB4H 1MCHA 4J8RB 4QRPE 4XRCB 4XHJC 1INEL 1X5YA 3I3BA 1ZTXH 1KGCD 4NP4L 4PJ5D 3HI5L 2HFGL 1DBKL 3PWUA 5GZOD 4PGEB 1W0YT 3MR9B 3ULVE 4KTEH 2IAMC 1LO5B 1VGEH 3LKQB 3UTPE 4TTDC 5C0BD 4EUPG 3IDMB 4HJGA 1FFRA 4N0UA 5IB3B 4OCSL 1DBJL 1QRNE 1S9WA 3QG6B 1CFBA 4AG4H 1I9JH 3MQIA 4H5SB 2UV3A 4LVHB 1LK3L 2YD8A 3OAZH 3DMMB 3VFPB 5H2BA 5IBUG 4L3ED 1IAMA 4KROC 4IRJA 4X6FA 1FNEB 4Z0XA 1HNFA 3GBML 4XCCH 4U2YA 5HVGB 5J3HC 4Q2ZA 1DBBL 3VXMD 3L3HB 5SX5K 2W0KA 3LSOA 3R8BB 2G2RB 2V2WB 3UZVB 4KJPC 4XNYL 4AEIH 2XA8H 1U92A 5I8CB 1CXEA 2R0WL 1NLDL 5HY9B 1XGRB 1RZ8A 3GMPA 3GSQA 3KPSE 1Q1JH 5HGDA 2ITCA 5D72L 3MRNB 2X4QA 3TPUA 1AFVH 1FGVH 1FLRH 4PLKC 2CK0H 5AZ2H 3FAWA 1EAPA 4YWGL 3NIGE 1E0OB 1JNLL 1D6EA 3HE7C 1G7IB 4MA3B 4GAGL 3EYSH 4FA8A 5FK9B 2LU4A 1RUKH 2ED8A 3VFWA 1MQ8A 3TJEH 4X7TB 1RZGB 5EC1A 1EGJA 4KPHL 1YNTB 2XXMB 3OR6A 1S9XB 2RJMA 4KXZH 4NQVB 3H3BC 3NCFB 1DUYA 1RFDL 1J8HE 1JIBA 2Q8BH 2DIAA 3KXFE 1Q8MA 2VERN 2ED9A 1JZ4A 3V5KA 1DE4A 4I2XA 3CFIC 3HE6A 5FHAH 1UJ3A 4ENEC 3JWNC 4PGDB 4PPTA 1OP9A 4QHMA 2BRRH 2GIYA 4JKPH 4M7JL 5JDSB 1FAIH 1J0ZA 2ICWA 3CX2A 3I6KA 4ZUWA 5D2LF 3UX9B 4A6YH 3FT2B 1FFNB 3RRQA 3MLRL 5LCVL 2Z31A 1ZAGA 1IT9H 5DUBB 4OGAC 2D4DA 3MV8B 4MZ3A 5IQ7H 3LQAC 3X3GL 4M93C 1Q94A 3NFSH 5BMFL 1IFHL 5MI0B 1D9KC 3K2MC 3RGVB 3GBLA 1AI1L 5DJ8B 1WWBX 4I0PB 1WLHA 1WF5A 1INDL 3DURA 4U6VL 4L9LC 5ISZE 4M5YL 4PIRF 5GZNC 5C09A 4P2OA 3VXRD 4N1CA 4ELMF 5D8JH 4H8WH 4XTRC 3TIDA 3D69A 3EDEA 1NGWB 1WIPA 1IEAA 8FABA 4U1HB 3PWJA 4X7SL 2QQLL 43CAB 5BOZG 3EDDA 3MRKB 3FO2A 2DQDL 1FIGH 5C0RH 3DROB 1GGBH 1OPGH 2B4CC 2HKHH 3VWJD 3AMLA 4JDTH 3SJVA 4JO3H 5C92A 4Z7OF 3QIWA 1QR1A 3O3DA 3HFMH 2JB5L 3H42H 5EIVA 2XZQL 4NT6B 4QHNB 1SY6L 3H0TB 2NXYB 4PJFA 3EGSB 4P2QB 4HC1H 4WGWB 5DMIH 1KJ2B 3S34L 2BVYA 4KVCH 4RWHA 3T09A 5JIPA 5ITBH 3UTTD 5DMYA 4HXAL 1I7UA 1QVOB 5IQ9A 5T5FL 4DKDC 3R0NA 4M02A 4X7CC 3THMH 2Z8WC 3LS4H 3MJ9H 1CE6B 3UYOD 3QYCA 5IHZA 5HYJE 3OKKB 2CRMA 4LHUG 4RQQB 5C70A 1BJMA 5DD0L 2Q86A 4KJQC 1CDBA 3DETD 2YWYA 3QO0B 2VABB 4PLJC 5FYKE 2X4NB 4G9FD 1UADC 1JWUA 7FABL 3V5DB 3RWCA 2OM5A 4KI5F 3KHOA 3WL9A 3EKCA 3DHMA 4GRLC 1S7UA 1AGDA 2XTJC 2EO1A 4ODUA 2ZJSL 3IF1B 4POZD 1XT5A 5ERWB 4M6NL 3BGMB 2G5BA 1MFBH 1FZOB 1A14H 2HN7B 2IF7A 3OKEA 5EIIA 2VLMD 3KPOA 4FFVC 3ILPA 1QSEB 2W07A 1TPXB 2DLIA 1I8KA 4PRID 4K7PY 3QXTA 3DV6A 3S35L 2AV1B 4NN7C 4D0CA 3K1DA 1ONQA 5DFVD 5DI8B 3DUSB 3VRJA 4HGMA 3BZ4B 1Q9LA 4RZCB 2FL5B 4MAYC 1LD9A 3T0WA 1HHIB 1KCSL 3MYJB 1NCAH 4IBLT 4MQXC 3F58L 5FOBA 4C4KO 1QSFA 3CJJA 4PR5A 4M00A 1ZHBB 2V9QA 4Z7UF 1KLGA 3WE6A 3V4UH 3BPLC 4PJFE 4ZTPH 3SE4C 2Y07H 4WW2F 2AERT 4F33B 1T1XA 3HAEB 5D1ZB 4OLVL 1WSST 4A2LA 4KMQA 1RIHL 5GJSH 3HPJB 3O4LA 4ZSOA 1H8OA 1OAZH 3BP4B 4Z0BL 1Z9SA 2EIDA 4P46B 4AENB 5DRNB 4IOSD 2KH2B 2NY0C 2AJ3B 1JTOA 4PJGE 3OL2A 5BRZA 1A5FL 1B4JH 1QYGH 3SBWA 5DC9B 4OI9A 1L9NA 1S78D 2MJWA 1YC7A 3N85L 2AV7A 2BNQE 3BFOA 4E0RB 4AZ8A 4WWKB 3JWOL 4PRAB 4P23D 2P5EA 3HAEH 4WU7B 2IG2H 2E7HA 4Z5RA 5FYJE 1I4FB 3QHFH 5DC4B 2R8SL 4OT1L 3S8WA 1YYML 1R24A 3F62A 1W2KT 3QJHB 3BPNC 1JTTA 4HGKC 4NYLA 4WI2A 4E41B 4BFBD 4ZFZA 4DVRL 4M1GH 2OYPA 1IKFL 3ZTJH 4XXCA 4JFDA 2HP4A 1Y6KR 4K94H 3RWHA 4X7EC 2DQGL 1QBLL 4N8VB 3UJIH 5F93C 4HIIB 1IGCL 2XKUA 1CFSA 3U82B 4K3EH 5IK3A 4GBXB 4KVNL 2I9TA 2R56L 2WSKA 2XN9B 1KCUH 2X4SA 1HIML 1NMBH 2DJSA 3I75A 3PV7A 3QT2A 4Y2DC 2CO7B 2IFFH 3VGEA 3QFDB 2HLFD 3CH8A 5A43C 4O2FA 3SCMB 2C3VA 3VI3E 4CNIB 4EZMA 2DQEL 1IQWH 3PQYA 1KTKE 5I8EB 3B2UC 1XGTB 5FUCC 1B0RA 4OCRL 3QXDB 2VTFA 5DGRA 3ZKNC 3BX7C 2VLKE 3H9YA 1A1OB 4QRPB 4NFBA 3UBXB 5HYSG 5E4IA 2W59A 4P9HC 1BX2A 4MCYB 3WO4B 4YR6B 3BPOB 1JPSL 4DGVL 5IHLB 1IGFL 5FO8A 1TVBA 5IB5A 1KJMA 1T5WB 3BO8A 3BYYA 3QCUH 4JFFD 4LKCB 5DJXB 5F7UA 4V2CB 4ZSOE 3BWAB 1JYVA 1BZ7B 5IW1A 5D7JB 5IJKA 4MWFA 1NAML 4O4YH 4K71C 3O6FA 4HKXA 1QRNB 1TCRB 2HG5A 3SKNB 4Z7NF 4N0CD 1J87A 2YC1A 5IM7A 2FATL 2GQHA 1BQHG 5C8JB 4O2EB 4X5LA 5F6IB 2P5EE 3J8F7 2IADB 4PJIF 1Z9MA 5FA3B 1SBSH 3NVQA 2R2EB 4QLRA 3ULVH 3DTXB 3WJJA 4QNPF 4JDVA 1NCUA 1IGJB 3DSNA 2FB4L 2J8OA 3U6RB 1JPFB 1ZTXL 4YZFE 3S5LB 3T3ME 4PJ9B 3MOAH 2MPAH 4C58B 3DVGB 3KPSB 3D39A 4KTEL 1VGEL 5CLWA 5JIHA 1A6AB 3GSWB 3QDJA 2IAMA 2ZSWB 2D9QB 2N4IA 5GGSY 3QNYB 2R29H 5AYUH 5EBLB 4JFQA 1FNHA 4AG4L 4EOWH 1PEZA 5HHNB 2NTSP 2XKNA 1AGFB 2AABH 2DB8A 2FEEL 4YK4C 4Y4HD 4CVZA 4HIXH 4XCCL 1VESA 4HIHA 1J8HB 1DBAL 3L3GB 4JZOA 3L6FA 4KKNA 4CW1B 1ZT7A 2E6JA 3KXFB 4JQXC 4AEIL 2XA8L 3PQYE 3FQNB 1X4ZA 1J1XL 1Q1JL 2H26A 1ZV5A 5I1LA 1K4CA 1AFVL 1FGVL 2CK0L 4MSWA 1MCOH 2AEPH 5T3XE 3L1OH 5IOPA 1JV5A 1SVZA 2AXGB 3WUWB 4S0SD 3PWUB 3RNQA 3EYSL 4W81A 1EBAA 3MLSH 1RUKL 2D31B 2RFXA 3HE7A 2ZUQC 3TJEL 3S4SG 4NRYA 2VXTL 6FABH 4KKAC 1P1ZA 2PKDA 2WQ8A 4PD4J 4U6XA 5FOJA 2Y06H 3EO0A 3MLTA 2DM2A 3TN0C 4NZRH 1ND0A 2Q8BL 4TVPE 3AU1B 3RY4A 3OKMB 4ZYKA 4Z0XB 3PWVA 5C2BL 5AG9A 5ISZB 2VR4A 1FNLA 2C3WA 1OSZA 4PRDB 5FHAL 3JTTA 1NFIA 5E2VH 2BRRL 1JVKA 3CSPA 3UTZA 3VMNA 4XPFH 4AIXA 4HUUB 4LOUC 1WIOA 1HHGB 4U7KA 3QUMA 1RZ8B 1I3VA 4A6YL 4ZPVA 2XFXA 3AS3A 5HGDB 3K80A 3LMJH 4M1CD 3C5ZC 5HHXH 3P0VH 2FWOA 5IQ7L 2MHAA 1XCQA 2I60L 1D6EB 2FDBP 5CILL 4YGVB 4BUGA 3VFWB 3L9RB 3OPZH 4DW2H 3NCJH 2NY4C 3OJMB 4HKZA 4N90E 1D9KA 5EC1B 5JOPD 4UT9H 1LE9B 2PXYD 4WW1B 3OR6B 4P5MB 2XTLA 3AXLB 3FB5B 3RKDD 4H8WL 1HSBA 3EJZD 3RIFF 2W9EH 4OAWA 4I5BA 3V5KB 1DE4B 2OTPA 4MCZB 2ZG1A 2LVCA 4UOW0 3X13A 5HYJB 4HWBA 3PGCA 4PJXF 2VXQL 3DARA 2HKHL 4YDIL 5FGRA 2X5PA 1EGJH 3UTSE 2ICWB 4JDTL 4JO3L 3MRRB 4R4ND 3HFML 2H8PA 1JF5A 1RURH 1U3HA 4OGYH 4O2CB 3WHXB 3UC0H 4HC1L 2B1HH 5DMIL 4CU6A 1Q94B 3PDOB 1PZ5B 2Y7QB 1CN4A 4KVCL 5TE7H 5C0CA 5ITBL 3NIDF 3LN4B 5HGBA 3ZYIA 2FJHA 3O45A 5GGQL 1JGLL 3THML 4FG6D 3LS4L 3UPAA 3T0EE 3VXTA 4U05A 4Q9QL 4P2OB 1A3RH 5DFWH 5FYKH 2EC8A 1U3JA 3TIDB 1U8NA 8FABB 4ETYA 2YD9A 1YYLH 4GW4B 4RFEA 3VFVA 3BHBB 3NN8B 3QCTH 5M95B 2OS7A 3FO2B 4LBEB 1G6RB 5D7LD 4TUKH 4LVEA 1U91A 5A16A 1TVDA 3MOBH 3S36L 4FQPA 4XC3L 2CLRA 4HPOL 3SJVB 1AKJD 1QR1B 5CEXB 3TBVB 4G6AD 4GRLA 3L5XH 3MCKB 4W6WB 2EIZA 4PJFB 4MNGA 1JHLH 4L4TE 1MOEA 1OQXA 4TPRH 1GIGL 1T21B 4YX2H 1LE5A 1MFBL 3RA7H 1SJHA 4P5TD 1A14L 5B38G 1I7UB 1I9IH 3RPIB 3ZT7A 4ZUTA 1YN7B 2AGJH 4XMLH 1X6LA 4ZPTA 3EFDH 4Z76B 1HILA 2NY1C 5D93B 2Y6SD 5HHOA 2GJZB 4YHIA 1H0DB 4PJGB 1UB5A 3LRHA 3Q5TA 4OLZL 3B9KC 1NCAL 3W11C 2BNQB 3ZE1F 4MAYA 2Q86B 5DUML 1BVZA 3VE0A 4YDVA 5D96C 5BOPA 5T1LB 4C56A 3MNVA 5LGHH 1SYVB 4R4BB 5HPOA 1KLUA 4BQ6A 4RDQF 2D0FA 1FSKC 4WJ5A 2BZDA 1IC5L 1T5XA 5GS3A 1F3JA 1JPGA 3GMOA 3FQRA 4Y0GA 2DKMA 2ZCHH 4G9DA 5T33L 3J7HA 5FM4A 3KG5A 2Y5TA 4HS8L 2G9HA 2QTEA 3KYNA 1NDMA 2G5BB 1CF8H 2E9JA 2IBZX 2V2TB 1U8MA 3OKEB 3SKOB 2VISA 1VB9A 3KPOB 1QYGL 3AUVA 3DIFA 2WBJB 3WCYA 2NY3C 5CD3A 5FYJH 4DTGH 5I17A 4PBXA 3QEQD 1ZSDA 3JTSA 4EN3D 5EDXA 5DGQA 4D0CB 2FLRT 3TO2B 4KDTA 4PY7A 5HGHB 4UT6H 4DCQA 1UEYA 4GJTB 3RBSA 2MNUA 3QHFL 4U1JA 4KUCF 3DUHA 4LCYA 1U8QA 4IEFB 5JOFB 5I9QC 3SO3C 3BZEA 5LWYH 1ZVSA 4JFOB 3ULSA 4TSAL 1J0KA 3P4MA 3LKPA 4OFDA 4K8RH 4M1GL 2VLKB 4Z7VE 3WLWC 1DBMH 4X9HA 1T1XB 4K7PH 4OB5H 3I3EA 1QQDB 2EXWC 5BO1H 5GSRA 2WINA 3ZKQD 3WYRA 3LEXA 4ZSOB 4G5ZH 1NCDH 1YJDL 1KCUL 5EFIA 1TJHH 2IFFL 3E3QC 4NQEE 4APQB 2X4TA 3ROOA 3MLXH 4Y2DA 2AV7B 1LP9E 1MFDH 2P5EB 1IQWL 3SY0A 5INDA 1RUAL 2XKSA 5J12B 2K7QA 1CD1B 2VITA 1CLZH 4WI6A 1YEEH 1CD8A 4W6XB 4CVUA 2C7UB 4I4WA 1XR9B 4XP9L 4AH2B 3MV7D 5IVZB 5C08D 5DRXB 3GBNL 4OCWL 5BXFA 5HJ3A 4F15C 1S7XA 2FJFB 4MGXA 4D0BA 1AXTH 5JA8B 5BZWB 1G9NH 1MFAH 1MUJB 2Z8RA 2R2BA 1U8OA 2XNAA 2ESVD 3MGTB 2FD6H 3MROA 3TT3L 4YBHA 4JRWA 5IK3B 1Q38A 2VZSA 4JM2B 3VWKD 3O9WC 3QFJA 2OSLB 1NC4D 4XVSH 4Z77A 3GMMB 4YBLC 4G7YL 3FO9B 5I66B 1LEGB 5JHDA 4O2FB 1FFOA 2C3VB 1RJLA 1QFWL 3SDCA 3VRLE 4Y1AD 1OT2A 3T08A 3PQYB 4FOMA 3MOAL 2MPAL 4X9IA 1XF2B 2EE2A 1IQDA 4HUKB 4HWZA 4KUZH 2HYMA 5L7XL 1NLBH 4L8CA 2ID5A 5I73B 1F58H 3UAJC 4I3SL 3RDTC 2R29L 3X17A 3RVVD 2NTFA 4XPTL 3UTOA 5IB5B 4EOWL 2BCKA 3BO8B 3QUXA 4P2RA 1I7TB 2AABL 4L3CB 5IW1B 5TDOA 3E6FB 3TV3H 4CDHA 4E42A 5J0BA 1XAUA 4FQXD 2NY5C 3O6FB 2YPKB 3QQ3B 4HKXB 1U8LA 2HG5B 3BH8A 4PJ7A 2BDNH 5KZCB 3CFKA 4LFHG 2YC1B 1KULA 4OZFG 1F6AA 3QIUA 2GTZB 2FX8H 4TRPH 4AMKH 2Q8AH 4PYHA 2FZ3B 2V7HA 2B2XL 1X4XA 4LLMB 2KBGA 1V7NH 4S1SH 5FUCE 1KXQE 5C71A 3NCYP 2AEPL 3WBDA 3L1OL 2IQAA 5IHBA 4U1SB 5IVOA 5KN5A 2CDEA 2OP4H 1IL1A 3HZYA 5IEKA 5I1KH 3MLSL 4Y4KB 1OAUH 5TF1H 1FLTX 2XWTA 4BZ1L 4HHAB 3V0WH 3HCVA 4MJIE 1T1ZB 5C0EB 1MCBA 3DMMD 4I3GA 3CX5K 1NEZG 4P4RA 1VEPA 5K9OB 4BSWB 1FRGL 3ARXA 2Y06L 4QOKD 4EJ1C 5KAQF 3PIQA 1IM9D 4CVZB 5DK0B 3QFJE 3TN0A 1TXKA 1CTNA 2ORBL 2FHFA 2Z35B 3RPKA 3O3BB 4KROB 3FT4A 3C5SB 2R2CA 5IBLC 5E2VL 1RAMA 3HG1A 4M6MH 5CFHA 5EORH 1QEWB 4EXKA 1B0GB 4JM4H 4JO2H 3ZE2F 1J1PH 2AQ1A 3VFMA 1K4CB 1IAII 4Q6YA 2J4WH 4JKMA 4N5UA 4G6ML 3UTSB 1QFWM 3C5ZA 3K4AA 1S5IH 3MUGA 5DJCB 3HE7B 4HKBB 4P2RE 3NCJL 1VACB 3SE3A 4HLZH 5IMOA 2R1WA 4KK8D 2AKRA 4NRYB 1IVLA 3OX8A 1P1ZB 4XVUC 4UT9L 4U6XB 2VXSH 2EDXA 2XICA 2W0PA 3EO0B 4OZHA 1A6WL 3MRIA 3CFEA 4B41A 1O7SA 2W9DL 3CD4A 5KG9A 2OJEB 3OMZA 4TN9A 5GRVK 4EI5C 3MYZA 4UB0H 4HJJH 4ZYKB 4KMTH 4KMLB 3PL6A 3T0EB 3HC3H 1OSZB 5BVPL 3JTTB 1ZLUK 1R3LA 4PYGA 3O3AB 1MAJA 2EYSB 1FCCA 2V9TA 3MV8D 4NJ9H 3VGHA 4CU8A 3QUMB 3TCLB 4MD5A 4F37F 2QBWA 4HF5H 3MLVH 2XFXB 3ULUF 4DKEL 4GLRH 3RGVD 1UXSA 5M7QA 4JO4H 3OF6A 4ZFFB 2ICES 5DEFA 1ZXQA 4OGYL 2CRYA 3UC0L 2B1HL 5EG6C 1DLHB 2CLVA 4Q74A 1N0XL 4XX1E 5EO0B 1HEZA 3TIEB 2WANA 3DRTB 2IWGA 4TUOA 1ZLUH 3VDBA 5JXEA 1EO8L 1D9KB 1ZHLA 5HVWA 5L0QC 5J6HB 1Z0NA 4L4TB 4OV5A 3QUMH 3P9WB 4L29A 1A3RL 4P3CH 4L9LB 2NW3A 4JJ5A 3TLRA 2QL1A 1WUNT 1M71A 1FVEB 3GJFA 4R0LC 1YYLL 1D5BA 2YPLD 4P48A 3IJHA 1Y18A 1RZKL 4WY7H 5F6HJ 4EVNB 2JJWA 3QCTL 3PWPE 4RMWA 3D48R 1MI5E 1G7HB 5HYIA 3LQAH 3X13B 5HYFA 1M6OA 5JDJA 1BLNA 4CKVX 1U8IB 1XMWA 2E3VA 4TUKL 1BD2D 1YNKL 4NQDA 4JPVL 3MOBL 3TFKD 3FQXB 4CN4A 5AG8A 1RK0A 1NSNH 3HPLA 3OJVC 2VE6A 4KK9C 1JFQL 2AJYL 5B4MD 4F9PC 2HMIC 2BC4A 4MJ6A 1NCTA 3L5XL 2DYPD 1ETZA 5DQJA 2MQCA 1UWGH 3PP4H 1AP2B 5C0CB 5KVDH 3TBSA 1W8OA 1RPQA 2ICWJ 1I9IL 5HGBB 4AL8H 4XMLL 2AGJL 2BOBA 3CZJA 2GW5A 4Z95L 1WT5C 2B4CH 5HI4D 4RIRA 3SDDB 5SWSA 1SJXA 4CJ1A 5F1IA 1G0YR 1T0NB 2D7QA 1E4JA 3RVWD 2XZAH 4NQXA 1RUMH 3FJTA 5EUKB 4F57H 1Z3GL 3BN3B 4RFEB 1NBYB 3VFVB 3GGWB 3JV6A 2X4UA 2MQ3A 4JFXA 3B9KA 4PRPD 2YRPA 5DVNA 5ESQB 4LNRA 5LGHL 5A16B 4XCYA 2AK1L 2QSQA 4U1IA 1N3NB 1TTUA 3VDAA 2JCCA 1FZMA 4GOSA 5J1AB 3R06B 4NM8H 5GGRY 1OW0C 4QKXB 3V8OA 3AC0A 4GRLB 2YXMA 3PV6A 1SJVA 2GUOA 1RZIA 4TULL 4H1LB 3H6JA 4MNGB 3RWEB 4HLJA 3EIFA 3U2SB 4Z7VB 1LE5B 1NPUA 5DT1H 5B3NA 4ZUTB 2GITA 4ZPTB 3BT2L 2UY6A 1AR1C 1HILB 2DWEB 4YAQA 2OL3A 4YHIB 3BH9A 1J05A 1S7SB 1U8KB 1UB5B 4UT6L 4NN7B 4NQDE 2YA2A 4NQEB 5F7FA 4FXKA 3EJYC 5DMKA 1E4XH 4ORGA 2CIKB 1LP9B 4MAYB 3GJEA 1PY9A 2CLZA 5FKPB 1MCNA 4C56B 3KDMA 5DJYA 4J1UB 1KLUB 4NKOA 1T03H 4HWEH 3KYMA 1ITCA 2FRGP 2VJXA 4RGND 1T7ZA 3BPLB 1T1YB 4HMDA 1JPGB 2N56A 2Y72A 1GGCH 2P4AB 1F4XH 4OB5L 1J88A 3IDXL 4F9LC 4HWUA 2Y5TB 1FQ9C 5DA0B 1MCIA 3D2UD 1NDMB 3NAAH 5ETUB 3K4DA 1SMOA 4G5ZL 4LSPH 1U8MB 4BUHA 2VISB 3ZKMC 1CGWA 4PG9A 2WUBL 4A2MA 3DIFB 1I1AD 4HIEA 2NY0B 2NX5D 5DQDH 5I17B 2BVTA 4FQIH 2ARJA 3NTCH 4PREA 1REIA 3BD4A 1BEYH 5DK2A 2PYFA 5TDNA 4PY7B 1Z9LA 3NA4A 3REVA 4PRNA 4X5WA 1MLBB 1UQSB 4HUMB 4U1JB 3IT8D 4I48A 4ZO8A 1MHCA 1OLZA 1CLZL 1U8QB 1YEEL 1CT8A 1GVIA 1P7QD 5EC2B 1A3QA 1UA6H 2C4FU 5IEHA 4L8BA 3LKOB 1U8HB 1J7VR 4P3WA 5KVMC 4R97B 3VRIA 4LMQI 5I2IB 1MFAL 5GSRB 1JNHB 2FD6L 3B5HA 4XCFL 1EHNA 1LO2H 1PKOA 1YDPA 2DL2A 5IIEA 5EFIB 2QHRH 4XVSL 1EO5A 3O9WA 2BSSA 2X4TB 25C8L 4HULB 3HZVB 3FONA 5T1DH 2APVA 4P4KC 5L2KA 4X6DE 1DEDA 3SY0B 2W9LA 4IHOA 1QP1A 4ZAKC 5J8OA 1A6UL 4KUZL 1BJ1H 3ULVD 3QZWG 2R1YA 1NLBL 1U3ZA 1F58L 5F9AC 4MD4A 1P4BH 4I4WB 4UNUA 1KCRH 1BM3L 1QRND 5DJZB 4IS6A 4MXQD 3MZGB 5A1AA 5BXFB 3U46A 4BK5A 4IRSC 3BW9A 3LIZH 4MJIB 3DX7A 3N1QC 3TV3L 5J9PB 5EU7C 2BDNL 2F5BH 4K71B 2VAAB 3PWNA 4BH8B 2BVEA 2BNRA 4MXVE 5JIKA 1CICB 4KKCC 3E3QE 4YFEA 5J13C 3QFJB 4LQ1A 1I1FA 1KJVA 3CSYA 4PJ9D 1SBBA 4P9HH 3FQUB 4FTVE 3SGDI 4S1SL 1RJLB 1NAKH 4O00A 3VXSD 3QXWA 5C6PB 2OP4L 1KB5A 2AJXH 4L4VE 4WHDA 4GG6A 5I1KL 3BXNA 1EBPA 1JNNH 1OAUL 2BOCA 1TZHB 2F74A 2NQCA 3N9GL 5EU4A 3RIAK 5KVGL 3V0WL 2H9GA 1HI6A 4NSKA 2VDPH 3LQZB 1WTLA 3OKOA 4LLQA 5EU6D 2H6PA 1ZKAA 3O11A 4YHPA 1RVFL 1FVDB 5F7EH 4AT6B 4POYA 2BCKB 3ILQC 4TSCH 1EHLL 4P2RB 4OI7A 5HD8D 2R2HA 1TJGH 4XP4H 5TDOB 4XP6H 2D0HA 1ZEAH 3DVIA 3N1MC 1U8LB 4EUPB 3BH8B 3QB7C 4YK4B 5CEZH 2M2DA 5KBNC 5MEND 3IVKB 5DQ9B 1KENH 2DQJL 3QPXL 5L2KE 4M6ML 3STBA 5I1AB 5IBUB 5EORL 2HWZH 1F11A 4OI8A 1NGXB 4JO2L 4HBCL 1J1PL 4AQ1B 4NRZA 2E9WA 2GJ6A 4WTWA 1E4KA 1T0PB 2IQAB 4X99A 1G7PB 4KV5E 4Y5YB 3WFBL 2JK5A 1S5IL 5IEKB 4MJ5A 5DR5H 1N8ZB 4XP1L 4P3DB 1K6QH 5F7HA 3P4OB 3CCHA 3PGDA 4EDWH 4LPXA 2ZCLH 2RR3A 4JZJA 2FNBA 2D4FA 2ZUQB 1HKLH 3LD8C 4IRJD 4X0KB 2VXSL 1ZANH 3TC9A 2F8XC 1DQMH 3KAAA 1N7MH 4YXKL 1LVEA 4LCUA 3PIQB 2NZ9C 4LLWB 4IDLA 3TN0B 4PJDA 5MEQB 3RWFA 5F7YC 4EI5A 1CGYA 3RHWK 5I1JL