4DKAA

Structure of editosome protein
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
127
structure length
127
Chain Sequence
QVQLQESGGGLVQAGGSLRLSCAASGRTSSLYSMGWFRQAPGKEREFVAAISRNGANTYYTDSVKGRFTISRDNAKNTVELQMNSLKPEDTAVYYCAADRFPTMEVVTIMTNEYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/immune system
molecule keywords single domain antibody VHH
publication title The structure of the C-terminal domain of the largest editosome interaction protein and its role in promoting RNA binding by RNA-editing ligase L2.
pubmed doi rcsb
source organism Lama glama
total genus 35
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dkaA00
1VADB 3KYKL 1CI5A 2G75A 1XF2B 2AJUL 3WFEL 1XGQA 1T2QH 1CXKA 4G8GB 2IFFL 1FNEA 1KC5H 3GJEA 1DQQA 2FX8H 3EZ8A 3EYSL 4QXTB 5TFSH 3MODL 4RFNC 4YQXL 5D7JA 3T3MF 4NCC1 5DFTA 2NY1D 3QO1A 2N7BA 4FZEH 3IXTB 1AQKH 1FZOB 2XZAH 1FLRH 4UTBL 1I8KA 2IPTL 1A7PL 2H9GA 3RJDA 3TP4A 2D03H 3RPIB 1HN1A 3ZMRA 4WUUB 1Y0LA 4TVPE 5GRUH 5C0GB 3O8XC 5F71A 5GRVL 4ZG1A 3ZDXF 2EECA 2UZXB 2MTPA 2DTSA 3PJSB 4D9QD 4I4WA 5CJQL 3T0XA 4DGIL 1D5MB 2HTKD 3MJ9H 1S7TA 1SJXA 3NFNA 3QUXD 1YEFL 2H8PA 5K33A 2BMKA 4KI5E 4HCRH 3I6LD 5HTSA 3H9ZA 3MUJA 3IDYC 3MQIA 2UWEF 5JQ6L 5DSCB 4ENEC 2PYEE 3VXSE 4PJEA 2BY1A 3C8DA 3NVQA 3AS1A 5DJCA 2V7HA 4IHOA 3LQZA 3O45B 4IDLA 1MLCB 2C1OB 2D4FA 5IESH 2A6DA 1BJ8A 2YMXH 1I8IB 4NJ9L 5BRZB 4R2GB 1XIWA 1M7DA 5IMOB 1BQUA 1GOFA 3HHRB 2X1QA 3JUYA 3ZDZF 3E3QC 2DM2A 1DQJA 5EBLB 1XGPB 4HS6A 4FXLA 4I5BB 1DBML 1I9JL 2IAMA 4LARL 1U58A 4FFYH 4PREB 4HPOH 1CFVL 2QHRH 3RWJB 4MA8L 3HPJB 3AMLA 3AROA 1I3RB 3WHXB 2XZCH 2DDQH 1KJVB 4Y4KD 1K4CA 4OZGE 3DHMA 3CFEA 2UZIH 3QNZA 4GUPB 4N0FA 2CH8A 1W72A 5MEPA 1C5CH 3EJJX 5CGTA 3GMNA 5SWQA 2DQUL 5J89A 1MJUL 3WJJA 4KV5F 1TTFA 4OLZH 5HDBF 5I18H 1UJTA 4TULH 2F53B 4AH2A 5FGRA 2OTUA 3GMRB 2QSVA 2DYPD 5IQ9B 4EKXA 5ANMB 5E70A 3L5WA 3WKMH 1JVKA 1R5IB 5F3BA 1FYTD 5IBUG 1QVOB 4ORGB 2X9WA 4AEIL 1NLDH 2OTWB 4ONFH 4GMTH 4QNPF 1I7ZA 3HMWL 4K3JL 3BP4B 4GXVH 5I74B 4M4RA 1B6UA 5C7XH 4XPBL 2OJZH 3BP7B 3NH7H 4G6AD 3RHWF 1QFWM 1ZT1B 3B8SA 1YNLL 4XVUD 2I24N 3S36L 5KS9E 2ADIB 4JVUA 3VGDA 2NZIA 4M48L 1DBKL 4J3OC 1G9EA 1B0WA 4GRWB 1WTLA 3RZCC 5J1AA 2E8ZA 5EU6E 1UWXH 3H7BA 1T5XB 3HS0A 3MJ7B 2HJFB 1A1OA 3D18A 1FJ1B 3P2TA 3STZA 3H9SE 5AEAA 3U9PL 4FQXB 4XP5H 4JFEE 4PPTA 3RUGE 3L1OL 4Y16A 4RDQF 1CDGA 3OKNA 1JWUB 3I84A 4HAGA 2VZUA 1QRNB 4L4VB 2NY2C 1F11A 3MGTB 3E1F1 2BRRH 4CMMB 3MRDB 3HNSH 3OF6D 2NYYC 2V5YA 2QSQA 1FN4A 3PXJA 1DQML 3HPLB 4YDKL 3CVHL 3QFJD 2Q7YA 1NCAH 2BSED 3EO9L 4NKIH 4LIQE 4K2UL 4MX7B 2ZSVB 5D93C 5T1KB 3NIFE 5ICZB 4KJWC 1Q0YH 1WFOA 1Q9LA 3BDYH 2AXFB 1T22B 4R4BA 2P8LB 4XVSH 3TCLB 1DLHB 2A77L 3VFRB 1NC2A 4R97C 3ARBB 3LN4B 5D7JC 4LMQI 2NNAB 2E9JA 2A0LC 1FVDB 3FOLA 3RZWA 3ARDD 4AT6A 2OQJB 4P3DA 4JRXE 5F70A 3R8QA 2NW3A 3MPCA 5CJOL 3ZLQC 4J8RA 5JA8B 4Y89A 4OD2B 4AG4L 3OKDB 2DBLL 4NN7B 2EEBA 3CC5A 1DFBH 5B8CB 2YOCA 4ZOEA 4OTXH 3LY6A 4DUVA 3BAEL 3RQ3A 5GS2D 4Z9KB 4HKJA 1AKJB 4JHBA 3RDTA 1GRWA 5BV7B 4IRZH 5SWSD 5DMGD 3ULVF 4X7CC 2IMNA 4F7CB 5I2IA 2Q8AH 3BRFA 4N0UE 5C0DA 1VKXB 2DBJA 5DJ6B 3HRZB 3S96B 2EYSA 5FB8A 3QDJB 5TE4L 4JHWH 5GGTL 2IALA 2GITA 2OM5A 2EDOA 3IAPA 4KMTH 5HJ3A 3QNXA 4WDIA 3QQNA 5I1AB 1EA9C 1XIWC 2EC8A 2H2SD 2HVJA 3V4VL 4EDXB 1MFDH 4KJQC 2VABA 1MCIA 1LO2H 3MBXL 4LRIC 4WO4D 4PGEB 3REWB 4X99B 1CDUA 2IAMC 4HT1L 4ZODA 1ZVSB 2ZP0T 2D7TH 4I9WE 4MJIE 4PJAB 4WFHE 2O5XH 4B7IA 3SGEH 1HH9B 3SGDH 5KVGL 4N8VG 4IRSB 1E28B 2KBGA 1MHEA 2R0WL 1ZA6B 4QRSA 3WJJC 4DEPB 2ZUSA 1DANU 2EDQA 3V0WL 4QRPD 4H88H 1I3GH 1NUGA 2X5PA 4JN2A 1SYVA 2FSEB 1QA9B 5HVGB 4YEFA 1UH3A 2DOCA 2IAND 1LWRA 1S9XB 3B5TA 4MNQB 1C5DA 3RWFB 3UTTB 3I02B 4JY5L 4PRPD 4X6BB 5DXWA 1J18A 2W9DH 2PXYA 1F3DJ 3BP6B 3VXRE 2Z8RA 3MNZB 2XV6B 5D2LE 1J5OH 2BRQA 2X40A 2XRAL 1W0YT 5CBEB 3D3VB 5F7MC 4J3WA 3OX8B 4P23B 4PJCA 1A1NB 1BD2B 4WI8A 2EH7H 3NPSC 1CZ8L 2CRZA 4LBEA 1W72H 3KS0J 4HWZB 3P4NA 6FABL 3NIDE 2KPNA 2X9XA 3HNTH 4HKZB 4QHLB 5I16B 3OTTA 1MRCL 1LDPL 1JGEA 1VENA 4OQTA 4Y16C 5KSBA 3SHSA 4F7TB 3QHTC 1CICC 4Z7UA 5I1CL 5T1DH 3VXNB 2LU7A 4L4JA 2X4OA 4EN3D 4YC2B 2EDTA 1Q9WB 1UXWB 1ZANL 4UV7H 2HT3D 1RIHL 2WWMC 3QZWG 1XGTB 5D5ME 2FZ3B 4MCZB 5F7HA 5BVPL 5DC9B 4LNRA 3DX7B 4FNLH 4LCIH 3HZYB 1WICA 1J0ZA 2AV1B 3ELAT 4MDJB 2AEIT 5LGHL 1P4IL 1Z9SA 1MIML 3WFCH 3JWNC 4JZJB 4ZSOA 5GRVK 1RUAH 4NQCB 2P45B 4KZDL 2XY2A 4Z7QE 5T3ZH 1TZGL 2YUWA 5DJYA 4JHZA 3ARUA 5FHBL 12E8L 3GDBA 1FZJB 3HC3H 2YA1A 4ETQA 3UPAA 1QHOA 2AJXL 5IIEA 4Q58C 1LMKA 2GEEA 5C86A 5DJZA 5CILH 4MJ5B 3HI5L 3PHQA 2JCCF 3NCFB 4O4YL 1E6OH 1HEZA 5EC1B 5DGRA 4M7ZC 3QDGD 4S1RH 3HZMB 3P11L 2HWZL 1JUFA 3RDTC 1JMZA 1OPGH 5TE7L 5I1IL 2VQ1B 2QSCH 4OD1L 4NM8H 3D69A 1L9NA 5I1EH 4G6MH 4NJAH 3TO4A 3RL1A 1QR4A 2ZKHL 2B4CH 5HHNA 1UEYA 4YDIL 5GQBA 1YJDH 4QHKI 4X6CB 3PGFL 1QRKA 1NFDA 4KGJA 3SJVA 4R4FL 1J1PL 2A73A 2D0GA 3H9HA 3NACL 3BZFB 1G7PB 5SX5K 3UTSB 1KCSL 1AO7D 5FO7A 3FN0H 4UB0L 2QQNL 2QADD 3EFFA 1UXSB 3DROB 1GC1H 4JPVH 1RZKC 2BDNH 3ZTNH 4G8IB 5JR1L 3ZKQD 3DURA 2ATPA 5F7DB 4LCWB 1LK3L 2OSLB 3TIDA 2HH0L 3VXUD 5DQ9B 5FGCB 4WEBH 2HKHL 5E0QA 3DARA 3MRLA 4HIIA 5CGYC 5TDOB 3GI9L 5JMOC 4U3HA 2R29L 1XR9A 3HAEB 1NBYA 4PLKD 4XAWH 3MLSH 3WFZA 1JTTA 1A7BA 5AD0A 3O6KH 3FTGA 4KK9D 1KLGA 1HDMA 1A7NH 2UV3A 3DV4A 4KH2A 1VDGA 4P5TD 3VE0B 5GSVA 3LKSA 1DZBA 5ICYA 4GMSL 4YDJA 3V0AC 2AQ3A 4JO4L 3FFCE 1TVHB 5TF0A 3T1WA 1INDL 3MMEB 3ARVA 1UENA 2X4TB 1IAKA 3IS0X 4XWGH 4NYLA 5F7EH 5C09B 4J7RA 4X6DF 5H37G 2RB8A 1YPZB 1DBJH 4HC1L 5HGDA 3RPKA 1FL6B 2PXYC 4PB0L 2P8MB 3LZFL 3OKEA 3X3FH 2P5EB 4NHUA 2C3VA 1KXVC 4Y5XB 5GRXG 3GSOB 5GHWH 4UT6H 3C8KA 5F7UA 3MRCB 3O3AB 4KQ4H 4O9HL 2ENSA 1WBZA 2VDKH 3DX8B 5ISZD 1BF8A 5CMAA 1FBIH 2R9HC 1F3JB 2EDFA 3QUMH 3RX7A 2LU3A 1PVHA 4E41B 4YHYB 1BFTA 3MLVL 2OJEB 4JFFE 5EUOF 3AM8A 3QEUB 3FO0H 1NBZA 2CK0H 5ADOH 4TPRL 4YO0B 5DI8B 5DRNA 4WUKL 3FQUA 3S7GA 3A0OA 2XYCA 1KPRB 3QUXA 4MXQD 3LHPH 1DBBL 2X4PB 1R3IH 3S37X 1HZHH 3HLAA 4NO3A 1C16B 2VL5B 1K2DB 1M6OB 1Z0NA 5MENE 4HIEA 1VGKB 4JO3H 1KENH 3VFOA 3ROOA 5FKAB 5D1XD 1V7NH 4Z0XB 1F58L 1YDPB 2BSSA 2QR0A 1A4JA 1MH5A 1NCBH 5IBLC 5BJTB 2RR3A 2F8VA 3ZKND 1EUTA 4PJ5E 3E6FB 4EI5A 4QXUL 5LXGL 4MA3A 1DUYA 5IM7B 3OL2A 1IC4L 3IDJB 4XC3L 1NGZA 2ZPKH 1T0NB 3BEWA 3KXFE 1D5XB 1T03L 3DUSB 3P9MA 4OSUH 3QJFB 3WFDL 3QUZD 4GO6B 2EE9A 1QLFB 4WV1C 5DEFB 4CJ1A 5FYJD 2IC2A 3MUGB 5GJSL 5FOBB 4H0IA 3FFDB 5HYSB 4Y4KA 4XNZB 4MA7L 4ZPVB 4K94C 4IMLB 4XP4L 2FBJH 4M02A 5J6GB 2IMMA 3BHBB 2AK4D 1HI6B 3C5ZD 4OLVL 5IJVB 2A83B 5J11C 3TO4C 5JLZB 4N90D 1JPFB 3SKUD 5LWYL 1I1AD 4YBHA 5I1JL 1FYTA 3VXQA 4NQXA 2WUCH 2PCPA 3OR7B 2D7OA 1IQWL 3BP5B 1KCUL 3Q0HA 4C59B 3U2SA 1IC7H 4OV5B 5FKPB 4KROB 2Z93B 3FT2A 2WIIA 5DMYA 4OGXL 1KCRH 2YZ8A 3GRWH 5EZIH 2JIXB 4LLWB 1AD9A 2WZPD 3IKCB 2VZSA 4XI5D 3BPNB 5GZOD 5F9JB 4JFHD 4KUCD 1A6UL 4X6FA 4QRRD 5FDWA 4XPFH 5D2NE 3TC9A 1H8NA 4KXZH 1Q94B 3IRZA 3VXSB 1G7LB 5GZNC 3S5LA 3OXSA 2C9AA 5EO1A 1PZ5B 4AM0B 3LKPB 3DVGA 4JKPL 3R0MA 1XEDA 2OL3H 3FB6A 3HUJE 4OLYH 1JWMA 2XZZA 3QCUL 4NQDD 3OF6A 3H8NA 2IH3B 2CR6A 1RU9H 2NXYB 2DQIH 3MLTA 3FO1A 5HYEA 2X41A 2NLJA 3RGVD 4Q9QL 3GMOB 1A2YB 1U8HA 4R7DB 3CVHA 3WO3B 1R5WB 5GGQH 5L9DL 4RGMC 4O58L 3RWIA 1U36A 5DD3H 4DN4L 3G6DL 3I3BA 1LNUB 2WBJD 4HHAB 4OB5H 1J0IA 4M1GL 1LE9B 3PDOB 1R24B 4OZGB 1GHFH 4BZ1H 3LH2L 3CFCL 1MHHA 4QOKE 3FQXA 1JWSA 2VL4A 4BQ8A 2ILLA 5C71A 1AD0B 3EDKA 5KZCB 2VLJD 2QTEA 2R56L 4KZEH 2WP3T 3SE9L 1OSZA 1SEBA 3T3ME 2VXUH 5FM5O 1WITA 4JHAH 4FZ8H 4CVZB 1KB9J 3AM8C 4P3CL 2C3WA 3DXAE 3KYKH 3DVIA 1MHPL 4QHNB 5IT2L 4RMSA 1F90L 3IF1B 3PP3K 2AJUH 5IK3B 3D0LB 5DO2D 2HTKC 3WFEH 1IQDB 2J7LA 3T09A 3QUXC 4XPTL 4NQVA 5SWSA 5F9OL 1OTUD 4QWWC 4AJ0A 1KIUA 3TN0D 3ZDXE 5CKAA 3EYSH 3HE7A 3H9YA 2F74A 3MODH 1INEL 4XMPL 4YQXH 5F1NA 5E4EB 5KS9B 4U1JB 1U3ZA 1FZOA 4RIRA 2FD6L 5FAAA 3C09B 4UTBH 5EU6B 5F8QC 5GGTA 5TQ0H 1U3JA 2IPTH 1A7PH 3RP1A 5CHNA 3JWOL 3P9LB 4WVRA 2CGRL 4EI5C 4YAQA 2H6PA 2DI9A 4WO4A 3AB0C 2YPKB 1NFIB 4JFEB 3RUGB 4YHML 1JHLL 3VI3E 3CX5K 1PX3A 3FZUC 1RPQA 4FQIL 5I1DB 2P44B 3DVNA 4AENB 1D5MA 4MXVF 4DGIH 4DZ8B 4P9HL 3OV6A 2QEJA 2QQQA 1YEFH 4Y4KC 3TBVB 3ZDZE 4MVBC 4RNRA 4H20L 5JQ6H 3QG7L 4ZTPL 3F7PC 3RWGB 2XQBL 1F6FB 2XG4A 1AGDA 2F15A 4O2CA 1KOAA 3SDAB 5B3NA 2BY2A 4N9OB 4QRPA 3OKMA 4YXHL 4GLRI 2EICA 5HBBA 3I6KA 5BRZA 3GSXB 4JRXB 4ODSH 5IMOA 1BJ1J 1F8TH 2IANA 4R90L 4P5KB 5F1OB 4ELKA 1JYVA 1JZ7A 2KKQA 1WEJL 4PJ9D 5SWZD 3L5HA 4PRPA 4MSWA 3FQTA 1LO0L 4KV5E 4PJ7A 5HDBE 4HK3N 3EUUA 4NN5B 1DBMH 1I9JH 4U1NA 4ZS6D 4LARH 2DQHL 4RFEA 1PKQE 2CDEB 2O5ZL 4G6AC 1KULA 4Q6IA 1CFVH 5SX5H 1MI5E 3VXPA 4MA8H 5F7NC 1D6EB 2BOCB 4XVUC 3ISWA 4YGVB 4MWFB 4DQOL 3NCJL 2P43B 4QNPE 1IGML 3F6IA 4HWEL 5INCB 4N0UB 4L4TE 1JYWA 2EYRA 1T1YA 3M1BB 2YC1B 2DQUH 5MI0C 5D7IA 1MJUH 4I2XA 5HY9B 1FO0H 3OG6B 5JW3L 3QQ9D 5F1KC 5E5RB 2DKMA 3QH3B 4O2FA 4XXDB 4CVXB 3NA9L 1KPVB 4QF1A 4N8CH 1WSST 1MCJA 4N1EA 2E6QA 1IE5A 1Q0XL 5D1ZB 1HCVA 4AEIH 1U8NB 2X44D 4E42A 2MHAB 1N6QL 2CO7B 1OTTD 2Y5TB 3UZQA 4TQEL 1ZLWK 3DOSA 1TZIB 3HMWH 4K3JH 3RVWD 3MV8D 2BJML 3VWKB 5HGBA 3BP7A 4XPBH 4G9FD 4W70A 3N50A 1ZT1A 3X14B 3IJHA 4PB9H 4L8SB 4MJIB 1YNLH 2ADIA 1YC7A 5C0CD 1UJ3C 3S36H 1P5VA 3CZJA 3OZ9L 4M48H 1DBKH 1UG9A 5HPMB 2Z4QB 4HEME 1HKLH 2XWJA 5GGRB 4NO0D 3U9PH 4CDHA 4X5WA 1NGWA 3L1OH 3RL2A 4LEOA 3MGTA 1T5WB 4K3DL 1Q9OA 4PBXA 3QIUD 1TDQA 1WWAX 5BZWA 4YDKH 3NBNA 4WW1A 4MX7A 1OY3B 4K2UH 8CGTA 1KEGH 3VFPA 3VXRB 1HKFA 5D2LB 1EFXB 4XCNB 3MLUL 1RZFL 2A77H 3HE7C 3DSNA 3O4OC 4PRDB 5DK0B 5FYKD 3OKOA 4H25A 3VFVA 1NANH 4LASL 1O0VA 3ULVE 2ICEB 4X6EA 2H2SC 5CJOH 3ECBA 4LLQA 5K9KB 1JF1A 4WENB 4WO4C 4AG4H 2ADJB 1P7QD 2X4NA 1QSED 4ZDHA 2DBLH 1QBML 4OCWL 3VXUA 1CFNA 4U49A 3KLAB 4G6FB 4QTHB 1KTDB 3QUYB 3BAEH 1G0YR 5HYJD 3FT3B 3LRHA 3U7WL 5D5MB 3X12B 2VZ3A 4IBLT 1KGCE 4F7CA 4D94A 2X09A 5IVXA 3K1DA 3IDIB 4RBPK 1XF3A 3K2MC 3PQYD 5AUMB 5D71L 1UKQA 3VGAB 5CZVL 2V7NA 2WINB 3CXHK 3MZTA 2VDNL 5T1MA 1X5FA 5TE4H 3TNMB 4I77L 4L9LA 1IGYA 1EEUA 1WLHA 2LAGB 3MGOB 4L3AA 3U4EB 3HR6A 1AGFB 4K9EL 5BMFH 1S7WA 3MBXH 2RBLA 4FQLL 1RURL 5DHXB 4X5XA 2AJVH 1QSFE 2FJGB 1J11A 4HLZH 4P4RB 43C9A 1K9TA 4H1LA 4HT1H 4O2EA 1KCVH 2IBGA 1PKOA 1LK2B 3EYFB 4HDIB 5INDB 4Q6IC 3NFPB 3QXVA 3L6FB 2CDFA 4Z7NE 1P4LA 4YHKL 5DHVA 4GFTB 3RU8L 4FTVD 3WV0A 2BX5A 3CFKA 4MQXD 2UYLA 2HJKA 1KYOK 5KVGH 3MROB 1E28A 4WW2B 3PWUA 4OZHE 3CJJA 4QKXB 2R0WH 5E5MB 4PJCF 1R6VA 3V0WH 4LSQL 4MD4B 4Z7OF 1U3HB 5EFIA 3VFWB 5DJDB 3BZ4A 4P2RD 3V6OE 4MNQA 1G7QB 4X4ME 3RWFA 2HT3C 3L3HA 1AC0A 4QLRA 4NZJA 2LVCA 2AV7A 3DX6A 4JY5H 4FXKB 1EEYA 1U8OB 5KSBF 4Z7UF 5IROA 2W60A 1QSZA 2I9LB 3WNLA 5E9DD 3HE6D 3QFDB 2XRAH 1A9EB 1NEUA 4JE4B 1BD2A 1VESA 2PETA 2V9TA 4LHQB 4EI6B 1BX2B 1CZ8H 1XGUB 4HUUA 4XBPA 4ZUTB 1UB6A 1EGJL 5C0ND 6FABH 1IAII 1MRDL 1MRCH 3QUZA 3FFCB 3X17A 4PRHE 2XN9D 4PD4J 5I1CH 4CW1B 1RD6A 5C6TH 3S5LG 5J57B 4HUKB 3SDXB 2NX5D 4FQCL 1R3HA 1RIHH 2VZVA 2ZSWA 5BVPH 3C2SA 1BVZA 1OP9A 3UYRL 2E7MA 3C5ZA 3HCVB 2JCCE 3HMXA 5F9WB 1HOCB 5LGHH 1FZMA 1P4IH 1MIMH 3WL9A 2JJSA 4NQCA 1I1AA 4APQB 4JVWA 1EHNA 3OXRB 5ESAB 2FIRT 5FHBH 12E8H 4FQQA 4U1MA 1K4DB 3GSVB 4C54A 2AJXH 3C6SB 4PJHA 3SKOA 4UT9H 3KYMA 1S5HB 1K6QL 1QEWA 2WV3A 3BRGC 1LEGB 1NFDF 4POZC 2EDJA 1KFAL 4O4YH 3EYQD 3MRGB 3QULB 1RI8A 3R8BB 3W82A 4QRRA 1ZWIA 4MB3A 3P11H 5MENB 4PLKC 4BFBD 2HWZH 5EOTA 5TE7H 4BA8A 1LP9A 4OD1H 3TZVB 4KK9C 4RMVA 5HYQB 3SDYL 4ZO9A 1JIBA 4CVUA 1FHGA 1A64A 3MR9B 1LQSR 2AJYL 3LEVL 3F7QA 2ZKHH 4YDIH 3MOAL 4I8DA 5EUKB 3VI4F 4NQDA 3PGFH 4PJ5B 3Q5TA 4Q97A 2XNAB 4R4FH 1J1PH 4YHIB 4HXBL 5H2BB 3NACH 5CINL 4L9LC 1QPPA 4KHTL 3RGVA 4OLEA 3WUZA 2KZ1B 4UB0H 4LAQL 3KXFB 2QQNH 3Q6FA 4WEMB 5FO8A 3S34L 2JLLA 4JZNA 1KTLA 2PTTA 4JFZL 5JR1H 4G43B 2WBJA 1RFDL 3D0VB 5C6WH 4XCYB 3ARRA 4RGNE 4MNHB 1LK3H 2HH0H 2XPGA 2BC4B 1V3JA 2HKHH 3DSFL 2R29H 4XVTL 1FFOB 1LILA 3L9RB 2VLJA 1JGLL 4S2SB 3FRUA 3V52L 7CGTA 2C3HA 2PF6A 3VE0A 4YEEA 1UWGL 2Z92A 2V5RA 5JPNB 1WAAE 4GMSH 4JO4H 1E6JL 4QYOB 4X9IA 1INDH 3PIQB 3BVNA 5HHPA 5J06A 4JPIB 1LD9A 4MXQC 4Z78A 1IKFL 1V7ML 3E6HB 1OD7A 1UEMA 2I60L 3CPLB 3S3PA 5EORL 5F7WC 1YPZA 2MJWA 4PRIA 4MZ3A 5EUOE 2YSSA 2AXGA 3GSNL 5ALBL 4HC1H 3V5KB 2RAMA 4MQ7A 3QXUA 3GSRB 2P5WD 2P8MA 1X5ZA 4PB0H 1XGRA 3D2UD 5IROC 4R96B 3LZFH 4JJ5B 1JJUA 4K71C 3QI9B 4K7PX 5D2NB 5DTFA 3MV9D 2NY4D 3K8KA 2NZ9D 4O9HH 1ZLWH 1KIPB 3ZKNC 4P5MB 5L8LB 3PGDB 1ZLSL 1PYWA 4PIRF 1RZGA 2WWKO 2Z31B 1FCCA 3S88L 1EXUA 5CEXB 1GSMA 5E94B 3BN9D 5DI8A 1A7RL 3O11A 4LK4A 3QYCA 3QUZC 4TPRH 1BWWA 5EU4B 3V5DA 4WUKH 4HZAA 4U05A 3DJ9A 4OCSL 3CUPB 3T4YA 5GRZA 1DBBH 3KYNA 4K7PY 1WZMA 5EN2B 1S9WB 5C08E 5JHDE 4OQ1A 5T3XL 1CK0L 4UZGA 1HXYB 3C5ZC 5JORB 3CSGA 5T3XD 4LCUB 1F58H 1VFAA 3SDCA 2AGJL 2P7TB 1CL7L 4KRPD 4ZYKA 5ITFB 3E3QE 2JJSC 4QOKB 1HQRA 1I1AC 1OAQL 4PJXA 4WHCA 3O9WB 4ZO8A 4L8BA 4QXUH 5LXGH 2J5LB 5IM7A 1ACZA 4PJ9A 5FA4A 3GIVB 2HT2D 1IC4H 2ENYA 3LEXA 1I4FB 4XC3H 5DEZA 2IEPA 2AJZB 2VSCA 2DLTA 2IADA 2ED9A 3WDHA 3PWVB 2QKIB 3DXAB 3BN3B 3V2AR 3WFDH 5C0AD 1HINL 4YPGB 5DEFA 3B3IB 1QO3A 3MRJA 4WU5B 4HUWA 1AE6H 1K8IA 1B2WL 5KTEL 1TNNA 5A3ID 1A6VL 5GJSH 3DO7B 1F45A 1WISA 2GW5A 3ARED 4XI5C 5GZOC 4MA7H 3CH1B 4JFDE 4IMLA 4P57A 2W65B 1BZQK 4XP4H 4X8JB 5F6IB 4I1NB 1N0LA 3BX7C 1S9VA 3K46A 3MNVB 3QUKB 3NAAL 4BFEA 4DVBA 2H3NA 1HHJB 2V5TA 1OAZL 3D5OF 5LWYH 2OR9L 5I1JH 3ARYA 3U30C 2H32H 4IOFD 3EKCA 3STBA 1LEKB 4RBPH 5I1GL 4MLIA 3IDMA 3IDGA 2IBZX 1IQWH 1KCUH 2A6JA 3RGVC 3A67H 1A6ZA 2AQ1A 3IRPX 2G5BA 4HLJA 5TGBA 3U0PB 1QFHA 3MV8A 2CJUL 4G9FA 1LO5A 4PG9B 3N1MC 4UNVA 4OGXH 3WCYA 2Q86A 3ZTJG 5I0DA 4OGYL 1T83A 1I8MA 3BH9B 5C0CA 2OMBA 2WBJC 3F6LA 1IAIL 2AAVA 5ERWA 4YR6B 4LSPL 1X7QA 1A6UH 3O0RL 2P1YA 1I7TB 3BEVB 2N4IA 1F13A 5D6CB 2VIRB 2JJVA 4NO0A 4JKPH 4B50A 2DM7A 3U6RB 3T0ED 4DKFL 5CJ8A 1ZS8A 4UMGA 1NCCL 3CFIC 4GKSB 3U4BL 5FA3A 3BKJL 4JY6B 3REVB 3WIIL 3U1SL 5KOVC 2MCPL 3V9FA 4NZRL 3QCUH 1LGVA 3QIUA 3RBGA 1MCDA 2DIJA 2B8OT 5HGHA 5HDQL 4HK0B 5DO2C 2MQCA 5I17A 3GMOA 4Q9QH 3LS5H 4IS6A 2I07A 2QBWA 1DSFL 3ES6B 5FFLA 1R3JB 3HR5B 1G6RB 4G9DB 2BVOA 2ICWJ 3IU3B 5L9DH 1PKQB 3QEQD 3TJHC 4JDZA 2PW1A 4O58H 1MI5B 1LNUA 1U8JA 4DN4H 3G6DH 4XHQA 2OYPA 4RZCA 2DRUA 3GSWB 4M00A 4PTUB 1IJ9A 1T3FB 3MUHL 3Q6GL 5IFJB 1PJ9A 1MCWM 4U1GC 3LH2H 3CFCH 3O2WL 4L4TB 4J3XA 2CR3A 1NCNA 1ORSB 2R1YB 3TIEA 2Z91A 4UQ2B 3DBXB 2R56H 4H1LG 1EEZA 3SE9H 1P7QA 2OZ4A 4UINL 1EH9A 1QSEA 1NGYA 2V17L 2ZCLL 4P3CH 3QWOA 3KGRA 1BQHB 3EFDH 1XR8B 3QAZC 1MHPH 5IT2H 1GZQB 3IF1A 1F90H 2X4UB 4IIQA 2E3VA 3LDBB 4XZUA 4LLDB 5GGUA 2IH1A 4PJEE 4J2XA 3BW9B 5EZOL 1FFPA 3R4DA 4XPTH 4FHBD 1BFVL 2OR8A 4M5ZL 3KJ4B 5F9OH 4P9HC 3H6JA 4QT5B 2HA1A 2XICA 3JTSB 4F15B 3HZVB 4XCCL 3ARGB 4Y1AD 4NQSA 4GBXD 1X3DA 2AXJA 3CZFA 1RAMA 2BSRA 1S7XA 1INEH 4XMPH 1C08B 3DUHA 1A6AB 4P2OD 4MXVE 5FO9A 5C3LD 5JW5B 5JW4M 2E7BA 5CIPB 5IOPB 3SDCC 4O51A 2FD6H 3HG1A 3BIAX 3CFBA 3CXDL 1I7UA 4KU1A 4GAYB 4F8QA 5I1KL 3JWOH 1TTGA 2NY3D 5GRJL 3EYOB 2CGRH 2FHCA 4PJ9C 4Y4FB 4HH9A 5IVOA 3LPWA 4YHMH 1JHLH 5ICXA 4Y5YB 4D3CH 2HFEA 1IMHC 4YFLI 4ZS6C 2FH6A 2EDDA 1E4JA 2V9RA 3P0GB 4FQIH 3ARBD 1L6ZA 5GJTH 1NSNL 4LRNL 1T1WB 1SY6L 5LJYH 1FPTH 4P9HH 4BSJA 4JKWA 4YZFF 4NKMA 4PJ7F 4M1CD 1P4BL 1ODAA 5IKCB 3D39B 2EYTA 3L3DA 4H20H 3RWGA 3QG7H 2YA2A 5HHVL 4ZTPH 4JDVA 2XQBH 3FB8B 5C70A 3T0WA 4JY4A 4YIQA 4PGCB 2M1KA 4A2MA 3QQ9C 2EO9A 4YXHH 3QNYA 1H3GA 2ZZUT 2NCMA 3PE9A 2D7PA 5BV7L 4R90H 1AKJD 4U6TA 3WIFB 1WEJH 4HV8B 3SKNB 1LO0H 2XKNB 3FB5A 1OTTC 2MFNA 5I71C 2EH8L 3MLXL 1YEIL 3FQNA 2E7CA 5E8NB 3HE6A 3SPVB 4F7PB 3LV3A 2DQHH 3V6FB 3MZGB 1WWWX 5TH2B 1D6EA 3BUYA 3MYZA 3O41B 4IEFB 1M7XA 4DQOH 5DA0B 3NCJH 3QXWA 3FHQA 1ZLVK 1IGMH 4HWEH 5JPMB 4MYWB 3WS6A 1SJVA 1B4RA 2OBGA 1N6UA 3BPLB 4LPWA 3GM8A 3L95B 3GMQA 4F3FA 1EAPB 4NFCA 1G9MC 1UCBL 5CWSA 1VB9A 4ELMA 3VA6A 1IEAB 1T21B 2X4SB 3U0TA 3NA9H 5HGAB 3BWAB 1RUKL 2XIDA 3MRPB 5DJAB 2LU4A 3QIUC 1HHHB 1ZOXA 4CJ0A 4JREB 4TUKL 1Z2KA 3FAXA 3UTPE 1N6QH 5H8DA 4TQEH 4IRSD 1QSFB 4PRBB 3O3BA 3FONA 2BJMH 1JK8A 3JV6B 3C2AL 1LEIB 1K3IA 2L7UA 2IFGA 2G9HA 1X6LA 3FB7B 3OZ9H 1PY9A 3ZO0A 3DTXB 2Z4QA 2ZCKL 2H26B 4L3CB 2VNCA 1DE4B 3T2PA 3FCTB 3OR6A 3MOBL 3WDIA 3JTTA 4EZMA 4PYHA 2ZUQC 2VDPL 3C5SB 1A3QA 4GRMB 1WT5A 2ADGB 1S9KC 2CLZA 1U8MB 4LLMB 2ERJB 2Q76B 3BD3A 2R1XB 4K3DH 4P23D 2X89D 3D87B 4UDUB 3EOTL 4NRXA 4IIQC 3B83A 5I76A 2W0LA 2DMBA 3GSQB 4LFHD 1Q9KB 1L7TL 4QRUA 3LB6D 5HSFA 4N9GA 5EBMA 5BO1L 1L9MA 3MACL 3MLUH 1RZFH 4XBGA 1TTUA 2DMCA 4LPTA 5I1LB 5ACLA 3SE8L 1DBAL 3B9KD 2NY0D 3BISA 3MGAA 1IM9A 3OGCA 3VG0L 1FVCA 5IVXF 3ORJA 1YYML 4ZFOL 1P84K 5EIQA 3BJ91 3L7EA 2RFXB 5EIIA 3MRHB 4K9EC 4PRHB 5DD1L 1AP2B 4XNQB 25C8L 1F4WL 2B5IB 5EOQL 4AEEA 5IBUB 3UJIL 3O6FD 1QBMH 4OCWH 2ARWA 2HG5A 3AU1A 4QTHA 4YFEA 3ARPA 4UIKL 3EAKA 3C6LB 4HH8A 4FQ1L 3X12A 3DWTA 3U7WH 3SBWA 4XAKE 2E8YA 2C1PB 4W4OA 5I8EA 4DN3H 4MQXC 4AL8L 4OZ4A 2JCCB 2VITB 5BS0D 4PP2B 3OAYK 4BH8A 5D71H 3OAUL 2ICWB 3MCG1 5CZVH 3H42L 4L3ED 2VDNH 3LKQA 3QDHA 3UAJD 3WS3B 4OF5A 4I77H 2GUOA 1A6TB 3WLWD 4K9EH 2DTML 1G6VK 3VFNB 1KB5B 1RURH 5KBNC 1MIEL 2P5WA 1VACA 3D2UA 1RZJL 2MQ3A 2XA3A 4Z7OE 3HE6C 1E4KA 1CIUA 2YD5A 1P53A 2BNUB 1PEWA 3MV9A 5J1SC 1TZHA 4YHKH 1Y18B 3RU8H 1CD0A 2G2RB 3MROA 4Y2OA 3HZKB 3MRNA 5KSVA 4JZOA 4N8PA 5IG7A 2J6EL 5KSBE 3WS6C 4Z7UE 5C0NC 2CIKA 5MHSD 1QSVA 4RAHA 1F42A 1FV1B 1ED3B 3MREA 4LSQH 4LCWD 4LVNC 5BVJA 4JRWA 5JOFB 1U3HA 3CDGB 5DJDA 1GGIL 4DKEL 1NDGB 1GXEA 1XCQB 1FL3A 1FSKC 1OVZA 4LU5H 5FF6B 3MLZL 3K8MA 4RGOL 5IB3B 4ZSOE 4WGVB 2FJHA 1YNTB 5JHLL 5F7LB 4LDEB 1ZA3B 2HLFC 4ODHL 4RGNB 5B4MC 5GS3A 3PWJB 4OUOA 4M61B 3ETBF 2D9CA 1XF5B 1MVUA 4X6DB 1BX2A 5M7QA 1GL4B 4XNMB 2WWKT 4MJ4A 3QSKB 3MRRB 1KYOJ 5C09D 4CAGA 3QPQD 1TCMA 4HBCL 4LSSL 1EGJH 2FEDD 3UYPA 3C5JA 1U95A 1MRDH 5C0AA 1WBXB 2BNQD 4X0KA 5L88L 5TDNB 1T4KB 1MFEL 5FYLE 4JQIL 2ID5A 5DQJA 4Y5VA 3SCMD 4Y88A 3DV6B 2JK5B 1WQVT 1WT5C 4HG4K 3EYQC 4RFNB 3AREA 5D7KD 3G5XA 3T2OA 5CS7A 4YHPB 5B3JF 4FQCH 4GLRH 5EUOB 2EIDA 1B6DA 2PYFB 1FC2D 2XWBA 1XH3A 2V5MA 1XFPA 2YRZA 5IHZA 2HRLA 4ONGL 3UYRH 4LOUD 1NFDE 3SJVE 4WI3A 1JZ8A 3O8XB 3A6CL 3RWDB 3RVXC 3LOWA 1MCBA 1U8KA 1MFNA 2V6HA 4APQA 2AABL 3T1FB 1ITBB 1G7JB 2QHLA 3KPMB 4N8VB 5DS8B 5CSZA 1LP9F 3G5ZB 1NGXB 3HNVL 1OGTB 1KCLA 3F12A 4C83B 1K6QH 3IDNB 3IDYB 1HILA 4POUB 3VI4E 3EO0B 5KN5A 2AJSL 4RMWA 1KNOA 2YUZA 2R0LL 5K9OA 1KFAH 4Z7WA 4JFOA 3SDDD 4PV8A 2FX7L 4JFYA 4KUZH 1ZHNA 5CFHA 2D31B 5C08B 5E1AB 4C58B 43CAA 3LMJL 4W4OC 4ZUUB 5GS1A 3BRDA 2F5BL 3BFOA 4P2QA 5B39A 1PD6A 4J12A 1EZVX 2A74A 3T0EA 5TQ2L 6CGTA 1NCUA 1OTSD 2AJYH 3LEVH 5EUKA 3CFDA 5GGSA 3GMMA 3MOAH 1JV5B 4OT1H 1AGBA 3NMEA 3DPBA 4HXBH 5CINH 2DKUA 1HXMA 1ZTXH 2IPKB 5KSAD 3QJHB 4KHTH 2D3VA 3ZYZA 4OF0A 4LAQH 1NC4B 3E2HC 1P2CB 3S34H 3KPQA 3UX9B 3BWUC 3DRQB 3B2VL 3QEQA 4JFZH 1ETZA 4X4YA 5IB2A 1JNNL 2A6IB 2DAVA 5CSGA 1EZVY 1RFDH 4YFDB 1B0GA 5D7LD 2Z35A 4ZFFB 1E4KC 4ZD3L 1U3YA 1T1ZA 5C0EB 4TVPL 1KEML 1YMHB 3B43A 3DSFH 4XVTH 1FFOA 2NY4C 2NZ9C 3UBXA 1BJMA 1HSBA 3FOMA 4NO2B 3BPCB 4M4PA 5DJXA 4X4XB 4EEEA 2ICES 2NY6D 4D9QE 2ESVD 1JGLH 3D25A 4R3SA 3MRMB 3V52H 1H3TA 1AHWA 5JXED 5I9QC 5LGJB 1U2CA 5IF0B 3PABB 1UWGH 3I6LE 1BLNA 4BSVA 4QYOA 2JIXD 5EU5A 3PIQA 1ZLVH 1E6JH 1MJJA 4UBDD 4DUWA 2JF1A 2RHEA 4MJ6A 1Z0MA 4U2ZA 1UVQB 1IKFH 1V7MH 2X1WL 1TNMA 2I60H 4DKAA 2BOBA 2PYED 4BH7A 4LSTL 5EORH 3VXSD 1T20B 5C07D 4WU7A 2HAZA 3GSNH 1RMFL 5ALBH 4GBXA 3RZCB 2EO1A 3TGXA 1DLFH 1Z9OA 3TBTA 2E9IA 4U6YB 4P2OA 4G8FA 4JJ5A 2R2HA 3QI9A 2DLEA 3U9UB 1SMAA 1B0RB 4KRPC 4S10A 4OAWB 3O3EA 4P3WA 3SGEI 2NXYD 2NY2B 4HPYL 1A22B 1HIML 1F5WA 1J05A 3UEZA 1ZLSH 2OK0L 2BVEA 3IGAA 3UJJL 1M71A 2Q3AA 2G75B 2HT2C 2HVKA 3VWJD 1P5UA 1XGQB 5D1QD 1JZ3A 2ZUYA 1G7MA 1VHPA 3CH8A 1RK1A 1KC5L 5I8CA 1V3KA 4I48B 1FNEB 1A7RH 1F6AA 3GJEB 5D93B 1PFCA 1DQQB 4PJXF 1CXHA 1Z9MA 1UH2A 4PLJD 1NDMA 3QDMB 4Y5VC 3SY0A 5A3IC 3WEXA 4OCSH 3WXWL 5DA4A 1YQVL 1A4KA 4R97B 4PJ8D 3AREC 3GO1L 5D7JB 4ZMAT 4NDMA 3QO1B 5EN2A 2LVEA 3ARWA 3ZSSA 4R9HA 5FV1L 1I8KB 5CZXC 5T3XH 4RWHA 1GGUA 2H9GB 1FYTE 1CK0H 4LCUA 1Y0LB 4U3XA 4ALAL 2Z0BA 2AGJH 5EWIL 1N8ZA 1CL7H 3VA2C 1X5JA 3RJQB 2A9ML 1SJEA 3O9WA 4KKCD 1OAQH 1UWEL 1WCBB 4IOFC 4HS8L 2H2PD 5L2KD 4RISL 1JF5A 2F54D 4I4WB 3G6JA 1HHKB 2QV2A 4MQTB 4XP1L 1S7TB 3NFNB 2BMKB 2M8XA 1F02I 3GB7A 3T0BA 1HINH 1RHFA 4PV9A 8FABA 5JQHC 3ET9F 5IMMB 1B2WH 5KTEH 5DRWB 1A6VH 1PW3A 5DJCB 3CIQA 3LQZB 4NC2B 4LKCA 32C2A 2Y6SD 1A21A 3VD3A 2A6DB 4BFIA 1UACL 3H9SD 2COQA 2IQAA 5GS1C 1DCLA 1XF4A 5F96H 1XIWB 1M7DB 3T0EC 2W92A 4DAGH 3NAAH 5ADPL 5IQ7L 1KIQB 5DZOA 4XHJD 9CGTA 4GAFB 3IFPA 1OAZH 1DUZB 1MJ8L 2UWEA 2APBA 2OR9H 4HS6B 4U31A 2VAJA 2IAMB 4LIQL 1U58B 3OAYH 5I1GH 3D9AL 2OP4L 3ULSA 2Y72A 3FN3A 4M3JA 1QBBA 4FQHA 4X7SL 2APVA 1K4CB 2CJUH 5DMJB 3CFEB 1A6PA 2VWEE 3QNZB 5ALCL 4N0FB 1MY5A 1W72B 5MEPB 3Q48A 3GMNB 5SWQB 5JW4Q 3G6AA 4LSPH 4Z5RA 2FECI 3RIFF 3O0RH 5D6CA 2CDGA 1FE8L 3LSOA 2EDEA 4KDVA 4AH2B 1T6VN 2OTUB 3W0WA 4WHYH 3T0DA 1SVCP 3JXAA 4BUHA 5F3BB 4X9FA 2ZNXA 4NZUL 3L3JA 4DKFH 3B9AA 1NLDL 1AHWC 3U4BH 3BKJH 1AGCA 4D2NA 2ZUXA 3WIIH 3AFLA 1I7ZB 1E27A 2MCPH 5SWSE 4NZRH 5J6HA 5E56A 2X89A 2BP3A 1BM3L 1MLBA 5HDQH 5BQ7A 3RTQA 4LSVL 1KG0A 2VXTL 5I6XC 1DSFH 3NPSB 3WFBL 3KPNA 3OWEA 2VDML 3NGBC 3UXFA 2GT9A 4GBXC 5J1AB 4CVWA 3H7BB 3VD5A 5C0FA 2UVFA 1A1OB 3R06A 2W0PA 4P2OC 3B9KA 3STZB 1CU4L 2FHBA 1T3FA 3DGCR 4KAQH 3Q6GH 3FJTA 1H0DA 4Y16B 3SGKA 3O2WH 1CICB 3OKNB 5D1ZD 4C56A 1F11B 2NY3C 4ZFOA 1I9RL 3FRPG 4L8DA 2XTJD 3X13A 5AG8A 4UINH 4XVJL 1FN4B 4GKNA 1NCAL 2V17H 2ZCLH 4LHUD 2Q7YB 4I9WD 4JM4H 2XTLA 1NH6A 1PG7L 4LCCA 3BDYL 5I8OL 3O6LL 1Q9LB 4R4BB 3VJ6A 3AGVA 5EZOH 1NC2B 1Z5LA 4M1CC 1BFVH 2L7JA 4M5ZH 4QRPE 4S1DD 1H8OA 3FOLB 4XCCH 3MV7D 4AT6B 2NTSP 2OXHA 3TNNA 4P3DB 5BRZE 1I7RA 1H15A 3V5HA 2NW3B 2XQYK 1VFBA 5FUZH 1S7RA 2IANE 4MHHI 4J8RB 2VR9A 1S7SA 4PRPE 3JBG7 4YZFE 4PJ7E 3WYRA 4RX4A 4P2CG 3CXDH 5I1KH 1N3NA 1PY4A 2YXMA 5GRJH 3CC5B 5K9QI 4M7ZB 2GK0A 1M7IA 4HKJB 4Y5YA 5JXAL 3RDTB 3MRBA 5I30H 5I2IB 4LPCA 3MRFA 1NSNH 4LRNH 1RY7B 2VDRL 5C0DB 1SY6H 5D7IE 4OZFH 3ILQD 4I2XE 3D39A 3LEYL 1P4BH 2EYSB 4OCYH 3TYGL 5FB8B 2DIBA 2IALB 2GITB 3KPPA 5HHVH 3H3PL 3IVKA 1PGRB 5HJ3B 3QNXB 4WDIB 4D9LL 2J6EA 1UYWL 2R1WA 2HVJB 3TBSA 2VABB 4LF3A 4DWHA 3EJYD 4RWYL 4NCDA 1LE5A 5EU3A 3KLHC 2RIKA 2W91A 5BV7H 2MSPA 3I9GL 2XKNA 4ELMF 1OAKL 1VFUA 3MO1A 4EBQL 2EH8H 3MLXH 5E8NA 1YEIH 4BFGA 1SBSL 4NKDA 3VFUA 1AJ7L 4B0MM 4LEXL 4EUPH 5E4IA 3MFGB 3WFHA 2EXYC 1MHEB 2W9EL 5C8JA 1D3CA 5T1LD 1GVIA 1OSPL 4QRSB 5J0BA 1VFOA 1RHHA 4JN2B 4E5XB 1SYVB 4HF5L 1UCBH 4Y4HA 5DUBB 1T21A 2BNQA 1BVLA 1BMGA 1H3WM 1C5DB 3TJEL 3SCMA 1W0WB 3AVEA 1WV7T 4WY7L 3M45A 2PXYB 1RUKH 1NJ9A 1HHHA 2R2BA 1I1FB 1BZ7A 3VFTA 5B39G 5IJKA 4WHYG 4TUKH 1J1XL 3R1GL 3RTQC 1G7IA 3LB6C 4PJCB 2Y7QA 5A2FA 4LBEB 5DVMA 3C2AH 1XZ0A 2CKBL 4U0RC 1V8HA 4GW1A 2YZ1A 2BVPA 3P4NB 3B9KC 1BBDL 5LG1A 3CK0L 3DTXA 2NY0C 1KXTB 2V2WA 1JGEB 2ZCKH 3IAQA 3VFGL 5KSBB 4Z7UB 3GNML 4Z77A 2X4OB 3EGSA 3VXUE 5FUOL 3L5JA 3MOBH 5LVEA 4Z76A 1IARB 3GBNL 2VDPH 1B9ZA 3GGWA 4XCEA 3O6FC 4LLMA 3UBXG 1PQZA 4LNRB 4DGYL 3GKWL 4M7LL 4D0CA 4UDUA 2VKWA 5IVXE 3VDBA 4LCCC 3EOTH 3NOIA 4LPXA 4NN6B 3HFML 1Q9KA 3RWCA 4ZSOB 1L7TH 5DJYB 4I0KA 5BO1H 1ADQA 3MACH 3V4UL 1J9CT 4ETQB 4UT7H 3FFCD 1MCOL 2FRGP 2ZOLA 3SE8H 1DBAH 5I66A 4O5LH 1AGEA 4LMQE 3UAJC 5DJZB 5FCSH 4WV1B 2OI9C 5KSAA 1YYMH 4P9ML 3WLWC 1EEQA 2DQEL 1CFQA 3UC0L 1HEZB 3HI1B 4DJMA 2E6PA 3I85A 1J7VR 3CMGA 3VU2A 2EE6A 1TIUA 4MLSA 5J13C 2MQ0A 25C8H 1JUFB 1F4WH 5D7LA 3INUH 5EOQH 3UJIH 1T7ZA 3QPXL 1RJYB 4G6ML 4UIKH 3D69B 5DWUL 1RZJC 2YUXA 2VXQL 5J11B 3ESUF 4M5YL 3STLA 3TO4B 5JIIA 3RL1B 1CD1A 3PGCA 5HHNB 5DR5L 2ESVA 3TVMA 1NFDB 1MFBL 5JXEA 4JFFD 2A73B 3H9HB 1NLBL 1CGTA 3OAUH 1DDHA 5FO7B 5J3HD 4MNQE 3H42H 2JJWA 4HWBL 3EFFB 3UCRA 3Q2CA 4G6JL 5EOCL 3BGMA 1N5AB 4R0LA 2CD0A 1W0VA 3QRGL 1S9YA 1M4KA 2ATPB 3DURB 4N68A 1R3LA 2P47B 2IWGA 3TIDB 1JF6A 2DTMH 5C07A 3VFNA 3KYAA 1MWAL 3MRLB 4HIIB 4ZNCD 3TZVD 1XR9B 1BD2E 1MIEH 1NBYB 1RZJH 5KVDL 5AD0B 4RAVB 4I3SL 4YHZL 1KLGB 1HDMB 3DV4B 2VO5A 3IAGC 1T7WA 3CNKA 3TBYA 2P42B 5GSVB 1CFBA 3LKSB 5ICYB 4GG6A 2WLYA 4UOW0 5CBAA 3QPQC 5FYJE 3VWJA 5D1QA 1IAKB 2FEDC 4Z0BL 5F7EL 4NYLB 4Y4HC 1ZHLA 3HKFA 3V7AG 1U8LA 5JOFA 5L8KB 1IAMA 5H94A 4TUJA 4GAJL 4RGMB 1WC7A 5HGDB 3SCMC 1UWXK 3HAEH 1GGIH 4DKEH 4PJ8A 3NFSL 1HH6A 3OKEB 1DL7L 3RAJL 4WFEE 5GHWL 4NHUB 2C3VB 2PKDA 1ES0A 2DI8A 3MLZH 1SHMA 5IJKC 4FQ2L 3C8KB 4RGOH 4NQCE 4QHMA 4XCFL 5AAWA 5JHLH 1WBZB 4PP1D 5CMAB 4LOUC 4ODHH 3PWJA 4FQJL 1RJLA 4H5SA 3MNWA 1IZKA 2B0SL 4PJHE 3DETC 5B3JE 2CMRL 1QKZL 4Z7VF 1Y6NR 1E4XI 4C55A 5EH1A 5L2KA 1NBZB 2F54A 5DRNB 1EDQA 3FQUB 2E5EA 4HBCH 4LSSH 1OL0A 4P59L 3QUXB 3MJ9A 2JE8A 4JFHE 1YN7A 3HLAB 4NO3B 4HCRA 2X42A 4QRRE 5IBTL 5L88H 2DQCL 5CP3H 1MFEH 1WWCA 4JQIH 1DEEA 4HIEB 1FNHA 1LP9E 3P4OB 3ROOB 3VFOB 4ZOCA 4NRZA 3SDDC 4IJ3C 3FAWA 1X5LA 5L2JA 2BSSB 2QR0B 1A4JB 1MH5B 5FM8A 5I1HL 4ONGH 3IFNL 4NQDE 2V5SA 1EPFA 4EI5B 3PXHA 4OBSA 4MA3B 3HB3D 4Z7WF 2NXZD 3AB0B 3A6CH 4U1SA 3WE6A 3LN5B 2B39A 1NGZB 3BEWB 2AABH 3P9MB 1T2XA 1YY8A 3IJSA 1KT2A 4L5FL 5TPWL 3VXOA 5KSAC 1KN2H 1MEXL 3B6SA 3HNVH 4Y4KB 2X70B 1MCLA 5K93A 3EO0A 4OIBA 1H3UA 4NNYA 1JNHA 3NCYP 2R0LH 1MVFA 3MV01 1TQBC 4GW4A 5GSRA 2VLJE 1W8OA 3U36A 4HG4J 2DQTL 2FX7H 4MCYA 5EA0L 3FHAA 2I27N 3UDWA 4OLWL 3LMJH 5B21A 4NKOA 2NY6C 1FYTB 3VXQB 2F5BH 4NQXB 3TVMC 1JN6A 4E0RA 5TQ2H 5JXEC 1TVDA 5D8JL 2PCPB 2X4RA 5EU7C 1IC7L 3U2SB 3QHZL 1YPZE 3MA9L 3BXNA 4PRIE 4UBDC 5KG9B 2VLRD 3FT2B 3WMSA 1NANI 2WIIB 5EZIL 4PJGA 5TE6L 5JNYA 2J12B 4F2MA 1C1EL 2YPVL 3IU4L 1AD9B 2AS5M 2ED8A 4OCLC 3B2VH 4WHTA 3UP1A 2DIAA 1YEJL 1NCTA 1JNNH 2PR4H 3S5LB 4JFPA 1QOKA 4NM4L 3OXSB 1IGTA 5EO1B 4WWKA 5MI0B 5HI3D 3DVGB 3QO0A 2E9BA 1KJMB 4ZD3H 4WCYL 3FB6B 4TVPH 1KB9K 3ARSA 1JWMB 3BGAA 5IV2A 3PNWA 2ZUWA 4CNIB 4NHCL 3MLTB 3L3KA 3VWJC 3DYOA 5D1QC 4JRYA 2NLJB 2P24A 4LHUA 5MEQA 4X83A 1U8HB 4ZPTA 1AQDA 5CP7A 1HK6A 3CVHB 4UU9A 2R69L 4PLJC 1R0AL 1BHGA 3RWIB 4PJ8C 1EJOL 3HC0A 4FMFA 1UJ3B 3N1GC 4LSTH 1TCRA 3MV7A 3IETB 1RMFH 1MHHB 4BZ2L 3N1PC 4HMDA 4PJXE 5JO5A 1UB5B 5IMKA 2DMKA 3P77A 2QQKL 1OSZB 1SEBB 2GFBA 2DJSA 5HPOA 4KKCC 3CFJA 4HPYH 1HIMH 2H2PC 3DMMA 2OK0H 3UJJH 1G6RL 5HVWA 4POYA 5FK9A 4I48A 3GI8L 3MOQA 5FM5M 2BVQB 3FT4A 4NQVB 5SWSB 3O81A 4PJDA 2BZDA 4RRPA 3QDMA 5E4EC 2BVTA 4DCQA 3G6JF 3HE7B 2F74B 3WXWH 1YQVH 3O4OB 3GO1H 5F1NB 3P73A 3SEPA 1S7UA 4RIRB 3RGHA 2CIIA 3T04D 5FECA 5TQ0L 4XPAL 5CHNB 1A1MA 3JUZA 3OBAA 3QXAA 4ALAH 4YAQB 2H6PB 1KPUA 5EWIH 4WO4B 3OAZK 5DF0A 2A9MH 3BSZL 4NQED 1WCBA 4HFWA 3MV8E 1U92A 1GJIA 1UWEH 4I3RL 4NUJA 1IILE 4HS8H 4G9FE 4RISH 1HHKA 3DVNB 4XP1H 5C0CE 3ARFD 3DIFA 1HYSD 2XG5A 4EXPX 4RNRB 5IMMA 4PJAF 5DRWA 4EVNB 5EPMA 1OGAA 1AGDB 4O2CB 2OR7A 5T1LA 4M8QA 3KWWA 4KK5D 4QRPB 3OKMB 3MLRH 5C9JA 3I6KB 4ODSL 1UACH 4GH7B 3UDWC 5IW6A 3G08A 1F8TL 4HD9A 2WK2A 2IANB 4LAJH 1KIQA 4ELKB 4LRIA 4H0GA 1KUMA 5ADPH 5IQ7H 3O4LD 4PRPB 1DUZA 2GCYA 3FQTB 4MSWB 1P7KA 4PJ7B 5D96C 1MJ8H 3PWNB 2DS4A 2VB5A 4HAFA 3ZYOA 5JDJA 1NEZA 4LIQH 4U1NB 1FRGL 4RFEB 2ZNWA 3VD7A 4MAUL 4Q6IB 3D9AH 2OP4H 3VXPB 3VGGA 5FYKE 1E4XL 5I75C 4X7SH 3PWPD 5ALCH 4U33A 1ZSDA 3QIWD 1HE7A 2C5DC 2EYRB 1EVUA 1T1YB 5KANI 5J1TC 4NPYA 3K2UL 2CKBA 1T04A 4WWKC 5D7IB 1BVKA 2ZOKA 4OKDA 5GGSY 1FO0L 4I2XB 1UH4A 4NSKA 2NQCA 3TH4T 3GSUA 4OJFL 1FE8H 1QSEE 4N8CL 5IR1B 4O2FB 5HHME 4QF1B 3KPLA 1S7QA 4NZUH 4LVOC 4U4BA 2XTJC 5MERB 1VSCA 2O26U 5DT1L 1G9NL 1DQDL 4E42B 4X7FC 4D0DA 4H26A 1MREL 4MDIA 3F58L 5HGBB 5IW1A 1BM3H 5DRXA 4PB9L 3VRJB 1KGCD 4LSVH 3IJHB 4PRAA 1OQXA 4YXLL 2VXTH 1VEOA 2F8OA 3WFBH 4W6YB 2VDMH 4X7DC 3HG1E 3IJYA 3D85D 4YDLC 1HKLL 3WLBB 1CU4H 2XWJB 3AC0A 1DTUA 3DGGB 4JQVA 2WQ8A 2KZWA 1CICA 2WP3O 1HQ4A 1NGWB 4X5WB 3RL2B 4OGZA 4ZAKD 1RSFA 3KNBB 4LEOB 4AY0A 1I9RH 3H7LA 1NMCC 1T1XA 3DMMC 1Q9OB 1QSFD 4XVJH 2A6KA 5BZWB 4LSDA 3BGFC 4WW1B 1EMTL 1KEGL 1D5IL 3QDAA 3VFPB 2PO6D 1PG7H 2EC9T 5I8OH 3VGFA 3O6LH 2VLKD 4KDWA 4JCMA 1U8PA 3ILQC 1MAJA 3ZHLA 3OKOB 4H25B 4JFFA 3VFVB 3S37L 4U1IA 1U93A 3FO9A 4X6EB 3DECA 3T8XA 1CD9B 4EQ3A 4QHKJ 4PJFA 2XZQL 1I1RA 3ECBB 4LLQB 1UCTA 3EJYC 2VDQL 2X4QB 4FFWD 1JF1B 1IGJA 4HWBA 5CUSL 2X4NB 5JOEA 3F62A 4ZDHB 2I9TA 1DQLL 3VXMD 4NBZB 1QFPA 3VXUB 1CFNB 3VD9A 4KKLD 1GIGL 4K3HA 4ESKA 2APTA 1R5VA 4P4KD 1CXLA 4Y19D 1MWAA 5JXAH 2FLRT 4TOYL 2I5YL 3FQRB 3VFMB 2EDKA 2FYYA 3QWRD 4OIIL 5IVXB 2X1XR 3WN5C 1F4HA 1XF3B 3LKNA 2VDRH 5F88A 2W0KA 4J3UA 5CGMA 2V7NB 4ELME 3LEYH 4P0DA 1MQKL 5ENWA 5T1MB 5EG6C 3TYGH 3EW3B 4AMKL 4PGDA 2I25N 3H3PH 4L9LB 1IGYB 4D9LH 1A47A 1UYWH 1VPOL 3P0VH 5B38A 4IRJD 5BMFL 1J1OL 1G0DA 1S7WB 5DUPL 4D8PA 1D7FA 1D9KD 4RWYH 5GPRA 2AJVL 4YFLF 3ULUL 4X5XB 3OJ2C 5DC4B 3K4ZA 1KCVL 43C9B 4H1LB 3ULUD 4O2EB 1N7ML 3I9GH 1SM3H 5HXMA 3S3JA 1OAKH 1T89A 4EBQH 2YK1L 2CDFB 4G42A 4WW2C 1P4LB 1PLGL 5DHVB 5ISZB 1SBSH 3CFKB 4YBLC 2UYLB 2HJKB 1AJ7H 3V6ZB 3QUMA 2YD3A 4LEXH 3PWUB 3KYOA 2W9EH 5CJXA 4Q9RL 3SO3C 4PD4K 1OSPH 5KSUA 2A1WL 3TO2A 3GUTA 1KB5L 1ZHBA 4NFBA 2WQRA 5EB9A 4E5XA 2GQHA 5EFIB 5DUBA 3BZ4B 4HF5H 3VRLF 2PW2A 3GFUA 4LCYA 3W9EA 3L3HB 3TJEH 1W0WA 2AV7B 3DX6B 2G60L 1EEYB 5IGXL 4WY7H 5EZLA 1I1FA 2W60B 2ITCA 3MV11 3OKKA 1HNFA 4K71B 1J1XH 3T77A 3R1GH 3BQUD 3LQAL 5M95B 2C3XA 4JM2D 1U8IA 4HUUB 4XBPB 4ERSL 3UTQA 2CKBH 1UB6B 5HD8C 1CGYA 1BBDH 1H3PL 3CK0H 4JQVC 3QUZB 1C5BL 3LQMA 3LKOA 3VFGH 3G04A 1RZ8B 3PV6A 3GNMH 5ESQB 5A2JH 5C6TL 5GGVL 2J8UA 4FG6D 1BZ9B 1ZXQA 5FDYA 5FUOH 1OAXL 1H3XA 5C0IA 5DQDL 1R3HB 4QEGA 3H0TA 5MP6L 4LDLB 3GBNH 2ZSWB 2MWCA 2J4WL 4XP6L 4DGYH 2YPLA 1HSAA 3GKWH 4M7LH 3C5ZB 4QCIB 4TNVF 1FZMB 3WL9B 3HFMH 2BNRD 1YNKL 4QGTA 1I1AB 1NUDA 4ZXBD 3RY4A 4ETYA 2B4CC 3H3KA 3GIZL 1YJDC 4GQPH 1G84A 3V4UH 2H32B 4FQQB 4U1MB 4JDTL 4UT9L 5E1HB 4PJHB 3SKOB 1MCOH 5J3HC 3KYMB 4I13B 3MXVL 4OF7A 3BD5A 5I73C 2VLRA 3TH2T 1QEWB 1GC1C 1X5IA 1FYHB 2WLZA 4WV1A 5C9KA 5K59F 4CN6A 1BJ1H 1WJ3A 4KGLA 2P5WE 3QIBD 4P9MH 1T0MA 3GRWA 2DQEH 3HI1A 3UC0H 4NUGL 4Y2DD 2ZUUA 4TRPL 3QEGL 4QRRB 1ZWIB 3OJVC 3MV9E 3OAZH 3TZVC 5L0QC 5IEHA 5DD0L 1O7VA 5EOTB 1RJYA 1LP9B 5F7FA 3QPXH 1MCCA 4A6YL 5DWUH 5A16A 2N7AA 2VXQH 4M5YH 2OL3A 2V2XA 1K3ZA 5CAYB 5DR5H 4L29A 4LGPB 3U30B 4NQDB 3ALPA 1MFBH 3N85H 4HUVA 4BQ6A 2W0FA 1NLBH 1KIRA 4RRPG 4WHDA 3RX5A 4ZNEA 3RGVB 4I18A 4OLUL 2CLVA 2V9QA 4JO2L 4HIHA 4ENED 3KDMA 3Q6FB 2YD7A 4HWBH 5FO8B 4JZNB 1N5AA 4G6JH 5EOCH 1KTLB 2PTTB 5ESVA 5DMKA 4GG6F 3QRGH 2HJLA 3BYTA 2XI9A 2WBJB 5JHDD 2XPGB 4V1DD 1A8JH 1JNLL 1MWAH 3WD5L 4QO1A 1T89C 1X44A 3NZHL 5E6ID 4PP1C 4WWID 4RAVA 3G5YA 5KVDH 3AMKA 2ZUVA 3CSPA 5DDHB 4I3SH 2VLJB 4YHZH 3FRUB 3ARQA 4G5ZL 2YN5A 1I3UA 2APXA 3H2WA 2Z92B 5A43C 1HNGA 5CJXC 5C0AE 5HHPB 3BVNB 5ID0A 1AXIB 4ODUA 1QG3A 1LD9B 4Z95L 4Z0BH 4Z78B 1KACB 3SDXE 5IMLA 5ID1A 4LQ1A 2V2TA 4PRIB 2YSSB 2AXGB 4RMTA 4GAJH 1CWVA 2AW2A 2MKLC 4Q2ZA 1EAJA 1MPAL 4MQ7B 3NFSH 4JFDD 5GRYA 1MOEA 1ZVYA 1XGRB 2E6JA 1DL7H 3RAJH 5DZNA 5IHUL 4HIJA 1RIUL 4X8XA 3TA3D 4HBQA 4U1GB 4FQ2H 1DVFD 2AK1L 1JL8A 5DTFB 4PJIA 4XCFH 3W9DA 1Y6MR 1OARL 2GAZA 2W9LA 3EOBA 1NAKL 4QTIL 1PYWB 3HB3C 5CEYA 1NEZG 2NXZC 3RI5F 1RZGB 4FQJH 4K7FA 4LLUB 1EXUB 2B0SH 1BBJA 4NQEA 2CMRH 1QKZH 1NBQA 3O11B 4IM8A 3QAZB 2R0KL 3V5DB 3RWEA 2JKXA 3ZKXC 1BEYL 1WF5A 1FNGA 3ARFA 3T4YB 4P59H 4LLVA 4G7VL 3S35L 3RZCD 1DN0A 5D4QA 4N0CD 3KYNB 4LL9A 5IBTH 1Q1JL 3MBED 3UPCA 2DQCH 3VDAA 5C2BH 4MA1C 4MAYD 3A6BL 4KPHL 1YMMD 3P4OA 1OP5K 15C8L 1QFWI 2C4FU 4P2QE 2A38A 5HI4D 1A9BB 3BDXA 4NWUL 1VFAB 3SDCB 4DZBA 3VH8A 3PWLA 3T3PF 4ZYKB 4XNYL 1ORQB 2VLMD 2AP2A 3DYMA 1HQRB 5I1HH 4PJXB 4S0SD 3IFNH 1M05A 4L8BB 3FKUS 5SWZB 2LE9A 3O4LA 3LN5A 3CVIL 4PJ9B 4UDTB 5FA4B 3OGOE 3CDFA 2GTZA 3LEXB 3F65A 3QP3A 1MCWW 2IADB 5ITBL 1MUJB 1CGSL 3UMTA 1S78D 3QEQE 1AE6L 1QO3B 3JV0A 3MRJB 1F4YL 5D7JD 5T5NF 4HUWB 4H0HB 4L5FH 1K8IB 5DJ2A 5TPWH 1MEXH 5CLTA 1IAOA 2X70A 4M43L 3PWPA 2EDYA 4D0BA 3K4DA 1JYNA 4P57B 1PBYA 1VFMA 3MRQB 3QIWA 3WNOA 1YQ2A 4QRTA 4PJGF 4K3GA 1AFVL 5HI3C 4CMHC 1S9VB 2DQTH 3NIGE 4DVBB 1FNFA 1CGWA 2H3NB 4GXUM 4KQ3L 5EA0H 1FO0A 1F2QA 2DYPA 1IL1A 4NC1C 2RGSA 3UPRA 4OLWH 4WFGD 2P46B 1UQSA 4UNTA 1CE6A 1PG7W 1C12A 5D8JH 1H5BA 3IDMB 4HKXA 3IDGB 3A67L 2A6JB 5I71B 4I18C 1A6ZB 2G5BB 5TGBB 3S4SA 3MV8B 5E8OA 3QHZH 4KK6C 5KG9A 3MA9H 1HWGB 4G9FB 5JZ7D 1LO5B 5TE6H 2Q86B 1C1EH 2YPVH 3IDXL 3IU4H 1I8MB 3V79C 5C0CB 3L5IA 1JP5A 3IDUA 5ERWB 1X7QB 1HYRC 2BSTB 3D85A 1YEJH 1ONQA 5KVEL 1ROWA 4NM4H 5CD3B 5I15L 1KJMA 3QQ3B 5LAXA 4NO0B 4AYFA 2H1PL 1ZS8B 4WCYH 4KKAD 4NBXB 1N5YL 5FA3B 4K8RL 3V6BR 3EIFA 4S1QL 4ZAKA 4NT6B 2AJ3A 4HZLA 4OV6F 35C8L 5GIRA 4K8RD 1CGVA 3MRIA 5IWLA 1CLYL 3QIUB 4CNIA 3U0WL 5HGHB 3KPSD 5DURD 4NHCH 3A6OA 3OPZL 3QFJA 5I17B 3LS5L 4HGMA 3I3DA 3X11B 4IS6B 5IFHL 4PTTA 2I07B 1JNJA 2YA0A 4HGWA 4HJJL 2BVOB 2VLKA 3GMLA 2R69H 4AIXA 4DTGL 1R0AH 4JDZB 2PW1B 4FP8L 1U8JB 1UJ3A 3ALXA 2NY1C 1EJOH 1JGDA 5HHOD 4RZCB 3ARDA 3ARZA 5SV4A 4LVEA 3IETA 5B38G 1UZ8A 2FEEL 4BZ2H 2HP4A 4PJDF 4PUBH 4JPKH 1Y6KR 2VE6A 4JLRA 1UB5A 4YUEL 1GGCH 4YJZL 3TIEB 4GS7C 1CVRA 2Z91B 3T65A 3G6JE 2QQKH 1B4JL 1EEZB 4JFQA 2HT4D 1P7QB 2ZUQB 2R2EB 1QSEB 4YXKL 4MHHG 1NGYB 5HHMB 3EFDL 1H3VA 3VXMA 3QWOB 1K5NA 3KPRD 1IEBA 2CPCA 1TXKA 1G6RH 4Q9BA 4YK4C 4IIQB 3BPOC 4P4KA 2KUTA 4XZUB 4Y19A 5GGUB 4QY8A 2BVQA 2C4FT 2IH1B 3ARFC 3GI8H 3V7AE 1FFPB 2BERA 1HYSC 3PL6D 2DWDA 4XT1C 3T4AA 1ZEAL 3ROLA 1AIFA 4NQSB 5IB4A 3CZFB 2OXGA 4MD5A 2BSRB 4JJHA 1S7XB 5FO9B 1TPXC 4KK5C 4YHNA 4TNWK 4URTB 4M6NL 5ACMA 4F9PA 4O51B 3HG1B 3CFBB 3I6GA 2UWEE 2EXWD 4XPAH 4Z7QF 1I7UB 3K81A 4KKBD 4F57L 2WWMD 1YA5A 2RCSL 3P3YA 1UZ6F 3L3GA 1SMOA 1MCRA 1D9KA 1K8DA 4HH9B 4WI4A 4X5LA 2GYSA 2EIZA 4OM1L 1CFTA 2X7LA 3BSZH 5ICXB 4D3CL 4OI7A 3RRQA 4PFEA 4I3RH 2HFEB 5J9PA 3ZE2F 1NC2D 3F7RA 5GJTL 2BHUA 5C0BD 5BZDA 1FPTL 1WK0A 4FTVB 3ESVF 4NKMB 1O5DT 4R8WL 1IM3A 2EYTB 3H3BC 5CIPH 3L3DB 4ACPA 5F21B 2F9BT 4EVNA 3O2DH 2CLRA 4WRLA 3QIWC 4XC1L 4JDVB 3W0WE 4JY4B 4KMQA 1I8LC 3JV4B 4YIQB 3RWHA 2R15A 4WW2F 2H41A 4M6ML 1F00I 5DLML 3WUWA 3QNYB 2EDXA 4JKLA 1JI2A 1T6WA 4J6RL 4L1HA 2JB5L 1EVTC 4C4KT 3S97C 4XGZB 3K0WA 2NTFA 1H5BC 5EBGA 3CCHA 3PWNA 3FB5B 4OGAD 4K55A 2Q1EA 4YHLL 1MHCB 3FQNB 3FQWA 3HE6B 2DQDL 1CG9A 1FRGH 3JVGA 3LV3B 4BQBA 4MAUH 1RIVL 3BQUA 4M93C 3BUYB 5F8RC 4GSDL 2D7MA 2Y4SA 1E4XH 4JM2A 3W5NA 1TVBA 1CTOA 2CUMA 1MCNA 1FLTX 3HI6L 3S3SA 1RZKL 1JPGA 2P8PA 1J8HD 4B5EA 3ZT6A 4C56E 3GMQB 4NZDA 4F3FB 3ULVH 3K2UH 2XY1A 2CUIA 4HX1B 1FAKT 2DWEA 3K80A 2FIKA 2LV4A 1JGUL 5CWSB 4ELMB 1VEPA 2FB4L 2XA8L 1XCTA 2XN9B 4PYGA 4LVNB 4OJFH 5IR1A 5FIEA 3U0TB 4ZAKC 5EOCJ 4OI8A 3P4MA 3CGTA 4EN3A 2RJMA 3P4LA 2OMNA 5GISL 5D7SL 1QFWL 2VKXA 5IWLC 1FSKB 5MERA 1N64L 5D72L 1OWRM 5DT1H 2FL5A 1G9NH 1DQDH 3OSKA 4U6HB 1MREH 2YKLL 3WO4C 3F58H 3O3BB 3FONB 4OKVA 5E8PB 1NAML 2PO6C 1JK8B 1VGEL 4AK1A 3VRJA 1N2RA 4W4NA 1OOAA 1WBYA 4ZOBA 1EERB 1RJZA 2BNRA 4RQQA 1MF2L 4R26L 4YXLH 1K85A 4ZXBA 4WJ5B 2W07A 2G9HB 5JIHA 5EO0A 3ARDC 3C9NA 2O61A 5LCVL 1FG9C 3WLBA 1KJ2L 3T08A 1RZIA 3U4AA 1ZGLA 4XH2A 3DGGA 5GXBB 1WCQA 3OR6B 4O00A 5DRZA 4I0PD 3JTTB 1JHKL 2PXYD 4ZFZA 3SN6N 5FGSA 3DRTA 3MRKA 3QIBA 3SKMA 3KNBA 1IC1A 2CLZB 4KKLC 1BAFH 4Y2DA 3QDGA 1V3MA 4XXCA 4NRXB 3BZEB 4P4KC 4PJFF 2HTLD 2R9HD 5I76B 3WHE0 2ITDA 4QRUB 1EMTH 3D39E 5DMGC 1JYXA 1OAYH 4N9GB 5EBMB 4HIXL 1J87A 4U7MA 5JDSA 4GQ9L 1D5IH 1P9MA 2ZJSL 5E2WL 4A6YA 3ZDYF 4OQTL 3QG6A 5MHSE 4XBGB 4MB4A 4TSBL 4D9RE 2GTWA 3K4AA 3F7VA 1X5KA 2L0DA 4BK4A 3EYVA 3SE3A 3NA4A 4F9PC 1IM9B 3S37H 1X5XA 3OGCB 3WJLA 1FVCB 1AO7A 5F93C 4FOMA 1OP5H 2VTFA 4NGHL 4IRJC 2XZQH 2X4QA 3L7EB 5F97E 4Z18A 5EIIB 2VDQH 4MS8D 1D9KC 5CUSH 4EOWL 1HWHB 1DQLH 3AU1B 2HG5B 3ULUC 1OP3K 4V1DA 2LABA 1GIGH 4ZUWA 2FCBA 3BT2L 4WTZA 5K9JL 3HN3A 3LCYA 1UGNA 2BHZA 3VG9C 4P46D 1FFRA 3RNQA 5E6IA 4DN3L 1KLFA 1UM5L 3AAZA 3FQRA 3VFMA 5I8EB 4TOYH 2I5YH 5KJRH 3DNKA 4OZ4B 4OIIH 1JPST 1WZ1L 4P5TA 3WSQL 3RFZC 4RMRA 3MFFA 4BH8B 4ODTL 2BNQE 1P7HL 1MQKH 3LKQB 4NNXA 4K94L 4LP4A 4PR5A 4AMKH 4XB7A 4BKLA 5FYLL 2CQVA 4MZ2A 3ZHKA 2GUOB 5D7KE 5E24E 1VPOH 5FYLD 4WFFE 3E2HB 1J1OH 1CL7I 5DUPH 5E5UB 1T2JA 3VH8G 5HVHC 3QZWA 4HC1A 3ULUH 2P5WB 1VACB 2AI0H 3GSNB 3D2UB 2YD6A 3LKRA 3TO4D 4WNQA 3BKML 3JVGC 1N7MH 3B9EA 4NRYA 5E6YA 2VRAA 3VRLE 1DVFA 4XBEL 3BQUC 2NY4B 3MV9B 3L7FA 2YK1H 5ISZA 1TZHB 5HGGS 3SJVD 2D7NA 4OF3A 1PLGH 4JM2C 1KSRA 3V6ZA 3MRNB 5KSVB 4JZOB 5IG7B 5I9QB 4LSUH 2CIKB 2FH8A 4Q9RH 2A1WH 3OG4B 3HUJF 3QQ4A 3MREB 1KB5H 4KTYA 5BVJB 1KXQE 4EN3C 1N0XL 2K7PA 4FG6C 4GRLD 5T5FL 1FL3B 4LU5L 3MBEA 4TUOA 2X6MA 3MX0A 1VCAA 3QEHA 4GT7A 1FL5A 4MAYA 1YMMA 1IGCL 1ZHKA 2G60H 2FJHB 5IGXH 5D1XA 1Q8MA 1GPOL 3WBDA 1MRFL 3VMNA 3KVQA 3TLRA 4FS0A 2J8UF 4OFPA 4KRPB 5EC2A 4JB9L 2FGZA 3LQAH 1CT8A 1MVUB 4ZXBC 5DJ0B 5L6YL 3S4SG 3KJ6L 1CGUA 1KLUA 4U2YA 3RNKA 4ERSH 1BOGA 4ZTOL 2X05A 4U1HA 3UROR 2MNUA 3C5JB 1U95B 1FNSL 5HI5D 4HWNA 1OB1B 3RY6A 1H3PH 5C0AB 5HHXH 4X0KB 1C5BH 4L8CA 4OLXL 1RZ8A 5ESQA 3QIBC 2VISA 5DQJB 2NY7L 4Y5VB 2MMXA 5D7LE 1BZ9A 5GGVH 1JPTL 3AREB 3G5XB 4Y2DC 1OAXH 3VXTA 2YBRA 3OJMB 4XXCC 5DQDH 2VR4A 4W6XB 4Z7VB 5MP6H 2XWBB 3DX9A 5FUCC 2AK4A 2J4WH 1XH3B 5IHZB 4QCIA 4XP6H 1FG2A 5DC0A 2ESVE 5K59E 4BELD 1P9MC 1UM6L 5EU7E 3KHQA 1Q72L 1U8KB 1YNKH 4M9OA 2HLAA 3GIZH 1CBVL 3C60D 3QCVL 1TJIH 3SE3C 2H32A 5CSZB 5AYUL 5DYOA 3WJLC 5EULV 1L7IH 4QWWD 4JDTH 1D5ZA 2QADC 5HHQA 3MXVH 5C0RL 4HS3A 1N59A 3F12B 5C07E 1QLEL 1HILB 5KN5B 4OFIA 2APFA 3VI3F 1KNOB 5K9OB 2HFFA 4NUGH 4Z7WB 2NW2A 1S3KL 4JFOB 4TRPH 4KUZL 3QEGH 1TQCC 3ABZA 4PV8B 4JFYB 1A02N 1ZHNB 1CDYA 1EO5A 4EI5D 4JPWL 5E6IC 43CAB 5DD0H 5GS1B 3TEUA 2VXSH 5IB5A 2X9YA 1ZT7A 4A6YH 4GG6E 4P2QB 5B39B 3T0EB 2A74B 4P5TC 1A14L 3FZUD 3BMVA 2O93L 2E7HA 4PS4L 3CFDB 5GGSB 3GMMB 5E8EA 4HJ0D 4PY8I 4KTDH 5H35A 4OT1L 3VCLA 2O5YH 5LKNA 3LAFA 1AGBB 2F19L 3KPSA 4TVSa 1ZTXL 3DVFA 4ZO6A 1HXMB 2YEZA 5GS0L 4MVBD 5IFAL 1NKRA 4OLUH 4JO2H 2XXMB 1KELL 5GS0D 3KPQB 4ONHA 3I50L 1CFSA 3QEQB 4U1LB 1ETZB 4X4YB 7FABL 2GJZA 4FXGB 5IB2B 3BKCL 5HHOA 1B0GB 2Z35B 5EO9A 5F1IA 3TA3C 1T1ZB 1JNLH 3WD5H 1DVFC 1FFNA 4X6DE 3UBXB 3NZHH 4HJGA 4M6OL 1HSBB 3FOMB 5DDHA 5DJXB 5A2IH 3BMWA 1XMWA 2ORBL 5JMRA 5L2KE 2F54E 1U8QA 3D25B 4R3SB 4HLZG 1AHWB 2JELL 2GHWB 3OKYA 1AC6A 4NZTL 2J8OA 4G5ZH 4LKXA 2ATKA 3KPRA 1BLNB 4U6XA 4ODWB 4BSVB 4PJIF 2C4XA 5EU5B 1MJJB 2WNGA 3OKLA 4LPVA 4NQUA 3BJLA 4KDTA 4MJ6B 2IF7A 3M17A 4Z95H 3ZYJA 4QHUA 4IOIA 5I6XB 3PL6A 4N0CC 2GJ6D 3TN0A 2BOBB 4BH7B 2VAAA 3MBEC 4OFYD 4S0TD 3NGBB 1KF9B 2XOTA 4WU7B 4Y1AB 2XACC 1DLFL 4GBXB 4MAYC 1MPAH 4HQQL 3WUWG 3KPOA 5D1XC 1U91A 3TBTB 1X5YA 5AZ2L 3MCLL 4P2OB 4G8FB 4ZS7L 4PY7B 5HI4C 2R2HB 3VD4A 5IHUH 1RIUH 3UTZA 3BH8A 1I9EA 2AK1H 2C26A 3O3EB 1OARH 5F3HA 2NY3B 1NAKH 1J05B 4QTIH 3W81A 1OQOA 2WW8A 3QA3A 1PAMA 3IGAB 5J4MA 4LLUA 4DUXA 1M71B 2VN7A 2HVKB 4FRWA 5SX4H 1SBBA 1L6XA 4M7LT 1YN6A 1G7MB 3N1FC 1RK1B 3T3PE 5I8CB 4PJBA 1W8NA 3HTLX 3RY6C 1F6AB 4N0YH 1TETL 2R0KH 4UUJA 1S78C 1CQYA 5C0BA 1NPUA 4LGRB 1NFKA 1NDMB 1BEYH 3SY0B 4DVRL 3WEXB 1A4KB 4G7VH 3S35H 3EOAA 3BIKA 4NDMB 1Q1JH 1BP3B 1OAUL 4QGYA 4OZFB 4X7TB 1NL0L 1BF2A 3A6BH 4KPHH 3DUUA 2Q8BL 1BWMA 2EKSA 15C8H 1A9BA 1BIIA 3B2UD 4NWUH 3TYFA 4CGTA 5EBWA 1ORQA 5E2TL 1N8ZB 3I75A 5CEZL 4XNYH 2MKWA 3JV5A 4CADA 1SJEB 3PUCA 5CEZD 1RULL 2WM0A 5SWZA 2DKSA 3Q3GA 4UDTA 4G8GD 3G6JB 4PJGE 3CVIH 3CAFA 1HHIA 1MUJA 2VOTA 5AAMA 5ITBH 5A2LH 3GB7B 3HE7D 5TJWK 5JZ7C 1CGSH 1ND0A 3JSSA 4PV9B 3W39A 1F4YH 8FABB 1AI1L 4EUPB 2CUHA 2N56A 4F33A 4M43H 2R4RL 4W81A 2XT1B 1MFCL 3KHOA 4LKCB 32C2B 3P9WB 3MRQA 1J8HA 4WUUD 4X9GA 2FJFA 4GW5A 4BFIB 3SKJL 2IQAB 5F96L 1AFVH 1XF4B 4DAGL 1OP3H 2XTJE 5KANG 4KKAC 1HHGA 4KQ3H 3S9DB 3R0NA 1KCKA 3IFPB 4JRYE 2P48B 2UWEB 4W68A 1PSKH 4K8RC 3NN8B 2KDGA 1RUQL 4OUUA 5EZJA 3ME0A 1UA6L 4ORZC 3ULSB 2Y5EA 2FX9L 4FQHB 5H37H 4ISVA 4LPYA 3MV7E 2GSGA 3KLSA 4MMXC 1NAMA 3IDXH 4CDGC 4HKBA 3TPUA 1QUNA 3G6AB 3K74B 4Z5RB 5BRZD 3K7UA 4KHXL 2BSTA 4R2GD 1AY1L 5HDLA 2CDGB 3LSOB 4Z7NF 5KVEH 3W0WB 5CD3A 3B8YA 5CJBA 3QQ3A 3EYUL 3IFLL 2DI7A 1QLRA 5I15H 1KJ2A 1IGFH 1NQBA 1WFNA 4AIZA 4I0PA 3EZJB 1PZUB 2H1PH 3L3JB 4EXKA 2HT4C 1N5YH 4OZHF 4NT6A 4K8RH 4WTZG 4S1QH 2PNDA 1AGCB 3ILPA 5KVFH 4BQCA 1SVZA 1CQKA 1E27B 35C8H 4UV4L 5J6HB 4WI5A 4PJDE 1CLYH 3MYJA 4UIMA 3P40A 3QDME 2UY6A 1LHZA 1MLBB 3U0WH 4KDTC 5BQ7B 3OPZH 3RTQB 3X11A 1QQDA 1KG0B 1OTUC 3PL6C 3M07A 5IFHH 3TN0C 4HJJH 3GMPA 3KPNB 3IXAA 5E2VL 5ILTL 1A7QL 4EQ2A 1NCWL 2GT9B 4DTGH 3LN9A 4U0RB 3GJFK 2DD8H 4FP8H 2F53D 5C0FB 5AWNL 4CU8A 3U83A 3R06B 4KAQL 3NZ8A 3VGEA 3B9KB 3N1QC 4JFXA 2NY0B 1H0DB 3GM0A 4XB8A 2EXWC 4BSWA 4C56B 4YUEH 4KKBC 4ZFOB 1YEDA 2XWTA 3JWOC 4L8DB 1B4JH 1CVSC 4HXAL 3X13B 2R2EA 1C7SA 3FL7A 3IB4A 4YXKH 4AEHL 1SYSA 4GKNB 3O6FB 1QFUL 4JM4L 4F80A 2W59A 4LVHC 1FGNL 2JB6A 2EEDA 5HYJA 4LCCB 2X1PA 4P46A 1OGAE 1S7VA 3VJ6B 1UZ6E 1WFUA 4HUXA 2QQLL 1Z5LB 3W2DL 5AG9A 4ZFGH 3TM6A 1II4E 5BS0B 3EDDA 2HFGL 2DQFA 3PQYA 3X3GL 3CU7A 1EO7A 1ZEAH 4ODVL 3ULUF 4FQXD 3Q5YA 4V2BA 3TNNB 1FGVL 1I7RB 1CLZL 1H15B 3V5HB 1FVEA 3ZE2E 4F58L 5FUZL 1VFBB 1S7RB 4L3EB 2Y36L 4YDVB 1QRND 2AVGA 4L4VD 5F9DC 1S7SB 4M6NH 5HYIA 2OI9B 3EO1A 4WGWB 5E99L 5D9SA 4EDWL 1N3NB 4F57H 2DQJL 4OIAA 2RCSH 4QXGL 1SJHA 1MAML 5T1KD 5J13B 2GK0B 4OGAC 1M1SA 1M7IB 4I3GA 4OM1H 4FQPA 5CZKA 4GKOA 5I30L 2JJUA 3MRBB 1T7VA 4Q74A 4JAMA 4CBPA 3MCKA 1U6AL 1YEHL 3MRFB 4G8EA 4FTVA 1R3KA 4OCYL 4XP9L