1AR1C

Structure at 2.7 angstrom resolution of the paracoccus denitrificans two-subunit cytochrome c oxidase complexed with an antibody fv fragment
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
118
Chain Sequence
EVKLQESGGDLVQPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVASINNGGGRTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCVRHEYYYAMDYWGQGTTVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (oxidoreductase/antibody)
molecule keywords CYTOCHROME C OXIDASE
publication title Structure at 2.7 A resolution of the Paracoccus denitrificans two-subunit cytochrome c oxidase complexed with an antibody FV fragment.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 24
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1997-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ar1C00
3RWIB 2PKDA 1MQKL 4JKKA 2AXFA 4JGMA 5EULV 5F1KC 3IDNB 2O61B 4PGCA 3QEQD 1NEZG 1ZWIA 2YPVH 1NGXB 3H9SB 5F7FA 5GGUA 1NCDH 2EYSB 2P8PA 4FP8H 1NCBH 1U8LA 4LAQL 4IIQB 4OUUA 2X89A 3WS3A 3CDGB 5I1DB 5C8JB 3BHBB 4YFLI 3W81A 3IXTB 4DJMA 1V7MH 3VA2C 3U9PL 4M43L 3GO1L 3ALXA 4NQCD 1NAKL 3GSRA 1JPST 3DVFA 3BPCB 4QWWC 3IB4A 5I6XC 2XTJC 2WSKA 5CZKA 5D6DC 4KK9C 2G5BB 1JPSL 1WZKA 4TSBH 3VD5A 1KJ2H 4QRRA 4QTIH 3T09A 3LSOB 4LCIH 5GQBA 1XIWD 3UO1H 4YHKH 1OSPH 5AEAA 1A6TA 2GCYA 1DBJH 1OP5H 5I15H 5GGQL 3O6LH 2EDNA 3DMMD 4HCRH 2HH0L 4Y4KA 3KAAA 1A6UH 4H5SB 1PEWA 3QCUH 3RKPA 2CLRA 4NRZA 3HI1A 4Y4FC 1UZ6F 5ESVA 5FHAL 1EAPB 1SBSL 3LKSA 2IG2L 3VXRE 1BOYA 3RWEB 1QFWL 3RPKA 1XR8B 2I5YH 3RBGA 2FX8L 5GGSY 3V8OA 1HKFA 4UDTB 4PJCE 1J86A 1A6VH 3EOYG 4PV8A 4NKIH 4D9RE 1KCRH 1I8LC 3LOWA 4M6MH 3Q6FA 4JFYA 3BEVB 1VFMA 3MLYL 2EO1A 1MLBB 2MNUA 3QUKB 3VFNB 5IWLA 1D9KC 3IFLL 1I3RA 1RULL 4H26B 3WFBL 1F4WH 5IEHA 1BJ8A 1QBLH 1YUHB 3D1MC 3FO9B 1A9EB 3HC0B 4HGWB 4M7KL 5T1MB 4HKZA 5DSCB 3QUYB 4HBQA 4X5WA 4TSAH 4CADB 3QCTL 1MQKH 2BVYA 2IANA 4RMQA 4N0UA 1UFUA 4G9DB 5IW6A 2FATL 4YHNB 3PQYA 5CBAA 1NAMB 4Y1AE 3TVMB 4JFFB 1KNOB 3LQZB 1CFSB 2HN7A 5DD1L 4FTVA 5GJSL 3MRRB 2IH3A 1JK8A 1RIHL 3HUJE 4LAQH 2CDEB 4Q2ZB 1RJZB 3QEHA 3O4LA 5H94B 4G7VL 4M48L 3B9DA 2WWKT 5CJOL 2C3WA 1LP9B 3CSGA 2VLRE 1ED3A 3U9PH 4M43H 3GO1H 4NKMB 1FRGL 1R3HA 3MNZB 1TMCB 5DZOA 5L88L 2PTTA 5DUPL 1X5YA 4R96A 5B8CB 2CJUH 1CK0L 5HYEA 5AWNL 5KJRL 1MFDL 1JPSH 4ELMA 5IK3A 3MXWH 2ADIB 4P5TC 4BFEA 2O93L 3ZHKA 1J8HD 1PDKA 3GDBA 2AEWA 3IJSB 1JE6A 1ZA6A 1AO7A 4LASL 5GGSB 3DV4A 5D2NB 2VYRE 2WM0A 3QA3A 1OWWA 3BP6A 5GGQH 3D39D 3S3JA 2UYLB 2OJEA 3EO0A 3STZA 1T66D 3IKCA 2NX5A 4JQVA 5D2LE 2VLMD 3OG4B 2HH0H 1W0YT 1KBGL 1RK0B 1LD9A 4Y5VB 3T8XB 5KANI 4BFIB 3B43A 5J1AA 1MI5B 2Q8BL 5IFAL 1G7LA 5C09D 2Z8VC 5FHAH 2OS7A 4KKBD 1SBSH 1VEPA 2BNRA 1JNNL 4CVWA 2IG2H 3VFPA 5F71A 1QFWH 3CFEA 3Q2CA 4ZS6C 4OLUL 2RQ8A 3LN9A 3SDCB 3QO1A 3KPQB 2EIBA 2FX8H 3TBTB 1EBAA 5IF0A 3KLDA 1TNMA 5EZOL 5F70A 1ADQL 5BW7A 4UAOC 35C8L 2FH8A 4MJIA 5FO7A 3UDWC 4Z7WB 1UKQA 5KVGL 1OQOA 1AXTL 2BMKA 2X1OA 4IS6B 3MLYH 4Z0XA 3IFLH 3T0VA 4B7LA 2VOTA 2C7UB 1RULH 3HC4L 3OHXB 1ZGLM 4MJ2A 3WFBH 1HYRC 3HE7A 3HMWL 4OKDA 5CD5D 3RDTB 5LWYL 4M7KH 5HJ3B 1X5GA 2P8LB 1BZ7A 3RHWK 1N4XL 4GRLA 1AHWC 1JF1B 4WV1B 5KS9A 2F8VA 4MAYD 3T2NL 3QCTH 5EZLB 3B5TA 1A3LL 3HNSL 4QGYA 1N6QL 1BVZA 2XXCB 4WWKD 3RWJA 2FATH 2BY1A 3UZQA 5MENB 4GW4B 3I6LE 3MV7B 1CDBA 3G9AB 3L3KA 5ESAA 4QNPE 5D1ZC 2JJWA 4JHWL 1U95B 2NR6D 5DD1H 3UCRA 1P7QD 3QXUA 5DHVB 5GJSH 3EJJX 4LSRL 1RIHH 3QDJA 3LKNB 4G7VH 3UTPD 3P9MA 3HR5B 2VUYA 1WBYA 3ARDB 1JN6B 3KPRB 1FRGH 2XTJE 3AU1B 5L88H 5DUPH 2BVQB 3ARSA 3V5DA 4G9FA 3B8YA 4HIJB 4WGWB 1AE6L 4WI8A 1OSZB 3A0OA 2FR4B 3I50L 1CK0H 1G7PA 4CJ0A 5AWNH 5KJRH 1CLZH 1MFDH 5T1LD 3BW9A 3MXVL 2V7HA 4L8CB 5B4MC 4NC2B 3CDCA 1UB6B 3EYUL 4XCYA 2NY0B 2YD4A 1OGAE 4P3WA 5DD0L 4P2OD 1L4IA 4DK3A 2ICWJ 4U0QB 4MS8D 2X70A 2CXGA 1U3ZA 2D7OA 4HLZG 3JWOL 5KSBB 5AUMB 1DN2A 4FQXB 4CUCA 1LO4L 2OR8A 4PJDF 3G6JE 4JG1L 4O2CB 5ALBL 3O8XC 3IDGB 1KBGH 5D9SB 1EXUB 4Z95L 1L7TL 1QFUL 3QNZB 5DEGA 1ZHNA 4QOKD 2Z93B 3PWPA 5T33H 4N5UA 5CIPH 1FORL 2W60A 2ICCA 2Q8BH 3HPJB 5IFAH 4NFCA 1OD7A 3SBWA 1JNNH 4U6VL 1H9VA 5C0BB 4HPOL 4YGVA 4OLUH 4X5XB 1ZT1A 3GJFK 2ED9A 1MWAA 2VWEE 3CUPB 4YZFF 4U6YA 4GLRH 3MV9D 2DLTA 4JFHD 4PJ8D 5JIHA 5EZOH 1ADQH 5ESQB 1BQHB 2VN4A 2N56A 4TNVF 1S9VB 2P5EA 35C8H 1U0QA 1BZ9A 1ZV5A 4JRXB 5KVGH 2MKWA 1AXTH 3FCTB 1E27B 3LPWA 4HG4K 4EOWL 1KJ2A 1N3NB 3BZEA 5IJVA 1KXVC 3WLWD 2C1PA 4I18C 5C9JB 3HC4H 1Z9MA 4KK6C 3J8F7 2ZSWA 2CO6B 3V2AR 1ZLWK 5LWYH 4L3AA 5DFWH 4PBVC 5B22A 3W9DA 3DYOA 4ZUWB 3BVNB 1M6OA 3BH8B 3T2NH 3RWFB 1AD0A 2BHZA 1MF2H 5JW3H 1N6QH 1A3LH 3HNSH 4HCRA 5EU6A 1T7YA 2WIMA 3LEYL 4ZTOL 4JFZL 5CHNB 3RZCC 3H7LA 3VFWB 1PFCA 2NPLX 1KXTB 3I9GL 4JHWH 1YMME 4HFWB 1UVQB 4LSRH 2B7DT 1S7VA 2WWMD 5SX4I 3FB5B 2QQLL 3ZYIA 1AGCA 5KSAC 1JV5A 3W5MA 1NC4B 4PRAA 5GIRA 1JP5A 4I0PB 1CDHA 4Q6YA 4BK4A 3V6ZB 5CJ8A 1AE6H 4UINL 1IT9H 4HK0B 1IQDA 5DJYB 3RTQC 3D2UA 1KJMB 3MXVH 5ACLA 4YHOL 4I77L 4JRYA 3RIFF 3EYUH 4GW1A 3LB6C 4OCXH 2LTQB 1OWRM 3O9WD 5DD0H 3MRCA 5EZJA 3SKJL 1UEMA 4PP1D 4TUJB 1AGEB 1IAIM 5EPMA 5INDB 4JQIH 5IV2B 4IRJD 3AXLA 4BSWA 1AGDA 3JWOH 3MMEB 3LMJL 5IQ9A 5I71B 2BHUA 1MLCA 1I7TB 1HOCA 2DLHA 1LO4H 5ALBH 1WQVT 4JG1H 5B38B 4Z7OF 3VMPA 5C08D 1U8PA 4Z95H 1L7TH 1QFUH 1XT5A 5DJZB 3HG1A 1XGTB 4HS8L 1XCTA 4XVUC 3ZKXC 4XZUB 5GSVA 1FORH 3U4EB 1QO3B 3GSWA 1JWUB 1HSBB 2BC4B 3SGKA 4RFNB 4JO2L 1F3RB 2J3SA 4C4KT 1NGZB 4UQ2A 4U6VH 1OTUC 4HPOH 4UUJA 3C5ZB 4Z7NF 1VGKB 1EO7A 2JJTA 4WFED 5JXED 1XGQA 2A6DA 3G6AB 3RY5A 3SKOA 1TZHB 3DURA 4P46C 2Q7NA 1C16A 3F7YB 4BA8A 1JUFA 2HJLA 2J8UB 5CAYB 1U8NA 3BP7B 4LVOB 4P99A 4AIOA 4XP4L 1A9BA 3LD8B 1HNFA 4EOWH 1DQLL 4L4TE 4PG9A 1I1AA 3TBYB 1ACZA 3B9KA 4NZJA 2E9WA 3UTQA 4XWGL 3CVHB 3IDJA 4N8PA 4TULL 3HFMH 2YUVA 1QG3A 1UM5L 2UUDK 1NCWL 3LEYH 4ZTOH 3PL6B 4JFZH 3EW3B 4P2QA 3GMPB 3I9GH 5MHSE 5GRVK 1RQ5A 3PGCB 4TSCL 5J89A 1X6LA 4HHAA 4JVPA 2E8ZA 1PJ9A 3ZZ1A 2WQ8A 3QEQA 2QQLH 3UTZA 4MA1B 4Y2OA 5JW5B 3TIEB 4FMKA 4N8VA 1VESA 4YDLC 1RUQL 3MYJB 4X9IA 4Z7VF 5GS0D 2Q86A 4ZFZB 3V0WL 1ZVHA 3SDXB 3SHSA 5L0QB 5L8LB 1LO0L 4OZIF 4UINH 4NO0B 2N1KA 4MLIA 3NIGE 2DLGA 1HH9A 1KC5L 4MDIB 3QJFB 4NQCA 4YHOH 4I77H 4R3SA 3TZVC 5D1XD 5L7XH 4X6DB 1O7VA 2ZUWA 3SKJH 4F2MA 5I2IA 3D0VB 1ZLVK 1FPTH 1AGFB 2P5WD 2IWGA 3GB7B 3LMJH 1HDMB 1IGIL 4WGVB 1XIWA 5F72S 5IUSA 4X6CB 4BH8B 4XMPL 1FNGA 3WJLC 2YD2A 1BECA 5KZCB 1LE9A 2MCG1 4HS8H 2VDOL 1SJEA 1CDCA 3L5HA 3ZE2F 4FNLL 3F65A 5FGBA 3AVEA 4WFHE 4AY0A 4GQ9H 2EDWA 1S3KL 2XPGB 1KLFA 4JO2H 1JHTB 2E27L 3UBXB 5FDWA 5K9KB 3LRSA 2FJHB 3U46B 5CFHA 1LEIB 5DJ0B 5DI8A 2UZYB 1JNLL 5GS0L 2JE8A 4NZUL 4FA8A 3ARBA 1OP3H 1S9XB 4GKNA 1MAML 4QF1B 1DQLH 1JGEB 5MEOB 1JI2A 4ISVB 4PJXB 4Q7DA 3QUXD 5I76A 3P9LA 4XWGH 3MJ8A 4ELKA 5IROC 2D7TH 1QEWB 4ZUUB 1VFBB 1KLGA 2XWTB 2VDRL 2OYPA 1QVOB 1UM5H 2WANA 1GHFH 2NZIA 1NCWH 5TDPB 4HUVA 4WU7A 3FQUB 4P2RD 4U3XA 2ZCKL 3D69B 3FT4B 5JIKA 5CIPA 5ICZA 3EYOB 4CU6A 1C5BL 4L3EB 5MEPB 3VXME 5HGGS 1FNEA 4PJBB 4HZLB 5C0EA 3I6KB 1RUQH 5JORB 5AYQA 1W72L 3V0WH 4HUMB 5T5FL 3BGFC 1LO0H 1ADQA 1I1FB 3ZKNC 1KUMA 2FIRT 5TDOA 1KC5H 2CIKB 4JFQB 5HGAA 4NNPL 3VJ6A 5IMKB 1JWSB 3GM0A 1IMHC 4BKLA 1I7UA 1BD2D 5DDHA 4KQ3L 3H0TB 1ITCA 4NCC2 5GS1C 4PLNC 3BP5A 2BDNL 4PGDB 5EO1B 3ROOA 3HMXL 5JUEL 1KYOK 3EOAA 1DLHA 4XNZB 3AY4C 4P5MB 3HZMB 2PXYB 4UTAH 4EIGB 1N6VA 1J8HA 1IGIH 3C6LB 4Y2DD 3CFJA 1U91B 3CFBA 2D0GA 2HRPH 1TVHA 3WLBB 3DXAB 2X4RA 3D3VB 4XMPH 4MD5B 3DETD 1NC2A 3D39A 3UX9B 1HHGA 1Q9WB 2VDOH 5E08L 1IGML 1EFXB 4FNLH 4QRSA 4NNYB 5C0AE 3QUZB 4U1MA 2LAAA 4EN3B 4CDGC 1P2CB 3O2WL 2E27H 4OF3A 3DJ9A 3MRDA 4PJCF 1JMZA 1IAMA 3PP3H 2NLJA 1UEYA 1UXSA 5C09A 3GKZA 5HHPA 1EO5A 2ARJB 4P23C 5D71L 5D5ME 3JV6B 4QXUL 3V6FB 3VRIB 2C3VB 1DFBL 5I1HL 1JNLH 4OFPA 4PPTA 4PJ5B 5GS0H 5EBMB 3BPNB 4NZUH 5IEKB 2VDQH 4U6HA 1ODAA 2BSTA 1MAMH 2X6MA 4ZUVB 5IIEA 5IMLB 5GGVL 2V9QA 2IH1B 2N7AA 3VFOB 3NIFE 3DWTA 2DM7A 4J6RL 3P73A 2VLKE 2H2SD 4GRWH 4KROC 3C60C 1CFQA 2VDRH 2JB6A 5HI3D 4OGYL 2X1XR 3FAWA 1XF4B 3LRHA 3EYQC 1Z5LA 1ETZB 3HUJF 4MA3A 3TN0C 4YDVA 4Q74A 4MAYA 5F96L 1CN4A 1C5BH 3EOBA 2YPKA 4WWKA 2ATPB 5TF1L 5HGBA 1VACA 3RVTC 1WK0A 1K3IA 5JLZA 1P7QA 1W72H 3HNVL 1FYTE 1ZWIB 2W07A 4LVHB 5T5FH 3KPMA 1XGYL 4LOUC 1FN4B 4L3CB 4AEIL 2GIYA 2JCCA 5DJ8B 3B3IA 1TVBA 4OUUB 4NNPH 3LEVH 2B1AL 4X7TA 1GOHA 4FFVD 3C8HA 4KQ3H 4KRPC 1FL3B 4GAGL 3ZHDA 5T1LA 4DGIL 3HMXH 5JUEH 2JJSC 1FZOB 2XY2A 4U6XA 4YC2C 1I8IB 2DQTL 4XC3L 4NN6B 5D2LF 1QSED 3QUMA 4ZPTB 1BFOB 4P2OA 3X11B 1FFOA 4DKEL 2FEEL 1PY9A 3PHSA 4LLVB 1BZQK 5TE7L 1TPXC 2YBRB 2EC9T 2ZWLT 1G7JA 3RUGE 1S7WA 3PHQA 5E08H 1IGMH 2GCYB 1A3QA 2BSED 2XOTA 5BS0E 2CUIA 1DDHB 1QSFA 4QOKA 1S7RA 3O2WH 3WS6A 1LGVA 2FEDC 3O6ML 5D71H 4FQQA 3C5SA 2CLRB 3IFPB 4QHNA 4QXUH 3HI1B 1A1OB 3B8SA 3RVXC 1A7OL 5CJXC 3VFGL 3LKSB 1DFBH 5FM8A 5I1HH 1FZJB 4E5XA 2OMNA 2YEZB 4GAYB 8FABA 3MV9A 4GH7B 1A4JB 4AIZB 4PJ8A 3B83A 5J8OA 3IYLW 1NCUA 3PV7A 4PBXA 5FUCC 4KAQL 3KPPB 4UNTA 1G1CA 1T6WA 4D0CA 2HLFC 1GGUA 1P69B 3DO7A 2VZSA 4K3JL 3QH3A 3VGGA 1NDMB 5GJTH 1T83A 4J6RH 5C6WH 5AD0A 5B39B 2BVPA 3MRBA 3ARZA 4TYUA 1YEFL 4OGYH 4QNPF 3ULSA 1L9MA 4J4PD 5IEHB 5I74B 3E1F1 3IGAB 4MA7L 1JGVL 4YXLL 2H32B 1P5VA 5F96H 4HKZB 4XB8A 3DBXA 4RRPG 5DQJB 1ZLSL 1OW0C 4LLYA 1PYWB 1IAIL 1MNUL 1UXWA 5TF1H 4FXLA 4HH9A 2IANB 4TUKL 4KVCL 4OCSL 2V5TA 1NUFA 4WNQA 4UIKL 3HNVH 4G8EB 5F7DA 4IJ3B 1FSKB 3T1FB 1XGYH 4M7LL 2FNBA 4EUPG 4UOJA 5MERB 4AEIH 2WBJA 2GJ6A 5FHBL 4K9EL 2BVEA 3K0WA 3OJ2C 2H2PD 2B1AH 5GGTL 1CD0A 2R0ZL 2Q8AL 3FOLA 1FNAA 1YEKL 5I8CA 3EYFB 4JCMA 1M7DB 4GAGH 2W0FA 1YMHA 2Z31B 4DGIH 4FQIL 4UOW0 3U0PA 4F15B 3G6JF 2DQTH 4XC3H 4OI9A 2XN9B 5EUKB 1R3LA 3O9WA 2GK0B 4ONHB 4WW1B 1IARB 3RVUC 4LFHG 4RX4D 1A4KA 4IRJA 3MNVA 3IJHA 4W6YB 4LP4A 5TE7H 4E41D 3VA6A 2OJZL 5JMOC 5DYOB 2ADFL 2HP4A 3BKJL 4U7SA 5MEQA 2NY3C 4KTYA 3WUWA 1UCBL 1HK6A 2P8MB 3SE4A 4JANA 5ICXA 2OQJB 2OJEB 3STZB 4HJGB 4C56E 2SEBB 1NDGB 3QXAA 3STLA 1LHZA 3O6MH 5D7LE 4AZ8A 3MREB 3OSKA 3C6SA 2R8SL 2YN5A 2HA1A 1A7OH 3VFGH 4JB9L 4HDIB 4L4VB 4UIMB 5KSUB 2X4SB 5JXEA 2H3NA 2DLEA 5IFJB 3VXNB 2BCKB 1MCQA 3DI3B 2YPLD 4PJAE 3D85D 3NCJL 4KAQH 2W65A 4JY4A 5JPMB 4XBPB 3WKML 2NY1D 3WFZA 1BHGA 1PX4A 5J57B 4K3JH 3NFNB 1PKQA 1A02N 5DK3A 5FO7B 5F1IA 1T20A 3BP4B 3VH8A 3TBWA 2NY4C 2X4PB 4MNQB 2NY2D 1DQJA 3QIBD 4RA0C 1YEFH 4HUWA 4M7ZB 3K2MC 5DQ9B 4MA7H 4DW2L 2FIKB 5HHME 1WWAX 3I6GB 1BZ7B 1ZLSH 5KS9B 2O26U 3ARGC 2HTKC 1IAIH 1MNUH 1HHHB 4HIIA 2OR9L 2PO6D 4KVCH 4TUKH 4OCSH 1LK2A 4UIKH 3O11B 1IM9D 3ZE1E 5I18L 4M7LH 4LLAA 3QFJE 1LO2H 2Z91A 1OLZA 5FHBH 2GTZA 4K9EH 2R56L 1FO0L 3P9MB 3Q5TA 3H7BB 5GGTH 1L0XA 4KGLA 1NGYB 2Q8AH 4NN5B 1YEKH 1B0RB 4TVPE 4I3RL 2AQ2A 4FQHB 1CICC 4GO6B 4U1GC 4PRID 4FQIH 4A6YB 5D1XA 3OR7A 2VQ1B 1C12A 3BW9B 4HC1H 5EO0B 4WWID 3U0TB 3DX7A 1GZQA 1UG9A 4JDVA 5CJQL 5JHDD 3W82A 1D5BB 2P5WA 3BDBA 5SWSE 2OJZH 2ADFH 1J11A 3BKJH 2HVJA 4XH2B 3BT2L 3KS0J 4NKDA 1UCBH 1J7VR 1EVUA 1ONQB 2VISA 2PYEB 1E4XH 4D9RD 1YY8B 2VITA 5KVMC 2NTFB 3F5WA 5KG9A 1P4IL 1W72A 2GJZB 3L3IA 1EK3A 3S4SG 2IMNA 4JG0L 4XPBL 1UC6A 4RCAA 5F3HB 5FK9B 2R8SH 4JB9H 4LCWD 5DJ6A 4J3VA 4JFOB 1AC6A 2M8XA 5FUCE 3DV6B 2G75A 5KAQF 1ZT1B 1MREL 3NCJH 4PGEB 1LEKA 4RSVA 3WKMH 1X7QA 3HI5H 3HMXA 3MA7B 3OMZA 4N1EA 4Y1AD 3V5HA 4TTGA 2P5EB 2VUOA 5HVFB 4JJ5B 3RWCA 4S1RH 1T89C 1Y6MR 2YOCA 2JIXB 1FHGA 4JDZA 1KJ2B 1BAFL 2C1PB 4PGJA 3VCLA 2VLRD 2YD3A 3BDYL 4Q6IC 1WIOA 2X7LA 5ENWA 4DW2H 3W9DB 4NP4L 1K4CB 1H3GA 3VWKB 4BQCA 1ZGLA 1I8KA 4POYA 2NXYB 2XNAA 3NFSL 3A6CL 3HZKB 4P2RA 4NNXB 2OR9H 5C0GA 1ZS8B 1V3MA 3TGXA 3MRNA 3NIGF 5I18H 1SMAA 3O0RL 5HYSB 1K85A 3PXHA 2A73A 2I27N 3GMQA 5I17B 4IM8A 4BYHA 4Y88A 2R56H 1FO0H 1JYWA 3HRPA 1PW3A 1RZ8A 3HZVA 1XF5A 1FLRL 4I3RH 4QRQA 2BOCA 1IM3A 3C09C 3O6FB 1U8MA 4TUOB 5C92A 1RZKC 3DRQB 3QQ3A 1BD2A 2DAVA 2DKMA 1U93A 4P4KB 4BSVA 3ARTA 3BJ91 4Z7UB 4PJDA 2HT4C 1EX0A 1TQBB 2FZ3A 5CJQH 4G6KL 2JK5A 1RI8A 1OAXL 2X4QA 4C83A 4GBXC 3BT2H 2IPTL 3U4BL 1RIUL 4PTTA 5E2VL 1F4HA 1IGTA 4LSVL 1N5AB 4Y8DC 3K3QA 2AJVL 4EDXA 5C3TA 5ETUB 3BPOB 5HYQB 2XG5A 1BLNA 1P4IH 4QT5B 2IFGA 2EDOA 1A7QL 1I4FB 2GEEA 3L3OA 1U8PB 4P57B 3RWHB 3V5KB 1F45A 1X9QA 3UBXG 1HKLH 5HGHA 4LIQE 3L5WA 1PX3A 1CXFA 4JG0H 4XPBH 3WHXB 4F37F 2XZZA 3GSQB 1JF5A 4I2XB 4BQBA 4ODBD 1KIRA 2VXTL 4LCCA 1L0QA 3RBSA 2AGJL 4UUJB 1J8KA 1MREH 4PJFE 3DYMA 1MCKA 5CP3H 4WJ5A 2HFGL 3I6LD 1H5BA 3WL9A 4P9ML 4OCLC 4JFPA 2H45A 2R0KL 1YY9C 3GSUA 4AH2A 5DRXB 5F9OL 1BAFH 4P48A 5E6ID 4Y4HC 5ELIA 1XF2B 2NY7L 5DA4A 2HMIC 2I9LB 3BDYH 4RNRA 1ZHKB 4NQTA 2G60L 1P1ZA 5HHVL 4KK9D 4NP4H 3S36L 2MKLC 3BXNA 3PDDA 3NFSH 3A6CH 5C0CE 1T4KB 1WBXA 3LQMA 4CVXA 3REWA 3BKCL 4HV8B 4M1DL 3WDJA 2WWKO 2A6IA 3KLAB 3H9HA 5AAWA 4P2QB 1W0WA 1WCQA 4ZXBB 3O0RH 1U3YA 1G9MC 3LS4L 3M17B 1J0HA 1IRAY 1EVTC 1KIUA 1KPVB 1X5LA 4NCC1 5IM7A 2J8OA 5A2KH 4KI5C 3L7EB 2AK4B 4OIAA 1GZPA 2ICEB 3GNML 4K7PL 2LU4A 4TNWK 1KEML 3GMOB 5DLML 5D1QD 1FLRH 1SYSA 4Z8FL 1Y18B 4PG2A 1YEDB 5I16B 1I7RB 1H3WM 2V2WA 2J6EA 5ISZB 4OGAC 4OLEA 4WTZG 2ZSVB 1WBZB 4Y5YC 1S9KC 3F7VA 5DR5L 2E7MA 1Z0MA 4L8SC 4LGPB 4G6KH 1SYVA 4I13B 1OAXH 1QSEA 3VFVB 1S7UB 4V1DA 2JLLA 5FV2A 1IVLA 3L6FB 1RIUH 1CLCA 2F15A 3U4BH 5M94B 2HFEA 2F54B 4Q9RL 3MRQB 3U30C 5ALCL 5E2VH 4APQC 4N9GB 4LSVH 3EDDA 2QSVA 1A0QL 1UM6H 1XH3B 4XRCB 2AJVH 3WN5A 4PJHB 3D0LA 1CYGA 2LVEA 1A7QH 5D5MF 2GSIB 1YN6A 3ESUF 5FYJU 1CT8B 4ZQKA 1G1YA 3DMMB 5C0RL 2FRGP 4KUZL 3PP4L 5SV3A 2DS4A 1HI6A 4IIQC 1CGSL 2V2TB 4GXVL 4DVBB 2EDTA 2FEEI 2VXTH 1U8QA 2AGJH 5GGTA 3FO0H 3WMSA 1FVEB 3NIFF 2HTLC 2DICA 3VFMB 4HSQA 4F7CB 5HYJB 2HFGH 4P9MH 4PRPB 2B39A 4X6BB 4GMSL 3QQ4B 3VDAA 1YMMD 2R0KH 2R2BA 3IVKB 3CZFB 4HC1A 4DZ8A 2GY5A 1IL1A 3FKUS 5F9OH 1YQVL 1RJLB 1T03L 4GKNB 4K55A 3LAFA 3C08L 1G7HB 3D5OF 5I0ZA 4LCUA 2NY7H 3MFFA 3VI3E 3DECA 5DS8B 5E7FA 5I76B 3MR9A 5IW1B 2G60H 5HHVH 3SCMB 3S36H 4F7MA 5KVDL 2JJVA 4HW6A 1ZHLB 5TE4L 2EIZB 1XGRA 2DI7A 4FABL 3BKCH 3K4ZA 3GFUA 4M1DH 5FB8A 1C7TA 4Z7VA 1I3GL 2A74B 1YPZE 3LS4H 4OZIA 1CZ8L 1G7MA 1OAUL 2KDGA 5F44A 4JZJB 5DZLA 5C0EB 5HI5C 3MLRL 3GNMH 4JFDD 2BRRH 3CPLB 4K7PH 5JA8B 5DLMH 1FVCB 1QBML 4M8QB 3I85A 1LNUA 3K1KC 4HKBB 3GSVA 4CRPA 5LGHL 1RHHB 3VJ6B 3T2QA 4S1SL 4ZS6D 5EO9B 4BKLB 3P0YL 2NW2B 4R8WL 1YQ2A 5DR5H 5DRWB 2Y4SA 2H8PA 1YEGH 4XHJD 3RUGF 3GMRB 1R5WA 3DX9B 4PJEB 5E1AB 5T1KD 3QBTB 1FIGL 4LSUL 4M3JA 4RAUA 4RX4A 1KN2L 4Q9RH 5CEYA 5ALCH 3QUYC 1A0QH 5IR1A 1S8DB 2WMPA 3QXTA 4KJQD 3FOMA 4GW5B 4WW2B 2X4RB 3W2DL 1ZLUK 4BFBD 4BH7B 1KV3A 5C0NC 3RJQB 3TVMC 1BJ1J 5C0RH 4J1UB 3BZDA 5FYLE 4D0DA 4KUZH 3PP4H 1NUGA 4GXVH 4KKAD 2DRUA 1FO0A 1HEZA 2OP4L 5D93B 3SQBA 5E8DL 5DMIL 1DSFL 1NBYB 3BQUB 4KKCC 5HHPB 2FX7L 3CXHJ 4Q9BA 3SKMA 1E4XI 3DI2B 3HZYA 5F3BA 3BN9C 3EOTL 1KLUB 2XWBB 4GMSH 5B8CC 3SY0B 5MHSD 2YPLA 4HT1L 4U1HA 3AS1A 3D85A 1K6QL 3MLWL 5F9JA 3SDAD 3T08A 4KY1H 5D4QA 4MNGB 1T03H 5TH2B 4AENB 4GKOA 3C08H 5B39G 3IDXL 1U8OA 3FQWA 1EV2E 2Y6SC 3C5JA 3QI9D 4LVEA 3LS5L 3QIBA 4MNHA 5D2NC 2APTA 2JB5L 5KVDH 3TP4A 2EDXA 5TE4H 2HFFA 2JB6B 3FONB 4FABH 4ODXA 2ADGB 3BYTA 5C6TL 4Y5VC 4MA3B 4XWOC 4OAWA 1VFAB 2JF1A 4MAYB 4D3CL 3A6OA 4M9OA 2E9IA 1QA9A 5CP7B 1J88A 5DF0A 1CZ8H 1OAUH 4WWKB 4H0HB 1SBBA 2OLDA 3O8XD 4ZPVA 3U48A 1IKFH 3TIDB 5JLZB 3FQNB 2IAMA 4PGBA 4OLWL 3SDCC 5A3ID 5EBLB 2X4UA 5CP3A 3CSPA 3LKPA 1QBMH 2QADC 2J5LB 5T3ZE 4GKZB 5LGHH 4XPTL 4Z5RB 1DQQB 3OXSB 4S1SH 3QIUC 4WFHD 4UZGA 3NOIA 5FECA 3P4NA 5GRYA 2YD6A 3P0YH 4R8WH 1NH6A 3ABZA 4XNMA 4OF7A 2BNQE 3FFCD 3VWJD 3O81A 4MX7B 2AV1A 3OBAA 4X9HA 2CMRH 3BKML 4LSUH 1EZVY 4PS4L 1OTTC 4PR5A 1IEAA 4PIRF 4DN4L 3RX5A 1J5OL 4WV1C 2VIRB 1YN7B 4DCQA 3W2DH 4C4KO 4GXUM 3H9SE 2YRZA 3ZO0A 3EYVA 2VZ3A 3PHQB 1T3FB 4U3CA 4NN7B 1CD1B 1CR9L 4LDOB 4PJAF 1JYVA 1A8JH 2OP4H 3RA7L 5E8DH 1CTOA 1DSFH 5DMIH 1G7QA 1YEIL 2FX7H 3E2HB 4O51A 3ARDC 3KWWB 1DBBL 4HXBL 4LCWA 3JUZA 3CFKB 5EIIA 3EOTH 4HT1H 3MLWH 3GSXB 1K6QH 5KSAD 3VXMD 5A43C 3A67L 3HAEB 4JLRA 4Y1AA 2G2RA 3Q3GB 1CBVL 4XGZA 2IMMA 2NY0C 3IDXH 5I1GL 3HUJA 3DO7B 5IG7A 1MY5A 3LS5H 5FO9B 3QXVA 1X4YA 2FGZA 4XCCL 5EUOB 5HI4C 4ZFGL 1UENA 2FCBA 3ZTNL 1T21B 1NBZA 4XX1G 1JGDA 3MRBB 1K4DA 2VLRA 5DD6A 5J12B 4F57L 3GHEL 1DVFC 3WD5L 4FQXC 5JHLH 1Q8MA 3ZE1F 2H26A 4D0BB 5C6TH 3ZKMC 2CK2A 5IB2B 3M1BB 1I1YA 5E94A 4F7TB 4WI3A 2AAVA 3MJ7B 4D3CH 3TCLB 3DBXB 4I5BA 3KYMA 3BGMB 1XGUA 2ENSA 2GTWA 5CJBA 3LKQA 5A2LH 3G5VA 5JIIA 4BZ1L 1B4RA 1HYSC 2XIDA 4ACPA 4OLWH 3H9YA 2X40A 3RIAF 4K07A 4ODWA 4JZOA 1A6ZB 1QHPA 4XPTH 5D1ZB 5D2LA 4M3KB 2XWJA 3D18B 5IMMA 5TDNB 1S5HA 1EA9C 4YGAB 3IAPA 2AI0L 3CD4A 1AQKH 3CH1B 2Q7YA 3FT3B 3VFRB 3BKMH 4HIEA 1BQUA 4PS4H 4TTDC 3M07A 4PY8J 2OXHA 4DN4H 1JRHI 2MFNA 1J5OH 5IB3B 1ZT7B 4WHYG 4LBEB 4CN6A 2V5YA 3RL2A 4JFFE 4X7EC 4Y7MA 1EGJL 5FO8B 1JNHB 1FJ1A 5MEQB 4OCNC 5TPWL 1I85A 3GJFB 4LLWA 5C08B 4JCLA 4J2XA 1CR9H 1LP9E 3MODL 1VHPA 3UTSB 3RA7H 2EE9A 2WINA 4WI5A 5E8NA 2DJ4A 5FA3B 3STLB 1T2QL 3QWOA 1KACB 1YEIH 5ITBL 1DBBH 4HXBH 2FJGA 4I0PC 4MAUL 2VJXA 1U3HD 5E8EA 5T5NF 1FG2A 2DF3A 3HRZA 3WIHA 2P45B 2H3NB 2Q6WA 4EI5B 3MRLA 3A67H 2DMKA 1ORSB 3ULVE 1NMBL 3OJDB 4NKOB 1K2DB 3TPUB 4M1GL 1CVRA 4LMQE 1CBVH 2LTQC 1LEGB 5D2NE 5I1GH 4KMTL 1SY6A 1G6VK 1AFVL 1F13A 4Y89A 4F9PC 4ZFGH 2OBGA 3DX6A 4JGJA 3ZTNH 3TZVD 3QZWB 3RVWC 1DN0A 3QFDB 3GHEH 4OFDA 5I71C 3WD5H 3CZJA 3GBML 5D6DA 2YN3A 1CLOH 1KGCE 1NCAL 1QR1A 1MI5E 1Z2KA 5ICYB 3TF7C 3D9AL 4Z76B 2EXYC 3FO1A 1IC5L 3QDMB 4RGMC 1OGAA 1TETL 4BZ1H 1WVZA 3MRJA 5GS2D 4YBHA 2VDLL 4X9FA 1BVKB 3C5ZC 4UILL 4W6XB 5SX5H 1W0VA 3S7GA 4XPFL 4Z77B 2Z4QB 3MC0A 4Z7WE 3QXDA 3VGHA 4M7JL 2GTZB 2B1HL 4LVOC 4ETQB 3OKMB 5D1QA 1NFDB 1O5DT 2DBLL 4Y4FA 1S78D 3LD8C 4M61A 3RVVC 3UJIL 5EBWA 2AI0H 3TH4T 3WFCL 1XGPA 5DRNA 1JPGA 2B8OT 3QXWA 5DC4B 5HPMB 1H15A 1CL7L 1GC1C 1D6EA 5LXGL 4PRDA 3BMVA 1LK3L 3FFDB 4GRWB 1U8JA 1WV7T 2KQMA 3KR3L 5MENE 1F6LL 4NQUA 3MV7E 5TGBA 4NBXB 5IMOB 3G5XB 4HULB 1EGJH 1RK1B 5HYIA 3GUTB 3PL6C 5TPWH 2VISB 1D9KA 4B53A 5DJAB 5FKAB 1MCCA 4PJFF 3MODH 4FXKB 5GGVY 3KPRE 5HVHB 4MA1C 1U8KA 3FB7B 5FKPA 5DHYB 1T2QH 5TFSL 3L3IB 1PZ5B 4MAUH 4G43A 4J8RA 1M05B 2CRMA 1ZVSA 5L0QC 4C58B 5DJ6B 4LRIC 3HPLA 1V05A 1WIPA 3JV5A 5JXAL 4FG6C 3NPSB 3O2VL 1CLYL 1NMBH 4JY5L 1DP0A 1ACYL 4M1GH 1GGYA 5HHQB 5IGXL 1Q9KA 1KG0B 1YMMA 1FC1A 4KMTH 5KSBE 1HHJA 4KJWC 4NT6A 1AFVH 5DFTA 3SOBH 4Q97A 1X5ZA 1CGTA 1CE1L 3KHQA 4XBGA 4MXQD 1D5MB 2R4SL 3QUXB 8CGTA 3ARPA 3DOSA 3GBMH 3CDYA 1F42A 1NCAH 1S9YA 3D9AH 4P5TA 4LGSB 3KPSD 5JTWA 2OL3B 3IS1X 5C0BE 4NHCH 4PJIB 1IC5H 4P2RB 1F3JA 1TETH 4G8GB 4N1CA 4RMTA 2PTUA 4ZAKC 5C0DA 3F62A 4GRMB 2VDLH 2EYTA 4NKQB 4UNUA 1GPOL 4MJ4A 2IPKA 4XPFH 4PY7A 1Q94A 3JWDC 4JRXE 1A7BA 4LLUA 2B1HH 2A77L 2PR4L 2WUBL 5L2KB 2DBLH 1H3TA 1L6ZA 1G9NC 4C56D 2CK0H 5J6GB 3UJIH 4U1NA 3VXTB 1MIML 4N0YL 3WFCH 4L8DB 4NBZB 5D7LD 2V5MA 3IF1A 3QQ3B 1B4JL 1RU9L 2QHRL 1U93B 2I07A 2XKNB 1CL7H 5BMFL 5LXGH 3W9EB 1F2XK 1LK3H 3P4LA 4TQEL 4PJDB 3KR3H 5T1KA 1A1MB 3BH9A 2FZ3B 2ZOKB 5CZXD 2RJMA 2JK5B 5J3HC 2X4QB 4Y2DB 2ZUUA 4AG4L 2DDQH 4J3TA 5ID1A 3G04B 4WIQA 4IRSB 1Q9OA 3REVA 3QWRD 3H3PL 4YXKL 1VCAA 3EYQD 2E7LA 3MUHL 5TFSH 4Z0BL 2X1PA 3G6DL 2H6PB 3L5WB 4UB0H 5GS2H 2WW8A 3GHBL 5HHMD 1BF2A 3VE0A 3ROLB 1M4KA 4Y16B 4CVUA 5JXAH 1J0JA 3FT2A 1T0MA 3O2VH 1CLYH 3VI3F 4Z6AT 1IEHA 1ACYH 1IC1A 4O2FB 4HUXB 5IGXH 3NZ8A 4ZD3L 3SDAA 4LOUD 1RURL 2H9GB 5DJ2B 1KPUA 4AT6B 2LAGB 4XNZC 4LLDA 3DRTA 1DANU 1MHCA 1MCWW 3QFJD 3O3BB 2PXYC 1CDGA 5DVNA 2R4SH 3C6LC 3OQ3B 3QI9A 4JZNA 1P7KB 2P1YA 3MCKA 1JYNA 2E7BA 1YPZF 1NFKA 1MHPL 3JTTA 1V7NL 3X3FL 5JOEA 5DWUL 1XF3A 4TVPD 5BV7B 1L7IL 2ESVB 2FYYB 4QRTA 2G9HA 1R5VB 2B2XL 4MZ3A 1DUZB 4CBPA 1PQZA 3QUZC 1BREA 4YLQT 3LCYA 2P7TB 3TYFA 1I9RL 1FZKA 3SKNB 1N59A 4I0CC 1DZBA 1ZA3B 4JPKL 3VFSA 1RMFL 3VDCA 2J8UE 3OGCA 1GPOH 1RZIA 3O8XA 1LDPL 4RDQG 3AMKA 3MPCA 4HGKC 3DROB 3HE6D 4LHUB 2A77H 2IBZX 2PR4H 2WUBH 4CMHB 2VAJA 3BPNC 5H37H 5IB4B 3DUSA 5ERWA 1R3JA 1MIMH 4N0YH 1OD9A 3RVXD 2FJFA 2VXVL 2P44B 1B4JH 1SJVA 4M6AA 1RU9H 2QHRH 3WHE1 3BGFB 4LLQB 5BMFH 3UYPA 3FFCA 1ZGLP 4TQEH 25C8L 1ND0B 1WZ1L 5DK0B 1P5UA 4I9WE 4F3FA 3MLUL 5CEZE 5DJCB 3SE8L 2OM5A 2WP3T 4NPYB 2EE2A 4AG4H 1HILA 3TO4B 3VXOB 5GS1B 3R06B 2R1WB 4I18A 4YFDB 3OB0K 1UJ3A 5FDYA 3RGVD 3WN5B 1T1WB 3IDIB 5A2JH 2BY2A 3U36B 4FN0A 3H3PH 4TVPL 4YXKH 1RPQA 4U05A 3SDXE 5EIQA 4Z0BH 5IVOA 2QV2A 1DE4A 1T5WA 3NPZB 3G6DH 4LVHC 4X8XA 1JFQL 2O5XL 1A7RL 3GHBH 2CLVA 1KIPB 4X6DE 3S5LA 4NRXA 2I9TB 1LE5B 4QHKI 4NQDB 4F80A 2PUQT 2HT2C 2A83B 3TV3L 5SWQB 4ZD3H 2JELL 1RURH 5KSAA 4Y19D 2O5ZL 3VXMA 4WEBL 4P23B 3WDHA 3UTTD 4LEOA 4X6CE 3LY6A 4ZUSB 4NN6C 4WO4D 1IL1B 4WDIA 2YZ8A 3EIFA 3RNQA 3TT1L 3TLRA 5F1SA 3RTQA 5JA9A 1EGJA 1MHPH 3FB8A 1V7NH 5CILL 3X3FH 5F1NB 3P77A 5DWUH 1L7IH 5DK2A 4F7PA 5D96B 5DURD 2FX9L 2B2XH 3VD4A 1OOAA 4K7FA 4F9LC 1I9RH 4Y4KC 1QYGL 4JPKH 1RMFH 2NY3D 3KPLA 1YEJL 3NABL 2XYCA 5MP6L 1Y0LB 1LDPH 3RY6A 3CLFL 4ZYKA 3CXHK 5J0BA 1II4E 2CIIB 1UB5A 3VXSB 5EZIL 4KJYB 4PJXE 3U9UA 1FAIL 1QLRB 3GJEB 1MJUL 4QTHA 2VXVH 4OI8A 5C0AA 1LNUB 5F21B 1F6AA 3L1OL 2F58L 1HN1A 4YHZH 5CLWA 2EDRA 1TCRA 2XKUA 1RZ7L 25C8H 4P46A 1WZ1H 5DO2D 1GAFL 1TENA 2C4FT 3MLUH 1D5ZA 2H8PB 1JPFB 3SE8H 5L6YL 5D5MA 4GS7B 1VA9A 1FQ9C 15C8L 2EXWC 1MHEA 4GAJH 4P9HC 5I74C 4CNIB 2GAZA 4BZ2L 4L3EE 5F97E 4KRPB 3SPVA 4P3DB 4NDMB 4PJBE 2RFXA 2HJFA 4K94L 5HHOD 4E41B 3MRFA 1JPTL 1EERB 1HHKB 4TVPH 3E6HA 4DQOL 1H0DB 5HHXL 2OSLA 3U7WL 1BF8A 5A40E 6FABL 4ZDHB 3RNKB 1FSKC 3ILPA 5J06A 3LKOB 1VPOL 3F12B 1JFQH 3ARGD 2HTKD 4W68A 4N0CC 2O5XH 1A7RH 3MLTA 3T77A 1INQB 2EYRB 4H1LH 2OK0L 2RIKA 1WITA 4JPIA 1HEZB 2QQQA 3MUY1 4S0SD 5DMGC 5C0CD 3TV3H 3JWNC 1H3UA 3HAEG 1X6NA 2O5ZH 3RZWA 2Z31C 1F00I 4R2GC 1K8DB 4OZHB 2YPLB 5DMJB 5F9JB 5A16B 2QKIB 3P4OB 2IADA 4F15C 4CN1A 1K5NA 2NW3B 3DXAE 5EC2A 4D9LL 3D3VE 5DTFA 5BQ7A 3UPRA 1AD9A 1P4LB 1FYTA 3TT1H 1Q9LA 4M4RA 1J87A 4LPYA 1WFTA 4LIQL 5F1OB 2ADJB 3ZMRA 3FQWB 3OKEA 2DM3A 1CICD 1IC4L 4PRBA 4X8JB 5CILH 3TZVA 1WC7B 5IW3A 2HVKA 5JZ7D 1IGYA 4MNHB 2FX9H 3ME0A 5T3XD 2VLLB 2K7QA 1NMCB 2AS5M 4ODXB 3PWVA 1A22B 1QYGH 2VSCA 2ITCA 3NABH 1YEJH 4P59L 5K9OB 4KK8D 4YAQA 3ZKSD 4JQXC 4PJ5E 3FQXB 1UKSA 4LPWA 3WJLA 2PO6B 4RIRB 3CLFH 1BQSA 5J9PB 1KF9B 3QP3A 2AK1L 5JQHC 1NGPL 1FV1B 1IM9B 3F7RA 4NFDA 2LU3A 5C1MB 2HT3C 4ZFOL 5EZIH 3CSYB 3TNNA 3ZYOA 2AXGB 2X4UB 3RUGA 5GRUL 4OZGB 1P84K 3QISA 1MJUH 1KTRL 5BS0A 3FN0L 1T1XB 2GITA 3V0AC 1J1XL 3L1OH 2F58H 3H42L 3JTSA 3KYNA 1GAFH 2F74A 5HDQL 1HXMB 2WIIA 4PRIB 1V8HA 4NO5A 3O3DA 5JDSA 1VSCA 5L6YH 15C8H 2FD6L 4OLYL 4M7ZC 4BZ2H 1LP9F 3MRIB 2NY6D 4PR5B 5L2JA 3U6RA 5JHDB 3VFUA 2VDPH 4I4WA 4K94H 4GRLC 3WUWG 5D6CB 1JPTH 1U58B 2A6JA 4DQOH 3U7WH 5HHXH 5IROA 2L0DA 2ZNXA 3OR6B 6FABH 3QNYB 2XG4A 5T3XL 4OZ4B 2BZDA 3EJZC 2AJ3A 1VPOH 4X4XA 1CL7I 3LN5A 3ULVF 2X4OB 3VGAB 5JNYA 1DCLA 2OK0H 3GBNL 4X99B 4OBSA 3PQYD 3KYAA 4O51B 5CKGA 4UDUB 1IFHL 4LCWB 4NN5C 2CKBA 4FTVD 4IBLT 2Y5TB 3O4LD 3HB3C 2HLAA 2NXZB 3AS2A 4MMZC 2YA0A 5BZDA 4RA3A 1F5WA 4ZUTA 4XMKL 3PV6A 4D9LH 1FFQA 1RJYA 4JN2A 2KQNA 1BOGA 2R1YA 2G2RB 4LIQH 2FDBP 5H2BA 3QEUA 1IC4H 1WTGT 3C2SA 4YK4B 5IG7B 3MV11 4R7NB 4EIZC 1T7ZA 4N1HB 2DQCL 5M7QA 3DUHA 3MUZ1 4NYLA 4GG8A 4HFUL 4HG4J 5ABDE 1JGDB 5HHNA 1OAKL 1CXKA 3AY4A 3ZL4L 3QG6B 2FHCA 2NY4B 4Z7WF 5E94B 1JWMB 2MHAB 3VXQA 4MB4A 1BVLA 2MQ3A 4X0KB 3E8UL 4I5BB 4HIHA 2A38A 4HLZH 3WUZA 3G5VB 1I9IL 2Y9RT 3TFKD 2KZWA 3K46A 3O41A 5GRUH 3JV4A 5C07B 1EZVX 3PABA 4YNYA 1F58L 1NLDL 2GUOB 4NO2A 4RQQB 5E8OA 1J1XH 3H42H 4C56A 2QTEA 1JTTA 5KBNC 1E4KC 3LVEA 5DRZA 2DQFA 1G6RL 5D7LA 5HDQH 1OQXA 1LILA 2JJUA 2FECI 3NBNA 2DJSA 4N0FB 2X09A 2PW1B 2FD6H 4OLYH 3NFPB 4ORZC 5ACZA 2RHEA 3HNTL 2E5EA 4OFYD 4QYOB 1CDYA 3KXFB 4Z18A 4R4BA 1T7WA 2IANE 2NXYC 4WHTA 5JO5B 3OAZH 1RZKL 5CGMA 4ORGB 5FOBA 3B9EA 3FTGA 3RL2B 3WE6B 3PDOB 4PLKD 5CBEA 5EU4B 2HKHL 2PYFB 4ODUB 3DNKA 2ZP0T 5T3XH 2C1OA 4M1CC 3QWRA 2DWDA 5FYKE 4OCYL 1ULVA 3R0MA 4H25A 1HSAB 3GBNH 3DIFB 1TQCB 2WINB 5IB1A 1T22B 1S9WB 4MXWL 5KSBF 5ANMB 2EO9A 2HG5B 3GSNL 3OX8A 1OP5K 2XN9E 3O6FC 2EKSA 2J2ZA 1LO5B 5EB9A 4X80L 1MHHA 3BEWA 2Q6WB 1SJHA 4P4KC 4LSPL 4XMKH 3PIQB 5FGCB 3WO4B 3PWLB 4IDJL 4G9FD 3K4DA 1TQBC 1IAKA 3QFJA 1J9CT 5EORL 1VDGA 2DQCH 5T3ZD 2BJML 3DX6B 4OGAD 2OCFD 5E6IB 4OV5B 5DJDB 4HFUH 2QL1A 2R2CA 3JVGC 1OAKH 2GT9B 4M00A 2IPUG 2EEBA 2JJSA 4OQ1A 3ZL4H 4G5ZL 3BPOC 1QR1B 4YXHL 2NYYD 4XXDA 2DIBA 2BNQD 4RMWA 3VXPA 4IOSD 1IBGL 3X13B 3MO1A 3L3DB 5JW4M 4K3GA 1MCNA 4L4VE 4QY8A 4S2SB 5IOPB 5LQBL 4MWFB 3KPOB 3SGKC 2DYPB 1I9IH 4H1LA 5IKCB 3L95A 2R2EB 2OTPA 1T04B 3PWPD 1HQ4A 5TQ2H 4YHIA 5DUBA 2FHBA 3GSOA 1F58H 1NLDH 3SDYL 4MNQE 3ARXA 1WAAE 5HY9B 2R23A 1G9ML 1SEBB 5D1QB 3GMNA 3OV6A 4MQTB 5C0FA 3HI6L 1G6RH 5CJXA 2EKJA 1JHKL 3EDJA 4CVZA 3HCVA 4CDHA 3IAQA 2EIDA 1I1RA 2BK8A 4FZEL 4BUGA 5BVPH 3B9KC 3HNTH 4ZO9A 3FL7A 3V0VA 3V7AE 3WIFB 1KOAA 4PRDB 2CDFB 3MNWA 4BQ9A 1RZKH 5H35A 1KCVL 3MRHA 5T3ZL 1UWGL 2HKHH 1F11A 3IKKA 4R7DB 4ZXBC 3MROA 5FCUL 1R3IL 2V2XB 4OCYH 3EHBD 2QR0A 2WLYA 3GGWB 4AQ1B 3GMMA 5INCA 2CLZB 1HH6A 5FKPB 1OW0A 4MXWH 4MLSA 3GKWH 4MCYA 1ZMYA 3CC5B 3WBDA 5DMKB 3H3BC 1EEQA 3GSNH 1RV6X 2EH7L 1BWMA 5LGJB 4J8RB 2Q3AA 3L3JB 4EQ3A 1G84A 3QDGB 3HPLB 2R0WL 2X9WA 5I8EB 4XCNB 4X80H 1ZSDB 5HI5D 2MQ0A 4LVNB 4M5YL 5J11B 1EFQA 1I8MA 3ES6B 4LSPH 3RWGB 1OTSD 4Y19A 4KWUA 3N50A 2QQNL 4IDJH 3F6IA 4HS6A 4HBCL 3UTTA 4F7EA 3VXUB 4WO4A 2PYEE 1MWAL 2VZ1A 3W39A 3I75A 4U3HA 2UWEB 4MQ7A 5EORH 1WIUA 5KSVB 1M7IB 1QRNB 2BJMH 4PJ7B 4WU5A 1EPFA 4X7FC 5AG8A 4LDLB 1T2JA 4E0RA 2FO1A 4HIXL 4XP6L 4G5ZH 1WCBB 2J8UF 1AGBB 1KCSH 4YXHH 5C9KA 1F02I 3HA0A 1S9YB 5F6IB 4AM0A 4QTIL 4IHOA 1IBGH 3MGOB 4RZCA 1FL5A 2QSCL 1U92A 3DMMC 5EOTB 3D25A 5FF6B 1F3JB 3HG1D 3ZE0E 2NY5C 5JPNA 5FCSH 2P5EE 4G80B 1ZANL 1HXYA 5F9WB 1Q94B 1XAUA 1KTLB 4HS3A 4MQXD 4PYHA 3SDYH 4JFDB 3RFZC 2Z9TA 3F7QA 5BJTA 1G9MH 5E95B 3HI6H 4KKCD 2DM4A 3W11D 1JHKH 5FEBA 1DUYB 4JM4L 4MSWB 3BI9X 3MRPA 2Y1VA 4BFGA 4RAVA 2ED8A 3IF1B 4YIQB 4FZEH 4M93B 3SCMC 5A2IH 1I75A 4JPWL 3CK0L 4KTEL 1EIBA 1A6VL 3QPQC 4S10A 5E2TL 3PGDB 4NKIL 4PJFA 3SDXF 1ZAGA 3VRJB 3E3QC 4MDJB 1QLFA 1KCVH 4NC1C 4X6FA 3ULVD 5T3ZH 1NLBH 1IGCL 1FZMA 1UWGH 2VDKL 3TA3B 4MD4B 4U33A 2D4FA 2WV3A 5SX4H 5CUSL 4X6DF 5ID0A 5BO1H 5FCUH 2Q87A 1R3IH 1OB1A 1UADC 3H6JA 2AJZA 2OTWB 3QIWB 5F88A 1JZ3A 5IVXB 1KTDB 4JZJC 3SDDB 4HX1B 4QCIA 4ZFOA 4X7SL 1L6XA 3ARGA 2FBOJ 4XWOD 2EH7H 4U6TA 3AREB 1MI5D 3CU7A 4X6CF 1EDQA 4NCDA 1FVDB 4K3HA 1QHOA 5C0CA 2R0WH 4Z7UE 4U2ZA 3V4UL 3FN9A 4PJ9D 4KDWA 4C55A 3MBEB 4M5YH 4UT9L 4JFEB 2VABA 1QRKA 3AB0B 1U8IB 1KB9K 3G08B 2QQNH 3FQTA 4HBCH 4JM2B 1IEBB 5LVEA 3B5GA 1KPUB 1VGEL 3NCEB 1H3VA 4NC0B 1MWAH 4EVNB 4G8FB 5C71A 4U1KA 2UY7A 1T1YB 3ZDZE 2E8YA 1HINL 4R4FL 1EMTL 3NA9L 4GG6B 4LARL 1CICA 2CJUL 3CFDA 3DVGB 4IMLB 4HIXH 3OKLA 4WVRA 3DTXA 4K71B 4XP6H 4X7CC 4JO4L 4WW2C 4WFGE 5F7KC 1W2KT 3BZFB 4J3WA 3MXWL 4OQTH 4RMRA 1XF3B 2ICWI 2I26N 3RDTD 2QSCH 5HPOA 4I2XE 1DL7H 1AQDB 3C8KB 2BXZA 4UBDD 7CGTA 3ULVL 5KN5A 4PJXF 1HNGA 3TYFB 5C7XL 1YYML 1X3DA 4ZTPL 5D93C 1UQSB 4MD0B 4NQEB 5MEND 4J23A 3BQUC 1QSVA 4NQVA 5D70L 2NZ9D 1I7ZA 4KKBC 4HAFA 1ZANH 4IOFD 3L7FB 4P4RB 3O2DA 1WZLA 4B0MM 43C9A 2ZOLA 1ORQA 3BDXA 5EFIA 3QNXB 1NUNB 1LQSR 3T4YB 3DUSB 4U1JB 2ENYA 4JM4H 1FG9C 1N8ZB 4D8PA 3F58L 4B50A 1IKNC 4PJBF 3DUUA 4I0KA 4LLMA 3OB8A 4HWZB 4WY7L 4E42B 3LEXA 2YC1B 4TN9A 4JPWH 3FFCB 5DMYA 3CK0H 3ARBD 4KTEH 3VWJB 4Z78B 5E2TH 1ROWA 1KPRB 4QXWA 2NY0D 3N0PB 4P2QE 1IGCH 2OTUB 1ZTXL 2VDKH 3PWJA 3FZUC 4UU9A 5CUSH 4MAYC 2AK4E 3AAZB 3IDMA 4FQXD 5F7HA 4Q6IA 3HS0A 4WWKC 1R24A 3OF6D 4NZRL 2YWZA 4ONFL 4UQ3A 2XQYG 4X7SH 3RJDA 3ZKMD 4YR6A 5FUOL 1C5DB 4H8WL 1DE4B 2D31B 3K2UL 4YDJA 3G5ZA 5ISZE 2J5LC 4WI7A 1JIBA 5GZNC 5HVWA 4A2MA 3V4UH 1UH2A 1NAMH 3OKYA 1HYSD 4HMDA 4UT9H 3OWEA 3UJJL 5E1HB 1G6RA 4NQXA 3T2OA 5I1LB 1R5IB 4U1IB 5I1JL 1YPZA 2DIAA 5SV4A 1Y6KR 3EFFA 4QHUB 4IRZL 4DEPB 3NN8A 1VGEH 2F54E 1JNJA 3LZFL 4LF3A 1YDPA 1S7XB 4LEOB 1I9JL 3X12B 4JRXD 4ZO6A 2BSRA 4PJHE 4XMLL 1HINH 4R4FH 1EMTH 3NA9H 4U1LA 4LARH 4WDIB 5BZWB 3RNQB 3V9FA 4ZODA 1CLZL 5CSZA 4JO4H 1MRFL 1JMXA 5IBUB 1TZIA 4CJ1A 3NMEA 5GGRA 4TTDD 1OAYL 3SO3B 2NNAB 3P30L 4NN7C 1T1ZB 2Z92A 2VE6B 3UMTA 3ULVH 4QRPB 2K7PA 4KKLC 2YD7A 2Y06L 4KUCF 4R6UA 5C7XH 1YYMH 3MQIA 1NC2D 4GUPB 5HYJE 4ZTPH 4XC1L 1C08A 1SQ2N 1YZZA 3GSNA 3X14A 3E2HC 4HAGA 4PRPE 5D70H 5E7BA 5EC1B 2WLZA 3MUJA 1CTNA 4ZYKB 4N0RA 5T33L 5EU3A 1D5IL 1UB5B 4GKSB 3BWAB 1A14L 3X17A 3BUYB 3S96B 3DGGB 1OF2A 4G8IA 4I0PD 1TVDA 3F58H 2YA2A 2EDJA 4WY7H 1OVZA 4HLJA 5MI0C 5E5RB 4WENB 2QADB 3E3QE 4X6EA 1XR9B 2UZIH 1NFIB 1U42A 2BSSB 4NC1E 5DFVC 1TCRB 4KHTL 1HHIB 5J12C 1MJJA 5AZ2L 3KLHD 3QIUB 4OFYA 1U6AL 5DD3L 1KENL 1ZTXH 1MHEB 2VR4A 5EN2B 1AJ7L 3TO2A 5GRZA 1UZ8B 5DD5L 3T04D 4Y4HA 1C7SA 5CWSB 5CD3B 3RWDA 4K8RD 1CVSC 1RVFL 4NZRH 3L9RA 4ONFH 3KDMA 3QQ9C 2P42B 5FUOH 3E6FA 2M2DA 4RBPH 4H8WH 1MF2L 5JW3L 3K2UH 2A6KA 1IGJA 4P5KB 3MRMB 3MLTB 3QEGL 4K3EL 3T77B 5BRZD 1MVUB 2RR3A 1A1NB 4UI2A 3F6LA 3UJJH 1U3HB 5DHVH 4MVBC 3IU3A 4PJEE 3RX7A 1TNNA 5I1JH 3ZT6A 4KMLB 4IRZH 3BAEL 1IQWL 1E4WL 1T5XB 3ARFD 1AR1D 3LZFH 4L1HA 4EUPB 1N0XL 2XFXA 1I9JH 2IADB 1K5NB 3OKOA 1YJDL 4XMLH 1BGXL 1IT9L 4Q9QL 4NM8L 4PP1C 2IFFL 3MV8B 4X4YA 4IRJC 3U2SA 2HJKB 4XNYL 1MRFH 2M26A 4Y5YA 5E00B 4OCXL 1OAYH 4L8SA 5LAXA 3P30H 1NJ9B 4JQIL 3V6OC 4KDTC 3CU1A 2Y06H 1DBKL 5DEFB 2BNQA 4YWGL 1OP3K 1WJ3A 1ZEAL 5I1AA 2A0LD 5IB5A 1CXHA 3O3AB 4XC1H 5CEZD 2DLFL 1DVFB 1R6VA 4L29B 43CAB 4K8RL 3ECBA 2VAAA 4QXTA 3SJVD 2F19L 3HLAB 3U83A 4FQ2L 1QSFD 3I2CL 5EWIL 3IDNA 2O61A 4MNGE 4AQOA 2MSPA 1NGXA 1D5IH 4EI5C 3H9SA 2BNUA 1A14H 2AERT 3I02B 3DX8A 2EYSA 3MZGB 3VRLE 5D7JB 2EDQA 3EO1A 4IIQA 3WXVL 3CDGA 3BWUC 2A9ML 5I1DA 5C8JA 2I25N 3IXTA 4M02A 1WLHA 3KG5A 4G6ML 1R3KB 4KHTH 3TNMB 2F74B 1D5XB 2WIIB 4I48B 3BPCA 1UWXK 2M1KA 4HKXB 4NUJB 5AZ2H 3FHAA 4J3SA 1U6AH 5DD3H 1KENH 4KJWD 2F8XC 4OQTA 1AJ7H 5D72L 2D2OA 1S5IL 1CG9B 4OT1L 5DD5H 4F58L 5L2JB 3LSOA 2YUZA 4N5ED 5GZOD 1VKXA 1RVFH 1QFHA 4NZTL 1MUJB 3QUML 3HFML 3VG0L 3ILQD 5D7IB 2AJ3B 3V4VL 1AKJB 3W0WB 4DOHB 3QEGH 1DTUA 4K3EH 5TE6H 4O58L 5CEZL 4H5SA 5GS0C 1BBDL 2AKRB 1QP1A 3VGFA 5JQ6L 1MH5B 3FAXA 4X5LA 3BAEH 1IQWH 2WBJD 2GJ6D 1E4WH 3CH8A 3GEWB 1N0XH 2HLAB 1XR8A 5D1XC 1N6UA 4UDTA 3RI5K 1YJDH 3TH3T 4ZNEE 1BGXH 3PV6B 4Q9QH 3PP3K 4NM8H 2IFFH 2DBJA 4PLJD 5F89B 5H2BB 4XNYH 3QEUB 4QHLB 4YUEL 4J3UA 5L7XL 1CGYA 1KB5L 3BEVA 4XTRD 3RQ3A 3FO2B 1MLBA 4AEHL 4NYLB 3QUKA 3VFNA 1RZJC 1RJCA 5HHNB 3INUL 1FPTL 4H26A 1DBKH 1DEEB 1YUHA 4FQJL 4YWGH 3FO9A 1ZEAH 3LIZL 1A9EA 3HC0A 4HGWA 3KPSB 5T1MA 5HVHC 5DSCA 3QUYA 1TJGL 2DLFH 3IJYA 1CE6B 1XZ0B 5IHLB 4CW1B 4K8RH 4OFIA 3THML 4LRNL 2Q3ZA 2F19H 4CADA 1WAAF 4FQ2H 2YSSB 3NA4A 4L3ED 3I2CH 1ES0B 2VXUH 3OAUL 3GZKA 2DM2A 3BISA 5EWIH 4G9DA 2FO4B 3OAYH 4LU5H 2AJYL 1NAMA 4JFFA 5CCKL 1KNOA 3LQZA 3BIKB 4JFXB 3NPSC 4GQ9L 4RGMB 4NO3B 4Q2ZA 2CDEA 1RJZA 3WXVH 2XT1B 3OJMB 5EUOE 5H94A 4DZBA 2A9MH 2WP3O 3S4SB 1LP9A 4W4NA 4EI6B 1OPGL 3CFIC 3MTRA 4NKMA 3SQOL 3PJSA 3MNZA 4G6MH 4Y5XB 1J0IA 1VEOA 3QUXC 2CR3A 1KT2B 4YHPB 3GK8L 2DQEL 4RFEB 5L8JB 2PCPB 1CQYA 5D72H 5ACZB 1GH7A 1G9NL 1S5IH 2ADIA 2FL5B 4G42A 4OT1H 3FHQA 4F58H 2PXYD 5JW4Q 3FB6B 3C6LD 1B0GB 3IJSA 5GGSA 3WEXB 4NZTH 3QUMH 2D7TL 4HK3N 4PP2B 3S36X 4U2YA 3VG0H 2C1OB 2UYLA 2NCMA 3N1MC 1GHFL 3V4VH 1RK0A 3QUZD 4EN3D 4MQSB 4O58H 4Y5VA 3T8XA 3LN4A 5CEZH 4BFIA 4OF6A 1MI5A 3WNNA 1BBDH 2YS4A 4AEEA 2VKXA 1KIQB 1E28B 3KNBB 5JQ6H 3MLXL 4XNQB 4YDIL 4N68A 4FXGB 4PJ9A 2IPUK 2EKSB 4UV7L 3KPQA 1NANH 3V52L 3VFTB 1MHHB 4K7PX 3TBTA 3SE3A 2D7QA 2EZ0D 2DL9A 4U1SB 2HWZL 1RZFL 3T0EA 3ZT7A 4KUCD 2D0HA 1WF5A 4Z7WA 4YUEH 2IGFL 1KB5H 4GXUN 5C08E 3V6OE 4IS6A 4Y2DC 4AEHH 1UT9A 4BJLA 4PB9L 2C7UA 32C2B 5FGRA 3INUH 3OHXA 3ZE0F 3UTSE 4CKVX 4MYWB 3DETC 4IRSC 2QSTA 4FQJH 4XBEL 3LIZH 1HWGB 5D7KD 2OI9B 4MZ2A 3RDTA 4UTAL 5HJ3A 3BO8A 2P8LA 3EGSB 3O45B 3PNWA 1TJGH 3VXPB 3CIQA 2APBA 2HRPL 1JF1A 4OV6F 4WV1A 3THMH 4G3YL 4LRNH 1YNLL 5M95B 5EZLA 5KOMC 3OAUH 2ZKHL 2R2HB 4H1LB 5MENA 2AJYH 4GW4A 3MV7A 3L95B 1CU4L 5CCKH 4Y16C 2GFBB 1U95A 5DHVA 4S11A 1HQ4B 3T3ME 4G6FB 4ZAKB 3HE6B 3LKNA 4Z7QE 1BFVL 5C86A 1AIFB 2DQJL 5K9QI 4PRHB 5KOVC 2AXHA 3PWNA 1OPGH 4LMQI 4W70A 3K1DA 4KK5C 1JN6A 3KPRA 3SQOH 3AU1A 5E9DD 4HIJA 7FABL 2HT2D 1OSZA 1EUUA 3BUTA 4YBQC 2FR4A 2X5PA 3GK8H 2DQEH 3MUGB 2VDQL 1EEYB 4TNVK 2VZUA 5I66A 4L8CA 2H2SC 2DJUA 1G9NH 5BXFB 5BV7C 1UB6A 5LBSL 2YR3A 3CCHB 3QDME 1T0NB 5HI3C 2X10A 2NQCA 1BBJA 2DD8L 4F33B 2ORBL 3MRHB 3GIZL 5GS3A 2P24B 5KSBA 3X3GL 1F11B 3RGVB 4Z7UF 4FQXA 4W6WB 4O2CA 3OF6A 3IDGA 3NVQA 3SGJC 1EXUA 2W92A 2D4DA 3N1FC 1NFDE 3QNZA 5IHZB 3QULA 4CMHC 1JGLL 3HPJA 1CFNB 4CU8A 3C2AL 3MLXH 4YDIH 2EC9U 3IRZA 3MGTB 4LPVA 3ZDZF 5C0BA 1UWXH 4UV7H 3BSZH 4X5XA 4XVSL 4GRWE 5CMAA 3V52H 3CUPA 4FQPA 4FFVC 3IETB 2VO5A 4YPGB 4Y19B 5ESQA 1BQHA 4X83A 4ZSOB 5K93A 1S9VA 4HS6B 2HWZH 1RZFH 2YKLL 4MJ5B 1HQRB 4ODSL 3ESVF 3LEVL 4R97B 3UTTB 3PXJA 4JRXA 2IGFH 1GL4B 3L5XL 4MJ6A 4WO4B 2W9EL 3FCTA 2DWEB 4MQ7B 1E27A 1TIUA 2X4TB 3TO4C 5FA4B 1N3NA 4PB9H 2J7LA 3I3DA 5C9JA 3O3EA 3RIFK 3OKKB 4N9OB 4XBEH 3WN5C 5SWZE 2EXWD 3FRPA 4AM0B 4ZUWA 4IHOB 3BH8A 4G3YH 2V17L 1BPVA 1YNLH 3PWUB 4HZAA 2AJUL 4UTBH 3ET9F 2DLIA 1X4XA 4JO3L 5I1CL 5DUML 2ZKHH 4O02L 5IQ7L 4RAHA 5CHNA 3IS0X 4K9EC 3FRUA 3VFWA 1CU4H 2D7MA 4EKXA 3WCYA 1UVQA 1BFVH 1HXYB 4WUUB 4QHKJ 3FB5A 1AP2B 3KYOB 2DQJH 3CMGA 2B4CC 1NC4A 3MRKB 2UV3A 5BJTB 4I0PA 5FYKD 1GGTA 5DMGD 3V6ZA 4LHJB 7FABH 4LKCB 4HK0A 4W4OC 5DJYA 4PRNB 4PJGB 2Z31D 1KJMA 2DMBA 4WFFE 2ED7A 4NGHL 4WCYL 4YDKL 1X5AA 3IFNL 3T65B 5LBSH 4PJIE 4P2RE 2XN9D 4NSKB 5D96C 4G8GE 5ITFB 2YD1A 3MRGB 4U31A 4TVSa 4J4PC 4TUJA 1AGEA 2DD8H 5INDA 5IV2A 4XHQA 4F9PA 5GJTL 5C0JB 2ORBH 5J56B 4NRYA 4WTWA 3C9NA 3GIZH 1FZMB 3MMEA 3X3GH 4LQ1A 4G6AC 4YH6A 5HHOB 3LKRB 1I7TA 1CXLA 1T6VN 1YNTB 5B38A 1MRCL 3MSPA 5L2KE 4JY6B 4XAKD 4IDLA 5HGDB 5DJZA 1XGTA 4XZUA 3OZ9L 2ATKB 1JGLH 5DHXB 3H3KA 3U4EA 4ZFOB 3S5LG 5E5UB 1JWUA 1N2RB 3T0EB 1HSBA 2EECA 3C2AH 2BC4A 1DQDH 1V3JA 5BRZA 2AXFB 1NGZA 4PJHF 1FLTX 4PGCB 5DQDL 4XVSH 3TPKA 4L4VD 4PFEA 5GGUB 3EJYD 3G6AA 2P8PB 1U8LB 3F7YA 3ARFA 1URLA 2J8UA 2N4IA 3FQTB 5F93C 2YKLH 3WS3B 1AY1H 4ODSH 3BP7A 3UAJD 4GS7C 5FYKL 3L5XH 2OX5A 2W9EH 1MIEL 4MB5A 5IBUG 5IBLD 3GSRB 3SGEH 4MNQD 1ZE3C 1HCFX 3TBYA 5D7SH 3CVHA 1FFRA 3CGTA 4V1DD 4N90D 3B6SA 4XI5D 2BX5A 1QLEL 1PY4A 4QRRB 4D94A 4YO0A 4XP9L 4I1NB 3CSBA 2V17H 3UTOA 2AJUH 3U1SL 4JO3H 4X98A 5I1CH 1G0XA 5DUMH 4O02H 3PL6A 4NQSA 5IQ7H 3WNLA 2LQRA 1A6TB 1A64A 3GMPA 4U7KA 3PGCA 3SJVA 1I7ZB 4Y4KB 1A6AA 1MJ7L 5JW5A 2IALA 3MYJA 4OF5A 4NRZB 3SDXA 4DVRL 5ESVB 4LRIA 1E0OB 4KJPD 5C2UB 4MDIA 2ESVE 3QJFA 3ZLQC 4M8VA 3HB3D 4NGHH 1DBAL 1KB5A 4WCYH 4YDKH 4OJFL 4X6DA 3IFNH 2XQYK 1MELA 4RDQF 4PV8B 3TEUA 2X1QA 4XVJL 3D0VA 1P53A 1NMCC 2NY6B 2J6EL 2CRYA 3Q6FB 4JFYB 4ZMAT 3QWQB 3GB7A 1E6OL 1HDMA 5GHWH 5F7UA 5J7CC 4X6CA 1I3RB 2PYED 1MRCH 2PO6C 3JSSA 3IDMB 4PJEF 5K9JL 3OZ9H 2H32H 1B9ZA 1AI1L 4K3DL 4R26L 1DBML 4ONGL 4X5WB 4JR9L 2KKQA 5E2UL 4YDJB 1JHTA 4BK5A 4OCRL 1XMWA 4N0UB 5IW6B 4WW2F 5K9KA 2FJHA 2DIJA 3PQYB 5CBAB 5DQDH 3U46A 3CDFA 5KW9L 1EHAA 1GIGL 3QDHA 2HN7B 4Y0GA 4FTVB 4NFBA 5I73B 3MLPA 2IH3B 1JK8B 5I1KL 1LO2L 1G6RB 2YWYA 4OTXL 1LEIA 5DJ0A 3QEHB 3AC0A 1GGCL 3O4LB 4AK1A 3OL2A 6CGTA 2R9HC 2VERN 5FYKH 1ED3B 1MIEH 5IFHL 1R3HB 2PTTB 1S9XA 3VW3L 4QF1A 2BSRB 1JGEA 1OGTA 4R2GB 4ISVA 4R96B 4H0GA 1VB9A 1OLLA 4A6YL 4HC1L 4ELMB 2DTML 5IK3B 1QEWA 5DGQA 1JYXA 1QLEH 3MACL 4ZUUA 4XP9H 1NANI 2XWTA 2Z92B 5GPRA 5EA0L 3VWKD 3U1SH 1ZA6B 1AO7B 5TDPA 3B2UD 1X5XA 3DV4B 4NQDE 4RWHA 3FQUA 4L4JA 3VGAC 3VRLF 1N2RA 3QA3B 3BP6B 3D69A 3FT4A 1MCEA 1E4XL 3EYOA 4L3EA 3EO0B 3IKCB 2NX5B 1MJ7H 4PJBA 1LD9B 4HZLA 3OKNA 4OF0A 1NL0L 5HD8C 1JJUA 5JORA 5J1AB 2NXZC 5EU3B 4Q0XL 1G7LB 3K80A 4DVRH 4EXPX 3BPLB 3FN3A 5C0IA 2BP3A 1CFBA 2BNRB 1I1FA 1RSFA 3VFPB 4JFQA 2CIKA 3CFEB 4HJ0D 3QO1B 1JWSA 3O6FD 2H1PL 5IMKA 1YEEL 1DBAH 4YK4C 4OJFH 5IF0B 3D6GA 3H0TA 3HI5L 2XACC 1OL0A 4PGDA 4XVJH 5EO1A 4L9LA 4MJIB 2J6EH 4S1RL 2NTSP 2C9AA 4P5MA 3KLSA 3HZMA 2PXYA 1E6OH 2BMKB 3UBXI 5DJXA 3TO2B 3C6LA 4Z0XB 4P0DA 1U91A 3G9VA 1RUPL 3WLBA 4ZNCD 3DXAA 4AJ0A 3HE7B 3D3VA 1WWBX 3VXSE 1P9MA 1Q9WA 5K9JH 4YPJA 1AI1H 2AV7A 4GRLB 4K3DH 1VADA 4R26H 1DBMH 1EFXA 1FNLA 4ONGH 4JR9H 4NNYA 3ZDYE 4QO1A 1AC0A 4KZEL 1KELL 3QUZA 4WFGD 5E2UH 4EN3A 2OMBA 1P2CA 4RGNB 5H37G 2V7NA 4OCRH 3RWJB 2D7PA 1QZ1A 2YK1L 5KW9H 3L3KB 5ESAB 5DGRA 1GIGH 2ARJA 4JJHA 3S88L 2IAMD 3QDJB 5I1KH 2KPNA 3JV6A 4OTXH 3V6FA 1GGCH 2ZJSL 1S7SA 4MMXC 5B3NA 2C3VA 5F9AC 4PJ5A 3TJHD 4XXCC 3BMWA 2ZNWA 1WBYB 5EBMA 1MCPL 5IEKA 5IFHH 4E41E 1QFPA 1FFNA 4KZDL 5JDJA 3VW3H 4ZUVA 3Q0HA 3V5DB 4G9FB 1MCWM 5IMLA 1RHFA 2IH1A 1MJ8L 1G7PB 3VD7A 4A6YH 1QSZA 3VFOA 5IT2L 2V7HB 2DTMH 3AM8C 3QO0A 5I75B 3MACH 3VXRD 5CJ5A 4XCYB 1C8PA 1IGFH 5EA0H 2X9XA 2X70B 1XF4A 3RHWF 5EOQL 4X9BA 2B5IB 3S9DB 3BRGC 3D48R 5F7WC 3ARWA 1TQCC 3SE9L 5EUOF 5FOJA 4PYGA 4OZHE 4ZXBD 2C5DC 2WQRA 2YPLE 3OPZH 2AEPH 4FMFA 5DEGB 1NL0H 1ZHNB 3VG9B 5C2BL 3PWPB 1HKLL 4Q0XH 2W60B 2AK4D 2BNUB 3DX8B 3DYPA 1FN4A 2BFVL 3NACL 4L3CA 3UYRL 3V4PL 3WO4C 5DJ8A 3EO1B 4BM7A 4UNVA 4YGVB 2H1PH 1MWAB 5E9DA 1YEEH 4U6YB 5ISZD 3T0DA 4D2NA 3M8OL 4AMKL 1FL3A 5E6IC 1F4YH 1NKRA 1BZ9B 1FZOA 3PE9A 5T1DL 4V2BA 3RX8A 1I8IA 4ZPTA 1AR2A 4GFTB 3TH2T 4MXVE 1FIEA 1BFOA 2CUHA 3X11A 5IJVB 3BZEB 4XP1L 1RUPH 4HK3J 2F54D 1IZKA 1SEQL 4LLVA 3CX5J 2ZSWB 2YBRA 1VKXB 1CGXA 1LMKA 2F9BT 4OZGE 5ECJE 1B2WL 1M6OB 4JHAL 4KZEH 1AD0B 1KELH 5CINL 4F9LA 1DDHA 3TCXA 2UZXB 5EU6B 1PG7L 2I60L 4K23L 4JKMA 1FGNL 2YK1H 3LDBB 4DK6A 2LABA 4PRIE 1MCJA 2WBKA 3S88H 1JZ4A 2CXKA 3IFPA 5F8QC 5D1QC 3IRPX 1A1OA 1S7VB 2ZJSH 2J88L 5HYJD 1AGCB 1FZJA 2YEZA 1JV5B 2EEDA 4GAYA 1JRHL 4XCEA 4PRAB 5GIRB 1A4JA 4AIZA 4PRPD 1MCPH 2AJSL 5JHDE 4KZDH 3KPPA 3V8CA 1TXKA 1IQDB 1MJ8H 4KXZH 2VWEC 3RRQA 3U82B 4OD3L 1MCOL 3D2UB 1NDMA 3JXAA 5IT2H 4JRYB 5B39A 2IBZY 3BD5A 4GW1B 3T0AA 3SCMD 3ULUC 5EZJB 3MRCB 4OCMC 3QPQD 4EDWH 5EPMB 5EOQH 1ITBB 3AXLB 4BSWB 1AGDB 3IGAA 3T3MF 4WI9A 5AAMA 4JAMA 2H32A 4LCWE 2RAMA 4Z7QF 3SE9H 4OB5L 5IQ9B 4H1LG 1UM6L 1MLCB 3IJYB 5DQJA 1HOCB 5JIPA 1PYWA 3RKDC 3SGEI 3HG1B 4ZOCA 1XCTB 5C2BH 5GSVB 5EBGA 3UROR 4G8EA 3UZEA 3Q5YA 2N7BA 3ARVA 1Q38A 3GSWB 4LVNC 3T1FA 1QPPA 5J11C 2BERA 2BFVH 3V4PH 5MERA 3NACH 3UYRH 5IESL 4UQ2B 4DZBB 3ZDXE 3RI5F 3FO0L 2NY5L 1XGQB 2A6DB 1NAKH 2VLJE 3PJSB 1FP5A 3EYFA 3SKOB 3DURB 3M8OH 1M7DA 4AMKH 1C16B 2XI9A 1JUFB 2F5AL 2HJLB 2Z31A 4LHQB 1CXEA 1U8NB 5T1DH 1VFOA 2QHLA 2XN9A 1A9BB 5EUKA 2GK0A 4ONHA 4WW1A 5F6IC 2CGRL 1NFDF 4PG9B 4X4ME 4G42B 4XP1H 1I1AB 1U9KA 4QWWD 1IILE 1SEQH 2XTJD 1NMAL 3B9KB 5B3JE 3C87A 5DYOA 3UTQB 2PNDA 5T5NG 4ZOEA 3DVIA 2XV6B 3IDJB 2P8MA 4H20L 5C07E 1GOGA 1B2WH 5JOPE 4JHAH 3P0GB 5CINH 2OQJA 4GRWF 4HJGA 1PG7H 2I60H 2SEBA 5F9WC 4OGXL 4K23H 4EBQL 1NDGA 4GQPH 4NIKB 1OGAD 1S7QA 1FGNH 2E7HA 3LN4B 5HVGB 3TBVA 5DEZA 5GRWA 1J10A 3BJLA 4HHAB 4JQXA 2BOBA 3CX2A 3MREA 3IFOA 3BQUD 1MFEL 3QEQB 2J88H 4QEGA 4HDIA 4L4VA 4UIMA 3UTZB 4PJ9B 1JRHH 1MAKA 2X4SA 4M6NL 4N8VB 5KSUA 1M1SA 2YMXL 2BRRL 2AJSH 3KXFE 2ARWA 3BE1L 2BCKA 4TOYL 3VXNA 2Q86B 5IFJA 1N26A 4M93C 3S98A 2W59A 1MSPA 4Y4FD 4XHJC 5JPMA 4XBPA 3BOVA 3S37L 4OD3H 1HH9B 3S3SA 3WIHL 3NFNA 4NQCB 1MCOH 1J1OL 1OT2A 4R3SB 3BP4A 3ALWA 4DAGL 4WHDA 2X4PA 3TA3C 4MNQA 1YEGL 3MJ6A 4HH8A 3LQAC 1WAAA 4F2MB 1P7HL 5I2IB 4KJQC 2BVTA 1SY6L 2Z8WC 2LV4A 2EIEA 4WEUD 5DQ9A 5C70A 4RGOL 3QIWC 5ANME 3WFHA 4GSDL 3N85L 2FIKA 3BO8B 1U2CA 4OB5H 3I6GA 1XIWB 3PNWB 3Q6GL 2E7LC 3SDDC 2PW2A 3FZUD 3K8MA 1D9KD 4POZC 3AREC 1JTOA 1FNGB 2EDKA 4KKAC 1HHHA 1LE9B 3W5NA 1SJEB 1W8NA 4AIXA 5FGCE 3O11A 1DR9A 3SKUD 3MBEC 2PF6A 3AB0C 4OBRA 4DUVA 5IESH 4JM2C 4BQ6A 5FDWB 3LRSB 4M48H 4PJIF 3SDAC 5CJOH 3NCBB 5GZND 2NY5H 4HF5L 3PWNB 3H7BA 1NGYA 1B0RA 2F5AH 5DI8B 3IT8D 4FQHA 3QI9C 4A6YA 2R15A 2VDNL 4K71C 4KY1L 2VQ1A 3KJ4B 2DB8A 1A2YA 3EDFA 3ARBB 5EO0A 5I66B 3U0TA 2CGRH 2PETA 2Z8SA 5E0QA 1D5BA 1NMAH 1D6VL 5E24E 3P9LB 1BBJB 2YRPA 3MJ8B 4LASH 4XH2A 4OLVL 4ELKB 1RUKL 4R0LA 4H20H 1CFVL 1ONQA 1KLGB 2PYEA 4P5TD 1TCMA 1X5JA 4JKPL 1CGUA 5IJKA 2ILLA 1X44A 1YY8A 2NTFA 1FFPA 4HUVB 1RFDL 4OGXH 4WU7B 4KKLD 5EIVA 4EBQH 1MRDL 3QULB 5CIPB 5A3IC 2GJZA 5ICZB 2AQ1A 4ENEC 3MOAL 2DI9A 5F3HA 1FNEB 2MJWA 5FK9A 1MFEH 4JFOA 1IKFL 3RU8L 3DV6A 4FRWA 4M6NH 2YMXH 2DQGL 4TOYH 2R0LL 1E4JA 1G7IA 3BE1H 5CMAB 2VB5A 4PGEA 1EHXA 3VWJC 3S37H 3MA7A 5TDOB 2GYSA 1OARL 5HGAB 3WIHH 1J1OH 4B7IA 3ULUE 1I7UB 4JJ5A 4MJ6B 4DAGH 1E4KA 5E2JA 5DDHB 2JIXA 2EDFA 1NBQA 1L9NA 5DFVD 3BP5B 3CVIL 4PY8I 3ROOB 1SY6H 2COQA 3O3EB 2CMRL 4YHLL 1UJ3C 3EOAB 3QRGL 1DLHB 3HMWH 2MTPA 4RGOH 4GSDH 1SMOA 3N85H 1AH1A 1J8HB 1K4CA 3Q6GH 3CFJB 3CFBB 3VWKA 1N4XH 3S6CA 1TVHB 3HZKA 4RFOL 3QDGE 2CPCA 1MCLA 4NNXA 1NC2B 3D39B 1HHGB 4L4TD 2AABL 2AP2A 1ZS8A 3FRUB 5HSFA 4OIIL 4QRSB 3EDEA 5HYSA 3QQ9D 2XICA 1QD0A 4U1MB 5I17A 3CLEL 4NOFA 3VXUE 2K3TA 5CSBA 4HUUA 4OUOA 2UWEE 3MRDB 4XPAL 1QRNE 4PJ7E 4DEPC 2MQCA 4F37K 2NLJB 2GK2A 1UXSB 5C09B 4HF5H 1NKOA 5D1ZD 1F4AA 3N1GC 4MVBD 4JRWA 4RMVA 1K9TA 3O6FA 4TUOA 3DRQA 3I50H 5KANG 2VDNH 5SX5K 1WISA 4P4KA 4U6HB 1WGOA 1BM3L 2BSTB 4Z7UA 5E2WL 5IIEB 2OXGA 3U79A 3SO3C 2E6JA 1F2QA 5JW4N 3WJJC 5K59E 1D6VH 4NRYB 3C9NB 4OLVH 4L9DA 1RUKH 3P73B 5B4MD 1CFVH 1CFQB 3AMLA 3JVGA 5DVOA 1N5AA 5JHLL 4JKPH 2IEPA 1CI5A 4JFDE 2QEJA 5ETUA 5HYQA 1Z5LB 1RFDH 4QT5A 1I4FA 4P57A 3V5KA 3RY6C 3RWHA 1MRDH 4YDVB 2UVEA 4KI5E 3UTSD 2DTSA 3EOBB 3MOAH 2YPKB 3WHXA 2APXA 3GSQA 2X2YA 5HGBB 5BRZB 4I2XA