5E4EB

Engineered interleukin-13 bound to receptor
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
196
structure length
183
Chain Sequence
MKVLQEPTCVSDYMSISTCEWKMGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSPADFRIYNVTYLEPSLRIAASSYRARVRAWAQCYNTTWSEWSPSTKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Instructive roles for cytokine-receptor binding parameters in determining signaling and functional potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Interleukin-13
total genus 31
structure length 183
sequence length 196
ec nomenclature
pdb deposition date 2015-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09238 IL4Ra_N Interleukin-4 receptor alpha chain, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e4eB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5e4eB02
1OGAB 4LSQH 3ROOA 1ES0A 3UTOA 5C0FA 3JVGC 3DI2B 4B7LA 1N5YL 3HE6D 1I85A 3KYOA 4LOUD 5ISZD 5TFSH 5IG7B 2PCPB 5M94B 3RVWC 5A2KH 5CGYD 4NKIL 4PR5A 4NCC1 3ARGC 1K4CA 4AIZA 1WF5A 2AABL 3EZ8A 3H9HB 4NO3A 1HSBB 1I8IB 4X6FA 5C07E 3LKSB 1BAFH 5C6WH 4XGZB 2A1WL 4WFFD 4I5BA 1B4RA 5JW5B 5SWSA 1UKTA 2ZG3A 4N9GB 4H26A 1INDL 1V7NH 4K3EH 4YDJA 3S4SG 1CGSH 4R97B 3O8XA 1JF5A 3T0VA 3VDBA 4HFWB 4OQTH 5T33H 1RUQL 3VMNA 4D8PA 2VL5A 4MCZB 5K59E 3B4NA 5DJCB 4AEFA 5IK3B 3MA7B 4LRIC 3QFDA 2OL3A 3MZGB 1D5MA 3R1GH 4P3CH 4EI5D 1AC6A 1DUZA 1FO0A 1C5DA 4WFHE 3G5ZB 2E8YA 5FHAH 3TT1H 1BFSA 3BP6B 4DKEL 1EK3A 1YYML 3QNYB 5CWSA 4C56E 4IOFD 1UM5L 2OQJB 4HZLA 4L8SA 1MHCB 4UILH 4XNQB 5E8OB 1EEYB 2NW3A 1T1WB 5T3ZL 4Z0BL 3OR6B 5JPNB 1OD9A 4ONOA 5L9DH 1S7XB 4DUVA 3O3AB 3NAAL 4WFGD 3DV4A 1G6RB 1TZHB 1FNGB 5IT2H 2DLGA 1UJ3B 3VXUD 4A6YB 4RWYH 3VFSA 2VDRL 3L5HA 4NBXB 5MI0B 4KJYB 3O9WC 1G9NH 4MNQE 2NYYD 3GKZA 3HI5H 4ZFZA 4LEOA 2XKUA 3L3KA 5B8CA 2FZ3B 1NBYA 3SKNA 3EJJX 4EQ3A 2CIKB 5FA3B 3ULUH 2O26U 4BQ6A 1G9EA 4J6RL 2V9QA 3IS1X 2ZOKB 5BXFA 4ZYKA 5ITBL 3VFNA 1A9BA 4ZTOH 1VA9A 2PKDA 4UBDC 4XAWL 1B6UA 3C5ZA 3VXQA 3QXUA 5DJ8B 3CX2A 3ZDZE 4DKAA 1DQJA 2NTSP 4OZ4B 3AM8C 2H2PD 1F4YL 2BXYA 4NQDA 2FJFB 2ZUSA 5F93C 3TNMB 5IV2B 4EZMA 2JB5H 1IKFH 5FM5O 5H35B 1XGUA 2JELL 4C57C 4Q9RL 2X9WA 4ODWA 1MVUB 2V7NB 2F58L 2NY1C 4TSAH 5DJAB 3VXTA 5C9JB 3FCTB 2F8XC 1HCVA 3QUYD 4FN0A 2R0KL 4LHJB 4JFXB 3MRFB 2NXZC 4PJXF 3DGGB 4RFOL 4NYLB 3ARTA 5IFAH 1KLGB 2XI9A 3DI3B 3NIFE 4NRXB 1BBJB 4JHWL 3VRJB 3CGTA 1CF8L 4ETYA 4DN4H 4G9DB 4Z9KB 1HOCA 3EOAB 5L7XL 4RAVA 2O93L 5FB8B 5MHSD 4LLUB 3O2VH 5DDHB 1JPFA 1IAOB 2H32A 5DFWH 5KVFL 4Q0XL 3MNVB 2FB4L 1NBQA 3BZDA 2EH7H 5I8CA 2PW2B 4P23B 1KBGL 1N64H 1JNNL 3I75B 5FEBA 1E6OH 4V2CB 1W72A 1MCWM 3X12A 1FFOA 1XF3B 2XZAH 4PJCA 3B5TA 4HPOL 3ET9F 3MA9L 2NY4D 1SY6L 4LLVB 2E7HA 2QQLH 1X4XA 3VGBA 1HIMH 3LZFL 3FKUS 3QCTL 2BOCB 3A67L 3CZJA 4NJAL 3VD4A 3OKOA 4Q2ZA 4D0DA 1Z0MA 3RVTD 1VGKA 1JRHI 2VC2H 1NBZB 3D1MC 1P7KB 3P73B 4KH2A 2X4OA 4HBCL 4GRWE 4PGZA 1D5BA 3X11A 4F7MB 1L0YA 2YC1B 1XR8A 3SKOA 1HYSD 3PQYE 4P9MH 3CVIL 4J3WA 3NA9L 4KWUA 1NPUA 1RUML 3T09A 1AGFB 4D9RD 1FORL 1WZ1L 4B53A 3JXAA 3O6FD 4OFYD 2E9WA 4EUPG 7FABL 2L4OA 4RFNB 3AVEA 1YDPB 4MAUH 1LQSR 1FL3B 4PJ8B 2FHCA 5HDBE 5I74B 1VESA 1WIUA 2AJYH 3LPGA 1TXKA 2HT3D 1BFOA 3D3VB 3DTXA 3MACH 3IDNB 1TITA 2CGRH 4KZDL 1X7QB 2H45A 4BQBA 3MLXH 4LVEA 1VGEL 1P69B 3OZ9L 4YZFE 3VXRB 4PREB 1KG0B 5IHUL 2NY0C 1I8KA 1AXIB 1MCRA 1BOGA 2DQHL 1UH4A 1X5HA 1X6LA 2Q1EA 4LDOB 5ADOL 5C0RH 1A6ZB 4NOBA 1Y0LB 2F53A 2FRGP 3IDIA 4NKOA 4AEHL 4HS6B 4M48L 4POUB 3VFOB 5D71H 3MRJB 3L3KB 3RBSA 1YQVL 2J1KA 4FP8H 32C2A 1RULL 1QR4A 2ATKA 3ZSSA 3RI5F 1MREL 1SYSB 5BMFL 1IL1B 2Z8RA 5IKCA 2ENYA 1QBLL 5A2FA 3H9SB 5C0GB 1VB9A 5DEGA 2Z0BA 4IOIA 4FQQA 4Y2DC 4JRWA 5JW4Q 1IGYA 3TNMA 4XWOD 5IV2A 4GBXB 5JR1L 3CFEB 1RAMA 4JO1L 1E6JL 3RY5A 3QG7H 3A0OA 3TLRA 3RUGB 4FQJH 2P46B 3HMXL 3P9LA 5E8NA 4XPTL 2X6MA 4H1LH 1ETZB 2FATL 2Z35B 3BD4A 3T0EA 2J5LC 3O6LH 4HWZB 4JFFD 2ZWLT 4HBQA 3T1FA 3HMXA 1PKQE 4FFYH 3VXOA 2ZCLL 3S4SB 4U1JA 4NQSA 4XCEB 3T3PE 5DJDA 4Q9BA 1CFSB 5JDJA 3PGCB 3FB5B 3OAUL 3VRJA 4Y5VA 5I75B 4Z7UA 4U7SA 4HQQL 1FJ1A 5IB3B 3C2SA 4GOSA 1FNAA 2EZ0D 4XC1H 4MNQB 4LLUA 2YWYA 4N1CA 2BCKB 4KI5E 3K1KC 4OM0L 3TESA 1J1OL 4NKMB 5EU7E 1I8MA 1A7QL 5FOBA 2L7JA 4K3JL 2PW2A 1YMHA 2IPKA 3CFBB 2ICES 2J4WH 1XCTA 4HAGA 2LU3A 3QDME 4ODXA 2NY2C 3HPJA 3ARBA 3VW3H 5E9DA 5C09E 2CJUL 3RWGA 1P7HL 3OKOB 4Q2ZB 1FVEB 3MRNA 1KFAH 4Z8FH 3T77B 3D3VE 2WAHA 3BQUA 1EMTL 4Y4KD 5I8KH 2C1OB 3MO1B 2RR3A 3BZ4A 3EHBC 5EUOF 4JZNA 3TH3T 3RU8H 5I1HL 3VGAB 4PJ5B 2OR9H 4PGBB 1HH6A 3UJIL 1YECL 1OAYL 3MFFB 4HS8L 1C7SA 5IR1A 1JGLH 1T7ZA 5JLZA 1J5OH 1QFHA 2WSKA 2XRAH 4HFWA 4OTXL 4R0LA 2G5BB 5LGHH 1VADB 2XKNA 2OMNA 4OBRA 2R9HC 2P1YA 2HG5A 3ZHLA 3RP1A 2EYTB 5DHVB 4WI8A 5F6HI 1N2RB 1VKXB 1JRHH 1XT5A 2V2WB 4AG4L 2P42B 1SBSH 4X7TB 2W0FB 5FO8A 1UZ6E 4S1SL 3CMOL 2P47B 2H2SD 4U1IA 3PQYA 3JUYA 4HK3J 3QB7C 3ZYIA 2BVPA 4L8SB 1JZ3A 4J3TA 4MA3B 1DN2A 4J4PC 5ADOH 4XCYB 5BS0A 4KMLB 1R3JB 5L8KB 4J2XA 1M7DB 1RHHA 4APQC 2QSCH 1JV5A 2PN5A 4HKXA 4NUGL 2P8LA 4CRPA 1Y18B 1G6RA 4R3SB 4YUEL 4PJCF 1LEIA 1GIGH 1LK3H 1E28A 1FGNH 3QWOB 3WL9A 3NMEA 5HYSA 3PWUA 2X4QA 4F9LC 3H6JA 2EIDA 3MLVL 1M4KA 3F7PC 3OGOE 4NOFA 4ZOEA 3TFKD 1KTLA 4JPIA 2DOCA 3DOSA 1KTDA 3C5ZD 4J6RH 3TJEL 5HD8D 1F4XL 5CJOH 5HGAA 4YFEA 4X6BB 1C16B 3GHEL 1G7JA 1A9EB 1QTYT 4A6YH 3C5ZB 1CBVH 3SGKC 1JHKL 4LCWB 2H41A 3VRLE 2D0HA 3SE4A 3SQOH 4B41A 1JK8B 3RZCB 3EDKA 2WBJB 4PGDB 1AQDB 1IEBB 4I3RH 3GFUA 4WWKA 2BNUB 2DQIL 1I1AB 3ILQC 3VXUA 1UEYA 3BO8B 3OKYA 2ICEA 5IM7A 3WS6C 2XA3A 3QXAA 4M5ZH 2NTFB 3K74B 1HCFX 3BEWA 5MERA 4TTGA 5EFIA 3VA6A 3AB0B 3ARED 3BJ91 1A4JB 4QYOA 2C4XA 3QUXA 1T1YB 4JFED 4PBXA 4V1DA 5F71A 1CZ8L 1NANI 2YHGA 3WKMH 5C86A 2IPKB 3UTPE 3OKNB 2HWZL 2LTQC 2JJTA 4ORGA 1DQDH 3BVNA 2OSLB 4KQ4L 3GMRB 4L9LB 4LLWA 3QIBA 5ITFB 3HAEB 5F8RC 4PJ8C 2I07A 5ACLA 3CLEL 2Y07L 3GSWA 5IHUH 5CP3H 2EKSA 1S9XA 3BMVA 4X6DA 3Q1SL 5LBSL 3UPRB 3MX0A 4U1MA 4FZ8L 5C08A 2ZCHL 3H7BA 4EOWL 1CK0H 5GRJL 4NNPL 4OI7A 2DLHA 2VDMH 3SDDB 3SDAB 1TTFA 3IGAB 3WXWH 4UDTB 1CLOL 1JGEA 1CL7L 2VLJA 4BSJA 2EH8H 1RIVL 4NT6A 1ZT1B 4KI5F 1MY7A 3W0WB 2AXJA 1M6OB 2XOTA 3I6GA 1KGCE 4TUKL 1IAKB 1OL0A 3QQ4B 4NO0D 3MUJA 1F11A 4EN3D 1MCLA 2X4NA 1FRGL 4Y16A 2A6IA 4GQPH 4ZUUB 3FL7A 3GKWH 3ARYA 2PF6A 1J7VR 2QQNL 3ECBA 2HJLA 4GBXC 1U3HC 4KRLB 1R3LB 3TA3A 5CAYB 2GFBB 1QNZL 1C5CH 2HLAA 2JK5B 4PLKC 1V5JA 4FABH 2E6PA 1B2WL 2Z8SA 3BFOA 3RUGE 3M1BB 4HUUA 5I71C 4YNYA 5CZKA 2CDFB 4JPKL 1XGTA 3HC3H 3L3DB 1CFQA 4OKVB 1LD9A 1FV1A 4LF3B 2NX5D 1M71A 5IB4B 4JG0L 3THML 4EI5B 4GMTL 4LSDA 5IQ7L 3KJ4C 1KOAA 2IQAA 2OM5A 3DX6A 1N0LA 2BJMH 5TDPA 3RX7A 4Y19E 4LBEA 4N0UB 3HTLX 1T22B 1KJMB 5CBEA 2PXYD 1JN6B 5IEHA 4OZHF 4JRXA 4GT7A 2UZIL 1CFVL 4LDEB 2ICWI 25C8L 3HPLB 2YS4A 2JE8A 4X0KA 4CN1A 5C07D 4G8EB 1RI8A 4M4PA 4P2OB 2IFFL 3RZCD 4MJIB 1DUYB 5IW6B 1PDKA 5CEZE 3HNVL 3C5JA 2NW2B 4OCYL 4JE4B 4C55A 5EN2B 4UINH 5FUOH 1II4E 3VRIA 2I27N 3ZKMC 3AS2A 5C1MB 3N1MC 5JQ6H 1BREA 3CUPA 2CLRA 4WI4A 4XH2B 1BQSA 4XP5L 3NPZB 5A1AA 2QL1A 2BVEA 3R06A 5C0BA 5T1LB 4HMEA 2QBWA 2HKFL 4N0YL 3TWCL 2B5IB 2ESVA 4I0PA 2VLLB 3KPRD 2C3XA 2EC8A 4P0DA 2P8MA 4FG6D 1PKOA 4QHMB 2VKWA 5FYKH 1J1PL 1CFSA 1DBAH 4N9OB 5F88A 4L4VD 4U1MB 4U31A 2PYFB 4OLZH 2X9YA 3SDAD 1JYWA 1ZGLA 1J5OL 2VDQH 1FNEB 3L3GB 1NCCH 4AEIL 1U8IA 2ZUTA 3T4AB 1MAMH 4M8QB 3TBWA 3RNKB 35C8H 4O2CA 2OJEA 4KJWC 1M7IA 2A0LD 3QEGH 4HK0A 1U95B 4XAWH 5IVNA 1OP3H 4X4ME 4PRHB 3WO4B 2NY7L 2VMFA 2R69L 1B3JA 1P4LB 4ZDHA 1GGCH 4LPXA 4PJHE 1JP5A 5KSUA 1HQRA 1OAXL 1L7TL 3V2AR 5E9DB 3HB3C 5AWNH 4EXPX 1MCSA 1R3IH 4BZ1L 4PV9A 1RZJC 4XZUA 3BGAA 4LNVA 5GS0C 3IKCB 3Q3GB 4N8VG 1QHOA 4XBGB 4NQEA 4N5ED 1KC5L 1D3CA 1OTUD 2O5ZH 2AERT 2V2XA 3IFLH 5DJ6B 2BFVH 2WMPA 4W70A 2AK4E 3ELAT 1CYGA 3VI3E 2NY4B 4M6NL 3CXDH 1PGRB 4XVUC 4HKJA 3PJSA 2D31B 1N7ML 4JCMA 2ESVE 4O58L 5JPMA 4K7PH 4Y2OA 4QRTA 5DQJA 2I24N 3O11B 4X5WB 2DQIH 4U3HA 1RPQA 1QLEL 2BX5A 1CDJA 1EEYA 1JVKA 1QSFE 3IFOB 1F5WA 1MFEL 3O4LA 8FABB 3WE6B 5GS0D 3WLBA 4L5FL 3V5DA 4MD0B 3IDYB 3DSFH 1FLRL 3BQUD 4NO5B 1JHTA 1JHKH 2F5AL 3OGCA 4LCCC 3TO2B 4LAQL 4DFHA 3O3AA 4CVZA 3ULUC 4MZ3A 1XF1A 4ERSL 2A6JB 2CLZA 3ULSA 5EZIL 3HMXH 4MJIE 4DAGL 5TJWK 1IGTB 2C7UB 1ADQA 3UTZB 3D48R 1CLZH 3QULB 4XPBL 1EHXA 4TNVF 1JZ4A 4FQXA 2AJUL 3QI9B 1A47A 1TCRA 1OTSC 1IGMH 1DEEB 3TBTB 1JN6A 5IEHB 1AXTL 4JG1H 4KHTL 5BS0E 3VFNB 5HJ3A 1J8HE 5FO9A 5DJ8A 5C0CD 3ULVC 3WNMA 1CICA 1A7OL 2BOCA 3QUXC 4HIXL 1XGUB 3ZE2F 5I16B 2VXSL 3JVGA 4MSWB 3RIAF 5FYLD 1CLOH 5TE6H 3VRIB 4ONHA 3JTSA 4HUNB 3GM0A 1ZAGA 2APBA 2X7LB 1ED3A 4NYLA 4O2FA 2NXYB 2A6KA 2AGJL 3SQOL 2DN7A 3CFKB 1K3IA 2C3HA 5I1CH 3STZA 1BWMA 1QSEA 4MS8C 4N0CD 3SBWA 5HDQH 1OF2B 4NRXA 2VSCA 5F1NA 1ZLUH 5DFVC 2DQDL 3EFDL 5HXMA 3PL6C 4P3DA 4HMDA 1U8LB 3IXAB 1M7IB 4U7KA 4CADB 3IJYA 3WD5L 4CVXA 2ZNWA 4X98A 4RMSA 2XQYK 2YA2A 1H3WM 2AV1A 4YHOL 2AKRA 4ZDHB 4LEXH 2IMMA 3HFML 4G42A 4LFHD 4XVJH 5BCAA 4ZFOB 1DANT 3ARPA 3Q5YA 4PG9B 4M1DL 2Y7QB 4ODUB 1QRNE 3RGVD 3QEHB 1JBJA 1LDPL 4OT1L 4LRNL 3B9AA 4IOSD 1TJIL 4Y2DA 1N6QH 3LD8C 2N7BA 3H7BB 4LSUL 3S37H 1EHLL 1HKFA 4APQD 5T1KD 3PJSB 3FQRA 3C5SB 3HNSL 3Q6GL 4YBLB 2XQBH 3MJ8A 1JGDB 2Q7YA 3O41A 4ZPVA 4N0FB 5D7IF 3D85A 4HZAA 4YHYB 2V5YA 5ISZB 3BISA 3CXDL 3SPVB 3V6FA 4JCLA 1ZA6A 1MCQA 5I6XB 2B2XH 4GRMB 1AHWB 4PJ7B 3P4NB 5JA8B 1R6VA 1BLNB 4LVNB 1YMMA 2BNRE 5CS7A 2WIMA 5JNYA 1LK3L 2I9LA 1YJDH 4R26L 4Z7VE 3A6CH 2OJZH 2A6IB 5GQBA 4JM4H 2EDWA 5D7JA 4X80L 2FH6A 1G7HA 2G75A 4WDIB 1ZWIA 1ADQL 4P5TD 3T0EC 5GGSB 3NVQA 4JGMA 1JHTB 1F2QA 2HMID 4OV5A 4RQQA 4NN6C 1KB5L 4P5TB 3VXNA 2MOVA 3H9SD 5IW1A 3H3KA 1R3HA 3PV7A 1IC4L 4BFGA 1FQ9C 1I7TB 4XCFL 2E9BA 2Q8AL 4YQXL 1PG7H 5KANI 3DV6B 1J0IA 5F9WB 3UZEA 1T5WA 4U2YA 4MDJA 4PJAF 2VQ1B 4R8WH 5D93B 1ZE3C 3CDFA 4I9WE 4D9LL 1SY6A 3TBSB 3RIFK 5DK0B 2WINA 2GYSA 1F6FB 1INQA 2A9MH 2RQ8A 4JO1H 1DLHB 5E9DE 4FQQB 1PLGL 3N1FC 1JWUB 3K8MA 2GJZA 1S9WB 3C9NB 1TDQA 1ORSB 3VWKB 2BOBA 2GUOB 3BESR 4GRLD 2XZQH 4RDQF 3V0AC 4BUGA 4LU5H 1CFTA 2C3GA 1T4KB 2QQLL 5HI4C 5LAXA 3V4UL 5D7KE 4Z7WA 2HFTA 2BY3A 4ZSOA 3KYMB 5A2IH 1KC5H 2BHUA 2V5MA 1LNUA 3SJVD 4HHAB 3BDYL 3SCMC 4EUPH 4M7JL 1HQ4A 3K4AA 2H8PA 2H9GB 4I18B 4DZBB 4E41D 4FQPA 4IRZH 5EC2B 2DWDB 5KS9E 1G9MH 1V7MH 5TDOB 3E6FB 4QRRD 4PB9H 15C8L 1RIVH 3IJSB 4IDLA 5E6YA 3E8UL 1KN2H 3TJHC 1SJHA 1EEUA 2W65B 2X4PA 4X6CF 5SWSB 1URLA 2XN9D 1U91B 3ZKQD 5IB5B 2CH8A 2HFGL 3VXRE 1A7NH 4O02L 1RUQH 4FTVB 1A6WL 3B9KA 1AE6L 5E7BA 3GI9H 3HZVA 5MEQB 4JFDB 4DN3L 4FTVD 4LSUH 2EO1A 4QHNB 3VWJD 3RI5K 1G7LA 3NZ8B 4M6ML 3GMLB 2APXA 3GJFH 4ZXBA 3GBLA 3S88L 3F7RA 4UQ3A 5D2LA 1FVDB 5D8JH 5DMJB 5FGCB 5JW3L 3I9GH 3SDXB 1DQQA 3SE8H 3C5SA 4PPTA 3V6ZA 1R0AH 1PG7X 1MIMH 4B5EA 3L3IA 4LQFH 2WP3T 1XF2A 1F90L 1CE6B 1P84K 4MZ2A 1JE6A 4OV6F 3QI9C 1PQZB 1H0DA 4NZUH 4XPBH 3TN0D 1MUJA 5F1IA 2AXGB 5L9DL 2NY6B 2EYSB 5AEAA 3SO3B 4FXGB 2HN7A 1YZZA 3MV7E 4OUUA 4WEUD 2DQFA 2YZ8A 5C0NC 4J23A 4YPGB 3Q5OA 1I9RL 4JLRB 5T3ZE 4U1IB 5F7EL 3CVIH 1FZMB 3U0PA 1KPVB 1A02N 4XXCA 2LE9A 4Z76A 1YY8B 2R2CA 5I18L 5JHDB 1KEML 2ARJQ 4MAYB 5D8JL 3O2DA 3IFNH 2VLKA 5F70A 1A22B 3LEYH 1CLCA 1EAJA 2DRUA 4PRID 1QBMH 3RVUD 3T65B 3MRIA 1KEGH 5GS3A 1R3JA 5KVDL 3AXLA 4XP1H 4FZ8H 3QDMB 3BKJH 4KKNA 4QGYA 5C0ND 2XZAL 3QIBB 4JO4L 4KROB 1MRFH 3PWUB 1YY9C 1NCDH 2NLJA 3B83A 4KZEH 1J05B 2KQMA 4F3FB 4YWGH 3MRCA 4URTB 1ORQA 3MUHL 4OGZA 3BW9A 3QZWB 4J12A 4ZAKA 5ETUA 3ARRA 5E5MA 2R15A 3RL1B 1NBVL 4G8FA 5HI5D 3VWKA 2UYLA 1NCUA 2Y06L 4I3SH 2VLJB 2ORBL 3UYRH 2OI9B 1YPZE 1V05A 1BM3H 1GC1H 4JQVC 5DMKB 3LS4L 1AGCA 3MNWB 1KJ3L 2FDBP 3MMEB 4HWBA 2JJWA 2OZ4A 1ZHLA 2D7MA 3LEYL 2WBWB 4M03A 1XR9B 1S7TB 2MPAH 3JV5A 3TIDA 2H6PB 2P5WE 4JPVL 43C9A 5AG8A 1U3HD 4P5KA 1WCBB 1RZGB 1I7UA 1TQBC 4X6CE 3V0VA 1P4BL 4E41B 4AQ1B 1GZPB 4LSSH 2JIXD 3ULVE 1EFQA 1OAYH 2VJXA 5DJXA 1B2WH 1Z5LB 3PWPD 5C0AE 4PS4H 2XPGA 4QNPF 5T3ZH 4QRPA 2DQUH 1Q94A 4Z5RB 5J3HD 3IDMA 1SYVB 4G8IB 4G6MH 1N0XL 4LAJH 4U4BA 4JM4L 1ZT4B 3SKJH 1RSFA 1S7WB 3G6AA 1FBIL 5I6XC 3LHPL 3I50L 4DTGL 4Q9CA 1NCTA 1ZLUK 4DZ8B 4TOYL 2B2XL 2VIRB 3HI6H 1KV3A 4QRPE 5HYJB 1KJ2H 1NJ9B 3GMMB 5ALBH 3W11C 2MFNA 3GMNA 1H3PH 2CLVB 5F96L 3P4OB 3X3FL 1IGCH 3FFDA 4OGAC 2XT1B 5JQHC 4ZUTB 1YA5A 4OLXH 1U8JB 2AXGA 1QLRA 5DJ0B 3MRKB 2Z9TA 3SE8L 3D2UB 3P0VL 3CMOH 1LHZA 2CQVA 3LKPB 4PGCA 1CL7H 3PDOA 5CILH 5AD0A 1FYTA 2BVQA 4L3EE 5E2TL 5GGVH 3WFCL 3ZYOA 4O2EB 4KVNH 4G7YH 4RISL 5IBTL 3MC0A 4OGYH 3PE9A 5DJDB 5HGDA 3BI9X 1X7QA 1NC4D 5D1XB 2X4NB 2BHYA 2DDQH 4AJ0A 3L3HA 5FIEA 2BC4B 3U9UB 5KVMC 3HLAB 3SGDI 2NY3D 3DX9B 2QQNH 1MCBA 5D1XD 3J8F7 3RWCB 3FOLB 4KTEH 5D5ME 3KLHD 2XWJB 4R4BB 4WW2C 3ZT6A 3IFNL 1KLGA 1WUNT 2ADIB 1FG2B 4ETQB 5JA9A 2QR0B 5E94B 3VI3F 5J1AB 3B3IA 4GXUM 3P9WB 5IHZA 2D7TL 3CFBA 1MRFL 3VG9B 3MOBL 1OQXA 4KK9C 2PYEE 1RJCA 1XCTB 2X89D 3EOTH 1UFUA 4V2BA 3RIFF 3RPIB 4MXQC 3HZKA 3V5KA 5IB2A 4P2RA 5FYJU 4HC1H 5ESAA 3RX8A 1SBSL 2DKUA 1YNLH 5ICXB 4H25A 3LVEA 3MXWH 4XPGL 3BHBA 1G9NC 4L4VE 1IAOA 3QXDB 5B39B 1DQDL 3CPLB 4KK8D 3MZTA 4FQ1L 3QFJB 4UZGA 4JREB 4P23A 3WSQL 3WLWD 4RGOL 3VA2C 2FJGA 3WFEL 3MMEA 1UXSA 4BH8B 2I5YH 4G8FB 5BXFB 3TT3L 3HG1D 2LFGA 3RVVC 4F15C 2ADGA 3EZJB 4H88H 4CL7A 4QRUB 1T03H 1VDGA 4F2MB 4P5MB 3B5HA 5F7MC 4KXZI 3LSOA 3ZDXF 5BVPL 1HEZA 3GI9L 4RGNE 3LD8B 1KPUB 4F37K 4NZDA 5EOQH 1ERNA 5JOEA 1AFVL 4P4KC 3HMWH 3P0GB 4OI9A 5DK2A 5LKNA 3MV8D 2EDYA 3WO3B 3TH2T 1BD2B 1TVHA 2ITCB 3EYQD 2OP4L 3VFVA 4KQ3H 5J6GA 1GL4B 1BP3B 1U41A 3IFOA 4YEFA 3P3YA 5F88B 3KPMB 3INUH 4P2QA 4GMSL 3ZL4L 3B43A 4LASH 3TC9A 5DJYA 5EG6C 3T0DA 1KUMA 5HVHC 2B1HL 2IBZY 3K2UH 1BQHA 4IHOB 2GIYA 4TSBL 1KB5A 1ZVSB 2FL5A 2EXWC 1QFWL 5CJXC 4H0IA 5C08E 3HUJE 1AGDB 1U8JA 4AEEA 3U7YH 4XZUB 3TBTA 5EORL 1JFQL 1YEEL 3MBEB 3UYOD 3S3PA 5D2LE 1F3DH 2B4CC 1G7LB 1NLDH 3NZ8A 1QFWI 3TV3L 4AIOA 4PV9B 5FYJL 1TZIB 1U42A 5LXGH 4HWUA 3IDXL 4FFZL 2D03H 5E2UL 4JHWH 3UTQA 1RJLB 4YIQB 4DFIA 4PRPD 5DEGB 5AZEH 2C1PB 5BV7C 2E5EA 4DGVL 2YUVA 3RY6C 4WI9A 3U2SA 1QO3B 3QUXB 5J9PB 1LMKA 4UV7H 1ES0B 1ZHNA 4QHUA 4ZQKB 4RSVA 4TVPD 5CZVL 2GK0B 5SWZA 1S7QB 2DQCL 3DMMA 2RCSL 3TYFB 4U1SB 8FABA 1KB9K 2HRPH 4OZIE 1CVSC 1EZVY 3IETA 4M02A 3B8YA 4BQCA 5CJBA 3O11A 4X5WA 3UTTE 1BIIA 4ZUVB 2MKLC 1IKFL 4CJ1A 5K9QI 1GOFA 4HQQH 4U1LB 1ZLSH 5FYJD 2IAMC 4GAGH 1IBGL 3CFCH 4RX4D 3NCJL 4Z95L 5T1DH 2Y6SD 4X6FB 1KPRA 4EIZC 3PP3H 2OK0H 3MYZA 3ARQA 3SDXF 4PJXE 3QQNA 1RUKL 5GHWL 2IH3B 3QWQB 5LXGL 1K5NA 1R5WB 3QUML 1QSVA 5GGVY 2A73B 2AK4D 4H26B 5MENA 1D5IL 4BA8A 4NGHH 3H9HA 2ZUQB 3MRBA 1CBVL 4DAGH 4YHKH 5C3LD 3QWRA 1WISA 2I5YL 4NN7B 1PYWA 3KYKL 2X09A 1LE5B 4XGZA 1QRKA 4NDMA 5DRNB 2YSSA 3ABZA 3PL6A 1FPTL 1TVDA 4NO3B 1JTOA 5HYIA 3ZHKA 1CIDA 5GZND 2FJHB 4RMUA 4AL8L 2BNRA 1UG9A 2IAMD 3RZCA 1TTUA 5KVGH 4OJFH 1S5HA 5HHVL 5EU6A 3FO2B 2BNUA 3O6ML 4PUBL 1C5DB 4Y16B 5JR1H 2BY0A 5HHNB 2ICEB 4GXVH 3MV7D 4Y88A 2DQTL 5FF6B 2OBGA 2J88L 4XNQA 5E8OA 2Z8VC 4X7FC 1QVOA 3GK8L 3VD5A 1T04A 4YDVB 1FO0B 5BO1L 4QXWA 4X6EB 2EYRB 2XZCL 1Q1JH 2OL3B 2WWMC 2EE9A 3FMGL 3GJFA 2W9EL 3SDYL 4K2UL 5DSCA 4KJPD 4QF1B 3F5WA 3KYKH 5EO9A 3CLFL 1T5XA 1NDMB 5KSAA 5D7JB 1S9VA 1TQCC 2XN9B 3P11L 2NX5E 4F7TA 4YLQT 5JMRA 4Z7UE 1KCRH 1Z3GL 2G75B 2CIKA 5FA3A 2ILLA 1JZ6A 3MRQA 2X1XR 4QXUL 4K9EH 2AJVH 3VFRB 5KG9A 4PG2C 4K94H 3ULVH 1JTTA 2ZUVA 1Z9MA 5J13B 1JF6A 5DUPL 1X6NA 4F33B 3L3JA 1J10A 1GHFH 2VISB 1KYOJ 2R1WA 2X4SA 2FSEB 4KI5C 4PJIE 4NZRL 1UWGH 2I9TB 3I3DA 4CJ0A 2E7MA 4NUJA 4CW1A 4F9PA 4OM0H 5DK0A 1Q0YL 4DGVH 3RX5A 4HK3N 3N50A 2DYPD 5SX4H 3VGHA 1EO8L 4I2XE 2IFGA 2XNAB 2HKFH 3D85B 4MA1C 4YHZL 3C6SA 5CFHA 5IW3A 4JFQA 2V6HA 4NQXA 4NQDB 1KCKA 3HI6L 3S36X 4YX2H 1PW3A 1S3KH 1C5CL 3MO1A 1VGEH 3W82A 5D71L 2BZDA 5JIPA 1M05B 3K0WA 4PJ9C 3GSNB 3CVHH 1NQBA 3HE7C 4KAQH 3D0VA 1FFQA 2O5XH 1VCAA 1NAMA 5DYOA 2OI9C 5AYUL 5HPMA 4C4KO 1WITA 2VDNL 3VE0B 5FK9A 4ELMB 3HA0A 2NMSA 4F7EB 2VDRH 4LRIA 1BX2A 4NQCB 4RA0C 4I0PC 4BUHA 4BZ2H 3LAFA 4P46B 1HILB 3W81A 1TQBB 1FFPA 2GAZB 4QYOB 3IVKB 1T7WA 1I1RA 1RZJH 1BM3L 1YMMD 2MJWA 2XICA 4NJAH 4ZFFA 1JPTL 2BVPB 2AQ2A 3MRRA 2BNRB 3EDJA 3U9PL 1I9JH 1T0MB 3ESUF 2IFFH 2NPLX 5D1ZC 1EV2E 3C08H 3SGJA 3E8UH 1F13A 5DRWB 1ZEAL 1W72L 3DRTB 5DD5H 2WLZA 2MNUA 3BZFB 2N1KA 3QO0B 5MEQA 4LPTA 1MPAL 1FNLA 3HI5L 1UXWA 4ZS7L 3SDCD 2VDML 4BZ1H 2FEDD 1LO4L 3QZWG 3QCUH 1BFTA 2GY5A 3I85A 3QFJA 4LCWD 3CFJA 1KXVC 4YDLC 3X14B 1NCBH 3GHBH 1FBIH 2WWKO 3CDGB 1UA6H 1QVOB 4S1QH 1NUGA 2Q8BH 5DMIH 3DMMD 5J89A 1FZJB 1MFBL 2Z91B 4X6EA 1WWCA 2H32H 3SO5A 3ULUL 3SE3A 3WSQH 3RGVB 4P2OD 1N8ZB 1G1CA 3U46A 4OZFH 1NSNL 2EC9U 3RWFB 1W72H 5DD5L 3O6KH 3DX7B 1OGAD 3MV9E 4JANB 4LCCB 1WWBX 3AU1B 4APQB 4CVZB 4EI5C 2Z8WC 3MV11 2NTFA 4R6UA 4Z7NE 1LO0L 3U82B 4FFVC 4YXKH 2GJJA 1P2CB 4PJFB 3F12B 1L6ZA 4Q7DA 5GGUA 3LV3A 4JDZA 1XGTB 2NY3C 3EJYD 1A6ZA 3DMMC 2PR4H 4TTDD 3CZFA 3UEZA 1NFIA 4QNPE 3GO1L 4XVSH 4PG2A 5EU7C 3VXUE 4JQIL 4CMHB 2X4TA 3T4YB 4X4YA 4PBVC 1R5IB 1LP9A 3BE1L 1UKSA 1F97A 2R4RL 2J12B 3BD5A 3BPLB 1G9NL 5C0EA 2EDTA 4CNIA 5B21A 2R0LL 4FFVD 5EC1A 3WIHH 4Q74A 4P2QD 3RVXD 5DMGC 4KZEL 1B0GA 1AP2B 1X5IA 4EIGB 1WAAF 3T1FB 5ITBH 4X6DE 5F3BB 2ARWA 4JFYA 4ZSOE 2EH8L 1FIGH 4ZS6C 2P5ED 3MROB 1CLYL 4JO3L 4XBEL 1N3NB 4HEPG 3CMGA 2PTVA 5E9DD 4J3OC 1I1FB 2EIEA 3C8KB 4HKZB 3LQZA 3FZUD 5EA0L 2ADJB 4L4TD 4YZFF 2ICWB 4DJMA 1NAML 1FE8L 1A7RH 1FDLH 1NL0L 1X5AA 3SKMA 5I1KL 2C1PA 4JFFE 1DBKH 1UWEL 2BVOA 2IBZX 4JVPA 3WXWL 4GG6E 3FB8B 3FCTA 3GSVA 3RRQA 5J9PA 4JKPH 5C0IB 3S35X 5EOTB 2YD4A 4Y16C 1F4HA 2HT2C 3FQTA 3ARWA 4UIKH 4RIRB 2K1MA 4GRLB 5DJXB 1KXQE 3LHPH 1FJ1B 2ZUXA 3ZE2E 2R2HB 2AXFA 4IMKC 2RGSA 1ZS8A 3MR9B 3HUJA 3P11H 4MX7B 3BUYA 4QHMA 4JFDE 3GSNL 4YEEA 3UTSE 4YHLH 5J11C 4NQDE 2F8OA 1BGXL 3GSUA 3BH9B 4FNLL 3V4VH 1HYRC 5FECB 4H1LA 1U8PA 2P4AB 4D0BB 5TQ0H 2Z93A 1X5JA 3MYJB 2CDGA 1GAFL 3Q6FA 4XPHL 3MNZA 5AUMA 3QCUL 2OTPA 3MBXH 1IGFH 4PRPE 2G9HA 3EAKA 3MODL 2DQJH 2YPLB 3PNWB 3QQ9C 1LO5B 4WFED 3HKFA 4WEMB 4BSVA 1Q8MA 3EYOB 4Z7VB 1Q0YH 1FFNB 1BJ1H 1U2CA 1YYMH 4HPYH 3BPCB 3X11B 1KB5H 3OG6B 3VD9A 4YGVA 2J2ZA 2QADD 3WS3B 2ZG1A 1A3LL 4LARH 4X5LA 4AK1A 4XWGH 1I85C 1YEKL 2EEDA 1RK1B 3BGFB 4C56A 5T1MA 4PYGA 2MMXA 4MHHI 2A2QT 2YN5A 4GXVL 3VH8A 4OZHB 1N6UA 2MWCA 3AS1A 3FFCE 4JY4B 4ZO7A 5T1LA 2VLRA 1G6RL 3OKLB 1K6QH 4L4TE 1IAIH 3TBVA 1NGQL 5LQBH 3RY6A 5EZIH 5FO7A 2ZPKH 5ERWA 3OL2A 3CSGA 1Q9WA 6FABH 1P5VA 1RIUL 4KKCD 3QDJE 4WV1B 4ODVL 5GRUH 3ARBC 3HZYA 3LY6A 4ZPTA 1A64A 3GMMA 4ZFGL 3LKOA 3DROA 3C09C 3BHBB 5J1TC 5C2BH 4UAOC 2WW8A 4NN5B 1S7VA 1E27B 5C07A 5DXWA 2M26A 4N8CH 3P4MB 1XAUA 1OLLA 3RZWA 5IMMA 4NRZA 3FFCA 5JMOC 5DJAA 2N4IA 1GGYA 2PXYA 2IF7A 3LKQA 5CD3B 1KT2B 3ARDB 5EO0A 3KNBB 3L5IA 4WTWA 3U9UA 2X10A 5E70A 3PIQA 1QFPA 1RZFL 3FOLA 3IFLL 4MNQD 3P40A 2BNQB 1S78D 4J1UB 1VFAA 5L8LB 2YBRB 3HG1E 1VFUA 3L1OL 1BEYL 5C6TL 1MCPH 3QG6B 1MIEL 1E4WL 2FEEL 2OSLA 1NCAH 1M05A 3NABH 3WHE0 1OAXH 3KPPA 5ITFA 5JIHA 1DQLH 1EGJH 1IT9L 3GGWA 3NIFF 4RGND 3U0WH 1CS6A 1WAAE 1MHEB 1T1YA 5F89B 3BVNB 1OGTB 2VLRE 3QHFH 4UT6L 5E8DH 3GMRA 3QJFA 3IU3A 4B7IA 5C92A 5JXAL 5C9KA 1H15B 1PAMA 5DR5L 3VJ6B 3WJJA 1E4XL 5DD3H 5IESL 4O51B 4A6YA 1IE5A 5D7JC 4ODBD 4TRPH 1SJEB 1N5AB 1E4JA 1FLTX 2D7OA 5DTFB 5KOVC 3ZTNH 2HTKD 4XRCA 3ARXA 1CGVA 2VO5A 1ORSA 2FR4B 1BF8A 4HBCH 2DIAA 2DMCA 4TUOA 3SGEH 3OSKA 5ICYB 4ONGH 4XHJD 1N26A 1DQML 1FFRA 2G60L 4YHYC 3JWOH 1HXYA 5CIPA 1T3FA 1IGFL 2VLKD 2VITB 5HYJE 4M62H 5CMAA 4Y4FA 1U93B 3EYFB 2D03L 4LEXL 3STLB 3N9GH 2OTWB 2FJFA 1DBMH 1TETH 2WUBH 3SY0A 4WO4C 5HHXH 3W9EB 2QADB 4K55A 4KKBC 5CJQL 5EORH 3UC0H 4R7DA 3IB4A 2EH7L 4GQ9L 4CMMB 4IBLT 4WFHD 3VFWA 2VL5B 1AR2A 1CGUA 2CK0H 2ZSWA 1V3KA 5IMKA 2X44D 3P9MB 4R7NB 4XNXL 5CP3A 3WUWG 1U8OA 1KFAL 1AY1L 5I8OL 1PEWA 4TSAL 4JZJA 4JVUA 2R1YA 1OY3B 1T6VN 3SPVA 1QFWM 1T66D 3S36H 4UOW0 1EFXA 4UNTA 1U58B 2XWBB 3TA3B 3TFKC 1TZHA 2XXMB 1CFNA 1UH3A 3NZHH 5ACMA 1UA6L 4S1QL 2WM0A 2BNRD 2I9LB 1S7XA 2IAMA 4D94A 5JOFB 3RTQC 3HNTH 2W0FA 2BFVL 4KQ3L 1NDGB 2OQJA 2EKJA 1S9YB 4HZLB 1I3VA 1WQVT 1CDBA 1DFBH 3CVHA 4MXWH 4AZ8A 4NM4H 3PQYB 2HFEB 5F97E 4M93C 1JNHB 1NAMH 1QEWA 5EWIH 1Q72L 5K9KB 1T21B 2K9UA 2VXSH 4LIQL 2ZOLA 2W92A 2AEPL 2DJSA 1PZ5A 4QHLA 4PS4L 4LBEB 5MEND 4MAUL 4W4NA 3B9KD 4NCC2 4KI1A 3DUUB 4GG6B 3UJJH 5I1JL 2IQAB 4GLRH 2N56A 3P2TA 3PWJA 4XMLL 3K2UL 4YHLL 4KTEL 5CBAA 1RZ8A 2XY2A 1K8DB 1RVFH 4XPFL 3DV6A 4F57L 1OAKL 4JPVH 4H0GA 3I84A 4OQ1A 1MF2H 4OF3A 2VQ1A 1K85A 4YXLH 3DPBA 1QQDA 2ZCKH 3GIZH 4OI8A 1Y6KR 5CD3A 4YPGA 1LE9A 1GOGA 5JDSA 4G5ZH 1KT2A 4ZNCD 3V5HA 1BAFL 1FC1A 4RGNB 1B0WA 1IAIM 3FT3A 2ITDB 2FIKB 3RBGA 1X5LA 3GDBA 1C08B 3U0PB 1UM6H 3E3QC 1DP0A 3EO1A 5K9OB 2R0LH 1F00I 4Z78B 4P9ML 1I9JL 2RHEA 1NAKH 1J1PH 4XPAH 2CRIA 1LNUB 1CG9B 2CXGA 4D3CH 4XPGH 3L3OB 5EIQA 3VXMA 4EDXB 5JXAH 5CILL 4JZOA 1FIGL 2W9LA 1IQWL 5JUEL 4P23C 1MHEA 3DVIA 5KW9H 1B0RA 1OD7A 3WFDL 2QQQA 1CN4A 2LU4A 5HDBF 4HWEL 4NP4L 2KUTA 4WHYH 4JRYA 2E27H 1K5NB 5E4EC 1KPRB 1GYAA 3HMWL 4HW6A 1VEPA 2IALB 1K2DA 4KDTC 5FFLA 4PJDA 1HOCB 4OB5L 4LGSB 5IB5A 5CIPB 4OZFA 1FN4B 1HI6B 2R2BA 1IM9B 5DMIL 4JY6A 5BVPH 1U92B 1L7TH 5DT1H 1CI5A 3MR9A 4MVBC 3KXFD 1HHKB 1ZHBA 4H5SA 3ZT5A 4XP6L 4JZNB 2RFXA 5E2WL 2O61B 2FD6H 5CP7A 3UPRA 1EHAA 4X7SL 5IR1B 3H9SA 3C2AL 2YKLL 1KACB 1XF4A 1YEGH 3TIEA 5I19L 3H9ZA 5J13C 43C9B 2HLFC 4G80A 4KHXL 4PBWD 2FYYB 3A67H 3QCTH 3VFTB 4QT5B 5HY9B 2WNGA 2BVTA 2FO4B 4XNXH 1NC2A 5FF6A 1IGJA 4YC2B 3NACH 5GGRY 4IRJA 2LAGB 2EDJA 3TEUA 4W6YB 1J0HA 1BQLL 4PJGB 4ZAKC 3BP7B 3AREB 5INDB 1IAII 4TPRL 3WIHA 1AD9B 3O9WD 5D2NE 1NDGA 1LK2A 1S9VB 4M3KB 4K23L 3PWNB 4OUOA 2XYCA 1KTKE 3WIHL 1CFNB 4S1RH 2ADFH 1U3HB 3QHZL 3KPRB 2C4FU 5EDXA 5C71A 3L7FA 5FOJA 3HNVH 2FECL 4X5XA 3PGDB 3WEXB 3QXDA 5IFAL 4PP1C 5EOCH 3L95A 2DQEH 4UTBL 4XCCH 3DXAA 3F7VA 5KSVA 1ZEAH 2PTTB 4R4FH 2F5BL 1O7VA 1ZTXL 4U0RC 3QUMB 4PJBB 1ZLVK 3V6OC 5C0JB 5ELIA 5IIEA 4U6HA 3OWEA 4MJID 1S7RA 3W9DA 1E4XH 9CGTA 4JKKA 5SX4I 4IRSB 5HGAB 4K94C 2VSDA 1Q9KA 1F42A 5FYKE 4UQ2A 3NFPA 3H0TB 2AQ3A 3IRPX 4PRAB 4X7CC 2D0GA 4PRHD 3CCHA 4ZG1A 1IGYB 1K8IB 4XP1L 5E08H 4JHZA 4OCWL 1EXUA 4TNWF 3LRGA 1HEZB 4K07A 2H1PL 1FVCB 4QTIH 4Y5YB 2DBJA 5BVJA 4H1LG 5D72H 2VH5L 5I75C 3T3ME 4X6CA 1J88A 4H8WH 4U1KA 1RY7B 3U6RB 5GGQL 4OD2B 4QRRE 2YEZB 4M6MH 5IMOB 1X5ZA 2F53D 2WQRA 3LQAC 3ULUE 1FP5A 3D2UD 1J1XL 1I1YA 1GZPA 2A6KB 2X41A 4DQOH 4E5XB 1F4AA 3QQ9D 5LGJB 4QCIB 4OZIA 5IFJA 4MCYA 4UV4H 4KY1L 4Z7UB 2J88H 2V2WA 2VDNH 5IUSA 5TPWH 1FN4A 1HI6A 2R2BB 2B5IC 1NC4B 3T1WA 3CX5J 1UQSB 2GCYA 2KQNA 1QLFB 2XTJC 3G5VB 5FYLL 3OJ2C 2V9TA 3MJ6A 2IJ0C 4FHBD 3RDTA 1P7QD 3O6FB 3QDGA 3CDCA 1NLDL 1SJVA 2CRMA 4YE4L 4DK6A 2OL3L 3QEQB 2B8OT 4TSCH 3MRRB 2GSIB 3MLTB 3RWGB 5HYJA 1LEKB 1WC7A 4AH2A 1VEOA 2YKLH 4MA7H 4ODXB 2P49B 4FQXD 4N90E 3OAZH 2FYYA 4HV8A 2HVJB 2C1OA 1IVLA 5TDNB 3S36L 1I7RA 4Y5XB 1Q9LB 4K8RL 1RURH 3AAZB 1T7XA 1MVUA 3SE9L 4C54A 1KPUA 5I9QC 4TUOB 4O5LL 1U6AL 5EPMA 3ARBB 5EU6E 1AH1A 4PJIB 3EO0B 5C7XL 4G6FD 2R23B 3KYNB 3CFJB 3BPNB 1FG9C 3NPSB 4O2EA 3MJ9L 5CUSL 5IVXB 4WI7A 2UZYB 3KXFA 1JZ8A 1AR1C 2B4CH 4G9FE 1CZ8H 4ZNEE 5MI0C 3I3EA 5AD0B 5ESQA 2MPAL 4ODVH 5GRUL 4XTRD 3KPMA 1WICA 4KK9D 1VACB 4L3ED 1YNTB 4S1SH 5FB8A 1W2KT 1UJ3A 4LGPB 4UUJB 3DO3A 4X6DF 1ZLSL 4KJYA 4BELD 1JWMB 1QBLH 1PG7L 1TMCB 1ONQB 4HJGA 1F90H 1JWSB 1D6EA 4Z7WE 3RIAK 1BECA 2IANE 3NIGE 1TVBA 2V17H 3VD7A 4XVTL 2F74A 2JCCE 4D9LH 3RPIA 3OKMB 5GGTH 1HXMB 1D5XB 1V3JA 4HF5L 3MGOA 5IROC 5JIKA 4JRXB 4MAYD 2ED8A 1CDIA 4GG6F 1NBZA 1MI5B 3PWVB 1Q9KB 5HTSA 3QPXH 4FQ2L 3H0TA 3LKNA 1L0XA 1EDQA 1LO3H 4OJFL 4OZ4A 3ZYZA 4HIJA 5E99H 5D7KD 5I1IH 4JQXA 5DT1L 4G8GB 5EC1B 2NXYD 4PTUB 1H3XA 2MHAA 1WAAA 1R3KB 3GJFK 3VFMB 4PB0L 3CPLA 3BKYH 1DN0B 3CSYA 4QKXB 3BSZH 3NH7L 5D70H 3SDCA 3H3PH 1ZA6B 1HSAA 3UBXA 3S37L 2EDQA 4YFDB 4HUXA 3U6RA 2V17L 1XZ0B 3LKPA 2L0DA 5DD3L 4LVOC 3EYVA 2D7QA 2VLLA 4XX1G 1F8TL 2GTWA 3EYUH 4XP9H 3MUY1 1YN6B 3MRPB 3KPOB 2GITB 1NKOA 3JV6A 3MXVH 5J12B 1EO8H 1HQ4B 1JPFB 5CIPH 4Y8AA 5INCA 2L7UA 1J8HA 3QQ3B 4UT7L 3QEQD 2NXYC 1NMBL 1OSZA 3RFZC 3SE4C 3PHSA 3GB7B 4NJ9L 1MJ7L 1SY6H 3O3DA 4OD1L 4PJ5D 2ARJA 2EXWD 3BWAA 2AJXL 5MERB 4RISH 4JZOB 4MYWB 2P5EE 1ACYH 3BGFC 3TPUB 3DVGA 3UAJD 3PL6B 1MCJA 3WBDA 5I15H 3V0WH 3B3IB 1KYOK 1Q9OA 3DUSA 2ZG2A 1T1WA 3ARVA 5I0ZA 3P0VH 4FTVA 3RWEB 1RZKL 3GJEA 3OBAA 4WJ5B 1RJZB 4U49A 1YJDL 4R26H 2AJZB 3EUUA 2IALA 4LMQE 1IGIH 2Y5TB 4JM2C 1AE6H 2M2DA 2FX8L 3DX6B 4P59L 4IJ3B 4XC3L 1XCQB 3N85L 4D0CB 3KDMA 3AY4C 1WFUA 2BERA 4QRSB 5I30L 1QD0A 4X6DB 3ZL4H 1KCSL 3BH8A 3G6JB 3K46A 2DBLL 3WFEH 1SEBA 4L5FH 3UTSA 5HYEA 3RWDB 2LVCA 1XF2B 4MJ2A 4N9GA 3WD5H 5ESQB 5MEOB 1ACZA 2MQ0A 3HI1B 1N59B 4K71B 3SDXA 1CTOA 1YNTA 1ZTXH 1UACH 1UZ8A 2QEJA 3MXWL 4PJBE 4OUUB 2DQUL 2OYPA 3PXJA 1PQZA 4LPVA 4J4PD 1YEKH 3TO4C 5DLML 5I71B 1ZLWK 2BRQA 4LHUG 4XNUH 3UO1H 3D25B 3GSOB 1NGYA 3UTQB 4RFEA 3HE6A 3QEQE 5ID1B 1NH6A 4JO2L 4PJ7A 1MI5D 3QDMA 1NEZB 3CSPA 4QRQB 5E5RB 1IJ9A 4MA8H 5FCUL 4GKSA 1MLBA 2NCMA 3MRCB 2E7LC 3T65A 4WW2B 5I8EA 3FT2B 4G8GD 1FNSH 3ESVF 3LIZH 2FEEI 3B9KB 1TZGL 2XA8L 3TZVD 4NN6B 4WUUE 4RAUB 4RWYL 8CGTA 1EO5A 4CDGC 1WFOA 5D7SL 3PGDA 5DD1L 2VXTL 3QJHA 4NNYA 1JPGB 4LKXA 1M71B 2GKIA 4JFOA 3R0NA 4HIJB 2OP4H 2IMNA 3GMOB 3FFCB 3W39B 4LSTH 4QOKD 1OARL 1KXTB 3WNKA 1QACA 2HAZA 2WWMD 4KU1A 2YUZA 1AGBA 5FUCC 1MFEH 3OG4B 1T20B 4HGWA 4UOJA 1YECH 2ZUWA 1MUJB 4OZGF 5F1IB 1MQ8A 1KIRB 5MP6L 5F44A 1MRDL 3K3QA 1TJHH 3MCG1 4JB9L 1A6AA 1YNLL 4Y4KB 2GJZB 2HKHH 5FDWA 2A83B 1WIPA 4NWTL 4RMVA 1MELA 3WNNA 5IVXF 4XP5H 1IQDA 2D4DA 1YN6A 3MRPA 3IF1A 4F9PC 1EBPA 3KPPB 5A16B 3FQUB 1I3RA 5IQ9A 1DQLL 1Z0NA 1CICC 4CUCA 5EO1B 3HR6A 3RL2A 1LO0H 1T04B 4M6NH 1XMWA 1NDMA 2V2TA 1NLBL 4TOYH 3BPNC 5B22A 2R1YB 1RJZA 1CD1B 1NCCL 4P9HH 5EULV 1EHLH 1BIIB 4FQIH 2IPUG 4M8QA 2HH0H 4G9FD 4K8RD 3TBWB 2V5TA 2X4QB 3OXSB 1JUFB 3I02A 1CLYH 4EN3C 4Q9QH 1I1CA 2BDNL 1T21A 1SM3L 4L4TB 43CAB 4HKBB 1M1SA 2OZ4H 1LP9F 3MRNB 2FR4A 4L9DA 5IWLA 3UYRL 4MWFA 3ZLQC 2R1WB 1MF2L 4X4ZA 1W0VB 3C60B 1RZKC 1DVFA 3MRDB 5ICYA 3AC0A 1GZQB 4XNZB 5T5FL 4NZTH 1VSCA 2CMRL 35C8L 4PRPA 5IBTH 1U3YA 5AAMA 3WFZA 1IEAB 1NSNH 4HIIB 3HR5B 3C6LB 4X99B 5D1QD 4L1DA 4WU5A 3VCLA 3PQYD 4NHUA 4WEBL 3BO8A 1IKNA 5D4QA 4F58H 3OPZH 5CD5D 2AW2A 4LPCA 1GGBH 1FGVL 3AU1A 5EU5A 3T08A 3V6BR 5KN5B 4W68A 1MCNA 3JTSB 1O0VA 3BIKA 4DKDC 2BSSB 2E7LA 1N0XH 2CR6A 3BUTA 1CXFA 1MLBB 4G6ML 5A3IC 4YHZH 1FZKB 5I8EB 2BNQE 1NBVH 5ESAB 4OLUH 5I1GH 5H37G 2ATPA 3B9DA 5BZWB 4I3SL 4NNXA 5CEZH 4H25B 2HVKB 3G6DL 5C0CA 2YD5A 3UPAA 4FQHB 2EXYD 4QOKB 3VFGL 4FQXB 4FMKA 2XIDA 1C12A 4Q58C 4KVCH 3IDGA 4N90D 1YEFH 3UTZA 4X98B 1QNZH 5SX5H 5SWQB 3MNZB 5AUMB 2VRAA 3QA3A 3IJHB 5DD6B 2KL6A 4BJLA 4UU9A 1INDH 4PJ7E 4BZ2L 4QRUA 1BVLB 3ULSB 2VYRE 4NC1E 1T2XA 2D7PA 1KTRL 5KSAC 3RDTD 2ZUQC 3S3JA 1IQDB 1KEMH 2FSEA 5HI3D 3TH4T 4LCUB 2FD6L 4N0RA 4DUXA 1OHQA 2C3VA 2E7BA 1UM6L 2ADGB 5KSBA 1I4FA 5K9OA 4C4KT 3ULVL 4GAYA 1A3RL 4RIRA 5ALBL 4IEFB 1FH5L 5E2TH 3EO1B 4OSUL 4F7CB 1NLBH 2IADB 3WFHA 5DMKA 4KAQL 4LCWE 5FXCH 3BX7C 2NY3B 4HC1A 4GSDH 4WO4A 3MFFA 5D7IE 3PF2A 4K9EL 4G43B 2FX9H 5FHAL 4OLXL 3EOTL 2DIJA 3RDTC 4JM2A 5IHZB 2YD2A 4MMXC 1HHIA 3G9AB 4OGXH 2OS7A 4AT6B 5EBGA 2W65A 3OJVC 5CEZD 1HZHL 4FG6C 3QQ3A 1BD2A 1TVHB 5AWNL 5HYSG 2LU7A 1UACL 4OV5B 4JANA 3FO9A 2EDOA 3QDJD 2E27L 1ROWA 1DVFB 1NMAH 5DI8A 4EI6B 4FZEL 3BWAB 2AKRB 5D1QB 5T3XL 2D4FA 3C09B 5FKAA 1KENH 1ZVSA 2DQTH 4PJBA 2NX5B 2FZ3A 3SKNB 1KIUA 1T0NB 3MLWL 5CP7B 3MUGA 5EU5B 4TUKH 3OTTA 1J11A 3O2WH 5TQ2H 3F58L 5L2KD 1UXWB 1FNSL 4JM2F 5FYKL 4L8CB 4Q6IC 1TZGH 4MJ5A 1G7QB 1Z9OA 1CQYA 3S5LB 4M1GH 5DK3A 3IFPA 3HUJF 1LEGA 4NC0B 3KWWA 1HHGB 2HLAB 2H26A 4PD4K 2YA1A 2ICWJ 2FECI 3MRFA 2FHBA 4P46C 4PJBF 3MROA 2NY5H 3U7AA 4HWNA 1XF5A 3WJLC 4I13B 1UM4H 3BDBA 5B4MD 3V4UH 3UJJL 2XG4A 1RUKH 2Y9RT 3DGGA 4KDWA 5I1DB 1JI1A 5C09A 4Y89A 1S7SA 3I6KA 3U4AA 2ATPB 2W9DL 3BQUC 3QUZA 3TVMC 2VDLH 4R4BA 3ZKXC 1BZ7A 1Q0XL 4OAWA 2OJZL 5FGCE 5LJYH 4JRXD 1RK0A 3X17A 4QOKA 4HK0B 4G6JH 3B9VA 5L6YL 1QRNA 4JJ5A 5J6HA 3MLZL 3MRLA 2JIXA 5SWQA 4P46D 3QIWC 4OIIL 4P48A 1F6LL 3RQ3A 4F9LA 3QEUA 4H20H 4JDVA 1N4XH 5DRNA 4UQ2B 5E8PB 4MD4B 4YHKL 5KANG 4PJCB 1ZS8B 3NFNA 3OMZA 4U6XA 2AJ3A 4EDWH 2GSGA 5K59F 2CD0A 3FN0H 4XPHH 1G9MC 3CLEH 1KF9B 4MD5B 1NCAL 4Y5XA 4RAHA 4PV8A 3AAZA 1A0QL 2QKIA 4AG4H 1F45A 1LO5A 3GZKA 4JEGB 4N68A 4X6CB 3TA3D 3WLWC 3ZE0E 2NW2A 5JHDE 4OCXL 3ZDXE 3VXSE 4LAQH 3M17B 2AEIT 4Y5XC 1NUDA 5CSBA 2BSTA 2LVEA 2QTEA 4XXDA 1AGFA 1LO2H 1HWGB 4LRNH 1AI1H 3AGVA 4I4WB 5BRZB 4PRDA 4YHOH 2CR3A 4QXTA 1RZKH 5BZDA 2XWBA 2XQBL 4M9OA 3HC0A 3MRQB 4W81A 3KPRE 3VXUB 1S7WA 4R96B 3MJ7B 1U8IB 4KKCC 5F7DB 1FLRH 3WKML 4UNVA 3RNKA 3ZE1E 1MCOL 2PYFA 5DO2C 5FGBC 3G5VA 1U3ZA 1ZKAA 2EIZA 4I3GA 3SEPA 4EXKA 2PO6A 3E2HC 5JHDA 4WNQB 4X9HA 4LHUA 1ZGLM 3KHQA 4DGYL 3WV0A 1WWWX 2F9BT 5DVOA 1B6DA 3GSQB 1Z6JT 1F6AB 2XZZA 4FS0A 5GJSH 5CEXA 2X4SB 3QUMH 1R24A 2RIKA 4OM1H 3ZT7A 1J05A 1OAZH 1MLCA 1WEJH 1PKQA 1OWWA 3T2NH 4DKFH 5KSUB 4M7KL 3I9GL 2V7HB 1G7MA 3V6ZB 1KIPB 1MCKA 2B1AH 3CFCL 5F9AC 3DETC 4R4NC 1S78C 4D9RE 1AGEB 4KMTH 3D69A 4OD3H 1G1YA 4HH9B 1LO3L 3KPQB 4HEME 5DEFB 3QG7L 4U6YB 1EFXD 4JR9H 5HPMB 4YUEH 3MV7B 5AYQA 1I9IH 4WU5B 1ETZA 2Z35A 4LIQE 3BKML 3NCFB 1Z9LA 4N0UE 3EYOA 2FCBA 4DGYH 5DD1H 2AK4A 4TUJB 3U4BH 4KMQA 5KSAB 1H3UA 5FK9B 2DLFH 3DLQR 2CIIB 3MLUH 3HS0A 2VXUL 1KPVA 1I3GH 3GSXB 4RX4A 5CZVH 3EYSH 1LDPH 3ROLA 2W0LA 2PO6D 2F53E 3V0WL 1FZKA 3TT3H 4JDVB 1MEXL 2I60H 4N8PA 5E00B 5FYJE 3MRJA 1MREH 4P2RE 4PY8I 2P43B 3S34H 1RZ8B 1WGOA 4XHJC 4F37F 3REWA 3GRWL 1V8HA 2JJSA 3ZMRA 5CEZL 4X8XA 4EDWL 5FKPB 2WBKA 4MDIA 3IXTB 1BVZA 4ZUWB 4HX1B 4MLSA 5FHBH 1DR9A 3RL1A 5HGBA 3PP4H 1I9EA 1BVKB 4ZS7H 5FGBA 3D0LA 5C0DA 3T0AA 25C8H 5F1OB 1RIHL 2VXUH 3GSRB 3ILQD 4JPWH 3U46B 1CG9A 5GHWH 5IBLC 2OTWA 1XZ0A 4G3YL 2W07A 2PYEB 3AREC 4R0LB 3GEWB 1FZJA 1DJSA 3HI1A 4L3EA 1DEDA 4ELKA 4WCYL 3LB6C 2HG5B 1TPXB 2DJ4A 2J3SA 2XV6B 1NEZG 2G5BA 3RWFA 5FUZL 1ZGLP 4K23H 2DM3A 4FFYL 1J1OH 1MIEH 2EIZB 4R7DB 4QRPB 2EC9T 1R3HB 2EYRA 4HLZH 4RFEB 3FO1A 1X3DA 4OLYL 3LN4B 4JAMA 2G2RB 4MLIA 2FLRT 4P57A 5EO9B 5IBUB 1C5BL 5FM8A 2PW1B 4QLRA 3TZVC 3S35H 3VXPA 1KSRA 1MJ7H 3DJ9A 1U6AH 5DC0A 3TN0B 3DVGB 2DLEA 4Y7MA 5F7NC 3QUZD 2IBBA 1WIOA 3HPJB 4JDTH 4XCNA 2J8HA 4PJFE 3DO7A 3SKJL 2AJYL 1JFQH 2A77L 1X4YA 3L6FB 3HZMA 1D6VL 2Q3ZA 2C9AA 3RVWD 1NGZB 3O2DL 3NCBB 3QJHB 4P2YA 3V52L 4DKEH 4LVNC 3BGMB 1T83A 2VIRA 1N5AA 3RAJL 4LKXB 4NBZB 4Y1AE 1GGCL 4RWHA 1YUHB 2MQCA 2F58H 2R1XA 1Q0XH 3GMOA 3QPQC 4ZUSA 4EVNA 1H3PL 4NSKA 4ZXBC 2DAVA 4HG4K 3QUZC 4ZPVB 4PRIB 1LE9B 4PJFF 4PGJA 1IARB 5CJ8A 4KRPC 5D2NA 5GGRA 2ZUUA 5BRZE 1B88A 4R97C 3D2UA 1C08A 1P7QB 4PJ7F 5GS1C 1SVCP 2BY1A 1IAMA 3W9EA 1JPSH 1OP5H 3KS0H 2A38A 4KRNA 1J86A 2HT4C 5C7XH 5GS0H 3LS5H 3U0TB 3OKNA 2D0FA 3N1PC 1ZWIB 2BVOB 4GKSB 3X13B 4L1HA 1MFNA 3AUVA 4GXUN 5HYFA 1X5XA 2XA8H 4M7ZC 1RZ7L 4HXBL 4EJ1C 2WANA 4FXKA 2Z93B 1QSEB 1QFUH 4DK3A 3I2CH 3V5DB 3AM8A 3LDBC 1OT2A 1A6WH 2QHRH 2YUXA 5EB9A 3HCVB 3PP4L 5D9SB 4PJAB 1K9TA 1U8PB 1CK0L 3IVKA 5C0DB 2AVGA 1FH5H 2HH0L 5L6YH 3RKPA 5KBNC 5DUBA 2WINB 1P6FA 3DUHA 1BQHB 5DHXB 1YPZA 4M8VA 4HKBA 4PLKD 5EBLA 4ALAL 3KYNA 1B9ZA 1U8HA 3OHXB 5D1QC 4N5UA 2ZKHH 4JFZL 1HHHB 4X7SH 3DWTA 4H5SB 3EIFA 5I1EH 2Y7QA 4FXLA 4ODUA 1BOYA 3OZ9H 1IMHC 2UWEB 3TO4A 5I16A 4Y2DB 3LMJH 4QHKI 4GS7B 3RJQB 1P1ZB 2BY2A 4JREC 1CVRA 4JFEE 5F7FA 4NWTH 1AO7A 4QWWD 1A7PH 2VXVL 3M17A 2VR5A 3V6OE 1UENA 4OCLC 4Q6IB 3FQUA 5IQ9B 4ZD3L 1NC2B 2HFGH 1UVQA 3O2VL 1ZT7B 3BKMH 1WZLA 3U83A 2BSRB 5CLWA 1S7QA 4QXTB 1FE8H 2IH1A 3VXMD 4U0RB 1AHWA 5DMYA 1Y0LA 1YEIL 2F53B 3VXMB 4EDXA 2DQCH 2DLFL 2RBLA 5BZWA 3TNNA 4U33A 2GTZA 4X5XB 1EHNA 3O4LD 2NXZD 3QCVH 4P3DB 1U36A 5GGVL 3L95B 4JDTL 3V7AG 3OKLA 1NAKL 1U3HA 2APWA 3ILPA 4YH6A 5SWZE 2IH3A 3EJZD 1JHLL 3MTRA 5GRWA 4NO2B 3PHOB 3T8XB 4QHNA 3S34L 4LHUB 2O5ZL 2PXYB 2R23A 1PYWB 3BP5B 4NKDB 5E03A 3UROR 3S88H 4M3JA 5J06A 4X99A 4H8WC 5EBMA 3TVMA 3GSQA 3KXFB 4JRYD 5T3ZD 1AC0A 3VXSD 1E27A 1MEXH 5C07B 1K8IA 5E6IC 3S6CA 1H3VA 3CVHL 2VZVA 2YPKA 4XVUD 1H3GA 1DUYA 5IW6A 1JZ7A 5I19H 2GT9B 4X0KB 2NY4C 4M61B 3WS3A 3JSSA 3MBEA 5FGRA 1DL7L 5E6IA 1ZV5A 2AQ1A 1EUUA 2X42A 2JB6B 2A1WH 5E2WH 1CFBA 4TQEH 4U1GC 1GJIA 4JR9L 1XGYL 1FVCA 3MBEC 1I1FA 4HKZA 1I9IL 4BZYA 4HXBH 1RZ7H 3O45B 1F3DJ 3IT8D 3UTTD 4JY4A 1CDUA 1QO3A 3LEXB 1NEUA 5JORA 3L5JA 3MGOB 3RKDC 4Y5VC 2YEZA 1FV1B 4LLDA 1LK2B 4HUKB 4K94L 2R29L 3DX8A 2H32B 4Z7VF 5DUBB 3BZFA 3MRBB 3RDTB 2GHWB 4FQLL 2HT3C 4S11A 1YPZB 1IZJA 3QO0A 2A73A 3K4ZA 5EOCJ 4IJ3C 2KH2B 1EX0A 2V9RA 5DI8B 4M5ZL 1YEFL 5FKAB 1ORQB 2P45B 3BUYB 4I9WD 1ZSDB 1DN0A 1G84A 5ILTH 3BW9B 4QY8A 5IEKA 3P0YH 4PUBH 4ZUWA 3WHE1 4AH2B 3FT4A 3LRSA 3KLSA 3KNBA 1D5BB 4POYA 1EGJA 3MLWH 4Q6IA 1I7RB 2E7CA 3TO4B 3D5OF 3QIUC 2DI8A 4QXGL 4JZJB 4MJ5B 2QJDA 1JRHL 1DBBL 1KCVL 4Y19B 4QTHA 2BNQD 1T5XB 2J8UF 5TGBB 1AD0A 3SOBH 3KR3L 3D87B 4NWUH 4KK5D 3L1OH 5C6TH 3FT2A 3JV0A 5ILTL 4LGRB 2VR4A 3TZVA 4ZTPH 5ALCL 5MENE 1QA9A 2G5RA 3O4LB 4DZBA 4JN1L 2AJZA 2JF1A 3FHQA 2GY7B 4MCYB 3DSFL 1RUPL 3CVHB 3GMNB 2CGRL 3QH3A 4EI6A 4KZDH 4GAFB 1R5IA 3VGFA 4P46A 4IS6A 5FUZH 3P30L 2F19H 1FFPB 4WU7A 4XRCB 1T03L 1NGPH 1JGLL 1BWWA 5L2KB 2G60H 1C5BH 4F33A 5CJ5A 1HDMB 2HA1A 2PW1A 2GK2A 3PHOA 5EWIL 3Q6GH 1I1AD 2R4SL 2JIXB 1H8NA 3LQMA 4LSRL 4S0TD 3MRIB 5JO5B 3L3JB 4RGOH 4AENA 1OARH 2GSIA 4FQIL 1PSKH 2RCSH 5FV1L 3WHXB 2X2YA 1EERB 4NN5C 2JB6A 3MCKB 1A7NL 3LQZB 4FQCH 4LLYA 4HIXH 1AQDA 1IEBA 4O4YL 3NIDF 1IAIL 2YXMA 2VLJD 3HRZA 1VFMA 2J7LA 3VG9C 5JDSB 4DW2L 5D7IA 2W38A 4MQTB 5TE6L 1CDYA 1FG2A 2Y6SC 4PB9L 5DYOB 2VUYA 4QO1A 3U36A 2NY5L 5C08D 4F7PA 1YEEH 3VMPA 1T2QL 3R0MA 4KKAD 5CJQH 3UC0L 2Y07H 4RFNC 3GUTA 3PIQB 5IP4A 4L4VB 4MNGA 3BKCH 5LGKA 4O2FB 3ZKSD 2BNQA 4J1UA 2W9DH 5I74C 4BYHA 4TSCL 3L3OA 4O5LH 4PFEA 1KELL 3S96A 5C0BE 3PXHA 3REVA 4C56D 1VERA 3T04D 4NJ9H 1G0DA 2ARJB 3KYOB 3TCLA 2EICA 2PCPA 4GS7C 2NY0B 2OTUA 3BJLA 4WHCA 3EKCA 4ACPA 4M00A 4KHTH 3SE9H 2XG5A 2DTMH 3M8OL 4NQCA 4EUPB 2W60A 2EDDA 4K9EC 3AFLA 3BD3A 1MFCH 1QYGL 3N1GC 4UMGA 1MOEA 1DEEA 1J8HD 4JY5L 4GW5B 2GAZA 1UWXK 2GSGB 2Y36H 4RMRA 4WWKD 4NIKB 3FN0L 1RV6X 1M6OA 2XFXA 4JFFB 2NLJB 3DETD 1IAKA 3ZDYF 1WJ3A 5I15L 3GNML 1IM3A 2HMIC 2PUQT 1A0QH 3CK0H 4AY0A 1XF4B 2NR6C 3DBXB 4Y19A 2C26A 5DHYB 3FT3B 1SEBB 1T83C 1OAZL 2E9IA 3FQNB 4DQOL 1CTNA 1T3FB 3KDMB 4ALAH 3X14A 4ZQKA 3RGVA 3BT2H 4NBYB 5CCKH 1CDHA 4HMCA 4U1SA 5DEFA 3U1SH 4OCXH 4ZNEA 1AQKL 2V2TB 1MHPL 1WWAX 5ICZA 5HGHB 4PJCE 4J7RA 4UIKL 3VFGH 3DURB 3C5ZC 1FYTB 2BVQB 5HD8C 4X80H 4CVUA 1KENL 4BKLA 5I1LB 3HE6C 1YN7B 4RMQA 3MA9H 3B2VL 1UZ8B 2DL2A 1CXHA 2E6JA 3TJHD 5MEPA 2F54B 3DYPA 1NL0H 3P9MA 4CADA 3BRGC 4N8CL 1CWVA 4KRPD 1Z2KA 1MFAH 4X9FA 1DDHB 2FGWH 3QI9D 1OSZB 4PJIF 3CZFB 3MV9A 4L4TA 43CAA 3VMOA 4IS6B 3S8WA 5I1IL 1GGTA 2WUCL 3T3MF 5B3JE 1UM4L 2ID5A 3PWLB 3X3GH 2X9XA 2WK2A 4XMPL 4RZCB 1IEAA 3BSZL 3QEHA 1W8OA 4IRSA 4OB5H 5J1SC 2V7HA 4GRWH 1S7RB 1MJ8L 3ILPB 2IANB 2DLTA 3LN5B 5KOMC 5EZJA 2CO7B 1KTLB 4JPIB 2P44B 4KJQC 3DVNB 3FN9A 5HYSB 1CICD 4M1CC 3LPWA 3K1DA 4UTAL 4LVHB 5GGSY 5E08L 1JF1B 3HRZB 1NMBH 3L5XH 1MWAL 1DZBA 3QSKB 3BKJL 3DYMA 5FAAA 4TPRH 1U3JA 5D7IB 3WFCH 3SE3C 3O3BA 4GRMA 3MBXL 2A9NL 2X70B 4N0YH 3TWCH 3BPLC 4LSPH 2ICWA 5HVFB 4GW1A 1ZVHA 2ZNXA 3NACL 3TCXA 1B90A 1KIRA 1DBAL 5DJZA 3MLSH 5FYLH 3QRGL 4BQ8A 4GKNB 4YJZL 3UBXI 3IU3B 4NN7C 3RTQA 3O9WB 4UTBH 3CU1A 1KJ2L 2JJTC 3D25A 5J11B 4LVOB 5MENB 2AK1H 3PG2A 4C59B 1TPXC 2NYYC 5K33A 3QIUB 1J9CT 3BEWB 1X44A 2PYED 1X5YA 2Q76B 5J12C 4NDMB 1A4JA 5KSBE 4HS3B 5E8EB 2FEDC 5I17A 5IOPB 3ROOB 1JNJA 2NY7H 3IXTA 3R1GL 4FNLH 4R9HA 1MSPA 3V4VL 4LLDB 4WVRA 4G9FA 2H2PC 5DQ9B 3CH1A 1UCTA 3I02B 3JV4B 3DBXA 3V5KB 5CMAB 5FGSA 5IB2B 4M1GL 4RAUA 1GC1L 2HVJA 1UWGL 3S98A 3FQNA 2XFXB 3FAWA 4JFFA 4YBQC 3STLA 5E7FA 3IKCA 3AS3A 4JY6B 2WLYA 1ZA3B 1A4KA 3OB8A 3QPQD 4QTIL 1PG7W 3DROB 4NQEB 2NZ9C 3IGAA 2I26N 4MQ7A 1JPTH 3NAAH 4Z7QF 3U9PH 2Z31A 5SV4A 3OB0H 4EOWH 1ZMYA 2CDGB 3VCLB 1BJ8A 3LN9A 3BPCA 2F54D 3ARFB 4L29A 1A5FL 4E9LA 4LP5A 4YDVA 2F5AH 1KNOB 4G3YH 3MGAA 1GGBL 1H0DB 3VFTA 3GMQB 4UB0H 3GBNL 4GKZB 3KPSE 1S7SB 1SVZA 4Q9RH 3RZCC 1UB5B 4OGAD 4L8DB 4P2OC 3QUZB 4I77L 3VGDA 3OQ3B 2DQHH 3H8NA 4OCMC 3ZKXB 4KRPB 2G2RA 4OZHE 5D2LF 5J0BA 1ONQA 3VFRA 2K7PA 1AD0B 1JPSL 1FAIL 1U8MB 1I3UA 4JAMB 4UUJA 4MHHG 1SBBA 5J6HB 2EE3A 4XNYH 4M7LH 1CF8H 1TTGA 4LSTL 4H8WL 2DKMA 1JI2A 2UUDH 5E8DL 1B4JL 1UM5H 4G8GA 5F8QC 5FO9B 1JCKA 1OAKH 5AZ2L 4JGUA 2RAMA 3B2UC 4WW1B 1AIFB 3GI8L 1JIBA 5EUKB 1IL1A 2DYPA 3KLAA 5DJYB 4NZRH 5BQ7B 5DTFA 1MI5A 3QDMD 4KGLA 2X4UA 3GMPA 4WTZA 1Q9WB 3MPCA 1HE7A 1DLFL 1HHGA 4LLQB 2QSQA 1D5IH 3QUKA 3L5XL 4PRAA 1AGDA 4YDIH 4ESKA 1HSAB 3UBXB 4YQXH 5C8JB 1IC5L 5LVEA 3KPSA 5KSBB 4LQFL 1EXUB 3B2UD 4RDQG 2J8OA 5GZOD 2V5RA 3FO2A 3S37X 3ULUF 1A1OB 2ED9A 3EO9H 3QAZC 3HB3D 1OCWH 1EVTC 1JNLL 3QIUA 5GGTA 5IF0A 4PRBB 3QG6A 5D72L 1UADC 1UJ3C 1F4WH 2UZXB 1DVFC 1NCNA 1WK0A 3QJFB 4F7CA 4OCWH 1AHWC 4YXHL 1NFIB 3GK8H 2IH1B 5DRWA 2DM7A 3KGRA 2NY6C 3SO3C 1FRGH 3MJGX 5D6DC 2UUDK 2C5DC 3NFNB 3FO9B 1AXSB 4I8DA 3UZVB 2CRZA 1YPZF 1F3RB 3HNSH 2FX7L 1QZ1A 4MQ7B 1VPOL 4G6FB 5H94A 4P3CL 4O9HH 4XI5C 1HK6A 3ULUD 2HP4A 4PJ5A 3KJ4B 4IRZL 4Y1AB 2IEPA 3VFPA 5CKAA 2ZCKL 4HD9A 4LIQH 3QA3B 3IS0X 1F3JB 1DBML 1TETL 5BRZA 4PJGE 1N8ZA 2EECA 2QLVB 4MJ6B 1CQKA 1GOHA 5MEOA 3THMH 3MLUL 1AKJD 4IMKA 4NQDD 1WBYB 2ZSVA 1IZKA 4JHBA 3ALPA 4LCIL 1I1AC 4GRWF 2XRAL 1AKJB 3S35L 5B4MC 1ODAA 2FIRT 4P4KB 3TIDB 2GT9A 2AJSH 4CU7A 4E41E 4LHUD 5IB1A 1LGVA 1EJOL 4KPHL 3HHRB 3L3HB 1I4FB 3H42H 2Q86A 4XCFH 3KXFE 1JYVA 4MGXA 5T5FH 4CMHC 5E95B 5DQJB 4RNRA 2B39A 1NGYB 2X5PA 5BRZD 1N5YH 4Q9QL 1P2CA 4PJFA 4MX7A 1BFOB 3D3VA 4K7PL 4BM7A 5JORB 2NY2D 4XVJL 1WEJL 1KCRL 1Z3GH 3HZKB 2DS4A 2VZUA 3MLVH 4JRYB 1UCBH 2XKSA 2AEQH 3H9YA 4JJHA 4G6JL 4K3DH 1RIHH 3OJDB 1V3LA 1IGTA 2C7UA 3LIZL 3PL6D 3SGEI 3WMSA 2B20A 4OD3L 3MLYL 4WW1A 5KS9B 5GGQH 2YXFA 2VDLL 1RD6A 4NKQB 1HZHH 2H1PH 3W39A 2X1WL 1ZSDA 3G08B 1AP2A 2ZUYA 5IESH 4UT9L 3OKEA 2WUCH 5L7XH 1G7JB 3MRHA 4MD5A 5KJRL 4L3EB 3BRDA 3EOBA 4H20L 4CW1B 4PRBA 3FB6B 1C1EH 4UDUB 2A83A 4B0MM 5DRXB 3Q5TA 4EBQH 4Y4FD 4LK4A 5MP6H 5K9JL 5SWSD 5SWZD 1U8NA 2X7LA 4FQJL 5IFJB 2HWZH 2DWDA 1OP5K 4Z78A 3NCYP 4OLVL 5DS8B 1L6XA 4JQVA 4QXGH 2JCCA 4OZGE 2I25N 4U3CA 1I3RB 4NO0B 3DIFB 2BSTB 4KKLC 4CN6A 3JV6B 1CGTA 4M6AA 3MXVL 4G7VH 1BPVA 1JUFA 5DJZB 5FKPA 3FTGA 4U7MA 1LVEA 1R5VA 4XNMB 1GAFH 2LAAA 1XFPA 2YPLE 1A5FH 2A6DA 1AO7D 2FHFA 1QSFB 2R29H 4HGKC 6FABL 1A1NA 5FUCE 1HHKA 4OCYH 2Y23A 4NNYB 4WY7H 3L7EB 3F7VB 1CD8A 1ZT1A 5JW5A 5GISH 1U92A 4FMFA 4KKBD 2HYMA 3I6LE 4MJ6A 3LKSA 1G6VK 5L0QC 2VDKL 2VABB 4OM1L 3NCCB 2O61A 2EE2A 2VERN 1IM9A 2GI7A 5EO0B 5IVXE 4D8PB 5J57B 3KHOA 3VXQB 3JWDC 4ELKB 5FM5M 5IGXL 3C6LA 4MB4A 2IG2L 5D2NB 5GGRB 2VOTA 2HN7B 4Y4KA 2J4WL 3FB7B 4WGVB 3JBG7 4CNIB 1OSPH 5T3XH 2P5WD 2FO4A 4PJGA 3EDDA 5D5MF 5FDYA 2ZJSH 3IF1B 2VDQL 4NFBA 4X7EC 4ODSL 1H8SA 2DL9A 3U7WH 3V6FB 5KTEL 2VN7A 3H42L 4MXVE 1GXEA 3WNPA 3D69B 3VDCA 4U1KB 3V7MA 4QT5A 5F89A 3OKKA 4HJGB 3W2DH 3CXHK 3NFSL 1NMCC 4OCSL 5DD0H 3U0WL 5ADPH 3TBVB 3LRHA 4UB0L 5H37H 4FXKB 1A6VL 2NNAA 4U1LA 3O2WL 5TQ2L 1BBJA 4XCNB 3QH3B 4ZUVA 4OTXH 3RGHA 2UVFA 1G7IA 2FBJL 4K3HA 3QNZA 5C6PB 4KVNL 4PYHA 4APQA 5E2JA 3C8HA 5L2KA 4DOHB 5C0CB 1R5WA 4NZJA 4YHPB 5T1LD 1JYXA 1NGXA 2EDXA 3HE7D 5GJTH 2J6EL 1D9KA 5EIVA 2YR3A 3W9DB 3T3PF 3ROLB 4M6OL 1FYTD 4G8GE 3P4MA 3F58H 3QO1A 3GO1H 4IRJC 4XVSL 5EZLB 5GIRA 1XGRB 2DTSA 1A21A 3IAQA 2MCPL 3EW3B 4C83A 4Y4FB 3HG1B 5IWLC 1RHHB 3EDFA 4ZO6A 1N64L 3L5WB 5IBLD 4K7PX 3JWDL 3MCKA 4LLYB 5AZEL 1T5WB 1TZIA 4NRZB 3RNQA 1BVKA 3G6JF 5BQ7A 2VZ3A 5DQDL 4IM8A 5J56B 1WBXA 1I7ZB 3PHQB 1YJDC 1MLCB 3EYVB 2XQYG 1EGJL 2YRPA 4U3XA 4NZTL 4K8RH 4WI6A 5HGBB 4G6AD 3FRUA 1KCUH 1OPGH 4DVRH 1ZHNB 12E8L 5INCB 3HAEG 1A7PL 4ZMAT 4WHTB 4MNGB 3V7AE 2P5WA 5D96C 4L8SC 1A6AB 1EFXB 3FTGB 3MV8B 2YA0A 4QF1A 1BFVL 4OZIB 2DD8L 1QKZH 3IDMB 4KY1H 3TN0C 5M7QA 2WP3O 4KHXH 3REVB 4LDLB 2CMRH 5JOFA 1JHLH 1H5BA 1XGPA 5FA4A 5DSCB 3D39D 3CXHJ 2FO1A 1YN7A 3NA4A 4TUJA 1DL7H 3L9RA 5T5NF 1Y6NR 3F7YB 4S1DC 1QOKA 1REIA 3VXRA 3C2AH 4WJ5A 4CBPA 2ORBH 5TF1L 4UI2A 2Y5TA 4ONFH 4GW5A 2VITA 3E6FA 5GISL 1U9KA 4Y8DC 5IVOA 5ACZA 4JKWA 1E6OL 4Z7OF 1WC7B 4I0KA 3FRPG 4OF5A 1U8KA 3ISWA 1FAKT 3O6FA 5CZXD 4PJDF 5DWUH 5IMLB 3MV9D 4PY7B 2ENSA 5EZOL 2WBJC 5I66B 4HX1A 3CU7A 4K3GA 1DBJH 2H26B 3HZYB 1FL6B 2QSVA 3T2QA 4CMMA 2X4OB 2Z92B 1J12A 2X1OA 4UBDD 3Q6FB 4C58B 5CUSH 1BGXH 4WRLA 4P2CG 4W4OA 4Z7OE 4L8CA 2P7TB 1L7IH 1JF1A 2O5XL 5HGHA 2BJML 2XTJE 3BE1H 4PTTB 3WE6A 3QRGH 1F11B 4HUXB 5CSZB 1LEGB 4PP1D 1VFBA 4MB5A 3RWHB 1U8OB 4M7ZB 3ARDA 1JWMA 3VXOB 1BZ9A 4PRNB 4U0QB 4U1JB 4YK4C 3LDBB 1UKQA 4XB7A 5DZLA 1PY9A 5DWUL 5T3XD 2A0LC 2J6EA 2V5SA 4OCRL 4Z18A 2AV7A 5A3ID 1D7FA 2IAND 1HXMA 4NO2A 5SWSE 5D7SH 3WO4C 4ZO8A 2MCPH 3DUUA 4GG6A 5L2JA 1JJUA 5LWYH 1TVBB 5D1QA 1J1XH 1QRNB 4JJ5B 5B39A 3G5YA 4ZFFB 3O4OC 3SDAC 5B39G 2AK1L 4R90H 3PWPE 5C0AD 2HKHL 1TFHA 3UJTL 3V4PL 1MJJB 4XAKE 4X83A 1DVFD 5TPWL 1UXSB 2I9TA 4YWGL 4L3CB 3CH1B 4HGWB 1CGSL 5IT2L 4JO4H 4M61A 1T1XB 4A2MA 3VI4F 5EZJB 3JZ7A 2DWEA 3VWJA 3IDUA 3LSOB 1J8KA 3W11D 3MA7A 1O7SA 5TH2A 4KTDH 2BK8A 3VU2A 1CU4H 3V5HB 2Y06H 4JKPL 1J0YA 2K3TA 4NHCL 3SDCB 5KVFH 4ZFGH 4WUUD 5DVNA 5TE7H 2R56H 3KPNB 3EOBB 4IDJH 5JHDD 1B0RB 2F5BH 2GTWB 1LWRA 2P24A 2ITCA 5JIIA 1EPFA 3TZVB 3VXSB 3O3UN 4NWUL 1MFDH 5JUEH 2WWKT 5D6DA 3U7WL 1EIBA 5D2NC 5BV7B 2YBRA 4Z7QE 3S97C 2BSRA 2RB8A 1H5BC 5HHXL