5E4EB

Engineered interleukin-13 bound to receptor
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
196
structure length
183
Chain Sequence
b'MKVLQEPTCVSDYMSISTCEWKMGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSPADFRIYNVTYLEPSLRIAASSYRARVRAWAQCYNTTWSEWSPSTKW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-13
publication title Instructive roles for cytokine-receptor binding parameters in determining signaling and functional potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 31
structure length 183
sequence length 196
ec nomenclature
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09238 IL4Ra_N Interleukin-4 receptor alpha chain, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e4eB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e4eB02
3TFKC 3OHXB 3P11H 1JWSB 3MCKB 4Z7QE 4AMKH 4WO4C 1JVKA 3GSRA 4HUWB 2YEZA 2G2RB 4HWZB 4KZDL 4MAYB 3SY0B 3SCMB 3TZVA 4XI5C 3ZYZA 2P8PA 5C0EA 4LSUL 3AAZA 5HI4C 5DRWA 4A6YB 4WUKH 3MJ6A 2EKSA 4LSTH 3EO9L 5C3LD 3ZL4L 4LDEB 1LEGA 4KJYB 4P2RE 3UP1A 2B39A 3OJDB 3OBAA 5I18H 2IPUK 4G9FA 1VPOH 1BP3B 1T66D 3MV9B 2VZ1A 1G6RH 2R2CA 3IKCA 2X4RB 4X4XB 4BZ1L 3KYKH 4P0DA 2HMID 3N1MC 2CKBA 2EIZA 4HJ0D 3GSNA 2AEPL 3O2WH 5C9JB 4W6XB 3C6SA 3PXHA 2YRZA 3D0LA 4KGJA 4HGMA 4D9QD 4KI5E 4NC0B 3SPVA 1MNUH 4X6DF 4JKPH 4LLYA 1DP0A 1I9EA 4Z95L 1GRWA 4IMKC 2YD7A 4LVHC 3KJ6H 4WV1A 1WWCA 4OZGA 2VO5A 3X14B 4Z6AT 5KTEL 4YFLI 1FJ1A 2W59A 3B2UC 5ICXA 2HWZL 4P5KA 5CEZD 4NDMB 5C0CB 5ISZD 5DJDB 3PUCA 4YHIB 5C07A 1DN0B 4G8IB 3ULUH 4PV9A 1DQTA 5HHMB 3PDOA 2Z35B 4I5BA 1MFEL 1FO0A 4RFOL 1XF2A 4LHUD 4XP4L 1MY5A 1RIUL 1T83C 2IADA 4G7VH 4HG4J 3FKUS 5E1HB 4PRIA 4Y4FA 2A74B 4YQXL 3UC0H 4O2CB 3TBWA 5DVLA 5IVZB 4GLRH 3EBAA 2Z0BA 3FOLA 4H20L 3PL6D 3EYUH 4K3EL 1J8HB 3HI1B 3DGGA 3DXAA 3OKKA 3CZJA 4JPVH 3MREA 2E9IA 1JGVH 5BO1H 3T77A 2DKUA 3SGDH 2ZUQC 2H6PB 2V2WB 5I1GH 1RY7B 1LP9F 3S35X 2AJVH 3QXTA 2V5MA 3FT2A 5MEND 2VR5A 2XACC 3JTSA 4B0MM 1QR4A 4EI5D 4LU5H 5HGDA 4EQ2A 5CGTA 5IB1A 3EFDH 4P2OD 1ODAA 3VDBA 4JFHD 3L3IA 4YLQT 1T1ZB 1U41A 5CEZH 1T0PB 3ARGD 2VYRE 2C3HA 4QWWC 3V6OE 5K9KB 3QIWC 3VDAA 1Y0LB 4LFHG 1JHTB 3CDGA 4S2SB 1M7IA 2HVKA 3GSXA 4NNXB 1XGQB 3DROB 3TIEA 3MRKB 3MTRA 1MIEH 1CLYH 3PWLB 3EKCA 1NGWB 3GRWA 5DD3H 3MNVA 1DLHB 1SYSA 4W4OA 1A4JA 4UT9H 1MWAH 5TQ2L 4ELMB 5EU3B 2NPLX 2VLKD 5GGQL 1HEZA 4YH6A 2X4UB 2FBJL 5E9DA 2BC4B 4JFPB 6CGTA 1GGIH 1T22A 1JYXA 4Y5VB 3ULVH 5EC2B 3HE7A 3Q6GH 3EHBC 4LP4A 3O3DB 3B6SA 1FSKB 2UYLA 3UJJH 3CAFA 4X7TB 3SDXF 1PW3A 1EK3A 3MLRL 1R3HA 3H0TB 4APQA 4PG2C 3U6RB 4NZUH 4PJ7F 3A67H 3MRIA 5EZJB 1IGYB 2LTQC 3WLBA 4PJ9D 5JHDB 3GJEB 5IMMA 4K55A 4PJDF 3RBSA 1IM9D 4D3CL 3C5ZD 1FFQA 4Z7VE 3OSKA 4M7JH 4DKFL 1ACYL 1MF2L 5ABDE 5J1SC 4RAHA 3BXNB 4EDXB 5DJ0B 4P46C 4JDZB 5C08D 5FO9A 3B8SA 1FLTX 1TQCB 2CJUL 4GKOA 4JGUA 1OHQA 4LSVL 3CLFL 4FQLL 4AEEA 1KCSH 1Q9LA 3MNWB 3FN3A 4L4VB 5F9WC 4JFEB 5D72H 4OCRH 5HHPB 2QR0B 4C56B 1KENL 4JO3H 3QDGB 1MH5A 2PETA 4HK0B 3PWPB 2JCCF 3WIIL 4CMMB 2NR6D 3FT4A 3JVGA 3C09B 4Z76A 1ZGLM 3PHOA 1FBIH 2Q8AL 2QL1A 3KPNA 3D3VA 4TRPL 5GRUL 3T8XA 1K2DB 4QHNB 2H8PA 5CKGA 2H1PL 2Y23A 4RISL 2IANE 3N85H 4L4TB 5E99L 5IQ7L 1CN4A 4OJFH 5C0GA 3S36H 2C3WA 4MNHA 3VFGH 5ITFB 3IFLH 4LEOA 3I3EA 5MP6L 2DYPD 1KF9B 4OZFB 1KN2L 2VDOH 4NSKB 5I8OH 5FAAA 1EAPB 2X4OA 2A1WL 3LDBC 4FZ8H 1CICC 3O6LL 4YBHA 2XTJC 1FL5A 3FRPG 3NCEB 1E6JL 2ZCLL 4XP9L 3B9EA 4UV4H 1BX2A 1ZE3C 5D7LA 4NQDA 4FQHB 5FF6B 2Z4QA 4XNUH 4IRJA 2EDOA 3C6LD 1ORQB 2EXWC 3KR3L 4U31A 4AM0B 4LMQI 1HSBB 5HYIA 4N0YH 3OX8A 4BA8A 3IYLW 4MLSA 4JDTL 5IBTH 5C6TL 4DN3H 1VGEL 3WS6A 1TCMA 1QP1A 4NPYA 4OD3L 5FO7B 2C1PA 3VXSE 3FFDA 4UAOC 4XWOC 2PO6B 1JGUH 3QDJA 4N90D 3SDAB 3OXSB 3SDDD 1F3DJ 1MEXH 4M00A 3BP6A 3F58H 1WV7T 5IHLB 3LIZL 4GSDL 4U1LA 1KB9K 2BOBB 1CDYA 2F54D 2JTDA 5GRVL 1LK2B 1JNLH 3HTLX 1Z9OA 5GHWL 1I1FB 3SN6N 4AIXA 5DJZA 2P5WE 3DJ9A 3MRQB 1FZMA 2IPKA 2VDML 1BREA 3VWJD 5I15L 1LO5B 1UZ6F 4G6ML 5DRNB 3ZTNL 2A83B 1MCPH 3GBMH 3RNQA 3FO0H 2Z8SA 3DVIA 3FQTA 4FRWA 4ZFOB 1FV1A 1E4WH 1VFAA 5L6YH 1CFVH 5CP7A 1BF8A 2UZXB 4CMHC 2YUXA 5JXAH 1RUML 1PY9A 3C9NA 4JFXA 4YXLL 3VGEA 5GIRB 1CFNA 5HHQB 5IWLA 2MTPA 5HVFB 3OKNA 3L3GB 4FP8L 5CD3A 4JRXA 3KYMA 1G0YR 3IDJA 4LBEA 4YAQA 2DN7A 2V2TB 2CR3A 1NCBH 3NH7H 1JUFB 3RI5K 2JLLA 4J6RL 4M02A 4R90L 1N59B 3VXQB 4WWKC 5LQBL 1G9EA 1I8MA 5ICYB 2WQ8A 5CZXC 1FZJB 2CK0H 3CPLA 3I6LD 5FKAB 3MODL 3RTQD 2WIMA 2ED8A 1HSAA 3C5SA 4LQ1A 4LSQH 5KS9F 5IFAL 4QTIH 1SBSH 3FO9B 4J1UB 1OAQH 4WTWA 1RJLA 4X8JB 2O26U 4OLUL 3O2DL 1QUNA 4HJGA 1JPSL 1XR9B 5DD0L 1AGDB 4WW1B 5E94B 1OGTA 3HC0B 3I75A 4HCRL 3EYOA 3C2SA 5FHAH 5CEXA 1DANU 3FB7B 2D7TL 2YXMA 2DM4A 3MLSH 1RJZB 1X3DA 2G75A 2Q86B 1DUZA 5CHNB 1ES0A 5GRZA 5SWZD 3PWJB 3RVVD 5F96L 5JPNB 4JREB 5FM4A 3FQWA 3QNZA 3CFKA 2H3NB 5IKCB 4D0DA 5DEZA 1FFOB 1OW0A 1MFBH 1RAMA 1T6WA 1F58H 3O41A 4R2GC 3SGJC 1CLOH 5KN5A 4IMLA 2MPAH 3O4OB 1QKZL 2FGZA 2I60L 3QO0B 3ARFA 3QFJD 4GG6F 1ZHNA 4GOSA 1J9CT 3V6BR 1PSKH 3MGOA 1N3NA 3QXAA 3V6ZB 4X98B 2IF7A 5I66A 3LV3A 4JFQA 2I07B 4LCUA 4QRUB 3Q1SH 5D1QC 4DWHA 1CGUA 5KSAB 1CD9B 1ZA6A 3N9GL 4FHBD 1ADQA 5IVXE 4UU9B 3W11C 1JGEA 5IVOA 5IMKB 4DZBA 2WP3O 2FHFA 5LGKA 3ARYA 5BVPL 4MNQE 1S7TB 5FHBL 2BSTA 4HJJL 4RWYH 5TF1L 3TGXA 1H8OA 3QCUL 4QXUL 5D1ZD 2ZCHH 2QKIA 3VRIB 4K94C 1AY1L 3BHBB 2E8ZA 2WBJA 4P48A 1A5FL 4NRZA 1LHZA 1CQYA 3MRGA 2QADB 3WFCL 1D5MA 4N0CD 3VFVB 2UZYB 5A2LH 4PB0L 4XBGA 1I7ZA 3S7GA 3NN8B 2EO9A 1FYTD 2E9JA 2H2PD 4YBQD 3QG6A 3DX9A 4D0BB 2G5BB 4U1GC 5FYKL 3QCVH 3G04B 2R0ZL 4QEGA 1PZ5A 5JW5A 3L1OL 5JXED 4I48A 4MJ6A 1AC6A 2WW8A 4KWUA 1BWMA 2EDQA 4HKJB 4JFOB 1QZ1A 4HUXB 4FTVA 1D5ZA 4WEMB 1MJJB 1QTYT 3NCBB 1BFVL 5LKNA 3BPLC 3RVXC 2E8YA 4OBRA 3UJIL 4OZIF 5FA4B 4Q9QL 4M7KH 3QDHA 2E9WA 4XCFH 3KPSE 1JK8B 4M6NH 3MO1A 3MFFB 4KQ4H 4Z0BL 2YHGA 3VRLE 4PJXE 3SO3C 4V1DA 4NJ9L 1PLGL 3DX7A 5FKPA 4KMQA 3BN3B 5HXMA 2QSCH 1TJGH 1IMHC 2B4CL 5JOEA 3BP4A 1EH9A 5KVMC 1JV5B 4ORGB 3UTSE 4NJAH 2XWJA 3OKOA 1EGJA 3WEXB 1QBBA 3B9VA 1JPTL 4HSQA 5BJTB 3RAJH 2PTTA 3FFCD 5D7JA 1RUQH 1I7RA 2J8UB 1N2RB 4DGIL 1YPZB 3NAAL 1X5XA 1D6VH 1KB5B 1DLFH 1RHHA 1GSMA 1D5XA 2V9QA 4U0QB 2I9LB 5ELIA 2DQIH 3RUGA 1FLRH 4ZAKD 4O00A 6FABL 4AG4H 4U33A 5IMOA 4G9DB 3A6BL 4P3DA 2ATPA 1WK0A 4NKMB 1T1WA 2XWBA 4KJPC 2A6DB 2MCPL 3HR6A 2VISB 2CMRL 4GRLA 3MXVH 2JJTC 3CFJA 2NY5H 4DTGH 1RIVH 2NYYC 2IMMA 1MI5B 4OB5H 2J12B 5E4IA 1NLDL 3LEVH 3EOTH 4I3GA 3SE8H 4H8WH 2FATH 1ZT7A 4OFKA 2R0WH 5DJCA 5ESVA 5TE4H 2DAVA 3OKDA 3CU7A 4LCIH 4H1LA 3TLRA 4NNYB 43C9B 4C58B 2IG2L 1IAIL 3DLQR 3TJHD 3OZ9L 3ZLQC 2YK1L 4HFUH 5D2LF 1KCLA 1PZUB 3IDGB 3B5GA 1T5WB 5L0QB 1WVZA 2NW3B 2R1XA 1BJ1J 3Q6FB 1FL6A 2JE8A 4PRAB 5C0BD 4KI5C 1MJUL 1I9JL 4IRSB 3V95A 5F7EL 5FYJE 3ROOB 5DUMH 3EDDA 4IIQA 1NCDH 4N9OB 3GMPA 1AGFB 1OARH 1TPXC 3VWKD 1IEBB 1R3JB 2D7MA 5H37G 2W0FB 4NQSB 3R1GH 4DK3A 1O0VA 5DGRA 4P2QD 1HHJB 3GDBA 4QHUB 3FONA 1OSPL 1AQKL 3UAJC 1YA5A 2DQHL 1IFHL 2G60L 4QNPF 2EZ0C 5SWQA 2P46B 3FO2A 4KAQH 3CUPA 3TVMB 2FJHA 3G08A 1VADB 3ROLB 3D6GA 4OD2A 4PGEA 2JJWA 4P5MB 4Y8AA 1OPGL 5GS1A 2DLIA 1C08B 3VI3F 3QJHB 4ZOCA 1HHKB 1CIUA 1F8TH 4P49A 4KDVA 4RSVA 4P2OC 4EJ1C 2A6IA 3BD4A 5ALCL 3HG1B 3ARGC 1PY4A 3LHPH 4IDLA 2UWEF 1N7ML 4ZYKA 3F5WA 1G1YA 1V7ML 5DYOA 3K8KA 1BQHB 4XCNB 4XWGH 3L6FA 4G43A 1GZPA 2N1KA 2XPGB 4L3CB 2R2HB 2R9HD 4ZD3H 1HXYB 3AMLA 3BQUD 1IGJA 3PQYE 5MHSE 4FXGB 5KSBA 2ZP0T 2AJYH 4ODXB 1NMBH 3GSUB 3RL2B 3KYNB 3PHQB 4Y16D 5HGHB 3QUXD 5HYSB 1EFXA 2DQGL 3KPRB 3RU8H 2ADFH 3L3DA 1I8KB 1M71A 1GGBL 5F3HB 3MZGB 4XNQB 1URLA 4KV5E 4XP5L 4C83A 5HVHB 4JDVB 4JZJA 4HT1L 3SGKA 3D9AL 5TDNA 3BDYL 3U7WH 1EEYA 4MB4A 4RAVA 5T1KB 1TQBB 4YR6A 4PP2A 4MD5A 2VLJE 3MLUL 4EKXA 2F19H 3H7LA 2X70B 5C2BH 4PJ8B 1XEDA 3U7YH 1G6RB 1WZ1L 1JZ5A 3AY4A 32C2B 2RAMA 4GMSL 3D5OF 4XXCA 4U3CA 2X42A 1U0QA 3JV6A 4PJ9C 4Z7NF 1G7MB 1B0GA 4F7MA 3GM8A 1KPUB 4ETQB 2ENSA 1UVQA 4HIHB 3C5ZC 1H0DB 3INUL 3KXFA 4G6KL 5MI0B 5DK0B 3ZYIA 5D8JH 3BPOC 2A6KA 4KK6D 4XMKL 3G6JE 3M1BB 5J9PB 1QPPA 5E0QA 2BFVL 4U1SA 2X7LB 1MCSA 4HEPG 4AQ1B 3LQZB 2VSCA 4Y4HD 4GRMA 4H1LG 1NAMH 1NH6A 2XKNB 2EC9U 3KPSA 5K33A 5ETUB 3WS3B 2HG5B 4YPGA 1A14L 3IU4L 4PV8B 3P0GB 3BE1H 4TSCL 1C12A 3P0YL 2DLGA 2NX5B 2QSQA 3NABH 5JW3H 1A22B 1J11A 3EO1A 1K3ZA 4S1RL 1BD2A 4U6VH 4JHAL 4DGYL 4MQ7B 5I1AB 5DUPH 2RFXB 5IB3A 5HYJA 3ZHDA 3MCLH 1D5BB 3P73B 3QWRD 2NR6C 4R0LA 3UTSA 4G6JL 4QRPB 4XCEA 3LN5B 1MJ7H 3GHBH 4QTHA 4JO4L 5IM7B 3GB7A 3O6KH 1S9YA 4P4RB 3GI9L 5F8RC 3L3JA 3WFEH 5LCVH 2DDQH 1QSEB 3M17B 3WJLA 4RGNE 1OAYL 1EEQA 2PW2A 2EDWA 4PD4K 1SBBA 1ZVSB 3MNZA 1RZIB 1KCUL 2V2XB 2P24B 3S6CA 1QRNE 3QULA 3W9EA 3MV8D 1A7RH 3LKOA 1H8SA 1YEIH 2R39A 4YXHH 2BMKB 4NHUA 1Z3GL 2WWKO 1BIIB 4YGVA 4CADA 4G8FB 3QNXA 4Y5XC 1ULVA 5HY9B 2VQ1A 3KS0H 1RK0A 2X10A 4Y2DC 1BVKB 4U1IA 1A4KB 4ODSH 5HD8D 3RIAF 1TDQA 2BY1A 3GO1L 3LN4A 2BVPB 4UQ2A 3OL2A 4FABH 3ARVA 1PQZB 3SDDC 3QHZL 3OG6B 2F58L 3H9ZA 5ESQA 4LSDA 1MCOL 4QF1B 5E6ID 2FIKA 5HHXH 2PF6A 4TUJB 4OFIA 5DA4A 2NY6D 3RA7H 4YGAB 4HHAA 1AIFB 4JJ5B 2XG4A 2YMXH 1Z5LA 4YBLB 3X3GL 4DUWA 1WBXB 1I85C 3MRNA 5HVWA 2FO4A 3ME0A 1B9ZA 4GQ9L 4N0RA 3TZVD 1IAOB 5B22A 1H5BA 1G7HB 1RULL 2YD8A 2X09A 1DQLL 4KK9D 2CO7B 1CGXA 2X4NA 5F7FA 4M7ZB 1JWMA 1OQOA 2BOCB 4P23A 4G9FD 2VDKL 2Q76B 1TZGL 4JN2A 1VSCA 3SE4C 2YPVH 4I9WE 2HFEA 1ACZA 4JGMA 1IAII 4NZRL 4WI2A 1NCNA 5HDQL 4BUGA 5I0DA 1NC4B 4HC1H 2ZSWA 2KZ1B 3BVNA 1F90L 4I4WA 1HQ4B 1MSPA 5TQ0H 1P4LB 4LLWA 4KKNA 3UTTB 4FA8A 2LQRA 3KLHD 1UKTA 4HS3A 3KHQA 4G5ZH 4WFHD 4I0PB 1B4JL 5HJ3A 1DBKH 3QUZA 1NFDA 5FIEA 4XC1H 3SJVE 5D6CB 4OZHE 4TVPD 1OLLA 5JOPD 1L0XA 3H3BC 1U92B 4YHYB 4H0HB 5HGAB 1P1ZA 4FN0A 3VMNA 4F80A 1IC5H 5C07D 4OGXL 1EDQA 4M5YL 2WLYA 4AY0A 4QRRB 3ZKMD 4K94L 4OLZL 3VI4F 4N0UA 4ZXBB 2JK5A 3PQYA 1MFCL 4OLVL 4Y5YB 5F8QC 4XP6L 4XNYH 5HI3D 4PRID 4GBXB 4U4BA 4Y4FD 5CAYB 2VXSL 3RVVC 5C0CE 5KZCD 4MJIA 4NN7B 1U8KB 1UJ3A 3P11L 3WFBH 4AMKL 1EAJA 1N6UA 5HHME 4FQCL 4CU8A 3DXAD 4M8QB 3WHXA 1FGVH 3VXUE 2G9HB 4L8SB 5BRZA 2DI7A 1ONQB 1LEKB 3D25B 3SE3C 2EYTA 2XNAB 5DMIL 1FZOB 5TE7H 3ZE0E 4LSTL 4G8EB 5L2KB 5LGJA 3QIUB 3IJYB 3D85D 3T4AA 4YDKH 4TVPH 3VFRA 5HDLA 2GJ6A 1BGXH 2A38A 1UB5B 1CBVH 3MQIA 2RJMA 1TZIA 3JSSA 1VPOL 2GYSA 4OLYH 1ZHKB 2V5TA 5J12C 4PJFE 2W0PA 3KJ4C 3EO0A 1I1CA 5KSUB 2JELH 4EEEA 2YUVA 3O2WL 3J7HA 5H8DA 1AP2B 1EBPA 5FYLD 1FNHA 3FQUA 4X4YB 1HHGB 3A6CH 5D1ZC 1QA9A 1VFOA 1AO7B 3MJ7B 1LD9A 1E4KC 1MNUL 4KHXH 3OR7A 2YSSB 4JKPL 4NZTL 3PGCA 4N0CC 4IM8A 5B38A 3PF2A 3TBSA 3OAUH 4L29A 4MX7A 3VGAC 5DHYA 4HV8B 4MJ5A 2H2PC 2IGFL 3JWDH 4KHTL 2Z92A 5E9DD 5D2NB 4K7PH 1HK6A 4YIQA 3ALWA 2R4RH 3HE7D 5CP3H 4HS6B 3EFFA 4MZ3A 2IEPA 3GBLA 1UACL 4HX1B 5SX5H 1T2JA 4LLQA 1KCVH 4PRDB 4WUUE 4MQTB 1N26A 3L9RA 3ARQA 3OKLA 1PKQA 4APQD 5EBWB 3FN0H 4JG1H 3IDYC 2O5ZH 4CW1A 4KROB 8FABA 2KQMA 3HCVB 4F2MA 5DUBB 1CTOA 4MD0B 1ZVHA 3UC0L 2EDNA 4JQIL 1A6TB 4I18A 1QOKA 4M03A 5F97E 4HZLB 1NCAH 4ZUWA 2CK2A 2Y5TA 1E4XH 3EYUL 4WI4A 3VW3H 1MRFH 3GMNA 4PJ5B 3KPOA 3BEVA 3RWFA 4NN6C 4LVOC 3DRTA 5HPMA 4JPVL 1Y6KR 3P9WB 3TA3A 2MOVA 3STBA 1S7WB 5KS9B 3SQBA 4QY8A 1Q0XH 3WKML 5I1GL 4U3HA 5BS0B 3KPLB 3AREC 4DEPC 4Y8DC 3O81A 5SX4I 3PWVB 2BNRA 3U30C 3GKZA 3WN5C 4PJIA 5DWUH 4LU5L 1MAKA 1J0KA 4PJAB 1UB6A 5CEZL 1WICA 5CILH 4Z7WA 2NY3D 4ONGH 2HLAB 5ESAA 4FQQA 1YN7B 5GZND 1FC2D 3WD5H 5HHOE 4M9OA 3VMPA 1NDGA 1FPTH 2I9TA 4TQEH 4ZAKC 1LK3L 4C55A 1ZTXH 3BZ4B 3LKRB 4FQXA 1RK1B 1T21A 3PP4H 3X3FH 1U93B 3L7FB 5DD3L 4PJGF 3V5DA 3ZYOA 1MWAL 4JB9H 2YD6A 5FOBA 3H3KA 4ISVB 3D3VD 4L4VE 4JFEE 4QXGH 3ARBB 3EYVB 1V5JA 2W0LA 4GG6B 3STLB 3QZWB 1GGIL 3VFTB 3QDGE 5GJTH 3Q3GB 3SKMA 3LQAC 2E7LC 3Q6GL 2O61A 1P2CB 3VXOA 1UM4H 2WP3T 4AENB 3DVFA 4JFYA 2BVOA 3DVNB 4BKLA 4LGRB 4HIXL 1WC7B 5DHVA 1MRDH 3IDXH 5MEQA 1LE9B 5D7LD 4NQDD 1JWSA 1A9BB 4L4TE 4IRJD 4HWZA 4HUWA 2G2RA 3HNVH 4MAYA 1QFWH 3UJTH 3SY0A 2B0SH 3SCMA 3A67L 1KJVB 5EO0B 5DVNA 3TJHC 4RA3A 1OT1A 5IBUB 1GOHA 2CDFB 3DMMB 4A6YA 3HAEG 1GC1H 1RUPH 1J88A 4KUZH 2ED7A 3U4BL 1P7KA 2YR3A 4WRLA 2QSTA 1WAAA 5I75B 4Z7OF 1UC6A 4KJYA 4M7JL 3QDJD 3I02B 3RGVB 5IB5B 4U1HB 1IC4L 4JQXC 3MV9A 4Y4KB 2X4RA 2XN9B 3R0NA 4X4XA 1UJTA 3VWKC 1Z0NA 4N8PA 5ACZB 4X9FA 1KCSL 5E8OA 1AI1L 1HKLH 5D72L 4OCRL 3WDJA 1F4YH 4HIIB 5J13B 4OZIB 3SKJH 4JO3L 1T89A 2ARJB 4MCZB 4KY1H 1JNJA 1INDL 5JHLH 1V3JA 3EYFB 3X14A 3ECBB 5E2UH 3G6DL 1YEJH 1FBIL 3GSVA 4NDMA 4YO0B 5C0CA 2EECA 2RGSA 5DJDA 5I73C 4YHIA 4PRHE 1DN0A 3B5TA 1KBGH 2C4XA 3N85L 4JRXD 1NKRA 1NBYB 2Z35A 3VFGL 3IFLL 4ODVH 3CH1B 2CXKA 4XCYB 4YC2B 2HJLB 3UDWC 1HYSD 3CMOH 4OQ1A 5DI8B 4PRPB 4FZ8L 2A74A 1G9MC 2HLFD 1A47A 4WHCA 3RWHB 1T0NB 5IVZA 1CDCA 3LB6D 3TV3H 1EHLH 4XNUL 3ZZ1A 1J8HA 1KYOK 2FB4H 1ZLUK 3T3PE 4Q0XL 3CC5B 1KJMB 2GSGB 3OB0K 3WNOA 5J06A 3T0EB 4Y16C 4BH7B 2Y9RT 3QUXC 4WTZG 5K9JH 2H6PA 4N0YL 2V2WA 1H3PH 5DVMA 2ZUWA 3DYOA 3PHSA 2VXQH 1XF4B 4LNRB 4C54A 1HILB 3O2DA 5DMYA 1MEXL 1MHPH 4XPTH 4OF3A 1T1ZA 1FG9C 5K9KA 4HCRA 2FGWL 1JNLL 1Y0LA 3VFMB 1JHTA 3IAQA 5ADPH 2A6JA 1G84A 4S2SA 4S1QH 4OT1L 3DUHA 3ALPA 4DOHE 2GAZA 4NNXA 2VDQH 5GGSA 1XGQA 3DROA 4HXBH 2VMFA 3MRKA 1J1OH 3PWLA 3R8BB 1DQML 5ANME 1NGWA 2ORBH 3GBML 4X5XB 5IP4A 5CJ8A 1DLHA 1TFHA 3QISA 4UDTA 3ARFD 1E4WL 2KKQA 3BEWB 4XRCB 4KDTA 1OP5K 4ELMA 4QKXB 4LPUA 4PGDB 2X4UA 3DETD 4JFPA 4P57A 4WO4B 1CGSH 1AC0A 1KC5H 4Y5VA 4OFYA 5EC2A 5EIIA 1JNNH 3O3DA 4N8VA 5ADOH 3MOQA 3V7MA 1D9KC 1A6AA 3OXRB 4N8CH 4O02H 4CVXB 4X7TA 5F7UA 5A1AA 4X6FB 2E6QA 3H0TA 2CUHA 3FT3B 5DF0A 3NH7L 3U6RA 5GGTL 4LCWB 1F4XH 1JRHI 1IKNA 1NBZB 4HGWB 4S1DD 1ZLWK 5EZJA 1IGYA 3U9PH 2WBJD 2XA3A 5HBBA 5I8EA 4CGTA 5JHDA 1GCFA 3GJEA 2ESVE 5T1DH 4I3RH 4JM4H 3LKSA 4QCIA 4RFNC 2ADIA 4QTIL 2Z93B 1SBSL 5GSRA 3BXNA 4EDXA 5DJ0A 4HPYH 4K8RH 4JDZA 4I0CC 4XPBH 4WFFE 3RJQB 2WNGA 1BQSA 3UZQA 2EE2A 7FABL 3D39E 1U3JA 4FTVD 3NCYS 1AGBB 4P3CH 1KJ3L 1RPQA 5CGYD 3F6LA 4KTDL 3MNWA 2UWEB 3MLSL 4JAMB 4L4VA 2M8XA 1P84K 1XR8B 4JFEA 1NCCH 3ZE2E 5HHPA 1P4BH 2QR0A 5F7YC 4C56A 2NXZD 9CGTA 3IDIB 1P5VA 3D48R 3PV6B 1CD1B 4RGNC 3PWPA 3E3QC 3RY6A 4V1DD 5EIVA 1MFBL 1HH6B 1YMME 1F58L 3ZO0A 4NBYB 2MPAL 3OF6A 3VG0H 5HD8C 3FHAA 3RWJB 3D0VB 3T0VA 1K2DA 4RDQF 1PSKL 1QFUH 4U1KB 5GQBA 1JHLL 5IV2B 5E6IC 5H37H 3GIZL 4LRNL 2EYRB 5ITFA 4L5FH 4QOKA 1OTSD 5CUSH 1U58B 5ERWA 3PP3K 4OZFA 5D7JD 3S5LB 3GI8H 4NSKA 5T3XD 2ZUQB 3QP3A 3AU1B 5EOTB 3OJVC 1VACB 4Z8FH 5A2FA 3TPKA 3VXRD 4OV5A 4UOW0 4BZYA 5BOPA 4RWYL 4FQHA 5FCSH 5FF6A 1IAIM 5DURD 1A64A 1ORQA 2ZCHL 5CGMA 2PYFB 4AM0A 4KK9C 2NCMA 3ETBF 5EU6E 1HSBA 3TBYB 2J8UE 3QIWB 3MLXH 2F53B 4XMLH 2XXCB 5FO7A 1NFIB 2O5YL 1KG0B 2PO6A 3C08H 1WBYB 3DUUB 4GRLD 4MDJB 5F7LB 3QCVL 3NMEA 2AGJH 3SDAA 3OXSA 1IC1A 3MLWH 5A16B 1PX4A 2WBWB 1YYMH 2BOBA 2DQDH 1LK2A 3OAZK 3RWEB 1I1FA 1XF1A 3FB6A 3L7EB 1WQVT 1YDPA 4IJ3C 4XNMB 4DFIA 4GRWF 4L3EB 3KLHC 1BJ1H 3FO1B 1XZ0B 3VJ6B 5H2BB 4EIZC 1ITCA 4JRWA 1LO5A 5DRNA 3ZDXF 2A83A 1WT5C 4KH2A 4M7KL 4WV1C 3MROA 3N1GC 2IFFH 1OOAA 4JR9L 4KQ4L 4ZFOA 3OB0H 1XCTB 1HDMA 1IEAB 4M3JA 5EOQL 5DEGB 2IQAB 5DLMH 3O9WB 4NHCL 4XNZC 3IKKA 4RX4A 4AH2B 3VFNB 1ZLVH 3BZFB 1TJGL 5IBLC 1P6AB 1DBMH 3ZKMC 5GIRA 4IEFB 5BV7C 5HHQA 1MCDA 2LTQB 1OAXH 1ZHLB 2ICWI 3L3GA 3IJSB 4HWNA 4OIBA 4NJAL 4MXVE 4JRYB 1W0WB 2FCBA 3SGEI 4Y4FC 5HTSA 2D03H 4OLWL 1SMOA 2EDTA 2V2TA 2MCG1 3RAJL 2NY2C 1I1AB 1JUFA 1RUQL 2D4FA 3DBXB 4PJEA 4YXKH 3TWCH 3UBXI 3F12B 3V0AC 3SDCB 1N59A 3VXQA 3GMRB 5GS0C 1DLFL 1FZJA 4MXQD 2APVA 1GHFH 1B6DA 4A2MA 2Q1EA 3UZVB 3MRRB 3QQ3B 4Y1AE 4KTYA 1I8LA 3CX5K 5SWSE 1BAFH 1FLRL 1YYLL 5L88H 1QSFB 1UWGH 4H1LH 3SKUD 4UIKL 3FO9A 3BH8B 4J1UA 4CVWA 4RBPH 4X8JA 2Y07L 3RZWA 3JTTB 1MHEB 5I17A 3VD5A 1XR9A 3NZHH 5HYEA 4YZFF 1AGDA 4WW1A 3HC0A 4HUNB 4QLRA 2I5YH 1G0DA 2YPLB 3V2AR 3FB7A 1RIVL 2A77H 1P9MA 1RJZA 4OB5L 4FMFA 1M7XA 2Q86A 3LEVL 5CHNA 3SE8L 2FATL 2M26A 5JPNA 2AS5M 4W4OC 5TE4L 1Q72L 2H3NA 5IKCA 1FFOA 4X6CF 4Z7UB 3HN3A 4UILL 3L5IA 2X1WL 3QO0A 2OK0H 3EDJA 3RDTB 3LDBB 4HFUL 1CICB 2JJSA 3U1SL 1JMZA 2XTJB 1EFXD 3KPPB 3HE7C 1U8OB 1AGCB 3V6ZA 4X98A 1VFBB 4HAFA 3KYAA 3T09A 3PGDB 2I07A 4QRUA 4U1NA 2MKLC 5FV1L 1W8NA 3TT3L 5KSAA 4TPRH 3K4ZA 4UU9A 4APQC 5IMKA 4U2ZA 1NCDL 2D9QB 2AJUH 2J4WH 4NP4H 2M1KA 4P2CG 1HOCA 2ENYA 1JMXA 4J3WA 4UAOB 3GNMH 3RVWD 3F8UB 3H9SE 3R1GL 3V8OA 1JI2A 4F58H 1ZLSH 1HCVA 2PW1B 1JZ2A 5FUCE 4HIEB 3MV7B 2F5BL 4NYLB 4PTTB 3BHBA 4PJCB 3KXFD 4B7LA 1RJCA 3QG7H 5IFJB 5KJRH 5I9QC 4OKDA 1UH3A 3VFVA 1FORH 4OCYL 3NN8A 5GRJH 5E2WH 2G5BA 4D0BA 2DD8L 5FM8A 4R4ND 3L3OB 1R3KA 3G04A 3KPSD 1OP3K 1F8TL 3AFLA 5DJYB 4X6DE 4JFOA 1FNLA 3QQ9D 2DIBA 3QDMB 2VR4A 4CMHB 2NY3C 2EH8H 3LHPL 2YRPA 1BD2D 1NDMB 5K59F 4UT7H 1AKJB 4R8WH 2ZUTA 5GZNC 4GG8B 4LVNB 1NMCB 3O8XB 3U4EB 5DJ6B 5FGBC 5HYJD 3ILQD 4XWGL 1CDGA 5C0AB 4X4ZA 4PS4H 3UTSD 1JK8A 3MFFA 3JVGC 4ZD3L 3SBWA 3CVHH 1ED3B 2KQNA 5EUOA 2NX5E 2AJYL 2NZ9C 1NMBL 1NAKL 4PGBB 1T5XA 2YKLL 2OTWA 4WWKB 5T3ZE 3QHFH 5D7SH 5IB2B 4X99B 3RU8L 2ADFL 3KVQA 4UTAH 1JV5A 4MJ2A 4ORGA 1RMFH 3BDXA 1I9RL 3KLDA 3BRGC 1X5AA 5KSVB 3U7WL 5FK9B 5BJTA 3QFDB 3RI5F 3UPRB 2EDHA 3AS1A 4UB0H 1N2RA 1YPZA 5C09B 2BP3A 2F19L 5JUEH 1T2QH 3U7YL 1UM6H 1KB5A 4O51B 1LP9E 4LF3A 4MA7H 5FV2A 3GSWB 3O6MH 2J6EA 5FYJU 4LAQL 3NA9L 2FLRT 2I9LA 2W9EL 2NY0D 4KPHH 4RGMB 1PFCA 5FDWB 1PGRB 2P5EE 4G9DA 1CGVA 5F71A 5D8JL 4NKMA 2HFGL 2A6DA 1IKFH 2QHRH 4A2LA 2VISA 1UCBH 1NAML 3DTXB 4NQEB 4TULL 1MI5A 3NIGF 3BE1L 3LQAH 4F57H 1T2XA 3NABL 1EO7A 5JW3L 1VB9A 1RU9H 4HWUA 4CBPA 4MB3A 4U6VL 5LBSH 3C60C 1A1NB 43C9A 3NCCB 1DSFL 1KXVC 4NNYA 5TJWK 4BSWB 3MCLL 3NPSC 2XZZA 1HKFA 1F4AA 1E28B 2Q20A 1BFSA 4S0SD 1MJ7L 4BZ2L 3U0PB 4FQ2L 4QXTB 3SDXE 2E27H 3T3MF 3O6KL 3NVQA 4P23D 3EOAA 1NKOA 3Q6FA 3WFEL 1TTUA 1F11A 4ZS6D 5LCVL 4PJ7E 4PRAA 4PREB 5JIIA 5FGCE 1AFVL 4RMWA 2EDFA 4YK4C 4IRSA 3TIDB 4BFEA 4XPFL 4ONHB 1HYSC 1AGFA 5EORL 2LAGB 2AW2A 4PJDE 2R56H 5KVGH 2HLFC 1R3JA 2W0FA 4NQSA 3LB6C 1AR2A 1A7RL 1FH5H 2Z8VC 4U1GB 3QCTH 1YEIL 1HHJA 1AD9B 3LMJH 4QHUA 3QUZD 2Z31C 2AJSL 5E8DH 3QA3B 2M2DA 5BXFB 5CKAA 4R96B 3TVMA 5GISH 1CR9H 5DK2B 1Q9KB 4JFFB 3ABZA 5E70A 3HUJF 1VADA 3ROLA 4ODSL 3WNMA 3BPLB 4P5MA 1HQRB 1HWHB 4K2UH 5FYJH 2W38A 1C08A 1HHKA 2PUQT 4OFPA 4FABL 4G6FB 4H5SB 4NUGH 1L0YA 3IJHA 3HG1A 3SO3B 3PQYD 3VXMB 2JCCE 4WEUD 5HHXL 5I1EH 3JUZA 1OD7A 2CIKB 3RA7L 4MJID 4UMGA 2FX9H 3UTQB 3ZKND 2FZ3B 1SM3L 1BQHA 4JY4B 4OM1H 4XCNA 5DSCA 4JG0H 5IGXH 3OGOE 1PEZA 5GS2H 1V7NH 2XPGA 2R23B 3F7VB 1CDBA 2R2HA 4PYGA 1HXYA 5BRZD 4KKLD 3VXNB 4FXGA 1P84J 3N1FC 4ODXA 3QHTC 4XX1E 1KEML 3GSUA 3RL2A 3PHQA 4JM2B 4HUMB 1MLCB 3B5HA 5HGHA 5HYSA 3KPRA 1QACA 5AD0B 1I8KA 5I0ZA 2GJ6D 5F3HA 1ETZB 4XNQA 4JDVA 1OM3H 3NCMA 4M1DH 2KDGA 1AD0B 2E7HA 2VLRB 4AEFA 1F2QA 4LASH 5L2KE 2X70A 4PJ8A 3U0TB 1G6RA 4HPOH 5TQ0L 2OJEB 32C2A 3IRPX 4ZFZB 4G5ZL 1G7MA 3BT2L 4HF5H 1DBKL 4ETQA 4XC1L 2PXYA 4HIHA 1J0IA 1H0DA 4YDJB 3QXVA 5DK0A 3RX7A 3NIFF 3LH2H 5J9PA 1MCFA 1UWEH 3QUMB 3C8KB 4Q9RL 1AO7E 2FBOJ 5CCKH 1JGDB 1KIRB 1BZQK 1QYGH 1MY7A 1UZ6E 2XKNA 3S4SG 5ETUA 4ZOAA 4I13B 3WS3A 2HG5A 3CXHJ 1T4KB 2PR4H 4PV8A 2EDKA 1QVOB 5F88B 2NX5A 2ERJC 4XNYL 5D2NE 3OAYK 4OUUB 3UCRA 4MQ7A 3HAEH 5I1AA 3REWB 1C5CH 2VDNH 3OJ2C 5E1AB 3VH8B 2RFXA 3WFBL 2CKBL 1D5BA 3P73A 2VB5A 1YEFL 1QNZH 5I19H 1IZKA 3B4NA 4QRPA 4GUPB 3LN5A 2EDXA 1FGVL 2CDGA 3TA3D 2YN3A 1TPXB 2GQHA 4E41D 5B3JF 2E3VA 4M43H 5IM7A 1S9KC 3Q2CA 1T1YB 4KZEL 4P4RA 2XZAH 4M6AA 4EN3C 1QSEA 4YDKL 2BNRD 3M17A 4YDVB 4TVPL 5JQHC 5F1KC 5D7JC 1ZVSA 1CBVL 1TVBA 1WWWX 1RZIA 2VABB 3ARRA 3FB5B 4TVSa 4EDWH 4OLYL 3STZB 2V2XA 2WIIB 2P24A 4GMTH 2KH2B 3FJTA 2HKHH 2JELL 3BP7B 1QSZA 3SEPA 4TOYH 5BV7L 1UH2A 3O3BB 2BMKA 4P2OB 2OXGA 5AWNH 1BIIA 4F8TA 2BHYA 4FQXD 3ARGB 5H35B 4G8FA 5AZEH 4HW6A 5I30L 5HY9A 1BVKA 1G9NH 3MJ8B 4PJHF 3OAUL 1R5WB 3VXPA 3CGTA 2XQYK 5CD5D 3BIAX 1HYRC 1BQHG 3JWDL 4TUOB 4GRLC 4K7PL 2BSRB 2BVPA 1D5IH 4LVEA 4S0TD 1QSVA 1PQZA 4JFDD 3HMWL 3CX5J 2VAAB 2ZPKH 4QF1A 4ZNCD 3F7RA 4TUJA 2NY1D 2EICA 3RZCC 1AIFA 4JJ5A 1KCVL 4G42A 1WBXA 5K9OB 1XIWB 4GG6E 5HYSG 2NTFB 3V7AE 1ZHBB 4JG1L 2O5ZL 4FQIH 2VLLB 1ZEAL 3RL1B 4DAGH 4MAYD 3SCMD 1IAOA 1QBLH 2GW5A 4KKBC 4M61B 3DX6A 4JANB 1NCAL 1E4XL 1WZLA 1G7HA 5AYUH 3UYRL 2C4FU 5FYLL 2QQLH 3DIFB 2QV2A 2HJKA 2OQJB 5DDHB 3X12B 1MQ8A 2NY7H 1A7PH 4XPAL 3MBXH 1KV3A 5H94A 2BOCA 4B41A 1M6OB 5AEAA 3NPZB 3MV9D 4MNGB 2Q76A 4OGZA 4EIGB 3IVKA 3WNLA 3GK8L 5DWUL 5C71A 5C0FB 3BPOB 4X4ME 3SHSA 1A3QA 1ZWIA 1Z9MA 1HCFX 4CAGA 2ID5A 4D9LH 5FUZH 1MCBA 4ONGL 4MXQC 1P4LA 2Y1VA 3TNNB 1A6VL 3UTTA 1TNMA 2XG5A 5KVFH 2CPCA 3IAGC 3IF1B 1A6ZB 1FPTL 1FZKB 5D6CA 1ZTXL 2DQCH 4V2CB 3PP4L 4CL7A 4YJZL 2XZQH 1U92A 1K5NA 1U3YA 1U8IB 5C0CD 3LKNB 3M8OH 4Q97A 4J8RB 3BKCH 1BEYH 4OZIE 1AJ7L 4LSPH 4QRRA 5B8CB 1W0VB 4ZXBA 3I6GB 4M93C 5F1IB 2X89A 1UM4L 3ARZA 4Y5YA 3WHE1 4GBXA 1PAMA 4G8GE 2OTUB 1MRDL 4N5ED 1U8KA 2ITDB 2VWEC 1MQKH 5DQDH 4XAKD 3MA7B 3FTGB 4HH9B 1J8HD 2DYPB 1LO3H 1UYWH 1QFWL 3UJTL 4M8QA 4OI9A 1WFNA 1A7QH 5EDXA 1VKXB 1L6XA 1KLUB 5GS0H 1C5DB 2G9HA 2Z9TA 3EJZD 5ILTL 3D25A 1LEKA 5JO5A 2XNAA 1GC1L 2F5AH 2ZNWA 1RUPL 4G8EA 5L2KA 3IJYA 4RIRA 4IHOB 4JZJC 1IJ9A 5DEFB 2IANB 1UB5A 2ZKHH 1WBZB 4WGVB 3UZEA 2W92A 3QH3B 4Y2DB 2YWYA 2OI9C 4ESKA 3HC3H 2Q8BH 4JCMA 3KNBB 5KSUA 3W5MA 4XXCC 4G3YH 1AP2A 4X4YA 4FNLL 1HHGA 4GRWB 2PNDA 1F4YL 3FN9A 2F54B 3SKJL 5EU7C 5F7HA 4LPXA 1KTKE 1UG9A 4F37K 5HGGS 4HV8A 1JL8A 2ARJQ 5JHLL 1B4RA 5E2UL 3GUTB 1J87A 1YEJL 4YUEH 3VXSB 4OFYD 5T5NF 4HS6A 2XQBH 2E7MA 4OIIH 3HR5B 3PWNB 1U91B 4HX1A 4MA1C 4ODVL 2B5IC 4PRDA 4ODHH 1OD9A 5D2LE 2WUBH 3ZTJG 1O7VA 5JORB 5EBWA 3CMOL 2X4PB 3P4OB 4E42A 1CGTA 5MEPB 3HCVA 1P7QB 5DUBA 2AKRB 4MD0A 1KT2A 2P5WB 1A6TA 1Z6JT 3TV3L 3CCHA 5F3BB 4PYHA 5JHDD 1MCRA 1PYWB 4PJ5A 1JCKA 4QRSB 3BZDA 4WW2B 3F7YA 5I1IH 3ESVF 4FQPA 5CJOH 1TMCB 2R4SL 5KS9A 3WJLC 1YQ2A 2IALB 4MXWH 1XGRB 3LEYH 5BS0A 3KPLA 5IW1A 3H3PH 2VXQL 1KCRH 1GAFH 4M6OH 3PWVA 1KIPB 4AK1A 4QNPE 5FYKD 4JCLA 4PJAA 1KTRL 2FD6H 1MHPL 1RZJH 5EC1B 5E56A 4L4VD 4JFED 1P4IH 2HLAA 2LAAA 1U8JB 4C56D 1YEDB 3MSPA 5I16B 1YN7A 5IIEB 2DWEB 4S1QL 3VI3E 1TJHL 2VDQL 3PWPD 4TNVK 4QYOA 3CNKA 4HXBL 3BZ4A 3LS5H 5BW7A 3DUSB 1ROWA 2ORBL 4X0KB 1U93A 3L7FA 3OF6D 4NWTH 5EZIH 4ISVA 4K3DL 2UWEE 2YS4A 4XX1G 4KKCD 3ARBA 4TTGA 3JWOH 3EYVA 3ES6B 3STLA 1EMTL 1I1RA 3IFOB 5B4MD 2OCFD 3QZWA 1CGSL 4JZOA 4TSBH 3Q3GA 5E8PB 4O2FB 4QOKD 5FM5M 5ADOL 1JNNL 1P2CA 5HGBB 3QFJB 4XGZB 4AENA 1QLRB 4N8CL 3DVNA 1WC7A 4M6ML 1OLZA 1OWWA 4LPVA 5J6HB 1HN1A 2VR9A 1YECH 4MA3B 1LE9A 4DKEH 1SEQL 4FXKB 1FN4A 1A9BA 5J4MA 2HTKD 1KJ2B 1H5BC 3THMH 1CGYA 1F4XL 4XVJH 4IRZH 1KJVA 5EO0A 2AJZB 2HH0H 2FH8A 2CDFA 5J12B 3DMMA 3KJ4B 1BMGA 5T1DL 1JWUA 3BIKB 3MRMB 4I3RL 4JM4L 4X4MA 4L9DA 5GSVB 2PO6D 3S37H 3SDAD 3DSFL 2JJVA 4K8RL 5IB5A 4U1HA 3TJEH 4XPBL 5JIHA 4Y4KA 3WO4C 4Z7NE 3QR2A 4GAFB 4B53A 2XN9A 3S98A 4HEME 3VGAB 5IMLB 2EDBA 1G7LB 1E4XI 1KFAH 4OCMC 4TNWK 5ACZA 4IOIB 5I2IB 5D7KE 1JZ6A 4MNQB 3QUZC 1P4BL 3IFPA 4HIIA 3PDDA 4OZIA 1K6QL 1R24A 3U83A 3Q5TA 2ARJA 3RWGB 4YE4H 4MCZA 5CJ5A 2V9TA 4RX4D 1AH1A 3EYFA 3L3HB 3IDYB 1FAIH 3ECBA 4L3EE 1E27B 3UPCA 4F7CA 2JKXA 3PNWB 3CLEL 1KPVB 4YO0A 3CVHB 1HZHH 1QFUL 2C7UB 1NBYA 3BH9B 4L5FL 4NN6B 3NIDF 3CH1A 4LVOB 5CUSL 4XCYA 2VL5B 2HJLA 3ZKNC 3JV5A 4W81A 3W0WE 1F97A 1U8PB 5DI8A 4PRPA 1UZ8B 1EEUA 4YHOH 4Z8FL 3AREB 3RWHA 1A8JH 4DEPB 1KN4H 4F15C 1TENA 4R6UA 3U30B 4LHJB 2V17L 5MERB 4KKLC 3L5WB 4JRYE 3BPNC 4PJXB 3KYOB 4XHJC 4RMSA 4HMCA 4P4KC 1KJMA 2GSGA 3DVGA 4ENED 3T0EA 1CL7H 5LWYH 4BH7A 2IAMB 3KDMB 1NGPL 1BHGA 2GJZB 3DV4B 4DQOL 3MLXL 2Y36L 3E2HC 1XF4A 4XMLL 2XIDA 2OBGA 5F89B 3C08L 4LNRA 2P43B 4XCCH 1HILA 4J3SA 3CSYB 1QFWI 2GT9B 1KNOB 1QRKA 3VFMA 1FFNB 2DIJA 1A3LH 1X7QB 3V7AG 2FYYB 4EVNB 2OL3B 3QZWG 2AEQH 5INCA 2PYEE 2VJXA 4KXZI 3CDCA 4X5XA 1CT8B 1N64H 4KK8C 4PG9A 3O0RH 3EOBB 3BEWA 2DRUA 4XRCA 4DFHA 4M5ZL 2XWTB 5DLML 2HAZA 3S8WA 4QHKI 4CN6A 3R0MA 3WV0A 4XT1C 2K7QA 4WO4A 1FGNH 1ZVYA 2EDJA 1AXTH 2VZSA 5KSAD 4PB9H 1A0QH 1INQB 1OAXL 1RV6X 3OXRA 5IBUG 3FCTB 4CVXA 1RVFH 1YEHH 1U6AH 2AK4E 2X9YA 1U8QA 2CLRB 2XTJE 3VGHA 4X6FA 4O2EB 3FT3A 3BUYA 1MFNA 5DHXB 1NSNH 4GW4B 1U8NB 5C0BB 3S88H 3TO2B 1M1SA 4LCWA 1NBVL 4PPTA 4HGWA 3AROA 4WFFD 3CFBA 1B3JA 4LCYB 4O4YH 3VWKB 2R2BB 2QADD 5E2VH 3U2SB 4KJQD 1BAFL 1UWGL 4OCSH 3BAEL 3LKQA 3WNNA 5I1HH 2Z93A 4GQPH 1WFUA 2R69H 4FFZH 1MFDH 4Z5RB 5JR1H 2AI0L 5C1MB 3O4LA 3HNTL 3P40A 2JF1A 4WFGE 2OZ4H 3H2WA 4IMKA 1I1YA 4POZD 5FEBA 1AGBA 3U0WH 5AAWA 4XC3H 2E7CA 4UI2A 4G80B 2UWEA 1OTUD 4JAMA 4YDLB 1XR8A 5EBMB 3T65B 5I73B 1KGCE 3UROR 3BD3A 4U7KA 5DT1H 1X4YA 3IDIA 2XV6B 1CD1A 3VI4E 1KEGH 1HH6A 5KAQF 4PJBA 4GXUM 5CD5C 4K7PX 2OK0L 4RNRB 3QEQA 3WL9A 5CIPB 3D0VA 2DQFA 5LJYH 1Q8MA 1T0MB 4U1KA 4BK4A 4OGYH 2OJZH 3Q48A 3Q5OA 5IV2A 2OR7A 3WYRA 3BRFA 5IROA 2EYRA 4Y7MA 3RFZC 4X5WA 4NBZB 1U58A 2W9LA 3S5LA 3MRLB 5KVEH 1R3IH 4U7SA 3QUXB 1BBDH 5GZOD 3AU1A 5EOTA 1VACA 2AJUL 4NP4L 5EA0L 2C1OB 3P30H 4DVRH 1RUAL 3WXWL 4J7RA 3OJMB 4Z0XB 3GNML 2KL6A 3FZUD 4F58L 5DJ2B 5I74C 2BNQB 1BOGB 2PYFA 2J1KA 2LVEA 5E4EB 2AABL 4LLVB 4XZUA 1YNTB 2DB8A 3QG7L 3QIWA 5EBGA 3TBYA 5KJRL 1IZJA 4P2YA 3RUGF 2F53A 1JI1A 3U46A 1N6QH 1NFIA 2HN7B 1HHHB 2Q7YB 1KG0A 5GRJL 4RMRA 1WBYA 4MDJA 2E9BA 5E5MB 5A16A 2BVTA 1MI5D 2EO1A 2JB6B 3VFOB 5DGQA 4GW5B 3RWEA 1NAMA 2EH8L 4XNMA 2VLJB 4ERSH 5EUKB 3RWDB 3FO1A 1XZ0A 4X8XA 3VJ6A 3MCG1 3QEHB 5H2BA 1OGAE 1L7IH 2I26N 4RGOH 5GGVH 1D9KB 2CQVA 4PS4L 1G7IB 2EIBA 3VMOA 1XCTA 4NQEE 5DEGA 1GGYA 5J6GA 2IQAA 5K9QG 3HAEB 3CVHL 4XH2B 3O9WA 1F3JA 2X2YA 4FXLA 4GT7A 3F62A 2DQEH 4K71C 4AH2A 3VFNA 3G6JB 4LP5A 1JGLH 5D7SL 1DBJL 4IRSD 4UTAL 1ZHLA 3WXVH 3IJSA 1NUNB 1LO4H 5J1AB 1W0WA 1WSST 4ZDHB 1XF3B 2BCKB 3HI5H 1DEEB 4N5EC 1I1AA 1QEWB 3DBXA 4PP1D 4JE4B 1E0OB 5FFLA 5D96B 5KG9B 4WDIB 1AHWA 3SDCA 1CE1H 3IDMB 4NQCE 3HPJB 2A9NH 4M1GH 3GMRA 3TESA 4P9HC 4ZS7H 4MA7L 4ELKA 3UYOD 3TVMD 2X9XA 2VDLL 2EYSB 3QQ3A 3EJZC 2BSED 3D18B 3HRZB 4HD9A 1TCRB 3HFMH 1X5ZA 1QSFA 4KPHL 3S34H 5CBEB 2VERN 5CJBA 3NZ8B 3BH8A 3D69B 3MLTB 4PJHB 4HULB 3JTTA 1MHEA 1IKFL 3HG1D 4RGNB 2QHRL 5IF0B 1UH4A 4O9HH 2XZCH 1UCBL 2YPLA 4HUVA 2N7AA 4HUUB 2ZUSA 3VD7A 4PJGE 1QRNB 5M7QA 4PY8I 4LARH 4Q2ZB 2DM2A 2EKJA 2IQ9H 3B83A 4JN1H 1VEOA 5F70A 1JYNA 1J86A 2DF3A 4I3SH 4ZNEE 3V79C 5DR5H 4Z7UA 5F6IC 3NOIA 2B1HH 1U8LB 4AEIL 4U0RC 3RDTA 1CICA 2AJ3B 3WIHH 3KPRD 3F7PC 3KPPA 5KSBF 1U8OA 1AGCA 2P8PB 1T03H 5C0EB 1FSKC 4IS6B 3C8HA 1X5JA 4C59B 5IOPB 1TLKA 1NGQH 4PUBH 2DQTL 4JHWL 4Y89A 3DX8B 3MX0A 1LEGB 3MYJB 4O58H 1MCNA 1GPOH 4GXVH 4PJ8D 3RVUD 4MQSB 1B90A 3QEGH 2R56L 1JNHB 1IKNC 1SY6H 5KVGL 2VN7A 3RPIB 1RZ7H 2LU7A 2OTPA 3GKWH 4Z7OE 3LMJL 4U2YA 2KZWA 2PW1A 3G5YB 4HC1A 2HP4A 1SJEB 4HIEA 2EIZB 2HFTA 3MV7A 2PXYD 4NNPH 5E8DL 4NYLA 4PTTA 2CO6B 4PJCA 5GISL 1KTDB 2VLRE 4I1NB 5IFJA 3AC0A 5JPMB 1FCGA 4IJ3B 1OP9A 2HT2D 4JO2L 2OP4H 2FO1A 1LE5B 2YOCA 1MCIA 4K2UL 3HI6H 4DUVA 1WGOA 3L3OA 4Q9BA 5DJYA 2B8OT 3QNYB 3MUJA 2XRAL 4EZMA 4UNTA 4HBQA 1FJ1B 3QDMA 3ULUD 1QLFB 2NX5D 4XNZB 1L0QA 3L95A 5I1EL 4LLMB 4D9QE 1NDMA 4XTRC 3RY4A 1AKJA 3O8XA 3U4EA 4OAWB 5DJ6A 3H8NA 3RY6C 4LSRH 3BW9B 1J7VR 5C0AA 4JG0L 4AZ8A 5IGXL 3CMGA 4QRPD 4XBEH 1V7NL 1C5BH 4CJ0A 3SJVB 4OZHB 1ED3A 5L8LB 4UIMB 4KKCC 1OSZB 1U3HB 4NFBA 5ISZE 1W72H 2NY2B 4PGBA 4BQ8A 2DBJA 3U79A 3ULSB 4L9LC 5B4MC 4WWKA 2NXYC 1IBGL 1QSED 2BZDA 3QPXH 5IB2A 4X99A 3HS0B 2B4CC 3UEZA 1MCKA 2XA8H 2VC2H 2IH1B 3BO8A 5EZLA 1OWRM 1JFQL 1QLEH 3O2VH 5I1DA 1YJDH 4M1DL 3D85B 5FK9A 3QFDA 4EOWH 3HMXH 3UPRA 2PKDA 3ZHLA 2HT3D 5C09A 3GM0A 2ITCA 4PIRF 2HTKC 4JO1H 3CFCH 4O51A 4YHKH 4TSAL 4HPOL 1OB1B 2VZTA 4J4PA 3H9YA 3GSWA 2EH7L 2UY6A 3DHJA 5E03A 4HF5L 5T3ZH 3RHWK 3VXUB 4ZQKB 1L6ZA 3QB7C 5FDWA 3FL7A 5MENE 2PO6C 1IT9L 4LDLB 3QQNA 1ORSB 2FJGB 2R15A 4JFHE 4GAYB 3O6FD 2CRMA 5C0ND 1HWGB 5CCKL 5FUOL 4X9HA 1N8ZB 1MELA 4P5TB 1YEEH 3DTXA 3ISWA 5I1CH 3ULVD 4PY7B 5CP3A 4PJFB 2WAHA 3MLZH 3FRPA 3GFUA 4MS8D 2W91A 4OF6A 2BRRH 1A1NA 1C5CL 1YEGH 2VDNL 2VTFA 3QUKB 4BSWA 1R3HB 3GHEL 3OB8A 7CGTA 2VLKE 1QNZL 5I19L 1BLNB 1E28A 5GGVY 5D1XC 3IGAB 2EIDA 5JDSB 3CSPA 1CLZL 4QXTA 4M43L 1F4WL 1HH9B 4Q6YA 3VDCA 1DANT 4LSUH 2XZAL 3OKEA 4NCC1 1BBJB 2P8LB 2P47B 4EBQL 4PREA 3TIDA 1C1EL 3ZL4H 1AXIB 4ONHA 1CF8H 3QDAA 3TH2T 1F6FB 5I9QB 3TN0B 4EDWL 2C3VA 3ZDZE 3ZMRA 4WUUB 2XKUA 5FO9B 1DN2A 2ILLA 3DYMA 3UTTD 3NCFB 3QI9C 4TOYL 4BZ1H 5J8OA 5E24E 3MUZ1 1QFWM 2L4OA 5DZOA 4UINH 4MNGE 5AWNL 5EPMB 2AEPH 4UT6L 3QA3A 5JZ7D 5BXFA 4R96A 4ENEC 4HKXB 2ATKB 2VITB 5AZEL 2NY3B 5DK2A 1Q9OA 1Q9KA 4MA8L 4JFFA 4KRPB 1NFDF 1WCBB 1LEIB 4L1HA 3SOBL 1G9NL 5DJAA 2FX7H 1HQRA 2B2XH 5C08E 3G5XB 1JPFB 4QRRD 5JMOC 5D93B 2C3XA 4ZXBD 4LLUB 1TJIL 3FT4B 3I3BA 2EDDA 4H5SA 3ZTJH 4Y19B 3WSQH 2D2OA 2X89D 4Z76B 3PHOB 5KTEH 2ZPKL 3VXMA 3VGGA 2V9RA 3D3VB 5EWIH 1JYWA 3T8XB 1CXHA 4GBXD 1VFMA 1D6EB 2CIKA 3WO3B 1OQXA 2FL5B 2YPKB 5TDPB 2XFXB 4UZGA 3UTQA 5C0GB 2FZ3A 1YUHB 1MFEH 1XF5A 2CXGA 4JY4A 1RIUH 2HT4D 4P59H 4DAGL 4WHTB 5HHOB 3O4OC 3F7VA 2R23A 3BOVA 3WUZA 3HZMB 1QBLL 2JJSC 3H42H 3VXNA 4L8BB 4JPIA 4KQ3L 5HVGB 3ZT6A 5AYUL 1O5DT 4H20H 1L7TL 3HZKB 5L2KD 4NQDB 3R4DA 4JM2A 4NKDB 5DQJB 2O93L 2D0FA 1R5IB 2NY7L 1UA6L 4PGJA 5KSAC 4Q74A 1ETZA 1FE8L 4TUKL 3ZKXC 4ODUB 1AD0A 2J88H 2K9UA 2VLRA 5E2TH 43CAB 1A7NH 1GGCL 3U0TA 2ICEA 3HE6A 3NCJL 2NW2B 5FUZL 4WJ5B 3X11B 2OJEA 1ZGLB 2ZSVB 4U1LB 5EZOH 4ZFZA 5F1OB 4ACPA 5KVFL 1EJOL 3EZ8A 4RMUA 4RZCB 3DV6B 4K23L 4P99A 4OD1H 4YDJA 4GS7C 3I50L 3G9AB 4KI1A 12E8H 3BPCB 4OF8A 4AIZB 3QUMA 5GJSL 3M8OL 4GRWE 2R29H 3C60B 1VFAB 4P2RA 4P9ML 5TQ2H 4A6YL 5ICZB 4JHZA 1BEYL 4BH8B 2F54E 1JGDA 1KIRA 3NPSB 4POZC 4F9LA 3ZDXE 1GGUA 2ZUYA 4X83A 5I76B 1T4KA 3P9MA 2FBJH 4D0CB 1QVOA 5F88A 1HIML 4MLIA 3IXAB 1OTUC 2HKFL 2GTZB 2YWZA 2APWA 2ADJB 3BMVA 4OUUA 3MACL 3EJYD 4KVCH 4WI9A 4JRXB 4M4PA 5DQDL 3REWA 2AJXH 5E1AA 4GKSB 3KYMB 3VH8A 3MLRH 1RZKH 4YK4B 4YAQB 4PJ5D 1LO3L 4DZ8B 4GUPA 4YX2L 3TYFB 1A7QL 3AM8A 5F9OL 4FG6D 4MCYB 4WVRA 1BVLA 5IB4A 3CPLB 5BS0D 2F5AL 4D9RD 1J1XH 5CLTA 3ARDC 1LWRA 4YDVA 5TF0A 4S10A 3C5SB 2Z31B 4PRHB 3SDYL 4MD4A 4K9EH 3PE9A 1S5IL 2ZKHL 5CJXA 4DKFH 1ACYH 2VABA 3FB5A 4U6HB 5GZOC 2WIIA 2COQA 1WIPA 3MR9B 4PJIF 2D0HA 1OGTB 1YY9D 3I6LE 3FZUC 3QO1A 2AV1B 2GY5A 4G3YL 3O3BA 1WLHA 4M4RA 4P2OA 4Z7WF 4YZFE 3ARGA 1KUMA 3DGCR 1ES0B 3SE9L 1KENH 3MJ8A 3ARBD 1M4KA 1LNUB 1R5WA 5B21A 4U1JB 3WLWC 4TUOA 2J2ZA 4P9HL 2DLFL 2VAAA 2XQBL 4HK3N 4OQTH 2Q8AH 5CS7A 1SJHB 1ZHNB 4TRPH 5GRUH 5IG7B 4NKOB 4OIIL 1NJ9B 4X6CE 1OL0A 1A7OH 1EFQA 3QXAB 4HMEA 5SWZE 1S78C 4MAUH 3V6OA 4AEHH 4ODHL 5I1KL 1TZHA 5K9OA 1XIWA 4JFQB 4QHLA 2NTFA 2ZZUT 5MP6H 1ZHBA 1BJ8A 2VLLA 3RL1A 2K7PA 2V5YA 4DOHB 1JF1B 5ID0B 2Y06L 4AL8L 1VDGA 1A02N 4M61A 3QFJE 3UTOA 1A6WH 4JANA 5ANMB 3DMMD 3K1KC 2ZCLH 4XP9H 1NBQA 3U36B 1LILA 1U36A 2BSTB 5EO1B 5L0QC 3DIFA 4E9LA 4NUJA 3CDYA 2OQJA 5DDHA 3X12A 5E5RB 4CN1A 5I1IL 4TTDC 2E5EA 2WM0A 1XT5A 4HBCL 1BQLL 4IRSC 2FEDD 3QUYB 1M6OA 4NRZB 3H3PL 1HINH 5B3NA 1GAFL 4M6OL 4Y4KD 1WAAF 2XN9D 5C6TH 2P45B 3HC4L 2XY2A 4OD3H 3CFEB 3T0DA 5C0FA 4Q9CA 1RZJL 2ICCA 3V4VH 4MJ6B 2Y6SC 4WU7B 1FVEB 5A40E 3TNNA 1P4IL 1UCTA 2BY2A 2P7TB 2Y25A 4LL9A 1Q38A 2AK1H 1NC2B 3IF1A 1A6ZA 1FZKA 5IHUH 5HI5D 2ESVB 1AQDB 1IEHA 3TH3T 5DD1H 1FYTE 5I15H 1G7JB 2QBWA 5EZIL 1ZT4B 3ZTNH 1PEWA 3T4YB 2VDPH 3LKNA 4Z7VA 5K59E 3JWOL 5DFVD 3D2UB 4BSVB 3DWTA 4KMLB 2OR9H 4BYHA 4H25A 4LHUG 3VH8G 4LRIA 4HFWB 5B8CA 1W0VA 4TSBL 1UXWB 4LKXB 3I6GA 4DW2L 5F1IA 1WCQA 3D39B 4YXLH 2DLEA 1UADC 4CN4A 1IM3A 4NFCA 4PRPD 2ICWJ 1UT9A 15C8L 4EN3B 2ITDA 3BGMB 4IBLT 1YECL 3CU1A 5GS3A 4DKEL 3MA7A 2CIIB 3FTGA 2EEAA 3R06B 1QFHA 1Q1JL 3THML 5TPWL 2PTTB 5D7JB 1VKXA 4J6RH 1KLUA 3T0ED 2HH0L 5LQBH 1YMMB 2APBA 3VFSB 1T7WA 5BZWB 3VXRB 4POUB 4HKZB 4M9PA 1RHHB 1NCWL 2E7BA 5CMAB 3MODH 2LU4A 2EC9T 2VN4A 3T2QA 1PG7W 5DURB 1IVLA 1YQVH 4YEFA 3OKMB 4IHOA 2D7QA 2IANA 1WBZA 5FB8B 3FFCE 1QPXA 4P3DB 3TJEL 1UXSB 3QH3A 5GGRY 1T20B 4Y2DA 4OLUH 3W2DL 1JPSH 2XWBB 3KNBA 4ZSOE 1KFAL 5C2UB 1DCLA 4KDWA 4JKMA 1J05B 3TNMB 4LSSH 2DKMA 2WWMD 2PXYC 3TO4B 2BVYA 5FM5O 1C16A 5M94B 2LE9A 5L9DL 3RZCB 2HT2C 5DJCB 4YE4L 5EU6B 4NQXB 5F7DB 2X4QB 1I85A 3NIGE 3OKDB 5FO8B 3NACL 3CVIH 4R3SB 4WO4D 1BZ7B 1EBAA 1FAIL 1GH7A 1KELH 2AEWA 3FMGL 2E6JA 3GUTA 4ELMF 3VXSA 1P7HL 1HI6A 1CXIA 2I60H 4ORZC 4QRQA 4BUHA 4I77H 3EGSB 3HLAB 3HR5A 3PWNA 1U91A 5L8JB 3WUWB 1VCAA 1XAUA 1FL6B 2CRZA 1UGNA 2VIRA 5D70H 1WTLA 3P4OA 4LCWD 3N9GH 3T3ME 4NM8H 5MEPA 1P7QA 2AKRA 2P5WA 1KN4L 5F7WC 1QQDB 1T66C 2IPUG 3MOBH 1GOFA 1PG7L 5F3BA 3SE4A 4WWID 2HMIC 1PYWA 2VQUA 5FHBH 4XNXH 4QRSA 4HJJH 3S3SA 1VERA 4HJ0C 5TF1H 3FOMB 4WFED 4WW2A 1MHCB 5C0RH 3QCUH 4RA0C 4WNQB 2CKNA 4QXUH 2IALA 4QGYA 5C0BE 1AY1H 1XGRA 2HFFB 4ZFOL 3O4LD 3TYGH 4K3JH 2V7NA 3WFCH 3RPKA 1KIPA 1J0HA 2FJHB 5JNYB 3S4SB 4EUPG 1J0ZA 5BMFL 3K80A 4OD2B 4XCCL 5EC1A 1TTGA 4P2QE 2R0ZH 3W5NA 3B2UD 1HNGA 4YHML 3HUJE 1LDSA 2ZOKB 1YEDA 2RHEA 5I16A 5IIEA 2DWEA 2D7NA 3LEXA 4RDQG 1R6VA 2QQNH 1CXLA 1U2CA 2AEQL 5EBLA 2IPTH 1N64L 4GKNB 3LZFL 5EOCJ 3VFWB 3O0RL 4Y1AB 5SWSB 4Q9QH 4ZPVB 3QEQD 4X80H 1NQBA 2H26B 4Z0BH 5IVNA 1A3RL 3V5KB 3ES6A 3MJ9H 3O6FC 1MJ8H 3GBNH 3PL6C 5C0NC 3IFOA 3L5JA 2CRYA 5E8PA 4O2FA 4RMVA 2WANA 1A0QL 1BM3H 4XGZA 2UZIL 1IARB 1TVHB 2R0LH 4FFYH 4HZAA 4YBLC 1QLRA 5CSZB 1RVFL 3SE3A 4JVUA 5GRWA 4XBPA 1KOAA 3L3DB 4MS8C 3QQ4B 4R7DB 5J6HA 4MA3A 1X5FA 4NO2B 1NSNL 5F9DC 4HLJA 4FXKA 2I25N 1U3ZA 5CZVH 4EI5C 3P77B 3S88L 1H8NA 4BSJA 4DGIH 2AJZA 1SVCP 2QQKL 5DTFA 4QWWD 1E6OH 5CFHA 4O4YL 3QIWD 4HWEH 1F3RB 4XAWL 3MRMA 2N4IA 2F53D 4Z18A 4OCSL 5GSVA 4XMPL 5I1HL 2R69L 1N0XH 2NNAB 4RMQA 6FABH 4FFZL 1MFDL 2ZUUA 5JR1L 4JKWA 4LNVA 4KFZC 3A6BH 4NQUA 2BNQE 1RZ8A 2CDEB 4ZUSB 3L3KA 5M95B 5IVXA 5IMLA 1G7LA 3FQXA 4U1SB 3B9AA 5KANI 5E08L 1CFTB 4IOIA 4XC3L 4GRMB 5I2IA 3NIFE 1IGTB 4MNQA 1AR1D 1A6PA 3EHBD 3H9SB 3MRPA 4LCCC 5IR1B 5BVJB 5JZ7C 3EO1B 3RWGA 4YHYC 1SYVA 1BD2B 1KEGL 3O9WD 2B5IB 2BNUB 5F9AC 4MQXD 5TGBB 4NWUL 3GJFH 5E7BA 4I2XE 1JF6A 3I84A 1IAIH 1KSRA 1KPVA 4OKVB 3CVHA 4LPTA 4ZO9A 1J18A 3LS4H 5F93C 4QTHB 1W72B 2OJZL 2C7UA 2YBRB 5FDYA 4GBXC 3BH9A 1DBBH 4X6DB 4XVUD 3BKMH 3L3JB 2VL5A 1I1AD 3EIFA 3P0VL 5B3JE 1U8PA 5C6PB 1NANI 3MBEA 3SDCD 3OQ3B 1UZ8A 1J12A 2HT4C 3AREA 1ZGLP 3P30L 2VDRH 4DVRL 3KLAB 4ODWA 4PJEF 3MUGB 3WFDH 5MERA 4JPKL 3L5WA 4PJXA 1XGPB 3KYOA 4X6BB 1BOYA 3CK0H 5FCUL 1QSFD 4WU5B 4S1SL 5D7IF 5A2JH 1OSPH 2NTSP 2DQHH 1DQDH 1IFHH 1LO2H 2G60H 2IAMA 3KDMA 2GJZA 3DV4A 5ENWB 1YZZA 3DO7A 3BDBA 1RFDH 1JP5A 5J0BA 3QNXB 3GIVB 3QRGH 5F89A 1KB9J 1QBAA 2FX8H 2YPLD 3CSYA 2XICA 5I71C 3MV8E 2GT9A 3LN4B 2OYPA 1YMHB 1KNOA 1Y18B 4RFEB 3T0WA 2LU3A 4H0IA 4PJHE 1FFNA 4ZUUB 3B9DA 1X7QA 2YC1A 1R0AL 2FYYA 4LPCA 4UV7H 2OL3A 4EVNA 1LP9B 3E3QE 3E6HB 1L7IL 1CT8A 3EOBA 1GVIA 2UVFA 3RDTD 5SX5K 1KB5L 1CICD 2AXGB 2DWDB 4ZO6A 1S5HB 2XWTA 2P5EB 1KULA 2J6EL 1Q94B 2DQEL 3X13A 3MV11 2DQUH 1JGLL 1H5BB 4R26L 2EXWD 3C6LC 1INQA 3HB3D 5GGUB 3WXVL 3K0WA 1LO4L 4WI3A 1GGBH 1MCEA 4LFHD 4HAGA 3HI5L 3EJYC 4E5XA 4O2EA 4XWOD 4XP5H 4U1MB 1MHHB 4GW4A 1U8NA 4HT1H 5C0BA 3D9AH 3BDYH 1CE1L 5IJKA 1IQDB 2D0GA 4J3TA 3MV7D 3MLUH 4JQXA 4JHBA 4ZS7L 3QIBB 4GKZB 3WO4B 2BVUA 4C57C 3NBNA 1IGML 4FG6C 3BVNB 4I4WB 3U2SA 2R2BA 3VWKA 4GMSH 4LLWB 2C5DC 2F74B 4R4BB 2NY4B 3S34L 3SDXB 4QGTA 3C2AH 1AXSA 1NFDB 5DJXB 3T0AA 1J0JA 3VWJC 3WIFA 4Z5RA 5C70A 4PJ7B 4PBWD 4XMKH 5FGCB 1U8MB 3QDMD 3PDGA 2BFVH 4TNWF 2P48B 1JE6A 1YY9C 4PJDB 1AKJD 4HXAH 4G80A 2BVEA 3O8XD 5EBMA 3T65A 4N0UB 4G6AD 1MAJA 5C0AD 3MA9H 4GW1B 5JOPE 5EH1A 4DGVH 4JN1L 1XGYL 4I3SL 1CE6A 5JW4N 3IU3B 5SX4H 5INDB 3UDWA 4LIQE 5C07E 1F5WA 4B7IA 4RNRA 3BGAA 3WIHL 4F15B 5CZXD 2BJML 5EUOF 1JBJA 1T03L 3RTQC 1LO0H 4F7TB 4ZPTB 2AQ2A 4JO4H 4PFEA 5BRZB 4POYA 4F7EB 1EUUA 3BPNB 4P4KB 4CVZB 1GGTA 4L8CB 2JCCB 3MRLA 4UQ3B 5C7XH 4ZTOH 5C09D 4O58L 4ZFGH 4GXVL 5GGRB 2C1OA 1CLCA 3VCLB 3QEGL 3E2HB 5B39B 1A2YB 1TZIB 3DXAE 4Z0XA 4J4PD 1BIHA 3GKWL 1YPZF 5DJ2A 4D8PA 2BNQA 3V52H 5C0DA 3VGDA 3FQUB 3TP4A 4LLVA 3I6KB 1YNTA 1CYGA 3BGFC 1YEKH 5I75C 1BZ9B 4AT6B 2CLZB 2OP4L 1HHHA 2Q7YA 4Y4KC 3HI6L 3PGCB 5E5MA 4MX7B 1V3LA 4CJ1A 2F8XC 5ACMA 3V6FB 2JB6A 3VFOA 5FYLE 1FIEA 4GW5A 2F58H 4WUKL 2VLJA 3QXDB 1MCOH 5EUKA 3RWDA 2YA2A 1CVSC 3WNPA 1RZFH 5BQ7B 4XVTH 4LSRL 5I18L 1D9KA 3L9RB 5L2JB 1G7IA 2HTLD 3KPQB 5I6XC 1FL3B 1C5BL 1G6RL 5E9DE 1EPFA 3HAEA 3KYKL 2RIKA 2X4TA 4XH2A 3QYCA 4GQ9H 1JZ8A 3GZKA 5DFVC 3G6JA 2LABA 1OAKH 4ZUWB 3BWUC 3QPXL 3KPOB 1CCZA 5DD5H 2SEBB 4E41B 4YC2C 2VC2L 1DVFA 5CLWA 4ZDHA 2AV7A 4FQJH 3P3YA 2DQJH 2DMCA 3KJ6L 2BCKA 1YJDL 1DEEA 1UWXH 4YBQC 4EOWL 1TZGH 1QEWA 5F44A 2ZG3A 1D3CA 5KG9A 4WDIA 4LHQB 3IDMA 3O3UN 5JXEC 1NUDA 3OR6B 3CFCL 2W60B 4JO1L 4YHKL 3ULUL 3HNSH 3DRQB 3K7UA 1H9VA 1B6UA 2EYSA 5J7CC 1CFSB 3D18A 2VRAA 2AXHA 4JFFD 1CWVA 4JPWH 4NZJA 5T3ZL 4OF7A 5ACLA 5CBEA 1B4JH 4G7VL 3NZ8A 2V7HB 3D69A 3MLTA 3WFZA 1BQUA 3T1WA 4PRNB 4NIKB 1KIQB 5T1MB 4G6FD 1T21B 1R3LB 5DA0B 3V5DB 2FWOB 2X6MA 5IF0A 3VXMD 5DFTA 4OGXH 3OGCB 4M5YH 4ODTH 4HUUA 5BCAA 1YEEL 2NY5C 5I1CL 2GFBB 2OR8A 1QRNA 4K94H 4OLZH 3BKJH 1JGVL 5BO1L 1EVTC 4Q2ZA 4W68A 4JFDB 3MLZL 3NTCH 3VXOB 2WWMC 3T2PA 3BIBX 2AJVL 2MFNA 4XP6H 4Y19E 1II4E 3GSOB 4RCAA 2VXUH 1YEGL 3PIQB 4DJMA 3D3VE 3EFDL 3LQMA 4MMZC 1U8LA 3SQOH 4JM2D 4WTZA 2AJ3A 3MRDB 4FQCH 2XY1A 3JV4A 3HHRB 2BY3A 2FJFA 2GITB 4HS8H 4IS6A 4GJTB 1QFPA 5DMIH 5I74B 4PBXA 1MIEL 1CLYL 1TNNA 5IOPA 1P7KB 2C26A 2VLRD 4UT9L 3DX8A 3MYJA 1CF8L 4NQDE 5D7LE 5EO9B 4XP1H 3HE6D 1JNHA 3B9KB 4KJPD 3QAZC 3RPIA 3JV0A 1E4JA 1PG7X 4LAJH 3BP5A 5DRXA 3V0WH 4UINL 4XXDB 3G5YA 2RCSH 2NYYD 3ULVL 1SJEA 2YZ1A 3V4PH 3VE0B 2FEEL 1SQ2N 4X7DC 5E8OB 3UTZB 1KTDA 3UJJL 5JPMA 3OKYA 1DQJB 3QDJE 4Q6IC 1LE5A 2FX7L 3OHXA 4P2RD 4NZTH 3WMSA 2B2XL 3MCKA 3HRPA 2DTMH 4NZUL 1WT5A 1F3DH 4N1CA 2J5LB 3QNYA 4LKCB 2IGFH 4KHTH 3WSQL 1FNEB 1JRHH 3DI2B 1QLFA 3GSVB 3I9GH 5EWIL 3NFPB 5I8CB 1K9TA 4XVSH 4OCXH 1H15B 4K71B 4LLMA 2FH6A 4MSWB 1XGTB 1UACH 4NO3B 4OAWA 2VZOA 4KI5D 3ULUF 3BW9A 3OJDA 4NGHH 4P59L 1WFOA 3SJVA 4OZHA 2DL9A 4UIMA 3H42L 4JQIH 1OSZA 1U3HA 3TBVB 3NIDE 5C9JA 3ULSA 2VSDA 3UAJD 4JRXE 5IROC 3VFUB 2EZ0D 3HS0A 3Q0HA 2DL2A 5F7NC 2IH1A 3WKMH 3QUMH 3MMEB 1A1OB 3D85A 3M45A 2J88L 5E2TL 4G8GB 1A7NL 1M05B 3ZT5A 1PKOA 5IQ9B 5HHNB 1OB1A 4G8IA 3RRQA 4OJFL 5EZOL 2MQCA 3S36L 3KPMB 3VXUA 5DVKA 1MLBB 2A6JB 4ZQKA 3VFPB 2GAZB 4OD1L 2VDOL 5GGSB 5I8OL 1LK3H 12E8L 3WNKA 4O2CA 1BJMA 4U3XA 1ORSA 2FJGA 1X5KA 4N0FB 4UV4L 2R9HC 2N7BA 2R29L 1FHGA 4GAYA 4UDTB 4J3VA 3BQUC 5J3HD 3GMQB 3HI1A 1N8ZA 5F6IB 2VH5H 4P5TA 4U0RB 3QWOB 4PY7A 3G5ZB 4P57B 2H32H 4PJFA 2H45A 1XIWD 1AR1C 5EIIB 5IFHH 4N8VB 5IBTL 5D9SB 4DN3L 1ZLVK 1A6AB 4NO0B 4KVCL 1CG9B 4YHLH 3ULVF 3LAFA 3KAAA 1JGUL 2AJXL 4HIXH 3QUKA 3PJSB 1RZKL 3O9WC 1MPAH 4MQXC 4MWFB 3E6FB 2HA1A 1BLNA 4Z9KB 5HDOA 3F58L 5JW4R 3IGAA 1WIOA 5JDSA 3U82B 4CNIB 3N1PC 4PD4J 3GMMB 1HH9A 2VLME 2BXZA 3ZSTA 5I8EB 1J1XL 1BBJA 2P8LA 3HPLB 3BESR 1EXUB 1X5LA 3LKSB 3O11B 3U4BH 1MCPL 2X1PA 2ADGB 1RUKH 4QCIB 4R97C 4XVUC 4K9EL 2VZVA 3FO0L 2ADIB 4FQ1H 1I1AC 4K8RD 4KK6C 3TN0A 1CDHA 5GSRB 5EU3A 5L6YL 1AHWC 3SDCC 1CFVL 4WUUA 5D2LB 4PRBB 1IC4H 3U48A 2FR4B 5JXAL 2BC4A 4Y4HC 4RBPK 3P4NB 5EPMA 1FFPB 4AYFA 1MCWW 1AI1H 4GAJH 4HKXA 2ATKA 2VITA 4BJLA 5CWSB 4BELD 1JPGB 1WCBA 1LEIA 3SGEH 1NCBL 2YA0A 3RJDA 3G5XA 5KOVC 1JPFA 5FGBA 4FTVE 4LLUA 1INDH 2CK0L 4Y19A 1YY8B 3G6DH 4OQTL 1S7RB 3ZDZF 3ZE1F 2DMKA 4LSQL 1D6EA 1A7OL 2FL5A 2YPKA 5TDPA 4L9LB 2XFXA 2NXYB 4MAUL 1YUHA 4AEHL 1S9VB 1OAQL 4V1DE 4QOKB 2D31B 5ERWB 4YHPB 4WHTA 5HHOA 3HZMA 4GLRI 3RDTC 4LVHB 1A6WL 3MOAH 5FHAL 1QBMH 4L8BA 4OV5B 3HZKA 4K7FB 4EUPH 4NKDA 5DQJA 3AS3A 4Q0XH 1R5IA 5IEHB 4NCC2 3IS0X 3SGDI 2IAND 3HB3C 4M48H 3QDGA 4HK0A 1HINL 5T3XE 4Y2DD 4ODUA 4D2NA 4CMMA 5LVEA 3PWUB 1CLOL 2ZWLT 4N5UA 1S7UB 1N0LA 3VXRE 3RX8A 5IW6B 43CAA 1PD6A 3V4UH 2ZG1A 4KTEH 5T1LB 3V4VL 3FHQA 4QHNA 2NW2A 4WJ5A 3RUGE 1IILE 3X11A 1ZGLA 1T3FB 2ZSVA 3GSQB 4L4TA 2DJUA 3H6JA 2FGWH 4WHDA 5T5NG 4F9PA 3LRGA 2AK1L 3RHWF 2A9MH 3FB6B 2NY6C 3Q1SL 1YDPB 4RZCA 3DV6A 4OT1H 4NT6B 2ZUXA 5IHUL 2JIXB 1EAPA 5DD1L 3BPCA 1DQMH 4AIZA 4W70A 3ORJA 3VXSD 2VDPL 3MROB 4B5EA 3TZVC 3C60A 5IESH 1HDMB 1N4XH 4F33B 1K8DB 5ICZA 2OR9L 4QHKJ 4BH8A 3GJFB 5I76A 1MOEA 2GTWB 5D1XB 3MJGX 4D0CA 2FEEI 3IXAA 1EZVY 4LVNC 1NMCC 3O8XC 2DKSA 4G6AC 2GTZA 2X41A 2ADJA 1P7QD 2P5WD 1S9WB 1IGCH 4GO6B 3BSZH 3I2CH 4GKSA 4K3GA 2X1QA 4UNVA 2VXTH 3I3DA 4DZ8A 4PJEB 3TYFA 5GGTH 4GRWH 3AUVA 4N1HB 3AS0A 4MCYA 5LAXB 1S8DB 1JZ3A 1I8IB 3ZSSA 5D7IB 4UUJB 3O3EB 3QI9B 3IETB 1QG3A 1MRCH 3MRQA 1MREH 1YQVL 2Z31A 4PRHA 5DJ8B 4XCFL 2IFGA 2IBGA 5EOCH 4M6NL 3MLVH 1Z0MA 3RWIB 4U6HA 5I17B 3CZFB 3MR9A 4HMDA 3W0WB 2QSCL 4J4PC 4PJAF 2AV1A 7FABH 3VGBA 1QO3B 3FB8B 1K4CB 1KJ3H 4LSSL 4YHZH 1NUFA 4RGMC 4KTDH 3LPWA 5HI3C 5DQ9B 3ZKQD 4DKAA 4GAGH 4UOJA 1LNUA 2AXFB 3K1DA 3ESUF 5T5FH 4U1JA 3CVIL 2WWKT 1KELL 1D6VL 3AXLB 4P46B 2WMPA 3JWDC 5ICYA 1JJUA 1GXEA 1A6UH 5FKAA 5D5MF 1SJHA 1FRGH 5DS8B 5IG7A 4I77L 4NKOA 3DECA 1NJ9A 2DQIL 1JHLH 2NMSA 5F9WB 4AG4L 4OIAA 2VWEE 1OAUH 3GIZH 4LRNH 2MNUA 5D70L 5J11C 4U1NB 5K93A 1X4ZA 4NM8L 5KSBE 1JF1A 5ID0A 4WI5A 5E94A 2NZIA 2GCYB 2HTLC 2PYEB 4JKKA 3ZKXB 3MOBL 5ANMA 3MXVL 4Q58C 2ICES 1RD6A 2NY5L 4LK4A 4DTGL 1HOCB 3U36A 4XNXL 3CFIC 5EO1A 3MGTB 3MRFB 3V5HB 5C0RL 3EOTL 3ZYJA 1FFRA 1YC8A 4H8WL 3PWJA 2EDRA 2P1YA 2R0WL 4Y2OA 3QUYA 3TYGL 4BK5A 4K3JL 2X44D 5C6WH 3IFNH 4LCIL 1NLBH 4X7EC 5F21B 3UMTA 3CFEA 4GS7B 4OZ4B 2O5YH 2AK4B 4L1DA 4GFTB 1R3KB 2OZ4A 4MNQD 4G7YH 4WU7A 4QT5B 1FVEA 2VL4A 2P7TA 3KXFE