5E4EB

Engineered interleukin-13 bound to receptor
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
196
structure length
183
Chain Sequence
MKVLQEPTCVSDYMSISTCEWKMGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSPADFRIYNVTYLEPSLRIAASSYRARVRAWAQCYNTTWSEWSPSTKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Interleukin-13
publication title Instructive roles for cytokine-receptor binding parameters in determining signaling and functional potency.
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 183
sequence length 196
ec nomenclature
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09238 IL4Ra_N Interleukin-4 receptor alpha chain, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e4eB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e4eB02
3S5LB 2H9GA 4K8RH 3T4AB 1FGNH 2ADJA 3BPLB 3KPRA 4CMHB 5TH2B 4MD4B 5JORA 1JZ4A 4M62H 3I75A 4XXCA 3IT8D 1O0VA 5T1KD 4DAGL 1E4XL 3LQZB 2IANE 4XAKD 1Q9OA 5EOCH 1I8IA 2Z35B 1BPVA 1MWAB 5T33H 3F12A 1F4YH 4WV1C 3TVMB 3OX8A 1PEZA 4OFVA 5F7EH 3S36L 3HRPA 25C8L 4N9GA 4JKMA 1PZ5B 4OIIL 3GO1L 5DD6B 2JIXA 2NY2C 4UQ2B 4CNIB 3SBWC 2CO7B 2A9ML 1CD8A 3DV6B 4I0PC 1SYSA 1XCQA 2CJUH 4NQVB 4FZ8H 4PJCE 1EZVX 3VXRE 3IGAB 2JB5L 3EOBB 5EB9A 5FHAL 3VJ6A 4IS6A 5F9DC 5LGKA 5F7YC 2ZUXA 5F1IA 1KFAL 5C6WH 3IDIA 2Y6SC 3U4BL 1CFSA 4H0GA 4ZTOL 1U3JA 4FQ2L 4OSUL 5D5MA 3STZB 4C83A 3RVWC 2R1WA 4JFDD 4P3DB 3HE6B 1C12B 1ZOXA 4IRJC 2NTSP 5DJ8A 4HZLA 2YRPA 3TM6A 4ZUWB 5D7SH 4LVOC 4YK4B 4HKJB 3X3FL 3BP5A 4OZIF 1C7TA 5FUZH 3CXDH 3VGAC 1LQSR 4HS3B 2HJFB 3JV4B 2HFFA 4LARL 1JZ3A 4Q6IB 4L3EE 3WFEL 3LSOA 2NLJB 1KEGL 2VDKH 5I76B 2R2CA 5EBWA 3TJEH 1K8IB 2V5YA 1HXMB 1YNKL 5J6GB 2MCPH 2XQYK 3WNKA 2DLGA 4IMLB 2D0GA 4GG6A 3JBG7 1TJIL 4ZFGH 1NL0H 1C1EL 1RIHL 2DM2A 5ELIA 2J8UE 4OD1L 4AJ0A 4DN3H 3PNWA 4NM8H 5D2NB 1VEPA 4YDKH 4MAYB 5DD5H 5A2LH 2R56L 3H6JA 3E2HC 1J0ZA 3LKRA 4ZD3H 4BK4A 4Y19D 3WS3A 2X6MA 3QJHB 4M7ZC 3LEXB 1BIIA 4PB9L 5C0AD 1ADQH 3S3JA 4DUVA 1QSFE 4U1GB 4Z7VB 1CBVH 5GGSY 1CLZH 4EIZC 3WHXB 1N8ZA 3GSNL 3V6OA 2ZSVA 4YZFF 4L1HA 1OTUC 1U8KA 4NJAH 2AABL 1FJ1B 4G8IB 1MLBB 4D3CH 5GISL 1EMTH 5EPMB 3FQRA 1FNSH 2A6KA 3BDXA 5C0EB 3LPFA 4JHWH 5E4EC 1MF2H 1H5BC 1KLGB 5H37G 1YQVL 3RVVD 4RA0C 5IK3A 1DN0A 4HMDA 4HGWA 3BKJH 3WXWL 1CL7H 1OOAA 4PRHA 4DGVH 3L3GA 4N0UB 2X70A 5EO9B 3TV3H 5HHOE 1WVZA 3DXAE 7FABL 1H3UA 4IJ3C 1IM9D 2F19H 1UENA 4J3UA 3IETB 1XMWA 5LCVH 5B39B 1QEWA 1AR2A 4X6CE 1IE5A 1M6OA 4D0BB 5CWSA 1BOGB 3OHXB 1BBDH 5GGSB 3MCKA 1F90L 2A1WH 2I9LA 2HT4D 3OGOE 4MNHA 4OCWH 4JQXA 4WWID 2XT1B 4YIQB 1QVOB 4GS7B 4MWFB 4NRXA 5DUBA 5SX4H 4U2YA 5F71A 5DUML 4MD0B 5GS3A 1AGCB 1CT8B 2IPKB 1YJDH 2NY1D 3AS0A 5MHSD 1ZT7A 1OW0C 3RKDD 5A2FA 1UZ8B 1K8DB 4QRPD 1DEEA 2HLFC 1UZ6F 1WAAA 4WJ5B 3MV7D 1QP1A 2EYTA 3FQXB 1YUHA 3DVGB 3CFJB 6FABL 2ZCHL 1WGOA 3MCLH 2A83A 4LHQB 4DQOH 4XBPB 3CFKB 4MNGA 4JB9H 1MIML 3O6FB 3V4UL 1TLKA 2HKHL 3MACH 4AQOA 5IHBA 1WICA 4M7LH 5JDJA 4XPAL 1K3ZA 1U93A 3O6ML 3RPKA 5IWLA 1DVFD 3RL1A 3D25A 4X7FC 1G7JB 1XR9B 3GI8L 4WW2B 3BEVA 4RQQA 1HH9A 5GGTH 1LO0H 4XXDB 4PJCA 4Z9KB 1T80A 1D5ZB 1HNFA 4L4VB 1A9EB 1D5BA 5FGCB 1WITA 3EUUA 5DJDB 2I5YL 5DMIH 4NKIH 1ZGLP 3LZFL 5D96B 4XMLL 1X5LA 5EU6B 3D85D 5C9JB 4M7JL 3HAEA 2DQCL 1BQLH 4M48L 4ZAKA 2WIIA 5KSUA 1X3DA 3MX0A 3UX9B 4F8QA 1T7VA 1W2KT 1W0VB 3LY6A 3EHBD 3L7FB 5CILL 2HT3D 1J8HB 2NQCA 4MJIA 1N4XL 4UAOB 4NZJA 3RY4A 3Q1SL 1IGFH 1JPGA 3ZTNH 4L29B 1RJZA 1Z5LB 4MSWB 2V5SA 4JKPL 3DUUA 4V2CB 3MRPA 3DROA 1KBGL 2C3GA 1B0RA 1U0QA 1U3HD 3IDGB 4P2QE 4NWUH 4CUCA 1G6RL 5HHPB 3U9UA 4GBXC 3V7MA 1BX2B 4ORGA 3QEQB 3EDJA 3O4OC 5DI8A 1G7PA 4KKCC 4UT9L 1DLHA 1OGAD 4L8BA 5E99L 4G80B 1E4XI 4DKDC 4RAUA 3B9KC 5BZDB 2F53D 1HK6A 3FFDB 3DSFH 1I3GH 2Z93B 3QXDA 4UIMA 5I30L 2EDEA 1PQZB 3QFJB 5ESVA 3BWAA 4MHHI 4LPCA 3R8BB 5H35A 1VFBA 1AC6A 4RNRA 1JNLH 5DRXB 1ONQA 5IHLB 5C86A 5I8KH 4U4BA 2VSDA 4YWGH 1B0WA 5KSAD 5DK3A 4KUCD 4KU1A 5C0GA 1OCWL 4CADB 2BSSA 3QUKB 4PJIB 4NC1E 1KGCD 2DJ4A 1REIA 3LKPB 4PJXA 1ZGLM 3CFDB 1OVZA 3RZCA 3BH8B 3T2NH 5IF0B 3RWGB 1NAKH 3G6JA 5DRNA 2AP2A 5SWZD 4O51A 5FO8B 4QXTB 1U9KA 5I19H 2EO1A 4RDQF 1GXEA 4H26A 2CK0L 4JAMB 4QOKA 1MEXL 4K55A 4PJFE 3KAAA 2P5EE 3I6LE 1ZA3A 2IC2A 3ZYIA 5E6IA 2EXWD 3PQYB 3WN5A 4EN3B 3NPSB 5EUOB 1QNZH 2A6DA 2PW2B 1YQ2A 1P9MC 3G5ZA 3O9WA 4WCYH 5GS1B 2FJGA 4IDJL 1D5IH 2BNQD 4PJ8C 3BN9D 4HIIB 1HNGA 4BH8B 2P42B 4JPWL 4KUZL 4P9MH 1F8TL 5HY9B 4XRCB 3FN0L 1FIEA 2VWEE 5AD0A 1JYXA 4XMPL 4X6CA 3SDCA 3SGEI 4BA8A 3WNLA 4OD3H 3NGBB 5DT1L 4ZXBA 3GM8A 4X6EA 4YNYB 4EBQL 2VXVH 2R1XA 3PJSA 5C2BL 5DA4A 1T7ZA 5KN5B 4GMTL 5FYKU 1RULH 4QTIL 5GZOD 5L8JB 3PGDB 3TO4D 3TZVD 4RFEA 2CIIB 3EYVA 4GRLB 3V0AC 4WFED 3QUXC 1DR9A 1HHIA 1B6DA 3SO3C 5FYJD 5D1XB 4LSQH 1MAML 4YLQT 5IUSA 3LB6D 4WFHE 3LS4L 1YN6B 3IDXL 1IVLA 2R29H 5GRVL 1ND0B 3BDYL 5LWYH 5E8PA 2VQUA 4XNUL 3NABL 3O6KH 5JW5A 1YEJH 1A5FH 3F7YB 3IKCB 1S7RB 4K94L 5HYFA 5IEHA 3B2VH 2H3NA 3GMOA 3W5NA 1BJ1J 4ZUUA 3AM8A 1KB9K 5BXFA 4HFWA 2XZCL 1IILE 5CEZD 4L5FL 2CKNA 2VO5A 4S10A 5DD3L 2EC9U 5FM5O 4F9LC 2NW2A 2AJ3A 5DJ0A 2Q7YA 4PRIB 5D7KD 4KJYB 1JWUB 4N0FB 5CFHA 3VXMA 4HF5L 2BVQB 5F93C 5ANME 4Z0XB 5GGTA 4WDIA 5I1JH 2F8XC 1AIFB 1W0WA 2ITCB 2GJ6D 2F74B 4XAWH 3CNKA 4ZS7L 3RA7H 2R2HB 4L3CA 1VB9A 4JDZB 1UH2A 1FFPB 1TNNA 2VLJA 2A73B 3G04B 5KW9H 4PIRF 1C8PA 3FFCB 2F54E 4M3JA 2VDQL 3GSXB 1I8MA 4FFYL 3SDAA 2HA1A 2RCSH 1KTRL 1EGJA 2QQNH 1FL3B 3E8UL 3DYMA 4KI1A 3OBAA 2OJEB 4H1LA 4NO3B 4XP4H 4OZIB 3MJ7B 1R6VA 1OARL 4OF5A 3VFGH 3UDWA 3TVMD 4U1NB 3KJ4B 3QFDB 5FV1L 3JWNC 4EDXB 3W2DL 3O45A 4R0LA 1QRKA 1LO4H 4PBWD 1VGKB 5EOTB 4NFDA 3VXPB 4HJJH 1KCRL 1SEBA 3D2UD 4JANB 4LGPB 1TQCB 4APQC 4YXLL 4HKZB 4BQ9A 1JZ5A 2PTUA 1KN4L 4KK6D 2G75B 2VC2L 3PWUB 5JPNA 5H94B 1VFUA 1UM6L 5CCKH 2KKQA 3HZVB 3TWCL 1EAJA 2NY5H 1JGLH 3S34L 2EE3A 4MCYA 4OI7A 2IADA 5JIKA 2P46B 5B4MD 1G9MC 1EPFA 4KV5E 4TNVF 5IQ9B 3C9NB 1FG2A 5HHME 4XCYA 4U3XA 1A6ZA 4JDTL 5TQ2L 2Z4QA 4GAJL 2BSTA 4LQFH 3KYKL 5F9WB 4JFYB 3D18B 1S5HB 3FT3B 4G9FA 4E41A 1AKJA 4LMQE 4N8VA 3UAJC 5IB5B 2P5EA 3MODL 3VRIA 3PL6B 5DR5H 5BZWA 4K8RL 1FGNL 2W65A 2WP3O 5DVKA 5J1SC 3T3PF 4M62L 3V7AE 2HTKD 3HRZB 5B21A 3T0EB 3VXTB 5GGVY 2NTFA 1RZ8A 3UTQB 3P4OA 4CN4A 3BVNB 3X14B 3JTTA 5EOCL 2C3XA 4P49A 2FR4B 3RDTC 2B5IC 4LSPL 2EYRA 1CD1B 4MS8C 4D8PB 1PW3A 4E0RB 4JGJA 5CD5D 4Y16A 3MLTA 4PG2C 5C0CB 1E6JL 1MHHB 1MREL 3MGTA 3ARDA 4HQQH 4JQVC 5F7EL 3PABB 4P2CG 4MAYD 1VADB 6CGTA 5IESL 3OPZH 4FQCH 4M4RA 4RMWA 1VFAA 5L8LB 2XTLA 3O2DA 2BDNH 4N68A 4KY1H 2OR9H 3EJZC 2BVYA 1IAKA 5FF6A 3Q0HA 5JMOC 3VFPA 1ZE3C 4OLVH 1S7SA 3EW3B 4HUMB 1OP5H 2YD2A 3EJJX 3IDYC 5F7NC 4PJEA 2R0ZH 3EOTH 3RL2B 2XKNA 4X4YB 5I1GH 2Y5TA 1T21A 3CK0H 4M7KH 5J12B 3VFSA 1B3JA 1IBGH 1RU9H 5FK9B 3FQNB 4LASH 4JFDE 5D7SL 5EIQA 2VQTA 3UEZA 5HGGS 3HE6C 2MQ0A 1K3IA 4KVCL 2EDWA 1H3PH 3GMLB 5KAQG 2JKXA 2WIMA 1ZXQA 1KCUH 5L8KB 2PO6C 3O3AB 1HHKB 4S1DC 1A64A 3K80A 3CGTA 3DGGA 2XWJA 5C09A 1AGFB 1JWMB 1BFTA 2VDKL 3OKEA 3CDGB 3LRHA 4WY7H 2IEPA 1OAZH 1DUYA 3MR9B 5IKCB 1RZFH 2HJLB 2MCPL 1VPOH 4MA3A 2R2EA 4OBRA 4XC3L 1NL0L 1A3RL 3OGCA 5F8RC 2QR0B 4HXBH 4DN3L 4NM8L 5D71H 3GMNB 1MFCH 2V7NA 3QNXA 3HS0A 3QUMB 2J8OA 1KT2B 4YDKL 4HSQA 3LEYH 4XCEA 4IRZH 1P84K 1SEQH 5DJCA 1XEDA 1V3JA 2Q20A 4ZD3L 1IGYB 2EE2A 1T4KA 2GHWB 4GRMB 1EX0A 1B88A 1T5WA 1X5ZA 2LTQB 4WWKC 5I66B 3MSPA 1ADQL 2F54A 1EJ6A 4L8DB 2WUCH 2FX8L 1CBVL 1CLZL 1V7MH 4JM2A 2A0LD 2EC9T 3RBGA 5J8OA 3O8XA 2XI9A 4I3GA 4Y4FC 4LAQH 4HUNB 4F58H 4MQXD 4D3CL 1EMTL 3QWRD 1FNSL 3V0WL 1R0AH 4YH6A 4Q97A 1Z9LA 3QZWA 2E8YA 5FXCH 1MF2L 2LAGB 4MXQC 3WIHA 5MEQA 3DX9A 5EO0A 1AY1H 4I0CC 4OCSL 5L2KB 1AD0A 4YHYC 4MJ2A 1G7QB 4M1CD 4WRLA 5IB1A 4DGVL 5D7IA 2P8LB 4OLUH 3EDKA 1IAIM 4KMTH 4L4VD 4XHJC 1CDJA 1I1AC 4PPTA 2F19L 4F7MA 1G7HA 1OWRM 5EU6D 5LCVL 3L3HB 1LDPH 1OAUH 5CJXC 2PYEE 3V52H 3LQAC 3WNMA 3ESVF 1ES0B 2O5XL 2PYFB 3RVTD 1BBDL 1OTTD 1Q9KB 5IW6A 3V4PL 3KXFA 1J8HD 4OFKA 3MLUH 5F89A 1BF8A 1U8MA 4HLJA 2UZYB 4K9EH 4OZGF 3WFHB 2VTFA 5DWUH 5JHLL 5IHZA 3ARGB 2EIEA 4U31A 1T0MB 1FL6A 5BQ7B 3VFMA 1JBJA 5EU4B 3NH7L 4HEME 3HI6H 5INCA 4DZ8B 1WBYA 2CPCA 3EZ8A 4QRPE 3MMEB 3C8KB 3CX5K 4AIZA 3MCLL 3SCMA 3MV7E 3GNML 4H20H 2NR6D 1JV5A 1NAMH 3L3KB 3O41B 5D6CA 3VXNB 3IU3A 2V6HA 3MRIB 4K23H 3NCMA 3T0DA 3GKWH 1KXVC 3MACL 4HV8B 4M7LL 5E8NB 4D2NA 2DQTH 4H5SB 1F2QA 3IS1X 2MKWA 3RTQC 1X4ZA 2CKBA 3O6FC 3QFJD 4PGDA 3EO0A 3V5KB 4YHNA 5L0QB 5C08B 4ZNEA 2VR5A 2YSSB 3ZT7A 32C2B 1OP3K 5M95B 4NN5B 1DN2A 5DQJA 3I85A 2F9BT 4C4KT 4LGRB 1I3VA 3ZDXF 1RZJC 3C6LB 3F5WB 3DETC 3MRBA 3TO2B 1T7XA 5KAQF 5M7QA 3ARTA 4OLEA 1LE5A 3D39A 2VISB 1QHOA 3SPVA 3U30B 1GOGA 4FQPA 1BQLL 5D96C 2ZG3A 4Y4HA 4R7DA 2ED7A 2HVKA 2VZVA 3HR5A 5EO1A 4PRAA 4LEOA 1IGFL 2N1KA 3KYOA 3RVTC 3HPLB 5IW1B 1QSED 4UAOC 3CUPB 2H2PC 2V5MA 3S97C 4EN3D 3P4NA 1H3WM 4P57B 2X40A 1QYGH 1VKXB 1IAOA 1G1CA 1KEML 5D6DA 3GJEA 3KPSB 1A6TB 4NWUL 1I7ZA 5L88H 2OSLA 3L5JA 5FECA 3L9RB 5E03A 4YEEA 5GS0C 4W6XB 3GMPB 4UDTA 2DLIA 2CUIA 4L1DA 2VZ3A 1DQQB 1UB5A 2YKLL 5DTFA 5E8EA 1OGAE 3TN0B 4TVPD 1TCMA 2ZNWA 3DSFL 2APBA 1I3GL 3VWJB 3WEXA 4XHQA 1Q94A 5CZKA 1HWGB 1YY8A 1RK1B 4GQ9H 1KNOA 4KRMB 1GPOH 3LKQA 5HGDB 3OKMA 4F33A 3KNBB 2ATPB 5LQBH 4U1MB 1ZAGA 1GOHA 2FX7H 4K71C 4K7PH 3TA3D 1K2DA 3ARRA 5DK0A 1U8NB 5EZLA 2XTJE 3BQUD 1I7RA 3KYNB 3VRLF 5E8DH 1H3XA 4X8JA 1H3GA 4P4RA 3QCVH 1NBVH 1MI5A 4WEBH 1P69B 5D1XD 2H8PA 3MLPA 1NAKL 4XMKH 2E7LA 4Z7WA 3MXWH 1AHWA 2IQ9H 2VL4A 4ELME 4QTHB 5I1LA 1FN4B 3N50A 5ACZB 5SWZE 2YPVH 3ULUD 4PJAF 3MRQA 3OKYA 1UC6A 1W0YT 1U8QB 3ZKQD 5EZJA 4BQ6A 2EEDA 2YA0A 4P2RB 1NLDH 3EGSB 5EIIB 1ZKAA 4LBEA 5DJAA 5HI3C 1QR1A 1KPVA 5IHUH 1D5IL 1WZ1H 3TCXA 4PG9A 3G6AB 4FRWA 3RWIB 2R23A 3QIUB 4JPKL 3NPSC 3KPQA 4CBPA 4NT6A 4ZFOB 1Q72H 2BNQE 4PRID 5GS1C 5HVHB 3Q6FB 1ITCA 1LD9B 3BPCA 1NCBH 2ICEB 1LO5B 2WANA 1NBZB 2X4SB 3CFIC 3MRNA 2AVGA 4TQEH 5FA3A 3P4MB 1YN7B 3DURA 2A9NH 1MCNA 5EBMB 3LN5B 4KK9D 4PRPA 4Y5XB 1QFWM 4JO3L 3FFCD 2DQFA 5I8EA 3GFUA 1F2XK 4J23A 1ZLWK 4M9OA 1A1NB 3QULB 3S37X 5FYLL 3MFFB 4X5WB 3PDDA 1EDQA 1PBYA 1CDIA 4E42A 3OV6A 1LWRA 2O61A 4GRLC 1A6UL 4OKDA 5E2WH 4LSQL 3MZGB 4NYLB 3TYGL 3I9GH 3CU7A 3RVUD 5DMKB 4UZGA 1JGVH 2PTTA 5FYJE 5ICYA 1NUFA 2R29L 3DI2B 2R4SH 4JDVB 1N5YL 4KKLC 5ISZD 2DQJH 3ULVH 3O6KL 5EU5B 4MMZC 1JF1A 1YEJL 1A5FL 3P11H 1MCRA 1KCKA 1QLEH 4UB0H 2V2XB 5D7LB 2ATKA 3W0WB 1DJSA 3MYZA 3PG2A 4KKAD 2SEBA 3NIFF 5T3XH 4M5YH 1CL7I 1DQDL 2QADB 3SKMB 4DEPB 3TFKD 3ULVE 1M7DB 4NUJB 1QG3A 4I48A 2EDYA 4OFPA 3H7LA 3RY6A 4Q0XH 1KENH 1N2RB 4HH8A 5HPOA 4Z7UA 1YMME 4XCFH 4DVBB 2R1YA 2F58H 2FSEB 4B53A 5T3XE 1HHGB 2P8MB 5I73B 3GIVB 4L8SA 3P9LA 4U6XA 4P5TA 5F97E 5SWSB 3ZDZF 4XAWL 1WBZB 1Y18B 4Y5YB 5JA8B 5DS8A 4YXKH 2YWZA 1N0LA 5IFJB 4HK0A 3EKCA 5KW9L 5SX4I 4H25A 4LCCB 4KK9C 4P5MA 3HR6A 2RCSL 1FYTE 1BJ1H 3ILQD 2QQNL 4JY6A 4ISVA 1RVFH 5KS9A 3T0ED 4NQEB 3MV8B 4L4TD 3FT2A 4M93B 4HPOL 2LVCA 3EOYG 4HWBL 2YMXH 3WIIL 5I8CB 3L6FB 1SJHB 3IVKB 5A2KH 3P0VL 1T2JA 3VFGL 2FYYB 4V1DB 5C0CD 5HYJE 5IMMA 3GMQB 3TBYB 5DURB 2CR3A 3N9GH 3ARQA 1LO4L 1FV1B 1GC1L 3FO2B 1YEDA 3KJ4C 3O6LL 2YZ1A 4ZODA 2C1PA 1S9YA 1IQDB 4HJJL 4PJBA 3QHTC 1D5XA 2G9HA 1NUNB 4JLRA 5CCKL 3GRWA 4EI6A 3P30H 1TQCC 1AI1H 3H7BB 2NY5L 1JGLL 3RWHA 4FTVD 1N59A 3R0MA 2JCCF 2ZOLA 4OLXH 3MGAA 3C60B 1D9KB 3DVIA 4UINL 3WJLA 3ZHDA 3PDOB 4AEHH 1CYGA 5AYUH 5LXGH 3MRGB 5JNYA 2OR8A 1SMAA 3HE7D 5F88A 4LQFL 3RU8H 4W68A 3HLAA 4MNQE 4MA1B 3UROR 3NA9H 3AUVA 3VFUB 4WNQA 1HSAB 3MTRA 4XBGB 2Z92B 2D7TH 4LL9A 4K3HA 2VDMH 5JPMA 2P5WE 4X9GA 5TQ0H 2HMIC 3TPKA 1UG9A 2ADFH 4PFEA 4ODHL 3Q5OA 5I18H 2VLKE 4P46B 5GGRY 3PL6C 5IMLB 3IDNB 4ZTPH 4NNYA 3RWFA 2A77L 4CVUA 2AJXL 3T0EC 3GSNB 1KCLA 1PG7W 4NRZB 5T1LA 1A7PH 1AO7B 1RY7B 3RGVB 1HXYB 2LU7A 2CH8A 3MJ9H 1XF3A 4HQQL 2I60H 1KB5H 3BGMB 1IEAB 1YEFL 3CH8A 4UV7H 4P23C 3OPZL 4FQCL 4KJWD 2BDNL 5CIPH 1N7ML 3FONA 1N6QH 1FL5B 3OR6A 1JPSL 5FO7B 1IKFH 4OLVL 1I1CA 4HDIA 1YEKL 1V3KA 3QDJA 3BZ4A 1CICC 5DD0H 1IC4H 2R0ZL 5ILTH 3EOTL 4URTB 3VXQB 4HPYH 4M8QA 4WI9A 2Z8SA 1X6NA 5MENB 1BZ9A 1BD2A 2P24A 5IBTL 3RIFK 3CK0L 1C16B 2YRZA 3GUTB 3C5ZB 4OZGB 1B0GB 3QDHA 3DVNA 3QH3A 4LASL 1WT5A 4HIEB 4I2XE 5GGRB 2XQBL 2E6QA 3QCTH 1JNJA 2BY3A 4MXVE 8FABB 4UTBH 1VA9A 1A4KA 3NVQA 1T1XB 4I9WE 1R3IL 5L2KD 1NC4A 2E27H 4OIAA 5CGMA 1W72H 4TVSa 1JK8A 1HHHA 3QSKB 5DJ6B 1K4DA 1PKQE 3CPLB 1OAZL 2FX9L 1CFBA 2YPLB 1J0IA 3E6HB 4C56A 3DUSB 3R06B 4B0MM 3LKSB 5E00A 1WWAX 3EOAA 4FG6D 5FCUL 3Q6GH 4HJ0C 4G6AC 2N7AA 1HOCB 2P43B 1R5IA 5JOPD 4GAGH 2G2RB 1MFCL 2J8UF 3PV7A 2JK5B 3UJTH 1DQLL 3WNOA 4F7CB 4M61A 3LEYL 1SEQL 1UM4H 5JQHC 1EO5A 3FTGA 1A9BA 1XAUA 3ARGD 2YA1A 1YC8A 5JHDD 4PUBH 4QCIB 1YYMH 3FT4B 5SX5K 3O3BA 2CIKB 2XFXA 3VW3H 3VI4F 1EUTA 5JO5A 2D9QB 2LTQC 3GHEH 1V7ML 3HG1E 2EDHA 2PXYA 4YHPB 5E6IC 5C71A 2X1OA 1A14H 2N4IA 4LKCA 3QUYA 2NXZD 4LAQL 3K8LA 3L1OH 3O9WC 3CH1B 4HCRH 4UDUA 1KIRA 1YMHB 1K5NA 3KPPA 5MERA 2F8VA 1Z9MA 4MYWB 4EZMA 1F6AB 2DQHH 3IDMA 4JREC 4X4ME 1DUZA 3K3QA 4FXKB 2W38A 1DDHB 1BBJB 1ZANH 2D7NA 5C08D 4I5BA 3IJSB 3SDCC 4HGMA 3O11A 2CLRA 5IEKB 1A3QA 4AZ8A 2UWEE 3MLVL 4OLUL 3MRLB 4AEFA 1NDMA 1E6OH 3NIDE 4KMTL 5C8JB 2X4OA 5AUMA 3C6LD 4KROB 2A6JB 3MBEC 1IFHL 3BAEH 4ETQB 3MNZB 5F9JA 1BAFH 4LSSH 3GSRB 1LDPL 1G6RB 4U1LA 4LKXA 5C0FB 1CI5A 3IDJB 5EBGA 5CGYC 3QPXL 1MAKA 3DLQR 4PP1C 4MXWH 1QFUH 1QKZH 5DWUL 3QQ4B 3S9DB 2M8XA 5EORL 5AZ2H 1YPZA 2FIKB 5I71B 2HT2C 5ICZA 2UYLB 4Y2DB 3QO1A 3OAYH 2P5WA 3HI5H 1BFVL 4HIJA 3KPSD 3DHJA 2G5BA 1IKNC 3KPLA 1FLRH 5F1NA 5HYQA 5I16B 1TCRB 3AM8C 4X6DB 3PWPB 5F7FA 4H20L 4PJAB 1NAML 4GW4A 4K23L 3TN0D 3ZKXC 2Q86B 2P8PB 2DQTL 3Q2CA 3PP3H 4O02H 2J88H 5DC4B 1UYWH 3BN3B 1GGTA 1WK0A 3HI1A 4U0RB 4NFBA 4MQTB 4DK6A 4TSCH 2Q6WB 1WFOA 3WUZA 1NGWA 4MDJA 5HI4D 1LILA 3PF2A 5L0QC 2B0SH 4OM1H 1F4XH 5E2TH 1XF5B 4HG4K 4I1NB 3UTTA 3H42H 3O4LA 4NUGH 1WFUA 2X4UA 1S7XA 4NQCA 3M1BA 1NMBH 4N9GB 3SDAC 1GIGH 3C6LC 4G6FB 5I1KL 2V7HB 4GFTB 3O2VL 4OF6A 1HDMA 4L9LA 5KVDL 3RWEA 3LIZH 1SYSB 1FZOA 2J5LC 3U30C 4LMQI 1NSNL 3ROLB 5IBUG 2XWTB 3QEHA 5JOFB 4KVNH 3DMMC 1OD9A 3UDWC 5CZXC 4OV5B 1M7IA 4P2RD 3EJYD 2M1KA 2IPTL 4I3SL 3B83A 2M26A 1QSEE 2R2BA 2OJZL 2HWZH 1RUAL 4S11A 3QNYB 4WFGD 5I0DA 1BECA 2V17L 3P73B 4HZLB 3EFFB 5B38G 4QLRA 3ES6A 4MX7A 3NTCH 3QIUD 2BVTA 5L88L 4O2CA 3HZMA 5KVFL 1T20A 3I2CH 3U83A 3VA6A 5HJ3B 1RUPL 1T03H 2X41A 5LGJB 3QDGE 3PV6B 4PTUB 1FO0L 1C5CL 4UUJB 3BGAA 1I1YA 5DFWH 2E7HA 1NGYB 2IMMA 4LCWE 4OZHF 1BVKA 3QI9A 1W72A 2BVPA 4J3OC 5D1QD 1T04B 3VWKB 4HUVA 3C5SA 3JV6A 2Z8RA 4QHNA 3H0TA 2VXUH 4KK8C 4IHOA 2RJMA 4LHUG 3IFLL 4GQ9L 4AM0A 2VN4A 4QRRB 1QSZA 3N06B 4OZ4B 4LRIA 3VWJC 4NDMA 4OQ1A 2EIZA 4L8CA 4QNPF 5IMKB 1BZ7A 3C09B 5E9DE 4GG6B 3C6SB 4LLVB 4K7PL 1U8OA 4OCMC 4BFIB 1IC7H 3BP6A 3RWJA 3PNWB 4NRYB 2QEJA 1IJ9A 4PJ5A 1X5FA 5E8DL 3QA3A 2H32H 1PLGH 1NBVL 3QCVL 5E2VL 5ACMA 1TZIA 1KIUA 5FOJA 4XMKL 4JFHE 4HKXB 3MXWL 2R0LH 3FB5A 5K9OB 2OP4L 4JO1H 2CDGA 1FVCA 1FZJA 3GKZA 1C5DA 5FDWA 3OB0K 1FH5H 1NLDL 1N8ZB 4PJFF 3ARDC 3W0WD 3WNPA 2WNGA 3JZ7A 3T0XA 5E94A 4I4WA 5EWIH 5IHUL 1UVQB 3OB8A 2QADD 1WZ1L 4RGNC 1ETZB 3S4SG 3EYOB 3RVXC 1RI8A 3T3ME 4AENA 3QRGH 5FOBB 4LLQB 1S3KL 4MD5A 5GRYA 2GTWB 1XGUB 5LAXA 5CJOH 3BUYA 4HGWB 4XNMB 1JPFB 4KGLA 5SWSD 1INDH 3ZDYE 3UZEA 4X5LA 2A9NL 2JJVA 5KZCB 1AGBB 4DUWA 4LPTA 4HH9A 3QBTB 3V7AG 3MJ8B 4HBQA 1IZKA 5DEFB 3BSZH 1J1OH 1Y6KR 4QF1A 1FE8H 3GDBA 4J4PA 5BS0E 1WCBA 4QY8A 4YX2H 1QOKA 5CHNB 1YC7A 3U2SB 1M71B 3HB3C 4OLWL 1FVEB 1S7WA 3UYRH 3GMRA 5C0BB 1I75A 4Y5XC 3SJVB 1K4CA 1M6OB 5FYJL 4JN2B 5BV7C 3MV8D 3GGWA 2I07A 3E3QE 43CAA 2X4RA 4MNHB 4OD2A 4Y5VA 4NO0A 1LVEA 2Z31D 3KLAB 2DM4A 5E2WL 4NQXA 5DUBB 2HKFL 5J4MA 5IOPB 4ZQKB 4RIRB 4V1DD 3I9GL 1JTTA 5JDSB 3DIFA 2WAHA 1XCTA 1V5JA 4TUJB 5DURD 3SE8H 4KQ3H 3QQ3B 4RISH 3HUJE 2DQJL 2IPUG 4XCNB 5C6TH 4XNZB 3BPOB 4NO5A 3C08L 4PP2B 3ULVL 1OHQA 3ZO0A 4OIBA 3P11L 4YUEL 5ISZE 3L7EA 2VABA 3EYFA 3TJHD 3IFPA 4YXHL 4ODXA 3O0RH 3AS1A 5T3XL 3TBSA 5AAWA 4NBXB 5K9QG 5IVXA 2IANB 5I1CH 3D0VA 4RMSA 1MCQA 5C07E 3RZWA 4G6MH 4GKSB 4WHTB 1RHHB 2BX5A 4PBXA 3C60D 4LLYB 1D9KD 3RHWK 4K2UH 1U93B 5KVGL 4DEPC 4XCFL 3ARBC 3MGOA 3QEGH 4HMEA 2F58L 3ARFD 3QIBA 1S5IH 5F9OL 2AQ1A 3TESA 3OTTA 4JM2C 1U91B 1ZHNB 1P1ZB 3O8XC 1X7QA 4JHBA 1Y0LB 1HH9B 4PJCB 3VXRB 3BO8B 4YXKL 5I73C 5IMOB 4ZDHB 5J0BA 1GSMA 1T2XA 5EC2A 2NNAA 1FCCA 3QIWB 3IJHA 5IB4B 3SE9H 2ESVA 5BVPL 1U8HA 3LAFA 1JTPA 3KS0J 4JO2L 5B8CC 2FRGP 4HX1A 1DL7H 4Y4KD 1NUGA 3EBAA 3A6BL 1KJMA 3A67H 4YPGB 1RVFL 4S1RH 2WIIB 4P46D 5E95B 2RIKA 2P7TB 5EH1A 4LCCC 2EYSA 5AEAA 2KZWA 4LNRA 1P2CB 1Z0MA 4L4TE 1AR1D 1I1FA 2DTMH 2GCYA 4LLWA 3BT2L 3VXOB 1T5XB 4M93C 3L3OB 4CJ0A 1AO7D 3RGVD 2YEZA 1IGTB 1CE1H 2B2XH 1S7TA 2C3VA 4U6TA 3C2SA 1ZT4B 4L3EB 4RGMC 3QXAA 1ZLSH 1BOYA 3AREA 3GJFH 3IRPX 4XH2A 2AK4D 5DO2D 4U1IB 2Q3ZA 5JLZA 4NSKB 4YHIB 3SO5A 2DICA 1KCVL 4YQXH 4KHXH 2HTLD 4X0KB 4RAUB 2HYMA 4NCDA 4KKNA 2F15A 1A7QH 4OLXL 1KN2H 3K8MA 2J8UB 4FTVE 3E0GA 5HDOA 4M6NH 5MEND 1WFNA 3MA9L 4AEHL 4PLOB 5I75B 3MRCB 3CDFA 5BRZE 5DQ9A 5H35B 1QO3A 5F6HI 2D7PA 1DEDA 4F7EB 2DDQL 3LRSB 1ONQB 1J05B 3JV5A 3SCMC 1T22A 2XIDA 2XNAB 1WQVT 4NO2A 4NZTH 3ZTJH 4WVRA 1D6EA 4PJGF 1QSFB 2YC1B 4WI8A 5ID1B 2VDML 3IXAA 4M43H 4G8GA 2DM7A 4R26L 5TQ0L 1PY9A 2OX5A 1ZS8A 2ADFL 1FFOA 5DGRA 1A2YA 1OT1A 1G7MA 3B43A 2JJSA 2YPLD 4UT7H 4ZTPL 4Z76B 1RUML 4FHBD 3GIZH 5DQDL 1Q0XH 1OAQH 2OK0L 4NFCA 2RBLA 4HIXH 2DJUA 1A7PL 2DQGH 1MAJA 4OFYD 5T5NG 3MJ9L 2E5EA 1KB5L 5IR1B 2VKXA 3UTPD 4XTRD 2CDEB 1EEZB 4LSTH 4DZBA 4C58B 3CC5A 1MELA 5C1MB 4IOIA 4Y4HC 4MVBD 5HHOB 4JFPA 4M1DH 3ZE0F 3BGFB 3QR2A 4CAGA 3DXAB 5HD8D 3VXSD 2BERA 1BFOB 4WV1A 1IKFL 1MLCB 2WBWB 4WUUA 5JXEC 4WGWB 5DD0L 1IC4L 4C55A 5ILTL 5L2JB 4X6CB 4LLAA 1CK0H 2IH3A 2R15A 1Q0YH 2Y9RT 3LKOB 2AJYL 3SBWA 3EZJB 1I8KA 4RAVB 1TZHB 3U9PH 3FOMA 4I0PA 5F1KC 1MHCB 4UTAL 1CS6A 3LDBC 2VIRB 3PJSB 2ZNXA 4F57H 5TE6H 4XB8A 3DRTA 3N1GC 4XC1H 4CMMA 3C5ZC 3QCTL 1L0YA 5CMAB 2W0FB 1GHFH 3HUJA 1NANH 4WO4B 3UTSA 2YUWA 2C9AA 1G7LB 3BYYA 3RIFF 1WSST 1GZQA 2BC4B 5FGRA 4R4BA 4OI9A 1JHKL 3GSUA 5HI5D 3KHQA 5GXBB 1RZIB 1R3HB 3CDCA 2DM3A 5J13B 5BW7A 2H6PB 1H9VA 5E4IA 1RJLA 5CEYB 1T6VN 2BOBA 4XPGL 3QDMA 3HCVB 2AXJA 3LQMA 3UJTL 3MYJA 3VXUE 2H3NB 3WLBB 2VLRA 4JVPA 4ZUUB 5JOPE 1NGZB 2GSGA 4HFWB 2BVOA 5JZ7C 3X12B 1UM4L 1LP9A 3OAZK 5DHYB 4PREA 2NX5D 4G9DA 4RWHA 1JGDA 3VGFA 1ZLUK 1J88A 1EFXD 2VQ1B 3P40A 3SOBH 2Y07H 4Y2DD 3VW3L 2K1MA 3MRDB 5JHDE 3VFOA 3CU1A 2EO9A 1MUJB 1HEZB 1CVSC 1IM3B 1I7TA 3HMXH 3GHEL 1L0XA 1RZGA 4XP5H 1OM3H 3ZE1E 4YGVA 4BZ2H 4HKBB 1AH1A 1A14L 3PWPD 4GRWH 3L1OL 3MA7B 4HCRL 5TF1H 1T1WA 2F5AL 1N6UA 2IG2H 3RUGE 1NFIB 1CGYA 1OTSD 4IEFB 1UQSA 5MEPA 4PJ7E 2NY4B 1X4XA 4BUHA 4GRWE 1KIQA 3S35L 1ZANL 3OKNA 3PWVA 4K3GA 4P2QB 2OZ4A 1WC7A 3L5XL 1KOAA 4OCRH 4Q2ZA 4R97C 4XCCH 5EC1B 3PUCA 3QO0B 3VD7A 4BQBA 2AK1H 4KQ4H 4LP4A 1E6OL 1R3KB 1OSZA 5HGAA 1MJ7H 1U58B 2FHFA 3MRKA 3TH2T 5JA9A 1XGTB 2HVJA 1ZK9A 4KKBD 4R0LB 1BAFL 5JW4M 2RB8A 3EO9H 3GJFA 4KROC 4G6FD 3CVHH 3IDUA 5IVOA 4QXWA 5INDA 4X7TA 2OTPA 3RKPA 5I6XC 1A6WH 1XIWB 3TBVA 3FRUB 2FJHA 5J6HA 5IM7B 1FC2D 2Q76B 4MXWL 1JZ2A 4MLIA 2NW3A 2PR4L 3RQ3A 2D7OA 5AZ2L 4U1HB 3AXLA 1CXKA 4RWYH 4YHLH 1FZKB 1W8NA 3PP4H 2DQEH 5DEGA 5C0JA 2WWKO 3HI5L 3CFEA 4KI5D 5T5NF 4B50A 5IFHH 1BF2A 5F6IB 4RRPA 1A6ZB 3VGBA 1UJTA 2AEQH 4Z77B 5ETUB 4QHMB 3KLHC 1FLRL 1T6WA 2NY3B 2BOCA 2C5DC 3ORJA 4FFVD 5A2IH 1XH3A 3NACH 1O7VA 1MQKH 1U92B 3H9SE 1AKJB 4I18A 1L7TH 1HE7A 1IGML 2DYPA 3QQ9C 3F8UB 4PJFB 5ESQB 2P5EB 1G7IA 1SM3H 4O02L 4Y19A 2J88L 2MHAB 1UYWL 2W65B 1YEHH 4X6BB 5DF0A 4QRRD 5C0AA 1KLFA 4TSCL 4L8SC 1CVRA 2NTFB 2V2WA 1JI1A 5IVZA 4LCIH 1F3JA 4OGXH 1QUNA 1F6LL 5FYKH 3W11C 4KK5D 3LV3A 3W9EB 4FQJH 4OM1L 1F4XL 5E2TL 2EYRB 5I1DA 3O3EB 4XZUB 3S96A 4GG8B 2YA2A 1VCAA 2Q7NA 4QRQB 1A6PA 3WHE0 4BFGA 4NUGL 4L4JA 4WI6A 1NMBL 2ENYA 5FYKE 1Q9LB 3MUGB 4M1GH 5T3ZH 2COQA 5E1AB 3MNVB 4KH2A 2UY7A 5DZOA 3S98A 5A2JH 1F58L 3SKOB 4WHYH 3VFPB 4KVNL 2DI8A 3DRQB 4N5ED 4UMGA 3WLWC 7CGTA 1QFHA 4JPVH 5T3ZE 3CFBA 4OF3A 3T0VA 4R90L 1A47A 1NMAH 3DX6A 2Y5TB 1IM9A 3G5VA 1I4FA 4XGZA 4TSAH 3WSQH 5KSVA 1OWWA 5CJBA 5IG7A 2B20A 4R8WH 1KTDB 4FFWD 4HUXA 1T03L 5DDHB 3SY0B 1OAYL 1LGVA 1MCKA 1UXWB 2Y36H 1T1YB 1NEZG 3G5XB 1RV6X 4G6JH 2GFBB 4BZYA 4JFFE 4UBDD 3VCLA 1UXSA 3WJLC 2Z91B 3UC0L 3B8YA 1GGBL 1H8NA 5KVEH 3VI3E 5DJ2A 3VWKC 5D2LA 5IBUB 1EHLH 2HFEB 3U4AA 3CSYA 4XPHL 5C0BD 3UJIL 1RK0A 1VHPA 5L6YH 1IC7L 2LAAA 3C09C 3H9ZA 3PHQA 5ANMB 3D5OF 1RFDL 4RFOH 1PFCA 1N5AB 1A4JA 3QNXB 4K94C 2VDLH 2XA3A 1XGRA 4KUCF 2DQDH 3BMWA 1G9MH 1VESA 5B38B 1PLGL 1SYVA 2ENSA 4GKZA 1WIUA 4N90D 5GSVB 3ULUL 3MROA 2BNRE 3RPIB 3F7VB 5GJTL 1RIVH 3HMXA 5DRWB 4ELMF 1QACA 2F54B 2P47B 1SHMA 4GMSH 5BJTB 5C70A 4GAYA 1HINL 2DIAA 3T65A 5GZNC 1P7KB 1FH5L 4JZOB 4LHUB 3K0WA 4K3DH 1N6VA 4KHTH 2A74B 2ZG2A 1SVCP 5ICXB 2YUXA 2IAND 5EWIL 1OGTA 1KYOJ 3MRJA 5J89A 1NC2B 3D85A 1CE6B 4K8RD 3HMWL 4ACPA 4DFIA 3VG9B 1CGSH 5C0RL 5HYSB 2UVEA 1TVHA 5MEQB 1T66D 5J11B 4IMKC 2EH7H 2R4RL 2IALB 5C0IA 4JEGB 3JWDC 3DTXA 3X11B 1N3NB 2KPNA 1ZHLA 5CJOL 5DJYA 4EVNB 3K1DA 1D7FA 1P9MA 4HWUA 4R96A 2AERT 3QAZC 1LEGA 2AJSH 3JSSA 3X13A 4CKVX 1J1OL 4YBQD 4OGAC 5KTEH 1S8DA 1FE8L 2ZJSL 1RUKH 3GSVB 4AIXA 4K3EH 1U3HA 1P53A 1P4IH 5J9PA 5C2UB 2QQLH 4FFZH 4F7MB 4ZSOA 2MQCA 4AH2A 1R5VA 4P9HL 4PJ9B 4RGOL 5FKAB 3VH8A 2MQ3A 4ZAKD 1KLUB 5HHMB 4OCLC 3INUH 1AP2A 3O3UN 3MRHA 2XG4A 4MJID 1QPPA 4OJFL 2F53A 2E3VA 3QCUL 4KGJA 2X4NB 2YN3A 3RGHA 4EQ2A 1F13A 3S4SB 3OXRA 4TUKH 4FQ1H 5FO9B 1HKLH 2EZ0C 4W4NA 4HBCH 2YBRA 4F7TA 3NCYS 3SE8L 2OTUA 4RISL 2OXHA 4M4PA 2V5RA 4HS6A 3U36A 4L3ED 4PLKC 3D1MC 1GGCH 4F2MA 1PY4A 3M8OL 4KTYA 1UWXK 3IFNL 1WEJH 3OG4B 1ACYL 4A6YL 3O0RL 3IRZA 1EUUA 5I1CL 5KANI 3I6GB 3L5HA 3MC0A 3IU3B 3GMMA 4P59H 3ULVF 3HNVH 2GJJA 1PZUB 1FQ9C 4K2UL 4HC1H 5IB3B 3C87A 3QEGL 4PGDB 2CLVB 1FVDB 1JGUH 1S5IL 4KJPD 3VFVB 4YHNB 3OKKA 3UBXI 2BJMH 1NBYB 1GOFA 2IF7A 4WU5B 3P77A 4OUUA 3QG6A 3SDDB 4Q9CA 1RZ7H 1QSFD 2H2SD 5KSBA 4I0KA 2RGSA 3SE9L 3RHWF 3FOLB 1NFDE 3QHZL 3RZCD 1M1SA 3OKLB 8CGTA 2ZKHH 3UTZA 1LNUA 1O5DT 2AKRA 1UKSA 3C8DA 2GEEA 3QIWC 1DE4A 3A67L 4QXGL 4S1RL 3E6FA 4JFEE 3C2AH 4J1UA 4FXGA 4QRTA 5CD3A 4PRAB 4JFDB 3ISWA 3BHBB 3KPMB 3PWJB 4CDGC 3TBTA 4QHUA 1UWEH 1KYOK 3MRMA 5F7HA 4GKNB 3VG0H 2Q87A 2WW8A 1GAFH 1CE1L 1LE9A 1IAOB 1EAPA 3ULSA 1TNMA 3B3IA 3DGCR 3GJEB 4IIQB 4X4XA 2XZAH 5CEXB 1ZLSL 3AFLA 5HHOD 3TZVA 1DFBH 1I7ZB 4L9DA 4YAQB 3HC4H 3RBSA 4WU7B 5FECB 5DMYA 1IQWH 3GI9H 5IBLD 5GJSL 3TIDA 3WBDA 2WWMC 4ENEC 1EHNA 1A22B 2AK4E 2HG5B 3B8SA 2XV6B 1F11A 4DVRH 2Y7QA 3EDDA 1KG0A 5GGVL 1DCLA 2DWDA 1CLOL 5GIRB 4MCZB 1QA9B 3DYPA 3K2UH 3LQAH 2ITDA 3BEWA 1D3CA 4ODTL 1LEIA 4EEEA 2FO4B 3HZYA 3THML 4DFHA 2V9RA 4NZTL 2EDNA 5GQBA 1HSBB 3I6KA 3AB0B 4WO4D 5DHVH 1I7RB 2BNUB 5KANG 3ECBA 5A1AA 3UTOA 4M43L 1Q8MA 3ZHKA 4JPIB 3MREA 4JFOA 1GZPB 3F6IA 1INEL 3OJDA 4RFNB 4WGVB 3O2WH 4PGEB 5DSCA 4BSVB 2VJXA 5ERWB 3UBXG 1NGPH 2GJ6A 1VFMA 3GIZL 5CSZA 1OAQL 1T0NA 5CUSL 1JTOA 4HIXL 5GRZA 4MZ2A 1MJ8H 2BP3A 4Q9BA 3AROA 5F7WC 2DQGL 1UA6H 5HHVH 1CU4H 4HHAB 2EDDA 3VFTB 2WBJB 4OKVB 5DJAB 3ESUF 3GSOB 4PJHA 5CP3H 4LSTL 3MRRA 5HGBB 2XYCA 3FZUC 1QLFB 4P4KC 3S5LA 3T4AA 3R1GH 1TJGH 3RNKB 5TH2A 1DBML 4CVZB 4M1DL 4MD4A 1FIGH 2Y06H 4NZUH 1OAXH 4ZO9A 1EH9A 5CP7B 3K74B 4PG2A 2C7UB 3LQZA 5DC9B 4IRSB 3VXSE 2Z35A 3BGFC 3MRNB 2PYEB 4JQVA 4JZJB 1MWAA 2XKUA 3U46B 4LVNB 5HDBF 1RZJH 2ZSWB 1CK0L 3TVMA 1A7NH 4PD4K 3P0YL 3CMGA 4LK4A 3K4AA 3U9PL 4FMKA 4JKLA 2VLJD 3SN6N 4GW1A 1PZ5A 3OF6D 4F57L 3U7WH 2BMKB 5DD6A 4UQ2A 4CNIA 1J1XL 2QKIB 2FZ3B 5I8EB 4XC1L 1JZ8A 4E5XB 1YY9C 3DV6A 4NQVA 3WFDL 1NCCH 3ZE2E 1GHFL 3IGAA 4MXVF 3EOBA 2YUZA 3JTSB 1IGCL 4QRPB 1UWGH 3MV7B 1K85A 3STZA 5CGTA 1G9NC 4P3DA 3HE6A 1SVZA 2AJVH 2ERJC 4ZPVB 1KIPB 4R3SB 1R24B 1A8JH 4ZUWA 2VXQL 4Y8DC 2FCBA 2ZP0T 1XIWD 1M7XA 1NAMB 5J13C 4QHKI 1DVFB 3AU1B 4IM8A 3JV4A 4Q6IA 2NLJA 4LNVA 5I76A 3FMGH 2NX5E 5E2UH 3MV9E 1A3LH 1HXMA 5J6GA 2Y07L 3WUWB 3N1QC 3SGJA 4D0CB 4PJDE 4POUB 1L6XA 4LRNH 1NGXB 3HFML 4BQ8A 4BZ2L 1OAKH 3MNWA 2WP3T 4G8EB 4KDWA 2D0HA 4ONHB 4DOHE 5TF1L 2M2DA 4G9FD 5D2NA 3G08B 1AKJD 4LU5L 4MAYA 4WWKA 3VFNB 4MA8H 2IG2L 4CN6A 2WLZA 3DO7B 2P5ED 3I6LD 2CMRL 4AG4H 3ZT6A 3LEXA 2EDBA 4QYOA 4K7PY 4XNYH 1MCPH 1J87A 2WLYA 3IFOA 3KPRE 3SDXE 2NY4C 4OCRL 4Z7VA 3VE0B 4B5EA 2Z8WC 4XCCL 2XZZA 5D1ZB 4FA8A 2OTWB 3WHXA 2AK1L 2BRQA 4KQ4L 4U33A 4Y16D 4J4PC 4JJ5B 2UWEF 2OR7A 4FQHB 1FJ1A 3MLRH 1MLBA 5IMMB 3NIDF 1RMFL 2CQVA 4M3KB 4LPXA 5EPMA 3H9HB 1X5IA 4NKDB 2J8HA 1OGAB 5C0EA 3EO9L 5CSGA 1H15B 5BOPA 1S9YB 3CVHL 1ZV5A 1KLGA 2R69H 4NNXA 1D5XB 4PY8J 4TOYH 5IJVB 2G9HB 5E7FA 4NQUA 4J3VA 2NY0B 4QWWD 3A6CH 3RIAK 1XIWC 2EICA 3ALWA 1GRWA 2DF3A 4N0UA 5C0DB 2ZOLB 5EO9A 4HGKC 5CJXA 3G6DH 5KSAB 1I9JL 4RWYL 3IETA 3J8F7 5D5ME 5B39A 4PB0H 1UACL 3BD3A 5DJXB 1L7IL 4KI5E 2NY6B 2DLHA 4D0BA 1BOGA 5C3LD 1TVBB 3HLAB 5GGSA 4ELMB 5K9JH 3NACL 4LF3B 4YIQA 1MQKL 5SWZB 2VKWA 1QVOA 4WNQB 1WCQA 4MWFA 2NY3C 1L7TL 5E0QA 1HQRB 1SBBA 4ESKA 4MD0A 1AGCA 1CT8A 2IPKA 1SM3L 2X4QB 5C09D 3AS3A 2VDRH 1SY6A 2FL5A 1UZ8A 1T2QL 4LCIL 3P0GB 4UOW1 5KVMC 4WJ5A 5FYKL 3RWFB 3FQXA 3K1KC 4RBPH 3DVGA 3CFJA 2BNQB 4ZUVA 3MLXL 1XGQB 5DMGC 5GHWL 4U6HA 2FATH 3CFKA 1ZTXH 3LN4B 1FNLA 3Q48A 3O6FA 3QWRA 4U1SB 1EIBA 1XGPA 1NLBH 2FWOA 4POZC 5J56B 4PJIF 4KRPC 3K8KA 1J10A 5T3ZL 4PTTB 1A6AB 5E1HB 5DZLA 1G7JA 1XR9A 1G9EA 4FZEL 2F54D 4JRYE 4WW2A 1B2WH 5MP6H 1FNFA 4HJGB 4O5LH 5GRXG 3ARUA 1LMKA 2EIDA 4M8QB 4J12A 5GRUH 4AL8H 4LHUD 1D5ZA 4JPVL 4S0TD 4L4VA 1A9EA 3TO4B 4Z78B 4TTDC 1NMAL 1WBXB 1NCUA 1XF1A 4NJ9H 5EU6A 1NC2D 1KJVB 4TSAL 1ITBB 3WSQL 3WE6B 2APFA 4R8WL 4AEIH 4ONFH 3DYOA 2Y1VA 1U8JB 2ADGB 1C08B 1X5GA 3L7FA 1ED3B 2D7MA 2FJFB 1A4KB 2YOCA 4WFFD 2KQNA 5C0ND 3T2PA 3SE4A 4G6JL 1T7WA 4L29A 3BP7B 4MSWA 5ITBH 2AEIT 4LQ1A 2UUDK 1YNLH 4PRHE 1MFEH 5KVEL 2CGRH 4HLZH 3BESR 1EHLL 3IDGA 3LS5H 1BVZA 4EJ1C 2ICWJ 5HHPA 1TVDA 3BOVA 1BX2A 3NBNA 4PJ9D 3MV9A 4TRPH 3QEQA 2UZIL 1YMMB 3UYOD 2IJ0C 4G80A 2D31B 2C3WA 4YHKH 2VDLL 1MPAH 5DJZB 2AS5M 3FFDA 3HC0B 1J0KA 2J6EA 1GGYA 2Z93A 3WCYA 4U1KB 2NXYB 4MAUL 1PQZA 2JJSC 1MJUH 3G5YB 3QUZB 4DCQA 4KC3B 4N8CH 1RIVL 4Q6YA 1NEZB 5DRXA 1IAIH 4FQXB 5C9KA 3CMOH 1FYTB 1NCDL 1NUDA 5ADOH 3F6LA 4K3DL 4KHTL 5AAMA 4CADA 3SDXA 1WAAE 1NANI 3QUKA 3ULUF 3QUYB 4R4ND 5F96H 4RMRA 1I7UB 4WEMB 1CGVA 5IF0A 4S2SB 3NFPB 1DBBH 4MNGE 3OJ2C 5HYJB 3IDMB 3T3MF 5FO8A 5KG9B 2EH7L 5IROC 3LMJH 3ZKMD 1HIML 5JMRA 1KSRA 4NZRL 4QXTA 3VG9C 2GJZB 3BZFA 3RWCB 5F3HB 4YDLC 1C7SA 3FL7A 1JPTL 3ZDYF 3D2UB 3ZTJG 1IGJB 3SDDD 3PQYA 4EN3A 5KTEL 5EUOA 2BSRB 3LRGA 2PW2A 4G8FB 3HAEH 5GS1A 3NIGE 5FHBH 3F7RA 1P4IL 4BSJA 2QQLL 4FFZL 3FAWA 5BO1H 3D39D 1TJHH 3HPJB 4BH8A 1ZSDB 1RAMA 1PEWA 1E28B 3W9DB 1GC1C 4XP1H 1PVHA 2HP4A 1AJ7H 4YBLB 5HY9A 4XRCA 2HRPH 5ALBH 3TBWB 3V5DB 5D7JC 3TGXA 4PJ9C 5EDXA 2UV3A 2X9YA 4FQ1L 4MJIE 5LJYH 2NY5C 3WD5L 1HKLL 4MNQB 4KDTC 4LSUH 5DK2B 1NCAH 2RFXB 5A3ID 1GGIL 4YNYA 4ZS6D 2YD3A 4ZO7A 5KJRH 4ZPTB 1QHPA 3V6ZB 1HQ4B 5BW7C 2P5WB 5KN5A 2CLZB 1R5WB 1GGCL 3JUYA 3PGDA 3ARZA 4FABH 2CIIA 4HT1H 3MLYL 3KPLB 4GRLA 2VLKB 1JI2A 1FBIH 5I1HL 1F02I 4XVUC 1RIUH 1WZKA 4UIKL 4OTXL 1YEIL 2QQKH 1A7BA 4X5XB 3HNVL 5D1XA 3DX8A 4R4NC 1YN6A 4HC1L 1KJ3L 4U1JB 5DA0B 4NN7B 1ND0A 4NWTH 1LK2B 1JGUL 3WFCH 1BEYH 4XWOD 1ULVA 1U8IB 3TPUB 3BIKB 3IKCA 1S7RA 5TE4L 1KXTB 2O5YH 4NQSB 3RX7A 1A1OB 1KB5B 4JRYA 1BGXL 1Z9OA 3MOQA 5FUCC 4HULB 4YE4H 3RX5A 2ZKHL 5CIPB 2W9LA 2XXCB 4PJXE 4OT1H 4PRIA 2YS4A 1MVUB 3C5JB 4KJYA 4L9LB 1JWUA 3TT1H 4D9QE 4N0FA 3GBNH 4EIGB 2R9HD 1FGVH 2BVQA 4F80A 1DLFH 3C2AL 3G6JE 4Z0XA 5E8OA 3WKMH 4Z8FH 3N0PB 1H3TA 3AY4C 1AIFA 2ITCA 4I2XB 2F74A 4PGBB 2VRAA 1IAMA 4UNTA 5DMJB 3RNQB 2R0WH 4HIHB 2R2HA 1UWEL 2WV3A 4JDZA 1M7IB 1QBAA 4XP6H 3MZTA 1FFPA 1DBJH 4QOKE 2VN7A 3MQIA 3OZ9H 2FGWL 2ARJB 2A73A 2WBJD 2R2BB 3FFCA 5ID0B 2DWEB 1OF2A 1JL8A 3CLEH 2XZAL 1CZ8L 2GK0A 5A3IC 1UCBL 3HZKA 4CU7A 4ZG1A 2CK2A 1PKQB 3HC4L 4LLDB 1EZVY 1FL3A 1PX3A 4EI5B 3GI9L 2OQJB 4R4FL 3FB8B 2GT9B 2OJEA 1MRFL 1XGYH 4IRSD 4NO3A 4OZIA 5L7XL 3JWOH 2AQ3A 1MCSA 2PYED 1I9EA 4JFQB 1EEUA 1W72B 4U1NA 3QFDA 3WL9A 3RWDB 4OCXH 3H0TB 3VGHA 4DVRL 4EDXA 2ZUTA 4MJ4A 1VGKA 2EDJA 3N85H 4BH7B 1AC0A 2CRMA 1ZVYA 5CKAA 5TDNB 2X05A 5LVEA 4HKZA 5ENWB 3T8XB 1A0QH 1A7OH 4LLUA 3PWUA 1MFDL 1KV3A 5H94A 3BP6B 2FEDD 4P48A 3HZVA 4I18C 3HG1B 1J5OH 5A43C 1MCOL 3OJMB 4DGYH 3NFSL 1ACZA 5IQ9A 3C9NA 3M17B 3O2WL 3FCTB 5E6ZA 2EKJA 2FECL 2DRUA 1MJJB 4XNQB 4QT5B 1FVCB 1K9TA 2R0KH 4JFYA 1QFWH 3D18A 1MJ8L 3FT3A 1S5HA 1ZLVH 5I74C 1UA6L 5HHXH 1CU4L 4N0RA 5IB5A 2VH5H 1MCFA 5E94B 2H45A 4MQSB 2GITB 4M6OH 1NFKA 1LK3H 1CDGA 3BYTA 2X4TB 3PL6A 1II4E 4GKOA 4PGCB 1DBAH 3R1GL 2ARWA 2UWEB 3RVVC 3WO4C 4M02A 3P9MB 3B6SB 4LDLB 2WK2A 2VZ1A 3HRZA 3T0EA 3VXTA 4NPYA 3UTQA 3BVNA 2IQAB 4JZNB 2FR4A 3VXME 4P5TD 3AGVA 1CD1A 1M05A 4P23A 4D8PA 4E0RA 1A7NL 2I9TB 5C0CA 4IRSC 5J57B 1MHHA 1OLLA 1QFPA 4JZJC 2EXYD 3PABA 4QF1B 3WNNA 2IFFL 1VADA 4HK3J 1EGJH 3F58H 3UBXB 4M6MH 3D0LA 3TCLB 3T1FB 4EUPH 2VLJE 4P0DA 1RZKC 4H1LH 1CICA 1EVUA 4GOSA 2HT4C 1B9ZA 3ZKND 4OCYH 4H8WL 2GQHA 3TYFB 4F3FB 2X4RB 5D1ZD 3RL2A 3JUZA 1UWGL 4NQXB 2NY1C 4EDWH 1LEKB 3BPNC 4XWGH 2OL3L 3RKDC 3DJ9A 1FPTH 4HUWB 5FK9A 1AXTH 3FQNA 4H0HB 4NGHH 2LU4A 3CSGA 4NO5B 2X44D 5DYOB 3WV0A 4BJLA 1JN6B 3BKML 5I9QB 4WI5A 1B4RA 1KB9J 3L7EB 1KJ2H 1Q9WB 2DJSA 4WHYG 2E9BA 2B1HH 2NY0D 4GLRH 3O3AA 1LO2H 1HHKA 2WM0A 5ADPL 4HXAH 2VXTH 1AXIB 3NCJH 3FQUB 4Y1AE 5D72L 3ZL4H 2XTJD 1DVFC 1AGFA 1F3DJ 1JWMA 3DI3B 3FMGL 3CDGA 5DGQA 3MV11 1A3LL 1R3LB 3MR9A 2HJLA 4N0CD 2BRRL 3QIBB 2GSIB 4M00A 4LRNL 1JMXA 2EE9A 2NY6D 2ORBL 2QR0A 1EBAA 3SKNB 3GMNA 5ESAB 2IAMB 3T2QA 3QUMA 1N0XH 4HAGA 1F4AA 2E7CA 1JPST 4G9FE 4E41E 2N7BA 1IGYA 3RUGF 2DQIH 4GRMA 1FFNB 3EHBC 4PJ7F 2NZ9D 1JNHB 2HT3C 5I66A 1QSEB 2W1NA 1MCPL 4GRWF 1WZMA 4HMCA 4L8DA 1CGTA 5EUKB 3STLA 2FLRT 1JP5A 4P3WA 3FRPA 2GCYB 2CRYA 5T1LD 3BJLA 3QDGB 5JUEL 3O2DH 1U3HC 3MLRL 5D1ZC 5AZEL 4LCWB 3VFWA 3SQOH 4WHDA 1PSKH 2FD6H 2BCKB 4RMUA 1BQHG 5E08L 1IEHA 1ORQB 4TOYL 4JY5H 1TZGH 4RGNE 4XH2B 1ORSB 2OBGA 4BSWB 5E2JA 5L2KA 3A6CL 2JJTC 3BP4A 5E9DB 3TNNB 1NKRA 4X7SL 3MBEA 1WWBX 3QDJD 4ZUSB 3T0BA 3MJGX 3VFRA 5EIVA 5TFSL 2P8LA 4NHUB 3ARYA 2CRZA 1CFNB 2NY0C 4UILL 3TA3B 4PJEE 3EYUH 3G6DL 1BD2D 3BQUB 1U95B 4PY7B 4NN6B 3EYQD 5DQ9B 5FKPB 2PUQT 4PB0L 2WINB 4V2BA 5KSAC 4HD9A 3B4NA 5BV7H 4BQCA 4X80H 1ES0A 2PYFA 5GRVK 3RIAF 5K9JL 1Q9KA 1VACB 5D9SB 5D4QA 2VDOH 2NY6C 4WI3A 2H32B 4MHHG 4ALAL 3OKOB 3WFHA 1JCKA 1NC4D 5D70H 5EOCJ 5BQ7A 5EU4A 1E4WH 1CIDA 1IKNA 3L95B 15C8L 1G7MB 4IDLA 5C09E 1DP0A 3ULVD 4C56D 4DZ8A 1BVLB 5C3TA 4JQIH 3D48R 1YECH 3VDBA 4IBLT 3VMNA 2EXWC 3MMEA 3C8KA 1YMMD 5T3XD 3GSQB 1ZTXL 3L3KA 3O41A 3VXNA 3MRIA 3NZHH 3BN9C 4HV8A 1NLBL 1QLRB 4LCUB 2ZPKH 4LSVH 5E8NA 4OF8A 4H5SA 5EN2B 1YDPB 3CC5B 2A38A 1JF5A 2NXYD 4IOIB 5HHNB 5IT2H 1FYHB 1MY7A 3QUZD 5FYJU 3V5KA 2FDBP 5B3JE 5BS0B 2DLTA 5C08A 2YSSA 4DAGH 1B2WL 2J3SA 5MP6L 1ZEAH 32C2A 1KC5H 2XA8H 4Q74A 1XF2B 4FQXD 4O5LL 4UQ3B 1FYTD 2WQ8A 2VDPL 4S1SH 5GRUL 4AL8L 2JELL 1QBLL 3B2UD 4UV4H 1X5YA 3C6LA 3F5WA 3QUYD 2NY2B 2MMXA 3WIHH 4EUPA 4F15C 2VISA 3FOMB 4NJ9L 2VSCA 25C8H 5CBEB 5GZOC 4JHAH 4XBEH 3TO4C 3TZVC 3GO1H 2AXFB 2DOCA 3UMTA 1HHJB 2FLBT 4R7NB 5HYJD 4ONFL 3DMMA 5A16B 1MCDA 1UADC 2FECI 3PIQB 3HUJB 4BFBD 5ITFB 5FHAH 3WJJC 1CFQB 3OL2A 5ISZB 3HPLA 4WFFE 4F9PA 3LB6C 1H0DA 1J8KA 4FNLH 4IRJB 5IW1A 4QHLB 5ITBL 3CUPA 3U4BH 2PNDA 4P57A 4XVJH 1MFEL 5D7IE 1JHTB 1NDGB 4NQEE 2ZCKH 3LS5L 5C07B 4Y1AA 5K9KB 1PG7L 1A6TA 4W4OA 2PW1B 3WDIA 3VGAB 1KJ2A 4TRPL 3L9RA 1CDCA 4I13B 4A6YB 4XP9H 4W81A 4XPBH 1P84J 4YHKL 3PWLB 5ABDE 1NBQA 1MPAL 1DQQA 1OB1B 1UJ3B 3T4YB 3KXFE 4WTZA 3VWJA 5FB8B 4MNQD 3WFEH 4UU9B 5MEOB 2P4AB 2RHEA 4GAFB 1RK1A 5IB2B 5CBAB 1MJUL 5HGDA 4AMKH 3DARA 4ZUTA 3VD4A 3KNBA 2P5WD 3HC3H 3VDCA 1IAIL 4JJHA 3BZDA 4U1MA 2CDFA 3CMOL 1T0PB 1U8NA 5ADOL 1U8LB 2VLKD 4NCC1 3GB7B 1MNUH 4X7CC 3KYNA 3E2HB 5T5FH 2AEPH 2CKBH 4L4TB 5FV2A 4M7ZB 3BPLC 4CMHC 4OZFB 5E5UB 3T0WA 2W60B 1HILB 2P44B 5T33L 3QYCA 3GBLA 3LPWA 1F4YL 3WIFA 3Q3GB 1FN4A 3LMJL 3X3GH 1MCWM 5ACZA 1MHPH 3T2OA 3TVMC 1R3JA 1DQJB 4ZNEE 2ED8A 5DHXB 4P2RA 4Z7NE 5IGXH 2ZOKB 4O2FB 5EIIA 2CJUL 3V0VB 3W39B 1HH6B 2AABH 2HH0H 4FZ8L 5DUPH 1H5BB 4YO0B 5FHBL 3NCYP 5HHQB 2AI0H 3G6AA 5BO1L 3K4ZA 3RWIA 3QIUA 4FTVB 3OKDB 4KK6C 4ZFOA 2RR3A 3MLWH 3D39E 1YQVH 4CVWA 1LD9A 4YDVA 5BRZB 1X5XA 2ICEA 5DD1H 5ALBL 1NBZA 2X4SA 2AJUH 3P4MA 5B4MC 2VITB 1YN7A 4JM4H 3HE7B 5EBMA 3LN5A 4LSUL 1NCAL 2MTPA 4I9WD 3AXLB 4Y5XA 5FUZL 3O3DB 7FABH 5KJRL 2VAAB 3CXDL 2ZUWA 2EKSA 4YK4C 2X4PB 4AIOA 1U42A 4ODUB 3CX5J 1A1NA 1UCTA 1WWWX 3QULA 4FABL 1BJMA 2PCPB 4EI5D 3MFFA 4X5WA 1FBIL 2X09A 2N56A 1F42A 1RIUL 1XH3B 4QRUB 3TJEL 4Q6IC 4KTDH 1JGEB 3QI9D 2QQKL 1BP3B 4G5ZH 4ZFGL 4NKOB 3K2MC 4NYLA 3L5WB 2HTKC 5DMKA 1EHXA 1ZT1B 3SGJC 5E7BA 3U0TB 4JDVA 3L3JB 3R0NA 3WFCL 3WO3B 3TC9A 1U8PB 1JUFB 1KF9B 5EU5A 5DD5L 5CD5C 2DKMA 2V2XA 5D7LA 2ZCHH 4PLJD 5D2NC 4G43B 5TDPB 4MAYC 3VRJB 1U3ZA 3IB4A 2YXFA 3HNTH 3SKMA 5SWQA 4CW1B 3ARBA 3HG1D 1MSPA 4YE4L 5A40E 1M7DA 4NUJA 2JF1A 3ROOB 1NFDF 1KTLA 3N1PC 1G0YR 4OT1L 1N2RA 1TETH 4DVBA 3O6MH 3D69A 4HWEH 1MI5E 2FSEA 1Z2KA 5TE7H 1DLFL 4U1GC 4K7PX 4NJAL 1HHGA 4Z8FL 4Z7WE 3GIVA 5SWSA 4KMLB 3QJFB 3EO1A 3ZYJA 1WBZA 2HJKB 1Y18A 2DLEA 3U4EB 4JFXB 2EEBA 4JHWL 4ERSH 4Y5YA 4XP6L 5B8CA 4U6YB 4ZOAA 5TGBB 2DIJA 1DBJL 2BXZA 5IFJA 3OZ9L 4BKLA 2I5YH 4TSBH 3I02B 1KUMA 3BKJL 3CLEL 4XGZB 2GW5A 4LCCA 1CL7L 1BQUA 4YEFA 4D0DB 2QTEA 2DQCH 3FO1B 4NQEA 3MV8A 4OQTH 2UY6A 3TV3L 1XF4B 5AYQA 4GUPB 1N4XH 5DFVD 5I8CA 3JWOL 1SJHA 2IBZY 3IVKA 2LV4A 3Q1SH 5E56A 4PR5A 2ZUSA 4D9LH 2CXGA 4CU6A 3VXUB 3TBYA 3JVGA 5TDOB 1KBGH 1T1ZB 3FO2A 3N85L 4GBXB 2A1WL 2ID5A 4HS8H 5DJ2B 4OCWL 1IQDA 3PHOB 4PRPE 3AS2A 3OR7B 1A7OL 3B9KB 2AXGB 1QBMH 1YJDL 4OGYH 4GS7C 2E8ZA 1EFQA 1MH5B 5JHDB 3H7BA 3KLSA 2D03H 4NQDE 4NO0D 4IOFD 1J5OL 4PRDB 2J7LA 1SYVB 4WW1B 3BZEA 3C60A 1MY5A 2XOTA 4DGYL 3GSWA 1F45A 3PDOA 1GVIA 1I8LA 2HN7B 3KPTA 2NXZB 3LKNB 3MRGA 2C1OB 4LFHG 4DQOL 3RUGB 3NAAH 1SJVA 4JB9L 2A0LC 1ZLVK 4PJ7B 5JTWA 5JW3H 4O2EB 1QFWL 3OXSB 4GRWB 4MQXC 2GAZA 3VFUA 2OM5A 3KR3H 5HHXL 2ICWA 1HSAA 4XBGA 2Z92A 1JJUA 4JO4H 3STBA 5I17B 3L3IB 2CSPA 4M6OL 1LK3L 2YK1H 3I3DA 1TENA 4MDIA 3U0PA 1P5VA 4FS0A 4LPWA 2GUOB 3CJJA 3REVB 3ILPB 1LO0L 5GGTL 1NJ9B 3KLDA 4P46A 4Z95H 4X83A 5F21B 4WW2C 5IMLA 3BXNB 3IDNA 3QIBD 3PGFH 5DMIL 4PJAE 4M1CC 4NKIL 4Z7UE 2CK0H 3GSNA 3BKCH 3CIQA 4NRZA 1AO7A 1J12A 3MO1B 1JNNH 1HXYA 3RGVA 2IAMD 2E9WA 2AQ2A 5CJ8A 3UJJH 3BGMA 4PJ8B 1IEAA 5K59E 3HTLX 3RRQA 1HKFA 1EGJL 3AVEA 2ADIB 4OLYH 4M6ML 3CVHB 5BVJB 3DECA 1DANT 4JKKA 2KQMA 3ZTNL 1OTTC 5JXEA 4QO1A 1NH6A 1F8TH 3KGRA 3H8NA 4RX4D 5FO7A 3ET9F 3ZE2F 3KDMB 4GT7A 3SE4C 1AP2B 3MRHB 3FB6A 4Q9QH 1IAII 4D9RE 5KS9E 5F7DB 4RMTA 3VXQA 2CD0A 5MENA 2NYYD 3QDGD 4XWGL 2YBRB 1C16A 3GUTA 3C5ZA 3H9SB 4OZGA 4LCWD 1B0GA 2GTZA 1FPTL 3LPGA 2OTUB 1E0OB 1AXTL 43C9B 3QNZA 4LIQH 3QPQD 5FA4B 4HIEA 2BHYA 4WI2A 1D5MB 1DZBA 1FDLH 4JR9H 3GRWH 3QUXB 1GCFA 2P48B 2NR6C 8FABA 3ARED 3SO3B 1PYWB 1IEBB 4PGZA 4PJBE 1T1XA 5E9DD 1LO2L 3V95A 4LIQE 4HXAL 5I9QC 2VXTL 3NCJL 2VZTA 3KYMB 2A6IB 3U6RB 1JNLL 3ZL4L 2MJWA 4RMQA 1MAMH 5I8KL 5DJ6A 4YWGL 1MIEH 3CPLA 5DC0A 2YN5A 5F3BB 2YPLA 4TYUA 3E6HA 3DUSA 3KWWA 3BDYH 3R06A 4X98B 5IIEB 1ZA6B 1AQDB 4PJDF 4JFHD 1HOCA 5C7XH 1KPRB 3T2NL 4K7FA 1HYSD 4KJQD 2G2RA 2JB6B 4K94H 4F7CA 2JK5A 4OUUB 2V2TB 3CVIH 2AEWA 3WFBH 1N0XL 4XI5D 2XZCH 4L5FH 4X6DF 4RCAA 5I19L 2DQIL 1QQDB 2AKRB 4FQLH 4PRBB 4PYHA 4MJ6A 4HLZG 2CIKA 5F7UA 4HF5H 1P7QA 1CF8H 2FEEL 1QNZL 2GIYA 4HUUB 4WCYL 1F3DH 3L3DB 3TBTB 4YHPA 4EN3C 2DL9A 1FFQA 4DJMA 1I3UA 3O2DL 3MRMB 3CH1A 4P9ML 5HGHA 1T3FB 1YMHA 3AAZA 3SQOL 4YPJA 1PSKL 2FD6L 4JFFB 5I8OH 1F6AA 2C3HA 2VDQH 4NOBA 4OQTA 4FXKA 5D1QB 4TPRH 3RP1A 3JWDH 12E8H 2AAVA 1DDHA 2XRAH 4OD3L 5BS0D 4GSDH 1BBJA 4FQIH 3KPOB 3IJSA 3E8UH 3ARPA 2VXVL 5IEKA 3NGBC 4WUUD 2EH8H 2KL6A 1I3RB 1QSVA 1OARH 1PX4A 5GS2H 3NN8B 1RULL 3MRLA 3BRDA 3B5GA 4UT6H 5C8JA 3QDJE 3EYUL 4YJZL 4L8CB 2A6JA 2NY2D 4NQDA 4ETQA 5HPMA 3MNZA 4APQB 1BD2E 3GSRA 3TA3C 3DBXB 1G6RA 2YD7A 1KCRH 5D5MF 3EDFA 2HRLA 5BV7L 3K4DA 3BQUC 4X80L 5C0FA 3T77B 1CFTB 4KI5F 5T1MA 1FNGA 3IDJA 3KPNB 2BNRB 2VC2H 4HK3N 2VDOL 1UM6H 2Y6SD 2ZG1A 5I2IB 3G9AB 3TWCH 5D1XC 2JCCE 1BQHB 1EK3A 1SJEA 5LWYL 3QQ4A 4IRJD 5D70L 3FHQA 4XI5C 2FIKA 3OJDB 3HAEG 2UYLA 3B2VL 4Y2DA 3ME0A 3ULUC 5C07D 4F7PB 1ZHKB 2BK8A 3FB7B 5EU3A 5JW4Q 4JQIL 4JDTH 1YECL 5TQ2H 4GAJH 3P2TA 4C56E 3KYKH 3D87B 5I16A 3NOIA 1TCRA 1UFUA 3PWPA 2AV7B 2FB4H 5CLWA 1IL1B 4PJAA 4GG6F 3NZHL 3OAUH 4LSVL 2Q86A 2Z8VC 5LBSH 5I1JL 2OCFD 2ZZUT 3NA4A 3FQTB 3QWQB 3SEPA 5IT2L 3RA7L 1MCWW 1TITA 3RDTB 2B5IB 1AXSB 2Q6WA 3PGCB 1ZEAL 1KC5L 2XA8L 4ZMAT 5IFAH 4LSPH 4S1SL 1XF5A 4UV4L 2XICA 2OXGA 2YZ8A 1E6JH 1MREH 3V5HA 3MRFA 3WIHL 3CCHB 5IESH 4GW1B 1S9XA 4JHAL 2VE6A 4XBEL 4XPTH 4XP4L 4KRLB 3FKUS 4PRNA 2V7HA 2Z31B 3E3QC 4Y88A 1U6AH 3VD3A 3IDYB 1S7VB 4AY0A 4EXPX 3REWB 2Q8AH 3ROLA 4P9HC 3TIEB 2XWTA 5JOFA 4YDJB 2W92A 1OTUD 5IV2A 2W9DH 4FN0A 4C54A 4OV5A 3RVUC 1J0JA 1QFWI 4FNLL 3V9FA 4PV8B 4XVJL 4Z7QE 4JGUA 4N5UA 2ZCKL 3QNYA 4J3WA 3NCCB 3P73A 2KH2B 3EFFA 4X99B 5JQ6H 3S35X 2Q3AA 1IT9H 4MLSA 1A21A 2PO6B 1XR8B 5HJ3A 4XP9L 4KKAC 4KVCH 5GGUB 1HI6B 5LGJA 3FO9B 1DTUA 3PV6A 4PTUA 4XPBL 5BRZD 3VDAA 4UUJA 3ZKSD 1DBKH 5KOMC 3TFKC 1NGYA 2X9WA 2E6JA 2WWKT 2XPGB 3ARFB 3SE3A 3FJTA 3IF1B 2APVA 1T04A 3VWKA 3QWOA 3FRPG 3LVEA 3FQWA 1UJ3C 4QRRA 4OZ4A 4X6FB 3WDJA 4AMKL 3CZFA 1NFDB 3ZYZA 5IMKA 1YPZE 3HC3L 3V6FB 5F9WC 4XC3H 3C6SA 4LLVA 3SKJH 4JG1H 2D4FA 1A3RH 2PKDA 5DR5L 4BFIA 3MNWB 4Y4KB 5H2BB 4JFEB 1MNUL 4NRYA 5T5FL 2FO1A 1PGRB 4ZOEA 2AEPL 1JWSA 1WAAF 2JJUA 3ARXA 2CKBL 1AFVH 1KXQE 1CDBA 4WWKB 2VL5B 2DYPD 3ILQC 2Z0BA 4HKXA 5LKNA 2HLFD 5K9OA 4QYOB 3VI4E 3ZSSA 3X3GL 1MHPL 2IPUK 3IFOB 4FQQB 4Y4FB 2X42A 2FX8H 2NY7H 3ZYOA 4N0YH 2BVEA 2XN9E 4NQTA 5IGXL 1WV7T 2OR9L 1GL4B 1FORH 4KY1L 5B22A 1FNEA 4RMVA 4MJ5B 2HH0L 5KBNC 1OP5K 4GLRI 1UVQA 5DUPL 3CSBA 2AK4B 4IMKA 4GW5B 2AI0L 3UTTE 4PJCF 3V0WH 3NIGF 1ETZA 3EYOA 3O4LE 1ZGLB 4ZOCA 1RJCA 3MLWL 4NQCE 1WZLA 4YHYB 5FOBA 5I1GL 4NNXB 4LLQA 5ECJE 5DD1L 2GTWA 3S6CA 1K6QH 1XGUA 4M7KL 4XNMA 1JPFA 4OCSH 1V8HA 1IBGL 2AJUL 2VLMD 5EBLB 1RU9L 4JM4L 1I1AB 3DX7B 4P2OB 1AGBA 3DV4B 5J12C 4ZFFB 2BFVH 3MJ8A 5DEFA 1H3PL 4RDQG 2JCCA 1YNTB 1TPXB 5CHNA 3HE7C 3U2SA 1M71A 2X1QA 1KCUL 1FVEA 1FAKT 5C0BA 3SJVA 2O5XH 4JN2A 5DHVB 3V4PH 4WY7L 2FEEI 2FHCA 4KTDL 1RZFL 3KLAA 1VPOL 5GSRB 1ZHBB 1S7QA 4G5ZL 4ZQKA 5IOPA 1CGWA 1G9NH 4RIRA 1J0HA 3RFZC 5JHLH 2YD8A 3VXUD 5JDSA 1ZWIA 4TUJA 4HXBL 2VMFA 1INQA 3QQ3A 5D71L 4GBXD 3NH7H 4XCNA 4EUPG 4JY4B 4PP2A 2FL5B 4J8RA 4KKCD 4HG4J 4JCLA 4IRZL 4H1LG 5FM8A 1UEYA 2WSKA 4NP4H 3B9KD 5EA0H 5F6HJ 4ZUVB 5JW4N 1XZ0A 3TNMB 3GNMH 2B4CC 4U6HB 2IANA 3HNTL 3RTQB 3VXSB 4KJWC 4GKSA 4WHTA 1RHHA 2WUCL 1XGPB 2DMBA 2FWOB 2XWBA 4LLYA 1E4KC 2YXMA 4PJ5E 1KTKE 1TETL 4PJXF 4OB5H 4HWEL 5CJQH 4LLMB 3BH9B 5TE7L 4F58L 5E5MB 2IH1B 2VXSH 1TQBB 3M45A 4BK5A 3G6JF 1U91A 1ZHNA 4WTXA 1CG9B 1P1ZA 3PE9A 1R0AL 1Y0LA 4ERSL 5DRZB 3VXRA 1AD9B 3BO8A 5IMOA 5JR1H 4ZDHA 1OP3H 3M07A 4QRSA 3QIWA 5IB4A 1EXUB 4TSBL 4F37F 1AY1L 5JW4R 2JJWA 4PY8I 3IJYB 4WTZG 4YPGA 4CVXB 3AMLA 4OQTL 3EAKA 2P7TA 2L7UA 1FP5A 1P2CA 4O9HH 2BZDA 3MUY1 4N8VG 1S9VB 3VXOA 2HLAB 1T5XA 3L3OA 1OAUL 4D9LL 3V52L 5E5RB 2OL3B 2VOTA 1IGTA 4PJ8D 4X6CF 2X7LB 1J0YA 4FG6C 4HS8L 1MHEB 4HEPG 3MLUL 1KEMH 4TULH 1ZT4A 5ACLA 3QB7C 4L3EA 1RD6A 1E27B 4K9EL 4WIQA 1MFBH 2NX5B 3MV9B 1QBML 5J06A 4U1IA 4OGYL 1EFXB 4NSKA 2NPLX 4OZHE 4EOWH 4YHIA 4PJDB 4X0KA 1RJYA 2D03L 2FNBA 3HI6L 2YKLH 2W9EH 3ARGC 1IC5H 2J8UA 1FCGA 1OPGH 3ARSA 1FFRA 4DOHB 3QQNA 3MRCA 3NPZB 4P5KB 3BIBX 3H9SD 4K71B 1T89C 4DCQB 4QNPE 1Z9SA 3NAAL 2J2ZA 4PV9B 4F7EA 3LRSA 2IGFH 5I1AB 1J05A 2YPKB 3GKWL 1GYAA 5JW3L 1Z0NA 3QUXD 2NXZC 2VAJA 1A6VH 2XNAA 3KR3L 2H9GB 2ADJB 3KPRB 3SDXB 4JO4L 1QSFA 1V7NH 2YC1A 5JORB 5ID1A 3I75B 2YK1L 2XN9A 4JRXE 5EFIA 5IVXE 1Q9OB 4H0IA 5EULV 1I8IB 4U05A 4RA3A 1ADQA 1CLCA 3U79A 4Z95L 3F12B 2BSED 1SJXA 3OX8B 3PGFL 4Z76A 1QRNE 4NN5C 5FYKD 3U7YH 3BZFB 5FGBC 3BKCL 4XVSH 3D3VE 1CIUA 2JIXB 1JNNL 4P4KA 3UJJL 5EU7C 4AK1A 1XCQB 5IR1A 5CAYB 4LSDA 5LG1A 4OLYL 2CDEA 1EEZA 2J1KA 4O00A 4LEXH 4ODWA 5HHOA 3VJ6B 4IS6B 4JPKH 5T3ZD 2ESVE 1TTGA 3DXAA 4HWZA 5F1IB 1MFNA 3IDIB 1BFOA 3BUTA 2JTDA 1J11A 1CFSB 1MLCA 5D5MB 4C83B 4Q9QL 1QYGL 2R1WB 4F9PC 3O81A 5L2JA 5DJ8B 2X5PA 1I9IH 3LKOA 3U0WH 4H88H 2DL2A 3BP5B 2FBOJ 4RAVA 4CGTA 1TZHA 2X89D 2ICWI 1MHCA 4W4OC 1IARB 2VIRA 4JO3H 3FAXA 1T83C 4JFFD 4LIQL 2DKSA 5HBBA 1FDLL 4JG0H 4JR9L 3GRWL 2HFFB 3D9AH 3BI9X 1VFOA 5CMAA 2W0FA 5FYLH 3UO1H 5L9DH 3LSOB 3VA2C 3VGEA 1ZLWH 4WO4A 1G7LA 3TN0C 5EBWB 4U6VH 1GPOL 4WUKH 4OV6F 3NFNA 4BUGA 1A6UH 5LQBL 2FX7L 3DX8B 2BC4A 3TYGH 1MIEL 3FN9A 3QZWG 5FYLE 4M8VA 4PBVC 4APQD 1RZIA 1R3HA 1N5YH 5HI4C 1FSKB 2VLLA 2DIBA 2H6PA 5C7XL 2W07A 5CEYA 4WEBL 1F00I 3HCVA 4E9LA 1AGDA 2BNRD 3LKRB 5HVGB 5IQ7H 3CVIL 3WLBA 4PGJA 3WFBL 1J1PH 2IQ9L 3WS3B 4JRYB 1NGZA 3X12A 1BIIB 1EEQA 4OLZH 1DQDH 5DHYA 4YDIH 2YPVL 4FQLL 4ZOBA 3PXHA 2VQ1A 2XY1A 4G8GE 4U49A 1VDGA 2ZSVB 1Z6JT 3MRDA 1CF8L 1U8KB 3HNSH 1FHGA 5E8OB 1N64H 1MUJA 1HEZA 1IM3A 3EJYC 3FQRB 4X7DC 5FCSH 3UAJD 4HKBA 2A6KB 3IS0X 3MA7A 1Q72L 4NOFA 3OMZA 3OF6A 1NCBL 5IK3B 1NFIA 3QIUC 1KPUA 1DN0B 5I8OL 1OF2B 4TQEL 5HVHC 2GK0B