3A6CH

Crystal structure of hyhel-10 fv mutant ln92d complexed with hen egg white lysozyme
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
114
structure length
114
Chain Sequence
DVQLQESGPSLVKPSQTLSLTCSVTGDSITSDYWSWIRKFPGNRLEYMGYVSYSGSTYYNPSLKSRISITRDTSKNQYYLDLNSVTTEDTATYYCANWDGDYWGQGTLVTVSAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Contribution of asparagine residues to the stabilization of a proteinaceous antigen-antibody complex, HyHEL-10-hen egg white lysozyme
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/hydrolase
molecule keywords Lysozyme binding ig kappa chain V23-J2 region
total genus 30
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2009-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3a6cH00
5HI4D 2DN7A 3VXNA 1YNLL 4P3WA 1HQ4A 4X5LA 3T0EE 3C09B 3MNVA 5C8JA 2Z8WC 1MQKL 4LLVB 2CIIA 1XAUA 5DEGB 5L9DH 4LQFH 4YDIH 1F58L 2BY2A 5CEXB 4MD5A 1T66C 5J1AB 5AAWA 3U2SB 1JTPA 2JCCB 4O9HL 1X5XA 1MI5A 1R3JA 2XN9A 5FGCB 3KNBA 2EDJA 4HPYL 5DRWA 2UYLA 2E3VA 3I75A 5FA4B 2WP3O 5JW5A 2ITDB 1U8MB 4QRTB 4XI5C 3STZA 4EI5B 3TA3B 1OAKH 3N1PC 5C0GB 5HGBA 4P46B 2YOCA 3MJ7B 4YXKL 4P2QD 5TDPA 3FOLB 4LKCA 4JPWL 4YHML 4AM0A 4ONHA 1UM6H 2VLMD 1IT9L 1OTTD 5EIVA 1J10A 3QXTA 3V8CA 3AFLA 3DNKA 5I2IA 3LAFA 4NZRH 1ZT1A 1KCVL 4JQIH 2VLRE 3QI9A 4ZFOL 4O58L 1TCRA 3MRLB 1QYGL 3SJVD 2VDML 4HWBL 1HINL 4JM4H 4XBGA 3UTTB 2P1YA 3PWJA 5GGTL 3WFCL 4JQXC 5FYLH 3L3OB 3BJ91 2DI7A 4OCNC 1QO3A 1H9VA 3D18B 5HHNB 3FO1B 5FGBC 3VI4F 4N8VA 1IE5A 5ID0A 5SWSE 2BERA 2EKSB 4PY8J 4YHNA 5F96L 1HHKB 2XN9D 4OQTH 1RFDL 3T65B 5E6ID 1A6WH 4H88L 1PX3A 3Q5YA 4RDQG 3ARQA 2AXHA 3MUY1 3MFGB 5JA9A 4KDVA 2HRPH 2APTA 3HB3C 3DXAE 5GRUL 4G42A 2AJSL 4UDUB 4ETQB 4F9PA 1ZANH 1TDQA 3QEGH 2GAZB 4QKXB 1FNSH 3MJGX 5E9DA 4BQ9A 2AGJH 3JV5A 2WW8A 3L3IB 5BV7B 4H0IA 2Y23A 2Q87A 4X7TA 4OKDA 3Q6GH 4ZOCA 4Z0XB 2BOCB 3GIVA 4MCZB 2VDNL 5AWNL 7FABL 1YNKL 3IRZA 1MCHA 1N6VA 4XPBH 5AZ2H 5ID1A 4TVPD 3LQMA 3G9AB 4G7YH 3WFHB 1BZ9A 5DQJB 5KOMC 3MRCB 1DVFB 5HYSB 4V2CB 1E28B 3MACL 4DEPB 2DTMH 3V52H 3RX5A 4IOIB 2VSDA 2GSGA 3LRHA 4LSUH 1CDGA 2FRGP 5E0QA 3MOBL 2YD8A 3P73A 2X4UB 1CLZL 2D9CA 4JHAH 8FABB 4KVCH 2IGFH 3DGGA 5B4MC 3SGJC 1LNUB 4PB9H 2VL5A 3QFJA 1W0VB 1G7PB 1S8DB 4MAUL 5F9AC 3WUZA 4NRZB 2BSTB 5EU6E 3SPVA 1URLA 5HY9B 1YQVH 4PRID 1ZLSL 2UUDH 3TVMA 3RVXD 5SV3A 5HI3C 4JFFD 1C5BH 4AEFA 5IOPB 5T1DH 3EYQC 4ZNEE 2IBGA 3VWJA 1FVDB 5CEYA 4HS3B 3TWCL 3I6LD 3ZDXF 2VERN 1JN6B 3ARFA 3EYUL 4RAUA 4OZHA 3QA3B 1U8HA 3VJ6B 5DJAA 1U8JA 3L7EB 2GHWB 1C16B 1NMAH 1S9XA 5F6HJ 2W0KA 3IJYA 1UCBH 5D7JD 1S78D 5CIPH 4TVSa 3MV11 1A9BA 1MWAA 1U93A 4OZHE 4MHHG 4HGMA 1A8JH 5I1JH 4K8RD 4M6OH 5DFWH 3RIFF 2YEZA 4S1DD 2DQIL 4EDWL 4KU1A 5JO5A 4O2CB 4L4TB 3DV6A 3GMMB 1OP3K 3L1OH 3HE6A 2Y36H 3Q0HA 5GPRA 1HSBB 2BNQD 2HG5A 3QDJD 1Z0MA 2WWKO 3QHFH 1YMMD 4PJAE 5FUZH 4FXKB 2JIXD 4FTVE 4K2UH 1RZFL 1DQLL 1MI5E 3BIKB 4NKQB 5A16B 5HHMD 4P9HL 4CUCA 1KCKA 4Y19B 4OCWH 3KXFD 2OI9C 3QHZH 2WWKT 3P4MB 3FTGB 1MCOL 4PRPA 5IB2A 1UJ3A 4LFHG 5EORH 1OQOA 3GGWA 3HC3H 2NY3B 4MCYB 3ZE0E 1U2HA 1H3TA 3UAJD 1OB1B 5HHOD 5M7QA 3D5OF 3PDOA 2Q76A 1G6RA 4OZIF 3OXRB 5JHDE 5D72H 3ARRA 4ZFZA 1UGNA 1BLNB 3F58L 1AD9B 2RBLA 3ALWA 3G6JE 4XNMA 5GSVB 5M95B 2PCPB 1ZT4B 5ALBL 5B38A 1TVBB 5FUCC 2C3GA 3VI4E 2EIEA 3HNSL 3N1GC 4KRPC 4P3DB 4RFEA 1WFNA 5DT1L 5F9WC 2JJTC 4X6DB 1Y6KR 4M8QA 5K9QI 4LRNL 1UXWB 4PGCB 1A1NB 5I8OH 4Y5YB 4YHOH 4PJ7F 5F44A 4U1KB 1LO3L 2YWYA 4MJ4A 4RA3A 3CVHH 1OD9A 4KMQA 2E8YA 4KUZL 2F19H 4JDZB 1DQQB 4Z0XA 3F7YB 3BGMB 3WEXB 2AK4D 3D3VD 3P0GB 4M02A 4HLZG 3WSQH 3Q5OA 5GS1C 1OAXH 4DKEL 2CK0L 3AMKA 4X6CA 2YD7A 1OGAA 3ILPA 3R06B 4TRPL 4GT7A 2QR0A 2QSVA 3IDYB 3UTZB 1QFUH 1ZV5A 1JMXA 2O26U 3GKWH 1QFWI 3QXAB 4L8DA 4ORGA 4Y5XA 3ARGB 4Y5XC 3UTQB 3OPZL 3BQUC 5FOBB 3WSQL 4LKXB 3A67H 3T09A 1S7QA 4GG8A 1S7XA 5I18L 4PJIB 5MP6L 4JB9L 1MRDH 2AV1A 2R0ZH 2ZG1A 4HWBA 4FMFA 1FNGB 1TXKA 4J3XA 3PWLB 3RHWF 1FO0H 3WLBB 2UUDK 4LAQH 2O93L 1E27B 4K3GA 4Z5RB 3H8NA 2FEEI 4Z7OE 3VXTB 2A1WL 5HVHB 4L29A 1KTKE 1DUZA 2MQ0A 5JORA 2W0LA 4NO5B 5DD6B 3BPCA 1CR9H 1G7LA 4HH8A 5FKAB 2A6JB 4F80A 5KSBF 2BHZA 1IGCL 1X5IA 3L3JA 4JLRB 1NCWL 4LEOA 1Q9WB 2R39A 4QHKI 3VRIA 4NQVA 3MMEA 3KGRA 1HKLH 4U4BA 3TBTB 5FYJL 5IWLA 1BFOB 1MF2L 5I30L 4KROB 4NNYA 3L7EA 5C0JA 2J6EH 1HHJB 5I1CH 5CINH 1W0YT 3EOBB 2E6QA 3ET9F 4ZSOE 3A6CL 1ZKAA 5D2NA 3X12A 3EO0B 2QHLA 4OZGB 4X4ME 1ZGLP 3X3GH 5CFHA 4RMQA 2BFVL 2WINB 1T1XA 5K9JL 4OUOA 5DJYA 1PG7H 3GJEB 5J56B 1SVZA 4NUJA 4RQQB 3V5KA 1HSBA 4PBWD 3WV0A 2I5YL 2CSPA 3VXSE 3RP1A 2R4SH 4F15C 3LB6D 5JIPA 2FX7L 2W38A 1DQDL 5D5ME 3WXVL 5FIEA 2AXJA 4PUBH 4KZEL 5GQBA 1MCCA 4G8FA 5EULV 1N59A 3BEWB 4NIKB 5LKNA 5E6IB 3HNSH 3IYLW 4QRPA 2BSSA 2YXMA 4FFYH 2BDNH 1GOGA 3CFJB 4H20L 4JO1L 2HFGL 5HDQL 4EI5C 2Z31B 1RJYA 4E5XB 1CLYH 1VGKA 1LP9A 2EEBA 1YPZB 3QQ4B 4GW4B 4OGXL 2PXYC 2R15A 1FIGH 1VEPA 3EOAA 2DQFB 1QVOA 2VNCA 1G7JB 1CXLA 2GKIA 3U0TA 2NCMA 1JF1A 5IQ7H 1P6AB 4NQCB 2FEEL 3V4UL 1S7RA 4EQ3A 1NCAL 1N2RA 3CMOH 3QNZB 1JV5A 2O5ZH 3GSUB 4G9FA 2ZJSH 1V7NL 2YPVL 4PTTB 2A73B 4I9WD 3F12B 1TZHB 2APFA 4P5TC 2R1YB 2DQDL 3G6JB 2VXVH 2VXQL 2X4QA 1ONQA 3QIBD 3MUGA 2VLJE 4JKPH 5DJXA 4LHQB 4KJQC 2VDLH 3G5ZA 2XY1A 3ZTNL 5C0CD 1N5AB 1VPOL 1PEZA 2UVEA 1ZT7A 3BZ4B 4FQ2H 1QHPA 3FB6B 4UNUA 5EU5B 4NWTH 4PJ9A 43C9B 1T03L 2CLRB 3VRJA 1GZQB 1UH3A 4X4XB 1QRNA 5DJ6A 3KHOA 5F1NA 5GRJH 4TNWF 2IADB 4OD3H 1OP5H 4YR6A 5C6TH 1MUJB 4GMSH 5GHWL 3VD7A 3CSPA 5T3XH 4DCQA 3VXMB 1PDKA 1BVKA 2NTSP 5DI8B 3NBNA 1LO0L 1UKTA 5CMAA 4OD2B 5F6IB 4N5ED 3FB5A 5K9OB 1F42A 1JZ2A 4MX7B 3U0WH 5LGJB 4YPGB 2ITCB 4PY8I 3ZE1F 2I27N 4HSQA 1CK0L 2AJUH 3FONB 2XACC 3DROB 2F53D 3JBG7 2P42B 4WI3A 5E2WH 5CZXD 3L95B 3TZVA 4YBHA 3T77A 3I3DA 5F88B 2V5YA 1CFTB 4KKNA 4U1SB 4NN6B 5C0DA 1A0QL 1P7QA 3QDJE 3FT2B 3ULVF 3P77B 5B8CC 1C5CL 5I1KL 5ENWA 1CICC 4KJWD 3U4AA 4LHUG 4IIQB 4LLDB 2BFVH 5C0IB 5BV7L 4XC3H 5E8EA 1CL7L 4M6NL 4XWOD 1MLCA 5GIRB 4EN3A 5EUOF 5J3HC 3QO1B 3MRMB 1G6RH 5HHOE 1H15B 1BFOA 3QIUC 1JZ6A 4KGLA 2XT1B 1CYGA 2YBRA 1CGVA 4QLRA 3IDXH 5HI4C 1E0OB 2H26A 3OJ2C 4TNWK 3LVEA 4RWYH 1KJVA 3FHQA 1EAJA 2WUCL 4JG0H 3B5GA 2FATH 4MYWB 3MRHA 3U9PL 1S3KH 4PTUA 3KPPA 4WWKD 4DTGH 1T04B 4CL7A 1GZPA 3UTSA 3VGHA 1DE4A 3BXNA 1TTFA 4RWHA 4YDJA 4Q9RH 1JHLL 2EECA 4MAYB 4NBZB 2X41A 2XQYK 4FQLH 1YN7A 3INUL 4OIBA 4ONFL 4HJGB 2ZNWA 3U0PB 5TDOA 1Q9OB 1KIPA 1MIML 1G9ML 2HH0L 1GGYA 4PJFB 1Y0LB 2M26A 2VXSL 3V5HA 1KFAL 5C7XH 5CP7A 4KV5F 5MHSE 1DP0A 3JXAA 1LEGB 5EBMA 3TCLA 4KK8D 1KT2A 3HAEH 5DSCA 4OZIE 5EZIL 5EDXA 1CG9A 2HLAA 1U58B 1KG0B 2CUMA 1VGEH 1INEH 3VCLB 4U2ZA 1W72B 4UT6H 2ZUQB 4HIIB 5DC9B 2CKBA 3LRSA 4L5FH 4HV8B 2C1OA 5D1ZB 5ERWB 2RCSL 5TFSH 1WITA 1FG2A 2BK8A 4PBXA 1UZ6E 5AD0B 3MJ8B 3CFEA 5D6DC 1BQHG 5ESAA 3C5ZB 4OCXH 5BVJB 1FCCA 4WRLA 5EOQL 3PV6A 1MELA 1OHQA 2I9LB 5SWZA 4J4PD 3QCTH 3QRGH 3BKCL 4ESKA 1OSPL 1TENA 3SDCB 2R8SL 4LPXA 5IVXF 5HYQB 3GMRA 1YNTA 2D7NA 4PY7A 1WVZA 1BOGA 2LE9A 4JVPA 4GSDL 4U1GC 1E4KA 5CLTA 4F57L 4JAMB 4TUOB 1QSVA 1AE6H 3B3IB 3U83A 3RJDA 2DM4A 2NXZC 3SBWA 3QDMA 5E5MA 1NBVH 3BHBB 3LEXA 4JZJB 1AH1A 4JRYA 1NGWB 1RJZB 2ZKHL 4LARL 4GRMA 3UZVB 1IAIM 2IPUG 3FONA 1H5BB 1K4DB 4M7ZB 3WDJA 5SX4I 1KJ2B 1IJ9A 1YMHB 4N9GA 3VFTB 3TZVB 3DUUB 3FMGH 5I0DA 3LD8B 4JFDB 3KYMA 1A5FL 3OR7B 4S1SL 2EEDA 4R9HA 3ZTJG 3MLWH 4QCIA 15C8L 2JLLA 5EBWB 5GS3A 5CIPB 4G8IA 4C56A 2OTUB 1UQSB 1BEYL 3MLYH 1FYHB 2OP4L 3HS0B 2QKIA 4LCWD 4FXGA 4KK5C 5I8OL 4GUPB 4IDLA 5CCKL 1A6UH 1HHHB 3OB8A 4KQ3H 1NBVL 2EDXA 2GJ6E 3BWUC 3L3OA 4JO4L 3VXME 2EYTA 4EN3D 5AG8A 4RRPA 3VFRB 1QR4A 2GTWA 4EVNB 2VKWA 4K7PY 4JPKH 1RIHL 2C3VA 2I60H 4FMKA 5E8DH 1KN4H 4NQDA 3B43A 2W9EL 3JSSA 1F45A 3TPUA 1E6OH 3LKSA 1EBPA 4DOHE 1T2QH 5C08A 3HHRB 4U1MB 1DVFC 4HF5L 4A2MA 1FC1A 4XPFH 4YHPA 5B39A 3L3DA 5FA3A 2HWZH 4JPKL 1UFUA 4PYHA 4KY1H 4AMKL 1MVFA 3TIDB 3QYCA 3QCUH 3QHZL 1SMOA 4AIOA 4XMPL 4TRPH 4U6XA 4KQ3L 2BVQB 4QXUL 1I9RL 5IT2H 4HCRL 4JFEE 1BP3B 1EFXD 1P4LA 2JB6A 2DLFL 3OB0H 4OV5B 2VMFA 2VR4A 1FFPA 4LSVL 2ICEB 3U30C 1SY6L 5BV7C 4P2CG 4TUKH 1XZ0B 4E9LA 1HEZA 3HRZA 5ISZA 1P1ZB 5A2KH 2CLZA 5CSBA 1YMMB 4TOYL 4YEEA 1X5KA 3P2TA 4XVUD 1JPTL 1NH6A 3UZQA 1V3JA 2NY5C 2W9EH 2ZCLL 3P9WB 5D7JB 2IBBA 2LV4A 3VFPB 3L7FA 2WBJA 4DK3A 1H3PH 4ZPVA 5C0FB 3HR5B 5BRZA 2EE3A 2HFFB 4QOKE 3IXAA 1A7QH 3U82B 2KKQA 5C0CA 5LCVL 4HFWA 3VFNB 1A7OL 1J1XL 4QY8A 5DHYB 1FH5H 4AT6B 4OCLC 1JGUH 5HYSG 1PG7L 4QRRB 1OLZA 2ZUUA 3D9AL 2Y7QA 1BIIB 4W68A 4JFOB 4I8DA 3RZCB 3SKNB 3S34L 4CDHA 3T2NH 2X6MA 3GMRB 5FK9B 4F7PB 3FOMA 5F89A 5EO9B 4P9MH 5C09B 5B3NA 4WEUD 1F3RB 3VXQB 1UEMA 1BVLA 3OHXA 3EDDA 4LCIH 1HCVA 4MNHB 1FYTA 4PRHA 1K5NB 5C08E 1CXEA 4MD4B 5D70L 2X4TA 5EN2A 3BH8A 4HX1B 1NBZB 2HT4C 4Y8DC 4WHYG 1W8NA 3SEPA 3DMMB 1H5BA 1K4DA 3B2VH 4Q6YA 4LGRB 3T08A 4E41D 4R90H 1QYGH 2R29H 2P5WE 3SO3C 3LQAH 4XVJH 4ZTPL 2CQVA 4JFEA 4FTVB 1NUGA 1S9YA 3QEQA 1JRHH 4NSKA 1FNHA 3GB7B 4ONGH 4RX4A 3SDAC 3G5YB 4FXKA 3BT2L 1A14L 1KCLA 1AP2B 2OL3L 3A0OA 3RVUD 5CGMA 4LSPH 2VO5A 4DW2H 3CGTA 5CHNB 3GJFH 3RVVD 1QRNE 2YMXL 5HHPA 4FFWD 4U1IA 1HHIB 2OBGA 3C8DA 4QHLB 4Y4KA 5MHSD 2NR6C 1RZ7H 5FM5O 5IIEA 1DL7H 5IB1B 2FO4A 1CD1A 1JGEA 3RWGA 2AXGA 1UB6B 3X3GL 5CD3A 2DJ4A 5DUMH 2H2SD 2N4IA 1OPGH 2HVKB 3D2UA 4RMVA 4E41A 2PCPA 2JCCF 3AREC 1TPXB 3DVGA 3H9SB 5EUKB 5D93C 1YEHL 1MFNA 1MJUH 1NFIB 4I3RH 1TVHB 2YPKA 5IUSA 4PD4J 5I1HL 5E99L 5FDWB 4EZMA 1T7VA 5E94A 3C5SB 4NPYA 4HUXB 3UTOA 3IFLL 2IMMA 1A6PA 3LN4A 4IJ3B 2A0LC 2OTWA 4MS8D 4Y1AA 3TM6A 4JDZA 4MXVE 4AL8H 2DYPB 2X4SA 1EVTC 2G5RA 1JF5A 1I7TB 2GUOB 1BQLL 5D7LB 1ACZA 2ARJA 4GXUN 1BAFL 3QWRA 2H45A 1DN0A 3MV7E 4DKFL 2F15A 5HGAA 3D85D 5LG1A 5FHAH 1TZIB 1UWEL 5KSBA 1YDPB 2B1AL 3WHXA 5JW3H 4NP4H 4PD4K 1FL3A 3IXAB 3VA2C 4HKZB 4EI5D 1Z3GL 3F65A 2ATPB 4WEMB 4ENEC 1RULL 2VITB 5C0AD 7CGTA 3RL2B 4EI6A 4L4VA 4OGAD 5CSGA 3P4NB 3H3KA 5C07D 3AY4C 2R4SL 4DKEH 4Z95H 4TVPH 5DJ2A 5EPMB 5IEHB 4ERSL 1U8OA 4HEPG 3PDGA 3U79A 4G6AC 4WV1B 2D0GA 1U6AL 4ODVH 1F02I 5E6ZA 3QXUA 4HHAB 2P24A 1ZWIB 3C60D 5GGVH 1EJOH 3D39E 3RGHA 2WANA 4PJFF 3QIBC 3HMXL 5A43C 1UG9A 3B2UD 1FVEB 5MENE 3V6FB 4YPJA 4L9LB 4M1CD 2Z31D 4L1HA 2EYRB 1TQCB 2E8ZA 4NGHH 3O4OC 1GH7A 3CVHL 1UEYA 3QIWB 2HJLA 4MJID 4RGND 4AIXA 2GK2A 5DEFB 5T1MB 1H3XA 3PGCB 3T0XA 5JOEA 5F9JA 1X44A 4Q7DA 5ICYB 3GBLA 5D7LD 1RUQH 5F7WC 5LWYL 1X5GA 5KSAC 1GPOL 3CD4A 2IALA 4PRNA 1XGTB 3HLAB 3TNMB 3D85B 3B9VA 4TULH 1YEFL 1OAZL 1UM5H 1LDSA 2E27L 3PWNB 4HEME 4XPTH 4PJXB 4TNVK 1FNFA 3SDXF 4FQ2L 2FBJH 3QISA 3C60A 2FIKB 2ICWB 1D5IL 1EAPB 3TC9A 1VFBB 2OM5A 5E00A 1J5OH 1QSFB 3V6OA 3W9EA 4HK3J 1OD7A 5BVPH 1NMCB 5I18H 3K4ZA 1HI6A 2DIBA 2QADC 4GH7B 1T22B 2CUIA 2ED8A 3ZDYE 1CTOA 3O6ML 4KROD 2X4OA 1EHAA 3ZMRA 4NQEA 1LP9B 3PGDA 4XP9H 2DF3A 3IFPB 4GAJH 4GW4A 3KPMB 4JCMA 3FFCA 2MNUA 5GGUB 5C92A 2H32B 12E8H 2W65A 3L3KB 5TF1H 4M3KB 3N50A 4KUCD 1A4KB 1QLEL 1U92A 4HD9A 4LVNC 2AXGB 4WNQB 3PP3K 5FECB 3BUYB 4KHTH 5F1IB 1OP9A 3M17A 3MCLL 1CLOL 2IH3A 2ICES 4QOKD 5FM8A 3SY0A 1MAMH 2VZ3A 1NCWH 1NGZB 3EDEA 4LSQL 5F9OL 5ICZB 2RR3A 1GAFL 3OKKA 1CGSH 1EXUA 1U3HA 1G7MB 4JRYD 5L0QB 3V4PH 3T0VA 1FL6A 5DTFB 1R5VA 2VIRA 3I6GA 4QRPD 5HXMA 4ODUB 1WEJH 3LKQB 2J8HA 3IDGB 4HZLB 4PJCF 2B1AH 4MA7H 5FHBH 3NZ8B 1OARH 5E08L 4PJ7B 4LSQH 3DX9A 3BO8B 2NY5L 1O7VA 5DUBB 3DYMA 1SJEB 4P5TD 5J6HB 2V17L 4K07A 3O3UN 1NDGB 4L8SC 4RNRB 1NAMB 2PW1A 3VD5A 1OAYH 1CIUA 1ZA3A 5GZNC 1R3HB 3GSQB 5LCVH 5TE4H 4LU5H 4OCWL 4MA7L 2WMPA 4YR6B 3CZFB 1UYWL 2LVCA 3O3EA 3VFUA 1I9JL 3TZVC 3MV7B 3TV3L 5KSBB 5E56A 4DVRL 5JXED 3U9UA 1BOYA 4X6FA 2X2YA 5GGSY 1B0RA 1IAKA 3O9WC 3BPOB 4FQ1L 1IQDB 5GS1B 3TO4D 3MCKB 1PZUB 1NFDB 4M61B 3TO2A 3QUKA 4D0BB 4IMLB 1RU9H 2JJVA 3BP5A 2IPKA 4X5XA 1JNJA 3DRTA 3ALPA 3MRIA 1IEHA 1KJ2H 3SCMA 1GGBH 2Q8BL 3V6ZB 5IVZA 1OAYL 1G9MH 2HH0H 4IJ3C 4KRMB 4KY1L 4LGPB 4PRAA 4WUUE 3O0RL 4YDVA 1S7SA 4JO2L 4ZUTA 4HULB 4M4RA 2W0FA 5C8JB 3PIQA 1GGUA 1YUHB 1WFUA 3AU1B 3VXRD 4HMDA 1NBYA 2OYPA 4FZ8L 2YBRB 3HA0A 4Y19D 4J1UA 5L88H 3QUXD 3TVMC 3PWUA 1B3JA 4GBXC 3UTTE 3T0EB 3W9DA 2FX7H 1QFUL 3SDXB 1M05B 4E42B 1ZK9A 1S7TB 4QRTA 3TA3A 3G9VA 2QQLL 4ODHH 3P30L 2JJSC 1QLRB 2B7DT 4ZO6A 3JV6B 1C7TA 4X9GA 3QDGA 2XKNA 3KPLA 3B9KD 3OG4B 4R3SA 4RGOH 4HUUB 4PJ7E 3O3BA 1T4KB 3LH2L 4PJXE 4OUUA 1FVCA 2P5WB 4R4BA 4Y2OA 3NA9L 1IC7L 4K8RH 2O5ZL 1VESA 2NX5E 3REVA 2YN5A 4LU5L 3QNYB 2X4OB 1AKJA 1IGFH 3OX8B 3GUTB 1M6OA 1N6QH 3DOSA 3DTXB 5IF0A 2ZUVA 5GGUA 1FL5A 1J86A 1ZE3C 5I0ZA 3QUYD 1FGVH 1UACH 2B1HH 1U92B 1Q0XL 3L9RA 4QXGH 1WIPA 2VZTA 2FJFA 4CKVX 3D87B 1DLFH 3UYPA 1I4FB 2NY1B 2FBJL 1PGRB 3WS3B 4PRPE 5ACZB 1CS6A 1CFNB 3EYVB 4PJIF 2UWEB 4BZ2H 4UU9B 3BOVA 1T83A 1MPAH 2DB8A 1G7MA 3WNMA 3ZL4L 3FQTA 5C0AE 2K9UA 4GXVH 3Q48A 4MZ3A 3W39A 1DBMH 1F6AB 3OKEB 3K7UA 2MHAA 3S88L 2AJVH 3SDAA 4G8GE 1I1YB 3PV6B 5DGQA 3A6OA 4EJ1C 1KLUA 2J8UA 5C1MB 3S36L 1KSRA 3KYKL 4P3CL 4FP8L 3ARWA 2APVA 1RY7B 3MXWL 2R0ZL 2BRRH 2WUBH 1DVFD 1DBKL 2WWMC 4NQUA 4PY7B 3OAUH 3HAEB 4FQIH 1AXTH 3VD3A 3IJSB 1TZGL 1RZ7L 4R97B 4LVHB 3NIGF 4GKSB 3VH8B 1KTRL 1FZKA 2XZAH 4W4OC 1VCAA 1XCQB 4J4PC 5DD3H 4RGNE 5E7FA 2LABA 1KEGL 1UVQB 1U6AH 4ODVL 5T1LB 3UEZA 4WU5B 4PJAA 4PJ5E 3F6IA 1FE8H 4JFHE 5C09E 5I8EB 5E4EB 1KIUA 3VFVB 4JQIL 3P73B 1KTDA 4I48B 3BZDA 1LDPH 3MZGB 1C12A 4WGWB 3EGSB 2X9YA 3DRTB 1WWAX 3DSFH 4JG1H 4XMLL 4EKXA 1NCNA 3BQUA 3OV6A 5KJRL 5E7BA 3V6ZA 3D0LA 3VFGL 2A9NL 2V7HA 4QRRE 4HWEL 4NGHL 4N0CC 5E8OA 2F8VA 4YE4L 3HS0A 5F9OH 4QRQB 5CP3H 4PJGA 4Q9BA 4CMMA 1S7VA 4NO2A 2IPTL 3BEVB 4QXWA 2EC9T 2VQTA 5JW4R 1S5IL 4PJDB 5L2JB 4Q6IC 2DL9A 4LLMB 3CLFH 4Q97A 1BWMA 4X6EB 5DHVB 1VFOA 4G6MH 4PLJD 5ESVA 2EO9A 2I25N 4HS3A 5FF6B 3WFZA 2R9HD 1XEDA 4RISL 1SEQL 3KPTA 3KLSA 32C2B 5HGDA 4J1UB 5C6PB 5C0EA 4QNPE 4NO0B 3KLAA 4MQ7A 4Q58C 5CUSH 4XGZB 3QDMD 4PJIE 5J6GA 4C59B 2VOTA 2UWEE 3QEHB 1MSPA 1SEQH 4JR9H 2VR9A 2VLME 4OZFA 1HXMB 1YY8B 4S1QH 5TH2A 7FABH 4JANA 4FQXB 2IFFH 4NOBA 2F5AL 2X1WL 1NAMH 5CJ8A 2DD8L 1MFBH 3ARSA 1HCFX 4L4TA 4ZNEA 4ODTL 3K8LA 1G7IA 5D7IE 5F9WB 3SGDH 1Z5LB 2VDPH 3OKLA 4QRSA 1A0QH 1AO7D 3BKMH 4NHUB 2EDEA 4JE4B 3HG1D 3EZ8A 4PYGA 3MRQB 5E6IC 5H8DA 5DYOA 4GAFB 3LQZA 5HDLA 3FRUB 4PJ5A 4NKDA 4W6WB 3UZEA 4AIZB 2DD8H 5SWQB 5D93B 2XN9E 2VZVA 1NC2D 2Z92B 4OLYL 2P43B 3MV9B 3TJEL 4G80B 3TFKD 2Z8VC 2Z8SA 3ARBB 4HUWB 1JGVL 4YAQA 5I1AA 2H8PB 5AUMB 3O4LD 2FHBA 3QJHB 4R2GD 4H25A 4BUHA 1D9KA 1LK2A 2AQ3A 3DARA 3NPSB 4N0YL 5IHZB 1BHGA 5JLZB 5E99H 1QBAA 1ROWA 4KK9D 5HHOA 1EA9C 1RUPH 5GRZA 2BMKB 4XNUH 3MYZA 4XVUC 1N8ZB 3MLTA 3PABB 1IM3B 4IOFC 4HPYH 5D2LE 1NCCH 2DLEA 3C08L 3MA9H 3DXAA 4YHKH 3OQ3B 1JGLL 3BRFA 4U1KA 1F4AA 3PF2A 4LVNB 3GMQA 4YE4H 1A3QA 3X3FL 1QKZL 2EE2A 5HPMB 3OKMB 5DA4A 4MNQA 1NGXB 3KPSA 2EDDA 1H0DB 1EEYA 1G7QA 1XF5B 2ZNXA 5TJWK 3LN5A 1A3RL 1IRAY 1PSKL 3CU7A 3VXRE 3M45A 1INQA 4JPIA 3VDAA 3HI6H 3G6AB 4JZNA 4P23B 3ROLA 4EEEA 3OJMB 4Z7NE 1OSZA 1OGAD 1J1PL 1L6XA 2A6DA 1BBJA 1OF2A 5C71A 2COQA 1A1OA 2C3XA 1EFQA 1ZTXL 1NFDE 4OCYL 2ADFH 2XWBB 4JY6B 4AEHL 1HZHL 4LPTA 4Y16B 1LEIB 1XR8A 4R2GB 3PNWA 3DBXB 4RZCB 5HD8D 2HJKB 5D2NC 1UKSA 4XH2A 1ZHNB 5I19H 2WIIB 5GGVL 3GIZH 2OL3A 1BQSA 1NCDH 5LQBL 5ECJE 4MQXC 3R0NA 5DZLA 2H32H 1WEJL 4NQSA 1FIEA 1CDJA 5DURB 3BAEL 5E2UL 3BPCB 2B5IB 4FQQA 3N85H 3MRBA 3K2UL 1G6RL 3FFDA 3BP7A 4UV4H 2GQHA 2NX5D 1X4YA 5HHPB 3MV8E 4J3TA 1KB5H 2X40A 4LIQL 4Y4FA 1QA9A 3HZMB 4GW5B 4U6HA 5CZKA 3JTTA 2DTSA 5K9QG 5C9JB 2BNQA 1FN4A 2AABL 3VH8G 4S1DC 1MVUB 1CIDA 1D5MB 1TCMA 4KXZI 2X4UA 3C60C 3KLAB 4PRPD 1C08B 3QCUL 5IBLD 4X8JA 1QP1A 2NTFA 5E1AB 3LKNA 3T2QA 4LSPL 5ISZE 4RMTA 1JZ8A 1U95A 3BH9B 4P57B 3T0EC 1TVDA 1YMME 2ED7A 3MGOB 5JW4Q 4PJBA 2YD5A 4FTVD 4N9OB 4R8WH 4GAGH 2ZCHH 4QTIH 2DWDB 1I3VA 5EO0B 4XP1L 4JZOB 4G6JL 4POUB 2A6IA 3ME0A 1DBJL 5I6XB 1OOAA 3RX8A 1TITA 5TE7L 5F70A 4LDOB 1LVEA 4RBPH 3SQOL 1LDPL 4ZUUA 3RBSA 2UVFA 3RWJB 3VGGA 1UADC 1YEGH 3TBSA 1BF2A 1IKNC 1AD0A 2JJSA 5D7LA 1KLGB 1R3IL 4OLZL 1MJ7H 3SO5A 2ICWJ 3BDBA 5ADOL 2FX9H 4O9HH 3RA7L 4G9FE 5DDHA 1YDPA 3WHXB 4Z0BL 5TFSL 5F3BA 4JY5L 4OLVL 5D9SA 2B2XL 1FCGA 2VDKH 3TYGH 3SHSA 1FGNL 4JGMA 4HBCH 1MEXH 1XF4A 4Z7NF 4FZ8H 5JPNA 2W60A 4Q0XL 3BD5A 2D9QB 5IG7B 3MV8B 3CC5B 3ARGD 2E7HA 1VA9A 4X7EC 4NJAH 1FAIH 5A3IC 1EZVY 1C1EH 3FFCD 2R4RL 5B8CA 5I15L 2IAMB 5IQ7L 3HZKB 4YHMH 3D3VE 2CDGA 2IANE 3C5JB 3T0BA 4WTZG 4D0CB 5HVWA 4OM0H 4BFIB 4LCCB 2VXSH 3PJSA 4HS6A 4CADA 5J06A 1TJHH 1FLTX 1B0GA 3SDYL 3X14A 3G5XB 2XOTA 3BQUD 1PFCA 3Q1SH 4QOKA 4GQ9H 3QIWC 1A02N 3IXTB 1MFBL 5J9PB 3QWOB 4R90L 2VDQH 4PG2A 2HJFA 4G6AD 4WFFE 4PGZA 2EIZB 1SYVA 1XGRA 3U2SA 1TVBA 4X4MA 4JB9H 2VE6A 3CZJA 4X6BA 1UACL 2B1HL 1QBML 4Y4HC 3PGCA 4WFHD 4NRYA 2VLKB 5D8JL 5DMJB 2YD3A 2PTTB 3IS1X 4YPGA 3DX6A 1D6EB 3SQBA 2D31B 1JTOA 2HN7B 4JHBA 3DO7A 2Z31C 4P5TA 3IS0X 5TDPB 1PBYA 3P4OA 5JW4M 2XTJB 3NABL 2XTLA 1T3FA 1X7QB 3RUGB 3L3HA 5T33L 2FIKA 2NY5H 1FFOA 5EBGA 1AO7E 1T2QL 2YPLD 3SGEI 2ZUWA 2XWJA 3RWEB 1XCTB 4JM2A 2VUOA 3MBED 3C9NA 3MRPB 3HZMA 1MIEL 3AAZA 3JTTB 1QBMH 1SBBA 3QO1A 4ODXA 4OZ4A 5I71B 5J89A 1IEBA 1U91B 3SKUD 5GS0L 5EU4A 1KB9J 2BP3A 3GM8A 5I19L 1MRCH 4S0TD 4XWGH 3I6KB 3IDMB 3IAPA 4MDIB 2ID5A 2PYEB 1A7PL 4WU7B 3INUH 2AV7B 1NGZA 3PWLA 2FR4A 1KN2L 1GGIL 3UTSE 4NQED 2Q1EA 5I76B 1JIBA 4YDKL 2VXTH 3QPXL 1T04A 3C6LA 3MGOA 1JTTA 4QXGL 1VENA 1DE4B 2XG5A 3RY5A 6CGTA 2HA1A 4K9EC 4HKXB 4U1LA 2A6JA 3L5IA 3MR9A 1MCLA 4LEOB 3GKZA 3WLWD 3P9LB 1FZOA 2DICA 1R5IB 4TTDC 4H5SB 1SJEA 5J6HA 3FO9A 4IRZH 3NCBB 3TBTA 4Q6IA 3QIUA 1CQYA 1WK0A 2DMBA 1M71B 1E4WL 3GSQA 3ECBB 3OL2A 4XTRC 5MERA 3U30B 1A6ZB 2C7UB 4K3EL 3DUSA 2R0WH 5AZEL 2X4RB 5T5FL 4CNIA 5KSAA 4L8SB 4LBEA 5JR1L 4TYUA 4NUGH 4QYOA 2ZOLB 1KT2B 2E6JA 4LCYB 4QHMA 3VFUB 4QHUA 4XVTH 5E2UH 2NY1C 5ALBH 4U6VL 1IGTB 3WUWG 2OR7A 4KI5F 5DJYB 3QG6A 3CFKA 3GJEA 5JDSB 1PKOA 1UB5B 1AHWA 5GZND 1HK6A 2FYYA 1L7TH 2H9GA 1QSEB 3MRKA 3MCKA 3C6SB 4J2XA 3H9SE 4TQEL 3RPKA 3F7VA 4WJ5A 4ZFGH 4MB3A 4GRLB 1X5ZA 4WO4A 3KXFA 1KEGH 3KLDA 4OB5L 4UTBH 3BWAA 1S8DA 2IMNA 3O9WD 3VFOB 3VI3E 4MAYC 4JKWA 1RJYB 5DK3A 5BS0B 4YDLB 3CH1A 1J8HD 3SE3C 2W07A 3V4PL 1MEXL 2W0FB 3MV8D 2WUCH 3D2UD 5MEQB 5ANMA 2DQFA 4JDVB 4NYLA 4I2XB 3U46B 4J3VA 3EJJX 4Y89A 1JF1B 3I3EA 2BNRA 2WV3A 3LKOB 4F7EA 3BDYL 2GSIA 5DRNB 3TO4A 4NKIH 1Q1JH 3IU3B 4MSWB 1ACYL 4N90E 3DVNA 1HNGA 1UCBL 3V0AC 3DJ9A 4ZOBA 1EX0A 1ZHKA 3SKMA 3IJYB 1IGJB 3GBNL 1ONQB 4IDJH 5KAQG 1MIMH 4FOMA 1GHFL 4UV4L 1H5BC 2IF7A 4HW6A 2AXFA 4GQ9L 3T2PA 3QDGB 3GMLA 3GO1L 1DN2A 1HQ4B 2NLJB 3QQ3B 2OTUA 1OCWL 2HFEB 4L4TE 3ZLQC 1T4KA 5D1XC 1X5AA 3G04A 5F1NB 3MOAH 1FORL 3ES6A 1FIGL 2H3NB 1YA5A 1H8OA 3QPXH 3OJVC 1UWGL 4FNLH 4JRWA 3KWWB 3LEVH 3QDAA 4BFBD 2YRLA 3IDXL 1FAIL 3GSXB 1BFTA 4X9FA 1I3RA 3CFDB 4P4RA 2CK0H 3VFRA 3MRJA 1GHFH 4UTAH 1RI8A 3HI6L 3I6KA 1EHLL 3QUZA 5C0NC 2FR4B 5GJTH 3EYOB 3OGCB 4OQ1A 1RFDH 1A6WL 3LH2H 4KTDL 4NFDA 4K55A 5F9DC 2FGZA 3OXSA 1GOFA 2OMBA 2ZOKA 5BO1H 3KDMB 4CVWA 3QUYA 5F93C 5TGBB 3QUYC 2DS4A 5DJZB 1GSMA 5FO9A 3SJVB 3LKPA 1EHLH 4ZD3H 3W5NA 2VDNH 1DQJB 5AWNH 3CSGA 1RURH 3BE1L 3L3GB 5I73B 2M8XA 4U33A 4LNRA 4XBGB 2XA8L 2G5BA 4ZUVB 4M8VA 1S7WA 3S4SB 5E2JA 3DX7A 4AH2B 4BSVA 4OD1H 4HKJA 3BZEA 1FJ1A 5FUCE 4UAOB 2HAZA 1UM6L 3HAEA 4MHHI 4PJAF 4HJJL 4MXQD 3PP4L 4HUVB 1ZHBB 2WQ8A 4LAQL 2DQUL 3CXHJ 2IBZY 5ALCL 3R06A 1CDUA 1CGYA 1OGAB 3REWA 4JFYB 3EAKA 5AG9A 1XGUB 3A67L 3IDNB 5I8KH 2DQCL 1HOCB 4K2UL 4NN5C 5DJ0B 3O0RH 1K3IA 3NGBC 3MA7B 4BA8A 1OTSD 4GG8B 3BKCH 3WNNA 2RJMA 1E27A 2CDEB 2R0WL 1ORQB 2Q6WA 4HWZB 3HNTH 3I50H 1ACYH 4QXTA 3E2HC 4ELKB 2XPGB 5JXAH 1BIIA 1I3GL 4KVNH 5DRZA 4MCZA 5D1ZC 5DMKA 5IGXL 1EEUA 1J9CT 4EIZC 1JYNA 5IWLC 1D5ZB 3O6FA 4JLRA 4HC1H 2HTLC 4NDMB 1YYLL 3RQ3A 2P8LA 1FDLH 3QG7L 4KMTH 1P7KB 1UM5L 4K7FA 2L7UA 1FHGA 2GJZA 4PJEB 5KSVA 3UBXG 1E4XI 4X4YA 4YNYB 3RVWC 4AENB 4Y88A 1RUQL 2XTJE 2UZXB 5DUPL 3DETD 5C0RH 2Y6SD 2K7QA 4YHOL 1A2YB 1MFCH 4ZXBC 3UTPD 1LO5B 2KH2B 1XH3A 1FNSL 4JREB 4P2OD 5DJDB 4EOWH 4HC1A 4JEGB 2CXKA 3QFJB 2RIKA 1H3GA 3S35X 5CZVL 3LV3B 2YMXH 4KK5D 3X12B 2A83B 3TLRA 5ITBL 1LO4L 1J87A 3IFOB 4YBQC 1AIFB 3FT4B 1QFWL 4HK0B 1P84J 1YYLH 1VDGA 5I75C 5H94A 4U7SA 4H1LB 2R1XB 1U8KA 4P4KB 2MCG1 1HE7A 2XQBH 1FVDA 5CLWA 3QXDB 1KXQE 3ARDA 2GCYA 2IBZX 3WFEH 5A1AA 5A2JH 4X0KB 1JWUA 5FO8B 3C2AL 3IDIA 4U1IB 1BQUA 3KVQA 2X4NA 5JA8B 1D5BA 2VZUA 1X4ZA 3QDMB 1VGEL 4X5WB 4U49A 1WT5A 4YHZH 4Q9QH 1Y6NR 3DIFB 2XQBL 2E7MA 4L4VE 2ZUTA 3T3ME 4FABH 5C2BL 5HBBA 4XNXL 5DK0A 5I8CB 3RNKA 1P4IL 2MWCA 1U3YA 2HWZL 1KPVB 4MB5A 2C4FU 3DVGB 3H9SA 2Q86A 4XNYH 5JO5B 2P47B 3PG2A 2YUZA 4BSWA 1CR9L 1CXFA 4GRLC 2F74A 1WGOA 3O11B 1QPXA 4XPTL 1GRWA 2DQGL 1ZMYA 1SQ2N 2P8PB 3CDGA 4YIQB 3O45A 3VI3F 2AAVA 2X4QB 4EQ2A 3G5ZB 4LRNH 5T1DL 1E4XL 1U8NA 4XP6H 2ORBH 1N5AA 4YX2L 1WAAA 1WBZA 5TE4L 4DKFH 5IB2B 4MNQB 3SGKC 2VZSA 4QEGA 3IETA 4ZTOL 1FJ1B 5IMKB 2A74B 4F7TA 3GKWL 4YXHH 5GRJL 1L7TL 3X11B 1INQB 1NMBH 3GO1H 5JNYA 5DFVD 2GUOA 1KCSH 5FYLL 4NQDB 2BCKA 4LSSL 3ROLB 3TT1H 4XZUA 4UBDD 3TPUB 1RZFH 4ISVB 2NY2B 4Q0XH 3LKSB 5F71A 2ZCLH 5CP3A 5D1XB 4P5MA 1FL3B 3ZKNC 1T89A 2ZUQC 4UMGA 5FGRA 5FO7B 4OFYD 1T89C 2V5SA 3L3DB 4KJYA 4UV7L 1CDYA 3M8OL 3CLEL 5D6DA 3MA7A 2VITA 5JW5B 3BPNC 3BYTA 3CLFL 4EDXA 5J13B 4JDTL 5FYJU 3CVIL 4PG2C 5CBEA 3MODL 4PJ9D 4YGAB 1P4LB 2JB6B 3FZUC 1LP9E 1HHGA 3S97C 4GXVL 3PWPD 5DT1H 2NW3A 5HJ3A 1HEZB 3HRZB 3VE0A 4Y4HA 4ONFH 4HWBH 3C2AH 4YGVB 4HF5H 1REIA 5C08D 5C0BD 2YS4A 3L5WA 5A3ID 1RIVL 5I2IB 2YD6A 3ORJA 3UTZA 1ND0B 4LLVA 3MNWB 5IEKA 2QQKL 1D7FA 5I1LA 4YHIB 2BNUA 3U48A 4HJ0D 1KPRB 3CSYB 4K3EH 4MQXD 3RWFA 3MNZA 1YEFH 3SDDB 3K8MA 3MRMA 3CK0H 1EGJA 4R26H 4E41E 2BXYA 4U6YA 2XZAL 4GQPH 3U36A 2FH6A 4U1JA 5CJXA 4LLQA 4U6TA 4QRRA 2DLIA 2R2CA 2Y5TB 3OJDA 4TPRH 3RVVC 4P46A 4PIRF 4QWWD 3W0WE 4NO5A 4NM4H 4B7IA 1ZXQA 2DLGA 2Q8BH 2Y06L 5KG9B 4Y4HD 4YDIL 4HAFA 1RIUH 5L6YL 4RAVA 3MREB 1I8IA 5FK9A 1DLHB 3TCXA 1H3WM 3QEUB 1IM9D 2VL4A 1WIOA 1MHEA 5HGGS 3T0ED 4DAGH 1KFAH 3WO4C 1WSST 5C7XL 3C8KA 2VISA 5L8JB 1KIPB 3SDDD 3BH8B 3GSRB 3S35H 2N7AA 1XGQB 1NCAH 4WDIA 1F6LL 4MGXA 4Z7QF 4PJGE 5D96B 2D7QA 1DL7L 1X6LA 5DVMA 3BUYA 1K4CB 5C0BB 1AC6A 4JFDD 3TBWB 3U6RA 1CG9B 1EPFA 2CO6B 5DQJA 4XC1L 4Z18A 2AI0H 3MBEC 4Z78A 3MPCA 1EIBA 1NL0L 4HMCA 4JVWA 1AQDB 1NGPL 4MS8C 2V17H 5D1ZA 3QH3B 2PYED 3GBNH 4GW1B 2I9TB 4D9LH 2Q20A 3KR3H 3G5VB 1KXTB 5IMLA 1Y18B 4G6KL 3WD5L 4U2YA 5ACLA 2AEWA 5CSZA 3PJSB 5BVJA 1DQMH 4LCIL 2BZDA 3CLEH 1MJJA 4WI8A 3MV7D 4RDQF 5HDBF 3KYNB 4IBLT 3HC0A 1IKFH 1GXEA 5E8PA 4GKZA 5I9QC 3K8KA 5EOTB 4CJ1A 4ENED 1WCQA 2DJSA 2O5XH 3VMNA 2EYSB 3WFHA 4S1SH 4OZFH 4ISVA 3S6CA 4DGVL 5BZWB 3AS1A 2YSSB 1NMAL 4KAQH 2PW2A 4OKVA 3WYRA 4X6BB 3QUZC 3MUHL 3CDCA 4UNTA 2CH8A 5F8QC 1T5XB 5C07E 4S11A 1LO0H 5E8DL 4GRMB 4N8CL 4PJGF 5B22A 3HE7A 1OCWH 4P2RA 1ETZA 5TF0A 4N0UE 5HHXL 4ONGL 3DUUA 4Z7UA 3GSVB 5IHUL 2YN3A 4MA8L 5E8NB 1RULH 3GDBA 3QAZC 2Q7YB 5IJKC 2NY0C 3B2UC 1CDCA 4BFGA 5F8RC 2YEZB 5K59E 2R23B 2R0KH 3K1KC 4JQVA 5HY9A 5DUPH 5MEND 4AEEA 3B6SA 3FO0L 1JE6A 1KENL 4RGNC 5SWZD 4JM2B 4XAWH 4ODBD 4JKPL 4NM8L 2BC4A 5D2NE 4HDIA 3QFJD 5F7EL 4ZUWA 2E6PA 5I1LB 4GKNB 2YWZA 4GUPA 2FJGB 4CMHC 1EJOL 3ARFB 1O7SA 5JOFB 3GGWB 1FQ9C 3I85A 5DK2A 3QA3A 5DJAB 4FA8A 5F1SA 1NGQL 3FQWA 4U6YB 1FG9C 5ETUA 4ETYA 2CXGA 2LTQC 1JK8B 5A40E 1R24A 3C87A 1G9EA 3S36X 3S5LA 5EZOH 4WUUA 3WFEL 1I1FA 5EPMA 4QTHA 1KGCD 3MQIA 4K23L 4U1MA 3MRRB 3LQAC 3BP6A 3HNVL 4YXLL 4PGDA 2ZWLT 1A6AA 2EXYC 1ED3B 3ARYA 4NQXA 4TULL 2G60L 2BHYA 1CQKA 3EOYG 3MX0A 2VTFA 4TSBL 4JFFE 3AREA 5BS0E 2CRZA 1S9VB 3HE6D 43CAB 4Z7WB 4LHUB 3IJHB 1I8KA 3B9KA 3NCYS 4HIJB 5IB5A 1T1YA 4M1DH 4JFPB 5EIIA 4JHWL 3C8HA 4B7LA 5GGSA 1IL1B 1RZKL 1WWCA 2CKBL 3RBGA 3CAFA 1IGIH 5L7XL 2L4OA 3MYJB 5LVEA 1SYSB 3QWQB 2XFXB 3B8SA 1AR2A 4OZGF 1IQWH 3KPPB 5INDB 3OGOE 3UTSB 2OCFD 4YXLH 3WIHL 2CIKB 2G75B 4M5ZH 4AG4H 1QLEH 2K7PA 1U8PA 4XTRD 4JR9L 4Y5VB 3RWCA 2EC8A 3WN5A 1BBDH 4A6YH 2HLFC 4JO2H 3RPIB 4Q9CA 2O5XL 4ZODA 4AT6A 2XXMB 4YXHL 1DUYB 3EYSH 3D6GA 2BNQE 4X6DE 2W59A 3IFLH 4XPAH 4M7KH 5K33A 1OTUD 4DGIL 3ISWA 3P11L 4X98A 3RWDB 4NUGL 2GK0A 1JUFB 5MI0C 4N0FB 3BWAB 2MQCA 3PWPE 5L0QC 1ES0B 4MAUH 4FQHB 2ADJB 2BOBB 5DD5L 1QUNA 2YUVA 1NUNB 1MFDH 2V9QA 3IKCB 3SKOA 2VUYA 2OXHA 1JNLH 4WHCA 2XZQH 4L29B 1CFQB 4TPRL 3TCLB 4CMHB 1YEKL 4G6JH 1J1PH 1HDMA 5SX5H 4RFNB 5TDNB 1F2QA 3VXQA 3M17B 2BSRB 2DMCA 2BY3A 4MA1C 3T65A 4F7PA 5J0BA 3QULA 1FYTB 4PRHB 5FKPA 4F57H 3TNNB 4GRWB 1EDQA 4M7JH 4JN2A 1QTYT 1KPUB 1WISA 2X70B 1FG2B 4C58B 3UTQA 3UJIL 4PJAB 4Q9RL 1PQZB 2LQRA 2P4AB 3V4VL 1AGFA 3NCJL 5J1TC 4XVJL 3UP1A 3PE9A 5DMGC 1CT8B 3ARUA 3D25B 5CGYC 1NAKL 5I1DA 2WLZA 1N6QL 5DUBA 3FMGL 5I1HH 1V3LA 5EBLA 4JFEB 4DN3L 4RQQA 2RCSH 3V5KB 3EO1A 4PB9L 1JF6A 2NW2A 3QUXC 4HLZH 5ACMA 4JHAL 4JREC 1AI1L 3HRPA 4D9RD 2YC1B 4G8FB 2BC4B 1N59B 4HS8L 2BSSB 5EZIH 2VZOA 4XMKL 1UENA 1HHIA 1RMFH 2FO4B 2JELL 4XCEA 1A7NL 1QSEE 2AP2A 1PLGL 4G6KH 1JPGA 5GS1A 1CBVH 2V2XB 4FQXD 2ESVE 1CDHA 1UWEH 3U7WL 4OF8A 2ZCHL 1CLCA 4L4JA 3MJ6A 4NQCA 4IRSA 2YUWA 3QEHA 3T2NL 4G9FB 3MRRA 1CK0H 3D1MC 3IDJA 3N9GH 1FO0A 3SPVB 3LSOA 4JJ5B 4PGDB 3S35L 2E7LC 3GI8L 1GIGL 3DETC 1I1CA 2Y6SC 1DQJA 4G43B 5IW6B 1QR1B 1I1RA 2P5EB 4ZUTB 3VG9B 5DXWA 5C0ND 3BGAA 3JWDH 1G9NH 2OZ4A 2EIBA 3FT3A 3F7RA 1PY9A 5I1EH 3G08B 3NN8A 4OF7A 2APBA 3HFMH 4YBQD 3HI1B 4OF6A 4XC3L 5I74C 4NWUH 4ZQKB 1IL1A 1HWHB 2PYFB 5EA0H 1I7TA 4O51A 2AJXL 4XHJD 1NCUA 3JZ7A 4KHTL 4MJ2A 5BMFL 2CMRH 1PJ9A 3ZTJH 5C9KA 4LLWB 3LS5H 1ODAA 4MNGB 1AGBB 3CXHK 1QLRA 5IFJA 3FO0H 1YEJH 4HFUL 5CS7A 3NOIA 1Z2KA 4HWEH 1MHPL 5I17B 2VABA 4MDJA 3O9WB 4F9PC 3O2WH 4XBPB 1JWMB 5E2WL 4JHZA 2GTZA 4G8GD 1C7SA 4JFFA 5GS0D 4LSSH 1ZGLM 3TT1L 3W11D 4ZPTA 1WC7B 3WBDA 3MXWH 2BVQA 4MXWH 1FV1A 3VXSD 5A16A 3TBYA 1XF3B 4Z7VE 1G0XA 4OUUB 3AM8A 1KN4L 1MCBA 1RZJL 4NOFA 2IFGA 4RIRA 4ZXBA 4MA1B 4PV9A 3S88H 2LTQB 4TUJB 1ZT7B 3BZ4A 4OSUH 2IANB 4LF3B 3HB3D 1JJUA 4F9LC 4D9QD 5IQ9B 1OTSC 1IILE 1MCKA 4GSDH 5F3HA 1CD9B 3VXUB 3L7FB 1A7RL 3THMH 4LLDA 3AC0A 2BSRA 4WHTB 5HYJA 1KC5L 5BJTA 2MKWA 4S1QL 4YNYA 3QULB 4FQIL 4NQCE 4JFHD 3MUZ1 5JPMA 3GNMH 4BQ6A 3SN6N 2FECI 3CJJA 3OKOA 1DR9A 5DRWB 1JRHI 2EYRA 3CDYA 1H3UA 1MAML 3QIWA 4RMUA 5DC0A 5FCSH 4N0CD 3DI3B 3QPQD 4F33A 4IHOA 4Y5VC 2MHAB 1JPSH 5EU3B 3RU8L 2QHRH 4TSCL 1BX2A 1R5WA 3M1BB 1ZS8B 4XAKE 2ZSWB 3V5DB 3MXVH 1LD9A 4GAJL 4PLJC 3VGDA 1NCBH 4JFQB 5DQ9A 1J8KA 4KDWA 1LWRA 2EXWD 4JPVL 4ZXBD 5KS9B 3BGMA 3ZE0F 2NPLX 4RMSA 4BM7A 2V5TA 4BH8A 5E00B 4AM0B 1BD2B 5CKGA 1VKXA 1NMCC 3QXWA 4I1NB 2HVJA 2C5DC 1DZBA 4NKOA 4N0YH 5AAMA 3H3BC 5B4MD 1QG3A 2RQ8A 3GJFB 3WD5H 5HGHB 4PJ9C 2EDWA 4PJFA 5DJ8B 1EEQA 1IC1A 1KELH 3QDME 1NCDL 1MLBA 1SJHA 3GMNA 2D3VA 3NCEB 5JTWA 5LQBH 1BPVA 5I16A 5HHVL 1NEZA 2ADGA 4OFVA 5JUEL 2Q3AA 3SJVE 1U3HC 2LVEA 4BZ1L 4LLYB 4PB0L 4LSDA 5KTEH 1Q1JL 5M94B 5FECA 5EUOA 2PNDA 1EHXA 2EKSA 2F53E 2WAHA 1NC4A 3GB7A 5JR1H 3VXTA 2ZSVB 4Z7WE 2J5LB 3GRWH 1J0ZA 3RNQA 3EYFA 4QT5A 1RSFA 4MNQE 1UM4L 1RZJH 3PXHA 3TFKC 1I9RH 3KJ4C 4L9DA 1NGYA 3DXAD 2W9DL 1INDH 4X6EA 2P7TA 5DR5L 3TIEA 2R69H 3BN3B 1FSKB 5H37H 5DS8A 1TMCB 2A77H 1PG7W 4K8RC 2FH8A 4R4FH 1RAMA 2FZ3B 1PD6A 1VADA 3VXPB 4NM8H 2CO7B 4P59H 5C0EB 1IEAA 5ESQA 4M93C 5F7YC 1AE6L 2YXFA 1LEGA 1OAKL 4TN9A 5BZDB 4JGUA 1BZ9B 4JAMA 4TUOA 1N26A 2BDNL 5D9SB 1T1XB 3O3EB 4LCWB 5KZCD 2V7NB 1DFBL 1B0RB 4NP4L 3V0VB 5T5NG 1ITCA 4HXBH 1HIMH 2PUQT 3F5WB 2IG2L 4K3DL 2EO1A 4XNZB 1I7RB 5IB4A 3RZWA 5MENA 3BKYL 4JO3H 4XP5H 5F7FA 1Z5LA 3UMTA 3FCTB 2AJUL 2EDLA 4Y1AB 3CFEB 1I85A 1OAQH 1MHHA 1FNEA 4LVHC 4H1LH 2GJ6A 4ZAKB 3CXDH 4RFOH 5B8CB 2P5ED 2DYPA 1I7UB 5GISH 4M62L 2KZWA 3W0WA 3VE0B 4CN1A 5EBWA 3TVMB 1T20B 4D9RE 3QUMA 3RY4A 2X9WA 3GM0A 5HSFA 4K71C 4YZFE 3KPRE 4HUWA 4J6RH 5IW3A 4UINH 5KVEH 1GAFH 1MCRA 5KAQF 3TBVB 3V8OA 3MGTB 3QUML 1UZ8A 4UAOC 5EU6D 3ULUD 3NPSC 4Y8AA 3AY4A 1J0YA 4KQ4H 4PRIE 5JPMB 4NWTL 4P2OA 1R6VA 1XGRB 3RI5F 3MLSL 1IAOA 2FJHA 1R0AL 5LGKA 1BREA 4GBXB 1EGJL 3PL6D 2KUTA 3VJ6A 5JHDA 4M5YL 2RFXB 4MJ6A 3I6LE 3P4NA 5L7XH 3HFML 1ZLWH 3MUGB 2Y5TA 5D71L 1A9BB 4OT1L 1AI1H 2GFBA 5SX4H 4DGYH 4XNQB 5JOPE 1ZA6B 5D7KD 1WFTA 3NGBB 4Y2DB 5AYUL 4M6ML 5JW3L 5F7LB 5TQ2H 4WWKB 1MAKA 3FHAA 5FA3B 1I75A 5D1QA 1CGWA 1YQ2A 5KS9A 1RUMH 3BP4A 2VWEE 1UXSA 3GBML 1QBLL 4GAYA 3VXNB 2OLDA 3STLA 4HAGA 4NKOB 4JZNB 4P23A 3HNVH 3VXMA 3QBTB 4CU7A 2VAAA 1UJ3B 5TQ2L 1T7YA 3C09C 1CZ8L 4OD2A 4JRXA 1IC5H 4GLRI 5HHME 2XA8H 3KNBB 1WBXB 1NCBL 3Q2CA 4OT1H 4HG4J 4N8PA 1JZ5A 4O5LL 1Q72H 1YEEL 1GGBL 4LPVA 4P46D 4MJ5A 5GRVK 1XGTA 1ULVA 4U3HA 1CFNA 3WXWH 3C08H 3MA9L 4XH2B 3OR6A 25C8L 3S5LG 2GY5A 1A47A 3WFDL 3QNXB 5CBAB 3FT2A 3RVTC 2G9HB 3RWIA 1PYWA 5I1IH 2GITA 1QKZH 5ANME 1F3JB 3BUTA 5ITBH 2MTPA 4YK4C 3OAZH 3ZT6A 4KJPC 4M8QB 1NAKH 2IAMD 1RHHA 2VDOH 3QI9B 3SE4A 2KZ1B 4AEHH 3NFSH 3UTTA 4D9QE 3D18A 5HHNA 4NN7B 1B0WA 4OLYH 1JHKH 1E6OL 3DVIA 1D5MA 4WNQA 3VXMD 5HDQH 3IJSA 4NC2B 3ZSSA 5LGHL 5FCUH 3ARGC 3VXOA 3GSNH 2IQAA 5IK3B 4CAGA 5F7DB 9CGTA 5BZWA 2OK0H 4XCFL 5IFHH 1FZKB 1KEMH 4MLIA 3QCVH 1IGTA 1BFVH 1I8LA 1PX4A 2N7BA 3HE6C 5DEZA 4XX1G 2GAZA 4ZAKC 5I1GL 4PP2A 5C0CB 2W0PA 1PLGH 3MFFA 5E9DB 2CK2A 3TH3T 3VFVA 3QHFL 5EO0A 4PJIA 4B50A 2Z0BA 1BD2E 3CU1A 5L2KD 3PWPA 3WLBA 5IHLB 2Q7YA 5DZOA 4HS8H 3QIWD 2G60H 4XB7A 1BMGA 2AKRB 3QUZD 5EZLB 2X1OA 3WNLA 3UYRL 1D5XA 3HC3L 4KMTL 4KVCL 1KCVH 1VERA 2LU3A 1XIWA 4PGEA 1F97A 3DHMA 5ID1B 3RAJL 4WFFD 1JNNH 3QDGE 4U7MA 3WFCH 4P9HH 4KRPB 3U7AA 1O0VA 4OF5A 5I1EL 5FF6A 4N68A 1UM4H 3PGFL 5HVGB 4Z6AT 3RTQB 3BGFC 5ESVB 5GRXG 5DK2B 4NQVB 2YUXA 35C8H 3T3MF 1ITBB 4MSWA 5E5RB 5C07B 3TEUA 3ARBD 8FABA 3HG1B 5JHDB 4K3JL 3SKMB 1IGJA 2VL5B 4LIQE 3SGJA 1CICB 3HMWH 4JKKA 4PREB 3KPOA 4G5ZH 2VLRB 1RUAL 4OM1L 5SWZB 4V1DA 4BH7B 4X7SL 4BFIA 2JIXA 4S2SB 1NLDH 4ALAH 1OW0C 5GS2H 1QLFA 4F8TA 3K74B 4MMZC 4GAYB 4UOW1 3P9MB 5SWSA 3PQYD 3VG0L 3G04B 4OAWB 5DMGD 5CD5C 2RHEA 2H3NA 3NZHH 4YH6A 3A6CH 4RAUB 1FE8L 5CEYB 2VAAB 4M7LL 1JN6A 1A4JB 5GGSB 1LO2L 4NHCL 4IRJA 3CFDA 2SEBA 2FBOJ 2OZ4L 3SDXA 5JXEA 4KMLB 3MYJA 3V9FA 3H9YA 5GISL 4M48H 5H2BA 1MHCA 5INDA 3U0TB 4D0DB 1KJ2A 1AQKH 3H9HA 3VWKC 4E41B 1J0HA 3GSWB 3WLWC 1QBLH 3EJYC 4YO0B 3OR6B 1U8PB 4NNPL 4XWOC 4Y5VA 3RWCB 2X5PA 5CBAA 5IW1B 5JQ6L 2ICCA 4HUUA 3KYKH 1H3VA 3S9DB 3QIUD 1MPAL 3O2DL 4X6DF 3U4EB 5K59F 3THML 1OAZH 3HUJB 3WJLC 1XGPB 3KLHC 3PABA 2QL1A 3ZZ1A 3GMQB 2OSLA 2AJYL 2XKUA 1DEDA 5IVXA 3DPBA 4I0PD 5JQ6H 2BVUA 2HTKC 4FQCL 4Y4FD 5CJXC 5CEZH 1MCDA 1A6VL 3EO9H 2YD1A 2VLJD 4PJFE 4N8CH 2PR4H 1A3LL 2WQRA 3UPCA 3OXRA 3ULUE 2VXUH 4OLUH 3MRFB 1K8DB 3AXLB 1QQDB 1MY7A 4L3ED 4DAGL 4X4XA 2F54B 1F58H 1IAIL 1TZGH 5KN5B 4D8PA 2R29L 4JFXA 1FGNH 1X3DA 5CMAB 1OP3H 3ZE2E 1SM3L 1A1OB 1FNAA 5DI8A 1OT2A 1TJIL 3KYOB 1KV3A 3DRQB 5L2KA 4PJBF 1AFVH 3K4AA 5JOPD 3RL1A 3MLRL 1PZ5B 1U8MA 1CLZH 4KK8C 3EHBD 4JM2D 4L4VB 3A6BH 2VC2H 4C56D 1OAUH 5DJ2B 5IEHA 4RRPG 2FWOA 4U1HB 3WIIL 2PXYA 1WQVT 5C0DB 1P7QB 3DV4B 3DUSB 1P1ZA 3UXFA 3T1WA 2FGWH 4OBSA 1WBYB 1I9IH 2B20A 4NZRL 2LU7A 2X89D 5CGYD 2Y9RT 2F5BL 4JCLA 3TYFA 1HSAA 2EE9A 2I24N 4ORGB 3V6OC 4GRWE 3O41A 1RVFH 3H0TB 1L9MA 2R2EA 3O3DA 4NO0D 5KVFH 1INEL 5IM7A 1RURL 3BE1H 3FB7A 4U1NB 5IBTH 1F11B 1C08A 4KZDL 4JY5H 4OLVH 4KAQL 2FX8L 4LP5A 3LKNB 1P53A 4GRLA 4I3SL 5IB3B 2V2TA 3O2DA 2X42A 2NTFB 1MCPH 4HGKC 4I4WA 2A2QT 4Q74A 1EERB 2J1KA 5BXFA 1U41A 4L4TD 4BQBA 4LEXH 1YYMH 2YR3A 4V1DB 3ZO0A 5HYJD 1RV6X 1G6VK 4XMKH 3MBXH 2Y36L 1BQHA 1KJ2L 2DQTL 4XRCB 3H7BA 2DWDA 4KKLC 3R8QA 2V5RA 5LBSL 5IJVB 3U0PA 5EO9A 4JZOA 3GSOA 3UDWA 5JW4N 3DLQR 4MNHA 4V2BA 5TDOB 4E0RA 4ELME 4FNLL 4LNVA 4J6RL 4IRJB 4N1CA 2PO6B 1X9QA 5EZJA 1VSCA 1NEZG 5D6CB 5ID0B 1F6FB 4HZAA 1KLFA 4PRIB 1RK1B 2GT9A 3AUVA 4DZ8B 2VRAA 1A3LH 3DURB 4XBPA 2W60B 3BSZL 2LAAA 4LRIA 4HT1H 2UZYB 4OFDA 4WO4D 1LQSR 1R5VB 1AY1H 3MJ9H 3MLUL 2C1OB 1J7VR 3Q3GA 1MOEA 3EJZC 3UBXI 5A2FA 4AK1A 5J1SC 3DGGB 3HUJA 5A2IH 1FZMA 3K80A 5AYUH 5EOCL 3LQZB 4P3CH 1R3KA 2CMRL 4NZDA 4PV8B 3BEWA 1T03H 1YEHH 1P2CA 4E5XA 2IFFL 3SCMB 2DWEB 4QF1A 1MH5B 4QXUH 1I3RB 1FLRH 2ADIB 3X3FH 2ZG3A 1F4WL 1LK3H 2B0SH 4QRUA 4R4NC 4D0CA 1U36A 4UQ2A 4LQFL 2AEPH 1WJ3A 4ZO8A 2DOCA 3V6OE 4L5FL 3HPLA 3SDCA 4N0UA 3EOTL 4H25B 2OS7A 5EOCJ 2EH8H 2F54A 1WUNT 1G9MC 3IXTA 4G8EB 4XZUB 3SOBH 4D8PB 1NLBL 4PTTA 3RKPA 4S0SD 2KPNA 3QUYB 5D1ZD 5FO7A 1TVHA 2E27H 1KIQB 5E5MB 3ZKXC 2MMXA 1T0NA 2XTJC 3ZT5A 3VGFA 2HTLD 3VFTA 3DX6B 4ONOA 3VW3H 3JV6A 4M7ZC 4JFQA 4MXVF 4KI5C 2WNGA 3LIZH 1P7QD 2Q8AH 3BISA 3DV6B 1RK0A 4ELMA 1IZKA 4LSTL 1XF2A 4OI9A 4Y4HB 5D71H 1DEEB 5BRZD 5CWSB 4G8IB 4C56B 3I84A 1XCTA 3V7AG 3EKCA 3E8UL 4NC1E 3GJFA 4P2OC 3C9NB 3MRPA 4JDTH 4YBLB 5HGAB 1M7DB 1MFCL 4I18A 2LFGA 3EUUA 3UTPE 4F3FA 3CX2A 4F2MB 3WL9B 4MX7A 5TF1L 2CRIA 1ADQL 3PWUB 2H41A 4U1NA 2CLVB 4JPVH 3L9RB 4HIXH 4G7VL 1G6RB 5HYEA 5L8KB 1D6VH 4GS7C 2MCPL 5D5MB 1CZ8H 2FD6H 4QXTB 4OZIA 2VXUL 4OLUL 3V4VH 5D1QC 5DWUH 2A9ML 4LHJB 3ULUL 3UJIH 1OWRM 5B39B 2J88L 3LCYA 4FQJL 3P0YH 1BQHB 3WIFA 3U9PH 2K3TA 4RAVB 3TA3D 2DRUA 4V1DE 5E8EB 1KENH 4FN0A 4HH9A 4CDGC 5LWYH 3O3BB 3R1GH 5GIRA 4XCFH 3ZYIA 4NKMA 3BPOC 1GL4B 4L4VD 5TE7H 3BJLA 4R0LB 5I9QB 4H20H 3QDJA 1MI5B 4PRBA 1AXSB 3FB8B 4ZFOB 4BQ8A 4L3EE 4YUEH 3ECBA 2UYLB 5E4IA 3IFNH 5F9JB 2VSCA 3ZE2F 4WENB 3EYUH 4L8BB 4LCYA 4NBXB 2NY2D 5D2LF 1GGTA 1I9JH 2F53B 1RK1A 1FDLL 3FQXB 3QG7H 4C83B 5DHVH 3FOLA 3GMOA 1UVQA 3EFFB 1QSEA 2GEEA 1MWAL 4NZTL 12E8L 4OFYA 4UI2A 5IMOA 4NZUH 4MAYA 1WTLA 3LPGA 4HFWB 3VFNA 4NRXB 4HWUA 4ZTOH 2GJ6B 1JPTH 4CVZB 5AYQA 3QEQE 1WZ1L 3ARED 2XY2A 3W0WB 1KLUB 1NMBL 2X4NB 1EMTL 1EEZA 4N0RA 3TBSB 3J7HA 4FHBD 1DQQA 1NC2A 4A6YA 2DQEH 3SE3A 3KYNA 5CP7B 4JJHA 4ZFGL 5IVXE 1OP5K 3HPLB 1S7VB 4NO2B 3N06B 4GKZB 5KSUB 4JO3L 5F1IA 4ODWA 1MREH 1OSPH 1WZMA 4NC0B 4X7CC 4GG6E 5HVFB 1AO7A 5EN2B 4BFEA 1QNZH 3KJ6H 1SBSL 3PWVA 4NNXB 3T3PF 5HYFA 5ADPH 4M48L 4NNYB 3G6JF 3RTQD 1P69B 4ODSL 2R2HB 4UIMB 5FOBA 1JZ3A 2J5LC 1ETZB 4F37K 1K2DA 2O61B 3ULUC 4P59L 5H35A 5FYLE 5D2NB 5CEZE 15C8H 1AXTL 4FTVA 3WS6A 1J8HA 2PN5A 1QSFD 2B2XH 3DX8A 4X7TB 5HHQB 4MXWL 4HJ0C 1L7IL 4OCRL 4PJCE 1YNTB 1JGDA 3QZWG 1UH4A 3I2CH 1I7ZA 1SYVB 3BIBX 3MO1B 4OGAC 3GHEH 4OF3A 4QHLA 5KW9L 4Z0BH 3MLUH 4PJCA 5GGQH 5BQ7B 3W5MA 4ZS7H 5IIEB 2FJGA 1NUDA 1YJDL 2P8MB 4KI1A 4PS4H 4QWWC 1ADQA 2WBJC 4Y4KB 2ESVB 3MRJB 2R0KL 3MRDB 3RWGB 3IVKB 2ZP0T 2Z93A 4P4RB 2A6KB 3BPLC 5C0JB 3U0WL 3SDYH 2D7TL 4XWGL 2E7BA 1KCUH 3VGEA 4KZEH 4FFVC 3WE6A 1BJ8A 4N9GB 5L88L 4YHLH 3G6DL 3KPSE 1XIWD 3HZYA 4MNGE 3L3HB 3OR7A 4WEBL 4BZ2L 4M9PA 4LASH 1TZHA 4LSRL 4XP1H 5J7CC 1G7HA 3LKPB 5E08H 4YGVA 2D7TH 4OLXL 1KBGH 4P2YA 4DUXA 3BN9D 3BIKA 4O2EA 5E94B 1RHFA 3ZHLA 4YHLL 5KS9E 1I3UA 4NCDA 2ZZUT 4UQ3A 5KSAD 5T3ZL 3B5HA 1T21A 5L6YH 1Q9LA 4OIAA 2EDYA 2L7JA 3S4SA 3IGAA 3MODH 5SWQA 5EFIA 2Z31A 4XPGL 1AXSA 4ZFOA 4LCUB 2PYEA 1E4WH 2CKNA 1H3PL 4F7CB 4KJPD 2DLFH 5D8JH 2ARJB 2F5AH 2ERJC 3BW9B 1T0MA 3HI5L 1QEWA 2AJ3A 1MWAB 1U93B 3VFWA 4OFKA 4GG6B 2QADD 4Y7MA 1S7RB 4UT9L 4OI7A 1AGEA 1AXIB 3REWB 4KROC 4L3AA 4F15B 1TZIA 5EU6B 5I1JL 3D0VB 1GOHA 4OCSL 1KC5H 4UZGA 3FB5B 4DFHA 4DN4H 4YHPB 1NL0H 3G6JA 2JJUA 5IMOB 2BJML 3N0PB 1DUYA 1FZOB 3MLTB 4XVSH 2F5BH 5BCAA 1LEIA 3CVHB 1HQRB 3DXAB 2YPLA 3CUPB 3WFBH 4OV5A 5J12C 3SGKA 4WW1A 2VISB 4G6ML 5CJBA 4HPOH 1JPFB 3TN0B 4ZAKD 2Z35B 3GSRA 3W2DH 2XPGA 3DTXA 5BRZE 4MCYA 3L5HA 3O6FB 2H1PH 5GS0H 3ROOB 3S37X 4KKCC 3BZFA 2P8LB 3D69A 2P48B 4FZEL 1OAUL 1YJDC 2FSEB 5JDJA 4HIHB 5CILL 2P45B 1FFRA 1KCRH 3O4LE 1AHWB 5GSVA 3F58H 1QACA 3PL6B 4I0PC 3OG6B 3QXAA 4L8DB 1R3JB 4Y5XB 5BRZB 4Y4FC 1FN4B 4IS6A 4NNPH 3P3YA 5GXBB 2DLTA 2VC2L 4H88H 2B4CC 4GW1A 3NIFF 2CR3A 4PGCA 1OY3B 5D7IA 3SDAB 5DD3L 3DROA 4G8GA 1CFVL 3NCMA 1CT8A 2VLRA 5ICYA 2G2RA 3RIAF 3V7AE 3T77B 2Y5EA 1BGXH 1J8HB 5SWZE 5IR1B 1UWGH 5TQ0H 3DX8B 5LJYH 5EBLB 3ULVD 4PPTA 2MKLC 5D7LE 3J8F7 3E3QC 3V0WL 3NAAH 2A38A 2WP3T 3QSKB 1CD0A 1KXVC 3D3VB 1JRHL 3ILPB 4ODSH 4Y2DD 3IDIB 4L3EA 2BVPA 1D5BB 1T22A 2VLKD 4EN3B 2XNAB 2J4WH 1ZHKB 1H15A 4JQXA 1JPGB 3MJ9L 3RKDC 4LDLB 2EXYD 2ILLA 1KGCE 4HK3N 3QZWB 2CDFA 3BKJL 1CLYL 3SCMD 1ZOXA 3EIFA 4WTXA 1FNGA 4EBQL 2DQEL 3IDYC 3WS6C 1KNOA 3GMPB 2IH3B 3MLRH 1FO0L 3MRHB 3OKKB 5KBNC 2DQTH 1UT9A 2Q86B 5IFAH 3QFDA 3T0WA 1IARB 2R23A 1U8QB 3OBAA 4ZYKA 5J13C 3AMLA 5ILTH 2V7HB 3NAAL 4KKBD 1SEBB 5GGTH 4U0QB 3BFOA 1KTLA 3TVMD 5BS0D 2WM0A 1HINH 4UOJA 3DECA 4NO3A 3C5ZD 3VWKD 5HDBE 4LLMA 3L3IA 5IVXB 3VRIB 3PP3H 3MMEB 5DLML 4PJ8A 4XCYA 5KVDH 1C5DA 4KHXH 4OGYL 1NDGA 4UT7L 4UT6L 3UPAA 3GIVB 1IQWL 2BXZA 1UB6A 4OZGE 4X7SH 2D0FA 3NIDF 4Z9KB 2NZ9D 3E8UH 1HHJA 5HYQA 2DM7A 3IB4A 1JGEB 1LO4H 3EOAB 4X9BA 1JK8A 1BOGB 1DQTA 4KKLD 3H3PH 4ACPA 5F1KC 1CGTA 1QEWB 1LE9A 4LLWA 2HJFB 4P99A 1AGBA 4KFZC 1E28A 3OXSB 2Q8AL 1V8HA 1P9MC 2D0HA 3FJTA 4JANB 4IOIA 4YXKH 5EU6A 1VFUA 3VXUD 4B5EA 5DHXB 1S3KL 4EDXB 3MJ8A 1IBGL 2K1MA 3TO2B 4KK6D 3ULUH 1YPZE 4WGVB 1X5FA 3C5ZA 3CDFA 4FABL 5C2BH 2VAJA 3ILQD 1ZLUH 1ZEAL 3VWKB 4TUJA 5FDYA 1E6JL 1A1MB 3O8XB 5IGXH 1QFHA 2AABH 2BVEA 1FFOB 1OT1A 1OGTB 5GRVL 2XWJB 5D2LB 2XFXA 3EJZD 1BJ1H 4ZFFB 3Q5TA 1Z9MA 3AU1A 3QWOA 4I0CC 5FYKD 4APQD 4DCQB 1BVKB 3O41B 5GRWA 4U1GB 4IMKA 2MOVA 4HKZA 4X9HA 3ZT7A 3BI9X 5D70H 4MJIA 4WUKH 2ATPA 2Z4QB 1NQBA 5DJCB 4JQVC 2Y25A 1LILA 4BKLA 5CJOL 4YHYC 4JRYB 2WWMD 3CFBB 4S1RH 3RGVA 3IFNL 1WWWX 2C3VB 4X7DC 1ORQA 2VXTL 2M1KA 3NTCL 4PGBB 2OK0L 1AY1L 1JI2A 1M05A 3I2CL 1S9XB 5F88A 4WI2A 4U1JB 5BXFB 1JHTB 2KBGA 1G1CA 1U3ZA 1U42A 1HILA 1VEOA 2AJVL 2DQCH 5ITFB 5LAXB 2IAND 3O8XC 1DSFL 2C9AA 4EXKA 1T7ZA 1ZTXH 3JVGA 5E1HB 3TN0D 2W92A 4HKXA 3MOAL 4U1LB 5JMOC 2X9XA 2X1PA 4YEFA 1ZWIA 3CIQA 3MR9B 1FVEA 4LRIC 4XT1C 3D3VA 1AQKL 4MQTB 4X4YB 1MUJA 1P6FA 5CEXA 1MJ8L 4FG6D 3OKDB 3P4MA 5DEGA 4H26B 3CNKA 3LHPH 3U7WH 3C6LC 1F00I 1CFVH 2PF6A 1CFSB 1U91A 3OX8A 3GUTA 4KRNA 2ADGB 3PGFH 5EZJB 2HRLA 2JELH 4QYOB 1SJXA 5C0GA 4OZFG 5EIQA 3MJ7A 2ITDA 4QHUB 2N56A 5EUOB 1EO8L 4J3UA 4DVRH 1CFTA 3QG6B 1W72H 1X5YA 4HK0A 2AW2A 2Z9TA 3CH8A 2NX5B 4RFEB 3LMJL 1U8QA 5CILH 3EYVA 1A7RH 1B2WH 4DKAA 1N5YL 3B4NA 2I9TA 1UXWA 1FZMB 2E9JA 3G5VA 5T1KB 2E9WA 2YC1A 3MROA 5D96C 1I1YA 3GEWB 3RGVD 5T3ZE 2JE8A 4XHJC 3P9LA 3NACL 4UNVA 2VDRH 1HWGB 5I66A 3OF6A 2Y7QB 3TP4A 1KB5B 2JK5B 2CPCA 2H32A 2W65B 5D1QD 4WO4C 3VG0H 3SKNA 5FHBL 1A4KA 3PGDB 4QTIL 3QCVL 3PUCA 2QTEA 3VXPA 3L3KA 3RNKB 3KPNA 4ZO7A 2CUHA 2VQUA 3W82A 5MEQA 3WEXA 3TA3C 5E8PB 3W11C 5C6TL 4GKSA 3VH8A 1U95B 1LHZA 4RWYL 2VQ1B 2EYSA 1BECA 1EO7A 2D03L 4S1RL 3VCLA 4X80L 2DDQL 4P2QB 5C0FA 2GSIB 4NQEE 4UDUA 2AERT 4J4PA 4MA3B 2HKFL 1MJ7L 1NBZA 2EC9U 1FL6B 1S7XB 5DTFA 2R0LL 1M7IA 4JFZL 1U8NB 3QT2A 3WUWB 4DZBB 1JWSB 35C8L 3QIBB 1BZ7A 3GHEL 4XNYL 1JPST 2AS5M 2XRAL 3IF1B 1SY6H 2DTML 4PJ5D 4R2GC 1Y0LA 1RK0B 4ELMB 3LKRB 1ZA3B 3HUJE 4LAJH 3ZHKA 4D3CH 2R2BB 4MLSA 2PYFA 4KKAC 5EU7E 4NQCD 3QUMB 1T1ZA 2DYPD 2OQJB 2FX8H 1AJ7H 4XP9L 4DWHA 4I5BB 4K3HA 1TNNA 1TJGH 4IOFD 4I2XA 4JM4L 5CHNA 3U46A 5FUZL 3MV7A 3GSNL 3FAXA 5IFJB 4RCAA 3G6DH 1BJ1J 1Q9WA 2BVYA 1FFQA 3HN3A 3W81A 3WL9A 4QNPF 4APQA 1Q9KB 4O2FA 5IMMA 2QV2A 4YDKH 2CRYA 3O9WA 1W72A 1EUTA 1MFAH 3FQUA 3FQWB 4WI7A 3VDCA 1TTUA 4XAKD 2A1WH 1Z3GH 4IIQC 3V0WH 3MV9D 1T83C 5D5MA 2WZPD 1HNFA 1ERNA 4KTEH 3UO1L 2IPTH 1IGCH 4IMLA 4UDTA 1HHGB 2IPKB 2WINA 3H6JA 3JWOL 3GHBL 4Y2DA 5D7IF 2XICA 3B83A 2ZOKB 4LVOC 1N0XH 4NQXB 3O6KH 2OR9H 4NT6B 3R4DA 3BDYH 3OKLB 4EUPA 4ZUSB 3M8OH 1EO8H 3FQNB 1KJ3L 5DD5H 1U3HD 4WHTA 1OPGL 3UPRA 3HAEG 3VWJB 2Z8RA 1S7WB 2Y72A 5C2UB 5HD8C 3SDDA 1YUHA 3NABH 3GSXA 4KWUA 1U8JB 4OJFH 5C3TA 3ZHDA 5I73C 5FM4A 5ILTL 3ABZA 5FV2A 5C86A 2NMSA 1FFNA 3ARBA 3U36B 5FYJE 1KJ3H 3SGDI 3MV9A 1A9EB 3CXDL 4N1HB 4RFOL 1EUUA 1V05A 3MOQA 4DUWA 3M1BA 3CPLB 3V5DA 3WMSA 4M43L 4PJ8D 1N2RB 3H9ZA 4C83A 4DFIA 4JFDA 4X99B 1HZHH 4LSUL 5JUEH 1XGUA 3RDTB 4WI5A 4BSJA 1F4WH 1MI5D 1ZGLB 2CKBH 4R3SB 3K2MC 2GITB 1DDHA 1KUMA 1UQSA 1F90L 1SJVA 1QPPA 2NZIA 3QQNA 1FVCB 2P5WA 4R4BB 3ULVH 3MROB 3DSFL 4JG1L 3RDTC 4FFVD 2OP4H 5D4QA 2BOBA 1AC0A 1DBML 5HGHA 2X7LB 5DJXB 3GJFK 5HPMA 4R96A 3QCTL 3QRGL 1S9WB 1EGJH 4OLWH 2D7MA 1YECL 1WFOA 3SKOB 3FO2A 3VRLE 2AQ2A 2J88H 4FQJH 3UDWC 2H2PD 1RZIA 5GJSH 3WFBL 4H8WL 4XNUL 3U6RB 2DQDH 1OB1A 4LP4A 1DSFH 1U0QA 3VXOB 3BN9C 3G6AA 3LN9A 3RU8H 1LGVA 3QUXA 1QD0A 1KPUA 4OFPA 3B2VL 1TNMA 5F6HI 4NC1C 1XGYH 1ZLVH 1LE5A 2NY4C 1MCIA 1PQZA 4YJZL 5I30H 3VXRA 4AJ0A 1UWXK 3LHPL 4F9LA 1BJMA 1HH9B 1XT5A 1U2CA 5K9OA 1Y18A 3CFCH 3STZB 3QIBA 4J23A 5B39G 4EBQH 4L1DA 1BZ7B 2AK4E 5HGBB 3IF1A 5DD1H 5DFTA 1BFVL 3WHE0 1FFPB 3VFMB 3RTQC 5D5MF 4LQ1A 4P5KA 1XZ0A 5C0AA 3T4YB 3P0VL 1A7BA 3FN3A 1L0XA 4Z76B 3MRBB 4U7KA 2C1PA 4XP4L 3VGAC 5D7JC 3QQ9C 2HKFH 5C09A 3MTRA 2QR0B 3VFPA 1HH6B 2IWGA 4UTBL 4P0DA 4KZDH 3ZYJA 1S5HB 1Q9KA 1F3DJ 4O2FB 4WU5A 3ARVA 3NH7H 2OJZL 3KPMA 1FYTE 4LDEB 4P2RB 4PRHE 4YK4B 2APXA 3P0YL 1D9KC 4GLRH 4KKCD 3UX9B 4LKXA 2E7LA 1KJVB 3SKJH 1G0YR 3ARDC 2EDRA 3SOBL 4IRSB 3GI9L 2H26B 3BESR 4RISH 4ZAKA 1RU9L 3HR6A 3ZKQD 4I13B 4PTUB 3KPOB 4R6UA 2EDBA 4KTDH 4PP1C 4XPFL 1QOKA 1YC8A 4PJEE 2WSKA 4CVUA 5JORB 5MEPB 5DD6A 5MEOA 3IDUA 2VKXA 3CDGB 5KZCB 1G7LB 5FUOL 3FQNA 5DHVA 4Z7VB 1Q9OA 1WBZB 3LIZL 1XIWC 5JQHC 2ERJB 1FSKC 4DVBB 2XWTB 4YDLC 3IGAB 3FT3B 4TTGA 4MD4A 4L3CA 4YQXH 1HKFA 5EC1B 4ZUUB 3RVTD 3S7GA 5KVFL 5T1LD 1A14H 2OL3H 5DF0A 2HMID 5BW7C 4J8RA 3EO0A 5JNYB 3WJLA 4OZGA 5I8CA 5DQDL 2F54D 1ZVSA 3CPLA 3SO3B 2M2DA 4MA8H 4Y2DC 2YRZA 4C55A 3MRCA 4FQXA 2IAMC 4HIIA 2HLAB 4G6FD 3FKUS 4JFFB 2XZCL 1F8TL 2FATL 4I18C 2MQ3A 3AS0A 5IV2B 3O11A 1SY6A 3WNPA 4HC1L 4PJEF 3MGAA 1HQRA