1KT2A

Crystal structure of class ii mhc molecule iek bound to moth cytochrome c peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
182
structure length
182
Chain Sequence
IKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, E-D alpha chain
publication title Structural basis of cytochrome c presentation by IE(k).
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 36
structure length 182
sequence length 182
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kt2A02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1kt2A01
1P9MA 1ZHBB 2AJVL 5J6HB 3GJFB 3VMPA 1KOAA 3NCJL 1UWXH 3C8KB 4YBLC 5F3BB 4YIQA 1K6QH 4OTXH 1T7YA 3BYYA 5DJ8A 1HHGA 3BIAX 2J5LB 3BIKA 4WDIB 3RDTA 3TM6A 3NPSB 2E27H 4LPUA 1EFQA 1WF5A 3R1GH 1C1EL 3WHXB 3U7AA 4I1NB 2DOCA 4M9PA 1NUGA 3R0NA 2R0ZH 1U58A 1NGXA 5CCKH 3TPUB 1PQZB 1MRCH 1YEFH 3JVGC 5C0FB 1UVQA 4H20H 3K1KC 4PTUA 5MERB 1YPZF 4HKXB 5I8KL 4K23L 1UXWB 5LBSL 3EYUH 3T2PA 2DMKA 5GRVK 5F93C 4Y5YA 1NGYB 2YZ8A 1YUHA 4NUGH 3VG9B 3MFFB 1S7QA 5F1NB 1YECH 1WLHA 5DJZA 2IALB 1T1WA 1D5MA 3MRGB 4NOBA 1RIHL 2YWYA 3O3UN 2WBJC 1I3UA 3UC0H 4JB9L 3B9KD 4JFFB 1IM3A 4MXQD 2LQRA 1P7HL 3RJDA 3PWLA 3OJDB 1S7WB 4OCNC 4QRPA 4HLJA 5C70A 3P4LA 5IEKA 2FB4H 4HS8H 4WU7A 1Q0YL 1XZ0B 2X70A 5FYKD 5ENWA 4YHIA 1MHCA 1KTRL 4XNXH 5DGRA 4M6OH 1JZ5A 3NAAH 3RWIA 4LAJH 4CVZA 4YEFA 4GRMA 2YPVH 1CLOL 5IJVA 4ZUVB 3QNZA 2NX5B 1WBXA 1ZMYA 3MXWH 2PW1A 4UNVA 3HFML 2LVCA 5J8OA 4XBPA 2WUCH 3ULVF 2AI0H 2BHYA 3T65B 3EFFB 1AGFB 4FQQA 5MI0B 3T8XB 25C8L 4KKBC 4RAUA 1S7VA 3UJIH 3BD5A 4UIMB 1NGPH 2GK2A 3WFHB 1ZS8A 1EBAA 2XY1A 4DZBA 5I71C 3K8MA 5DJYA 3S34H 5EIIA 1NMCC 1SJXA 3O0RL 3SCMA 2NYYD 2XZCL 1N59B 3PUCA 4D8PA 4OZFG 4GQ9L 4HUVA 3SHSA 1HSAA 2EE3A 1JTPA 2N4IA 3X13B 3MLRH 3AREB 2G60H 5AUMA 2AK4B 4L4VA 1JRHH 3BEVB 3BKCH 4JM4H 2GTZA 2AJ3B 3B2VH 4GKNA 4U3XA 5FV1L 2I9LB 3PP3K 2VSDA 4KTEH 3VFWA 3EUUA 1IGFH 4UINH 1OP3H 2EEAA 5ETUA 3DVIA 2A77H 3UBXB 4X7FC 5C0EB 3U0WL 1CFVL 3TBYB 4UZGA 3TV3H 3A6OA 3B9EA 4OCYH 5DMIH 4CVUA 5INCA 3OF6A 5FYJD 4HT1H 3L95A 4WWKC 3MGOA 1OGTB 4L29B 1ND0A 3HZMB 2D7MA 1Q94B 4H26A 4L8SB 5FGBA 1OAZH 5LCVL 4CVWA 2CDGB 4JFDE 1B6UA 3PWPA 4L9DA 4KKLD 1RJZA 1XF3A 3I02B 1BIIB 1ZA3A 1KIRA 1CD0A 3QEUB 4LRNH 4XXDB 5FHAL 1M1SA 4NHUB 1HKFA 2WW8A 4JHAL 1FFRA 4AEIL 3G6JA 4EUPG 3AUVA 2GJZB 4IS6B 5ADOH 5GSRA 1KCLA 1NEUA 4GXUN 2FX8L 1A02N 1ZLSL 5E8PA 2Z8WC 5C71A 3MLXL 3D2UB 1J11A 2DBLL 1E4KC 2IJ0C 5A3ID 5IVXB 3MRDB 3S5LG 5L6YL 3TYFB 3LQZB 1SEQL 4OLZH 1LE9B 5MP6H 3U4EB 4JVPA 4OSUH 3SGKA 1XGPA 5C09A 2VDOL 4MB3A 3ARWA 3LN4A 1CE1L 3FRPA 3HC3L 1KEMH 5HI4C 5EUOF 1FZMA 4XWOD 1Z0MA 4NN6B 1HIML 2J5LC 3UJJL 5HBBA 4ODBD 2EH8L 2AEQH 1E6JH 1JF6A 2QQLH 3NPSC 1EEYB 4G7VH 4XBEL 4YO0A 2B5IB 5ID0B 3FB8B 4GLRH 1F4AA 4ONFH 4QNPE 2QEJA 4U6HB 4U1SA 3QT2A 2DLIA 3L3HB 4NP4L 4PG9A 4F2MA 2FBJH 4KAQL 4GAFB 2BERA 4WEUD 1YA5A 3CSYB 4WUUA 3BWAA 2EXYC 5D7IE 3WN5A 1QRKA 3GSNA 2HKFL 4JFPA 3O2VH 3BZ4B 4BZ1H 1J8HB 3VG9C 2HVJA 5GHWH 3D18A 4TSAH 2XWTA 2WQRA 1U8HB 4FFWD 2WM0A 2YPLE 1G7JA 1BJMA 3I2CL 3BE1L 1ULVA 1Q9OA 4PY8J 1JZ7A 4P2OB 2FX7H 2BVEA 2Q86B 1HHKA 2EYTA 3FB5B 4G8GA 2XWBB 2NY0D 3VRIB 1A2YA 15C8L 4UTAL 3QNYA 3BQUA 3LRGA 3QHZL 5DZOA 5LG1A 1AJ7L 2YPLD 1HYRC 4I0KA 4CMMA 4M1CD 4Y19B 3STLB 3WFEL 4K8RC 3RX5A 3O3DA 2UY6A 2Z4QB 3L6FA 4NRYB 3ULUC 3GJEA 1OSZA 5D7LD 5MI0C 5T3XH 1CXIA 3T2OA 1P84K 4M5YL 2UZIL 4FN0A 2VC2L 4MLSA 3BXNB 2EE6A 1IARB 1MCPH 4PJEF 3CX5K 3EFDL 3NACL 5GS1A 1HHHA 3GI8L 4KDTC 1NLDL 3VXPA 3NABL 3EYVB 4F7EA 1X5LA 3VFUB 3QFJE 2R15A 3AREC 1NEZA 3MJ8B 4MVBD 1NAMA 5JW4Q 3LHPL 2J3SA 5BRZA 4ONGH 1I3GH 3KPMB 1U8NB 2Z31D 3FQXB 4YWGL 4C55A 1J1PL 3OG4B 2UYLA 4EN3A 2AVGA 2ATKA 2YD4A 3VFPB 1NCAH 1T20B 2VL5B 3TNNA 1FG9C 4NKIH 4QXWA 5D71L 5IKCB 3DRQB 1IZJA 1CS6A 4PUBH 1FIGH 4WI6A 3O6FB 4PJIF 4I8DA 1BEYH 3C08H 3CU1A 4H8WH 5HGDB 3ULSB 1CFTA 4M6NL 4MD5B 4V1DB 2V2XB 4NCC2 3QJHA 3W5NA 1V7MH 5I8EB 3BN9C 1MI5B 4KZEH 4L8SC 3DBXA 4ZOEA 4RA0C 5CSBA 3SDXF 2VLLB 4PP2B 2BY1A 3SDYL 2APXA 5DLML 1MPAL 4LP5A 4U1HB 1FFPA 1XGQA 3UP1A 3LY6A 4EOWL 4PLKC 2ZCLL 3E6FA 2ICWB 3K81A 4DK6A 5EOTB 3HN3A 3A67L 2E5EA 2AABH 5MHSD 5J1TC 4K2UH 4FQ1L 1A6AB 3WO3B 3KXFB 4D0BB 5KSAA 1C16A 2QSCH 4KU1A 2YA1A 3QUMA 2OX5A 4OZIA 3I6KB 4XXCC 5CP3A 1LO3H 3OGOE 1OOAA 3DVFA 5ICYA 4RMTA 1U3HD 2HG5B 5DRZA 3CMGA 3PABB 4D0CB 5K9JH 4LCUA 4P5KB 4HK0B 5LQBH 3QRFM 4JPVH 1BPVA 4OLWL 1CI5A 4RIRB 1S7XB 3T2NH 4HS3B 3QO1A 4NNPH 5F7YC 1CK0L 4NN6C 5D1QA 4CU7A 5CBAA 1GH7A 4PRAB 1R5IA 2J12B 1D6EA 3RTQB 2VAAB 2B5IC 5JPNA 3VXNA 4NWTL 2Y36H 1UT9A 4BJLA 3FT2B 3IFLL 2GITB 2HN7A 1E4WL 4ERSH 4XHJC 12E8L 1AKJA 3CMOH 3OWEA 3TCLA 5D6CB 5D9SB 1INEL 3TLRA 1VHPA 4ORZC 1MVUA 2H8PB 3HUJE 3QJFB 4MHHI 3RAJL 1GIGH 4TNVF 3O6KH 1KG0B 3QFDA 4WV1B 4LCWA 2ZUUA 3CFEB 2VDQH 1JN6A 1Q8MA 1KBGL 3PP4H 4QXGH 4YHPB 1MQKH 4XP9L 4NUJB 1RSFA 3IFNH 4DVRL 4HZAA 4MA3B 2DJUA 1U42A 2XRAL 4P2OC 1BQSA 1VEOA 3NCYP 4JFYB 3ZE0E 1CFQA 3ARDB 5KS9E 1NGZA 3BP7A 2DL2A 1AD0A 4PBVC 2BRRH 4U4BA 2XNAB 4YHML 1SM3H 1E6OL 1G1YA 3O4LB 3T08A 1EO5A 3BN3B 1KENL 2DQUH 1ZKAA 3IDYB 1T2XA 4MCYA 4O2FB 1DUZA 4ZPTB 3VH8G 4PRNA 3LDBB 4LVEA 2XQYG 4H0HB 4OLYL 5SX5H 5JR1L 2OXHA 4XNYL 4HULB 2VAJA 4E5XA 4LLYA 3G5VA 4TUOB 4PBWD 2Y25A 3LIZH 2OJEB 3C6LB 4K7FB 3LEXB 4X98B 3QG6B 4OCWL 1C12B 2HWZL 3JWNC 2YC1B 4G6JH 1EMTL 1RZJC 2AW2A 4KRNA 1LNUA 4R26H 3QIBD 1A6ZB 1WIUA 3F7YB 2KL6A 3WIFB 1OSPH 3CFKA 3EOAA 4FFZH 3MBXL 1A1OB 2ZJSL 5HHVH 1M05B 2HVKA 1X5YA 4U1GB 4AENB 4JFZH 3S9DB 4TNVK 1WWCA 4HGMA 4BA8A 4I0PD 3B9VA 5DD3H 4HQQH 1RAMA 1AXIB 3MJ9A 1RZ7L 1FL5B 2UWEB 1NSNH 4KKAC 2CMRH 4WFHD 2VLRE 2CLVA 4YR6B 3MTRA 5FOBA 5F89A 1U8LA 3O6FC 1CXFA 4MAYA 1ONQB 1M4KA 4RISH 3WXWH 2QADD 1Y0LB 4HHAA 2ZWLT 3I85A 4ISVB 3BH9B 4CRPA 4FTVB 1IRAY 4DJMA 5JDSB 3BUYB 2Z8VC 4YFLF 5GGQH 2OI9B 1U8PB 3VE0A 3KR3H 3SE9H 1PD6A 4IBLT 3CZFA 3GSNH 5KVEH 4N0RA 1RURH 3S36L 2HLAB 5BO1L 1N26A 3PGCB 4AH2A 2V5SA 1DEDA 1QFUH 4BSVA 3QXAA 4MYWB 4KI1A 2OTUA 4QY8A 5GIRA 2IANE 3ARYA 5HHOE 1OGAB 5CAYB 3H3PL 2K3TA 2FH8A 1WTLA 4R4BA 4LHUA 1X5JA 1CXLA 5I1DA 2YPKA 2CPCA 3HMWH 1Z9LA 3BD4A 1QVOB 3CVIL 4PJ5E 3MV7A 4HLZH 1NCUA 5IB2B 4JDTH 4QRRE 2BSSB 2IAND 3W9DA 5HHOD 4YE4H 5FCUH 4ODXB 2X89A 5L2JA 5E8EA 1PGRB 5DURD 2V5MA 2FJFA 4L3EB 4P99A 1WZKA 4KK5C 2BSTB 3FN3A 4KMQA 4NDMB 3WIIL 4FQIL 1N8ZB 1D6VH 4ZUWB 5AEAA 2WWMC 1P84J 2V7NA 4PJ5D 4QRRD 1BD2B 2DIAA 4HIEA 3RTQC 3W11D 3IAPA 1BJ1H 1R6VA 3FONB 1I4FA 4DKAA 1AC0A 4Z7WA 1KCRH 1Z5LB 2VLKA 1UXSB 4YX2L 3BKMH 3EYQD 4BKLA 3C5JB 3V4UH 4HF5L 4FQJH 4ZQKA 3MCLL 2CXGA 4PYGA 4Y4HA 5E6YA 4WRLA 1B4RA 3DX7A 1C5BH 3TT1H 3AS2A 4OF0A 1AE6H 3CDGA 4OZ4A 5DD6A 1MUJB 4HEME 1YMMA 5DD5L 4WV1C 1R3HB 3ZL4H 3P0YH 1YYLL 4QTIH 1EZVX 5BZDB 1I3RB 1U8IA 2E6JA 4LSSL 3NFSL 3GSOA 3KJ6H 4PRBB 4RRPG 1K4CA 5EBMA 1P4BL 1GZQA 1FZOA 1MHHA 2AJXH 2VXTH 1ZVHA 1EAJA 5E8DH 1UZ6E 2AQ2A 1M71A 1MAML 5C9JA 5K59E 4R7NA 3TESA 4NQCE 3CLEH 3HE7A 3DX8B 1F00I 5I76A 3ARDC 5D4QA 5EUKA 2N7BA 4NQDB 5BS0E 4OQTL 4ZSOE 1N2RB 1P2CA 1QLEL 3BZFA 1RULH 2DLHA 2OJZL 5E1HB 4ZUUA 3O3AB 1KV3A 4JO1L 4Z0BH 4UNUA 3IDYC 5HHMD 1U8MB 3FCTB 3SDCB 1ZEAL 4LRIA 2D7TL 4E41A 3LDBC 3ECBB 3RVXD 5GXBB 4NQCD 4L1HA 1SYSA 2MQCA 2NQCA 4ODHH 3OXRB 5DRNA 4QNPF 4LBEA 4PJ8B 2OQJB 4Z18A 1FO0A 3C6LC 5IT2H 1A8JH 2FHFA 1CCZA 5KVFL 1QNZL 3MRPB 1EO8H 1X5FA 5TE6L 2W9DL 2QR0B 3TWCL 4KROB 4YGAB 5D7IF 3QUMH 1AY1L 2YN3A 2G75B 5CJOH 3MRQB 5EU5A 3CVHL 5AWNL 1IEAB 4RNRB 2ZUQB 4L3CB 5IVNA 3BPCB 3RPKA 4BQCA 1G6RL 1H9VA 3RDTD 3JXAA 4U1GC 2C9AA 1EXUA 1S7TB 2NXZD 2BFVL 1HKLL 4HS6B 3V8OA 1WAAA 2JF1A 2F74A 2X4TA 2DYPB 5JW4R 4ODUA 3GMPB 5A16B 1J0ZA 3L3DB 1OARL 1A3LL 1BJ1J 4FHBD 1KEGL 4QRPE 1O7VA 1RJCA 3O6LL 5D2NB 3ORJA 4PP1D 2X4RA 4X4YA 1MCNA 4YHOH 5BZWA 3UPCA 5FB8A 3CLFL 2OI9C 5EN2B 3VGFA 2D4DA 1J0YA 4A6YL 4MS8D 4POZD 1T1XB 2E6QA 4MQXD 1T2JA 4J3XA 4HH8A 4XMPH 3UMTA 1UWEL 2PR4H 5KOVC 4O58H 2PO6D 4UB0H 2IG2H 4JQXC 2GK0A 3KPRA 5KVDH 1R3IL 1OAUL 4N9GA 3D0VB 1KIQB 4KMTL 3ZYJA 4TVPL 2WUBH 4UDTB 5D7JB 5CBEB 2FLBT 1BJ8A 1JHTA 1S9WB 4EVNB 4FQHB 2A6KA 4LSUH 5KSBF 4YUEH 2FATL 2EDLA 3OHXB 4F9PA 1SQ2N 5EO9B 4L4VE 3H42H 4O2CB 2BVTA 3FB7A 1DVFB 5H37H 2B1AH 2P8MB 4MHHG 3UCRA 1KCUH 3SCMD 5B38G 3WJJC 3LKRB 4MB4A 2VIRA 3DX6B 4U1KA 3RWHB 1F4WL 4GW5B 4HGWB 4ZXBD 8CGTA 5JXEC 5KSUB 1N3NA 1KIPB 3MLPA 2R1XA 5DK3A 1FNAA 4G9DA 1FNSH 4XAKD 3K2UL 3LEYL 5E94B 2HLFC 4G7YL 4TSCL 4U1MB 3VXSA 5E70A 2DQFA 1MNUH 2Y5EA 3MQIA 4JZOA 4LSDA 3ZHDA 1Q1JH 3ROOB 1IT9L 5SV3A 5ELIA 3GHEL 2EDFA 4QHLA 4DW2L 1EAPB 3MJ9H 5F8RC 2RR3A 4TUJA 3ES6B 3LN5A 3QULB 1HZHL 3TJHD 5DJDA 4QWWC 4LLVB 5LGJB 1JL8A 2OMNA 1G6VK 1VGEL 3OF6D 4Y5XA 1PJ9A 3HPJB 5ECJE 2AKRB 3G6JE 4EUPH 2FYYA 1WIPA 3HG1B 3QDJA 4M1GH 4HBQA 5JOFA 4FQ2L 5E2UL 4FMKA 1AO7A 3T1WA 3PWPD 1FV1B 4QXUL 2F19H 3O11B 5GS2D 4YEEA 5ACZA 3U79A 3OKLA 3UYOD 3OKYA 2B0SL 3JWOH 4KVNH 4P9HC 2VUOA 2DQGH 1MRDL 5C09E 2XOTA 1VKXA 3SDCC 3AS3A 3LH2H 2C4XA 1U8OB 3MROB 1T03L 1C5CH 4K94C 4RAVB 2FGWL 4Y4FA 1JPFA 3THML 2ARJA 4PJ8C 3MMEB 4RBPK 4UU9B 5L8KB 1EHLH 2MKLC 3P0GB 1HSBA 4HV8B 4NO0A 2X7LB 3N50A 5HHNB 5IV2B 1PKOA 5K33A 4YPGA 4HUMB 2DIJA 3MRJB 5C09D 4Y8DC 3VJ6A 4KROC 4W6WB 1L0QA 3V9FA 3HUJF 3H9ZA 1TTFA 1YJDL 1BQHA 3OR6A 5CEZL 4N0FB 5IROC 2ZUQC 1B2WH 1X5IA 3D5OF 1EJ6A 4PJAA 4WUUE 3CVHB 2BVYA 5C1MB 1RK1A 4LF3A 2IPTL 4DKFL 3M1BA 1TZIA 1LQSR 1MWAL 4JFHE 3MRHA 4BQ9A 1PLGH 4XNQA 5KTEH 4Y7MA 3ZE0F 3OJ2C 1Z0NA 5KS9F 5CEYB 5EO1B 1LO4H 2R0WH 4V2CB 4QRTA 4PRPB 3UTSB 4P57B 4WUUD 2BSRB 5D2NC 4ODWA 5L0QB 3K8LA 2VITA 4LKCA 2XZAH 4OCLC 4YQXL 5E95B 5EU6A 4NQVB 1KB5B 3V5DA 2DF3A 4G8GE 5HDQH 4JFHD 5F7DA 2X1WL 4PJ9B 3W0WA 3P0VH 4MA7H 1I9RH 3C09B 4DQOL 1IKNC 5TF1H 5BV7B 3LS5L 4GG6B 4MWFB 1IEBA 2NXYD 1OAYL 4BYHA 5BJTA 2X4QB 3FFDB 3LKPA 4N8VG 1YDPA 2CRZA 1N6QH 3ZKNC 3H7BA 3MOAL 1RJYB 5BOPA 4X6CB 5F88A 4LNRA 2XQYK 2XKNA 3MV8D 4G8GD 5I30H 2HFGL 4X6BB 3QEQA 5CFHA 1YY8A 4C56D 1T1YB 3QISA 5H8DA 4Y4KB 1QSEB 1FORL 1WGOA 5D7JC 1H15B 2QQNL 4G43B 2NW3B 3JV6B 4F7CB 1MJJA 4Y16B 1UJ3A 4X5LA 4LOUD 3UTTA 2FJHA 4PGDB 5J56B 5JUEL 1N6UA 2XKSA 3ZYIA 5D93B 3RP1A 3O3BB 1FE8H 5BRZE 2R1WA 1DVFC 1KCSL 1A9EA 4P2QA 5FF6B 5I8OH 1BMGA 2EZ0D 3EO9L 1FO0H 3F12B 5CJXC 5CGYC 3QG7H 3ILPB 4EI5A 1U8QA 2XV6B 4GKZA 4POYA 1VERA 4O5LH 2W0FB 2CUHA 1VFBB 5KSVA 3D87B 5L7XH 5AYQA 3KYNA 3LMJH 1S9VB 3P11H 3FL7A 3MFGB 3PV7A 2VKXA 4J4PC 2ICWI 4QHNB 4EN3D 1DUYB 4HSQA 3CFCL 1I7ZA 4JRYA 4OZHA 5ESQB 2OR9L 3GI9H 5EPMB 5TF0A 1B0RA 5E24E 1DBBH 2XA8H 5F3HB 5IVOA 5J11B 5EU4A 4PRIA 1AGBA 4P5TB 3QZWB 2Z9TA 4Q0XL 3NH7L 2FLRT 2D31A 3IJYB 3U36A 4F9LA 1T1ZB 2UZYB 3VWKB 4IOSD 5GZNC 3TH2T 4IRSD 5E5MB 5AG8A 1DQJA 4FFYL 4ONHA 2A6IA 3QEGH 4JY6B 4X4XA 3TIDA 2R9HD 3DECA 1X5AA 3IU4H 4HUKB 1VESA 2Y6SD 5DDHA 5C0BA 3UTQA 4OZIE 5F7LB 1NGQH 4ENEC 3WMSA 2C7UA 1CGVA 3F7VA 5DEFB 3EZJB 1PKQA 3O2DA 5IHLB 5DQDH 5SWQB 1GGUA 4S1QL 2O5YH 2B4CL 3RX7A 3I50H 2Q7YB 4CN6A 5CWSB 4K7PL 5HYJE 1XF5A 3H8NA 3EDKA 5EC2A 4G9FB 5D7SL 3KPNA 1MJ7H 5JHDA 5DVMA 3UAJD 5DYOB 5JORA 1KNOB 3P9MB 4JY4B 5IB4A 5M94B 5JIPA 4ORGA 5IMMA 5GRJL 2NTFA 3EJYD 4N8CH 5D1QD 3IFOB 4HMDA 3WKMH 3B6SB 3BISA 1Y6KR 4G6KL 4PJXB 5ICXB 3QDMB 3CUPA 5I1KL 4R90H 2C3VB 5IW3A 5DS8A 1FFQA 1UZ6F 3DGGB 5K59F 3VXMA 1W0VA 2EE2A 3TA3A 1MWAB 3X11A 4X6DB 3QHFH 4EBQH 2MQ3A 4XX1G 2DTML 2EDJA 4NCDA 4OCSL 4LAQH 4QEGA 5KN5A 3RBGA 4HIJB 5L0QC 3IXAB 2J2ZA 2O93L 3MRLB 3O41B 1CF8L 3N1GC 5GRVL 4PJ9C 4LCWD 3C09C 4HFWB 32C2A 2CLZA 5BV7C 2P49B 3FAWA 3QIUA 5FO9A 2FDBP 1DP0A 3ARUA 2YD1A 1EHAA 4NIKB 4ELKA 3X17A 5HHPA 3C9NB 2FEEL 3WJLA 1A7QL 5DQ9B 1MJUL 4KK8C 3MR9A 3T2QA 1SYVA 5TDOA 1YEIH 2JJWA 2DQJH 3PWJA 5EFIB 3L7FB 5DJCA 5CUSH 4JY5L 5DRXB 2J6EL 2BCKA 4Y4KC 2QQKH 3GSWA 3PWVB 3Q6GL 3KYOA 1B88A 3W5MA 1KLGA 1MFEL 4Y16C 4WI9A 1JHLH 3RWJB 4XNZB 5C0CA 4MXVE 4G8IB 2FSEA 3B8YA 3WDHA 3UDWC 4NBXB 2SEBB 4HWEH 3FKUS 1K3ZA 1NUNB 4XNMB 5D93C 1LO2H 3FO9A 1YEDB 5TDPB 4ALAH 3KYKL 4WTZG 3QCTL 1W72B 2AK1H 4PRHB 1NCWL 2M2DA 3IDGB 2PTTA 4OZGE 1IMHC 1KTLB 3NIDE 4PIRF 2DDQH 3ZDYE 4HDIA 3MLYH 3JVGA 4F7TB 3MRFB 1IAKA 1QBBA 1K3IA 1BQLH 1N7ML 1F4XH 3V7AE 3EYOB 2C3XA 1FC1A 5JO5A 5CGMA 4YXKH 5E7BA 4WW1B 4LEOA 1H8SA 3QPXH 4NJ9H 1AXTL 4AJ0A 1CGSL 5DJAA 1JYXA 1I9EA 1Z9OA 2WBJA 5J11C 2FO4B 2MCPL 2BNQB 3GSQB 3VFOA 4Y1AB 4P5TC 1IQDB 1DZBA 3G08A 4MAYD 4QTHB 1WT5C 3QUKA 5JQ6L 5CHNA 3DXAA 5E1AB 1PYWB 3V4VH 1KN2L 1DBAH 3F7PC 3VWKC 1XR8B 1W2KT 3LQAL 4S1RH 4U1NA 4MDJB 5CZXC 4AK1A 4XCCL 2EIZB 2I60L 3DNKA 3S36X 4HBCL 1OCWH 1F42A 1OTSC 4JFOA 4QHUA 1GGYA 1FFNB 1J86A 1QRNE 1A5FL 4K3EH 3MV7E 5DZLA 3L3GA 3ULVL 2D03L 1MVFA 1ADQA 4LLDB 2H6PB 3TFKC 3VXOA 4PYHA 4QCIB 1M7XA 1RZIA 4LVHB 4LHUD 4FFVC 2A38A 4G6FD 1T3FB 2VDKL 2ID5A 1A0QH 1ORSB 3A6BL 2AAVA 4NM8L 4ZYKB 2BVPA 4I0CC 4RGMB 3FFCD 4GRWF 4KFZC 2APTA 3MV7D 5C0GA 4WHDA 3W39B 4ZO8A 2X89D 4N0YH 4HWBL 2AS5M 4PJBB 1CDIA 2ZOKA 3RPIA 3B9DA 1D5ZA 4RWYL 4FZEH 3PQYA 2CRIA 3S88H 2ESVA 1YN6B 4Z7WE 5CSGA 3R8QA 1HXMB 2VLME 1XGYL 1BAFH 2WSKA 3IVKB 2AJYH 3MJ7A 4WTWA 4XPAH 1L6ZA 3U9UA 1A47A 4F8TA 4ZG1A 3G6JF 1JGUL 3Q1SL 4NBZB 3QIWB 2XXCB 1ZVSB 1YMME 4TUKH 5CILL 5I18H 2OMBA 1UG9A 4OKDA 2GYSA 3JUZA 4KXZI 5D6DC 4PB9H 2OZ4A 3FQRA 3S98A 3WNPA 2R1YB 4JZNA 2VLMD 1P7KB 4X5XA 3GKWL 3QUZB 2VRAA 5FK9B 2VLKD 4O4YH 2XN9B 2MJWA 4WWKA 4XPHL 3MA7B 5K9KA 4Y4HD 4MD0B 5L8LB 1TJIL 1MLCB 2JE8A 3P77A 3DUSB 3QQ9C 1YMMD 3EO0B 2VE6A 1NC4B 4LMQI 4W4OC 4JCMA 3GBNL 1OP9A 1NDMB 3QQ4A 4YHKH 4PY7B 4DZ8A 5I8CB 2IH1A 3WFDL 4E41E 2ZP0T 5GGSA 2FJGB 1V8HA 1IGJB 3BKYH 5HSFA 1YQVH 5IIEA 3CPLA 1M7IB 1E4KA 4KY1H 1G0XA 4X7EC 4LLMA 4ZFFB 5ESVA 2P7TB 3OJVC 1JPGB 2H26B 4P4RB 3FO2A 1RIVH 1DQML 1XR8A 4FABL 4E41D 1FDLL 4XNZC 1ZHBA 4R3SB 2CJUL 5J6HA 2OLDA 4GXVH 1QR1A 1FNFA 5D2LA 1Q9KA 4BK4A 4PBXA 3HCVA 4I3GA 3HAEG 3CXHJ 1JUFB 3GGWB 4YHNB 3F6IA 2W92A 1WAAE 4K9EC 3S37X 1YEKL 5JW3H 4OI8A 3HHRB 5C0FA 2VZ1A 4M7LL 4Z7NE 4HKXA 4PTTA 1AFVL 4U3HA 1P5UA 2XQBL 2VDPH 2YXMA 1H3PL 3OAUL 4MQTB 3ARGD 2HH0H 1T7ZA 2AXHA 1NGYA 4LSPH 2A9NH 3MFFA 5F1NA 2B1HH 1HYSC 3K4DA 3V5HB 2IALA 1FQ9C 3MRGA 4F37F 3RHWF 1FYTB 4JFFA 5B39B 4HZLB 2X42A 4N0CD 4Z7VB 1OP5K 5J6GB 3ME0A 1AI1H 3MLVH 4QT5B 4KJYB 2ZCKL 3KPRE 1TJHL 1U91A 3HNSH 1XZ0A 4NC1E 2VXVL 1VEMA 2R4RH 3X3GH 1KUMA 2J88L 1A6WH 2I27N 4Q2ZA 1N4XL 1QUNA 3NGBB 4HUWA 2XZZA 1Z3GL 3H2WA 3SN6N 2NX5A 5IMOB 4LEXL 3O3EB 5E9DD 1KJ3L 2PUQT 3T65A 4P48A 4XGZB 5IUSA 3VXUD 3GMOA 1MCOL 1WEJH 3JTSB 4LVHC 2D7NA 2VZOA 4LDEB 4UIMA 3NIFF 3CK0H 3ROLB 1GJIA 4RGMC 5KANI 1LDPH 1HQ4A 4YFDB 1LO0L 3AS1A 4J3SA 1TNNA 4LPXA 1H3XA 4BUHA 3P30H 1NKOA 3NCBB 3X13A 5C3TA 4O2EB 2AK4A 3BEVA 2AJ3A 5DR5H 1DQDL 1UA6L 3ARFB 3KPPB 1JF1B 2I9LA 2DTSA 4LSRL 2WQ8A 1JP5A 4KRPD 1TCRB 1FVEB 5H2BB 3CNKA 1HHJA 1S7UB 1A6UH 4M6AA 2NR6D 4KUZH 3UBXA 5C0EA 3BMVA 5IB1A 3S4SG 2PYEB 3QIWC 6FABH 3TBYA 1N0XL 5DUBB 1IC1A 4FZ8L 1FZKB 3QUZC 5CIPB 1X44A 3SO3B 3VXSD 3NZHL 4LK4A 1XIWB 4TVSa 1U2HA 2I5YL 3QDJE 1OGTA 2G9HB 4OZIF 1BM3L 3AC0A 4L29A 4LHJB 5GGTL 1P4LB 1Q94A 1AO7E 4L8SA 2EICA 1IGTB 4PD4K 3IDNB 4D3CH 4DUWA 3ZSTA 2DWEB 2CDGA 5ABDE 2AV7B 4FXGA 1MF2H 1NFIB 3CZJA 2GY7B 4CVXB 2DKMA 3I02A 2EH7L 4XXDA 4HC1A 3MRRA 4LIQL 4NHUA 4OGYL 2IFFH 2KQNA 2Y7QB 3QDJD 2GJZA 1AO7D 2YSSB 1C7SA 2EO1A 1BFSA 2Q8AL 3MLWH 4OLXL 3D2UA 4YDKH 5I1HH 1BVZA 3MOBL 4CADB 3MRDA 1CDHA 3IJSA 4RFOH 3FTGA 3LQZA 5CD5C 3GHBH 4XXCA 5D7KD 1RI8A 1LE9A 1RZKC 3TBTB 5HTSA 3HB3D 1MFCH 3MGTB 4Y4FD 3E6HB 3MZGB 2BY3A 5IBLC 3CAFA 3JWDL 3MGAA 4PJAE 4NO0D 2DD8L 3PGDB 3U7YL 4NSKA 2R56L 2DKUA 1EEYA 1UEMA 5F1IB 2HMID 1UYWL 5F6HI 5ID0A 2CUIA 3S97C 4TRPH 2D9CA 3SKUD 1IQWH 4U6HA 5B3JE 2BJMH 3DO3A 3DYOA 1Q0XL 4P2RA 2DN7A 5EU6E 4NKMB 1EEQA 5IMLB 3W0WE 3BZ4A 1J8HA 2VDML 5DJ2B 3V0WH 5BVPH 3BPOB 5DGQA 2FWOA 1U8HA 5GJTL 4XVSL 4OI7A 3I6GB 5I1IL 1IVLA 4LQFH 3G9AB 1L7TL 3T4YB 2OZ4H 3MUGB 3SKOB 2HT2C 5EU6D 5I17B 4C4KT 4JHWH 4CNIB 1HQRB 2Q86A 1EJOL 3W0WD 2HAZA 3E2HB 3FB5A 3K80A 3QEQE 4MXVF 2XWBA 1JWUB 5IOPB 3PNWB 2PCPB 3MCG1 3NCFB 3O8XD 1MCWW 3NGBC 1OHQA 1WK0A 2V7HB 4OT1L 3EOBB 3EDFA 5EA0H 3UTTE 3S35L 5M95B 1UACH 1MRFL 3STLA 2YMXL 4OZGF 4PLJC 1PX4A 3BGMB 4M7KH 2Z4QA 1EEZB 3NIDF 3QEQD 1MFDL 5SWZA 3VA6A 3ZDYF 2CKBH 3SBWC 5I1AB 2W9EH 5F71A 2ATPB 3OR7B 4P2QE 1MCQA 4OM0H 1NL0H 3BHBB 3BXNA 4NZUL 2NY1B 2APFA 1C8PA 1ACYL 3UTTD 1M7DB 4Q9RL 4UUJA 5FYKL 1AGCB 4E0RB 1YYML 3H9SB 4S1SL 4X5WB 3EYVA 3VFUA 1PDKA 1KELL 4NQTA 3MYJB 3GJFH 4NM4H 1KF9B 1RVFH 5FUCC 3JV0A 5TH2B 4GMTH 3KPMA 1U8NA 5I73B 3ARFC 3IB4A 4OZHE 4JRYE 4ZO6A 5DT1L 1ZT1B 1KGCE 2J8HA 4FQXD 4ZS6D 3VFPA 4EI5D 2VL5A 1OLZA 5IKCA 3GNML 2JIXB 1QPPA 1EZVY 3DRQA 4JKKA 4PRIE 3SKJL 4DCQA 4LU5L 4MJID 5JNYB 3DVGB 3O6FA 4HXBH 3P2TA 5KW9H 2P44B 1CICA 2R8SL 2XPGA 5HGDA 3ULSA 4NRXA 4JRYD 3SO3C 4XP6L 1XIWC 3LZFH 2A1WH 4V1DA 2V2XA 3K2MC 2NY4B 3TT3H 1SY6H 5I8EA 1MI5A 2W59A 2P1YA 2E6PA 4PRID 5IR1B 4DAGL 2YEZB 4PP2A 1EVUA 5DF0A 4WHTB 1FJ1B 5C0BE 2J4WH 4UOW1 5IP4A 4KI5D 1RU9L 1MEXH 4I2XE 3HI6H 4NPYA 4G3YH 5EOTA 1MCEA 1QKZL 5J12B 4ZUTA 1PKQE 2X1OA 1TETL 4X7DC 1CFNB 5I74B 4WHYG 4PB0L 3SPVA 5J9PB 3FO0H 2X2YA 4RGND 2VXSL 3A6CL 4X80L 2X4NB 1VPOH 4Z7WF 1A6AA 3KXFA 4D0BA 5FYJL 1ZLUK 3RL1B 2W91A 4G42B 1JGLH 3NFPB 3I6KA 3FMGH 4GRLB 3F58L 8FABB 3FQTB 2HG5A 4F58H 1GPOH 4K8RH 3PABA 4D0CA 4OV5B 2QQQA 4P5KA 3P4OB 4HK0A 3ULUH 3UYRL 3U4BH 1B9ZA 5DTFB 4GBXB 1S7XA 2X4PB 3KLAB 4K7PX 2YK1H 5IQ9B 4L4TA 3GRWA 3RTQA 2DQCL 2VAAA 3T1FB 5JHDD 3MBEA 2P8PB 3WNLA 4MMZC 3VXME 1S5IH 3CH8A 3QRGL 2GITA 3E3QE 4AT6B 2LV4A 2M8XA 5CJBA 5DO2D 3TVMB 2Q3AA 4JANA 1WFOA 5ALBH 3VGBA 4ZTPL 1K9TA 5D6CA 5D9SA 1ZGLP 3C60A 2ZPKH 3RWCB 4UOJA 1T22A 2H8PA 3QJFA 5D72L 3PHOB 1DQLL 4WGVB 5DJXB 1J87A 5GGRY 3VXMD 1KG0A 4UMGA 3SE8L 2R2BA 3TA3D 2DI9A 1W0WA 1TMCB 3BPOC 3HR6A 1CDCA 3CFEA 4G8FB 2AGJL 5BXFB 2R69L 4OJFL 3DRTB 4RAHA 5EOCL 4L8CB 4NUJA 3QCVH 5FUOL 1RUKL 3OKNA 4YGVA 5AZ2H 1CD9B 4JFYA 2F5AL 2BMKB 3ARDA 4LSTH 3E2HC 4L3AA 2HTLC 3VFSB 5KANG 4IRZL 2QBWA 3QIUD 5LXGL 1MHPL 1QFWH 1WZLA 3O4LA 5D5ME 5T33L 4MJ2A 1CG9B 5C0CE 1BGXL 4I3RL 4ZPTA 3HKFA 5E2JA 1R24A 1AGEB 1AIFB 3VG0H 1BOGB 4F33B 3MLUH 1VCAA 4HC1H 5FYLD 1NCDL 1WAAF 5EUOA 3WS3B 3RIFK 1EGJL 4RZCA 2F5BL 1UB6B 3TYGL 1RUPH 2OJEA 1WFTA 3ZT6A 3C6LA 1V05A 4BM7A 2O5XL 1A7RH 3LEXA 4X98A 3R8BB 3QG6A 1F6AA 1QHPA 4Z7NF 1C12A 3MA9H 2KBGA 3B9KB 4HXAH 4OFKA 2NY1C 1G9NL 4P3CL 3ALWA 1JYWA 4LSVH 3O6MH 3VW3L 3AY4C 3G6DH 5BMFH 5BQ7B 1A6ZA 2NY2D 5HD8C 2MTPA 3F7YA 4JG0L 3WIFA 3IF1B 1A1NA 3LB6D 1ZLWK 3TGXA 4P9MH 4B41A 1UKTA 1OAQH 1M05A 4KUCF 4OZFB 1MFAH 3HS0B 1R5WA 2AJVH 5I73C 4NT6A 2DQTH 1FPTH 1FL5A 2UWEA 3LEVL 5DZNA 1J88A 1F6FB 3SEPA 3REVB 4XRCB 1JPSH 3WE6B 2NY6D 5E2VL 4YXLH 4CGTA 3DXAE 3N1FC 4XNUH 1J5OH 1ONQA 1KFAH 1Y0LA 3WDIA 1JYNA 3HNTL 4L9LB 4LCYA 3QXVA 5EZJB 2V17L 5E56A 1TZGH 3BH9A 4FTVA 5B21A 2HA1A 5JDSA 3NOIA 3BUYA 1CT8B 2NY4C 1U8PA 1U0QA 4IRJB 5I8KH 4K23H 3SJVB 1NCTA 4GKSB 5TE4L 4X6FA 2AV1B 1KN4L 2HLAA 4H1LG 3PGCA 1CGYA 3K8KA 1S9KC 3ARSA 3P9LB 5HHXH 3DXAD 3FB6B 3MLTA 2DJSA 4CMHB 2VZSA 2LAGB 1YEHL 4HJJL 1RIHH 4XC3H 5F7MC 1OGAA 5J12C 1JYVA 4HKZB 5C6WH 2P24B 4PGZA 2DM7A 5I74C 4P49A 4RGOL 5E5UB 2C3HA 1Q0YH 3D0LB 5FA4B 1S9YB 4U1LA 5FYKU 1X4XA 4GOSA 1A3RL 2BSSA 2YS4A 1BF8A 3NCYS 4GRLC 4LSQH 2FHBA 3PQYE 4P23D 3S5LB 2IQAA 2ESVE 2F9BT 4L3EA 4XZUB 1T66D 2BSTA 3HFMH 5SWSA 4NDMA 1N8ZA 4ZUWA 4WI5A 3RKPA 4G6AD 4GBXC 3NPZB 2J1KA 4M93B 1DQQB 3OB0K 3WJJA 2NZ9D 3MUZ1 5T5NF 3G9VA 2XZQL 4YC2B 2A9MH 3JWDC 4JPKH 1RMFL 2BHUA 1RZJH 5JXEA 4MMXC 1SJHA 4XVUD 1BVLB 4FMFA 3FONA 1EV2E 5FHBL 2ESVD 3O0RH 1JHKH 1ZTXL 2XZCH 3D39A 1Z5LA 3TVMC 4RQQA 4R6UA 1CL7H 3C5JA 1C5DB 3UJTL 2R4SH 4OTXL 4LVOB 2FEEI 5ALCL 4ELMA 5ERWB 3BX7C 1SHMA 1T21B 2IF7A 1VENA 1KPRA 1TTGA 1R3HA 3CH1A 3INUH 5BZDA 4IOFD 3R1GL 4JHBA 3VGAB 1J05B 1PW3A 3U0WH 4B53A 1MRCL 1VGKB 1YEFL 1DLFL 4Z7UB 1MH5B 3MZTA 1LE5B 4Z0XA 5AD0B 1H8OA 1X5ZA 4R96B 3DX8A 3R06B 4O02L 1PSKH 3EYUL 4NZRH 2E7BA 5BW7C 3OKMA 4GAGH 1N2RA 4M61B 4JPWH 5FYJU 2WIIA 3O3AA 3RGVB 4NUGL 4PJDB 3IKKA 4PJAF 3U0TB 1YECL 2OYPA 4Q58C 5FUZH 3DETC 1U8MA 3FCTA 3SDCA 3UC0L 1MIMH 5IW1B 3ECBA 3WD5H 3HMXA 4APQB 3CDYA 1H5BC 3OXRA 3DTXB 4D9QE 1OD9A 4U31A 4HPOH 5B3JF 2AXGA 2FB4L 4HS8L 4JHAH 4AEIH 1DEEB 1GL4B 3F8UB 4KQ3L 4PJHB 3RWEB 4XNXL 4M6OL 1LK2B 2CSPA 3B9KC 3MRPA 1SVCP 1T0NB 3NAAL 4MXQC 5ACLA 5JLZB 2DBLH 5ISZD 4K71B 2G75A 3VXRA 5HI4D 4AEFA 4L8DB 1JI1A 3MRQA 3PGFL 1IEAA 3MXWL 5L6YH 4RNRA 4G8EB 5IROA 4NQED 4D9QD 2WUCL 3BPCA 2NY0B 1F2QA 2ITDA 2Y07L 1U92B 5DFVD 1S7TA 3E1F1 2KZ1B 4HIXH 2GSIB 1XCTA 1QFPA 3WL9B 3EJZD 4HS6A 5JOPE 2WBKA 3ARZA 2JJSC 3GRWH 3WXVL 2DYPA 5AZEH 3S34L 3V95A 5C08D 4JFFE 1HIMH 3UJJH 5I66B 3GMPA 1G1CA 5J06A 3D69A 1QYGH 3TBVB 1BFOB 1XGUB 3L3DA 3UYPA 2H9GB 1U2CA 3RRQA 4P2YA 5D7LB 4X8JB 5J13B 4KDVA 2HTKD 5D2NA 1TZHA 2OBGA 5DJ6A 4L9LC 3MLRL 1XF2B 1FNHA 2G60L 3GIVB 1C08B 4PGCB 4XTRC 5JOPD 1JRHL 3BKCL 4JM4L 2VUYA 3RL2B 1IKNA 4IRJC 2NYYC 3QQNA 4LPWA 4OGXH 4JFFD 3P9WB 4KTEL 5D1ZA 1T1XA 1OT1A 3KPSA 4JFEB 4MD4B 1RZGA 4UINL 2NX5E 3SDDD 2HKFH 2A77L 1KJVB 1BBDH 4X7SL 4CMHC 1R3JB 3D3VB 3Q6FB 3SOBL 1NPUA 1MHEB 3ULUE 2Z31B 4ZO7A 4AY0A 1IZKA 2VWEE 3HTLX 4OCYL 3BE1H 1T7XA 3C5SB 5J1AB 4YBQC 4HT1L 2EDNA 5CKGA 5CLTA 1LEIB 4UDTA 3SGJC 1QSVA 2NX5D 1I1FB 5CBEA 4H5SA 4H88H 4OKVB 4J23A 3FHAA 1S9WA 1OAZL 4EVNA 4OZHF 1SEBB 4FQHA 5EU3A 4EIGB 15C8H 5KSBB 3OHXA 4S2SA 2AK4E 4LARH 4LRNL 1ZAGA 4O2CA 2GFBB 5JIHA 5FO7B 1I8LA 2P8MA 2ICWJ 3WFEH 2Y4SA 3OG6B 4M93C 3CC5A 1JFQH 4KKLC 5CJXA 3LKRA 4YC2C 3X3FH 3L3JB 3RWHA 2UZIH 1OY3B 4GW5A 4HGWA 3AAZA 3QUYD 5KSUA 1A64A 1KIPA 2B20A 2AK4D 3TNMA 4QF1B 1KB9K 4OLZL 4C59B 5E94A 1X3DA 4J4PA 4JO4H 2WMPA 4R4FH 3GI8H 1MFBH 1S5HB 4U1MA 3UO1H 3KHQA 2JLLA 2RB8A 1N6VA 5A3IC 3ROOA 1IJ9A 4OFVA 5FM8A 2NY7L 4LVOC 4GG8B 1EAPA 3LHPH 4L5FL 2ZSVB 3ES6A 4LHQB 2H32B 2AEQL 1E6JL 1TVBB 1U3HB 2QQLL 3B3IB 1S8DB 2AJSH 3HPJA 4UTBH 1R3LA 3VGAC 2AKRA 2HFFB 4ONFL 4M00A 4X0KB 1I1RA 3GBMH 1ZT4B 3HG1A 4K3GA 2FBJL 3WIHL 4GUPB 4OM1L 4JM2A 1FV1A 2PETA 3O11A 5IVXE 2O5ZH 4XBGB 5GZOC 3O2VL 1LP9B 3V6ZB 4BZ1L 2E3VA 3RGVC 5GHWL 4TSAL 1DFBH 5FKAA 2OK0H 2G5BA 4OCXL 4MQ7B 3L7EB 2FO1A 3SDYH 3TO2B 3HC4L 1U8OA 5DLMH 3MROA 1T83A 1I1AB 1ZOXA 4APQC 4RAVA 3D2UD 1K8IB 2F15A 4NNXB 3VH8B 5I1JH 2ZCLH 3MMEA 2FX7L 4HV8A 5F9JB 5E8NA 4OFYA 2X7LA 5HHNA 3FOLB 4UT9L 4Y89A 5IV2A 1EFXB 4FFWC 1T04B 2MHAB 2Y23A 3GMRB 1V7NH 4R8WL 3CFBB 4K71C 4KV5E 3BWUC 3HUJB 5CLWA 2YRPA 5DK0A 2F8VA 2R23B 4LPVA 4N0FA 4DFHA 2NY0C 3W81A 4OGAC 1VB9A 4EXKA 3CD4A 3BGFB 3V4PH 1J8HE 1KLUB 1B4JH 2EDDA 3S8WA 4M1CC 3GMQA 2MOVA 4IIQB 3RI5F 4OUUB 4XHJD 5CEYA 3IS0X 4C4KO 3VD9A 1DCLA 2PNDA 4P2RD 3QNXB 4PRPA 3UTSA 3L3KB 5J13C 2PYFB 5TE7L 4NWTH 3LSOB 3HE6B 4L1DA 4KTDL 4NQVA 1KB5A 3DLQR 4DOHB 1T7VA 2X05A 3GZKA 1RIUH 1YZZA 1D5BB 3ZYZA 1QOKA 4ONGL 1I3GL 1BZ9A 3QIBB 3NZ8B 5E4EB 3DUUB 3GSRB 4MWFA 1AH1A 4M7JH 2ZCHL 1NJ9A 1NCAL 2X4QA 3RAJH 2Y1VA 3QQ3A 1SMAA 5IF0B 1KJ2B 1RJYA 4Y19E 1J0HA 4X6CA 1FIGL 3FT4B 4NFBA 5KAQF 4I0PB 2Z31C 5SWZE 4UT6H 1ZLVK 1BEYL 3B4NA 4TQEL 4X6BA 4H8WL 1KBGH 4XP5L 1JJUA 1NCBL 4DVRH 1F3JA 4Y4KA 1QSEA 1H15A 1V7ML 1G7PB 1QQDB 4G43A 3JV6A 3WCYA 4KZEL 5I1EH 4KXZH 4JVUA 2Q8BH 4AMKH 2QADB 4P9HH 1LILA 1OT2A 4OD3L 3UDWA 3L3OA 5SWZD 4YHMH 4MA8H 3AU1B 2V6HA 1I85C 2XY2A 3FZUC 3O3BA 3W9EA 2NPLX 2DM2A 3HMXH 4K94H 4OLYH 5FF6A 3M45A 2CLRB 4UV4H 4ZD3H 2AABL 2EDWA 4IMKC 4QXTB 2O61B 3MRIB 4WW2B 1RK0B 3ILPA 2IADB 1JGDB 4K2UL 1RV6X 2CIIB 1CLZL 5HYSG 5K9OB 4OCWH 3EYFB 3PV6B 1VFBA 2HWZH 1NAKH 4PJ7B 1EMTH 1BBJB 1S9VA 3G04A 3OX8B 3OAZH 4ZFZB 1LO3L 4QHNA 1WUNT 1DUYA 1PZUB 4V1DE 5ESQA 2RHEA 5K9JL 1FVCB 4U05A 5LQBL 5EPMA 2VERN 1ZA6B 1MI5E 4KKCD 3QEHB 4JPVL 5F3HA 1TXKA 4N8PA 3O6FD 4YDJB 4DN3H 4WFGE 1FNGB 1CICD 3QZWA 4P5TA 5DURB 4F57H 1A3QA 1WT5A 3H0TB 4M02A 1U3HC 1VEPA 3BKJH 2BVQB 3IJYA 1FBIH 3G5ZB 5EC1B 4V1DD 2QSQA 3DURB 3I75A 3LV3B 4M8QB 4NKDA 1MI5D 2ITCB 3D85D 4PJ5B 4M1DL 3TN0D 1HN1A 5E5MA 2CGRH 3QFJA 4RDQF 4IDJH 3KPQB 5E00B 2YN5A 3KXFE 1ZSDA 1GIGL 5B39G 5HVWA 1QPXA 4QHMA 5BO1H 5DEFA 1UH3A 4XCNB 1II4E 3TZVA 3PP4L 4J3WA 4QXGL 1MQKL 4MNQA 4KWUA 1I1AC 5SWQA 4AM0A 1T4KB 4H25B 3IFNL 1K2DA 3KXFD 1L6XA 1UC6A 1MIEL 1IKFH 2Q7YA 5CWSA 4EDXA 2UUDH 4G9FA 5CZVH 1RHHA 3O4OB 1UEYA 4N68A 3PIQB 3DO7B 1SM3L 43C9B 4KK5D 5DYOA 1CGXA 5F9OL 2DQUL 3P9MA 4ETYA 4JY4A 4QKXB 2X09A 1IAOA 3U1SH 1GGCL 2ZZUT 4KHXH 3IFOA 4L4TD 3B6SA 1IGYB 4PJXA 3BGFC 2IPUG 5GPRA 1NBZB 3MBED 5E2TH 3LKNB 3IKCB 4NJAL 4K3DH 5D6DA 5HHMB 2VOTA 4X6DA 3V5KB 1FGVL 1KCVH 4IIQC 2AJUL 3RZCA 2PW2B 3HLAB 3DROB 3BDYH 5EIVA 3VU2A 1ETZA 2ARJQ 4R26L 2GT9A 3C60D 4LLQA 1KB9J 4ZSOB 1OSPL 4HIJA 3IXAA 4FFZL 2AEPH 5TQ2L 3HE6C 2H1PL 3O41A 5JIKA 1I7TB 5MEQB 5HHVL 1WWBX 4JQIL 2LTQB 4MX7B 5T1LB 4JFZL 4W4OA 4NOFA 4YX2H 2I9TB 5DD3L 2WLZA 4HQQL 4HF5H 3HRPA 3QIBC 3MCLH 1HEZB 3O4LE 4JQVC 5E4EC 5C0AB 4ZUSB 3ALPA 5T1DH 4ZS7L 4M62L 4PR5A 1ZANH 3BIKB 3C9NA 4CN4A 5FV2A 2C1PB 4N1CA 5DQ9A 1X6LA 2A83B 2NXZB 4I0PC 5A2LH 3EDEA 1OTUC 4Y2DA 1U58B 3L7FA 5FKPB 3BW9B 1MAMH 1HDMB 4PTUB 5EDXA 3KJ4B 3KR3L 3SE9L 4TPRL 3GSNL 1RURL 4G8IA 2D9QB 4ODSH 2QADC 1A1MB 3EDJA 1QLEH 2QHLA 2SEBA 1D9KD 3AXLB 4Y5YB 2OJZH 5JHLH 1QFUL 2JELH 1YEDA 2R2HB 1T1WB 1D5MB 3C6LD 2A6JB 1ZEAH 4GSDL 2D7TH 1W72A 4PRHA 1IM3B 3IDGA 3TJEH 2UWEE 1KTLA 1NFDB 4YFLI 3K0WA 4WW2C 2PO6B 1OL0A 4F7TA 3MRFA 1G7HB 5ENWB 4PS4L 5B38B 5KVFH 1MHCB 2ZOLA 4S10A 3EYOA 5TE6H 5DMKB 5FCUL 4KMLB 4WI2A 5IJVB 1V3LA 1ROWA 3TBSB 3QNZB 3VGDA 4FTVE 4MZ3A 1XGRB 1UH4A 1WBXB 1U6AL 1CLYH 3CVHH 5AWNH 3RWGB 2PW1B 2DWDB 3ULUF 1G6RH 1D6VL 5I0ZA 3DIFB 2FO4A 2BNQA 2ZKHH 2EDEA 5KG9B 5FM5O 4QTHA 1S7VB 1GAFH 1RZFL 3KNBB 5E1AA 1PYWA 1OGAE 3SCMB 1F4YL 3EO1B 1KT2B 1XCQB 4MDJA 2EIZA 3O6LH 1KB5H 4S0TD 2LU4A 3W11C 1NAML 3BKML 3VGEA 2VDRH 4ZXBB 5DMYA 1FFNA 4GFTB 2DQEL 2R29H 5BV7H 1EHXA 5EU7C 2W65B 4FQLH 1C5BL 1AE6L 1EO7A 3DWTA 2H6PA 2ILLA 3P0YL 2VLRA 4QCIA 5HHQB 5IHUH 1YY9D 4L3EE 4J3TA 5DSCB 5SWSE 1T3FA 1ORSA 5I16B 4ODTH 2AJXL 4KVCH 4ZYKA 4Y8AA 5GGVL 2HFEA 1R3IH 1YC7A 4OF3A 1OAUH 1BD2E 4GRWB 4KMTH 5GRWA 5INCB 5T1KB 2IAMD 3ZT5A 3O4OC 4PJBA 3OKOB 2MQ0A 4Q6IC 4L3ED 1ND0B 3K7UA 5SWSD 2XTJD 2ZG1A 1HXMA 3SGDH 5EZIL 4PV9B 3IVKA 4U6YB 1T7WA 4NHCH 2HT4D 3PWPB 3C5ZA 4UAOB 4ODHL 5IWLC 2HT3C 2CR3A 3STZA 5JXED 2OXGA 1I9IL 1ZVSA 5GSVB 5IT2L 1CGWA 4ZFGH 2X5PA 3BSZH 1EO8L 3D39D 2DKSA 2VN7A 1OAXH 5FK9A 3QUZA 3RVXC 5E8PB 3WFCH 5IVXF 3V79C 2XN9A 3QUML 3MA7A 5HI3C 3QBTB 1ZGLM 4HJGB 4S1DD 4MD0A 4W6XB 3TF7C 1BVKB 1MLCA 5C0DA 2COQA 3LCYA 3DUSA 2J8OA 3UTPE 4NQDE 2LTQC 3EO0A 4QWWD 1NC4A 3GO1H 4L4JA 4OD2B 2R0KL 3FQNB 4DUVA 2IBGA 1IT9H 1NDMA 2D7PA 3GHEH 1FZMB 3WYRA 2BY2A 2KPNA 5I8CA 3QDGD 2WIMA 4Y2OA 4LCCB 3VWJA 1HHIB 3WLBB 3PL6D 4N8VB 1IGJA 3CSPA 1Y18B 2NXZC 1FCCA 2ADJB 1MCCA 5TDNB 2FZ3B 1M7IA 1G7LA 4KV5F 4LMQE 4U1SB 4YHOL 2P7TA 1JPGA 1LHZA 5FDWA 4PG9B 3KJ4C 4P4RA 3IAQA 5E2UH 1BIHA 5FEBA 3SDCD 5F6HJ 3BWAB 3VXRE 3TH4T 4PP1C 4XMPL 1A7NL 3PDOA 4JFPB 4LKXA 4Y5YC 3V0AC 1UFUA 2PR4L 4IHOB 2Q7NA 4O58L 3IDMB 3D18B 1D5IL 1MRDH 2IG2L 1TJGH 1BFVL 5KVDL 1TPXB 5IESL 4POZC 2NXYB 3GGWA 3WFBL 2EYRB 1TITA 4LLUA 1Q9OB 1CVRA 2WUBL 1F8TL 2RJMA 3VXRD 2PO6C 1EUTA 1P53A 2OL3B 3CDCA 3MV8B 1HHKB 2EYTB 3T0DA 1A2YB 5DFTA 5D2NE 4LSUL 4DGIH 3QNYB 4YUEL 3RX8A 5HYQB 2VSCA 4C56B 3CFJA 3EZ8A 5GGUB 5E6IA 4WTXA 4Y5VA 3H42L 3BRDA 4YHZH 1GHFH 2EDOA 5JZ7D 2DYPD 4OLVL 5DC0A 3QXWA 1KCUL 2C5DC 4RCAA 3KPSE 5M7QA 2VH5H 3ZZ1A 3L6FB 1F90L 1FAKT 3GJEB 3BP5B 4Z7VA 5J6GA 3B5GA 4I4WB 1MWAH 3BH8B 1DDHB 4QT5A 4KJYA 5E6ZA 3ZTNH 5HVHB 4WUKH 3RU8H 1DBKH 1CDYA 4TSBL 2V2WA 3V0VA 3SCMC 1AR2A 1Q9LA 1FNSL 4ZNEE 3GSUA 4XWGH 4X6EA 5GS1B 5D1ZD 3KPSD 3DOSA 1Q1JL 4ZXBC 3ZKND 4YXHH 1NAMB 4W4NA 5GS0C 4XGZA 4WWID 2UYLB 3LS5H 5EWIH 2ATKB 4Z95L 3SBWA 1T0PB 3JTSA 1DANT 5TQ0H 1BFTA 3BAEH 3QI9D 1I8MA 4M1GL 3ROLA 2NLJA 3D25B 3TJHC 4JG1H 2HFGH 2AEIT 1RJLA 3RVVD 1HI6B 5EZOL 5J4MA 2F19L 4YDVB 4Q97A 1FORH 2QQNH 3QJHB 4O2EA 4HWBA 1V5JA 4PLNC 4KVNL 2DQGL 2WWKO 5FGBC 4IRSB 5T3ZH 3KPPA 3L1OL 3MLZL 3ELAT 2VO5A 4RWHA 4BH8A 4I3SH 4QOKB 2VLJB 3S3PA 4GT7A 1FVEA 1W72H 1FFPB 4UAOC 5H2BA 1XGQB 4O9HL 2DJ4A 3BP4A 4JO3H 1MCWM 1EHLL 1WCBB 4K9EH 1MY5A 5E4IA 5DUBA 3PJSB 1NQBA 2P42B 3B9AA 3OAYH 4J4PD 3EO9H 3MRBB 2F53B 3WNMA 1FZKA 5JPMA 5J3HC 1D3CA 3F7RA 1XIWA 1IE5A 4JLRA 5JA9A 2CK0L 3HG1E 2G9HA 4XPGL 4JAMA 1P4LA 3I3EA 1B2WL 3IDNA 2BOCB 5FGCB 2DWEA 5ICYB 4OD1H 5DRZB 2AV7A 4NFCA 1NFIA 3PWUB 4K3JH 4KK9D 4CVXA 1N64H 5JMOC 3O2WH 1PLGL 3ZE2E 3OPZL 5KTEL 1KC5H 4X9GA 3QO1B 5MEOB 3HG1D 2Y7QA 2DLEA 1A4JB 4LCCC 4Q0XH 1D6EB 4ZPVB 1LO4L 4OB5H 2YSSA 4KKNA 3KVQA 4JM2D 1L7IH 5JPNB 5CD3B 5EBLB 1AXSB 2OCFD 2CDFB 3EAKA 4CADA 1JTTA 5HDQL 4ENED 1ZGLB 3P0VL 2E7MA 1I9RL 1BZ7A 4EQ2A 3CJJA 1KIUA 3MGTA 4NZTL 3WN5C 3BPLB 3E6HA 1N6QL 3PWNB 4QGYA 1UM5H 2VABB 4JGJA 3MREB 4LCWB 4NGHL 4OFYD 1WITA 3PGDA 3PHQB 2HKHH 1TPXC 3DMMA 1RPQA 2NXYC 2IPUK 5IFJB 3KPOB 1J1OL 3U6RB 3EKCA 1JRHI 3RVUD 3BDBA 2EKSB 2BDNH 5FECB 1JBJA 4JFDD 4H0GA 1NGZB 3BP7B 2C4FT 4PRPE 3UTSE 1HOCB 4X4MA 1DN0A 3ARBB 1RFDH 4NKMA 2G2RB 4PJGB 4UIKH 5IMLA 1FE8L 1YNLL 1YEGL 1NANH 4ODVH 1FZJB 5DJ2A 1IM9B 4LOUC 3IDXH 1DJSA 5CS7A 4NQSB 1KSRA 3I6GA 1F5WA 2CKNA 4G6KH 2UY7A 1FO0L 1IC4H 5J1SC 4N0UB 3QG7L 3CSBA 1DSFH 3G5VB 3QH3A 3SKOA 4X6CE 5CJQL 4O5LL 5I17A 5HVHC 2F54B 2PXYB 5L7XL 5E5RB 2VR4A 2DTMH 3LMJL 4BQ6A 5IOPA 4OCSH 4ZAKA 2EZ0C 2DQDH 1LNUB 2PCPA 5GS1C 1QSEE 4B5EA 3EOAB 4JE4B 2V7HA 1DBBL 2E7LA 1CF8H 1ACZA 5CJ5A 2XA8L 4HH9B 4P2CG 2UWEF 3BIBX 4M6MH 1EEZA 5I1AA 4D9LH 3OR7A 3IETA 1B0GB 1U8LB 4MDIA 4O51B 1A7QH 5H35A 5GGRB 4POUB 1M7DA 1Q72H 2IC2A 2X4SB 4WFFE 1AGCA 5AAMA 4HAFA 3QWOB 3QEGL 1CWVA 1W8NA 2NY5C 3H9SA 1RZKH 4JY5H 4X7CC 2J6EH 2VTFA 2XFXB 4FS0A 1NGQL 4OBRA 2EDKA 4R2GD 4IRSC 4YBHA 1E4XH 2W38A 3CCHB 3PE9A 3UPAA 5CKAA 4GLRI 2FEDC 2JJTC 5GIRB 2JIXA 2Y6SC 3KYKH 3P73B 4NZJA 1W8OA 4DKEH 4XP1H 5F21B 5JNYA 4ONOA 3T0BA 2N56A 4G6FB 1LK3H 4XMLL 5I1DB 1MJ7L 1PG7H 3JV4A 3MC0A 2C3GA 3FFCB 4MJ5A 1AHWB 2DLFH 1LGVA 2XWJA 3EOYG 4P5TD 5GJSL 5IW6B 4RMVA 4WHTA 3PP3H 3H9YA 5FA3B 4DVBA 1A7PH 2Y06L 1JNNL 1A7BA 1GGIH 1NBVH 2MCPH 3EJYC 2WINB 3NTCL 4I77H 5CZXD 3BOVA 3QHFL 4EBQL 3BT2H 4MNQE 1CFNA 2ENSA 4HIEB 3QFJD 3IT8D 1K8DB 5FGSA 5J9PA 1KN2H 5DHYB 2X4NA 4GH7B 1LD9B 3RL1A 2FGZA 4U6VL 3HC0A 5L88L 1AGDB 4A2LA 2XG4A 4G9FE 4XCCH 4XCYA 3TFKD 2I60H 2VLKB 3HI5L 3NFPA 4HBCH 4GRLA 3FQTA 3GMLB 4FFVD 4ZQKB 4ELMF 4LLWB 3TZVD 4Y4HB 4OV5A 4MNQD 3BPLC 3P4OA 2D03H 2I26N 1CFSB 1IILE 1O7SA 4OZ4B 5DTFA 2JJUA 5ID1B 4GBXA 1NBYA 4WU5B 2X4PA 3KLAA 3VFGH 4PGBB 4PJXE 2AP2A 5IQ9A 2H2SC 5IB5A 3QDME 4G9FD 3GSOB 4I18A 3SGEH 1K4CB 2C3WA 4KJPD 3T1FA 1QO3B 2DQJL 1GZQB 4WNQA 1FZOB 2P8PA 5CUSL 3HAEB 2QQKL 4X6DE 2EECA 3OKKB 5C9JB 3WUZA 3DYPA 1PVHA 3MLSL 3TVMA 1JHLL 4HWBH 3ARBC 3OZ9H 3RWCA 1X4YA 2VN4A 4DN4L 4ALAL 1INDL 1ES0B 3PHOA 1XGYH 2MCG1 5D70H 3BDXA 3LD8B 5DJXA 1JNHB 4E41B 2AK1L 3ISWA 2VJXA 4G8FA 3VD4A 1SYSB 3RZCD 2ZUWA 4LBEB 1LEKB 4L8CA 4PFEA 3MLYL 4CDHA 5CILH 2ZUSA 1MAJA 5HYJA 1W0YT 2CDEB 5CIPH 1OWWA 1BQLL 2PXYC 2ICEA 5JW5B 3RVWC 3CXDH 3VFSA 1S3KH 1JZ4A 2DLGA 3MXVH 4M48H 3VDBA 4NJ9L 4AEHL 4HX1B 3GB7B 1YEJH 4U1JB 1AGEA 1AIFA 1BOGA 1D5XA 3PF2A 1MCFA 3MODH 4BK5A 5LKNA 3BI9X 5B8CB 5T3ZE 3ARGB 5L2KB 2RIKA 1UJTA 4Y2DD 1WSST 2F74B 5TFSL 3IDJA 1UB6A 2X4UA 1YNTA 2R2CA 1DBAL 1HXYB 4PRHE 4S1RL 3FQWB 3M8OH 3B9KA 5I1CH 3PXHA 2LU7A 2HRPH 3SE3C 1ITBB 4WFEE 1OCWL 1Z2KA 1ZWIB 5ITBH 3N85H 3RA7L 5T3ZD 2DI8A 4K3EL 1N5YH 5FB8B 2RGSA 4P46B 3O81A 3KLSA 1JGVH 4OZFA 4PRHD 4ESKA 3ZTJH 2HJLA 1XR9A 7CGTA 4J6RH 4NO2B 4MXWH 4WFED 2JJSA 4U33A 5E9DB 3REVA 2BNQE 4XRCA 3WE6A 3VXUB 4Y1AE 2YD3A 2V9QA 3LKOA 4HD9A 1J9CT 1FG2B 1PY9A 3LKQB 2DQIL 1QA9A 2F58L 1HK6A 4L9LA 3U48A 4DFIA 3S4SB 5DVKA 4Z5RB 3KS0H 2YA2A 4BH7A 2VR9A 4FZEL 3UTZB 1JHTB 4OUOA 1AHWC 3V8CA 5L9DH 1BAFL 1CBVH 4IRJA 2AJYL 1CGUA 2A6KB 4AL8L 3SJVA 4GKSA 5A43C 2BNQD 2AV1A 4G6MH 2WNGA 4FXKB 1H3PH 3Q5OA 2X6MA 4GW4B 1UENA 4LASL 4U6XB 3WUWG 4TUKL 1AC6A 4OZGA 5DUMH 5F9DC 4PB9L 3RIAF 4HKZA 2VIRB 4O4YL 4GJTB 4ZFOA 3SGJA 1N3NB 3D0LA 4EUPA 4X9FA 4HG4K 5FA4A 1S9YA 4G9DB 1EIBA 1RUAL 1G7MB 1CYGA 4LP4A 5HGBA 5LWYH 5ANMB 1I1YA 4A2MA 1N4XH 2VLRD 2OR8A 4PJBE 1F58L 3VXSB 3IRZA 4JZOB 4P3WA 1UB5B 1QBLH 3ESVF 3S5LA 3H6JA 2Z8SA 4Y4HC 5F6IB 1VACB 4XZUA 1DQTA 1KJ3H 1AQDB 2JTDA 3LN5B 5E2WL 1MCOH 3ALXA 4R0LB 4DKDC 1YQVL 1I9JH 2OP4L 3MX0A 4Y5XB 4MAUH 3IXTA 3QDJB 4MSWA 4JM2F 1FP5A 2Z0BA 1OW0C 4DWHA 4IEFB 4U7KA 5I15H 1QRNA 2XN9E 3OTTA 4DGYL 1KXVC 3C5ZD 3ZE2F 1HH6A 3S96B 2ADFH 4QHKI 5ERWA 3N0PB 3O2DL 2GJ6B 3IGAA 1T21A 2VMFA 3LD8C 1VKXB 7FABL 1B3JA 3CDFA 4XCEB 1H3UA 3QUZD 1QACA 2NTSP 4Y4FB 3V7MA 1JPFB 2ARJB 5JW3L 5HGAB 3SY0B 2DICA 4Z7UA 4X8XA 1U8JA 2YXFA 1LE5A 1N0XH 5AD0A 3VD3A 4YDIH 2RCSH 3CX5J 4R96A 3R06A 3KS0J 2VQUA 1NC4D 2VDPL 3OBAA 4X7TB 3MYZA 1ZHNB 3NZHH 5BVJA 4M61A 2HH0L 2I5YH 3OR6B 4RA3A 4WEBH 1Y6NR 1BM3H 5A1AA 1XT5A 4LSPL 2BOBB 3RGVA 3U0TA 2B1HL 3REWB 5A2KH 3O9WD 2PF6A 3VWJD 4LF3B 5IW1A 1XEDA 1TZIB 5B8CC 4APQA 5C8JB 3VDAA 3ARGC 3VXQB 1AI1L 1DL7H 3LS4H 4JFQB 4OGYH 1EPFA 2J8UB 5DA0B 1DEEA 3HNSL 3L5IA 4OFDA 5D8JH 5C07B 1EGJA 3I3BA 5CD5D 3RWEA 3X3GL 2PN5A 5L8JB 1LK2A 3AFLA 1ZHLB 3SDAB 5T3XE 4KQ4H 1KTDA 1A6WL 1RQ5A 4N0CC 1KXQE 5IB3A 4OLXH 5I19H 4LKCB 1MCRA 3MOBH 4OAWB 4L8DA 1NDGB 2L7JA 2WK2A 5IBLD 3GMNB 4G8EA 3RKDD 5F7UA 5FO8A 4P46C 1U95A 3L5JA 4N90E 4TNWF 4J1UB 2CRYA 1U92A 3U7WH 1IEBB 3O8XB 1WEJL 3LKPB 5T3XD 4X6CF 2GSIA 3WL9A 5FYLL 2FECL 1N5AB 3OSKA 3JWDH 4YK4B 3CK0L 5IBUB 1UQSA 1U3ZA 2XKNB 5BS0D 5I66A 4HJ0C 3OV6A 4Z7VE 3TBVA 3QEQB 1BFOA 1XGUA 5KOMC 2H9GA 1YY8B 4X8JA 4N90D 1UYWH 1URLA 3P30L 2XKUA 1N0LA 5E6ID 1XF2A 1JZ6A 4LNVA 1CD8A 1C08A 4G5ZH 3S37L 1UJ3B 1Q0XH 1T2QH 3DX9A 1F45A 3RL2A 2XA3A 4JFEA 1IEHA 1V3KA 3T0EB 1J7VR 2X10A 1H8NA 1KJVA 3D48R 2OSLB 2YUZA 1A6UL 3DPBA 4R7DA 1R3JA 3D3VA 3Q6FA 6FABL 3MSPA 1MHEA 2Z31A 2YUWA 5I75B 4YAQB 5I1IH 3HR5B 4FQXB 3UPRB 3T0XA 3C5SA 4E42B 5HY9B 5J1AA 3RNQB 1DBML 2NR6C 1DE4B 3MACH 4MJIB 1EJOH 2FIKB 4OKVA 1YNKL 3ABZA 1SEBA 4JKMA 3Q3GB 5E8OB 1I7ZB 2YBRA 4JRYB 4OZHB 1MF2L 4MNHB 1I85A 1B0RB 5DFWH 5FUCE 5F6IC 3WSQH 3S35H 2GFBA 4HWZB 5FO7A 2IFFL 4QRPD 4PRIB 4UBDD 1AGBB 1DLHB 1MFDH 3GK8H 4R0LC 2A2QT 3F62A 3IFPA 3QCUH 4Y5XC 3U36B 3L3JA 4YDKL 1NBQA 1ZK9A 4NZUH 4UI2A 4JN1H 4RFOL 1ACYH 3GHBL 4WI3A 1DQJB 5FYKH 1ADQL 4RGNB 4X4XB 1MFCL 3TIDB 4OZFH 5E08H 1GOFA 1KELH 3UTQB 4GG8A 4QRSB 1K4DB 2PTVA 4NYLA 1CVSC 3F7VB 4DGVL 5JMRA 4U3CA 1F02I 2H32A 1TVBA 1FCGA 4WY7L 1RUML 2XIDA 3B3IA 1S8DA 4Y4FC 1XIWD 2Z35B 4TRPL 2HFFA 1JK8B 4TYUA 3CFIC 2EDTA 2B2XL 1T0MB 4JO2H 2X4OB 1FGNH 3FT3A 3P4NB 4WI8A 1HWGB 2HJKA 5FAAA 4L4VD 1M6OB 1BX2B 5JHDB 2HMIC 1TIUA 4YH6A 4G80B 3V6OC 1YMHB 4KZDH 4XBGA 1QG3A 2P5WB 2Z93B 1FHGA 4KDWA 5H94B 1FLTX 1TNMA 2OTPA 5IMMB 5BVPL 3CIQA 4PJXF 4XCFH 3HPLB 3TO2A 4LQFL 1I1AA 4HW6A 2OZ4L 1K8IA 4NNXA 3KLHC 2W0KA 2YWZA 4X6DF 3VH8A 3WHE1 4Z9KB 4JHWL 3TA3B 1FAIH 2BNRA 5ACMA 4UDUB 1UM6H 1EFXA 4M03A 1T04A 5HGHB 3SDAC 2VXSH 2MHAA 2GHWB 2HFTA 3A6CH 1NGWB 1V3JA 3GMRA 4X80H 3CFBA 3NA4A 5FYJH 1R3KA 4X4ME 1FN4B 1MAKA 1ED3B 1UACL 2D7QA 4W70A 4MZ2A 4XP4L 1JPTH 2CLZB 3L5HA 3DARA 5SX4H 3QIUB 1SBSH 4M7KL 3DMMD 5FO9B 2QKIA 3BJ91 5CMAB 3O8XC 5I1LB 4XPFH 2WAHA 1PEWA 4K3HA 1KLUA 3QSKB 4LVNB 1L9MA 4TN9A 4Z8FH 3BFOA 2GW5A 4OM0L 4YK4C 1H3TA 1NL0L 4EEEA 3TO4A 1QTYT 4I5BB 2H2PC 1SYVB 5TDOB 4WI4A 4U2ZA 1B90A 3RUGB 5HPMB 1S78C 3PG2A 3HE6A 3ZKMC 2ZUXA 2NW2A 4PGEB 1RVFL 3U30B 1UJ3C 5J89A 1D5BA 4GMTL 2FSEB 2PKDA 4ZTPH 3RZWA 3OKEB 2EDYA 3KWWB 3NZ8A 2NY2B 3GSRA 3QIBA 4JDZB 4JQVA 4JRXB 5D72H 3T0EC 3FO9B 5CEXB 4KPHH 3QPQD 3LN9A 1DQLH 4OCRH 5IF0A 1KJ2A 1G6RB 3LPGA 4PJCB 3VCLA 2VISB 5DC4B 3FO1B 4H1LB 4HXBL 4NRZB 1IC7H 4I0PA 5KW9L 3UEZA 5I75C 2AGJH 3MJ6A 3N9GH 4ZAKD 3G5YB 1CU4H 3WBDA 4FQXC 1FL6B 1BHGA 4ZS6C 5C6TH 5FCSH 3H7LA 1CR9L 3LZFL 2A1WL 4OIIH 2F5AH 3GSVB 1G7PA 1QQDA 2NY6B 2W60B 3RY6C 3FRPG 3H9SE 3QAZB 1AD9A 5IM7B 5LXGH 3JBG7 4YPJA 3AU1A 3NFNB 4HK3J 5T33H 5B4MD 1MEXL 2GAZA 2VXUL 1BGXH 4A6YB 4NQXB 4G3YL 2A0LD 3T4AB 1TVHB 4D94A 3NA9L 2VDNH 4QXTA 2KUTA 5AYUL 5CHNB 4WW2A 1RK0A 5DVNA 1EGJH 1JGDA 3H9SD 2YD5A 2F5BH 4HK3N 4KI5C 2P43B 4F9LC 2APWA 3BQUD 3EYFA 5IQ7H 4U1NB 3RQ3A 5JXAH 5JW4M 4PJ7A 1BBJA 4PV8B 3FMGL 4ZFZA 4JFOB 2XXMB 4RGNC 1GPOL 1U93B 4JG0H 1AQKH 1WICA 2EEBA 3L3GB 1FVCA 2KZWA 3ULUL 1YEEH 3MV11 2JIXD 3QEHA 3U4BL 2VQ1B 3VXOB 2KQMA 2YK1L 1RZIB 3H0TA 4P23B 4UQ3B 4YZFE 3F5WB 2BVQA 1S5IL 1DTUA 5EC1A 4EDWH 3DSFH 2NY4D 5C0GB 5C2BH 3LV3A 5JA8B 4HLZG 4M8QA 2ITCA 4PJBF 3VA2C 4RRPA 4WIQA 5ALBL 2B8OT 3AVEA 3HNTH 5BRZD 1BLNB 4R4ND 4PGJA 2ZPKL 3CU7A 3CFDB 1NC2B 3ZKXB 2FL5B 2IH3A 4AEEA 3SKNA 1MFNA 5DO2C 1AR1D 1TENA 3MJ7B 5TE4H 5IEHA 5KJRL 1KN4H 1FL3A 3JTTB 1OP3K 1JGEB 3NCMA 3VMNA 1T4KA 1T5WB 4H25A 3QCVL 2A73A 5AZ2L 3TA3C 4FOMA 2VZUA 4JZNB 4X5XB 1L4IA 4LSTL 1VA9A 3WLWC 4GRLD 2ED7A 1NEZG 1A14H 4HCRA 4JZJB 4RGOH 1ZXQA 3PIQA 3MNWB 3DO7A 1QFWL 43C9A 3DI3B 2WZPD 5C7XL 1WC7B 1XAUA 4NO5A 1A3RH 4JVWA 2VE6B 4DTGL 4HC1L 1INQA 2JB6A 3QIUC 4I2XA 1IGYA 1HE7A 1NBZA 3OKDB 3LKNA 4OLUH 3IKCA 4DZ8B 1KULA 1RUPL 3CX2A 1G7QB 4LVNC 2A6DB 1A7RL 1I7RB 5IBTH 3VFVB 5GGSB 4WO4A 1HNGA 3MA9L 4HXAL 4J3UA 3V5KA 4RBPH 1MELA 3GDBA 4LSVL 5KSAD 3MUY1 3CPLB 3O6ML 2PW2A 1KYOK 3PHSA 3DROA 3I9GH 5BMFL 3G5XA 3EOTH 4L8BB 4P9ML 4AZ8A 3MNVB 5HYFA 1ZTXH 1I7TA 5MEQA 5TGBB 3SQOH 2YZ1A 3FO2B 4JPIA 3DUHA 3U30C 3VDCA 4MX7A 5T1LA 4EXPX 2IEPA 3DYMA 4KJQD 2I9TA 3C2AL 5ISZB 2DQTL 3UJTH 1FPTL 1HEZA 2NY2C 5D2LB 4LCIL 5C0AA 3TIEB 4ZUSA 1QR1B 1Q9KB 4Z78B 3LB6C 5ALCH 4QRUB 2H32H 4NQEB 2P46B 5HYJD 3QXDB 2AJZB 2I07B 3HCVB 2CIKB 1JPSL 2MMXA 2C1PA 1OLLA 1H0DB 4YXLL 2A83A 1FFOB 4KHTH 4LGSB 4XNUL 1J5OL 1KFAL 4TTDC 1WVZA 3HI1B 4PJFA 3W82A 1HWHB 5FKPA 1AKJD 1I1CA 4UQ2A 3BW9A 1DLFH 1TZGL 2Q87A 1JTOA 5KBNC 5C08B 1HDMA 2WV3A 2YKLL 5F1OB 3X14B 4PTTB 3DETD 2NY6C 2QHRH 4O02H 2XICA 3QAZC 1A1MA 3AXLA 5FYKE 4E9LA 3BESR 2GCYA 3MV01 5HHXL 1NUFA 3WEXB 2R2HA 4O00A 4XC3L 2A6JA 4P4KB 2FX9H 4Z7VF 3GIZH 3LVEA 3Q2CA 5HDBE 4J2XA 3ZSSA 1NFDA 3SDDB 3ESUF 4C57C 2BY0A 2E9BA 5AAWA 4BFIB 1GXEA 4EI6B 2PO6A 2JKXA 1U91B 1A9BB 1ORQB 4EJ1C 2NCMA 1IAIM 4ACPA 5F7WC 1G7HA 4KQ3H 5B38A 2E8ZA 5DMKA 4Q2ZB 4K07A 5D5MA 4HUWB 5T1MB 4LSQL 3TBSA 1XGRA 1JWMB 4U1IB 1XGTA 3PGFH 3RWGA 4ZOCA 2DWDA 3SJVE 3CGTA 3FN0H 3GMOB 3AMLA 3DIFA 2Y07H 5ITFB 1FVDB 1VFAB 5KG9A 2A9ML 4P23C 3BZEB 5DD1L 4JPKL 3KNBA 4OF7A 3OGCA 1T66C 1RZJL 3WXVH 1IAIL 3ZYOA 1P7QA 1IGMH 4XTRD 1JHKL 2Q1EA 1HQ4B 4G6AC 3EO1A 4IRJD 1KT2A 1NMBH 1XCQA 3SJVD 2NZ9C 3MRNA 2X44D 5E0QA 1CL7L 5GQBA 3MV9B 4ZXBA 2R4SL 3QUYB 3N06B 4XVUC 1K85A 1E27A 3ZKXC 1I75A 2W65A 5C0RL 5H37G 5FYJE 4AIZB 2EYSB 1KJ2H 3INUL 5HHQA 4JDVB 4GAJH 1SMOA 5C0JB 1NMAL 4YBQD 1HHJB 5DSCA 3ARQA 2FR4A 2DB8A 5I16A 4X7SH 4XI5D 5IB1B 1CN4A 3SOBH 1UZ8B 4CL7A 3PDDA 4HUXB 2EC9T 1P69B 1A4KA 1PSKL 2VR5A 4IOFC 4NC0B 4NZRL 5T1KA 5GRYA 5IFHH 4GAGL 4JZJC 2Q6WB 1VADB 4JPWL 3OKOA 1NFKA 1JMXA 1L9NA 5F8QC 3MO1B 4PV9A 5FUZL 2AQ1A 4U6YA 3RY4A 1MIML 4FXGB 5EORH 3WD5L 1CIDA 2ENYA 3ETBF 4M9OA 1FH5H 4HPOL 3MRRB 4AQOA 5GSVA 3V7AG 4OGZA 1IGCH 3S6CA 1OM3H 4N5UA 4XC1L 3IYLW 5IGXH 1QRND 1A6VH 3U0PB 2FD6L 1JWSB 4J8RB 4P3DA 4NWUH 4Z7UE 2MKWA 4HJGA 2YD2A 4M43H 3IJSB 3FTGB 1GGBL 1BVKA 1P1ZB 2Y5TA 4HMCA 4ZTOH 1ITCA 4WVRA 3N1QC 1DBJH 1P6AB 4ZOBA 4OD2A 1YJDC 3FQNA 4HIXL 4PJDE 1QEWB 2NY7H 1QLRB 1A6PA 3GRWL 4L5FH 4LHUG 5AZEL 1ZT7B 2R2EB 3U4AA 1Z6JT 2MPAH 4LCCA 4NSKB 4BFBD 2BP3A 1QYGL 1HHIA 5DFVC 3WLBA 4N8VA 1Y18A 2ADJA 5TDNA 1H3GA 4IJ3B 2FZ3A 4U0QB 3EJZC 5GZOD 3EHBD 3RGVD 4PJHE 1JZ2A 2E9WA 1ERNA 5B22A 1I8KB 3E8UL 2QL1A 3WIHH 1ZV5A 4P2RB 4OGXL 1AP2B 4OM1H 4X4ZA 3GUTB 2OM5A 2HTKC 2JCCB 4APQD 1LO5A 1OQOA 1BBDL 2W0PA 2WANA 4FP8H 4IHOA 3IDMA 3VFTB 4NC2B 2FWOB 1QD0A 4OCXH 4FNLL 4P4KC 4F8QA 2DQHH 3TBWB 2W0LA 1OB1B 3HC4H 1GYAA 2CKBA 2EYRA 3SDDC 1T80A 3HE7D 3T0AA 1HH9B 1NCCH 4GMSH 3GMMA 5I2IB 3DJ9A 2OL3A 4HCRH 2VZVA 4H88L 4UT9H 4FA8A 3MV8A 4RFNB 5KVGH 4OGAD 5D7LE 5FM5M 2BVOB 1T5XB 5C0ND 5HYQA 4C56A 3K74B 4JN2B 2GEEA 4R8WH 5GGUA 5HYSB 3V52H 4XAWL 5HDLA 4LARL 1UGNA 3Q48A 3GJFA 3C8KA 5CINL 5F3BA 1ZHKB 5SX5K 4JFEE 5JOEA 1OPGH 1WFUA 5SWZB 5C9KA 1JFQL 3BP5A 4WDIA 2VWEC 4I4WA 3BH8A 1DDHA 4DK3A 3X3FL 2BC4B 3D3VE 5IFAL 4CAGA 1R0AH 3WHXA 4YHYB 1MJ8H 4MJ6B 2IQ9H 1KYOJ 2BK8A 4YNYB 5T5FH 2P48B 1KTKE 1O0VA 2W1NA 3AROA 1PQZA 1XF4B 3TPUA 4UUJB 1UH2A 5DUPL 1ODAA 4JO4L 1QLFB 4R4FL 5MERA 1MFBL 5TE7H 4JFED 3UO1L 1UXWA 1CQYA 4IM8A 4KTDH 1YPZB 1FIEA 1CTOA 3QUYC 5E03A 1SY6A 1UCBL 5KZCD 3D3VD 3QXUA 3C8HA 5KSBE 2ZCHH 9CGTA 2NZIA 2AJSL 4UTBL 1HCFX 1HINL 3MRCB 4FQCL 4NQUA 4DCQB 3OJDA 4HIHB 1S7WA 3GBML 4QRQB 1CICB 3D25A 1X5GA 4TQEH 2XPGB 5DA4A 2PTUA 1HI6A 1FNLA 4NRXB 2LFGA 4XP5H 4C83B 1NCBH 4YDVA 1CQKA 1PEZA 2O5ZL 1RD6A 4KJWD 1FSKB 3FZUD 4KUCD 5MHSE 3D85B 4ZUVA 5DD0H 1E28B 3TN0B 1DFBL 2OK0L 4IRSA 3DHJA 4OD3H 4TOYH 3KPRD 3WV0A 5D1XB 2JB5H 4YZFF 2V9TA 2JJTA 2VLJA 4QOKA 5IHZB 3EFFA 1AGFA 2P5EB 1IL1B 3T8XA 4NPYB 4N5ED 5DEZA 5LAXB 5I1JL 2GJJA 1WCBA 4NZDA 4ZUTB 2AERT 3AB0B 4HWNA 3WFHA 3PJSA 5MENB 3MRBA 3SPVB 2F53A 4PREB 1V7NL 3U46B 1CLZH 1N59A 4RMUA 2MSPA 4KDTA 2B4CC 4JR9H 1RZ8B 3AREA 4PRDB 2BOCA 3WHE0 4X99B 3H3KA 2DL9A 3PWUA 1LP9E