1AR1C

Structure at 2.7 angstrom resolution of the paracoccus denitrificans two-subunit cytochrome c oxidase complexed with an antibody fv fragment
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
118
Chain Sequence
b'EVKLQESGGDLVQPGGSLKLSCAASGFTFSSYTMSWVRQTPEKRLEWVASINNGGGRTYYPDTVKGRFTISRDNAKNTLYLQMSSLKSEDTAMYYCVRHEYYYAMDYWGQGTTVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title Structure at 2.7 A resolution of the Paracoccus denitrificans two-subunit cytochrome c oxidase complexed with an antibody FV fragment.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Complex (oxidoreductase/antibody)
total genus 24
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1997-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ar1C00
3P4MB 4TTDD 1OGAA 1IGMH 3JWOL 1NGXB 3BYTA 4X6EB 4OIBA 3CLFH 4KGLA 2ZSWB 1D9KA 3LV3B 2WINB 4PJCB 3HZVB 5IB5B 1CD1A 3V6OC 4LBEA 7CGTA 1BVKB 2HT2D 2GW5A 3F5WB 5F96H 4X4ME 2NY5H 4K7PX 5IK3B 4RFOL 2E3VA 3RWDA 1KJ2A 4JPVL 3SPVA 1KIQB 1B0GB 4GKZA 4P2OC 3SKNB 3EYQD 4N8PA 4PBXA 2VLJB 3IKCA 2I5YH 1CGUA 1HOCA 4WFGE 4ONFL 4P2RA 1REIA 4O4YH 1IKNA 5J6HA 4OCRH 1QR1A 2ED8A 5CLTA 4XNYL 2YD9A 3FO1A 4D0CA 4IRJD 3C60A 5C0CD 3VW3L 3DSNA 3A6CH 4X6DA 4WVRA 1RULL 1NFKA 4HKBB 1V3KA 2IADA 2IQAB 5H37H 2FD6L 3KS0J 4QOKD 2DKMA 4K9EC 2VKWA 3NZHL 3DYOA 5ID0B 3BMVA 4TVPH 4NRXA 4IDJH 5JIIA 2CO6B 3NPSC 1LP9F 4OQTH 3UPRB 2YRPA 2QQKH 1EFQA 3Q5YA 4K7PL 4OFKA 1FC1A 5GISL 1T5XA 4DK3A 3EJYD 1KTKE 3S97C 2OBGA 4DKEL 2VLKA 3IRZA 2XZZA 5F7EL 3L5XL 1RUKL 2X70A 3RGVA 5FHAL 2W0KA 5EU4B 3QNXA 1XCTA 3IJHA 2ZZUT 3JWNC 1JNJA 2UWEB 2XV6B 3LS4L 4RGMC 1A7BA 3H0TA 1CFTB 2EDYA 5I1GH 3LS5H 1HDMB 4MWFA 3B83A 5LCVH 4GRWB 4NT6A 3RY5A 4HBQA 2X4SA 5CIPH 4JQXA 4NHCH 3WFCH 3VGFA 5T1KA 1ZT7B 4MX7B 3VGAB 1T20A 1FZKA 4HKZB 4LASL 4JFED 1NLDL 1S5IH 2ATKA 2CR3A 1H3TA 3MNWB 5C7XL 3U7WL 1NEZG 2Y7QB 1UVQA 3DIFA 2J1KA 1A7OH 5F1OB 3Q6FB 3QAZB 1C1EL 3BPNC 4E41A 3ILPB 1VGEH 1KPUB 5EO9A 2VISB 5EN2A 5KZCB 1J8HE 4P9HL 4KUZH 5FFLA 4ZFGL 5INDA 2P1YA 2F5AL 5KSBA 5E70A 1NMCC 3QR2A 2J6EH 3VWJD 1T2XA 2FX9L 3FB8B 5DXWA 5T3XL 4QRUB 2DKSA 3KPNB 4XNZC 2H41A 4L3AA 2OZ4H 4UTBH 3WIHL 4FQQB 1T1WA 4XNUH 1T0PB 1ZE3C 5DUPL 5I6XC 4KPHH 4RRPG 4JO2H 3TIEB 2I25N 4PRHA 3THML 1FG2A 2EDKA 4Y4KC 4HT1L 5D8JL 1AE6L 4G6ML 1H8OA 1WBXB 1V7ML 1UM6L 4PY8J 3BI9X 4ZYKB 3OKLB 3WNNA 3R4DA 4K94C 4J12A 5L2KE 1I3GL 5E2TL 1HKLH 3WE6B 3BGFB 4U1IB 4DVBB 4M6OL 4P2CG 1CDHA 5TDOA 2RR3A 1RURH 4RAVA 3FOMB 1L9NA 5E5UB 1CGSL 4WHCA 4CJ1A 3Q6GH 5E2VH 1S7WA 3IJSB 3D3VE 3OKNB 1IAKB 2FATH 1MCEA 4PUBH 3E2HB 4MXWH 3LN5B 1KCRL 5HI3C 4FFWC 3TIDA 4EOWH 3IU4H 2HFGH 2DLTA 3I3DA 4Q6IC 5IT2L 1R3JA 3F7QA 1QLFB 3QQ9C 4AEFA 4UAOB 5IUSA 1UENA 1NGZB 2YWZA 5B4MD 4OV5B 2Z4QB 2PXYB 3KJ4C 4FQ2H 2VLRB 4X5XB 1XAUA 4APQD 3E8UH 4XPHL 4H8WH 3V4VL 4B41A 1EFXD 1W0VB 4DUXA 4PRNA 2P5EB 2DLGA 5DD3L 4NQEB 3UTQB 4F57L 1XH3A 1NUFA 4L8CA 4PG2A 3C8HA 3MNVB 1LK2A 2GUOB 4IRJA 1VGKA 4W6XB 3QFDB 5C0CA 4K9EL 3EUUA 1QO3B 4QOKA 2VLME 4YDJA 1DANT 3SDXE 1GGYA 5FYJL 2ZP0T 3KXFD 3HPLB 5HHMB 1A1MA 4OLXH 5F9JA 3N1QC 4I48A 1X6LA 2PF6A 2B4CH 2DTML 4AG4L 3QQ3B 1BWMA 2P49B 2CKBA 4J3OC 2JCCA 1HQRA 1CK0L 2W0LA 3WHE1 5A2IH 1TJGH 5DMKB 4NQVA 5MHSD 4LEOA 4ODXB 3MCKB 2L4OA 3RTQB 4XAKE 1QHOA 4LKXB 3OPZH 5EBWB 3S5LG 4FXGA 3QXDB 5GGSB 1M05A 1TPXC 3TV3H 3VDAA 1K4DB 5KVDH 4HUUA 4MNHB 4G8GE 2DJUA 4M43H 4TSCL 3HC0A 1PQZB 5MEOA 1AXIB 1C8PA 5HHOD 4HHAA 1G9MC 1E6OH 2AJXL 4X6BA 3TJHD 3T0ED 4KK9C 3G9VA 4JFEA 3VWKB 1FV1A 4NQDE 5FYKD 1CFSB 4IDLA 5CD5D 4MNGE 3T65A 5L8JB 4E0RB 1HK6A 4X80L 5ITFA 2R2CA 5GGTA 3LPFA 4LSPL 3SKJH 4ZPVA 4C56B 1NJ9A 3HC4L 4A6YL 3BEWB 5L0QB 3ZT7A 1CD0A 1KBGH 1I7UB 2AXJA 25C8L 3OAYH 4MZ2A 5DHYA 2VL4A 3GBNL 4F8TA 3QEGH 3HMWH 4KRLB 2PETA 3TFKD 2OS7A 2XNAB 4XC3H 5GGUB 3B2UD 4IRZL 5J7CC 1A7PH 4BSJA 3G5YA 3VWJA 1OSPL 1DL7H 5HGDB 4M7LH 2X4UA 2YC1A 3UJIL 1U8NA 2VDNH 3TBVA 1KEGL 5IBTH 5SV4A 5JORB 4X7SL 5F7KC 4JM2D 4LVNC 5CD3B 5DMYA 2Y36H 1OQOA 4YAQA 4Y19B 4FOMA 3DETC 3RVUC 1JPTH 1AO7D 1N64L 3QBTB 1N4XL 5IEKA 3DWTA 4BUGA 1AR1D 1CDIA 2HH0L 5JO5A 4WFED 1OAUH 3CMOL 1AY1L 5CCKL 3UTSD 3ARBD 4C57C 3EZJB 2NY3C 4YHNA 1TXKA 2DI8A 3OKOA 4TUKH 1MI5D 1CD1B 4LBEB 2VDRH 5DRNB 4AL8H 4N9GA 1EGJH 2NY1C 3GSVB 5CEYA 3LPGA 3RWDB 3P9MB 3SPVB 5E8OB 4GKZB 1FYTD 2BHYA 4S0TD 5HPMA 2I07A 1B90A 3IKCB 5CILL 1OGTB 2JJSC 3UROR 3W11C 3CDGA 1JIBA 4RDQG 4P2RB 5C1MB 3VXPB 1QR1B 1MVFA 1HILB 3VXSD 3FO1B 4D0CB 4ELMA 5L88H 3CSPA 3FQWA 3DYMA 1YNLH 2C1OA 3ZHKA 2IADB 2YA0A 3NA4A 1WK0A 3GFUA 1MY5A 3SCMB 4APQA 1N6QL 3RPIA 4KV5F 3FCTB 1M7DA 5T1DL 1EFXA 3ZSTA 1V7NH 1A3QA 4NOBA 4DN4L 1QP1A 2MSPA 3T8XB 4Y5YC 1O5DT 2X4NA 3DV6A 1A1NA 5FF6A 2H1PH 4C4KO 4YHML 1BJMA 1T5XB 2BJML 2GKIA 3DMMC 5JXEC 3DV4B 3HUJE 4LOUD 4XZUA 4JFFB 3V7AG 3F7VB 5FUCC 4EDWL 5T1LD 1UWEH 1MCBA 2GJ6E 3RGVB 1Q0YL 1XCTB 2EH7L 3IJHB 3KXFA 2H8PA 4WTZA 5DC0A 2EEAA 3FRPG 4ISVB 3AU1B 1JHLL 2CGRH 2Z35A 2QR0A 3LRSB 3H0TB 4OIAA 2BVOA 3H6JA 3ULUF 3OXSA 1NCCL 4MWFB 2CRIA 4YZFE 3GSQB 2PR4H 4NT6B 2ERJB 5EUKB 4TVPD 2X4SB 3MRJA 3VG0L 3WJJC 2FX7H 1FNFA 2AK1H 2A9NH 4OLWL 5AZEL 5T1KB 4ONGH 2MKLC 3ZZ1A 1BFOB 2JTDA 1P7KB 4MCZA 2PN5A 5HY9A 4JDTL 3TBTA 1FZKB 1NC2A 2EO9A 2YD5A 5C0BE 3CFBA 3QP3A 5IIEA 2AQ3A 1RIVL 4OCLC 2ATKB 2WBJB 4UV4L 3UJTH 3ULSA 5E94A 2BVPA 1UVQB 3HI6L 2QV2A 2R15A 4E41B 4JGMA 2EDXA 3T0BA 4PLNC 4NUGH 4Y88A 1ZLVK 1HHKA 5EO9B 1G9ML 5KTEL 5EN2B 3ZDXF 4L8SC 4FZEL 2AS5M 2WP3O 1FO0L 1W72A 1FVEA 4HZAA 3QFJB 4YNYB 5HHOA 4HEPG 4MS8C 1MF2H 5KSBB 4OI7A 1SBSL 1LMKA 4Y7MA 5L9DH 3T0EA 2VDKL 4Z18A 1BEYH 4N1CA 5C08B 4AIOA 2NXZD 1I9RL 3ISWA 4PJDE 1X4XA 4WEBH 3RY6A 1T1WB 4M7LT 4PJFF 1PG7X 2O5ZL 4E5XB 4LQFL 3A0OA 4PRHB 3ZYOA 3K2UH 3L3GA 2P5WD 4Z7WE 3SGEH 5L7XL 1OW0A 1WC7B 1MHPH 4NKIH 2Q8AL 5FGCB 5FB8A 3DX8A 1X4ZA 4XCEB 3GNML 4R7NB 3I6LE 3PNWA 1K3IA 4OFIA 4X7CC 3TYGL 3JV5A 4L3ED 2OSLB 5BVPL 4P2QE 1T7YA 3MXVL 4RAVB 5D5MF 2X1PA 4U1SB 4JZOA 4X4ZA 1GC1C 3MUGA 5EOTA 5JPNB 3VD7A 1J0KA 4JM2A 4GQ9L 3VXOB 3V4UH 2B39A 3U79A 2YZ8A 4K7FB 3OWEA 1AO7A 1F4YH 2DD8H 4YEFA 5HD8C 4MVBC 2D7PA 3MJ9H 2UYLA 4XMKH 3UTSA 3ARBA 4L4TA 4WV1C 1YQ2A 3F7YA 1FGNH 3CFJA 3DVGA 1IL1A 1PDKA 1S3KH 5EC2A 1PG7L 1MI5A 3OKDA 1P7QD 1NCBH 5HI4D 4N8VG 1FE8L 2GYSA 4PRID 5JLZA 1MFNA 5DD1H 3SGJC 1U2CA 3G5VB 3MLVL 4N68A 4UQ3A 4KTEL 2FZ3A 3UTOA 1FYTA 1UM4L 5D2LA 3SDCC 1CZ8H 1CF8L 4HUXA 2MFNA 1QRNE 4I4WA 1NUGA 1B2WH 5E08H 1E4KA 5SX5K 4TPRH 1XH3B 5F7FA 3VXSA 8FABB 4IRJB 1TTUA 1MCSA 1YECL 5C0CB 2EDBA 3GMRA 2HLFC 3Q1SH 1FGVL 4OBSA 3SO5A 4MZ3A 1HWGB 2NY2D 5IEHA 5FYJU 4QOKB 5BV7H 3GIZL 1TNNA 5F9JB 5DQDH 4ZUWA 4H88H 4I48B 4MLIA 1VCAA 4NN6B 2VZSA 1P2CB 1RJYA 5C2BL 5DRZA 1XGTA 2OJZL 3OBAA 4JKPH 3NACL 3LQAL 2JCCB 1WAAF 4JCMA 4LMQI 4YHLL 4JB9L 3C08L 1UQSA 2HN7B 4GW5A 4HUVA 5T1LA 4FXGB 5CGYD 4HFUL 2VR9A 1M05B 1FBIH 3STBA 2BNQD 3UDWC 2B1HL 4U0RC 3QZWB 4HUUB 5F6IB 3D9AL 2KZ1B 4GW4B 5MEOB 1QBAA 2CDGB 5E2UL 5KAQF 4Q58C 4Z8FH 4HHAB 4P5KA 4OQTA 1F4XL 2OLDA 1YEEL 4RIRB 2ADJA 1S7SA 4XWGH 5T3ZD 3OAYK 3JV0A 4ETQB 4JFEB 1FV1B 5FGBC 3T65B 4ODTH 4YBQC 3N06B 4NFCA 5ITFB 5DR5L 1NJ9B 1MCOH 3BWUC 3T3PF 5TE7H 4HGMA 2LVEA 4DWHA 4ALAH 4IMKA 3S3SA 1A64A 5DHYB 3N1FC 2VQ1B 5GGVH 1F4WH 1YJDH 1ZT1B 4OZIA 2BY2A 3O3EA 4ZTPL 3FT3A 4K7PY 1Q9WA 2EDDA 5CIPA 5GZOC 3ULUH 1GZQB 3G5YB 3PQYE 3VWJB 3KS0H 4WFFE 2X4UB 5AYUL 1U8NB 2VDLH 4UB0H 4I0CC 3TBVB 5TPWH 3RDTC 3JSSA 1JF1A 4QXWA 2DM3A 3ARGD 3U46A 4ZDHA 4YAQB 2ZUVA 3TNMB 4FHBD 1AFVL 2HFFA 1MPAL 4WI8A 2P5WA 4ZS7L 5JO5B 4MNQD 5CEZL 3ZKQD 4LK4A 1U58A 1IRAY 1WJ3A 2OL3L 3AB0C 4Y2DD 5EOCL 3RVTC 4PRPD 2FYYA 3VRJA 3KGRA 1EV2E 3OKOB 2AJZA 4JG0H 1WIOA 2RB8A 2YS4A 4L3EA 2L0DA 1N59B 4LPTA 5C09B 4N9GB 5A40E 4R4FH 1EIBA 2V17L 3V6OE 5J6GA 2NXYB 4G9FB 4WI4A 4P46D 5J1AB 2YN3A 4P23B 4LARL 4LCIH 3O0RL 2XWJA 5HPMB 2I07B 4XCCL 3QUZD 4BK4A 43CAA 3BRGC 2FSEA 3MRQB 5JQ6L 2JK5A 2DWEB 3KPOA 3ARDB 2LVCA 3S34H 4Z6AT 5FO9B 3QCVH 1IAII 4F37K 3EO9L 3FQWB 3MUJA 4V1DB 3MACH 1P7QA 5JHLL 4Y5XC 3QEQE 4M7ZB 4HC1H 5TE6H 4PRIA 4TSAL 5TE4H 1Z9MA 3RPIB 1JWMA 1OAKL 1KJ2L 1YMME 5I71B 1DDHA 1M7DB 2DQDH 2NR6D 4JM4L 1KJ3L 2DF3A 5KVEH 4KDWA 3RAJH 3O2WL 4QNPE 2PYED 1E4XI 1RY7B 2X4NB 1T1YB 1F3DJ 1A1NB 4XXDA 1Z9SA 1I8IA 4YO0A 5FM5M 4XZUB 4X0KB 1CFBA 1RU9L 4Q97A 2J8HA 4RMVA 5GS1B 4OZ4B 2UUDK 1YYLH 1A4KA 2AK4E 3IKKA 1BF8A 1JZ4A 2P7TB 3WO3B 3KXFB 1SY6H 2H8PB 4PJ7A 1T83A 4DTGL 1U8MA 1DSFL 2Z35B 4AEHL 2QR0B 3UC0H 1EHLH 2VDOL 2CO7B 1OAZH 4AEEA 4YX2H 4PJ5E 3GSNB 1Z9OA 4HJJL 3RJQB 1BJ1J 1NC2B 1NANI 4UOW0 5IIEB 4IBLT 4QRPB 3K4DA 3NGBB 1FL3A 5MEQA 3TH2T 3ULSB 4OUUB 3B9DA 4KY1H 3NABH 1QFWM 1H0DA 1WZLA 3WDIA 4GS7B 1BZQK 1ETZA 3E3QC 3I02B 2NY4B 3LEVL 1KF9B 1FVEB 4KK8C 1JNNH 1UFUA 1YEIH 4ZUVA 3U1SL 5CSZA 5CKAA 3HC3L 4RGOL 2VZUA 3HI1A 5DT1H 4G6JH 5A2KH 1DUZA 5ISZB 4YHKH 1GZPA 3OB0H 3T0EB 3TO4C 1ES0A 3QDJE 1TJHH 3WLWD 3MLZL 2AJSL 2WWKT 4WO4D 5MI0B 3QHFH 2LTQC 3AAZB 3RVVD 1KSRA 1XF1A 3SJVB 4X83A 3N50A 1C5BL 5HDQL 4NJ9H 1M7IA 1E4WL 2J4WH 4M7JL 4UUJA 3BZDA 2YD4A 5D1XC 2XICA 5MEND 5DFVD 4WI7A 1OAYH 2NYYD 1CVSC 5AAMA 1Z6JT 3GSRA 3MLUL 4QLRA 1A14L 4D9RD 4G3YL 1VFOA 4I2XE 4XB7A 4DVRH 5TGBA 3MUGB 3ARGA 1N0XH 3CFIC 4JM2B 4NC0B 4RA3A 2DLHA 1KB9J 1AO7B 2XKUA 1MWAL 4MNQA 5D2NC 1J0YA 2FGZA 1CS6A 5KSAB 4MXVF 4Y2DA 3UTSB 3REWA 1D6VH 4L4TB 2BFVL 4PRPA 3F7YB 4JG1H 2IBZX 2OI9B 1IL1B 4LDOB 5EC2B 4XH2A 2Z93A 1MI5B 3OKDB 1QSFE 4O9HH 2DI7A 3VXME 5ICYA 2B5IC 5B3JF 3QIBC 3BXNA 4NPYA 1RZ8A 2YUWA 4AH2A 4UQ3B 3B4NA 4P46A 5FM8A 1FYTB 4IIQA 4XCNA 3QUZA 2C3WA 5C3TA 4ZOAA 5I1EL 2A1WL 3H3PL 4ZD3H 2AGJH 1KC5H 2IAMD 4OCWL 4YPGA 1RHHA 1VEOA 5ADPH 2HVJA 1IQDA 3GMRB 1QLEL 5I19L 5GXBB 5IGXL 4UQ2A 2W0FA 4I0PD 4M3KB 1CGXA 2X2YA 4XHJC 2JB5H 2E7LC 3LQMA 4PREB 5C0RL 2FX8H 3FO9A 1Q94B 4ZUWB 3KPRB 1EGJA 3UTTD 1NCWL 2MKWA 4IJ3B 5EO0B 5IBUG 3TH4T 4LU5H 3ILQD 4ZTOL 3HUJF 2PYEA 2HKFH 1IBGL 5FXCH 1RJYB 4HIHA 3WDHA 4NQCB 5DRZB 1XGTB 1KN4H 4R2GB 1YUHB 3TT3L 3EO0A 2DQFB 3T0WA 2O5XL 1X44A 1HSBA 3BQUD 3FOLA 1MFAL 4NWUL 2CDEB 1I4FA 1OARH 4QRTB 1JZ7A 4GW5B 5T1LB 3FO0L 4N1HB 3I3EA 4KKBC 2ORBH 5EPMA 9CGTA 4YH6A 2PO6D 4GG6E 1KCSH 3QCUL 2NLJA 3MZGB 2R2BA 3W0WE 2X4RA 5IROC 5KW9L 5EO1A 5GSRA 2CKBL 3DI3B 1MJUH 1OTTD 2HP4A 4P5KB 4NBZB 4NM8H 2DB8A 2ADJB 3R06B 5I1KH 1UZ8A 1S7SB 3D5OF 3RUGA 4OZFB 2EH8H 3C5ZB 4OD3L 5GRUL 5J13B 3QZWG 5CJXA 2VDQH 3JV6A 5CINH 3DX9B 4PR5B 1LE5A 4PTTA 4H1LH 3LRGA 2P24A 3DVFA 4Q9RL 2OP4L 5KBNC 3O4LD 3W82A 3GJEB 4OV6F 1Z9LA 1CLOH 4HLJA 4OZIB 3VRIB 1NPUA 1BPVA 3HCVB 3QRGH 1RUQL 4PJDF 4ZUUA 1Q9WB 5CIPB 3AS0A 2AJYH 5ACZA 5JXAL 3CX5K 4R8WH 4DGVL 3ZE2E 4EZMA 3MROB 4ESKA 3B5TA 1BQLL 2NXZB 4IRSD 4F9LC 4LCYA 1FL5A 5GGTL 3MRRA 1JF1B 4XCFH 4M93B 3QUYA 3U46B 1JTOA 3AM8C 2G60L 5F7HA 4DFHA 4KK6C 1G7JA 2HFFB 3MLXL 2Y9RT 2P5WB 3OAZH 1J86A 4NC2B 1U58B 5FUOH 5B38G 2KBGA 4XVTH 1IC7H 4XP4H 3ARFB 2FYYB 3VRJB 4Y16D 4EQ2A 3IDNA 5MENA 1A21A 5C07E 3RZCD 3V0VA 4IHOA 5FCUH 4XVSL 5T5FL 3ULUD 1I9JH 1FNGB 1NH6A 1YY9D 2E8YA 1QLRA 1S5HB 1MNUH 4XMLH 5BW7C 5J6GB 2Q8BL 4UT9L 1S7XA 1F90L 1KLGA 4PB0L 4N90E 4FZ8L 4NQXA 3VFGH 5DEFA 5IMMA 5D9SA 2FSEB 1IZKA 1L9MA 2JK5B 2XZCH 3BKYL 4JCLA 1GHFH 3KPOB 5IWLA 4JRXD 1WZ1H 5CUSH 3B8YA 1OP9A 4RAUA 2F53D 2ZSVB 4Q7DA 1DQDH 1UYWH 5E9DD 2JJWA 5TF0A 2PTTB 4JY4A 2ZG3A 4PRIB 4V2CB 3I2CL 3VFTB 2VR4A 1JWMB 3Q2CA 1G7LA 1DDHB 4W6WB 1RK1B 4Y89A 4WW2A 3MOAH 5BRZD 1T2QH 3MNZA 3WBDA 4J3VA 3MYJA 1PSKL 3QUXD 1I8IB 2IAMA 5EBGA 1MCWW 2IH1A 3HLAA 1RZKH 2BNUA 4Q0XL 4JKKA 3BZFA 2NY2B 4WJ5B 4PRBB 2B20A 1A4KB 1QA9A 3OJ2C 3ZTNH 2ARJQ 3K4AA 5FUCE 2XTJD 5E4EB 2XZQL 1FSKB 4X4XA 4JE4B 5DK0A 5C6TH 2C3VA 3OAUL 4PJ7B 1JV5B 5LJYH 1U8MB 3HB3D 2R29L 3UTTA 3CGTA 1HINH 3WJLA 1U93A 2DRUA 4NN5B 4KDTC 3BDXA 3ZT6A 4JJ5B 3QSKB 3W5NA 4KH2A 4E42A 3BQUA 3FFCE 2DMBA 2VR5A 1VFAA 5DI8B 4LLYB 2R4RL 5I8OL 4YXKH 4EUPA 1MRFH 4YEEA 3RVWC 1UCBH 1FRGH 1FL3B 3TWCH 1A6WL 5MEQB 2H2SC 5JW4M 1M6OB 4RGNB 2PO6A 3BHBB 3CH1A 1J0ZA 4QTHA 2FO1A 1H0DB 5K9QG 3OB0K 4NCC1 2X4OA 4I77L 3O6ML 1FN4A 3BD4A 5ENWA 3SDDC 1E6JL 4J4PC 3L6FA 2WIIA 3L3KB 4M6ML 3S36X 3PL6C 1UM5L 5CSZB 2EC8A 2AV7B 4WFGD 3HI1B 4BQ6A 4J23A 4NGHH 2DDQH 1MUJA 3B9VA 4JO4H 4ZS6D 4Z77B 1TZHA 1ZANL 2WBWB 1AXSB 1A9BA 2XN9B 1FZMA 3IDXL 3TC9A 3D25A 5HVGB 4GKSB 43C9B 1UKTA 4TYUA 5GRWA 2IGFH 1A3LH 1DEEA 2XFXA 4GAGL 3O4LA 2EZ0C 1W72L 3ZE1F 5SV3A 1WBZA 4POYA 5IB3B 1M7IB 3NIDF 3QHZL 5I1HH 2B1AL 5FYKL 1FNEB 3KLHC 3ARWA 1DBAH 4HZLA 1JNLH 4OFVA 1E27A 5CEZE 1EJOH 4IRSA 1A22B 4NNPL 5CJQL 3S36L 3GUTB 4I3SL 3MODH 3MRHA 3FQTA 5DMGC 4LPXA 3ARGB 1NDMA 2EIDA 5C3LD 3UZQA 4YQXL 3JWDC 5I18L 5M7QA 1NAMH 2ZCHL 1G7MA 3FAXA 1DUYA 3REVA 3RQ3A 3DXAE 4XP5L 3FB6B 1CFNA 3VFUB 3GMNB 3REWB 3BIBX 2K1MA 1WCBA 4Y16A 3RZCA 2QHLA 2Z93B 3L3DA 3WS3A 4WFHE 5GRYA 3W2DH 1QSVA 2C4FU 3O2VH 4QTIH 4ZXBB 1N5YH 1QFWH 3G6JE 1R3KA 1K6QH 1OTSD 1RZ8B 4AH2B 4P46B 4IIQB 4XCNB 3K1KC 5F3BA 2R69H 4POUB 1KTDA 4TTGA 4LPCA 4TSBL 3ZDZF 3WO4B 4H25B 4FRWA 4ZUTA 1ZEAL 1WF5A 3K2MC 2G75A 4JFXA 4JRXA 1JZ6A 1J8HD 1RHHB 2F53A 5FHBL 2PCPB 2HVJB 1CDJA 5E9DA 3KYMA 4J3TA 5C0NC 2ZKHH 5HYQB 5SWSE 1KLFA 4UQ2B 2WIMA 5I1DA 1Q0XL 4G80B 1PKQB 3JWOH 3CXHK 3U0PB 4WI5A 4PGEA 4K3EL 1MRDL 3RIAK 3HZMB 1NQBA 1DFBH 1T7ZA 3D0VA 4XPAH 3FO9B 4LRIC 2VKXA 5BRZA 4NZRL 5J89A 4O2CB 4YHZL 5I74B 4HIHB 3C8DA 3MJ7B 3QUXA 3IETB 3QG6A 1BVLA 4N0UE 4HMCA 4XP1H 4RFOH 3PXJA 4RAHA 1HSBB 4JPVH 4HQQL 4AZ8A 3PF2A 3R8BB 3LD8C 3CLFL 5EFIA 3MOQA 4LLUA 3IDYB 2QTEA 4PJFA 3H9SE 5L2KD 5TFSL 1JGUH 2IALB 3TYFA 4XNYH 1X4YA 1PEWA 3VGAC 4HC1A 1KJVA 15C8H 1OTUD 1RPQA 1OM3H 3IRPX 2D03L 2R2BB 3BPOC 1RULH 1NGQL 1U8QA 2VITA 1QBMH 1LO4L 2FD6H 1NFDE 1TJIL 4LCCC 3D3VD 3QAZC 3QO1A 4R97B 3HNVH 4J8RA 4KHXH 4XPTL 4O4YL 1UZ8B 4YHOH 2ZCKH 1KULA 1LWRA 3UYOD 1A3RH 2GTWA 2WW8A 3VJ6B 3K3QA 4N5EC 1L7IL 2DQJH 3JV6B 1CN4A 1FQ9C 1AC6A 1F4HA 5EOCJ 4XWOD 3MRKA 2VE6A 4DKEH 1LE5B 5F7EH 4JQIL 2IWGA 5DVLA 1BOGA 2XXMB 3L5XH 4NNXA 5K9OB 2A6JA 4TVPL 4JZJA 1RUKH 1Z5LA 2W91A 4Y5VA 5I8EA 5I16A 3M1BA 4FFVC 2F54B 3MV9E 2IPKA 4ZUUB 4J2XA 3LS4H 4OZFG 2G2RB 3CFEA 3OAZK 3SOBH 4HG4K 2L7JA 4X9BA 4KKAD 3MRRB 3PWPE 1BQHA 3U48A 2AQ2A 4FXKA 2VLMD 3H8NA 3QUYB 4FQJH 2X40A 2J8OA 3QYCA 2EDEA 5CP3H 4LASH 2H9GA 1G7JB 2PW1A 1F3DH 4FG6C 3U7WH 3QDGE 3LS5L 1NCAH 5LCVL 3OGCA 5DJCA 1XT5A 5F7NC 3N85L 1DJSA 2EXYC 3BE1L 3IDNB 1BD2A 4IMLA 4ZUSA 3GSWA 3VXTA 2YXFA 2M26A 2XWBB 1QLRB 4UNTA 4U2ZA 4XAKD 1S9WA 1WIPA 4U6XA 2F5AH 3EOAA 1NCTA 5LVEA 1SYVA 4X6CE 5HYJB 1FL6A 4NJAH 2WANA 3RX5A 2FX9H 4JKMA 4NQXB 1W0YT 5DEFB 3IB4A 2PXYC 4Z78A 1JGDB 1VGEL 2XYCA 4G8GD 3OL2A 3VD9A 5J11B 3WIHH 1P9MC 2OQJA 3I6KB 2Q6WA 1BJ1H 5DUPH 5HYSA 5E8EA 5H94A 3WL9A 1X5ZA 3MRPB 5HI5D 1I3UA 5D7IE 1BIIA 3STLA 1KYOK 4JY4B 4HT1H 1UB5B 2XQYK 1AE6H 3L95B 4G6MH 5DA0B 4MSWA 1V7MH 1UM6H 1ORSA 5FA4A 4RMWA 1RZJH 1LNUA 1G7LB 5KOVC 4JFDE 5E2TH 4UTBL 2ED7A 2W1NA 4PJHF 3ZKXB 4XNUL 3GSUA 2H32A 4WNQA 4M6OH 4MMXC 5CWSB 5I30L 4LLAA 1CGSH 1J8HA 4XPBL 4L29A 1PYWA 2DLEA 1W0WA 3MUZ1 3HLAB 3K81A 4S1SL 2D9QB 3DROA 2YBRB 3BZFB 2X41A 4U49A 2C3XA 1HKLL 1TLKA 3MTRA 1IGYA 4HCRH 5DK0B 2EO1A 2C3VB 3M8OL 2HRPL 1UWXH 2XI9A 4WI6A 3RTQC 3VMNA 5IT2H 4FQXD 3UBXB 3UTTB 1RZGA 5AWNL 3LB6D 3CJJA 5C6PB 5E2VL 5BZDB 1U93B 1JGEA 2E9WA 2GCYA 5FKAA 2UZYB 5EBMA 2FATL 1LO0H 4PUBL 2X5PA 1MFCL 2ATPA 3D69A 4E42B 3BQUB 4ZFZB 3IU4L 1WFUA 1VFAB 4JFQA 2HFGL 2W60A 5DD3H 5GPRA 5TF1L 5L2KA 1GSMA 5EIIB 5GZND 2PO6B 3CH1B 3MRIA 2CRYA 4HLZG 5F6HI 4P4RB 5F93C 4S1QH 4FQ2L 1A5FL 3BP5B 1UJ3A 3FZUC 4K9EH 3VWKC 5BV7B 4HH9A 3VXUB 2NY6C 4QRSB 3IXAA 1MCNA 4GMTL 1C5CH 1FIEA 3VFMA 3L6FB 2WIIB 1OF2A 1ONQA 2NTSP 3D3VA 3QI9D 3E3QE 4Z7OE 4NUJA 4I3RH 2BVTA 4RNRB 2NY0D 5JZ7C 3SGKA 1YMHB 4QRQA 1MUJB 4TUOA 2XPGA 2B0SH 4AG4H 1U8PA 1A9BB 5DWUL 1FZMB 2XKSA 2G9HB 4OZHE 3D25B 5DO2D 1CK0H 3DUSA 1F3RB 12E8L 3TCLA 1DEEB 3QUKA 2IBZY 4OLXL 4ZOBA 1B0RA 1OVZA 4GKOA 4QGTA 4LDEB 4YBLB 3VG9C 3BRFA 2B4CL 5F9OL 1WBZB 1G9EA 5FYKU 5T3ZL 4WIQA 3DGGA 1HNGA 1TJGL 3X3FL 4AT6B 1SBBA 3I75A 1AIFA 2HTKD 1KENL 1G9NC 2EYSB 1JZ8A 4O02H 1Q9OA 3UMTA 1LO3L 4KRPC 5DYOA 3OX8A 4OZGE 1N0LA 1CTNA 5IW1A 3MRHB 3FQTB 2GJ6D 3Q0HA 5CJBA 3SDXA 3HE6A 1B0WA 1D5ZB 3TV3L 2H26A 1G7MB 4GRMA 4Y4FC 1DUYB 1OP5H 2IF7A 5C9JA 5DD0H 4H1LA 4X80H 1CFNB 4G6AC 2FHFA 1ZSDB 4CN6A 3MJ6A 1FP5A 4F7CA 4LSPH 3MFFA 1S7RA 4BUHA 1WCBB 3ARQA 5D2NE 4Y16B 4A6YH 3GKZA 5EA0L 3R1GL 4OLUL 3VFSA 3RZCB 1N6UA 1UC6A 5D7LE 4EI6A 25C8H 3WS3B 2Y06H 3GBNH 1IKNC 3B6SB 1OPGL 3MA7A 3MMEA 4EEEA 5C0BD 2HFEA 4HV8A 4PJEF 3TVMB 2D7NA 1OSPH 1J0JA 3VGBA 5F3BB 5CZVL 1KTDB 1X5KA 3UJIH 3SCMC 4ZUTB 4PJ9B 4ZNCD 3L5WB 1KBGL 4G8GA 4JO3L 2G75B 3LCYA 1I7TA 4X7SH 1RJCA 2F19L 4KKCC 3ZKND 2YHGA 4K94H 2VMFA 5I1DB 1N4XH 4RFNB 2HH0H 4PGEB 1DL7L 1NGWB 4KVNH 5CCKH 4KI5C 3D0VB 3T09A 3ABZA 1IKFL 1T3FB 3O6FC 4TOYL 1HHIB 2VABA 1BZ9A 1URLA 2Y36L 3H7LA 3GMPA 1I1AD 1JPTL 3QG6B 2OR8A 1BVLB 1CQYA 1OCWL 3OXRB 4QY8A 3DGCR 4LKCB 1BHGA 2EDQA 3BH9A 1YEGH 5SWQA 5EFIB 5CILH 2ERJC 1LEGB 1T22A 5MEPA 2V2XA 3L7EA 1DQLL 4PJFB 3C2SA 1ORQB 5FAAA 3VFPB 2HAZA 3SKUD 2XTJB 3T3ME 1XIWD 3AFLA 3TYFB 4AL8L 1EGJL 1KJVB 4FQXA 1OP3H 3ZMRA 4P2QD 1S8DA 5LGJB 1IQWL 2VITB 1U8QB 2WBJC 3T4AA 3ZHDA 1YDPA 4JKWA 4AQOA 1N6QH 1IC5L 3QO1B 4Y4HC 4J8RB 5T1DH 3PG2A 4P5TD 5D5MB 3ORJA 2ZG2A 3VA6A 4DN4H 3MREA 2CLVA 4Z0BH 5C70A 5L88L 3GM0A 4UILL 1J1OL 5D7SL 1A9EB 5HHPB 4YHMH 4L9LA 2BJMH 4PLKD 4U7KA 2JJTA 1V7NL 4JZJB 3AREB 5BZWB 4Y5VB 5I8EB 3M1BB 4PJGF 3RX8A 1Q0YH 3MV8E 1EX0A 3WUWA 5ADOH 3QI9A 2EH7H 3GKWL 3WEXA 1MJ8H 3VFOA 5IOPA 1DANU 1QRND 3QPXL 2IPKB 4AYFA 4KQ3L 4Z9KB 2H1PL 3F58L 5J12C 4B5EA 3T1WA 3X17A 1P4BL 1NCCH 4KRNA 1ZHBA 4NO2A 5AZEH 1BQHB 3Q3GA 4YWGL 1FFPA 4LAQL 2OXHA 2DWDA 1J0HA 4JDTH 3EGSB 3D48R 1S7UA 2H9GB 3SQBA 2PW1B 1RIVH 3RKDD 3T2PA 2HVKB 2A74A 4UV4H 1WFOA 3KNBB 3OGCB 2PR4L 4O51B 3HI6H 1A7NL 2QKIA 2FX7L 2N7BA 1BD2B 1MIML 5CEXA 4IMLB 1OLZA 4NQSB 3RKPA 4ZUSB 1G9MH 3CSYA 4LQ1A 5GGRA 3GSWB 4M62H 4FZEH 2FWOA 1FO0H 3HUJA 4IM8A 2A0LD 1QKZL 2GJ6A 5TQ2L 3HE7D 3RWHA 4QXGL 5IESL 3MBEB 5JW3H 2CKNA 4Z78B 3ESUF 2H6PA 4NUGL 4U1MA 3DO3A 3LKPA 1I9RH 2XQBH 2Q20A 3EIFA 2C26A 5ILTL 4OD1H 1ACZA 2QADB 5DA4A 3WL9B 1MF2L 4M7KH 1HEZA 1JK8A 2UZXB 1QFUL 3IF1A 3QHTC 3STLB 3DYPA 2HTLD 3CH8A 1XF3A 3G04A 5INCA 5DFTA 5C0BA 5FA4B 2SEBB 5E2JA 1G7QA 1BEYL 1I7RA 1SJHB 1KPRA 4U0QB 4JHWL 1VA9A 3OZ9L 1A8JH 3TYGH 3GSUB 4WNQB 1AGCA 5BVPH 2HT4C 1TFHA 1NSNL 3MXVH 4PLJC 4Y0GA 3K2UL 1I75A 1NAMA 1UWXK 4XVUC 3P0GB 1J8HB 1W0WB 4NN6C 4GQ9H 4OTXH 4LLWA 1MHPL 1VESA 4ZNEA 4X6DF 3KYNA 4JREB 1KV3A 1T89A 3PQYD 4F9PA 3IU3B 4XNQA 4WFFD 4ODUB 2VNCA 4QF1B 4X6FA 1JPGA 3WNLA 4PJDA 4QWWC 4JFHE 4O2EA 3WNMA 4L4JA 1FE8H 1BMGA 1JGEB 5KOMC 2AW2A 1I1AA 4W68A 3WNKA 2Q76A 3MGOA 1F4YL 2DD8L 3MLVH 1F4AA 2DBLH 4ELKA 2Y6SC 4KTEH 4Z7WA 3FAWA 1CF8H 1N5AA 2W60B 5JMOC 1FGNL 2EDLA 2R2EA 1IAOB 5L2KB 2B7DT 4POZC 4NO3A 2CQVA 1S3KL 5EOQL 5CJ5A 4MDJA 3LN4B 1XIWA 1NCBL 3GBML 3UBXG 4NKOA 5EZJB 3MRIB 5JOEA 5IMKA 3X11A 5DD1L 2EIZB 1UJ3B 4P2QA 2QJDA 4HH9B 3S3JA 1AGBA 2ZPKL 5E0QA 4X5LA 2MHAA 1CZ8L 3VFMB 4YXHL 1OF2B 2IANE 1N6VA 3PV6B 3WSQH 2VSCA 4CL7A 3QUML 4P5TA 3X12A 5E08L 5EU6E 4P2OD 3UYRL 3MOBH 4QRQB 2P8LB 4TNVF 3W39B 32C2A 1XGRB 4L8DB 1U8PB 5GS0C 2OJZH 5IVXE 3LKOA 3NACH 1FNSL 2FGWH 1LEIA 4KTYA 3TT1L 4YHLH 5BV7L 1FJ1A 4JB9H 3KWWA 2IH3A 3S35X 3LQZA 3QUKB 1YMMD 3D39E 5DQDL 4H88L 4XTRC 4WWKC 1QRNA 1T0MA 1WBYA 2B1HH 5GRZA 4KU1A 4JKPL 5KSBF 5HHVL 4WWID 3DGGB 1RUMH 3D9AH 4CKVX 1PY4A 5MERA 1G84A 1FFNB 5B21A 4Z7UE 1Q9OB 5E2UH 5I75B 4ZODA 1F4XH 1YEEH 2AK4D 4L5FH 3V5HA 3NAAL 3HE6B 4CU7A 3GMQA 4KJYB 2MCPH 3B5HA 3NIFE 5C9JB 1UXSB 4H1LB 2NXYC 1FORL 2K3TA 4F7CB 5LAXA 4LLQA 3MFFB 1S7RB 4P23C 4K3GA 1MIEL 4W4OA 3S9DB 2KDGA 3S35L 3VFSB 1S7TB 2XA8H 4PJ5D 4EI6B 3FL7A 3VH8A 1GCFA 2VLJE 4XWGL 3ARDC 1U8LA 2JELL 3MA7B 3MMEB 4ZTPH 1R3LA 2HFEB 4HV8B 3HE7A 3IFPA 4KMLB 4J3WA 1FIGL 5AYUH 4H26B 2OTPA 1MCOL 5TE7L 4S1RH 5CP3A 3LZFL 3V7AE 5I71C 2QL1A 2R8SH 1J9CT 4LMQE 5GGVL 3IGAA 1YJDL 4X5WA 3FFDA 2I27N 1P84K 2DQTL 4ODBD 1RIUL 5CBEA 1AFVH 5DS8A 1MPAH 1G1YA 5CEZH 4ZS7H 1DVFA 1EERB 5F6HJ 1H8NA 2OL3H 4BSWB 3QDMB 3IDMA 1F6LL 1G6VK 2VDLL 2KZWA 3QDJD 1RK0A 3QB7C 5E03A 5GS1C 1L6ZA 4L4VD 4OSUL 1GC1H 3SGEI 3TN0C 3T77B 1UKQA 4BFGA 3CLEH 3VGHA 4F3FB 2V17H 3LMJL 1OP3K 5D96C 1YEJL 3CFCH 4LARH 5SWQB 2UWEE 1NC4D 3ARVA 3QULA 3WIHA 4Y4KD 5MEPB 2V2XB 3PWLA 3QRFM 3BN3B 3DVIA 5JQ6H 4JG0L 3PQYA 4GRWE 1X7QB 4K23L 3ALWA 4MB3A 2VL5B 2AV1A 3EO9H 1MCCA 4RMUA 3NGBC 1MJJA 5JHLH 2YD2A 4QEGA 4XP9H 3WHE0 4YHPA 4LCIL 2R56H 4TSAH 1YDPB 3QJFA 4XNMA 3TP4A 5KANG 1OAKH 3WHXB 3H3BC 3WS6A 4OM0L 3MRFA 1KJ3H 5EBLB 1ZGLP 2JJUA 2NY4C 2CLVB 3MREB 3O2WH 5EWIH 5HI3D 1A6TA 4FFWD 3P73B 3UBXI 5HGAB 5FO8A 3AMLA 5LXGL 3ZKMC 2F58H 1QSFD 2YUZA 4L9LB 3VXMD 3QQ9D 3B43A 1A0QH 1RU9H 4HCRA 1UXWA 4JY5H 4PP2B 3V6OA 5IV2A 5IHZA 3WFHA 1LDPH 4UU9B 2EDWA 3JTSB 3P4LA 1WWWX 5FYLE 4DZBB 3WEXB 1JN6A 3KLDA 4YDLC 5MI0C 3VFOB 5DJ2A 2CDFA 3FONB 1FFOA 3A6BH 4P2OA 1U3HC 2NY0B 1DSFH 4AEHH 2C1PA 5HPOA 3NFSL 4PJAE 2VO5A 3FQRB 4X9HA 3SDAC 2A77L 3LVEA 4ZMAT 4MJ2A 4XMPL 1DEDA 3ZE0E 2OTUA 1F11A 1YYLL 3Q3GB 2X05A 1FFPB 3BPLC 5DDHA 1FAKT 1C12B 1YMMA 2A6IA 4MD4A 5IBLC 3TNNB 3UC0L 2A74B 3K80A 3VI4E 3MRBA 4JGJA 5MP6L 4NFDA 2QKIB 5FUZH 3KPQA 1OAZL 1KT2A 2VYRE 4UIKL 5CEXB 1DLFL 2VDPH 3L9RA 3CSYB 5GGRB 1LGVA 5C0JA 3LEVH 3CCHA 2FWOB 1T80A 4M9OA 3HUJB 5KSAC 4QT5A 1DE4A 4LVHB 3U1SH 4HKXA 4ZO6A 3HC3H 2R1WA 4I13B 1A47A 4RGOH 3NN8A 2OI9C 2C7UA 2GJ6B 2HMIC 4XBGB 3F8UB 3RWHB 5LQBH 1YEDB 1U36A 3JVGC 4KY1L 3VCLA 1NKRA 5HXMA 4R4BB 1MH5A 3MLZH 4U1MB 2AABH 3W0WD 2YMXL 2VLRE 3ELAT 4J3XA 5DHVA 5F1IB 4B7IA 4ZAKC 1YEIL 1U41A 2J8UE 4PJ5A 4Y8AA 1HEZB 1JK8B 2DYPD 2P5EE 4G6JL 3IF1B 3KPSB 4YHKL 5E5MA 4AIZB 5E6IB 5HDQH 2CPCA 3GGWB 5C0BB 1G7QB 2EKSB 1E4WH 4KRMB 4DAGH 4M7JH 1HHGA 3N1MC 1KPRB 1BLNA 1ZS8B 2J5LB 2XT1B 1BM3H 3VXRE 4KK9D 3MGAA 2AXFB 1U3YA 3DRTA 4D8PA 2AXHA 1QTYT 2IPTH 5L6YL 2ZOLA 1I9EA 1YQVH 2GK2A 1AGCB 5CZXC 4OF5A 3U4AA 1A14H 3DUUA 1NAMB 2WWMC 3NFPB 4IJ3C 3EOYG 3O4OB 4LLWB 4ELMF 5F7DB 2J4WL 3KYNB 3B9KB 4R2GC 3BP4B 1S7QB 1MWAH 5FOBA 5IFAL 2V2WB 5KAQG 1CGTA 2KKQA 5IW6A 4XNQB 3MRDA 2WUCL 2BFVH 3QDJA 1MFBH 3BGMA 4U1GB 1JPGB 4PJDB 4L4VA 2FO4A 4CVXA 5T33H 4M02A 1KIUA 2ICWA 1VENA 1QQDA 4C4KT 1I1AB 1FZOB 2WLYA 3MGOB 5TH2B 3ROOA 4YGVA 4ODWA 3BT2L 1KIRB 5D1QB 4Z7WB 1Z2KA 3DETD 3RVUD 1N5AB 4YGAB 3FRUB 2VXTH 4Y4KA 5DJXA 5DUBA 5A3IC 4JG1L 5FECA 3H3PH 4HS6A 2R2EB 3C09B 4NO3B 5C07D 4R4NC 5ERWA 1XIWB 2NY3D 4JHBA 4NKOB 4O9HL 5I66B 4HFWA 3K46A 1JTPA 2GI7A 4KROB 4P2QB 2FJHB 1OOAA 1AGBB 1VFBA 3C5ZC 4I2XA 5C0GA 3O9WC 5J13C 2NY1D 2DLFL 4KXZH 5DK2A 1UEMA 2YEZA 2VN4A 4N90D 4U6YA 2PYFB 2AGJL 4P5TB 3X12B 5IF0A 4IMKC 3W9EB 4C56E 3W11D 1GPOH 1IBGH 4LF3A 32C2B 5FV1L 4PGCA 1T1XA 1J05A 2D0GA 3PDOB 4GG8A 1ZWIB 3LKOB 3E6HB 4LHUD 4Q6IA 4JHAL 2V7NB 1QSFA 3F7PC 4NWUH 4P4KC 3VXMA 4AY0A 3VI3E 1AKJB 3FB5A 2IH3B 1XR9A 3LQZB 4HIJA 5I1LA 1T21A 4LSUL 2FIRT 3FO0H 1SEBA 5A2JH 1QRNB 3QCUH 4P9MH 1JMZA 1OD7A 3DO7A 1ZVSB 2QHRH 5KW9H 1WUNT 4Y19E 3KVQA 3O3BB 4JFPA 4PJHA 1TENA 1I1FA 3QXVA 4X7TA 5ID1B 2NZIA 2HRLA 3RZWA 3BVNA 3SQOH 3ARFC 4U6TA 3DMMD 3TBSA 3EYFA 5JXED 4KZDH 1J5OL 1EO5A 3CVIL 2ORBL 5C0AB 1BF2A 1FH5L 4CADB 1ZTXL 5CP7A 3MYZA 3BKJL 4U6HB 5EZLA 1KCSL 4KUCD 5D7KE 4HWNA 4EI5B 3O8XC 2D31B 1KOAA 1SEQH 3RWIB 4JPIA 1T1ZA 2Z31C 1KCLA 5GSVB 4YE4L 4J6RH 5D93B 4MA1B 5FGSA 4NM8L 4KHTL 1EA9C 5I1KL 4Q9RH 2YD8A 1VB9A 3FFCD 3MBXH 5IM7A 3TBWA 3RI5K 1MAJA 3C5SA 1VPOH 1X5XA 1R3LB 2EH8L 1XGQA 1RUQH 4HIEB 2NY7L 1S9YA 1U8HA 3HE7B 3IFPB 1U42A 4JM2F 5JXAH 2VDQL 4DGVH 5CINL 2Z91B 1EBPA 3RNQA 4GG6A 4ZFOA 3NZ8A 3B3IA 3CXDL 1NKOA 1BQLH 1NBZA 2ICEB 4MHHI 1MAMH 2HLAB 3W0WA 5GGTH 2BVYA 1HN1A 2E7CA 3WN5C 4XXCC 1Q9KB 4X5WB 3FFDB 4LPWA 3FQNA 2G60H 3QRGL 2DYPA 5DS8B 2DICA 2R0KL 5EUOE 1SMOA 3MLXH 4R8WL 4C59B 4MS8D 1DVFB 5JR1L 4K07A 4ZO9A 2VSDA 5DC9B 3IDMB 5F1NA 3KHOA 1FO0A 3RNKA 1FFQA 1RK0B 4Z0XA 5D2LF 4PV9B 4KI5E 4UT6L 2HJFA 2ARJA 4Q9CA 1AI1L 4JFFE 2YPVH 4XCFL 5T5FH 2QQNL 3BEVB 1FSKC 3P9LA 1DQQA 3MZTA 4KAQL 4YLQT 3AY4C 4M03A 2Q8BH 4XVTL 1F90H 2H45A 3V95A 4PB0H 3QULB 4FZ8H 2A83A 4NN5C 3PWLB 5GGQL 2FEEL 4RWYH 1NCNA 3U0WH 1OSZA 2UZIH 1N3NA 2I60H 5CEZD 1MNUL 1DN0A 4WUUE 1ZLSL 4OF6A 1XZ0A 1MJJB 4NO0D 4YHPB 1YY8B 3LKNA 4RGNC 3DI2B 3QJFB 4QCIA 4XNMB 1RHFA 3EJZC 3MJ8A 1SJEA 1GHFL 3MRFB 4UDTA 3DXAD 3ECBB 3CZFB 1TVHA 1QYGH 5GS3A 5HD8D 3CDCA 5IMLA 4MVBD 4QHKI 1EO8L 3GIVA 2X1XR 1PSKH 2P48B 2ZUTA 5I17A 5FO8B 2G5BA 5C07A 2X4TB 3QFJE 3L3OA 4WFHD 3BUTA 4XBEH 4Q0XH 1UXWB 4MD5B 1K2DA 2DJ4A 3WFHB 3PWUA 5FDWB 4HW6A 4F7EB 1QVOA 2YZ1A 5C08E 3QQ4A 1QR4A 1JN6B 1LO2L 3OAUH 1IEAA 3SDCD 5JNYA 2GQHA 2JJSA 5DJ0B 5SWZE 2V5YA 3QIUB 4PRHE 4Z7VE 5DJ8A 5GRVK 5B39G 4LHUA 2OTUB 3BH8A 4PJ8B 1F11B 5SWSD 1S9KC 1UACL 1H5BC 1JVKA 2D7MA 2HLFD 4S10A 1WWBX 4K3DH 3SY0A 2R4RH 1YMMB 3UTZA 2MOVA 3MA9L 2VZVA 1FLTX 1JUFA 1A6WH 2NNAA 2XRAL 3QH3B 5L2JA 3MLTA 3V52L 3BZ4A 4LVOC 1QOKA 3MSPA 1KT2B 2FHBA 3NPSB 4I77H 4Y5YA 2Q7NA 3L9RB 3O6MH 1E6JH 3CCHB 4TVSa 4DJMA 1OT1A 3V79C 2PTUA 4M6MH 5ACLA 5HJ3A 4PGDA 3L3IA 3VFWA 4HKXB 3TJEH 4JGUA 3DMMA 5E24E 2R1WB 3NIFF 5JXEA 1UCBL 3H9SD 4KMTH 1G7HA 1GAFH 1P6AB 3EDKA 2FR4B 3VCLB 1ZANH 2Z92A 4Z7QE 1S7VA 1TTFA 3EZ8A 3IDXH 4ZXBC 2UV3A 5M94B 1CFQB 1IMHC 4R90L 4AMKH 3OG6B 1MEXH 1LD9A 4GAGH 3WO4C 1ZKAA 3FFCA 3PP4H 3WJJA 1W72H 4R0LA 5I73B 5BS0B 1M71A 2LV4A 2Q1EA 3F7RA 4NRYA 1GGUA 4JFOA 1HHGB 5FO7A 1BLNB 5JW5A 3QHZH 3BP7A 1GOHA 1Y0LA 4AJ0A 4YJZL 3DRTB 4KTDH 3HAEG 3MC0A 3QQNA 4GQPH 4HGWA 5H35A 1A3LL 4UV7L 4YBQD 2ITDA 3PUCA 5CJQH 1WZMA 3JUYA 3S36H 4YHYC 3WFZA 3DUUB 5BXFB 4D0DA 1IE5A 4YQXH 4L8SA 5I74C 5I18H 3MRMA 2ZCHH 3MV9D 3MRGB 5I1HL 1FCCA 4A6YB 5FOBB 1DBAL 1JNLL 4I5BA 1DP0A 5FV2A 3GMOB 5GZOD 1EJOL 1X5LA 4BSVA 1C7SA 3BGMB 3VE0A 3IDYC 5AZ2L 4L4VB 3PWPD 5JPMB 2ICWB 4XCYA 4NHUA 4W4NA 1QQDB 4XNZB 3RDTD 1J8KA 1B88A 3MRCB 2ADIA 1RQ5A 3FHQA 3ROOB 1F97A 4ODWB 5EZIH 1XR8A 2BSSA 3QDGD 4DGYH 4OLVL 4FFZH 5DJXB 4Y4KB 5DUBB 5CJ8A 2D9CA 4HS6B 1ZEAH 2NX5B 1GGIL 1R5VA 3CUPA 3RVTD 5ERWB 4U1LB 4HFWB 4L3CA 4PJ7F 5HHXL 5FHBH 1EEZA 3O2VL 2FB4H 2DLIA 3DJ9A 4QTIL 1N5YL 2OL3A 3ESVF 3F65A 4NO0A 3M45A 4JFEE 4LIQE 3C5JA 5BJTA 1EAPA 5DK2B 4K3EH 2R69L 4CMHC 2YEZB 5DRWA 1MCJA 4OCNC 4HIIA 5GGVY 5IKCB 5IF0B 3DXAA 4NZRH 1K8DA 2ID5A 2XWTA 4PGZA 4YHZH 4LF3B 1GOFA 2Q7YA 1NBYB 1X9QA 1T1XB 1Q9LA 3QWRD 1J05B 1XF2A 1PX4A 1U9KA 2LQRA 4Q6IB 5AG8A 4WV1A 1I3RA 1QSFB 4MQTB 3VXMB 4HQQH 1PAMA 3FB5B 2MQCA 1DFBL 1XR9B 4HIJB 3U7YH 5I1LB 1DLHB 4XPAL 3KYAA 1T21B 1WIUA 1JHTB 4NSKA 5TFSH 4JFDD 3SGJA 3OMZA 4M1GH 3EO1B 2DIAA 3QUYC 1U91A 3EYOA 3SDCA 4OAWA 2R4SL 2ARWA 2A6DA 2D03H 3L3HA 4XP1L 1UCTA 5DLML 5K59E 1NGQH 1PX3A 3EOTL 4GAJL 4OJFH 3ZYIA 4JEGB 4N0FB 1LO4H 4PJHB 1TJIH 2XG4A 4JFPB 4W70A 1I1FB 4X7TB 3MCLH 3SHSA 3BVNB 4KJWC 1MLCB 2H3NB 5SWSA 4EJ1C 4XPTH 1J1PH 3S8WA 4RBPH 1JGUL 1RIHL 1XF4A 2RFXA 5DFVC 4DOHE 2E5EA 5EZLB 3TZVD 15C8L 1OM3L 1PEZA 4HPOL 4MQSB 1CVRA 3MGTB 1L7IH 1T1ZB 4NNYA 2OK0L 1QBML 5C09E 3HR5A 3MLSL 3BGAA 3PXHA 5IVZA 4LNRA 3TLRA 2W38A 1EBAA 4G9FE 4XX1G 4JQIH 3HNVL 4DKAA 4KHXL 4N0UA 1CXEA 1MCIA 4YHOL 2ZCKL 1AQDB 5DD6A 1H3XA 3IFOA 2VXUL 1A3RL 3A6OA 3CX5J 3D0LA 3H9SA 2DQJL 3DNKA 1NGYA 4V1DE 2VAJA 4GG6B 3NZ8B 2J8UF 3B3IB 4OCMC 1I8LC 2WUBL 4P3CH 1NBZB 3IAQA 1NLBH 3D18A 3W0WB 3UDWA 3ZL4H 2GT9B 4LEXH 2W65A 5DJAB 1NFDA 1IEHA 3FQNB 1PJ9A 4ZO8A 5IG7A 4FNLH 2DYPB 4YXLL 5CLWA 1DQML 2VZOA 4JKLA 4KK8D 1NL0H 4B50A 3SOBL 4F80A 2QQQA 1FO0B 3RNKB 2OR7A 5BQ7A 3N85H 3BE1H 5DGRA 4Z0XB 3TO4D 3GDBA 5FGBA 2BY1A 2ZUQC 2EYRB 4FQJL 1HYRC 2WM0A 2QEJA 3WFDL 1D3CA 2DJSA 2FL5A 3KPPA 2DM7A 3JWDH 1DQQB 3VFRA 4F15C 4YK4B 1QFHA 1FDLL 1NCAL 3X14B 2QSQA 4QXUL 2A83B 3MV9A 5EU7C 3K8KA 1RUPL 3QG7L 1M7XA 1A1OA 1DBMH 2Z0BA 3BQUC 4U3CA 1KNOA 1OSZB 2IJ0C 1N3NB 5DVMA 5D1XD 4O58L 2P46B 1BVZA 1DN0B 4XC1H 3PWPA 1U8JA 3UX9B 4NJAL 4Z7NE 3RDTA 3DSFH 1FPTL 3RU8L 3P30L 2LE9A 3LKNB 4QRPE 1IEBB 1ZLVH 3HZYB 2AEWA 4LVNB 1R5IA 3WCYA 1SJEB 1CGVA 3QDGA 5CMAB 3C6LD 4UDTB 3MV7E 3S4SA 4N0YH 1WTLA 3O11A 4GSDL 5IMLB 3JTTA 4WDIB 1C5DA 1QFWI 5KJRL 2G5BB 3ULVC 5I30H 5D7LD 4XPBH 1MWAA 2MPAL 4LSRH 2RIKA 1NMBL 1HXMA 3CAFA 3MO1B 1RZJL 4S1SH 2IPUG 5ISZE 4AEIH 1K2DB 4KC3B 4X6CA 3PWUB 2IMNA 3QIBD 1QVOB 4NKMA 3QQ4B 3FN0H 4F37F 3M8OH 2HRPH 2E27L 5JNYB 3KDMA 3VGEA 4PJEB 5AWNH 1PZ5B 1IARB 4YBLC 2F74B 3RUGF 3QWRA 4GBXC 4Q9QL 5DJ8B 4OCYL 4LHUB 1MFCH 3BH8B 4PRAB 5CAYB 3SJVE 5D7IA 1OWRM 4CVWA 4MQ7A 4HCRL 3SY0B 4HK0A 4S2SA 4Y5XA 2QSVA 5TF1H 2BK8A 3UTZB 1XGUA 3LKRA 4XHJD 4JFDA 1JUFB 4DGIL 3MLTB 2Y07L 4X98A 4MJ6A 3BZ4B 4XGZA 1LO0L 1A5FH 3HAEA 1T03H 5D71H 2M2DA 4GMTH 4ORGA 5A16B 3KYOA 1H3PL 5HJ3B 4PGDB 4HGKC 4W81A 3DMMB 4YFEA 1G7HB 4L4TE 3V0AC 1F6AB 3QIWC 3TZVA 2CIIA 2GFBA 5DSCA 4S1QL 4F2MA 3DX6A 2YPLB 1S7VB 5DWUH 1NUDA 4KKBD 1U95A 5EG6C 5FYLH 4CVZA 1XGPA 5FDYA 3U6RA 4P59L 1C5CL 3TVMC 3JBG7 3CFDA 4JRWA 3UTPE 4DCQA 3HNSH 3UJJH 8CGTA 12E8H 5FK9A 3EFFB 5SX5H 1LD9B 3FFCB 4I3RL 2VC2L 4PJ9C 4Y1AE 1YEKL 4R0LB 5F9OH 2B0SL 5DEGA 2P8MB 4WHTA 1M71B 5J1TC 1JHKL 4JFOB 3SO3B 3DARA 4RFEA 5FO7B 3BP7B 1YPZF 5T3ZH 3H3KA 3Q5TA 1Y0LB 3NFNA 3X3FH 3P77A 4RFNC 3NCYP 2F5BH 1KENH 4JVPA 5D4QA 3OR7A 5H35B 3MLPA 1D5BA 2EICA 1UZ6E 2ITDB 1LO3H 3O2DH 5EUOF 4H5SA 4JN2A 2B2XH 3MV8D 4QHKJ 1JZ5A 3KPRE 1U8KA 3MRMB 2GTZA 1W8NA 2JB6A 3EHBC 5AD0A 3B9EA 1ND0A 4NQCE 2NZ9C 4I5BB 4PJGB 4O02L 4OB5L 3QCTL 4BSVB 5A2FA 4OZHA 3VE0B 3TO4A 4NFBA 5EA0H 3R1GH 4OLUH 4WW2F 3M07A 3SKMB 4XCYB 4NHUB 2FEDC 1OPGH 2VXSH 2A73A 2ZG1A 3IDJB 1F6FB 3NIGF 1UGNA 1XF5A 1XR8B 5DD0L 1HCFX 4S1DC 4KK6D 4M1CC 1DCLA 1CDCA 2BNRE 5CZVH 1F2QA 5J1SC 2OR9L 1AHWB 2ADGA 2MWCA 4DW2H 3PGFL 3CUPB 4JO3H 2DMCA 2Y06L 2VQTA 4L3CB 5D1XA 4A2MA 1EEZB 2F19H 4OZGA 3T08A 3FO2B 2OL3B 3CXHJ 2D4FA 4NO0B 3LY6A 4UOJA 1AJ7L 2R0LL 5BJTB 1EAPB 4Z95L 4PIRF 4PJBE 1V05A 5DRWB 1YNKH 1IKFH 3C6LA 4TOYH 3DXAB 4HDIA 4PGBA 5ESAA 5HGBA 3ULVL 2V2TA 2V9TA 1ITBB 1K8DB 3AREC 2XWTB 5D2NA 1G6RH 1PW3A 1Q9LB 2EE6A 2W0PA 5IQ9A 3U7AA 4NIKB 4K94L 2J7LA 1N8ZA 5D7LA 1OGAB 2P45B 1I3RB 1OCWH 3BN9C 4ZQKA 4OZIE 3VRLF 4JN1L 1A7RH 5HDBE 3H9HA 4KVNL 1Y18A 3OGOE 1DQLH 1J87A 1ZHKA 1GXEA 1D9KB 3QIBA 5HDOA 4BH7A 3P2TA 5HGHA 3T2OA 4RBPK 3EYOB 3SDCB 1PBYA 1I1CA 2DL2A 2A6DB 3L3HB 5ITBL 1KJ2B 1IQWH 3OKKA 4O2FA 1YEGL 3NVQA 4F7PA 1EJ6A 3RJDA 4UDUA 1IC5H 1HOCB 1U0QA 5J6HB 4RQQA 1CLYL 1XF4B 1INQA 2RFXB 4FQIH 1D6EA 3P0VH 1KN2H 3OF6D 5ANME 4K2UL 3C60B 4UILH 4OFDA 4X6DB 1J1OH 3SE4C 2E7LA 3MV11 4NNYB 5D7SH 5E1AA 3HR5B 2XA3A 5IVZB 3C87A 5C8JA 3MBEC 4LNRB 1AQKL 3SGDH 3GSOA 4N0UB 5D1ZC 3QNZA 1BECA 4JANA 4NRXB 4MJIE 5IW3A 1OB1A 2GIYA 4NO5A 1IM3A 5DD6B 4F7MA 4FQLL 3IFOB 4Z0BL 5J57B 1T0NA 3GKWH 1NEZA 3DHJA 3HG1E 3QPXH 3D0LB 4Z5RA 2QADC 4OLZL 4KQ3H 1T7XA 3F58H 3LOWA 5C86A 5DQ9A 1SM3L 1P4BH 4HG4J 3RVWD 5FCSH 4J3SA 2VLKB 2H2SD 1TTGA 4GXUN 5B8CC 3D18B 1RMFL 2X70B 4YWGH 4MDIA 3HKFA 3S96A 2W65B 2NPLX 1NFDB 2X1WL 4I1NB 3QNXB 4U6VH 4LAQH 5ADOL 1MJ8L 2IAND 2VLLA 5IROA 4DQOL 5IG7B 3SDDD 4D0BA 4J4PD 4R96A 2ENYA 3BWAA 5EU6D 3PL6D 1A7NH 4R7DA 1G9NH 1KJMA 1R6VA 3DRQA 2UUDH 1IFHL 1G7PA 2ADFH 1QNZH 5BQ7B 4P57A 1MIMH 3EBAA 4RRPA 3BPCA 1MJ7H 4JREC 4ZFOL 1SVCP 2FNBA 2IG2H 1T20B 1IM9D 2FL5B 4R3SA 4YDVA 2ESVD 3D39D 1QKZH 1ZLUK 4OF8A 4H20L 5TQ2H 3MV8A 4QXGH 3DIFB 4HJGA 1WT5A 5IESH 4NZDA 2EZ0D 5I8KL 3ZT5A 2YRLA 1V3MA 1HI6A 4M62L 1KNOB 6FABL 5KSVA 5ILTH 3BZEA 4JAMA 5E1HB 2WLZA 3LKSA 1PVHA 5INDB 3KLHD 4K71C 1KYOJ 1U8JB 5D7JC 4HK3J 1QFUH 4F9LA 3RDTB 2Y5TA 4GKNA 5JW3L 5DMGD 1JRHL 2R39A 1BJ8A 4RGNE 3AM8A 2XQBL 3G5ZA 3S4SB 4JHWH 3B2VL 3OZ9H 5GGRY 4OD1L 3JTTB 3SE9L 4GUPA 1C5DB 3PIQA 1EEQA 3AB0B 1X5GA 4M7KL 4NZTH 1NSNH 1R3IL 2ICWI 4MJ5A 1FG2B 3LIZL 1AH1A 4PPTA 5DTFA 2VLJD 1MWAB 1W8OA 2APWA 4X6CB 1CD8A 3QO0A 3AGVA 3SE3C 1U3ZA 2AXGA 5BW7A 4EN3C 2XN9E 4NKMB 1O0VA 5CHNA 5TDOB 1B4JH 4IS6A 3KDMB 5I1AA 3ARXA 5E5RB 2MQ3A 4P2YA 1S7WB 4OTXL 5FGRA 3B5GA 5EORL 2CIKA 2F9BT 5D7IB 3WIFA 3TIDB 2X9YA 4MQ7B 4KZEL 5C0ND 2E7MA 4HK0B 4S2SB 2VIRA 4JZNA 1U6AL 1R3JB 4KWUA 1XGUB 3LKRB 1R3HA 4JFDB 5C0FA 5EOQH 4KJPC 3G08A 1LP9E 3GBMH 4BK5A 3TA3C 4X98B 4DFIA 3HE6C 2V7HA 3MLYH 4U1NA 4HMEA 2DBLL 4OLEA 2ZPKH 3E1F1 3WLBA 2HJKA 3S5LA 2W92A 4FQ1H 4PRNB 2YD1A 4G6FD 4YXHH 1P5UA 3C8KA 1XGYL 4HWUA 1PZUB 4NQTA 3QUMH 3UYRH 1JTTA 5DFWH 3CK0L 3OF6A 4EUPH 4L8CB 3TZVB 2GFBB 5DSCB 1LK2B 4F2MB 5B3NA 1VGKB 3DX6B 1U95B 4CVZB 1XGPB 1FNSH 3WUZA 3TT1H 3CFDB 1T7VA 4DCQB 4YDJB 2A2QT 5FK9B 4FQCL 1HWHB 3D2UD 4BKLA 3WSQL 1IVLA 4HXAL 1VDGA 4HWZA 1A1MB 5DUML 4YFLF 5J56B 5JOPE 4J3UA 4UI2A 4KDTA 3MOBL 1I7ZA 1RVFH 4MMZC 2MCG1 4MXQC 1F8TH 4WHTB 3VD5A 2CKBB 4RFEB 2FBOJ 4RSVA 1YC7A 5HHVH 2FGWL 1HQRB 4JRYE 4LHJB 3P77B 4NQVB 2LU7A 4LEOB 4LLMA 2RAMA 1CR9H 4N5ED 5KG9A 3OR7B 1D5BB 1EEUA 1PKQE 1K4CA 4OGAD 4H5SB 3K8LA 2DN7A 3QA3A 4JN2B 1EZVX 3LSOA 3NAAH 4U33A 5FYLD 3MRLA 1FFRA 3SDDA 3S3PA 4X99A 2Q87A 4J4PA 2JB6B 3VA2C 3FTGA 5EU6A 4EQ3A 1RUML 2KH2B 2QBWA 2QSTA 3PL6A 4FFVD 4S11A 1ND0B 3HC0B 1Q8MA 5E4IA 1FORH 4B53A 4C55A 1MIEH 4OZHB 1RZFL 4H0HB 3S35H 3GRWA 3KLAA 4GAYA 4L5FL 4LSSH 2B8OT 2VH5H 4X6BB 1A02N 1IM9A 2JELH 1NMAH 3T04D 4G43A 2ESVA 3D39A 4EVNA 2MCPL 2BRRH 2LABA 1XF5B 2ZOKA 4HAGA 1H15A 1FIGH 4QHNA 4ZPVB 1QZ1A 4FG6D 1CE1L 2XA8L 3LZFH 5GRXG 4WEUD 1LE9A 2BERA 2DKUA 2EXYD 5D1XB 4Z7UA 3P4MA 3PABA 1G1CA 2DQTH 4X7EC 4XAWH 1RIUH 1INEL 4QGYA 4FA8A 1RZKC 3WFEL 1BZ7A 4LSQH 2YC1B 4L9LC 2YN5A 5D6DC 2WK2A 3K7UA 4X9FA 4S1RL 5IB5A 3C6LB 4HDIB 5HGBB 4HUKB 2R8SL 4PBVC 4OSUH 3RBGA 1IGCL 2PXYD 5D2NB 4E9LA 1BGXH 5IQ9B 4HBCH 1KIQA 3RWEA 2UVFA 3EDEA 1JI2A 5IEKB 2P5ED 3SKNA 3LMJH 1WVZA 2F54E 2VLJA 3V4PH 3H9HB 1YEJH 4JPWL 5A2LH 4CDGC 1J12A 5EIVA 1R0AH 1J10A 4YHNB 1GGCL 3QIBB 4G5ZH 2YR3A 3VXRD 4BH7B 1GC1L 4K23H 4NZUH 4MCYA 3CLEL 5CEYB 4GRLD 3KPLA 3RIAF 3CFCL 3EFDH 4F7PB 1VERA 3PJSA 4UDUB 3CDGB 4R26H 3V7MA 4OM0H 3FRPA 4RQQB 1INQB 2Y4SA 1D6EB 1QPPA 3UPRA 1NAKL 2X6MA 4ELMB 3T2QA 1KCUL 5E1AB 2C1OB 5LXGH 1M1SA 4GXVL 1A2YA 2WZPD 4XP9L 4LRIA 3RTQD 2ZCLL 2R56L 4D9RE 5J06A 2CD0A 4APQB 1CICC 3GSOB 5HYJE 5EU4A 3QNZB 4JANB 1EFXB 3WIIH 1OB1B 2Y1VA 1IM3B 4OI9A 4F7MB 2UWEA 1T0NB 5EWIL 5D6CA 3U83A 1CFTA 5GS0H 3DV6B 1HYSC 5FF6B 2FIKA 4HIXH 2E7HA 3NFSH 2F58L 3SDXF 2A77H 5E6IC 1A0QL 4XMPH 4JY5L 1ZT7A 1BREA 4N0CC 3I50H 4MX7A 1LDPL 1MREH 4N8CL 3S96B 4HKZA 3FZUD 1FC2D 3VWKD 3D2UA 2NY6D 4BZYA 3MNWA 4D0BB 1K5NA 3A6BL 5AG9A 4LCCA 4R96B 3QWQB 3BWAB 1MQKH 2BVOB 3Q6FA 3OXSB 4C56D 4DUWA 3ILPA 5IVOA 5MP6H 4FN0A 1KJMB 1UZ6F 3FHAA 3MRJB 1KPUA 3U4BH 5JZ7D 2VISA 1LO5A 4CU6A 1MCRA 4UIKH 2AJUH 1DLFH 3B9KC 4MAYC 2R0ZH 4MCZB 5AEAA 4LGRB 5HY9B 5L8LB 2K7PA 3TBTB 5T1MA 2RHEA 3CFBB 4R3SB 4YDVB 4MQXC 3RVXC 5JDJA 2EC9T 5E94B 5GRVL 2BNQA 2BVPB 3MV8B 5JW4R 4HJGB 4G8EA 5FUZL 1CT8A 1IC4L 1I1AC 1NDGA 4FQQA 3PDDA 2VDPL 1HHKB 4PJAA 1HI6B 5EU7E 2YMXH 5KSVB 5D1QC 4Y19D 4JAMB 1W72B 5HHOB 3LKSB 4NWTL 1DBKL 3OR6A 1AGFA 3C09C 4ZYKA 3OKLA 4KRPD 2BXZA 2I9LA 3TPKA 5LQBL 4GKNB 2BMKA 4RA0C 3JXAA 3JWOC 4BFEA 5D7KD 2ENSA 2AABL 4KROC 4WHDA 3WE6A 4AK1A 4UT7H 3G5ZB 3O2DA 4CRPA 4JLRA 2CUIA 4U1IA 2HA1A 4DVBA 4Y4FD 2AP2A 3UO1H 3VXUE 5L6YH 1MRCL 4J1UA 3FOMA 4N8VA 4NBYB 5BVJA 4O5LL 4G6AD 3EYUL 3D85D 4MJ5B 3L3GB 4JFZH 3OKNA 4PJBF 5DTFB 5F7WC 5E6ZA 3LN5A 1RI8A 1JCKA 3ULVE 2E9BA 5GRJL 1MY7A 1KACB 2DAVA 2DTSA 4MAUL 4DAGL 4FTVE 5J9PA 2R9HC 5FB8B 3DX8B 1BM3L 2O93L 3NMEA 4DZ8A 5I9QB 5IFAH 5F7UA 2AXGB 3PNWB 4XHQA 2IPTL 3SE8L 1QLFA 2WUCH 1X5YA 1XFPA 1YQVL 2LAAA 5JOFA 4IS6B 2QLVB 4LPUA 4OV5A 2Z4QA 1FG9C 4JZOB 2PXYA 5CGTA 5EOTB 2WV3A 3KYKH 2AEPH 2H32H 4X5XA 1IT9L 3SCMD 1WFTA 2KQMA 1WEJL 1EDQA 5DMJB 4BYHA 1W0VA 2J8UA 1ROWA 1P9MA 4WENB 2CIKB 2P5EA 3BT2H 4RWHA 4U2YA 4KKCD 2UYLB 3UTQA 3ARBB 3GO1H 3MXWH 4KV5E 2VIRB 3GSNH 4JZNB 4Q74A 3NCMA 1MFBL 1MOEA 3CFJB 3DVGB 3ET9F 2DQEH 3VXRA 5C0FB 2GUOA 4KI5D 4CU8A 5T33L 2BX5A 3G08B 2M1KA 4JFFD 5K33A 3O6FD 5JLZB 4TNWK 1J88A 2V7HB 2F8XC 1QO3A 4FQHA 2JKXA 4U1NB 3N1PC 4GRLA 4EI5C 3E6FA 2FZ3B 3WLBB 3S5LB 2FRGP 4WHYG 5D2LB 3O81A 3HPLA 1EUUA 2DLFH 5CGMA 4HUXB 2VXTL 5D93C 4WCYH 4I4WB 5D70L 5FOJA 1G6RA 2E9IA 4J7RA 3VXSB 4NOFA 4JQVC 5F9WC 5DMKA 3TF7C 4WUUD 3S88L 2VQUA 3GMMA 3MCKA 4JHAH 5IEHB 3RTQA 3HE7C 4LKXA 1XMWA 4GAFB 4LRNL 3TCXA 1ZXQA 3QXDA 1KGCE 2WBJD 5GGSA 3RGHA 3PHOA 4LSUH 5F89A 1UWGL 4LNVA 2YOCA 2AVGA 4Y4HD 1GPOL 1K4DA 3T1FA 5F97E 4XVJL 2O26U 3HFML 1PQZA 4LFHG 4HUMB 4MD0A 2YK1L 2VZ1A 3BDYH 2R1YA 3QFJD 1WSST 3F6IA 1DVFC 1UQSB 4PY7A 4HUVB 4P9HC 1K4CB 5F7MC 3QA3B 4YZFF 1MCLA 1J5OH 3VWKA 4DN3L 3CVIH 3LSOB 3ARZA 1FH5H 5C08D 1T5WA 1X5JA 1ZTXH 2BRQA 3BKJH 3MRLB 4X99B 3HHRB 4P9ML 3FTGB 5EU6B 2ICWJ 1H9VA 1YEHH 4C56A 2QHRL 4YE4H 5SWZD 1J0IA 3SQOL 1FNAA 4M5YH 3GI8H 1GGTA 4KHTH 4KZDL 4GAYB 2PW2A 2XNAA 5GGUA 4I18A 1IM9B 4PJFE 3LH2L 4N1EA 2ESVB 3D39B 1SEQL 2K7QA 3GHEL 2NY7H 2NW2A 2ZOKB 4D9LL 5JUEL 3P3YA 4J6RL 4XBPA 2OX5A 3PWVA 5F7LB 4DKFH 1ULVA 5GJSL 3CXDH 1G0XA 3SDYL 4WRLA 2GSIA 1P84J 3MBXL 4I0KA 5F72S 4Y19A 1JZ3A 1FZJA 3PHQA 3O3EB 3PABB 1VPOL 3KR3H 5D5ME 3FT3B 2XG5A 2R0KH 3OG4B 5B22A 1INDL 1BZ7B 4BQBA 5JR1H 3HNTH 3NPZB 1MAML 4Z7WF 5DRNA 4WO4A 4UT6H 3GSVA 4Y4FA 1AI1H 4ZDHB 2QQNH 2DI9A 4WI9A 1UKSA 3P9MA 4XPFH 3D85A 2X42A 5E8OA 3RWEB 4KAQH 3U36A 4OIIL 1OGTA 1ZV5A 1CQKA 1LEKA 3DOSA 2MNUA 5F9DC 3VXPA 2JLLA 3QIUC 4ZFFA 4WW1A 5GGQH 2AJZB 1HILA 5IHUL 4PJ8C 4XI5C 2YPVL 3ZHLA 4LFHD 1A6VH 4L3EB 4JJHA 4MCYB 2IFFH 4V2BA 1ZLSH 3RBSA 4X7DC 1YPZA 3KPLB 5TQ0L 4D94A 3SCMA 4D9QE 2D7QA 4M48L 3WDJA 2HT4D 2XWJB 3FCTA 4PLJD 1GGBL 3LDBB 3PJSB 2BP3A 43CAB 4XVUD 3IS1X 1TZIA 1MQ8A 4OM1L 1ZGLM 3U30C 5EUOA 3T8XA 5F8QC 3P0YL 4RWYL 3U0WL 2UZIL 2I60L 3MQIA 1BD2E 1EO8H 1HCVA 4OZFH 1WQVT 1OQXA 1JJUA 1P7QB 1A2YB 3DV4A 4JFFA 3F7VA 3O6FA 1XCQA 4QWWD 5IJKC 4PFEA 4NP4L 1WAAE 2EXWC 4M8VA 4G6FB 4GMSL 4OLYH 4ISVA 1QYGL 3AU1A 1JWUA 5D6CB 2Y6SD 1LO2H 3LRSA 3LD8B 5TDPA 4XXDB 3GSQA 4YO0B 2FIKB 5EUKA 5IHBA 4M9PA 4KXZI 5I73C 1PGRB 4POZD 2VXVL 4XBEL 3VFNA 3NBNA 1BFOA 4WUUA 1P7KA 4I0PA 2APXA 1UACH 3D2UB 3BPOB 1LDSA 2BC4A 4YDKL 2KPNA 2WBJA 3RWGA 1K5NB 1ADQL 4LCCB 3MA9H 3MUY1 3LHPH 3V0WL 2XRAH 4PJXE 4Y4HA 4MA7L 4NQUA 1JYVA 1CWVA 3T0XA 3V52H 4HKJA 3JUZA 2E7BA 1LO5B 1EK3A 2XXCB 4U1JA 4YNYA 1CU4H 3QFJA 5EC1A 5GS0D 3QUMA 4K3DL 3T3PE 5T1MB 7FABH 2HG5A 4WTZG 4OBRA 2DIBA 2F8VA 4P48A 5F21B 2BNQB 3GM8A 5C08A 4G8EB 3MCG1 3O6LL 1CT8B 1NDGB 4ENEC 1U2HA 3ALPA 3HTLX 4XTRD 4HMDA 1ETZB 1IGIH 4WWKD 4PJAB 5J3HC 2YPKA 5SWZA 1MFEH 5E99L 1LVEA 4R90H 4E5XA 3L5IA 3KG5A 4Z7VA 1I9IL 4CDHA 3CPLA 4ZUVB 3TJEL 2E8ZA 4UZGA 3G5XA 4PS4H 3OR6B 1AGFB 4KMTL 3F12A 1WC7A 3AS2A 1GAFL 1DUZB 1OWWA 2I9LB 1GZPB 2BMKB 3GBLA 4XCEA 1LQSR 1ES0B 2I26N 1G7IA 4R7NA 3T4YA 4WTWA 3ARUA 4JLRB 2OSLA 4K3JL 2EDTA 5C09D 4MJ4A 4HWEL 4AMKL 4J1UB 4U1SA 4UV7H 4N8VB 5BVJB 4OCSH 1MEXL 2NXYD 4G9FD 4PD4K 5JPNA 1QG3A 3G6AA 3PP4L 3VXOA 4P23D 4RMRA 3BYYA 4K7FA 1P6FA 2DM2A 4PYGA 3NCFB 5J9PB 4UUJB 3J8F7 3I3BA 4I9WE 4MA3A 4OF3A 4DZ8B 3ARDD 3BSZH 3R0NA 2CJUH 4KTDL 4QRRE 4PP1C 2IQ9H 4V1DD 3U9PL 3GSRB 5JOFB 3DPBA 3V5DA 5AZ2H 3ZTJG 4OF0A 5TGBB 2ILLA 3VFVA 3HRZA 3G5VA 4HLZH 2C9AA 2J8UB 2CXGA 1SYSA 5BOPA 4MNQB 4Y2DB 4OLVH 1MCPH 4PRPB 4LLVA 5C6WH 3FQXA 3TO2A 3VXRB 8FABA 4AQ1B 1GGIH 4XH2B 4YUEH 2OTWA 3BISA 5ICYB 2BY3A 4UNVA 1MHEA 5HHXH 3ES6A 1HZHL 2I24N 3BXNB 4NZJA 1HE7A 4FQHB 4NPYB 4EXPX 4GRLB 4Y2OA 2VRAA 3E6FB 1HH9A 5EZIL 3TN0D 1QSEE 2NW3A 4DGYL 1I85C 2V5RA 3QUZB 4FFZL 1JPSH 2E6PA 4PRDA 4HJ0C 1MSPA 3W5MA 1G6RB 1P2CA 1EZVY 4YPGB 4IEFB 4G7VL 2FB4L 4OFPA 1IQDB 1RV6X 4NRZA 4LCWE 2W0FB 3GMMB 4QNPF 2HN7A 1NC2D 3KJ6L 1P4IL 3U0TA 3T2NH 2D4DA 4QRPD 3HI5H 3PHOB 5F89B 2DMKA 1BX2A 3QZWA 1CDGA 3MV7D 2PYEB 3V8CA 2BHUA 3T1FB 1JFQH 2EE9A 1WICA 1Q72H 2BVEA 2R4SH 4HF5L 4MD0B 5K9JH 3EO0B 2NY4D 4GW4A 5DLMH 3FOLB 2R1YB 2CDGA 3EOTH 4GAJH 1I4FB 1JNHA 3LEXA 5JHDE 1ZLWH 4PY7B 4RIRA 4YDIL 3U7YL 5IFHL 5EZOH 3ZKMD 4LSVL 5TDNA 5ISZD 2IEPA 1GH7A 5DD5L 4ETQA 3QDME 2O61A 2NY6B 1RIHH 4M1GL 5EPMB 4YR6A 1T5WB 3PWNA 3E0GA 1QHPA 2DQIH 2NLJB 5C0EA 4HPOH 3LKQA 3PGDA 1KB5L 2OK0H 2X4RB 3NCBB 4OJFL 2ZUYA 3MLSH 5EO1B 5GSRB 4YK4C 1U3HD 3SBWC 3MCLL 1TQBB 1MFDL 5J0BA 3SDAD 2VQ1A 1OLLA 1ZT1A 3SJVD 2PW2B 1J1PL 4OGXL 3RIFK 1IGJA 2AAVA 4I18B 4KJQC 1PLGH 3RPKA 3RUGB 1C08A 3EAKA 1GZQA 2VXUH 1U8IA 5B38A 4U1KA 2NW2B 5H37G 4ZSOE 3SKOA 2BSED 5F70A 3SEPA 4XBPB 5IBLD 4DEPB 3O3AA 3PWVB 3VG9B 2R2HA 3K4ZA 4X4MA 2WUBH 4PTTB 2BZDA 3I9GL 4WWKA 2P24B 2GSIB 2J12B 1QACA 1CCZA 4M6NH 3TNMA 1FZJB 3PHQB 3GRWL 5JA8B 3NCEB 5CZKA 2KL6A 4YXLH 2X44D 1DQMH 2ZUXA 5KSAD 5ACZB 4KRPB 5FIEA 4L4TD 4RISL 2AEIT 4P3CL 2HMID 1NLBL 3NH7L 4LCYB 1FL5B 3ZL4L 1N59A 5C09A 4WO4B 4MXVE 4LEXL 4Y4FB 3ULVF 1T66C 3UTPD 3WFDH 2AERT 3BGFC 4TUJA 4G9FA 4AM0A 3D85B 1U8OA 4FNLL 5J1AA 1FCGA 3U36B 4P23A 4YC2B 3OKMA 4ZAKD 1YYML 3KPMA 4Y1AD 1FDLH 4HD9A 1NL0L 1DBJL 5B3JE 1LEKB 3GK8L 3MRQA 4QXUH 2DWEA 4ZFFB 3IS0X 1RUPH 3ARDA 4WW1B 5JQHC 3QG7H 5MENB 2Y25A 3E2HC 3DURA 5FO9A 3KPTA 3V0VB 4IHOB 4V1DA 4GLRH 3ZO0A 3JWDL 4O58H 1PG7W 5E7BA 5DJDA 2BHZA 1YPZB 2V9QA 4UAOC 5CZXD 1S7XB 4WTXA 1FPTH 3RU8H 1KLGB 5LWYL 3P30H 3CSGA 2DQUH 3RWCA 5IMMB 3KPRD 2WWMD 3H42L 4CN1A 1TZIB 5D9SB 5EUOB 1DBML 1NEUA 4NQCD 1T1YA 4GSDH 4R2GD 4RAUB 1JPST 1KEML 4XC1L 5KJRH 1XEDA 1RAMA 5F9AC 2R23A 4HK3N 4X0KA 3DSFL 3LRHA 3O6FB 1XCQB 3LQAC 4P3DA 3GMLA 2MPAH 5GS1A 4I3GA 5I76A 4OZ4A 1TMCB 1NMBH 4NQDD 2P4AB 3TN0A 2P7TA 1F3JA 2J88L 4WW2B 1CYGA 4N0YL 4G6KL 1JWUB 3MNZB 1CXLA 1DR9A