4DKAA

Structure of editosome protein
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
127
structure length
127
Chain Sequence
b'QVQLQESGGGLVQAGGSLRLSCAASGRTSSLYSMGWFRQAPGKEREFVAAISRNGANTYYTDSVKGRFTISRDNAKNTVELQMNSLKPEDTAVYYCAADRFPTMEVVTIMTNEYDYWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords single domain antibody VHH
publication title The structure of the C-terminal domain of the largest editosome interaction protein and its role in promoting RNA binding by RNA-editing ligase L2.
pubmed doi rcsb
source organism Lama glama
molecule tags Rna binding protein/immune system
total genus 35
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dkaA00
2NY5H 3EBAA 1I1RA 4H8WC 3SQOL 3G6AA 3W9DB 3HFML 2VSDA 4PJHA 5L8LB 4UNUA 1U8JB 3S5LB 2I25N 4JKMA 4PGEA 5E4EB 3FO0L 5I73C 1K5NB 4RAVA 5I1CL 1IFHH 5E2WH 1ZLSH 4RGOL 3T1FB 2CDEA 3VMOA 3O2VL 4MNHB 4H1LG 4A6YL 2VZUA 2J3SA 5CZXC 4NKIL 5B22A 4OZHF 5EIIB 3RWJA 2BCKB 4NZRL 5IKCA 1BFVL 2I5YH 1P4LB 3NMEA 1A0QH 4HWEL 2B8OT 3UC0L 1NGYA 3HCVB 3QDMD 5F9JB 4OUUB 4MB4A 3ZDYE 3CFBA 2R2HA 4R7NA 3RVTD 1TJGL 2QSVA 4JG0H 1C5BH 4Z77B 4XMPL 3MRPB 1HXMA 3AFLA 4PJXF 1GPOL 3UPRB 1I3UA 1SMOA 1EJ6A 4X5XA 1A8JH 1BFTA 5CS7A 2A1WL 1AGBB 1EEUA 2UYLA 3IFLH 5HGDB 5D2LA 5EPMA 4C57C 4ODHH 5I1EH 3GSNA 3L7EA 4OQTA 4MVBC 1INDH 1MEXL 4WIQA 2VZTA 4L8DA 3IYLW 4YFLI 4Z7WB 1IARB 1U2CA 4B50A 1IL1B 4B5EA 1YQVH 5C0FA 5TE7H 5IIEB 5D6DA 1TIUA 3EOYG 3MV8E 2F5AL 4YDVA 3C5ZD 1TDQA 3PQYB 4W6XB 1U6AL 2OM5A 3WEXB 1AY1H 4MCZB 2X09A 1F8TL 2UUDK 3DRQA 3RWEA 3S4SB 2VQ1A 1BJ1J 5CHNA 4LSQH 4JGMA 4HF5H 4GG8B 1SBBA 2V7HB 3FQNB 3SDXE 1W0WB 3TZVD 5DDHB 4UIMA 3G5VB 1HWGB 2HT2C 4C56E 3R8BB 5A1AA 4EDXA 4MB3A 1TCRB 3HR6A 4XAKD 1U3HA 4LSVL 5ANMB 4V1DE 3RDTA 2W07A 5DQ9A 2J8UE 2QR0A 5D5MA 1FGVH 3QDGE 4XPHL 3OQ3B 2J88L 3IKCB 5D7SL 3SY0A 4WHDA 3OG6B 3O11A 5BRZA 4Z7UA 4U4BA 2E9WA 1F5WA 5T3ZE 3BHBB 4KQ3H 4CVZA 3OAYH 4CU7A 4OLWL 2OJZH 1JPSH 2D03H 5GGRA 1JWUB 3GJEA 4U49A 4UB0H 3E1F1 3FOLA 1A6WH 1IC4L 5CSGA 1LK2B 1QOKA 4X8JA 5DEGA 4JDVA 2GCYA 1MF2L 2NY7L 3DSFL 5ADPL 3MRFB 4GG6A 5IROA 2AJZA 1QP1A 1KCKA 3P9LB 2BNRB 4K3EH 1NCWL 3ARZA 5E5MB 3CZJA 3WO3B 1VB9A 3RWCB 1IC5H 4PY8I 5C0ND 1KB5L 2A6JA 3VXSA 1G0DA 1UM4L 1UWGH 2LV4A 3EYSL 4I9WD 5F88A 4YLQT 3DVGB 3MFFA 4R96B 4AENA 3BH9B 4L4VE 4XNYH 4NQEA 3SKUD 4MDIA 4I18B 5CLWA 5HXMA 4KTDH 3WN5C 3MRRB 4ZTOH 2Y36H 1JHTA 5DD3H 4NM4H 5EZOL 1A9BB 5ERWB 3BYTA 1F58H 3CX2A 1R5VB 5KSBF 1NGXA 2ZZUT 2Y6SC 3MRIB 4WW2A 3HE7D 3ULUL 3M45A 4P46B 5FHAL 1ES0A 3MLTA 3DECA 3BP5B 4FXGB 4QF1B 3FB5B 3R0MA 2N7AA 1DQTA 2X4SA 2WIIA 4NWUH 5I75C 5DF0A 4GRLD 2A6DB 2FWOA 4LEXL 5E9DB 4JKLA 2HFFB 3L5WA 3TN0D 5ICXA 2EE2A 4LF3B 5F3HA 1Z9OA 5ITFA 5IW6B 1CBVL 1J7VR 4Y88A 4O2CA 3K80A 4P0DA 3I6LE 1D9KD 1QFWL 3TVMC 2XN9A 3WUZA 3QFDA 3MA7B 4HXAL 1JZ8A 4ODUA 4AEIL 4P5KA 5E6ZA 5BCAA 1U3HC 3S37L 2APFA 1WBXB 4NOBA 1RZFH 4H20H 3W11D 4S11A 2VN4A 3NFSL 3P9MA 4XT1C 2BOCB 2PF6A 1XGPB 1EUTA 3HKFA 3HPJA 3SDDC 4ZFFA 3I3EA 2FGWL 3L3DB 1FLRH 1YDPB 4LFHD 3P2TA 2HFTA 4NNXA 3C08H 5BS0D 2NY0D 2WINB 3QCVL 5TFSL 5HTSA 3QIUD 1YEIL 3QG6B 4RWYH 3ZE2F 5HYJE 2R0LL 3TP4A 2O5YL 1Q9LB 4WWKD 2ZCLL 1JYVA 4PJGE 4YX2H 1XGQB 3S36H 1LK3H 2CRZA 3L1OH 1D6EB 5CD3B 1KXVC 4ZOAA 1QTYT 3QG7L 5IROC 3VWJB 2BZDA 4FTVE 4DTGH 5EO1A 4MX7A 3BZEB 1RJCA 4MSWB 1HSBA 1B0GA 4IRJD 2ZSWA 3VGHA 4IDJH 5TDPB 4B0MM 2VO5A 3IGAA 1JVKA 5T1DL 4NDMB 2VN7A 1UM6H 1P84J 1XR8A 3GNML 2GEEA 2F15A 5E8PB 3DTXA 4CMMA 3VXMB 1OTUC 4K94L 5AUMB 4WHCA 4KVNL 4JCMA 3HPLA 1Z0NA 3X14A 3W9DA 1KLGB 3JUZA 3IJYB 3BZDA 3RPIB 5AG8A 4NJAH 1EO8L 4WW2C 5FUZL 1KCRL 2CKBL 4MA7H 1NEZA 1U8JA 4KK9C 1MHPH 3S5LA 5DTFA 3MV9E 5DYOB 4X4XB 5CMAA 3PF2A 4PGBB 2Q76B 1UVQA 4EBQH 3MRLA 3P4NB 5IVXF 5DMIL 2EO1A 2AGJH 3K8KA 5CEYB 4MNHA 4QRQA 1KCSH 4FZ8L 5CJQL 3F7PC 3UXFA 1N3NB 3SE9H 5KBNC 1L6XA 4GS7B 1BD2D 1L7TL 5DK2B 1P4LA 2PCPB 4U6VH 1UYWH 3O41A 5FYLE 5GGVH 4M5ZH 3QXVA 5FKPA 2Q8BL 5F9JA 4OUUA 3TV3H 1L6ZA 3SGEI 2R0KH 3GI8L 1DFBH 2XACC 3D48R 4BQCA 4D2NA 3RGVD 4QLRA 4UZGA 5L6YH 3MQIA 5IGXL 1GGTA 5FV1L 5D72L 3MRPA 4FG6C 3G5XB 1FO0L 3OF6A 3UPRA 2VZ1A 2O5XH 1T0PB 4PV9B 3VXPB 5GGTL 3QPXH 4FNLH 5CP7A 1L4IA 1ZTXH 3V6ZA 2DTML 2WP3T 3PNWB 4X6BA 4X7DC 5ACZB 4MB5A 4XWGH 1L7IH 1EEZB 1CLYL 4UIKL 1U8PA 1F97A 4OLYH 4AIZB 5IIEA 1PSKL 2YPVL 4Q9RL 4J3TA 1I1AC 1IGTB 1HQRB 4HHAB 4QHNA 4DVRH 3WEXA 3DXAB 4MCZA 5GRUL 1HHGB 2DLFH 4G6FD 1NCAH 3S4SA 2EYSB 4GKZB 4GG8A 2V7HA 2BJMH 2R0ZL 2ZOKA 3H9SB 5LGHL 5I74B 1W0WA 5DDHA 5C2BH 3G5VA 4F57L 4G6ML 3C2AL 5D1ZD 4YHYB 1EEQA 1A1OB 4EJ1C 1OARH 1CICB 1JF1B 1OTTD 2ATPB 1TCRA 5F3BB 1V8HA 2O26U 1ZHNB 1H3XA 4NRYB 1CDBA 5DT1H 1SJHB 5ANMA 3KS0J 4WCYL 5J0BA 1MQKH 2VLKD 4QTHB 1AJ7H 4XNUH 1MAMH 4GKSA 1NC2B 3ZL4H 4MS8C 3IKCA 3AB0B 1U8LA 2YD1A 4OCRL 5DD5L 2RJMA 1YNKH 4ZODA 3V6OA 4NKOB 3S98A 3GMQB 4KRMB 3DUSB 4OT1H 4L3CB 3RTQB 3BHBA 1F13A 4KKNA 3RUGE 1MCBA 4ZAKB 5E4EC 3WJJA 2LTQB 3TLRA 2IH3A 3DGGA 4G9DB 3EJZC 4ZUVB 5ECJE 5GRZA 5I17B 2R1YB 2HFGL 4PG9B 5FKAB 2ICWA 1WV7T 2OSLA 2WWKT 2X4OA 4I8DA 4XPBL 5CINL 3PDOB 3SJVA 2CGRL 2AV1B 3MRFA 5EN2B 3LQAL 3O0RL 2MQ0A 2BX5A 3P9LA 4AL8L 3O4LB 5IBLD 4JR9L 1WWBX 1IKFH 5E5MA 5K93A 3Q3GB 4JG1H 4NC0B 5T1LB 3RWCA 5J3HC 1PQZB 1RURL 4WEBH 4HJ0C 5HGHB 3RPKA 2FHBA 5L8JB 1VGEL 2WNGA 3DVGA 5KG9B 4TSBH 5KW9L 3BH9A 4RA3A 3GSQB 1KN4L 4LCWA 1BHGA 3BDYL 3IDMB 1U0QA 5CWSB 4I18A 1QBML 3DI2B 3RVVC 3MRRA 1U8OB 1J1PH 2ZUWA 3QUMH 5HGAB 4RBPK 5GISL 5ERWA 1KOAA 3JWDC 2HG5B 4UOJA 5D7IE 1GYAA 2XZQH 3VFPB 1R5VA 1F3DJ 1Y18B 3EYUL 5C1MB 3ARGB 4TVPD 2DTSA 3O2WH 3BP7B 3EIFA 5E2UL 3R06B 4QYOB 3REVB 4LKXB 1BZ9B 1RUPL 4FXGA 4R2GB 5L2KE 1YEHH 3N06B 2VDLH 4LDOB 4YXLL 3OTTA 4JO4H 4PP2A 2FX7L 1P7KB 3EDEA 3MUHL 2ZCHL 1QLEH 2HFFA 1AIFB 2YXMA 5E00B 1CFTB 4JZJC 4FQHA 1BQHG 3MV8B 4RMQA 3PL6D 4JHBA 2IQ9L 3HRPA 4OFPA 3ZKMC 1KLFA 5IW6A 2EDJA 4JN2A 5IHLB 4WU7A 1JJUA 1VFOA 3MV7A 3UPAA 3GKZA 1KYOJ 3MA7A 3P0GB 3PHSA 2Q87A 4PGCB 1PG7X 1TXKA 4UOW0 5BV7B 2XI9A 1IKNA 3QUZD 3NN8B 4WI7A 1I8LA 1WFTA 4LOUC 5HHXL 5HSFA 2BNQD 5GGVY 3SDXB 4Q0XL 3WJLA 5K59F 5INDB 1DQLH 3DROB 4JM2C 2BOCA 5HDLA 4G9FE 2RFXB 3MUY1 4C56B 4O2EB 3V6OC 4NHUA 4XB7A 3BKYH 3L3IB 1YDPA 4V1DB 4KGJA 4KHXL 1TNMA 1SJEB 1FNGB 4Y4HB 4ODSH 4D0DA 4TRPL 1CGUA 2J8UB 4BQ6A 1RZGA 1I3GL 3ES6A 1OWRM 1JNLH 1IAIL 5HDOA 5HI3C 4N0YH 2JJSA 1RV6X 4KK5C 2ERJC 4GOSA 1AD0B 4NQCD 1Q9LA 4BZ1L 3BUYB 1RUQL 4HK0B 2FZ3B 3LS5L 4AEHH 4XTRC 5CD3A 4H25B 5K59E 1UM5H 3VWJA 4M1GH 2ZSVB 5FYKE 4M8VA 1LWRA 3RAJL 4IHOB 5C0CD 3BZEA 4MSWA 1KLUA 3I6GA 1CI5A 5BO1H 3UJTL 3CUPA 4NUJB 4KY1L 5TDPA 5J8OA 3T77B 4YHZH 2DB8A 5JO5B 4DKDC 1IQWH 1C5DB 4KKLD 4GBXB 1QRNE 4POZC 1X5GA 2I07B 1BAFH 4FQ2H 4R26L 3IDXH 4AG4H 2QQLH 1TENA 3O6FD 3WIHH 2ZG3A 5E8PA 1A3LL 3TT3H 4I18C 1Y6KR 3H6JA 3KJ4B 4F37F 4HEPG 4RSVA 2CMRH 5E99H 3OB8A 1DBJH 5DD0L 5T5FL 3GHEH 3CAFA 3ZTJG 2GY7B 2XYCA 3FAXA 15C8L 4OSUH 3ZE1F 3KYMA 3RPIA 2XT1B 4QRPB 2E27L 4L4VB 4U0RB 3KXFE 1QHPA 2OX5A 1KNOB 1CE6B 5JUEL 4M6ML 4WGVB 4Q58C 3HG1E 1A7OL 4MJ6B 3MA9L 1CGSH 2W60A 4PGBA 2Q76A 1KFAH 3V2AR 4XMKL 43C9B 3P4NA 5K9KB 3LVEA 5CEYA 2HRLA 4X9FA 5DQJB 1OM3L 3PHOB 1IGMH 5DD6B 1N3NA 3NACL 3DYPA 1FORL 5DK2A 2FSEB 2PCPA 1F6AB 1RJLB 3WS6A 1DSFL 3LZFL 1JGUL 3KPMB 3VXUE 4N1HB 3FO9A 3OXSA 2EEBA 1IKNC 4KKCD 3U36B 2CK2A 4ERSH 4MXVF 1I8LC 1TQBC 5EU5B 4QRRA 2YA2A 2K9UA 3WJLC 1JCKA 2BXYA 1OF2B 1BZ7B 1IEHA 4G6JH 3JWOC 3G5XA 5EU3B 4MDJB 2DLIA 3F6LA 4WFHD 4GQ9H 3VFNB 4PV9A 3VXPA 1INQA 4DKAA 3VH8A 4M7KL 4HD9A 4B41A 3LRHA 5ACZA 3B9KD 1EEZA 1CLOH 3SPVB 1VDGA 2MCPH 5MEQA 3MJ7B 3ULUE 5F9DC 3VDCA 3MLSH 5EIQA 4OLUH 4XPFL 1IGTA 5FCUH 3U1SH 1HQRA 4HHAA 1PG7W 1DBBH 3O45B 3FQWA 2R4RH 2DN7A 1FPTH 5D70L 3SEPA 4OCNC 1HHGA 2G5RA 3UAJC 5DRZB 1YMHB 5HYJB 2EYSA 3IJHB 3WYRA 2PYFB 4GKZA 3UTTD 3H9SA 1QYGH 3MRHB 4PJGB 4BZYA 3BFOA 2ZUYA 2HVJB 2ICWI 4LSUH 4K7PL 4L9DA 4FTVB 4PJBE 3EKCA 2R4SL 1CICA 5F3BA 2HAZA 2BFVH 4JO2H 1ZHNA 3VGEA 5F21B 4NRYA 4OZ4B 1SJHA 4F7EA 4RZCB 2R15A 3KNBA 1ZEAH 5JDSB 3VGDA 4X6CF 3FN0H 4HS8H 4HZAA 4YPGA 1AR2A 3BGMB 5I1DB 1TZIB 4NKOA 3GM8A 5MP6H 1LILA 3DUSA 2GQHA 3P0YL 4L3CA 4RGMC 3RTQA 1IE5A 5AYUH 3OKEB 2BVUA 1BIIA 3NCCB 4ZAKA 3EOTL 1SHMA 3D2UD 4G9DA 2F5BH 4BQ9A 1I8KA 1I9RH 1C7SA 5I17A 2R1YA 1KJ3H 1XGRB 5E8DL 1DDHB 3VFOB 3PDOA 2X4PB 4U3HA 1AI1L 2R56H 4MMXC 3MV9B 2AV1A 1XEDA 5KVGL 1BMGA 5EN2A 2F58L 2M1KA 5MHSD 5MI0B 1A1NB 3MNVB 3Q3GA 2IBZX 2ZUVA 5T1LA 2HTLD 5TE4L 4DAGL 3KLHC 4KV5F 2I26N 4W81A 1PQZA 5D6CB 1WVZA 3JVGA 3QULA 3SGDI 5JW4M 3PP3H 3QXTA 1GHFH 3GSWA 4R4NC 4P5MB 4XNXL 3S3JA 1LEKB 3BT2H 3KPSB 4JKPL 4PRPA 4Z7VF 3SBWC 5ALBL 4K71B 1NQBA 1ZT7A 1NCBH 1S7RB 1T80A 2CSPA 2P8LB 4NJ9H 4I77H 2X4TB 4UINL 2MKWA 3GSQA 3MLVH 2W92A 1MNUH 2ENSA 4U1KB 1XR9A 4LU5L 2J5LB 3T0DA 4TVPL 4YBHA 4KZDL 3B9DA 3O6KL 1ADQL 4RGNC 2HG5A 3TF7C 4DZ8B 1Y18A 2Z0BA 4YXHL 2VMFA 3ARGA 2Z4QB 1Z9MA 4L4JA 4KV5E 4QYOA 3REVA 1VFBA 4FMKA 4LKXA 1NL0L 1BZ9A 2HKFH 3ESVF 3M17B 5ACLA 5T5NG 3WD5H 3EW3B 1P7KA 1IGIL 4PJ9B 3FCTA 1AIFA 1CFTA 4Y2OA 2VL5B 5FHBL 3ULSB 2IPUK 2XWBB 1Q72H 3QDME 4HC1A 3BZ4A 5EUOE 3RIFK 4LNVA 3I84A 5GZNC 3H0TB 4U1IB 1E28B 3SDAB 4YHYC 4JZOB 3WIFB 2HFEA 1J0YA 3PWUA 3EYOB 4PGCA 4AM0B 1Z9LA 2VDQH 1MFBL 2VRAA 1J8HD 5GZOD 3I6KB 4K8RH 4JO3H 3NN8A 3X3GL 2A6IB 3S35H 1N8ZB 1GZPA 3SDXA 3MFGB 1G7HA 2Z8SA 1H8OA 4CL7A 2JELL 5EZLB 2RFXA 4C56A 1PAMA 2Z31B 2BVQA 4O2EA 3RVXD 5K9JH 4S1QH 5HI5D 5DLML 1A22B 5IJKA 4KXZH 4V1DA 2QSCL 4GAJL 4FQXB 3Q0HA 2YD6A 4X9BA 4ENEC 4Y4HA 2J8UA 4JY5L 4ZAKC 5IHBA 2OL3H 3O6MH 3LEYL 3QDGA 5EA0H 3BEWA 2JIXD 1HH9A 3N9GL 1HINL 3NCJL 3HS0B 4HK0A 2P8MB 2FZ3A 5GGSA 3A6BL 3LPWA 2GUOB 2VDNL 4GAFB 4H25A 3RUGB 3GSRB 2XRAL 2Y5TB 5SWZD 3S88H 3RKDD 4IHOA 4NUGL 4XVUD 3ARWA 4WJ5B 3GMLB 4NUJA 4XAKE 2RB8A 2Y06H 3T77A 3JVGC 5JO5A 3LB6C 1FG2A 4GBXA 3QQ4B 1TETL 4S1DC 1WWCA 2B4CL 2I07A 4Z7QE 1MCDA 4G6KL 4W70A 4P4KB 1NAKL 5IFHH 2AK1H 1CFQB 3QNZB 2B0SL 3CDCA 3TNNB 5KSVB 1CLCA 4NP4H 1UWEH 1YY8B 1VFAB 2IBBA 3NH7H 4HFUH 3WKNA 4ONGL 4D9RE 3T4YB 5I1LB 1FSKC 1JYWA 2AJYL 1DCLA 3ARGC 5BOPA 4XHQA 4L4VA 1D5BA 3E6FB 1CE6A 2GKIA 4G8EA 3ARPA 3SDCB 4PJDB 3T8XB 3ZDZF 4MJ6A 4HDIB 4HFWB 4Q97A 1J1XH 4YBQC 2EXYD 3LRSB 4OF8A 1PY4A 1MI5A 3ZT6A 4QHLA 1H3TA 3QIWB 5D7IB 1T1ZB 4Q74A 3OXRB 1NCTA 5DSCB 5DFTA 1TVDA 1CD9B 3PHOA 1N0XH 5CIPH 5DD6A 3OKDB 4U6XB 4BM7A 1R24B 4NQUA 4LP4A 5L2KB 1GIGL 1F6AA 2Y07H 1FG9C 2B39A 4I9WE 2Y7QB 4Y4KD 3FB6A 1QLFA 5BV7C 2OR7A 2VLMD 5HYIA 1MFEL 5JPNB 4A6YB 3TH2T 4XCFL 4NHCL 1KEML 2FJHB 3CIQA 5EU5A 1SBSH 3TBWB 1T0NA 3OKKA 5KANG 3U46A 3RX7A 1OF2A 2ARJB 4FQIH 2DL2A 2OP4H 4LMQI 2CQVA 5EU3A 4MDJA 5ALCH 2EH8H 3V5DA 3Q6GH 1NBYB 4X4ME 3VFNA 2CR3A 2AJSL 5IJKC 2GJ6B 5JQ6H 3T2NH 1YYMH 4M03A 4KKAD 4CAGA 3DNKA 5CFHA 4G9FB 5DFVD 5KVFL 4KRPD 4K9EL 3DV4A 1K6QL 2B1AH 5E8OB 3MJ7A 4L3EE 3EZ8A 4EUPH 4DN4H 5E6ID 5I8EB 3V5KB 4ZNEE 3UJJH 1Q0YH 1FL3A 3O9WB 1U91A 2RBLA 5LCVH 3S9DB 3O45A 4NWTL 4LSDA 3IF1A 1A6UL 1MFDL 3TPUB 1IC7H 4XPAH 3EZJB 1G9NC 3IJHA 4OJFH 2PYFA 4NCC1 4XVSH 3V0VB 2CLZB 4PP1C 2DICA 3MRHA 1F3RB 2HVJA 3AREB 2NY4D 2VXSL 4NO0A 4FTVA 2BY1A 3WS3A 1Y6NR 2MFNA 1QFUH 1OSZB 2D7MA 1JPGB 2CRIA 4OZ4A 2NTSP 4F7CA 3HAEH 4RZCA 3K74B 3GSUB 2YUXA 1QRNB 1FE8H 3C5JB 4TULL 3RHWF 2YPKB 5BS0E 3BGMA 5I1DA 2B5IB 1SMAA 1XCQA 1TZIA 4BQ8A 1NAML 4TQEH 4JDZB 1ZHKA 1V3LA 5C0BB 3V4PH 3CC5B 3RVUD 5FYJH 3ET9F 3OKEA 2IAMD 5LKNA 1YPZF 2XICA 1KXTB 5HVHB 3LS4H 3V52L 4M7ZC 3ARFB 2VXTH 2HLFD 1HKLL 2PTVA 3V6FA 4F58L 1T2QL 4ISVA 5EOQH 4HKBB 2IH1B 1DDHA 3KXFB 3IDGA 3VFOA 4MXQD 4PB0L 1MWAL 2X4PA 3QPQC 3T0BA 3MV9A 3GK8H 3HG1B 5C08E 4XP6L 2VAAB 1CFBA 4ETQA 4XNZC 1P7QB 2NY5L 1F3JB 2D7QA 3MNVA 5HYSB 4APQD 3WFZA 1EFXB 5D6CA 1FIEA 4QHUB 2EZ0D 4P5MA 3HE6A 1LEKA 4F7PA 1NANI 4KAQH 1S7RA 3I02B 4Z5RB 1A6AB 1W0YT 3MRBA 4GW4B 3VXUB 2ED9A 1FNSH 5D7LD 4D0CB 4HWUA 4F8TA 1KB5B 3AY4A 2H32A 4U1KA 1T21B 1FYTE 1IFHL 5E2WL 1ZLSL 1S5IH 2OZ4A 4RWHA 2IPTH 1JPTH 2PKDA 5HPMB 4HEME 3SO3B 3GB7B 3BX7C 2X9XA 1A0QL 1UCTA 2A38A 2V2WB 1ZKAA 3X3FH 2BVPB 3JTSB 5B38A 4YK4B 4YNYB 3Q5YA 1II4E 1U8MB 3ULVF 1CLZH 4LIQH 3M17A 2XKUA 1S9KC 4I2XA 2HVKA 4JG0L 5K9OB 1C5BL 2F19L 1BD2E 4XGZB 4PJFF 3VRLE 4PJ9A 1P4BL 3KLAB 4MA3B 4IOFC 2FO1A 1YUHB 3L3KB 3JSSA 1OB1B 2VL5A 2DOCA 3ULSA 5DMYA 2XWBA 4BJLA 1NGQH 1X4ZA 1GSMA 5I1EL 3GMPA 3UYOD 1FFQA 4U1IA 1E28A 4NN6B 1INDL 3SDAA 4JZOA 3WIFA 4YDIH 3EYOA 1L0YA 1MCOL 3K8MA 1YQVL 3I6KA 4F33B 5TE7L 5IQ7H 1QBBA 4PRDB 4Y1AD 2A6IA 3QISA 1N8ZA 4NT6B 4OF5A 3SKOB 4IBLT 1AY1L 4YPJA 5SWSD 4ONOA 4PJBB 3WE6B 5KJRH 4Y19D 1GH7A 1KGCD 4PJFE 4HH9B 5T5NF 1QA9B 4ZFOL 4LSQL 3EYVB 4FQXA 1T03H 1QUNA 4HF5L 2FR4B 4ESKA 3UX9B 4RX4D 1R3HB 3RIAF 3IKKA 3GGWB 1HI6B 3WXWH 1A7RL 3HS0A 1G1CA 5EBWB 1J1OH 35C8H 3TIEB 3CU7A 3CSGA 1OVZA 2P8MA 1ONQB 2H41A 1I85C 1WWWX 2A0LD 2GUOA 4LRIA 4MQXC 2VLJD 3F6IA 4JCLA 2Y5TA 1FGVL 4EQ2A 1AC6A 4G8IB 3BD3A 5MI0C 3EJYD 4FZEH 3VRIB 5CEZH 3GBMH 2CK0H 4ZO9A 1HSAA 3HAEG 3HE6C 3QQ4A 4P2OB 1AE6H 2VLKE 4KQ3L 4K71C 4AMKH 2OJZL 1JPSL 2CDFB 2D03L 4P4KA 2XTJE 4HGKC 4Y2DD 3KPTA 4P59H 1AC0A 1Q8MA 3QUXD 1CT8B 1U8IB 1CFQA 3QNZA 3TNNA 4UB0L 1YY8A 3PUCA 1VFAA 4IMLB 1A6WL 1OLLA 3FONB 3TFKD 4N0UE 4FFWD 3IXAB 3QJHA 3FHQA 3T4YA 4NO3A 1U2HA 3HNVH 3VGAB 5FUCC 3N85H 1RMFH 4YH6A 4TPRH 4K3EL 3E6FA 2BRQA 5MEPB 2VSCA 4KJWC 4HKXB 1VEMA 3T8XA 3SDCA 4G80B 4HIEB 4HDIA 4HFWA 3LRSA 1KIQB 4GRMA 1WK0A 3QI9D 3D85D 4Y16C 4ONHA 3QIWA 5D7IA 4NZTH 2H45A 3MO1A 3OXRA 2CKBB 5B3NA 1CR9H 4M61B 4OBRA 4XNYL 2AW2A 4DCQB 3OKDA 1OD9A 4U6XA 5F1SA 1HNGA 1WBYA 1VFMA 3OGOE 1R24A 2Y36L 5DD3L 4NM4L 5L2KA 3OL2A 3Q1SH 2W65B 2V6HA 2Y7QA 4JFZH 4HG4K 3PGFL 3LH2H 4A6YA 1P5UA 4PY8J 5BZDB 2FJHA 3QDMB 3TBWA 3VGFA 2FJFB 5F7WC 5EUOB 1NDMB 2ARJA 4OD1H 3VA2C 5D2NE 2P5EE 2C3VB 4G7YH 3BAEH 4FABH 3IRZA 1D5MB 4NWUL 3GUTB 5ACMA 2FECL 1NBYA 3QFJA 4D9QD 3QEQD 3MYJB 4TVPE 5F89B 1CZ8H 4YO0B 1U92B 4ZOEA 3WHE1 1OAZH 4KK8D 4G9FA 1FO0B 2R2EB 4R7DA 1IM3B 4MLIA 5E8OA 1D5XB 3LD8C 4X5WB 1QSFD 5I8EA 5IB1B 1QHOA 3LKNB 4NO2B 5L9DH 3O9WA 2PN5A 4LRIC 4OCYH 4Z9KB 4H20L 3DLQR 3WV0A 3CLEH 3C5ZB 4OBSA 3G08B 1KJMB 1EZVY 1MIEL 3TPUA 5HHOD 1N59A 1U3JA 5C9KA 2P48B 1YECH 3V0VA 4ZYKA 3BYYA 2CLZA 2J2ZA 4OQTH 3P4OB 2DQIL 4HK3J 3AREA 2BNQE 3TZVB 1FZKA 2X70B 2OTPA 5C07D 3RKPA 4H88L 5JR1L 2PTTB 1OSZA 2GFBB 1JPGA 5GSVB 4RWYL 4YZFF 4LBEB 1XF4A 4X99A 5ISZD 4BELD 3GSUA 1TVBB 4JJHA 4EEEA 4YX2L 3S36L 1LK3L 3L1OL 1PLGH 1VA9A 4P99A 2YPKA 3SGEH 5CJ8A 4DTGL 3IDYB 4FQQA 2DRUA 4YEFA 3BPOB 4JDZA 3MBXH 3MRQB 2EC9U 4AIXA 3CC5A 2D7TH 2P42B 2QL1A 2XQYG 4JB9H 4IDJL 4HIHB 1A47A 4NQCE 3KHQA 4P2RA 4UTBH 3QIWC 2F54D 3AS0A 5CEXA 1HHIA 4K23H 3VCLB 1UM6L 1HXYB 1SJXA 5KTEL 2AJXH 5DVLA 3DBXB 3FL7A 3BD5A 1KTLB 5C0CE 2X44D 3CX5J 3H2WA 3KXFA 1IQDA 3LOWA 2WZPD 1JZ4A 4MAYD 4NC1E 1UC6A 3EYFA 3TJHD 4TVSa 3HG1A 1X5XA 5DVKA 4OIAA 2Q6WA 4IJ3C 1F3JA 3UBXG 3UYRL 2ZUQB 4JAMA 3T0AA 3UYPA 3LAFA 5EBLB 4NJAL 1EFXA 4X6EB 4QHUA 4MA7L 2PXYD 1MHPL 4KI5D 5EOCH 3W0WD 2YA1A 3I02A 4Z5RA 4HUUB 5I15H 3MLRL 4GW4A 3VXUA 5I8KH 4EBQL 2FLRT 3H8NA 3SKMA 3MJ9L 4DWHA 1KB5A 2XV6B 2ZUXA 1T21A 1EGJL 2AGJL 4JFDD 5GRYA 1KCSL 1UFUA 4FFYH 2BSSA 3SE9L 4U1NB 1C12B 1ZSDB 3OAUH 4LDLB 4LKCB 4WV1A 5HPMA 4U6VL 1UYWL 2CLRB 2QSQA 5GGVL 1NDGA 4M5ZL 4U1LB 3VXRD 2NY3D 5GGUB 2BVPA 4YNYA 3HE7B 2R0KL 1U8MA 4LASH 1DFBL 4GAYA 1KXQE 3NIFF 1AGFA 2WWMD 2C4FU 3BVNA 2GTZA 4XGZA 4LPCA 4NFCA 5IW3A 1A7NL 2WBJD 3KLAA 4MA3A 3SDYL 1YUHA 3L3KA 4GRLB 4FXLA 1CG9B 4WWID 1HQ4A 2O5XL 3TN0B 5I6XB 4CN1A 3QPXL 4QWWC 2ESVD 3X12B 4FNLL 1VKXA 1I1YB 1CK0H 4UBDC 1IBGH 1ZTXL 2VABB 1XGTB 4GKNB 1D9KB 2PYED 3H42H 4XWGL 4F33A 1J0KA 3MRMB 1G6RB 4WFHE 4KROD 3FO2B 3SKOA 4DVRL 4U1MB 3QXWA 2XIDA 1FFOA 1TZGH 1K3IA 12E8L 5C0AD 4EN3C 4U2YA 2DLFL 3ZYJA 3WLBB 1ZHLA 4U6HB 1NCAL 1QA9A 1CXHA 4DFIA 3K8LA 3EYVA 3UO1H 5BQ7A 2BJML 1ZVYA 1BIHA 3QDJD 2X1XR 2C4FT 4P9HC 5FO8B 4CMHB 3LMJH 5BS0B 4J8RA 2A9NH 2NY0B 3GGWA 1HI6A 5HDQH 1UWXK 1OARL 4PJEF 1CIDA 1KG0A 3QIUB 5EBWA 3TIEA 4OV5B 1MCSA 5A3ID 2XQBH 1ONQA 3MREA 5DT1L 5I1KH 1P4IH 3UTTE 1MQKL 3HFMH 4WWKB 1T7XA 1AJ7L 4XNUL 1MAML 3N1PC 5KS9E 3QEHB 4G8IA 3PIQB 3PXHA 1OP3K 1ZWIB 5EDXA 3VRIA 1ZHBB 1YNKL 2EYRA 1UENA 3FO0H 5IMMB 2BDNH 4IRJB 4NQVB 4OT1L 1IGFH 4P2OA 4J3XA 1N26A 5IVNA 1X6LA 5B3JF 2PO6D 4OZFH 2VKXA 3KGRA 4U7KA 1CT8A 1Q9KB 3UC0H 3FONA 4PJAE 1B4JH 3IXAA 3ZKND 5CBEB 5ELIA 2ATKB 4CVXA 4WV1C 3DI3B 2HN7B 5C0DA 1IKFL 4ONFL 4JG1L 4HKXA 4G80A 4HIEA 1QFHA 4NKDB 1KIQA 4WEBL 1QFWM 1NKOA 4LSSH 4JEGB 3AMLA 2CKBA 1FN4B 4M61A 4TSBL 5MHSE 3SCMD 1NKRA 3L5JA 2HJLA 4PFEA 4MHHG 4MJIE 1J1PL 2G9HB 4NN5C 4Z7VA 5SWQB 3QUML 1A21A 1BD2B 3U4EB 3WO4C 3U6RB 1U6AH 3GJFK 2V9QA 4X0KB 4WTWA 1TPXC 1Y6MR 5BZDA 1I9JH 3MRNB 3P0VL 3CNKA 3QDMA 3O2WL 1S8DB 3BKCH 3SGJA 2CKNA 1F8TH 1RUAH 4XWOC 5EUOA 1NDMA 4GRWF 2C3VA 2FL5B 2QTEA 4JPVH 1OT1A 3MGOB 4OFIA 3RGVB 1D5MA 1YEHL 4M8QA 1KUMA 3GUTA 4JO4L 1BF2A 5GGRY 1PJ9A 1QLEL 3MYJA 1U92A 4BUGA 1U93B 5IHZB 3HI6H 4UDUB 1EPFA 2Y25A 1FO0A 1P84K 2R2EA 1IM3A 1X44A 2LAGB 1KEGH 3PWPD 1T4KB 4Y5VB 5IWLA 3IDNB 1HYSC 5IB1A 3LKNA 4NO2A 3QO1B 3QBTB 2IWGA 1KACB 1OAKH 5FB8B 3C5ZA 1EAPA 1KJMA 1DQLL 5DJYB 4K8RD 2WV3A 4HMDA 3QQ9D 4XI5D 3SE3A 1WZKA 3ARBD 5CZVL 4G6FB 1J8HE 5IQ9B 1D5ZB 3VRJB 1KELH 4ELME 2XA3A 3P4OA 3BKYL 4KMTH 1O7VA 4G42A 4P2OC 4L1DA 5DRWA 4ODSL 1IC4H 3TZVA 4AEEA 1NBZA 5JOFB 2X70A 2PTTA 1JNLL 1YEGH 2GFBA 1X9QA 5GSVA 2NY7H 5D1ZB 4PJ7E 1H3PL 2C3GA 4LBEA 5ADPH 3ZKSD 4FN0A 3C60A 5DA4A 2VLKB 3C8KB 4N8CL 4GSDH 2X1QA 2IAND 4DFHA 4P23D 4M1GL 4JHZA 4ZUTB 5E0QA 3MBEC 3BD4A 2YHGA 3MRQA 2EDHA 3G04A 5BO1L 4N0UB 4YHZL 5C3TA 5M94B 1IQWL 2YOCA 5JXEA 4H0HB 5FK9A 1TLKA 5BJTB 5SWZE 1BAFL 3DBXA 2B7DT 3ULVL 2I9LA 3IDXL 5SV3A 4AG4L 1IM9D 2QQLL 4JREB 3WIHL 4IEFB 3TT3L 3S37X 2VZOA 1HIMH 5FGSA 3NIGE 1ITBB 4ZS6C 2CMRL 5E99L 1FAIH 1DBJL 4PLKC 1CU4H 4WU5B 5FHAH 4LVNB 4XX1E 3GHEL 4TUJB 5F9OL 1JNJA 1AHWB 4OSUL 5DI8A 3HZYB 1NMAH 3HN3A 3HHRB 1FZJB 4X6EA 1R5WA 1HHKA 3EAKA 3L3HB 3KJ6L 4LEXH 3RVTC 3CCHB 1FVEA 1CGSL 1A3QA 4HUUA 1KFAL 5FO9B 1ULVA 5LWYH 2NZ9C 1CF8H 2VWEE 3DRTB 2K7PA 4XNMB 3TJEL 5KVEH 5D1XC 1IGML 4UT6H 3B5HA 4U1NA 2P5EB 1C12A 5D2NB 1ZSDA 4DJMA 3KHOA 2CLRA 1MUJB 3NFSH 1WSST 4U1LA 4NNPL 4C4KO 4OTXH 2G75B 2FH8A 3M07A 4WI4A 3WNNA 1CL7L 2CUHA 4ERSL 3HE7A 2N7BA 5DHVB 1WICA 3CD4A 4POUB 1EMTH 2FGWH 4NKMA 2ZNXA 5J11C 3GSXB 4GLRI 1MVUB 4G6JL 4KPHH 1YMME 3UMTA 4L3EA 4GRLA 4X6DF 25C8H 1CG9A 4MA8L 4ZNEA 3BPNB 4H26B 2DQCH 4S0SD 2VLME 1MJ7L 4ZXBD 1YEIH 3X12A 3LDBC 3PL6B 1NEZG 1I1YA 1XF1A 3S5LG 1XGTA 2ADGB 4GKNA 1MY7A 2YPLD 3DVNB 4BFGA 4N5EC 3HUJF 5IMKB 4JM4H 3KYNB 2MCPL 1U3YA 5DC9B 1G6RA 4MWFB 1SEBB 1DUYA 1F2QA 3C60C 3FO2A 3QUZB 4OLUL 4ORZC 5FCUL 4Q6IB 4F2MB 1S7WA 4X9GA 1MCJA 1DBBL 1RY7B 2BNQB 3B9EA 3PWLA 5E2VH 5B21A 3WNPA 2R4RL 3IDYC 3NCBB 2FECI 3BXNA 3WLBA 3SGDH 4U6HA 1KJ2B 5T1DH 4DKEH 1QR1B 4X98B 1QYGL 4NRZA 1NEUA 3OKLB 3O3DB 4PJHF 5JXEC 5FO8A 1AQKL 4RFEB 2VZ3A 4LSUL 2IG2H 3OKNA 5BS0A 4Q9QH 1CFSA 1NBQA 3GBLA 3BQUC 1OQOA 3TH4T 3QIUA 4K94H 4LGSB 3V4UL 2BFVL 4OV5A 4JO2L 3FQTA 2CUIA 1JHKH 5ENWA 1YEFH 1EHLH 4NQCB 4WWKA 1Z2KA 1ZEAL 4EDWL 4WI3A 2DQHH 5DXWA 3QEHA 3FN0L 4HS8L 3B8YA 3PIQA 1URLA 5TF1H 1QNZH 1WUNT 1J12A 1B2WH 1ZHBA 5C0CB 5CCKL 5MP6L 5FOBA 2X7LA 4PPTA 4IRJA 3MLZH 4NQVA 5IVXB 4OFKA 5AYUL 3RY4A 2ICWJ 3G6JE 3FT3A 5C08A 3ZE0F 3TPKA 4FZ8H 3CDYA 4XP4H 2WW8A 1EERB 4LEOB 1DQQB 3NCYS 1I9RL 5FYJD 3MJ8B 4LCUB 1Q9KA 1KJ3L 3MLPA 3VD7A 3O6FB 3S4SG 4ZDHB 7FABL 3ARQA 3GMOB 1VENA 2ATKA 2Q20A 2R56L 5GS0C 4Q7DA 1KYOK 5D2LF 1JGVL 4NQDE 1UZ6F 1ROWA 2MOVA 1ZLVH 5HD8C 3T3MF 1S7UB 1FYTA 2FO4B 5JA9A 5E8NB 4NKDA 4AQOA 2OI9C 1GHFL 4UDTA 5GGTH 2HMID 1NCBL 4W6WB 1HOCA 1FN4A 4I77L 5F6IB 1TJIH 3MLVL 5EZJA 3ZYIA 3I75A 2QADD 4K3JH 4PBVC 2G9HA 2LU4A 4QXUL 2VC2H 1BWWA 2GY5A 1BD2A 4RA0C 1MHHB 3U4EA 1ND0B 3GSOB 3U6RA 2BP3A 4O58L 4X0KA 4Y5YB 5IT2H 3ARXA 3MRNA 5D7LE 1S8DA 1MCEA 3QDHA 5MERB 1R3KB 2FL5A 2VXQH 4TUOB 4O4YH 3IFPA 4PJIE 1IAIM 2HKFL 3MGOA 4R0LB 2OJEB 4K7FB 1F6FB 3RGVA 2JB6A 5HGGS 3C5SB 1E6JH 1NCUA 2JK5B 4XBGA 3WD5L 4Z7NF 5D5MF 1J5OH 4K3DH 4XCYB 2EE3A 2MKLC 1U93A 1Q72L 3GRWL 5IHZA 4OFDA 5HDBE 1HHHB 1F02I 3B8SA 3ZKXC 2C1PB 4UDUA 3TO4C 4Z7UF 4WCYH 1KN2L 1R6VA 3B9KB 1T4KA 4PJFA 1UQSB 3QHFH 3QIUC 3IDNA 5BZWB 4NKQB 2VDQL 1Z5LA 2Q86A 3QO1A 2EXWD 3JTTB 1PKOA 4K8RL 4JO3L 3U0TA 4R90H 1M4KA 4MD0B 2AQ3A 1EBAA 3DGCR 3S35L 5FB8A 4X4YA 1HHJA 5E4IA 5DJYA 4LHUD 1FL5A 1YY9C 1ZA6B 3LHPL 4QNPF 1GOGA 2V7NB 2YD7A 5FFLA 5K9JL 4GG6F 4S1QL 3VFSA 1D5ZA 3VRJA 3RHWK 4S10A 4Y1AE 3UTTB 5TQ2H 4J3VA 1DQMH 1O7SA 1P9MC 2HTKC 4LAQH 5KS9B 2OL3L 3O6ML 1G7MA 1KV3A 2AABH 2FX9H 4NZUL 3BZFB 5EA0L 2H2SC 2IGFL 3INUL 4GXVH 1RZKC 1MCPH 2J8OA 5CZXD 4OZIE 3UTOA 3MNZB 4LCCA 4D94A 1RZ7H 2R69H 4M02A 5L2JB 1A6PA 5F1NB 4OLXL 2FIKB 1JGEB 4WTZA 1J0ZA 5EOTB 3OJ2C 3O6LH 2NY1C 1F45A 4P2QD 4ZS7H 2AJ3B 1MHCB 5EC1B 4N0UA 2Y06L 4PJAB 1KN4H 3UTSD 1H3WM 3PWVA 2EDEA 1CYGA 5HY9B 4HWBH 5IG7B 5BJTA 1NAMB 3D0LB 3D2UB 4JRXD 5CEZD 5I9QC 1UZ8A 5IFHL 2AK1L 3LSOB 3RWGB 4MVBD 4NP4L 4URTB 1UWEL 1I9EA 3NH7L 4HFUL 2D3VA 3T0VA 4WU5A 2DWEA 4OLEA 1AHWA 3GMRB 4ORGA 1CXFA 1RUPH 3PE9A 3HZYA 1FZJA 1MWAB 3NPSB 4I5BB 4YXLH 3L3HA 3MRCB 3DHMA 2FX7H 5JNYB 4JY6B 3HR5B 1IAKA 1J1XL 2XKSA 4N8PA 5FO9A 2J8HA 3UTPD 6CGTA 4YHIB 3QUKA 1XIWC 3DRTA 4XP1H 2IBZY 1B0RB 1N0XL 1V7MH 5D2NA 2P5EA 2H26B 4MXWL 3QAZC 3ALXA 1TJHH 3K0WA 2UY7A 3O3AB 1XGUB 1MUJA 1JTOA 1M7IA 1X5HA 2G75A 1K8IB 2LE9A 4P3DB 1FAKT 5F7EL 3CFJB 3HB3D 5DHVA 1ADQA 1SBSL 3B2UC 2P43B 3W39B 2I60H 4FQIL 1H5BB 1MVUA 2OP4L 4XNQB 4KHXH 4RMVA 5EWIL 5GXBB 3WNMA 5EU7C 1QACA 5ALCL 2EH8L 4X80H 1G84A 3ARYA 4KI1A 1HNFA 2VITB 4NBZB 5IB4B 4NZJA 2L7UA 5JQ6L 3RY6A 5DMGD 3LPFA 5GSRB 3T2NL 1BJMA 2ADGA 4BZ2H 3ARDA 3DVNA 2V5YA 3FQXA 3RI5K 4J3UA 4WHYG 2B1AL 5IMKA 4HV8A 3KYNA 5J6HB 4M7JH 1J9CT 4JQIH 4MWFA 4NFDA 5BXFA 4JZNB 1J8HB 4D9QE 5HHNA 3QEQE 1Q0YL 3UJJL 3QUZA 4ELMB 4LCCC 4F2MA 3HRZA 1S9VB 1ZK9A 5LCVL 2WQRA 2BNQA 5EG6C 2D0HA 2XTJC 3P11H 4CJ0A 4LLVB 3QH3B 5D9SB 1IC7L 3VFMB 1KJ2A 4XPAL 1U58B 4PJ7B 5GJSH 3MCG1 4XBEH 4OJFL 1NANH 1JWMB 1QSFE 4GW5A 4KRLB 4XVSL 4X98A 4K07A 2IQAB 3OKLA 5LGJB 1XMWA 3MLXH 1A3LH 4RFEA 5H37H 2GK2A 4JRWA 3KYOB 1I7UB 2YD3A 5C71A 5F8QC 1G0XA 4ZFOB 2JIXB 1QFUL 3U9PH 5KSAA 3NBNA 1RUML 1AQDB 3QZWB 4QRUB 4NQCA 4NIKB 1OHQA 1OOAA 1UH3A 4LVNC 4O00A 1RAMA 1FE8L 1WEJH 3VH8G 3OAZH 4OGAC 2Y6SD 2XA8L 5SWZB 3TH3T 5C07E 3IAPA 1TQCB 5C0CA 1NMCC 3VI3E 3ZLQC 3V4PL 5ISZE 2VOTA 5J12C 3RZWA 5C6TH 3WIIH 4MZ3A 3GIZH 3ISWA 2E6QA 3LS4L 3GO1H 4LEOA 2VXTL 3NACH 3ROLB 1UJ3B 4LCUA 3O6FA 5T3ZH 3LZFH 4ZDHA 2FEDD 3C09B 3P73B 1J88A 5D2NC 3GMOA 3TVMD 5EIVA 4JVPA 3IDUA 3GK8L 3GIVA 1PEZA 3T2PA 5A2KH 4RMWA 2A74B 3PHQB 4E0RB 1G9NH 2GT9B 2F54E 2VLRD 3ALPA 4CUCA 3DUUA 3FZUD 2FO4A 1KT2B 4Q2ZB 4IMKA 3FRUB 4Z7WF 1MREH 5E8NA 5D96B 5F1IB 1P7HL 3SDDD 4KAQL 4K7PX 2YEZA 4OCMC 2DDQH 2DKSA 5GS1A 4CVUA 2E5EA 4BH8B 1CGVA 3RY6C 1WCBA 4ZNCD 1S5IL 1MCWM 2IPTL 3MC0A 3ARDC 2NW3B 4PRNA 4KI5E 4UQ2A 5DJ6B 1MHHA 4D9LH 2H6PB 3W0WE 4HSQA 1JPTL 3GSOA 4Y5YA 2MWCA 1ZS8B 4C55A 4Y4KB 3X3FL 3QUZC 3D1MC 5DJAB 5MERA 3R8QA 3GEWB 2VH5H 1R3KA 3VW3L 1I9IH 4TUOA 4JFDE 5DEFB 1FZMB 2HLAB 4K7FA 4LIQL 3AMKA 3C5SA 4HLZG 2ADIB 4M5YH 4WFGD 1S7QB 4M9PA 3PWNB 3DWTA 4XCYA 4EXKA 1S7VB 2GJZB 3VXRE 2J6EL 1LE9B 2R4SH 4L4TA 5D1QA 2E7LA 1HHHA 1A4KA 3U30C 1NGQL 4X7FC 1C5CH 3VI4F 2F53D 1EAJA 4LVEA 4YDIL 5BZWA 4KRPB 4GKOA 3FFCD 1F00I 5DJZB 1CL7I 5DJDA 5KSAC 4AH2B 5JOEA 4YAQA 5IQ7L 1OTUD 5E6IB 3WNKA 4OCXH 5FGBA 3UTZB 5JW4N 3DO7B 2NX5D 2XG5A 3FN9A 3RNQB 2EKSB 5KJRL 5D4QA 1T0MB 2OR9L 3EOTH 2PYEE 4KK9D 1D6VH 5D7JC 1VGKB 4NC1C 4KJPC 1CFVH 3UTTA 3P4MB 1OTSC 3WMSA 1T03L 3QEUA 2F9BT 4HBQA 4IRSA 1A7PH 3P40A 1A7QL 2ICES 2NY4B 3BZFA 3VE0B 3MCKB 1S78D 3LEXB 3SO5A 3MOAH 5KVGH 3WXWL 5C0AE 1J1OL 35C8L 4HIJB 3MNZA 2WLYA 4CADA 3G6JB 2XN9D 5L8KB 4DAGH 1U8KB 5L2JA 5F1NA 4YDLC 1AXTH 1I7ZB 1JGEA 2ICCA 3LKSB 5EOTA 5J4MA 4FZEL 3H7LA 1G7LB 3PGDB 2AJ3A 4IMKC 4IRZH 5CEZL 1MHCA 3GBML 4JFXA 4UINH 4PJAA 2BNRE 2CK0L 2YMXH 3VFTB 2IAMB 3BDBA 3MRDB 4HX1B 5D7KD 1AE6L 5IM7B 2C9AA 1CQYA 4NBYB 5IG7A 4AMKL 3KPRE 3D2UA 3D0LA 3QWQB 4UQ3A 4P59L 5DMKA 2YN3A 4L8CB 4QEGA 5GS1C 3LSOA 2Q8AH 2P4AB 3MNWB 4PJ8D 2ZUTA 3RWFB 2W9LA 1JP5A 3GMRA 1NL0H 2EIEA 2XFXB 3CVIH 1I1AD 3GMMA 3HNVL 5DZLA 2OTWB 3N85L 1RMFL 1MWAA 4TPRL 5F7DB 3RX8A 4FFVC 4APQB 1IGIH 4FXKA 1L9MA 4MJIA 3QA3B 4JY6A 3HR5A 3QXUA 4NZTL 1J86A 1ACYL 1IAOB 4OAWB 1CR9L 5D7LB 3DYMA 4LLAA 5TDNB 1B0RA 1NFIB 2VUYA 5D1QC 2E7LC 5IP4A 3T2QA 4PJIB 3GMNB 1CD1B 2HKHH 4ODWB 3O3AA 5GGSY 1XGUA 3Q1SL 3RQ3A 4DEPB 1H8NA 2JELH 4JFZL 4X7CC 3LH2L 4OF0A 4JFYB 1WC7B 2LU7A 5FGBC 3MOQA 4MCYB 1N5AB 2SEBA 1WWAX 4LPWA 4OD1L 1H5BA 4AQ1B 2OXHA 4ZPTB 4EVNA 4G7YL 2BOBB 4FABL 1NCCH 2HT3D 5KANI 2H32H 1BX2B 5IB4A 1WTLA 1EXUB 1OT2A 1CZ8L 1X3DA 5GSRA 4KGLA 4IRSC 2CD0A 2OMNA 1OAZL 5DFWH 4HCRH 3UEZA 3EDFA 3HI1B 4HUVA 1S5HB 1ZV5A 2C1OB 1AKJA 5J6HA 2VB5A 3HZVA 2XRAH 1JE6A 5LQBH 2P24A 2YSSB 1RK1B 3QQ3A 2NY6C 5CGYD 5L9DL 4Y1AB 4Q9CA 3CLEL 4CDHA 4LLVA 1OSPH 3QH3A 5D9SA 3QHTC 5J3HD 5SWSB 1U58A 1A6TB 4KDTC 4Y19B 5TPWH 1CXIA 4HJ0D 1QO3B 5DO2C 1GGCH 2APXA 2HJKB 1YECL 5CGMA 4OZIB 3WCYA 4QT5B 4YR6B 2IQAA 4OQTL 4G8GA 1VPOL 5LGJA 3OF6D 1IGCL 4J12A 1IZKA 1JIBA 1I7UA 3HNTH 3RVVD 4ZFOA 3M1BB 3M8OH 4OCSL 2HP4A 2R1XB 4QRUA 1ZT1B 1J8KA 1N6QH 2NTFA 4H1LH 4PRIE 2VLJB 3VWKB 2DJSA 5SWZA 4JN1H 3MRKB 5FECB 1N6VA 4XP9H 2BRRL 3MBXL 3NOIA 3QRGH 3I3BA 2DQFB 1E4JA 2H3NB 1GJIA 2D7TL 1DBAH 3CK0H 4JB9L 4PV8B 2VISA 4JLRA 5EFIB 1UB5B 2XZZA 5EO0B 5J6GB 2FEEL 5HBBA 4Y2DB 3STZA 5IHUH 4K23L 1UJ3A 3QUXB 3ZKMD 2AJXL 2YZ1A 1MH5B 4JPIB 3DMMC 1AGCA 4XCEB 3P73A 5HGBB 3F58H 4HUMB 2AK4D 4HUKB 1T83A 2A74A 2FBJH 5F1KC 2IPKA 4E0RA 4UAOB 1JL8A 2VR9A 4LOUD 4BH7B 3F7QA 5JW5A 1KT2A 2EE9A 4Q2ZA 2PW2B 2IC2A 1MCWW 4JM2D 4XCCH 1EJOH 3DO3A 2GTWB 3G5YA 4O02H 3QI9B 3D85B 5HHQB 2P7TB 5I15L 1WIOA 5I8KL 4N9GB 3RVWD 3J7HA 4MNQA 1K6QH 4U1JB 2EDDA 5H94B 5F9WC 4OQ1A 2A6KA 2E3VA 4HMCA 1DUZB 3O81A 4FFYL 5HI3D 2NW3A 1MAKA 2H6PA 4KK5D 3OAUL 1JFQH 4BFIB 1YMMA 3OB0K 1ZS8A 5C7XH 1QFPA 1T3FB 3SJVD 4Y4KA 5SX4I 1MFDH 5DJAA 1T7ZA 4L9LC 3QXAA 4P5TA 5DEFA 2L7JA 5IFAH 4LASL 3QUMB 2VNCA 2HLAA 5KVMC 4P4RB 3BO8B 4FOMA 3CMOH 2ADIA 3PWNA 4PB9H 3D0VB 2VXSH 3RVXC 2AEPH 3DXAE 6FABH 3C2SA 3QEQB 3S97C 4POZD 4Y4FD 5B8CB 1V3MA 3RBSA 4FQ1H 4LCWD 5DS8B 1CK0L 1MCIA 1IBGL 1AXSB 1I7TB 4EIGB 5T1KD 3H42L 2BMKB 5DJZA 4EI5D 5GRJH 4TSCH 1JF5A 5C3LD 1QSFB 5E6IA 5L0QB 2CLVB 4HS6B 3CH8A 4W4OA 3UTZA 3U9UB 3WNLA 5JIHA 3DO7A 2VDPH 2EKSA 1TZGL 1W0VB 3RKDC 5HHOB 1T0MA 1A4JA 3K2UL 2CIKB 1MFAH 3V52H 3O4OB 3CU1A 4NPYA 4LVHB 1BJ1H 3NCYP 2ILLA 4GW1B 3P4MA 3UO1L 5GHWL 4KK6C 2DWDB 1FJ1B 1WFNA 3MCKA 2XWTB 1X5ZA 3LEXA 3DVFA 5C07B 3MXWH 5HDQL 1X5AA 3D39D 4HIJA 3BWAB 2XQBL 3MV7D 5ISZB 3KYKH 3W2DH 1P4IL 5I1KL 4I0PC 2EDLA 1U8KA 3QJFB 3ZDYF 1T83C 3DIFB 4YIQB 1I7ZA 5J9PA 3LKSA 4D3CH 1NJ9B 2VWEC 3NVQA 3PGDA 4I3SL 2EEAA 5DUMH 4U7MA 3CZFB 3O4LE 4PJCE 2EIZA 2BDNL 2KDGA 3WDHA 3VFTA 1IGFL 2IAMA 3MRDA 4HX1A 4LVOC 3HC0B 4JKKA 5H35B 3VG9B 5BVPL 5IM7A 2EXYC 3L3OB 4NQDA 2D0FA 3I9GL 2F54B 1DVFA 2NMSA 2B2XH 4EI6B 1JTTA 2QHRH 3MNWA 1JZ7A 1EBPA 3RWFA 3WUWB 1B4JL 1HEZB 4NQTA 1MLCB 4I0CC 4NN7B 1C08B 3LKRA 2XFXA 1CDCA 4WI5A 4B53A 2OTWA 2F19H 4HKZA 5F7DA 5FYJE 5DGRA 1GZQB 4HH8A 4PLJC 4APQA 2Z8WC 4P5TC 1P4BH 1S9WA 4LP5A 1JWSB 4P9HH 5CAYB 3UAJD 2PXYB 2AQ2A 2CJUH 4LSSL 3W0WB 5C09D 4N68A 2P47B 3SDXF 1EUUA 5D7LA 3QR2A 5TDNA 1NFIA 8FABB 2BHYA 1UWXH 1MCOH 5C0GB 3EFFA 4TSAH 1AR1C 1TZHA 4JFDB 2JE8A 4PJIA 1CD1A 1DQJB 4LQ1A 4ODWA 4Z6AT 4HUWB 5HHMD 2UWEE 2J8UF 1GAFH 3T4AB 4ZPVA 4JFYA 4ZO6A 1M71A 1WC7A 3VXRB 3DX8B 2IADB 2NY3B 1I9JL 1OP3H 2ZG2A 4WW1A 1S7SA 4W4OC 3BKCL 1DN0B 1RUAL 2DM3A 1N5AA 3TA3A 3TYFB 1PG7L 4JPVL 1UA6H 4ZPTA 2YN5A 1ORQA 4HS3A 2DM7A 4R4BB 3NABH 1A7RH 2C7UB 1PYWB 2PUQT 1YNLH 2IALA 3HI6L 1WTGT 2D0GA 4NNYB 2C1OA 2GIYA 3CX5K 4F15C 1KEGL 2PYEB 2YSSA 3CFDB 7CGTA 4AZ8A 1U8HB 1Q94B 2IF7A 2VLLB 4Y1AA 1OAKL 5FOJA 5IB3B 4CNIB 4LIQE 4KROB 4KKBC 1I1CA 1L9NA 3U0PB 3KLHD 1A6TA 3JV5A 4QRRD 4UNVA 5C0AB 1QO3A 2BHUA 4R4ND 1S9XB 3LN4B 4XRCB 1J0IA 4YR6A 3VG0H 2ZWLT 1KELL 1UADC 4KMTL 2DBLL 5F72S 3QDJB 3ARRA 1FLTX 3WSQH 3JWDL 4I4WB 5J57B 1YEGL 3M1BA 1DVFC 2M26A 4OZGE 1I4FB 3DURB 2XY2A 3GJFH 4JE4B 4MXQC 2NY2B 4RGND 4AEFA 2NXYC 1XF5A 1MRCL 4HUXB 3VWKA 4X6FB 4GSDL 3DETD 3KPRB 1K4DB 2RR3A 5CP3H 3WHE0 5FECA 4BFEA 5ADOH 5E94B 2X9YA 3CPLB 3LN5A 2DQFA 4GLRH 2H3NA 3LCYA 5EH1A 5JIKA 4QRPE 1K2DB 3WBDA 5TE6H 5EFIA 4CVWA 2AV7B 1UB5A 2H1PL 5EO0A 5DC0A 3KDMB 4JFEA 2PO6B 2C3HA 4W6YB 2K7QA 3B2VH 3OBAA 4JHWH 4WHTB 5GZND 2Y72A 3PGFH 1HIML 5FA3A 4OI7A 5D6DC 3UTSE 4S2SA 1FAIL 1CU4L 5LAXB 2H2PC 4DEPC 2X05A 4BH7A 2GAZB 1NMAL 3S8WA 2PW2A 4ELKB 4XMLH 4L8SB 1RU9L 3UBXI 3TA3C 4FMFA 2GTWA 3BIKA 2ZKHH 2YD4A 3QI9A 3D85A 1DLFH 3E2HC 1F4YH 1IZJA 5JPMB 4MAUL 1RIVH 5LWYL 1D7FA 2D2OA 3OJDB 4ENED 4N9GA 4QXTB 2ZJSH 1CF8L 4U1JA 2NCMA 2XZCH 5H94A 3SCMB 4M1CC 2ARWA 3LQZB 1CD0A 5KVEL 4UT6L 2X89A 3QB7C 3S36X 1LE5B 1KIRB 4BFIA 3RDTC 4PJGF 5GIRA 1T3FA 3UTPE 5K9QG 2UV3A 1MIEH 3S34H 4OTXL 1FVDA 1UGNA 5I2IB 4KHTH 3QUMA 4P4RA 4Z0BL 1EMTL 1J05A 2FATL 3OG4B 4KPHL 2DQIH 3D0VA 1U8QB 4LLYB 3IU3A 3LB6D 5HYSG 1OW0A 25C8L 3QEQA 4H88H 1E4KA 2RIKA 4PRPD 5JR1H 2DQCL 2YBRB 4S1DD 5B8CA 1QFOA 4ZOCA 1ZT4B 2V9RA 1E4WH 1FC2D 3OMZA 1I7TA 4L3AA 2BMKA 1N7ML 3O3BB 5I66B 3PWPB 4JM4L 3UCRA 1QSFA 5K33A 1CDJA 2NNAB 5IOPB 2CLVA 3BJ91 4HS6A 3SE4A 4WO4A 4F9PA 3U9UA 4HAGA 4HZLB 4QY8B 5ETUB 3WFCH 5F70A 3OKOB 3VWKC 4ODXB 5E2VL 2V5TA 2BERA 1RULH 1W0VA 3KWWA 4P57A 3FB8B 1NPUA 4NGHH 2D31B 2CIKA 4UV4H 5IW1A 3ARBB 4YBQD 1CD8A 2BXZA 4UILH 4DKEL 5KTEH 2YC1B 4M6NH 3MPCA 2DL9A 1OAYH 3BN9C 1RPQA 1AGEB 4PRIB 1FJ1A 2MNUA 4DVBB 4R4FL 3U83A 2IG2L 5C07A 4Q9QL 4P9ML 1IJ9A 3DX6B 2AQ1A 4WDIB 5D93B 3NIDF 5F7HA 3UYRH 3BWAA 4DGIH 4HGMA 1JHKL 2EH7H 1YEFL 3KS0H 1DZBA 4O5LH 1YC8A 1EHLL 1G9MC 2OL3B 5DJ0B 3QJFA 5FM5M 1FFPB 3JWOL 2DQHL 4YIQA 2WLZA 4DN3H 4UAOC 4ZMAT 2IANB 4P23B 2AP2A 5TF1L 1QNZL 2LU3A 1EEYB 5HYFA 1B2WL 2YA0A 3CZFA 4MQSB 5FO7B 5F93C 3MLRH 1K5NA 3MLZL 1AO7D 3MJ9H 4C56D 2AKRB 4OD3H 3HC0A 5H35A 2Y4SA 1EGJH 3NPZB 3T1FA 3QI9C 1VHPA 2FGZA 1G7IB 4XP4L 5I1HL 3ZDXE 1QKZL 2F54A 5E1AB 5EBMB 3KPSE 5EIIA 4EI6A 2BCKA 3ZMRA 1IM9B 3VJ6B 3NIDE 3BWUC 3QDGD 3MRGB 1CN4A 4R8WH 1ORSB 1BQLL 3WUWA 3HCVA 4NYLB 1FCCA 1MLCA 1IGJB 5FYKU 1L0XA 1C08A 4LCYB 3STBA 1K85A 1ZLUK 5T3ZD 3MACH 4Z77A 1T1XB 4N0CC 1A7NH 3NZ8B 3SDYH 3B43A 1JWSA 2JCCE 1AGBA 4ZUWB 5HGDA 1FV1B 3W0WA 2FEEI 4U3XA 2CIIB 3P9WB 1PZ5B 2J12B 4LRNH 5DK0B 4PP1D 3P77B 5I71C 1KCVH 3MOBH 1MELA 2DI9A 2VLRE 4HW6A 8FABA 1E4KC 1TJIL 3VFUB 4Z7WA 4RFNB 4HLJA 1IL1A 4JFDA 4OLVH 1DANU 2Z92B 4K3JL 1DQJA 2VC2L 3QT2A 4HUWA 2O61B 1UKSA 3D18B 3V7AE 5F8RC 3PQYA 1HE7A 4MHHI 1F3DH 5IT2L 5L0QC 3VXRA 3DX8A 2IADA 5CIPB 5T3XH 12E8H 1NFDE 1DN0A 2P44B 4WO4C 4F9PC 4OF6A 1KSRA 3NGBB 1LP9E 4U05A 1P53A 2VXQL 4O4YL 4J4PA 3FQNA 1E6JL 1U8NB 3RUGF 1CQKA 1J5OL 4K3DL 5BW7A 3B6SB 2EDQA 1MI5D 1PYWA 4ZXBB 5GS0H 5IK3B 4QCIB 4R97B 2X4QB 4XB8A 3JV4B 4NNYA 2YXFA 3V8CA 2YPLB 2PYEA 3CFDA 4WFGE 3QPQD 3QHFL 2W0FB 5DRXB 1U8HA 1Q94A 2VUOA 2LFGA 2VLLA 4JQVA 5C92A 4G6AC 4CNIA 1DANT 4R90L 2CPCA 3FFDB 4QRTB 3ZTJH 3U0PA 2F53E 4EUPB 2B1HH 3FFCE 1FQ9C 2PTUA 1JWUA 3QHZH 2X4RB 1PKQB 5TQ2L 1ZA3B 1DQML 1LK2A 4I4WA 4LAQL 1UEMA 2AABL 2FX9L 2NX5E 1DE4B 4U33A 5KVDH 5E7FA 4JFOB 3DURA 3ZKQD 4GXVL 1FGNH 1MCPL 5D7IF 2BNRA 4PJCB 3MZTA 1W72H 5IBUB 4ONFH 2EE6A 1RZ7L 2Z35B 4HUXA 4X6FA 1T89A 1V5JA 2R69L 1QR4A 3KPRA 3IETB 1K4DA 3V0WH 3VXNB 5CJOH 2Q7NA 4I3GA 3HAEB 3CPLA 3O6LL 2VXVH 5E08L 4ZS7L 1AP2B 4W68A 2KKQA 3GDBA 3BMWA 4R96A 5EC2B 1R3JB 5HVFB 4Y5XB 4KI5C 2MJWA 4JO1H 2XN9E 4MQTB 4IOFD 4HWBL 4TTDC 3KDMA 3OGCB 1Q9WB 2PO6A 1B6DA 4PJDE 2ARJQ 4F9LA 1A9BA 4WHTA 4NO0D 4YXKH 4GMTL 3MR9B 3T0XA 4YHMH 1E4XI 2APTA 1CDUA 5MEND 1F4WH 4JGUA 5E8EB 1QLRB 2RHEA 3MRIA 3P0VH 4P46A 5GJTH 5LAXA 2I24N 4U7SA 1M7DB 3B9AA 3BP5A 2GAZA 4QF1A 3FB5A 1OGTB 4X7EC 4ACPA 4NRXB 5I16B 2NY3C 2PETA 3IT8D 4WUUD 2IFFH 3CLFL 3GI9H 3PWJB 1FBIH 2A6DA 3SN6N 4WI9A 4OKDA 5E9DA 2XY1A 3TESA 1DP0A 4J4PC 2WWMC 2HH0H 2WQ8A 4LF3A 4MNGB 3V6BR 5L7XL 2UWEB 1MHEB 3OJDA 4XHJC 1RZKH 4QXTA 2Q3AA 3BKJH 5KZCD 5BW7C 1RVFH 3RP1A 4MA1B 4XP1L 3LQZA 3U48A 4LSTH 5TF0A 1V7ML 2QADB 4UMGA 1DLHB 1LE5A 4PRHD 1KIRA 1WBXA 2GJ6E 1TJHL 5HVGB 2VIRB 4AY0A 1IT9H 2HT4C 4MQXD 3JZ7A 1D5IH 1XGPA 3UZVB 4JQVC 2RQ8A 5I2IA 2UZXB 4PGZA 2H9GB 4KTEH 5CZVH 3L3DA 2I60L 1KIUA 3ILPB 5I1GH 2QSTA 1U8QA 4LLYA 3WJJC 3BE1H 4CDGC 1TVHB 4X80L 3HE6D 2WINA 3ZYZA 2VR5A 3RY5A 3QG6A 1H3PH 1ZT4A 1I8IB 4RMRA 5F9AC 1SM3L 4MJ5B 4XXCA 4BZ2L 1XGQA 2FHCA 2DMBA 4AJ0A 1D6EA 1HWHB 3O3BA 4N8CH 5I66A 1XF3B 4M7JL 5AD0B 2NNAA 2DQJH 4JQIL 2VXUH 2NY2C 5IOPA 1FVCB 4HZLA 4QY8A 5ETUA 2V2XB 5F6HJ 3OKOA 1HZHL 4KQ4L 1T89C 4ODXA 3DJ9A 5E03A 1GCFA 4GUPB 4PRBB 3P11L 4LHUB 4F7TB 4KJWD 4OZGB 4R6UA 2IPUG 5GJSL 4XBEL 4NDMA 5CJ5A 2YC1A 4Y16D 3VGGA 3ULVH 2NYYC 5JIIA 1MCRA 2FJGB 3KPOB 5C0BE 1AGEA 3MLXL 3BP6B 4PRIA 3RZCD 3VXMA 2OCFD 1MQ8A 1P6AB 4F9LC 3DX6A 5AUMA 4WDIA 3WL9B 1GRWA 4NZDA 5F9OH 2CR6A 1LEIB 3U9PL 1YEKH 3MRJB 2GSIB 1KLGA 4PLOB 3IJYA 2OL3A 1IGYB 5DJ0A 3U7YH 4P46C 1HYRC 3DV6B 3T0ED 1WEJL 4HBCL 3KJ6H 4P23A 1X4YA 2UZIH 4JQXA 5DYOA 2EYTB 4X4XA 4OV6F 5FO7A 4P2QB 3HMXH 2AKRA 3K4AA 1TTGA 3UTSB 2OTUB 3TJEH 2HYMA 4JPKL 4X4ZA 5C6TL 1G7IA 3WIIL 2I9TB 4P3CL 4U0QB 3GIZL 3TO2B 2ICEB 1XAUA 5EBMA 3GO1L 4DGYH 4JRXB 43CAB 3VJ6A 2WUBL 4EXPX 3CVHH 5T3ZL 1ORSA 4NNPH 4NYLA 3ULUF 2GHWB 1IGJA 4OFYD 4LFHG 1Q9OB 1CL7H 2FNBA 4LCYA 3L6FB 4NO5B 2BVOB 4Z7OE 1VCAA 1G9NL 3Q6FB 2E6PA 3NZ8A 1MREL 2G60H 4YEEA 2Q1EA 3IFNH 4MA8H 3SQBA 1KTDB 3OV6A 1MJ7H 1T2JA 1FYHB 2AK4E 2CIIA 3EHBC 1PZ5A 5B39B 1W8NA 3RWIB 3PNWA 4HUNB 2DDQL 4PJBF 3VFUA 3FQRB 1JTPA 2JJSC 2Z92A 4AIZA 4WI6A 1NMBL 4QHMB 3EGSB 1ZANH 2YWZA 3D18A 3HZKB 5IEKB 4D9LL 1CCZA 3DXAA 3NA9H 4PR5B 3VWJC 1ZLVK 5CIPA 3TWCH 5F96H 2C5DC 2V9TA 2VH5L 2JKXA 1I9IL 3L3GB 1S7TB 1QBLH 3ECBB 3G6AB 3H3PH 3ALWA 1LO5B 3L95B 5IMLB 1U8NA 4IIQB 4M5YL 1AQKH 1SQ2N 3QQ9C 4PS4L 4XI5C 4NOFA 3DX9B 2WAHA 1A1OA 2VDRH 1PBYA 1JF1A 2ATPA 4PGEB 3V4UH 4ZXBA 5HI4C 5IK3A 4QCIA 3C6LD 1C5CL 2P8PB 2O93L 4RAVB 4QTHA 4E41D 4EDWH 4KC3B 3RBGA 4RISH 2CDEB 1NC2A 2E8YA 2W0FA 5DRXA 1IC1A 4QOKD 1B3JA 2DF3A 1HILB 4KH2A 3RWJB 5CCKH 4OCXL 3GMQA 3FFDA 3T08A 3F62A 4JQXC 4EUPA 1LO4H 3ARVA 4OF7A 1PX4A 1D6VL 2O5ZH 3VFRB 2Z91B 1CFVL 4ZUVA 1JI2A 2DIBA 4D0BB 2EKJA 4PG9A 5FKAA 1MIML 1A7PL 3QFJD 2DLEA 4M48H 5CKGA 7FABH 3BI9X 4X5XB 1DE4A 3U4AA 5GS2D 3FTGB 2UYLB 3ZSTA 4GS7C 3AS2A 4JFOA 3MOAL 2R29L 1JGVH 3WN5B 3SKJL 1FNFA 3L7EB 3WS6C 3O4LA 4PJCA 5HHPB 5C70A 3P30H 3T3PE 2DAVA 2Z35A 2V5MA 3HC4H 4L8DB 1WF5A 1QSVA 1T6WA 5EU6D 1AXTL 3R0NA 4HJJH 2D7OA 3TBTB 5HGHA 4J6RH 4M7LH 5I1AB 2BVYA 4IRZL 1AP2A 3D39E 5KG9A 4AK1A 1R3JA 4Y5XA 2YMXL 5LXGH 4TYUA 3IDMA 2YRPA 4I3RH 5CWSA 5I75B 3OGCA 1Q9WA 1U8OA 5EUOF 3RWEB 2VQ1B 4QXUH 2DQUH 5HGAA 1WAAE 4QWWD 2FX8H 3FJTA 1MJ8H 1PZUB 3UJIL 4RFNC 4O58H 4UBDD 5FYKD 5DURD 3IDIB 3VFPA 2Q8AL 3T0WA 3HI5H 4PBWD 5E8EA 1QLRA 2JCCB 3S35X 2QLVB 3KAAA 4L5FH 5L88L 3BP7A 3TVMB 4O9HH 1AD9B 3R06A 1CE1H 1M7DA 3CVIL 4WFFD 1OGTA 4M93B 5I16A 2VLRB 3OX8B 3PWJA 2XKNB 5JORB 2IBGA 5CD5D 4EN3D 5E00A 1KPUB 3MV8A 2WM0A 1GGIH 3GRWH 4X7SH 5IESH 5I74C 2UWEA 4P2CG 1MHEA 4ZQKB 3SDDB 4Q9BA 2R0WL 3WXVH 4WTZG 1KN2H 4P2RD 5B4MC 2LQRA 1NFDB 4M00A 1CICC 1LP9B 3OR6B 5MEOB 4OGXH 2HKHL 4YGVB 3KXFD 1VESA 4K7PY 5C09E 5INDA 3DROA 3OZ9H 4OGZA 3AB0C 2GCYB 3LHPH 4QRSB 2H9GA 4ZO8A 4GG6B 2ZNWA 1JBJA 1C7TA 4OUOA 4N0FB 3L3IA 3RTQC 5KAQG 5IF0B 1SJEA 1FNGA 3PV6B 1A14H 1NCCL 5HHME 1TVHA 2LTQC 4Z7QF 3N1GC 4NZUH 1ZOXA 2IGFH 1I8IA 2GYSA 3INUH 4HQQL 4MJ5A 1OP5H 3VDBA 2GITB 1AD0A 5F88B 3QIBB 4HCRL 3BRFA 3BUYA 1F4XH 2GSGB 1SY6A 2F53B 4PIRF 3RNKB 1XF3A 3CXDH 4LCIH 2EO9A 5LQBL 5AD0A 3FFCB 2ZSVA 1GXEA 1JHTB 4XC3H 4OLXH 2E9IA 1KB9J 5IEHB 3IB4A 3BUTA 4Y89A 4GUPA 3GFUA 4XVTH 4PRBA 5EU4B 3WFBH 3K7UA 4F7TA 1C5DA 1OSPL 2NX5B 4WW2B 4RRPA 2P1YA 4OZGA 2R9HC 2J1KA 1ES0B 3MLTB 1QRKA 5TPWL 1GGCL 3SOBL 4L8BB 4F8QA 3CH1B 4QO1A 1OQXA 3IAQA 1OCWH 3KPOA 2EDFA 3BP6A 4LPUA 5AWNH 5LBSL 1KENH 3PGCB 3HNTL 5ICXB 2P5WD 3WL9A 3QCTH 5F3HB 3M8OL 1LEIA 1XF2B 3U7AA 1IGYA 4QRPA 1BQUA 1N6QL 2X10A 1MCKA 4PLNC 4V2BA 2XN9B 5SX4H 5IFJB 1KNOA 2YD2A 4P5KB 4JN1L 3OSKA 4R2GC 4XP9L 4XWOD 5J13B 2KL6A 1GC1C 3QRGL 4QKXB 3U79A 43C9A 3P9MB 1DBAL 3CK0L 5K9KA 3UTSA 2OTUA 2I9TA 3WNOA 4O51B 5DQJA 2IJ0C 2NLJB 3TO2A 2HMIC 2ICEA 3V0AC 4MXWH 1C1EH 5IHUL 2FSEA 2FHFA 1RJLA 1YJDC 3KPMA 3F58L 1A7BA 4PJ8B 5F7YC 3U36A 5F7EH 5HVWA 1U95B 4OZFB 2HJFB 3K3QA 4FS0A 1HYSD 1B6UA 4NQSB 2W59A 2FBJL 3OAZK 4RAUB 1BZ7A 1ZLWK 1I1AB 3ROOB 3EFDH 3LV3B 2Z8RA 4LMQE 5EWIH 2PNDA 3ZT7A 1Z9SA 4XCCL 1KTDA 1EJOL 3ME0A 4O02L 4AT6B 1O0VA 4Y4HC 1RD6A 1KCUH 4P2OD 3RWIA 3SE8L 4MYWB 2DM2A 3SPVA 3LKOB 1N64H 3CSPA 3EGSA 5IEKA 2X5PA 1JFQL 4ODTL 4PYGA 1CFNB 5F7MC 4PJ5D 5C7XL 1UB6B 4CMMB 4J7RA 5HHVH 5DRZA 1YMHA 5HYJA 2KZWA 2AJVH 2XXMB 3L3GA 1S7TA 3HPLB 3MBED 4W4NA 3ECBA 3X14B 5IFAL 1LO5A 3L95A 5IMLA 3CMOL 4IIQA 4PJGA 3WDJA 5FF6B 3ORJA 4GBXC 4GXUM 4PB9L 1NEZB 5E2TH 1LNUB 2AEPL 6FABL 1NUNB 5DTFB 3DX9A 3QDAA 5C6PB 1RZIB 1N4XL 5CMAB 5GPRA 1LO3L 1UVQB 1RUMH 2P8PA 3KJ4C 2AXFB 3MRLB 3VDAA 4FQ1L 5JDSA 4U6TA 1HN1A 1QBAA 4M6OH 4QRQB 2XNAB 2A2QT 5GRJL 4ZS6D 5JW3H 4TSCL 2CRYA 1BECA 2XA8H 4PLKD 1HILA 5ESVB 4PRPE 4U0RC 4YHOL 3O41B 3LKPB 2VDPL 1RZJC 5FKPB 3X11B 2AJUH 4BKLB 2DLGA 2BY3A 1MFAL 3VFRA 2Z91A 3FOMB 4GRWH 4S0TD 4K2UH 2CDGB 4D0BA 1XGRA 2NZ9D 3S3PA 2ORBL 3U0WL 3FTGA 3GBNH 2XG4A 3MXWL 5D1XD 3T09A 2D4FA 2XZAH 1G1YA 4JFPB 3OB0H 3WN5A 4ZFZB 2WSKA 2HA1A 5CP7B 3ARSA 3WLWC 1EZVX 5HHPA 3V6ZB 1A1NA 3MZGB 4YBLB 4N1CA 5ICZB 4OZHE 4X6BB 2FD6L 3KYKL 3W2DL 1S7XB 1MAJA 1U8PB 1CDIA 2COQA 4WY7H 3TBTA 4DGVH 1MOEA 3KPSA 4D3CL 5I1AA 4GT7A 4QHNB 5DUML 2P8LA 3VRLF 5DWUH 5ICYB 1IAMA 2X4TA 3K4ZA 1OAUH 5FYKL 4TNWF 4PJXE 3H9HB 3WKMH 4JZJB 2ZOKB 2AXJA 2B2XL 4DZ8A 3IDIA 3O8XD 1MFNA 2QHRL 3O2DA 3U7WL 4N5ED 2JCCA 1AO7E 2Z4QA 3TVMA 4CU6A 3K1KC 1AD9A 2AK4B 3VW3H 1Q1JH 5KN5B 3C60D 4LPVA 1IILE 2VLRA 3OX8A 2XKNA 5JORA 3HB3C 4GKSB 4BUHA 1ZGLP 1F4AA 4JM2B 4OI9A 3HC3L 2AEIT 1KPUA 1NH6A 4P9HL 2J6EH 3DHJA 1U8LB 5F7KC 1CXKA 2CJUL 4IIQC 3L3JB 5CSBA 4ZQKA 3SDDA 2Y5EA 5EZIH 5JA8B 2ID5A 3H0TA 4D9RD 4H8WH 1NFDA 5JXED 3U2SB 4OKVB 4AM0A 4KVCH 1LP9A 2OYPA 5DMGC 4TSAL 3OR6A 2IH3B 3DGGB 4XPTH 5MEOA 5TJWK 3BQUD 4XAWH 4YGVA 3V4VL 3IFOB 1T6VN 2BC4B 1RFDL 3R1GH 4DQOL 2ERJB 4LARH 2ICWB 2OSLB 2X4OB 2Q3ZA 3HZMB 4M7LT 1GAFL 3UTQB 5EZLA 3SJVB 4N5UA 4ODVH 2NR6C 2Z31A 4QRSA 2OR9H 5I1IH 2VJXA 1QSZA 1RUKH 4N0FA 4YC2B 4JPWH 1EK3A 3A67H 2ADJB 1UH2A 1UA6L 5IF0A 1PEWA 3PV6A 1R5IB 5I0DA 5T3XD 2IEPA 1A7QH 1I3VA 5I18H 4C4KT 2VE6B 3R4DA 3NABL 4KFZC 2CUMA 4I1NB 2GITA 4Y4FB 1T20B 1YNLL 3QIBA 4UUJB 2GSGA 2F53A 4LCWB 3RNKA 3RUGA 3GSRA 5T1KB 3FFCA 5TDOB 2DKMA 4EI5B 1MCHA 1T1YB 5GS0D 3VGBA 4XPGH 4KJQD 1CTNA 5IEHA 3MXVH 1MJJB 1MI5E 2QEJA 1DBML 4WJ5A 5HD8D 3GMLA 2Y1VA 3TBVB 5EU4A 5IB5B 5IJVB 2NX5A 3OKYA 4EQ3A 1BVLB 1TTUA 2D4DA 5FIEA 5KAQF 5DVNA 1ETZB 4L8BA 3CH1A 1JRHL 3VG0L 5T33L 4JGJA 5KSVA 3AY4C 2W1NA 4L3ED 4PP2B 1RHHB 2J5LC 3KPQB 3PGCA 3WSQL 2C3WA 4FQHB 5I1LA 3L5XH 4XXDB 1XF2A 3D39B 4JN2B 2FEDC 4RFOH 4WU7B 4RDQG 3MV7B 5IFJA 4NQXB 5KSBE 4PJDA 1Z6JT 4M93C 1F11B 1WFOA 4Z8FH 3L7FB 1TQBB 5ADOL 5AZ2H 1IMHC 2P49B 1X5LA 4M3JA 3FZUC 3Q5OA 4CGTA 2CXKA 1T1ZA 4PJ9C 1GGUA 1ACYH 1GGBH 5DSCA 2DLHA 2DYPD 4O51A 5DJ8B 1YYLH 2NLJA 4OCWH 5TE6L 3H3BC 1B9ZA 3MCLH 4HXBH 4NHUB 4ZO7A 3CGTA 3SDAC 3B2VL 4P49A 3KG5A 4D0DB 3TO4D 3V5HB 1RZGB 4JHWL 3ES6B 3K1DA 4PJ8A 1U95A 5FXCH 1T5XB 5JPNA 4OZFA 2HJFA 5DJ2B 4NQSA 5IBTH 1FL6B 1L0QA 4RAUA 1I1AA 4AYFA 3ROOA 3LV3A 4WTXA 2DQTH 2Z31C 4LLUB 4XMLL 2EDTA 3QZWG 1JF6A 3DPBA 1YY9D 5E70A 5MENE 2GJ6A 2ZKHL 4AT6A 4FQXC 2EIDA 1KLUB 2M2DA 3I6GB 1DLFL 1LGVA 4HULB 1F4YL 5C09B 1FFRA 1RIVL 1YC7A 3CUPB 5C08D 1FDLH 2ZJSL 2HTKD 5JOPD 2XZCL 3LKOA 4WUUE 4OLZH 1JHLL 2H2SD 3V5KA 3QIBC 4RNRB 3ZE2E 4XX1G 1CFNA 3E8UH 3V95A 5HHMB 1UB6A 3VFGH 5IV2B 2G2RB 4G5ZH 3S34L 1X7QB 3W82A 4KHTL 3REWB 3KYMB 5JMRA 4QXWA 2NY1D 1FYTD 3GSNH 4PRHE 4UT9H 1VPOH 5FF6A 2X4NB 1IGCH 1LNUA 4RGMB 3FMGL 3N1QC 4P4KC 3QSKB 1RZIA 4S1SH 4ZD3H 4XZUB 2W60B 1DJSA 4OCSH 1LDPH 1RIUH 2AXFA 3BIAX 1E4WL 1SVCP 1MFCH 1S78C 4WGWB 5EORH 5SX5H 1QRNA 2XNAA 1ZE3C 3DARA 3C5JA 1YN6B 5D71H 3G9VA 5ESVA 1U41A 1LD9B 5F7LB 2BRRH 5C0BA 3LKPA 3WFCL 2MQ3A 3FO9B 4FQLH 3OXSB 3SDCC 3X11A 2X1OA 1RULL 4BKLA 5J13C 4D8PB 4NGHL 4UV4L 3KYAA 4QRRB 2JJWA 3FOMA 3ARFA 2XPGB 1ZGLB 3V7MA 4UILL 2CDGA 1KPRB 1CWVA 4HIXH 4HKBA 4M6NL 2IH1A 1T2XA 1XIWD 1OAYL 3EO9H 5FUCE 1MCCA 5GGQH 5IVXE 4F7MB 2VAAA 4FQCH 1INQB 4JFPA 4ZFZA 3ULVD 4WNQB 1P7QA 3VH8B 1BM3H 4N8VB 4DGIL 3EYQC 5HYSA 4I2XE 5ICZA 4PJ8C 1S7XA 2EH7L 4O5LL 1WZ1H 4RGNB 5MEQB 1B90A 3KLDA 1KBGH 4DN3L 3FN3A 3B2UD 1H9VA 1A6AA 4JFHD 5A2JH 5ICYA 3O3EB 4UU9B 2MTPA 3FQWB 4M6AA 1ODAA 4BA8A 4D0CA 2EC9T 4OD3L 4XH2B 1XT5A 3T0EE 3H9HA 4JZJA 3CFKB 4WFED 2DS4A 5JXAH 1NGPH 3GB7A 3QCUH 1BVKB 5HYEA 4R8WL 2V2WA 2YK1L 1EO7A 2AK4A 3JTSA 4LLQB 2QBWA 3O9WC 1EFQA 3V9FA 5KN5A 4F7EB 1I8MB 4MD4B 3KNBB 5K9OA 5DR5H 3MACL 2XTJD 5H2BB 4LPYA 2XTLA 4JM2A 1V7NH 4YPGB 2VTFA 1OB1A 3ARTA 2HWZL 1NBVH 3L3JA 4EZMA 2X1PA 2HT3C 5CJXA 3AREC 4LRNL 1KCVL 1MLBB 3MOBL 3U2SA