1KT2A

Crystal structure of class ii mhc molecule iek bound to moth cytochrome c peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
182
structure length
182
Chain Sequence
b'IKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEFEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class II histocompatibility antigen, E-D alpha chain
molecule tags Immune system
source organism Mus musculus
publication title Structural basis of cytochrome c presentation by IE(k).
pubmed doi rcsb
total genus 36
structure length 182
sequence length 182
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kt2A02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1kt2A01
3ULVC 1UEYA 3IFNH 3R1GL 5FYJD 5BXFB 4LRIA 4X8JB 1DBJH 1MPAH 3IFOB 3P0VH 3PDGA 5EIIA 3FAWA 5E4EC 3ZT5A 4G8GB 4OCLC 2C9AA 4TTGA 2V17L 5L8LB 4PS4H 1X5ZA 2Z91B 4XGZB 1JP5A 4UB0L 4MCYA 5F1NB 4ODTL 3IF1A 4XB7A 5CJBA 5SWSD 2YEZA 2ITCA 1H3PL 3MJ9L 4OJFL 4M6MH 3PV7A 4OLZH 4ELKA 3TVMC 3SDDB 2E5EA 1T1ZB 5J8OA 1NCDL 2APVA 5E8OA 3L7FA 4U3XA 1S8DA 5HHMB 2LQRA 2BVQB 5SV3A 3OKKA 1OTTC 1J87A 2J8UA 3LEVH 1WK0A 3OKDA 4K3DL 5DO2D 4JKKA 4HUWA 4LRNL 2NY2D 1LD9B 5D2LA 5DQ9A 2O93L 4KROD 2OL3A 2IQ9L 4GOSA 4N8CH 2V7NB 3HI6L 3H2WA 3JVGC 4RAHA 5KVDL 1EVTC 4RA0C 3VI4F 4XWGL 3I3DA 1A3RL 5F7NC 2GJ6A 2PKDA 3VGAC 1MNUH 5C3TA 4O00A 2ICWJ 4M43H 2R2BB 3WHE0 4ELME 4XWOD 3JWOH 2Q7NA 2QQNH 5B39B 1A0QH 4LSVH 3M07A 1NUFA 5GGTA 1VFUA 4Z0XA 2X5PA 4ZOAA 3QUZB 4Y5YC 4LLAA 3IU3A 4R26H 3NFPB 1IM9B 2G5BB 5EU6D 1MWAL 1OAKL 1RIUL 4IMKC 5FO8B 1N26A 2D4FA 4KMTH 1BFVH 1P84K 2RCSH 5E00A 4MXVE 4HS3A 4LAJH 1WGOA 4MA7H 5IW1A 2VLKD 5IM7B 2YXFA 4JRXA 1IGJB 4P5MB 3SY0B 5JIHA 2R23B 4HHAB 4FXKB 4P9HC 5ICXA 5I0DA 3HI1A 3AFLA 3GBNL 2HJFA 1VESA 15C8L 3IDJB 5MENB 1Q9OA 3C5ZB 4U4BA 1AI1L 1G7MA 2J8UE 1BAFH 1VPOL 3H3KA 4UT9L 3CZFA 1PG7L 1KJVA 2ZSWA 4H88H 1P4IL 2DLGA 4NO5B 4DKDC 3FB6B 5EO0A 1J1XL 3IYLW 4PJXB 3AUVA 5F6HJ 5HPMA 4OAWA 3ARDB 3LKPB 5D7JB 4NZUH 3EAKA 2VLRE 3OR7A 3MA7A 1RMFL 5LWYH 1UC6A 2NPLX 2RGSA 3MJ9A 3BFOA 4EI5A 1HN1A 5K59F 5MI0C 1I1YB 4FRWA 1MF2H 3KG5A 2IQAB 4HFWB 4GH7B 2GJZB 4DZBA 1CFVL 5CIPA 4HIJA 4G7YH 4UTBH 1Z0MA 3FFDA 2H2SD 4X7FC 5IWLA 3BD3A 4PY8J 1RUAL 3UZVB 5KVGL 3ZE0F 2OSLA 4F9PA 5EO9A 4PLJD 3VXMA 1O7SA 1MH5A 2BVOA 2OLDA 2Y36L 1T0PB 1ZSDA 3WL9A 1S9XA 3BVNA 4IJ3B 4U1NB 4DOHE 1BQLH 2MOVA 3KDMA 3V0VB 4R0LC 2GIYA 3MRHA 4X6FB 5AZEL 4GG8B 2I07A 2R8SL 1NGWB 1KB9K 4IRSA 4APQC 2JELL 4MA3B 2R2EB 5CBEB 5DJZA 2VUOA 2XKSA 3HZMA 1OLLA 1MCNA 4ODUA 1N3NB 1LO0H 2W9EL 2DBLL 2FL5A 4HJJL 1IC4H 3MRJA 4YX2L 2AJYL 4QRSA 1FN4A 4HZLA 5T1DH 4X9FA 1CICC 1YMHB 4U1HA 3O6FC 4MAUH 1FP5A 3WKMH 4KJWD 1CK0H 5F44A 2VQ1B 2DMKA 4HPYL 2ZPKH 2JF1A 2YUWA 3LKQB 4HXBL 3P9MB 4ZUWB 4Y4FD 3B9EA 1QBAA 3PGCA 4M43L 5F7FA 3SDAB 2Y9RT 1EAPB 4OCRL 2WBJC 3CU1A 4B0MM 4LL9A 3V6OE 4WTZG 4P57A 2D3VA 2FD6L 1ZLWK 1TCMA 4YHMH 1G7IB 5DMGD 3S4SB 4PRIA 3VE0A 3UTQA 4GXUN 5DQJA 3STLA 3WDIA 4EXKA 3SKMA 1QKZH 2DF3A 1CDGA 3TJEL 3IDYC 3B5HA 3JV0A 4UV4H 4KJPC 1G0YR 1GJIA 3RTQD 2FDBP 3SE8H 1J7VR 3O9WD 4K2UL 5IFJB 5IBUG 1ZTXH 3FFCA 1JHTB 4P46C 4X4XB 3LHPH 2BP3A 1JN6A 4QXGH 3C2SA 4WW2C 3VI3E 3QCTL 2AJZA 5INDB 2GCYA 4GKSB 3AAZA 4Z9KB 1PX4A 2VDOH 3BE1H 2EZ0D 4LVOB 1WLHA 1Q9KA 1HHKB 4X6CB 4ZYKA 1BQUA 4M00A 1YEDB 2OQJA 2YPKB 5HHME 4G9FB 4Y1AA 4M4RA 5I17A 3CXHK 3GJEA 3N06B 4NT6B 4MJ2A 2AEPL 3D9AL 4L9DA 4N0RA 2NX5E 4LSRL 5D1XA 2YD9A 1OLZA 4H8WC 4PREB 3FCTA 2J5LC 2DN7A 1NCAH 4RAUB 1I4FA 3QUMA 3O81A 3ZTNL 1UB6B 2DQTL 3SDCD 4XBGB 4YFEA 3LS5L 4PJ8A 3BKJL 5JLZB 1MY7A 4LASL 2FJHB 3ZL4L 1UB5B 3ARVA 3BGMA 2FO1A 1HXYA 1DEEB 4F8QA 4PGBA 3GMLB 3U4AA 5C6WH 2V5TA 3KPSD 2WBJD 1F6FB 1OARH 2B20A 1CL7I 1JMZA 1GZQA 4KK8C 5DC0A 3WFBL 1OAZL 3BPCB 3O0RH 4GAGH 3ALXA 5LCVH 3LB6C 2ZPKL 1T22B 5E1AA 1MHCB 5JIKA 3RBGA 1Q1JL 4OGZA 3QWQB 1PG7H 4H88L 4MD4A 2EKSA 3KYKL 3MRLB 1Y6KR 4JKLA 1YEEL 3L3HA 3LN5A 3SBWC 3VXPA 5CBAB 5IHBA 5EBGA 2D7PA 4QRRE 4XGZA 4NN5B 3FQTB 1F90H 5J13C 2YD3A 3NCMA 3W0WB 5LQBH 3TNMA 4YXHL 3LKRB 1QR1B 4JGUA 2X42A 4J23A 1S7RB 4LHQB 4HS6A 3RDTD 2QSTA 3QO1A 5EBWA 5FKPA 2A83B 4G7YL 3V5DA 4QTHA 3EYFA 4PJGF 3GGWA 3D69B 4JHAH 3L7FB 5FYKD 3PP3K 5T5FL 5I1JH 3F5WB 3CDGB 4LKCB 3MRFA 2DB8A 3N1PC 2MWCA 4F37F 3QHFL 2J8UB 4U1MA 4WNQB 3NMEA 3WD5L 4XCYB 4N8VG 4OCWH 2NY4B 5D70L 1UWEL 3RVTD 5LGJA 4FNLH 4NN6B 5HTSA 3HG1B 2G60H 4X9GA 3GSUA 2BX5A 3LVEA 3A6OA 5TFSH 3ALPA 2JIXB 1KFAH 5CD5D 5DFWH 3KPNB 5EUOB 5BO1H 2CDFA 2YD7A 3ROOB 3FO9A 4LP5A 4X0KB 3WHE1 1FYTE 5DXWA 1YDPA 4FQJH 5JIPA 3ARQA 2LU4A 5D7JD 2MHAB 2LABA 1YNLH 2BDNH 4RQQB 5GZND 3JV5A 1KPUA 2VQTA 1X7QA 1ZLSH 2DL9A 4Z0XB 4JO4L 2VABA 1HHGB 4HDIA 4PRPD 1FO0A 1PEWA 3IXTA 2N1KA 1RQ5A 3I9GL 3MLYL 4PRHB 4NZJA 4HH8A 4LSUH 3MBEA 4XVJL 4W6YB 1OTSC 3BKYH 3IDNA 4UIMA 2HKHL 5ABDE 2VWEE 3DYMA 1MRDL 5DRWB 5E00B 1EGJL 4KROC 2DL2A 3GMRB 3HG1D 4OIBA 1WAAA 4PGZA 4Y5VA 1M7IB 3CVIL 3ECBB 1IGJA 5DFVC 1KN2L 5EZJA 3P30H 4K94L 3VMPA 4NNYA 1OT1A 2F15A 1FE8H 2FYYB 3VXSE 4HLZH 5T1LB 2DQFB 4ODVL 3GSQA 1RJCA 2B1HH 2E7CA 1RZKL 3IDJA 4C54A 3T2OA 4LF3A 4X7TA 4HZAA 4CMHC 3ARDC 4OD1H 5L2KD 4L9LA 1KEML 3JSSA 1JF6A 4XPHL 5BQ7A 5EA0H 3HRZB 2N56A 4IOIB 3Q48A 1IGTB 1G7LB 1I7RA 1EFXD 4GQ9L 4M62H 1Q0YH 2HFGH 4YXKH 3T3PE 3ARDA 4DTGH 3EDEA 3WXVH 2VDRL 3PDOA 4P2QD 4PJGE 3KNBB 5IEKA 2AVGA 4K7PH 3IDIB 2I5YL 5T1KB 2IH3A 3VDAA 1K8DB 2UY7A 3LAFA 3VFUB 3EOTH 4KV5E 4M62L 2PYFB 1J05B 1QFWI 4E9LA 1UKQA 2NY7H 3DECA 4HD9A 5FEBA 2XZCL 4U0RC 1WAAE 2DQEL 1EJOL 3D0LB 1UM4L 3WHXA 3C5JA 1LE9A 5BS0E 1AGFB 4U1IA 4LLQA 3E3QE 4Q9RH 1MPAL 4QGYA 5GGRY 5IMLA 4GG6F 3IU4H 1U2CA 4N90E 1RZKC 4EKXA 4Z76B 3D3VE 5H37H 5FA3A 5JW5B 2NZ9D 2YC1A 1L6XA 4J3OC 3P73A 4LPWA 3H9HB 3KDMB 1EGJH 4AEHH 4X6FA 1YPZB 25C8L 1A47A 1NGWA 2AJVL 2JJTA 3CVIH 4MAYC 1P7QD 3MJ8B 4EUPH 4MA3A 2J4WL 1TZHA 4QT5A 3MV7A 3DTXB 4RWYH 1QLFA 5DJZB 5E6ID 4UDUB 4HGKC 4OCYL 3TFKC 2GEEA 4YDIH 2VLRD 2FL5B 1XCQA 1Q8MA 1KELL 1FN4B 1DSFH 2Q3ZA 4YC2C 2AK4E 4MHHG 4ZODA 1KG0B 4HKBB 3RWEA 4X6CF 1MVUB 3F58H 3V2AR 1RUQL 1NBYB 3O3AA 2VKWA 3UC0H 4U3HA 3JWDL 2WIMA 4AENA 1F6AA 2P8PA 2HFEB 3O6LL 3QDMD 4NKMA 4JM4H 2CRYA 2W0FA 1MQKH 2JCCF 5GGUA 3HNSH 4JG1H 4U1GB 4LARL 4X4MA 3UYRL 3QUXD 4S2SB 4F7CA 4P59H 4OGYH 5C9JA 4IRZL 3D25A 3SDDC 2Q6WA 4FQLL 5C2UB 2QV2A 3BN9C 1AKJD 3TT3H 1FG9C 5LBSL 4JHAL 3PWPE 2R39A 2V2XA 3FFCB 5TGBB 1B88A 5D7LD 1HQRB 5IMOA 5DVKA 1JN6B 5GXBB 1ZA3A 1QHPA 4XVSH 3CPLB 2OP4H 4OI7A 5FYJE 1OP3H 1WBYA 5GIRA 3U36A 3OAZH 4Z78A 4FN0A 4GKNB 5BS0B 3L3OB 5T3XD 1WC7B 2CLZB 1T89C 3KR3H 2A74B 2IH1A 2YN3A 3P4LA 5BOPA 3FQWB 4K3EH 3ZLQC 4L4TE 2WAHA 1X44A 4NDMB 1FC2D 3BKJH 1B0GA 2FWOA 3V0WH 5CJXC 4X8XA 1RAMA 1BMGA 3MV9B 5JXEC 3I2CH 1V3MA 4IBLT 2BHZA 4PB0L 4H5SA 4YXKL 4DTGL 2GK0A 2LE9A 4WW2F 3UTTB 3TFKD 3C87A 5F9WB 3UTPE 5D93C 2DYPB 4YZFF 4F7PB 32C2B 4DGIL 2YHGA 3DIFA 1YMMA 3EFDH 1MFCL 2D7QA 5IMMA 1AJ7L 3DX6A 4U33A 5ID0A 1SJEB 4BQCA 2EXWD 3V5HA 2MQ0A 3TH3T 1ZA6A 4DGYH 1J5OH 5IQ7H 2FLBT 3SGDH 3GO1H 3VG9B 3X14B 5FGRA 3V7MA 2HTKC 1CFBA 4GW1B 5DEFB 4HT1H 5HGDA 1WIUA 3MZTA 4HBCH 1R5IA 4LDLB 5EOCJ 1DUYA 1JGUL 1K2DB 3TA3A 1RZ7H 3D1MC 4XPGH 4MQTB 4OF7A 2HWZL 5F70A 4ZFFA 2MPAL 5FM8A 3WIFA 3WNOA 3KPQA 1MHCA 5JDJA 2JJVA 1ZKAA 1A2YB 1QBMH 1U3JA 4HGWB 1HE7A 4HKXB 5HDBF 4YIQB 2NY1B 2P8MA 4CVZA 4LCIH 1QRNA 5BRZD 4XHQA 5D2NB 4PLNC 5IVXA 2HG5B 5FDWB 1AD9B 3OZ9L 3LKRA 1KIQB 1KLUA 1MCEA 5BXFA 1Q0XL 4PRDB 3T3ME 2V2TB 4L3EB 5FB8A 5CP7A 4Z18A 3KPPB 2F5BH 1L6ZA 4OF0A 1MCSA 2MCPL 3ARGB 1OGAE 1WZ1H 2WM0A 1W0YT 5D1XD 1TVHB 4Q58C 5FYJU 2X4QB 4YJZL 5JXAL 2IALB 3RZWA 4W6XB 1XIWB 1YEHH 1G0XA 5BW7C 3P0YL 2EDWA 4X6EB 2GKIA 3STBA 1KCLA 2H6PA 1ZV5A 1T1ZA 3VW3L 4DGYL 5D7IF 3RU8L 4TUOB 5D9SA 1G6RB 5HDQH 5TPWH 4U1LA 4PJ8D 4UV7L 2NXYD 4GW4A 4I0PC 4PJGB 1J12A 1O7VA 3CVHH 2EXWC 5J56B 1D9KA 3KYAA 3WKML 4OLYH 4LSQL 5I9QC 3SE4C 3FN0H 2J8UF 3HZVA 2VRAA 3GI8H 1MCPL 2Q7YA 2QTEA 1W8NA 3MXWH 3KHQA 4MJ5B 1G9MH 4X98A 5D7IE 4WI4A 1FO0B 5HGHA 2HKFL 4NYLB 2FD6H 1J5OL 3C9NA 1GL4B 4EZMA 3QXUA 3LPFA 4HV8B 5IB1B 1HXMB 3LKSA 2VJXA 3IDXH 5MI0B 1RIVH 5D4QA 5FA4A 1XF4B 4Y5VB 3V52H 4KKLD 1IGYB 4GFTB 4NQDD 3MA9H 3SQBA 3MSPA 3NFSH 1T0NA 5F7KC 3O9WC 4OGXH 1T5XB 2BNUA 4HPYH 3SDCA 1MHEB 4K9EC 2YA1A 1T1WB 4JB9H 3AS1A 4WCYL 1OAYH 5C0CE 2G75A 2Y4SA 4YHZH 2DBLH 5HGAB 4PLOB 4HS3B 1LP9A 4OZGB 5BVJA 1P53A 1AGBB 3NFSL 1NJ9A 1H0DA 1RZFH 2A6IB 2LVCA 5T3ZD 3FT4B 3HI1B 5DUML 3D39D 3O2DA 2CMRL 4L8CA 1NFKA 4IRJD 2PO6D 2ICEA 2E7BA 3KYOA 1RZ7L 5HPOA 3U30B 5HHPA 3CFDA 1FRGL 2XACC 2CK2A 1A6TB 2ATPB 2PXYD 5T1KA 1VKXA 1VGKB 1RJZB 4TULH 1BIIB 1KIPA 2IMNA 1KNOA 3SGDI 1IBGH 1N6UA 3QJHA 5I1HL 3VJ6B 1OPGH 1KIRA 3OXRB 1YEJH 5DJ6A 1GHFL 3C5JB 1LE9B 1S5IH 4E5XA 1M4KA 5F9AC 5IMLB 1HZHL 5ADPL 2K7QA 1JZ8A 1JGVL 1T7VA 2P7TB 3BD4A 2VDLH 4HIJB 3W2DH 1R5WA 3ARED 1QSFA 2R8SH 1KENL 3EDFA 5F7DA 4BYHA 4TVPD 4WUUB 3IDXL 4C57C 2VOTA 5E08H 2EICA 4RISL 1YPZA 1SY6L 1IC7L 4CN6A 3MJ8A 2OTPA 3VFMB 1GGYA 2J8HA 4QT5B 3DTXA 5E8OB 5D5MB 4OQTL 1S9XB 4MNGE 3RIAK 1CD9B 4YHML 5H37G 1YEHL 2F54A 4U6HA 1P4BH 4WCYH 5C08E 2H1PH 5JHLL 1SHMA 4UTBL 3B3IA 2Z92B 3GMOB 4TPRH 2KZ1B 1MNUL 4NM4H 2ADGB 3VGFA 3EBAA 4WW2B 4FQXC 1N5AA 2ENSA 1JV5B 4XNXL 1IILE 1OY3B 4V1DE 1CXFA 1KCUH 1NC4D 3G5XB 4NNPL 5SWZB 3MRJB 5CFHA 1Z9OA 5CD3B 3X17A 1JPSL 1PLGL 3L3KA 2X70B 5B3JE 2RHEA 5TE4L 3UTTD 2OI9B 2WUCL 3QPXL 4LLVA 3BQUC 3LRGA 3U4EA 3U7YH 2HAZA 5TDPB 5HI5C 1JE6A 1LK3L 2IQ9H 3CFIC 5GS0H 3EOBA 5I19H 5FFLA 4UBDC 3BH9B 3QRGL 4N5ED 1N2RB 1GPOL 2E9IA 3LHPL 1ODAA 2BCKB 1FORL 3QWOA 3I2CL 5J0BA 1C16B 1YJDL 4MXWH 3WJLA 2EE2A 1IKNA 1HQRA 1NLBL 2OMNA 4PRIB 5E5RB 3THML 3VE0B 4P2OB 3KPRB 5J57B 3QIWC 3OJDB 1INDL 3FOMA 4HHAA 3EJYD 2V9RA 2L4OA 4MWFA 1JTTA 3V4VH 1UH3A 1JL8A 1XH3A 4AQ1B 1JPGA 1JHTA 1SMOA 1UKSA 5GRVL 1F4WH 5JO5A 3U0PB 1AQKH 3OQ3B 4OZHB 2GCYB 4MDJB 1LDPL 3PABB 2D31B 1FLRL 1LO3H 3T2PA 3MLWH 4X83A 4DN4H 1VFBA 5LWYL 1ND0B 3RX5A 2YN5A 4NO2B 3V8CA 5DHVH 5IB5A 1FNSH 2ARJA 4ZD3L 4KWUA 4JHZA 4YHKL 4QHUA 3KLSA 1HCFX 1JUFA 3JTSA 3D87B 1JGEB 5DFTA 3TBSA 3U9UB 1H8OA 5EIQA 3CH1B 3CFEB 4OLZL 3DX6B 4Q9BA 4UNVA 5C0BA 5DD6B 15C8H 5HYJA 3T0ED 1DE4B 1R3LB 3VCLB 1E6JH 3H42H 4Z7VE 3KPSE 4OD3H 4JFHE 4HWBA 2SEBB 4R2GC 4HUUB 4PJIB 4QTIH 5J3HC 5EIIB 3CNKA 1XGTB 5GGVY 1NGXB 3KPOA 4F7TB 4D8PB 3BEWB 3U4BH 2HT2C 3C60D 1U8MB 4XBGA 5LCVL 1MJ8H 5DI8A 2PR4H 3HC4H 1X3DA 3OR6B 4OD3L 4GQ9H 4U1NA 1RZJC 4HGMA 4CN1A 1UACL 4XMKL 5ADOH 1IAII 1RULL 5BJTA 3KPQB 3N1GC 4ELKB 2ZNWA 3QIWB 3C5ZD 4PYHA 3GMLA 2B4CH 2EH7H 2R2HA 1DP0A 4ZO8A 2XN9D 4CVZB 5KVGH 2R29H 4NIKB 4P4RB 1S8DB 1GZQB 5GGVL 1UZ8B 4ODUB 1N3NA 1V7NH 4GAJL 2AJXH 2VNCA 3OKDB 2Q20A 5DD3L 4QRSB 1NKRA 4BK4A 1FNGB 1S7TA 3MJ7A 1NCNA 1QO3B 3BQUB 2DI7A 4X5WA 4QRUA 4TUKH 4LIQE 4K3GA 4CVUA 3VXPB 5C2BH 1BWMA 4TQEH 2ESVA 3TVMA 1IM9D 4C83B 1F2XK 3QUXA 1YNTB 3S88H 4Y1AD 43C9A 3PV6A 3TCLB 2YKLH 3AS3A 4HKZB 4PJHB 2X1WL 2BSRA 2ZKHL 2LAAA 1NCTA 3OF6A 2XWBA 1BVKB 4LGRB 5GGQH 4BFGA 3MRKB 4KQ4H 5DURB 4MA1C 3CVHA 4U1GC 1MAML 3S36L 3WXVL 5SWSB 3OKOB 5E99H 5F71A 5D2NE 4J3WA 4EI6A 2JJSC 2XQBL 3RX7A 3HUJE 2X4TB 5ISZA 3PQYE 5F7UA 1ES0A 5FO8A 1O0VA 3G9VA 3MUY1 4S0TD 1CFTA 4RFEA 4X9IA 3D0VB 3QQ3A 1AHWA 2BVPB 1CG9A 4Q74A 3IFPA 1QSED 1FGVL 4BFEA 2VXVL 3ROOA 3IT8D 5CEYB 3MO1A 1YEDA 2WIIA 4RWYL 4FABL 3O6KH 5I17B 2HJFB 2VLJE 3WIHL 3MGTB 3SDDD 2I9TA 3QIBA 5ESQB 1CQKA 4IOFC 1QRNE 3T8XB 4RIRB 4E0RB 2DAVA 1KJVB 2BNRB 2PW1A 1OGTA 4UUJB 4OB5L 3QPXH 4F7MA 1RU9L 2MKLC 3OF6D 2BSTA 3FT2B 5IIEA 2G2RB 4JN2B 1T1XB 4EDWH 4Y19B 4EEEA 2XZCH 3EYVA 1T1YB 3WJJA 4HWBH 2BC4A 4Y0GA 4LASH 3ZL4H 1FIEA 5GRUH 2IANA 2CUHA 4OIIL 1J11A 3OB8A 5CIPB 3HUJA 1A3LH 4ORZC 4XI5D 4UOW1 3D2UB 1UFUA 4QY8A 4U1SB 4PJFA 3BDXA 1NLBH 4F80A 3GM0A 4QWWD 2NLJA 2CJUL 1YEFH 3DX7B 4XH2B 4ZS6D 2FEEI 4P46B 4PP1C 3MACL 3O0RL 2J88L 4RRPG 4D9QE 1V3KA 2QSVA 5KG9A 1IAKB 1MI5D 2FNBA 1I7ZB 5CZXC 3BVNB 1NCBH 1FSKB 3MRDA 1KIPB 2EIDA 2DM7A 5IR1A 3DSFH 4FZEH 2ADJB 3R4DA 3NAAH 1T22A 1KB5H 3BW9B 1CYGA 5DHXB 2FX7H 3TO4A 4JJ5A 1KIRB 3RKPA 4GG8A 2I07B 1U8KB 4MD4B 4CMHB 4LHUB 2HFTA 4ZPTB 1U8IA 3EJJX 3L3HB 2YPLB 4LAQL 2R2EA 3IDIA 3M17A 4QO1A 1URLA 1S7XB 4GO6B 4OFIA 2P5WE 5GGSA 4M6OL 4NNXA 3X3GL 1BWWA 4J12A 4BELD 4PGJA 4D2NA 3D0LA 3K1KC 4UT7L 1DQJB 2J12B 3V5DB 4LLDA 4LLQB 5E7FA 3VFMA 1C5DB 5FCUL 1JZ5A 4TVPE 4DKEH 4UIKH 4ZUVA 3LRSB 4HIXH 2R0WH 4WV1B 3GSXA 4S1RH 2ZJSL 5DJ0B 4TSAH 3DUUB 1LO0L 4OZHF 1T2XA 4D9LH 5DHYA 3SE9H 4BM7A 2O61B 1Y6NR 1TZHB 2JCCB 2ADGA 3GK8L 3BGFC 2A6KA 1QFPA 5E9DE 1KULA 5IQ9A 2Z8RA 2BNQD 1QRND 4YHIB 1UA6H 3RHWK 4XI5C 5KSUB 1F11A 2FGZA 4M7ZB 3WN5C 1G9EA 3V5KB 4JY4A 5HHNA 1P4IH 2DMCA 3L7EA 1QBLH 4PP1D 4RQQA 4PJ9C 2FH8A 1DL7L 3RVUC 1FFNB 1F6AB 3AGVA 3IGAB 1T21A 4HEME 2VLKE 4ZYKB 1MJUH 1OL0A 3BJLA 3MBEB 4D0DB 1U8QB 2QQNL 2YPKA 1FV1A 4FQHB 1C16A 2AXJA 4Q6YA 2NY1C 5EOTB 4KUCD 3BT2L 4Y4FB 1TDQA 1MCIA 2Y25A 2ID5A 4JVUA 4RGNE 3FMGL 5FCUH 1ZHBB 2FYYA 1HKFA 1XH3B 1U58B 3OKYA 1F4HA 4MZ2A 5JW4M 2NR6D 4L4TB 3CFJA 1SYVB 3IKCA 4TOYH 2R1WA 5GJTH 3L6FB 1INEH 1NMAH 1WBYB 1H9VA 1NL0L 1E6OL 4L4VB 4P5TA 4U6TA 2ITDA 3SE8L 3TYFB 3TBYA 4DZ8B 5HYSB 4NQCB 4NRZA 1UB5A 4U7MA 2ARJB 4HEPG 4Q0XL 3G5YA 4R7DB 3VD5A 3I6KA 3PQYB 2W91A 2AV7A 5IB2A 3QSKB 3GIZH 1KB5L 3VXSD 5KTEH 1YN7B 3DXAE 4KK5C 4KC3B 3EKCA 1CFQB 3JWNC 1JYVA 4X99A 2SEBA 3UPCA 4C56D 2OXGA 1BX2B 3WHXB 3WJJC 4ONFL 1IFHL 1NEZB 5E8NA 3ZHDA 3ARYA 5EU4B 4D8PA 3BEWA 5CBAA 3HR5B 4FG6D 3V5HB 1M7XA 2VDRH 4Z76A 5FA3B 3OGOE 3OAYK 3TNMB 3BN3B 2E6JA 1OGAD 1KV3A 3T77B 3H9HA 2W9EH 4QXTB 3U9PH 3D2UD 3TGXA 4JM2A 5I30H 3VG0L 5TQ2L 4TULL 3SJVA 1HH6B 4U2YA 1FYTD 1YEGH 3K81A 4BFIA 1GSMA 3QXVA 1DLHA 2O5XL 3TO4C 5FYLE 1R0AH 3MUGA 3U30C 1A22B 1KXVC 3BWAB 3X12B 3W5NA 3WXWL 1U3HA 2I60L 3RBSA 1RFDH 1JGLH 3BSZH 4X7SL 1HI6B 1P7KA 5FKAB 2BY3A 4R2GD 4AL8H 2H45A 5K33A 2WWMD 3EDKA 5MEQB 2CXGA 4HJJH 3AREC 3ARZA 4BKLA 2BVTA 4P2RB 2GY7B 2CDFB 4N9GA 4HKZA 5GSRA 4JGJA 1OAUL 4WY7L 5D96C 5CIPH 5F72S 2Z31C 3I50L 2CIIA 3TO2A 2EDTA 3N1FC 4DAGL 2UZXB 2QQLH 2EDRA 1G7QB 4Y2DB 4Y5XA 2FH6A 4JJHA 4LDEB 2ED9A 4QXGL 1BD2E 2CKBL 5T1LD 1HHGA 2OK0L 3DRQA 5HHVL 3GSNH 4HW6A 2CD0A 1UM5H 5ANMB 1NANI 4J7RA 4MVBD 2FRGP 4NQDE 2V2XB 3NBNA 1YUHB 4P4KB 3G6AB 1ES0B 4P46D 2HLFC 1E6JL 5D9SB 3QFJD 5F96H 3CPLA 3K3QA 3UYRH 3IFPB 4JRXD 4GMTL 2X1QA 4X4YA 1E4WH 1QNZH 4PJDB 3GK8H 4WWKA 1ZLUH 3TNNB 2DQFA 4LVEA 3K4AA 2QSCH 5D72H 3L95B 4X5LA 5FO9B 4DEPC 3CC5A 3QHZH 1AXSA 3QCUH 4WW1B 5CJQL 3E2HB 4E0RA 4LHUG 3S37H 5E8PB 5HVHC 4Z7UF 3MRPB 3OXSA 4LIQL 4WDIB 1KTLB 1WF5A 2CLRB 3P11L 2JLLA 4P5KB 1F4XL 2CRZA 2G2RA 3DSFL 1R6VA 3MRRB 4FZEL 4FOMA 1C5BL 5I66A 5IB4A 2IBZY 4M7JL 5LG1A 4GT7A 1K8DA 1KBGL 2QJDA 2CRMA 1BEYL 2VC2H 5FUCC 5JDSA 4PJ7E 5C2BL 4P46A 1J8HD 4ONGH 4TTDD 1T1WA 4YXLL 1EHAA 2YSSB 4H1LH 5E03A 2Z31D 4JAMA 4YDKL 4OI8A 4L4JA 3BRDA 2CR3A 3NZ8B 1V7ML 4LGPB 1KPVA 1U8JB 3U7WH 1NJ9B 4TNVK 2Y6SC 5EOQL 5KANG 4ZFFB 5I0ZA 2VISB 1CDCA 2EDNA 4LCUB 4I2XA 4WWKD 4NQXB 4JJ5B 4IDJL 3ARSA 1EFQA 2XFXA 1CXIA 3SOBH 1XMWA 3B43A 5EOCH 4HKXA 1T6VN 1WIPA 2K1MA 4J3UA 3M17B 5F3BA 1A6TA 1VKXB 4F9PC 3VD4A 1RUMH 3RL2B 3JUZA 2Q76A 5DRZB 2FIRT 3V6FA 1UKTA 3WFDH 1R5VB 5I1CH 3IB4A 1XGUB 1AQKL 4NGHL 1AC0A 3QULB 5GZOD 4HUKB 5DJ6B 2X41A 3VFOB 1TJGL 1FYHB 2V2TA 4HWBL 4LLWB 1K6QH 2NZ9C 1NBZA 1D5IH 1TNMA 5L2KA 3MOQA 3EJZC 3HA0A 4LSUL 2AGJL 1A6WL 1P4BL 2OBGA 1GIGH 3ETBF 2JJSA 5EN2A 3GMPA 5SWZE 4Z7NE 2XWTB 4NKMB 3QI9A 1J8HA 3GSXB 5DJ0A 5HYEA 3B2UC 1AXTH 4LOUC 5C0DB 4Q6IB 2UYLA 2YOCA 2NW2B 4M93C 3QXDA 2BY2A 5ACLA 1WFOA 5GGQL 4ZS7H 2ICWA 5FAAA 4Z77A 4RZCA 4NJAL 4NKIH 4PJBF 5TE4H 5FUZL 4WI3A 3VFWA 4PS4L 3EHBC 3VFPA 5F9DC 4L3EE 1KLFA 2H26A 3L7EB 5B39G 3HZVB 2XZAH 3DURB 2DWEA 1YYLH 4ZUUB 1BREA 5DS8A 1F00I 2V5RA 4OQTA 5EZOH 3IGAA 3PWLA 4H8WH 4PJ7F 4PGCA 5IJVB 1MFAH 1P9MA 4W4NA 2VZUA 3P30L 5DDHA 1F02I 3BZFA 3HE6B 2CDGB 1HXMA 1FZJA 1CDYA 5I8OL 1YNKL 3BKCL 3FRPG 5DT1L 1KJ2A 3CDCA 5I2IB 1G9NC 2WP3O 4M93B 3J7HA 4G6ML 3S5LA 4O4YL 1NCUA 4MJIE 4LARH 4PJEB 3U7WL 5I1LA 2YWZA 1N8ZA 4X9BA 2VZSA 2IJ0C 5A3ID 1FZKB 3QHFH 3TN0D 2Y07L 3UTSA 2HFFA 5BZDB 5CGYD 4X6CE 4U7KA 2C4FU 4RRPA 1T5WA 2QHRH 1MIMH 3QEHB 3VRIA 1JPFA 3QEUB 4IS6A 4NP4L 4XC3H 5D7IB 1T7ZA 1OGAA 3QCTH 5IUSA 3TM6A 4XP4L 4JRYE 2ED7A 4OCYH 4HC1H 4U6XA 3G5YB 4R7DA 3CIQA 4XCFL 3CFDB 3HMXA 4YBHA 5D2LF 1K2DA 2D31A 3TA3B 3Q3GA 4CNIB 5DVOA 3VJ6A 1SMAA 1UJTA 3WIFB 1I8MA 1PD6A 3GRWH 1CFQA 1SEQH 3C2AH 5E2VH 1FNAA 3NCCB 3VWJD 1BX2A 3GNMH 2YD6A 3ZHLA 1AQDB 3WXWH 4LSTL 5CGMA 4ONHB 3SGKC 1G9MC 1R5WB 2VYRE 3UJJL 2XRAL 4HF5L 1S9VB 2UUDH 3G5VB 1F3RB 4YDLB 3O8XC 3S34H 4Y1AE 3UAJD 1JF1A 4P2QB 5DA0B 3RPIB 5ID1B 3FZUD 3I6GB 2QLVB 2UWEA 1OB1A 4CBPA 2OR9L 1X5LA 1AGCA 2L7JA 4LU5H 4CW1B 3RWIA 3AB0C 2C3WA 3FN0L 4PR5B 1XIWA 1DBBL 4G8IB 3INUL 3K7UA 2QQLL 4NHUA 3SKUD 4WGVB 4X6EA 1EHLL 1NC2A 4YFDB 5BRZB 1IE5A 4XPHH 3PHQB 1DQQA 5FKAA 3FO1A 1GCFA 3BZDA 3GKZA 1XIWC 1P6AB 3RGVD 3BAEH 1UZ8A 3MCLH 1LDSA 1N5AB 5JMRA 5HYFA 4KVNH 2P24B 1D5ZB 4DN3L 5KZCB 3RUGE 5CCKH 3QFJB 5TE7H 5CD3A 3L3KB 5DK3A 5D1QB 1OD9A 1CF8H 1NFDE 4A6YH 4OZHE 3S96B 3HCVB 3ZKXB 5F9OL 3OB0K 3E0GA 4IMLB 4NQED 2QQKH 1IGIL 3BH9A 1JI2A 2Q1EA 1ED3A 2GW5A 4APQA 2BCKA 4L8SA 5EBMA 5F1KC 4LSRH 1RUPH 3IS0X 5JOFA 1DUZB 1H3UA 3QUYD 2AJ3B 1K8IB 4PJIF 2W07A 5EFIA 1ZGLA 1MCCA 3SE3A 1XR8B 3PWPD 2HYMA 4K9EL 3OKOA 1DQDL 3QQ9C 3BT2H 3CFKA 3F62A 4AT6B 1INQB 2VIRA 5KSAD 2PCPA 4K8RC 5EU3B 5ISZB 1U92B 1BVLB 1LNUA 3JV4A 4Y4HD 3CX5K 4K2UH 4Q9CA 4HXBH 3QRGH 3FHAA 5CGTA 4AY0A 1RZIA 3CVHL 3FTGA 1CLYH 5DJ2B 4L4TD 3GSNB 5E8PA 2FEDC 3HAEB 1EBAA 4M7LL 1D5XA 4KMTL 2BNQB 4M1GL 4KKLC 1FVEB 4J3XA 3MOBL 4YGVA 2O5ZL 4J8RB 1JUFB 4NO3A 3K0WA 3RDTB 4FFYL 4CJ0A 4EXPX 5JORB 3O45A 1UA6L 3CFEA 1A9EB 1T6WA 3KHOA 3P0YH 2ATPA 4RISH 3PGFL 4L3CA 1VGKA 5F7HA 2WLYA 5IHZA 2IF7A 2A2QT 3QJHB 1ZLVK 1DE4A 4GRLC 1U8LB 1T03H 3QR2A 5F9OH 5DYOA 1XZ0A 3QUZC 5IIEB 3PL6C 2E7MA 1XGTA 2UZIH 3WNNA 1INEL 1NMAL 3EFFB 5BMFH 4NN5C 3NABL 4KHXL 3WNKA 3LN9A 4NRYB 3UBXB 2GQHA 1WFNA 3QDHA 4JO2L 2Z93A 4ORGA 3VW3H 2QKIB 1WTGT 2H41A 1HQ4B 4UIKL 3MCLL 4LCUA 3QI9D 2GI7A 1YJDC 2FX9L 3AXLA 4KKCC 1PG7W 5CJXA 2P1YA 3ZZ1A 5EBLA 3T0EE 3U6RA 3GI9L 3PDDA 4NQVA 1QTYT 3AU1B 3BHBA 2F5BL 2Z35B 2IAMC 4ELMB 5LKNA 4KK5D 4KI5E 5JW4R 1ZTXL 3MCG1 4JFPB 2E9JA 3W11D 5JA8B 2PTTA 1JYXA 1JVKA 4QHMB 4WTWA 1QFUH 5C6TL 3BQUA 3KJ4B 4KZEH 4G8GA 4WJ5B 5C0BE 4DKEL 3QRFM 2BXYA 2D0GA 4L9LC 3R8QA 4Q97A 3B9AA 4EUPB 3G6JE 1KUMA 5KZCD 4KK9C 3TVMB 4EJ1C 4XB8A 4FZ8L 3QUXB 5GQBA 1YNTA 3WMSA 4OCSH 2GUOA 4RMUA 1BZQK 5LAXA 5AYUH 1JK8A 3HPJB 3ZDYF 1OT2A 4Q6IA 2NW2A 5DLMH 1FNEB 3VDBA 3MRKA 5D7KE 5E4EB 3VGDA 1PKQE 2BVQA 4OCSL 1HHJA 4MSWA 3H9ZA 4FQ1H 4K3JL 1EUTA 4WV1A 4M61B 5DSCA 3UTZB 3VXRA 4MXQD 4LNRA 1X5IA 2OL3B 4M7LH 4K8RH 2X4TA 1VA9A 3QUZD 2FJGB 3CMOL 5ALCL 2DD8L 4RFEB 1OP3K 5AZ2L 3C08H 4L8BA 1CE1L 4M7KL 4M5ZH 3C5SB 1EFXA 4XT1C 4YHIA 1E4KC 5HHOE 2FGWL 4UMGA 1XGYL 4NJ9H 5I74C 1BFVL 2RCSL 1F4YL 1KT2A 5CLWA 1N7MH 1FZJB 3BP6B 4HIIB 5B39A 5JPMA 1KLGB 4LLYB 1HOCA 5IF0A 3LS4L 1OCWL 3ULVL 4EDWL 1ZT1B 2K3TA 3GHEH 3RGHA 1MJ7H 2X2YA 1RZGB 2Z8VC 3V6OC 2MPAH 4XXDA 4J4PC 4EN3B 4QHUB 5FYKH 4ERSH 1T1YA 4WFGD 1DBAH 4H25B 5HVGB 1YEFL 4DFHA 5BZDA 1MLCB 2A6DA 5INCA 2C4FT 3X11B 5I1AA 4QNPE 5HYJB 2R0LH 5CEZH 1P5UA 5D6CB 4G6JH 5EO1A 3IU4L 4RMSA 5KBNC 4P3CH 5FIEA 4WGWB 2YBRA 3TZVC 3EZJB 2VDNL 2ZOLB 4L4TA 1HH9A 1CN4A 1SYVA 3C5ZA 1IAKA 5C6PB 1U8MA 1RU9H 2KQMA 2RAMA 5IG7A 1V5JA 1V7MH 2VO5A 3OKLA 7FABH 3RIFK 1I8MB 1DQTA 3RP1A 4J6RL 3RI5K 4LVHB 3IXAB 1KACB 3FB5A 3GBLA 1U8KA 2VZOA 5SWSE 4NJAH 1I3RB 4MXQC 4YFLI 1Q0YL 2HFGL 4XZUA 5EZLA 4B41A 2DLTA 2VC2L 1QA9B 1FORH 1U6AH 1BFTA 2ZKHH 1AGEA 1FL6B 1NLDH 2VXQL 4Y5YA 3MJGX 4ZNEA 1S9KC 5GPRA 4JDZB 1ZHKB 1BM3L 3O11A 4HJ0D 4X99B 1CDJA 4PRPB 4GG6E 1MCWW 1TXKA 2DQEH 1KEGL 3HR5A 5CZKA 2Z91A 1OB1B 1BM3H 1PAMA 5J13B 5KJRH 3GKWL 2GHWB 1RMFH 3LRSA 4GBXC 3PV6B 3TCLA 4HMCA 4RSVA 5HD8C 4G8IA 3UX9B 4XNXH 3CXDH 2XA3A 4UI2A 4Y16A 5EORH 1UJ3C 1HH6A 2ILLA 2HMIC 1AO7A 3IJSB 2EEDA 2VXUH 5SWSA 3O2WL 4K8RL 2WNGA 1NFIA 2FHFA 5KSUA 1BGXL 5DQ9B 1QPXA 1VADB 5ILTL 4CL7A 1IBGL 1MVFA 2W9DL 4GS7C 3S96A 2EDEA 3P77B 4NM8H 1T66D 3NCYS 3G6JB 3F58L 1KCUL 1MCHA 3HFML 3WS3A 4ZUWA 1MCKA 4YXLH 4OV5A 3KJ6L 1D5MA 2BK8A 4GUPA 5T1KD 4C4KT 2IADB 5H35B 4JR9H 2XICA 5F96L 2D03H 2DQGL 3TO2B 4PBXA 4UB0H 1TCRA 4QYOB 2CK0H 3STLB 3RWHB 3VDCA 1JHLL 4BSWA 1ACYH 4MCZB 4DVRH 4EN3D 1ZHLA 1K6QL 2PW1B 3IU3B 3MOAH 1CI5A 4LSTH 5C07E 1IQWH 1L9NA 5DHVB 3T2QA 1HSAA 4OF6A 3G6AA 3IKCB 5C0AA 1C1EL 5B4MC 2Y5TA 4IIQC 4LVOC 1EA9C 5DJ2A 2DQUL 4RDQG 1DQLH 3D2UA 4QY8B 2WWKO 3EZ8A 4I13B 3TBYB 4DZ8A 5HYSA 1CXHA 2OQJB 5CP3H 3WFZA 4O2EB 1CLOH 1HNFA 1JPST 5L0QB 3F7YA 3RVWC 4YGVB 4RGNC 3G6DL 4NQEE 5E9DD 3HC0B 1WEJH 2VLKA 1I7ZA 5FM4A 1YEEH 3LQAL 3KS0J 2ZSWB 3MRDB 4U0QB 1N7ML 5IR1B 1UWGL 1MFDH 3HAEG 4ESKA 1MWAA 2P4AB 4I48A 3FCTB 4GRLB 4YLQT 5IEHA 5KJRL 4P5KA 4UOJA 5BW7A 2F5AH 5BRZE 2VXSH 2VL5B 5D1ZB 3TV3L 4RAUA 2FHBA 2CXKA 1UM4H 1UB6A 3EYQD 3WS6C 1NUGA 5D2LE 3VFNB 5I8CB 4HPOH 1S7QA 5JLZA 2XA8H 3OAUH 1EXUB 3B4NA 4N90D 4MB3A 2OSLB 5CMAA 5C0FB 3O4LB 3ZE2F 1INDH 3P9LB 4MNQE 1K3ZA 4JEGB 2OTUA 4R4NC 2GSIA 3F7PC 3WE6A 3SDYL 4YHLH 1JHKL 1K5NB 2L0DA 4ETQB 2QADB 2Z35A 2BSED 3BPCA 3O3EA 3BSZL 3U83A 2F54D 4ALAH 3BWAA 3UP1A 1U91A 1T7WA 3IJHA 1CGTA 4RFOH 5ESAB 3B2VL 2KKQA 2DWDB 5DZNA 4I5BA 3OJVC 4KI5D 3RY4A 4LSDA 4PJ7A 5FUZH 2A0LD 5C9KA 2VDMH 2H3NA 5SWZD 2LTQB 5B22A 5ALBH 4BKLB 4WEMB 3KYNB 3V4UL 5HVWA 1KCVH 1HIMH 4UAOB 3QO1B 5EBWB 4KKBD 3TBVA 4UAOC 1JK8B 3HPJA 4YEFA 5CINL 5FGSA 1WBXA 1KC5L 1FNEA 4LCCC 3L3GA 3BZ4B 3VFRA 1QFOA 1AD0B 1LEKB 3GMPB 3PGCB 2APXA 2FB4L 3HE7D 1G7HB 2Z8WC 4N8VB 5LGJB 3NTCH 1EAPA 1YNLL 2BDNL 1GGUA 3BESR 4HPOL 3HG1A 1JWMB 2D9QB 4LCIL 3WUWB 2BMKB 3NACL 1DANU 4GAYB 4P49A 5ESVA 3M1BA 5DQJB 4AYFA 4BZ2L 3OL2A 1AP2A 1J1OL 1LGVA 1T80A 1A7RL 3WDHA 1Q72L 3RVXC 3SKMB 1FSKC 3EYQC 3GJFK 1FL3B 3DX9A 1EEYA 5EUKB 2HVKB 4WUKL 3MRGB 3DO7A 4G8GE 4JQXC 2H26B 3DX8B 2FR4A 4V1DD 3VRLF 3CC5B 4WFED 2A9NH 2CGRH 2EIZB 1RK1B 3O8XB 4NBZB 3WLWC 4L4VA 1IZJA 1RIHH 2KL6A 4U31A 2VDML 1KTLA 3RX8A 4NQCA 2F58H 5C1MB 2IAMA 3DROA 4CGTA 1WIOA 4EN3A 5IB4B 3EFDL 5I2IA 1MIML 1CTNA 5B38G 2GITA 4P0DA 5HYIA 4KU1A 3O3DB 5J1SC 3TVMD 1HZHH 5ADPH 4LQFH 2BHUA 5ALCH 2YBRB 2CUMA 2OS7A 2P45B 3R8BB 5I15L 3MXWL 3CDFA 2DQIL 3MRBB 4M7LT 2H32A 4OLWH 3P11H 4K71B 2EDHA 1G6VK 4YHZL 1U95A 4L9LB 2DQDL 4CADA 2CUIA 4JPWH 4MXVF 1JCKA 3HRZA 1DR9A 4LSVL 4GAFB 4NKQB 3X3GH 5H94B 1I7RB 3WJLC 5IW3A 3VXRE 5C86A 1Q72H 4LP4A 4HMEA 1AE6L 4XNYL 3VFGH 4LPVA 5HJ3A 1E27A 2EE3A 4BQ6A 4PJBB 5JHDB 4PJHF 5C0IA 3VD7A 2BHYA 4PJDF 1JZ2A 1G1CA 4Y5YB 2KPNA 2MCG1 5JNYB 1DBML 3O9WA 1MAMH 2JJUA 1QBLL 4OD2A 1REIA 2YUVA 4ODSH 3O11B 2CGRL 1DL7H 1OAYL 4WFGE 4ZQKA 1N6QL 1S7UB 1CLYL 1G9ML 4LRNH 5DUPH 5L6YL 3QDGB 5KSBE 1UM5L 2W9LA 5I71B 5IBUB 1ADQA 5DJCB 1EHLH 3QI9C 3TIDA 4N9GB 5GSRB 1MFEH 3BUTA 3HMWH 1A6AB 1NCDH 3A6BL 5D7SL 2UYLB 3GEWB 3DV4A 3GSOA 2CIIB 4U05A 4LPCA 1KB5B 3D69A 2NZIA 2UWEB 5E2VL 1DJSA 4MJ6B 4DN3H 2RFXA 1S3KH 4K94C 1HYSC 3ULUH 4U1MB 4WNQA 1QFUL 3NABH 4KHXH 4LSPH 1TNNA 4UT9H 3VFWB 5E1HB 1B3JA 1RHHA 1K4DB 5CSBA 1W0WA 3RWEB 1WZ1L 3FO1B 5DURD 1HWGB 4GBXB 1KTRL 4B50A 3RKDD 1G1YA 2HH0L 2Q8AL 1DBKH 4OIIH 4XP6L 3QO0B 5C09D 2IADA 5I76B 3MV9E 2W0FB 4Z7WA 3LEXA 3DVFA 4RMWA 4YBQC 4DCQB 1I8KA 3EO1B 3LQAC 4JFDA 3HCVA 2PYEA 4FQCL 1TCRB 4QYOA 4ISVA 1ZOXA 2H2SC 2AEQH 4N1CA 3TT1L 1SEBA 2X89A 2VABB 4OLYL 2DKMA 2AKRA 3GSWA 4ZFGL 4N0UE 1PZ5A 4A6YB 3MRRA 1LEIB 4X6BB 4AEIH 3W82A 1X4XA 5TE7L 5T1DL 3H6JA 1N0XL 3NOIA 4IS6B 5DR5L 2FZ3B 3TJHD 1INQA 2PCPB 8CGTA 3DI3B 3G9AB 3F7YB 1LNUB 3JV4B 4KFZC 4HUXB 2ZUTA 3MV9A 1MCRA 3BPLB 1RZIB 3V7AG 1KPVB 3FTGB 1TJGH 1U8JA 5D7LB 5BQ7B 4XVTH 1G84A 4OCMC 5IOPA 3FN3A 5A2FA 4JN1H 3MLVH 1CVSC 2H8PB 4IOIA 3W9DB 1Y18A 3FQRA 5T5NF 3DRTB 4EN3C 2R0WL 1FVEA 2DQJL 5A16A 2YPLE 3DIFB 5SV4A 5F7EH 3WFEL 4CVWA 3CUPA 4WHTB 3JWDC 4DVBB 4QRPA 4E41B 3QUKB 2P48B 4IMKA 4D3CL 1FFQA 1XF3B 4JDVB 5KOMC 4Z7WE 3RWFB 3HAEH 1WWAX 1S9YA 3NIFE 2PYFA 5DGRA 1P69B 3DPBA 4ZO7A 4U49A 3UTSE 4CN4A 2XI9A 4KUZH 4P2QA 4U1KA 3RAJH 5ID1A 2Y6SD 1U93B 1ORSA 5DJ8A 1I7TA 3I6GA 3GSNL 3MRNA 4NRYA 1Z3GH 1J1PH 2V6HA 5DLML 1BBJA 1M6OA 4K94H 4ETQA 3IF1B 1AHWC 4IRSC 3HMXL 3T1WA 1U91B 1X6LA 3IJHB 2XTJE 2ZUXA 4CU7A 3MLSL 1FL5A 1OAUH 4RGNB 3PHQA 4I5BB 1DQQB 5EBLB 4BZ1H 1RJLA 3U6RB 3QXDB 4LIQH 1IAMA 4Q2ZB 3S35L 5EORL 1QSFE 4ZAKA 5F7YC 2ZG2A 3OKKB 3QEQD 4Y2OA 5LGHH 2B1AH 5F89A 3RWJB 5J9PB 5C0EA 3MRIA 4HUWB 4ZTPH 5C0GA 1LD9A 4W4OA 4XX1G 5F8RC 5I8EB 5HYQA 2EO9A 4DN4L 3EOYG 4PRDA 5DMKB 4WJ5A 2B4CC 1WBXB 3TBTB 2YZ8A 5ILTH 2H2PD 2EE9A 3GKWH 2F53E 3QNYA 1AIFB 2YD4A 2Z31B 2DLFH 4F3FB 3V8OA 5CZVH 2P8PB 1GAFH 1QG3A 4M3JA 4LFHD 3ROLA 5HD8D 5E94B 4S1DD 4BH8B 4P3WA 5JXEA 2EH7L 2QL1A 4GMTH 3ZKMC 4X80H 3QXWA 3ZE1F 4XP1H 2YKLL 3HZYA 2K7PA 3STZA 4X7EC 2DLFL 3O4LD 3V95A 3M1BB 5EFIB 2DI8A 4U1LB 3O3BB 3THMH 2HLAA 2VTFA 4XPBH 1PW3A 25C8H 5E0QA 3U4BL 5DA4A 5I1LB 5F7LB 3ARBB 5C0AD 2NY5L 1J1PL 3TYGH 3QAZC 1RY7B 4H20H 3QFJE 5IBLC 3E6HB 1CIDA 5EUKA 3QQ4B 3NVQA 4CDGC 3MRGA 1W72B 4OLVL 1NEZG 3WNLA 3DX8A 3LKNA 1LK3H 1HCVA 4FXGA 3Q5TA 1YMME 1UEMA 2F8OA 1C12B 2B4CL 2DM4A 5BS0A 4QHKI 2IPTL 3VRIB 3HLAA 4MQ7A 2CLZA 4FXKA 1UT9A 1LEGB 3LS5H 2HRPH 1LVEA 1N64L 4L29B 4ODHH 4DKAA 4MXWL 1KT2B 5I71C 4JPKH 1DFBH 1JYWA 4KK6D 4J8RA 3BP6A 4HIIA 3QCUL 4TNWF 4HS8L 4O58H 3CK0L 4ONGL 1KLGA 4LLYA 3X13B 1A02N 3Q3GB 1ZT1A 5SX5H 4Y5VC 1QYGH 4MAYB 4NO5A 4JREB 4YQXL 3N85L 1J0KA 2MFNA 4OSUH 4F7PA 3HG1E 3UEZA 1I1YA 5B4MD 3VWKD 4NC1E 1ZLUK 1LP9B 1HKLL 4G3YH 5F97E 1BIHA 4JFQB 3CSYA 2QKIA 3NCYP 1LE5A 3RVTC 2X1OA 4ODVH 3NA9H 3QJFA 3WLWD 2Y06H 3D85B 4WFEE 3BE1L 3SE4A 4AG4H 2X1XR 4F37K 3BP7B 1I3UA 3W2DL 3O41A 5KS9F 1TJHL 4TPRL 1NAML 2DQHL 1XF1A 3BKYL 4OFYA 3WDJA 2B5IB 4PB9L 3IDYB 2VE6A 1BZ7B 2VSDA 4NHUB 1GOGA 3IXAA 4S10A 1L0QA 4Y4FC 5C8JB 5I73B 4IRSB 1NDMB 4MYWB 4OT1L 4E5XB 4GMSH 5KVEH 1VHPA 2OL3H 1D5BB 1OP9A 2VMFA 5J6HB 1CTOA 2JIXD 1QSFB 1KFAL 5JZ7D 2ZUYA 2XN9E 4PRPA 2XKNB 3PGDB 4LOUD 5CJOH 5EC1A 5ETUA 1MCBA 2JK5A 5L88H 2PO6A 4MA8L 1MQ8A 1IT9L 1YEJL 3G04A 2AXFB 4RA3A 2D7TL 1CICB 4PRHE 2IALA 4PG2A 1ZLSL 4JY6B 4G6FB 1B9ZA 1KXQE 3U0TB 2R4RL 4C56B 3WFCL 3MLPA 1CGYA 3SDAA 4OKVA 3HRPA 4PPTA 3SHSA 4LLUB 3BGFB 1CGVA 1OAZH 4PRIE 3B3IB 2A0LC 4ODXA 1DUZA 4V2CB 1T4KB 3UTQB 4PTTA 3QUYB 4KKAC 5BO1L 5EPMA 1LO2H 4L8BB 1R3KB 2P5EA 1NMCC 1F6LL 3DBXA 3RY6C 1U3YA 3C6SA 3WEXB 1WWBX 5SWZA 3TESA 5DC9B 5MERB 3TPKA 1IKFH 5C0RH 3GRWA 2VIRB 4NN7C 2DQDH 3MGAA 1N0XH 2YRPA 3QWRA 4DCQA 1KJ2H 1U92A 3SO3C 2PYEB 3LD8C 3QDME 4YAQA 3AAZB 5KVMC 3KXFB 2F9BT 3RJQB 5D7LE 4I77L 5D7SH 3Q6FB 3TF7C 3LDBB 1SJXA 2OCFD 1XGRA 2C7UB 3S98A 1DQML 5AUMA 1FFPA 3S3SA 3ARFD 4Y2DC 5E2UL 2ZNXA 4H25A 1DBBH 3RWHA 4QRPD 1PKOA 1V8HA 5KVFL 3RNKB 5J89A 2G60L 3EYOA 2E7LA 4KGLA 3W0WE 4B7IA 3ZDZF 1GGBH 4XAKE 3VMOA 1FZOB 3D3VB 1PSKH 1MOEA 2GK2A 3MV8D 1JPGB 3QUMB 4MDJA 1MIEL 3PABA 1F3DJ 5E2WH 1FAIH 3BIBX 2HJLB 1CCZA 3UBXA 3S8WA 3BIAX 2VXTH 4PJ8B 4YHLL 2BVUA 5GS1B 4M9OA 2NY4C 3ISWA 2KUTA 4JPWL 3RNQA 3D48R 3H9SD 5EZOL 4OLXL 3UPAA 4XZUB 3SQOH 1A7BA 4XP9H 3EYSL 4NQCD 4DVBA 4CMMA 1IEBA 1XF3A 4JDVA 1YPZF 3DGCR 1EEQA 5DVNA 3ZHKA 1ZT4B 3ESUF 2PTTB 4IRZH 4MNQD 4DUWA 1K85A 3NIDE 2IEPA 2E6PA 4MAYD 4MJ4A 4QHMA 3IDMB 4HWZB 5EC2A 1LO4L 1IGCH 1Q9WB 5BV7H 1I7TB 1FNFA 4EUPA 3OKMA 5HHQB 5I8CA 2X4NA 4JFEE 4XPFH 1WEJL 4HJGB 4MA7L 3QDMB 4KVNL 3KS0H 4HIXL 5ACMA 4HS6B 1L7IL 4XTRC 5HVFB 4PRBA 3EYFB 5AD0B 3BP5A 3KR3L 4FMFA 4J3VA 3QDAA 4P4RA 3WE6B 3S88L 4L8DA 4Z7VA 3WCYA 1CXKA 1AR1C 2PF6A 1BECA 3RZCD 1A4KB 1NANH 1KTDA 5IW6B 1CFSB 4AIZA 5LXGL 1F5WA 5HDOA 1AKJB 4AEFA 2VXTL 1MCOL 4X5WB 1C5CL 3KPRE 4PJ7B 5GSVA 4K71C 3GSUB 1AIFA 2ADFL 4C83A 3QYCA 3HE6D 5FF6B 2O5ZH 5E4IA 1HHHA 3C5SA 2YUXA 3FOLA 1XCTA 4JZOB 5E94A 3EYSH 3SN6N 4BH8A 1BAFL 2GY5A 3GIVA 1ZT7B 5H8DA 3VXUB 3IDGA 2APWA 4U0RB 3HZYB 4JY5L 3STZB 4Q9QH 1XF5B 3GBMH 4XNUL 3BZ4A 3SDAD 3VFRB 2I24N 1KENH 4PGEA 1IFHH 1RZGA 1N4XH 1YQVH 4ZUTB 1JBJA 2EDLA 3G5ZB 2HN7A 5CEXB 3HR6A 3E6HA 3QBTB 4K8RD 3WUWA 4HC1A 3KLAB 4G80B 4M6ML 3RKDC 2Y5TB 2H9GB 3O4OC 5DFVD 1MLCA 1Y6MR 2A6DB 3QQ3B 1AHWB 1UXSA 2BVPA 5FV1L 3OJDA 4KDWA 2Z0BA 3X11A 1AJ7H 3BKMH 4RNRB 1BJMA 4JFZH 4HULB 5T1LA 1J10A 3L9RB 5AAWA 1F58H 1YMMD 4WIQA 4LQ1A 4C4KO 4LF3B 4NZUL 4X7TB 4LBEB 4V2BA 4LMQE 4PG9B 4ZSOB 1ND0A 2DMBA 4A6YL 4M9PA 3ARBC 2QADD 2AEWA 4JFFA 3U48A 5KAQF 3FB5B 5C07B 1AI1H 4FQLH 3B9KD 4PJCB 3KNBA 1XFPA 1TTUA 2NY7L 4IDLA 4YBLC 1QD0A 3FQXB 5H2BA 2GFBA 5F7EL 3IETB 3MMEA 4JFQA 2GITB 1SY6A 4UT6H 5FV2A 1J05A 3NCJH 1EXUA 2D7OA 1EZVY 1WCBA 2OP4L 4UINH 3OZ9H 1CD0A 3DGGB 3O4LA 4LAQH 2QHRL 1UWGH 4MDIB 4PRAA 2X7LB 4OFDA 5KG9B 2OTUB 4ZAKC 3ZYIA 2R0KH 1IC1A 1K5NA 1JWUA 4M6NH 4EQ2A 4S1SL 1MCPH 5BJTB 5H94A 2IFFH 5B8CA 4XRCB 4LHUA 3T65B 2ZWLT 4ZPTA 3EOTL 1S7WB 2YPLA 3TPUB 1S7XA 1BD2A 1NEUA 4NZTL 2OJEB 4F9LA 1LK2A 4NFCA 3GNML 3BUYB 4OGAC 4OD2B 4QRRD 1DBAL 2UWEF 4X4ZA 5MP6H 2QEJA 2X40A 4X6DE 4HK0B 1GOHA 4PFEA 2RR3A 5JQ6L 1KG0A 2E7LC 5JHLH 1RVFL 3DXAB 4XHJD 2X6MA 1CVRA 1MI5A 5C7XL 4ZUVB 3V4VL 1PYWA 1CS6A 2HFEA 1VFMA 3IAGC 2ARJQ 5E6IB 1LEKA 2VDNH 4OZGE 3MXVH 1D5MB 3DLQR 3UJTH 5DT1H 5E8EB 4URTB 4YBLB 3DUUA 1ZWIA 5ERWB 3GSRA 3ARBD 3PHSA 5F1IA 3UJIL 5L7XH 1MRFH 4EOWL 1M05B 2BMKA 3LPWA 3D5OF 1PFCA 1I85A 3K80A 1T4KA 3MFGB 3QUYA 1UJ3A 5CS7A 3I3BA 1SYSB 2Q6WB 3UJTL 5EPMB 3ULUD 4P4KD 3QPQD 4MCZA 3CLFL 1ZHLB 2R56H 5FECB 1PQZB 1TZIA 5ENWB 3UJIH 3VGGA 1MFBH 1IGFH 1E4KA 2HVKA 3DO7B 3IS1X 1HSAB 5DZOA 1VSCA 4GRMA 5HDLA 2DYPD 3VWJB 4OB5H 3QNXB 2R56L 2EEAA 5CSGA 1S7VA 1X5XA 3R06A 4R3SB 2COQA 3SBWA 4K7PL 1F4YH 4N0CC 5CEYA 1T2QL 4D0DA 3DROB 4O2EA 1LO5B 1ZVSA 4G6KL 5AUMB 5TFSL 2J5LB 4JFDB 3MGTA 4HIEA 3F7VA 5JXED 3Q6GL 2XY1A 1C5BH 2VLME 3T0VA 3WFHB 2HTKD 3T8XA 1I1AA 4G8EB 4H5SB 2PTUA 4KKAD 3S3PA 1P2CA 4OLVH 3G08A 4NCC2 4YQXH 4HH9A 3V6ZA 2R4SL 3R1GH 3RWCA 4N0YL 2NY2C 2R9HC 3VFNA 1X5KA 3MLUH 4GS7B 1R24B 2IPKA 3SPVB 4GKZB 3T08A 3DV6B 2JCCE 2M8XA 4JPKL 5GS2D 3GB7B 3FJTA 3WNPA 3JXAA 4FTVB 5EA0L 5CMAB 3F8UB 1CE6B 2WLZA 5C0FA 5DEFA 5GS0L 3PWUA 1L0YA 4L4VE 2E8YA 1IEHA 4FQIL 2HKFH 2AERT 4PJBA 1TLKA 5JHDA 4OCWL 5D70H 3KYKH 5DJDB 4JZJA 4PRID 5D7LA 3O3EB 4S1SH 1WBZB 1YN7A 3V6OA 1WWWX 3K8LA 3O9WB 3IVKB 1RI8A 3QNZB 4HLJA 4N8PA 3VFTB 4A2LA 4XP5L 3EJZD 2IMMA 4ZOCA 3DRTA 3GDBA 4J2XA 5EC2B 1S7UA 4HWZA 5A16B 4U6YB 5FGCB 2YRZA 3BQUD 3SO5A 3QDGA 2YMXL 3CUPB 4WHTA 4HWEH 1MFEL 1QUNA 3HMWL 1EHNA 2P5EE 3N9GL 3H42L 3T4AB 2HG5A 5FDWA 2IGFL 3SEPA 3E8UL 5IGXL 3E3QC 4I3RL 3NACH 3TO4D 4R2GB 4M8VA 4ZFOA 2CK0L 3RWGA 1DEDA 4HJGA 4PLKC 5J4MA 5C0NC 1JRHL 2BJMH 4L3EA 4RGMB 1SBSL 1U93A 5IVXF 5FB8B 5AWNH 3MQIA 4N68A 4ODSL 2FX8L 1MRCH 3N1QC 2RFXB 5IFAH 3MUGB 1B4JL 5K9OA 4KZDH 2BXZA 5L7XL 1YQ2A 1F4AA 4MMZC 1CFSA 4AIZB 3PWNB 3S6CA 4G8FA 3MLRH 1WCQA 2O61A 1E4WL 1QNZL 3N1MC 4G42A 3P0GB 2JCCA 5T33L 1T7YA 2KDGA 4ZAKB 3ZSTA 3O2WH 1TETH 1TQCC 5ICZA 3VXTB 1HHHB 3FOLB 3DX9B 2B39A 2VB5A 2XQYK 3BDBA 3MRIB 4Z7WB 1DN0B 4WHYG 4MQXD 1NCCL 2FB4H 3CSBA 4B7LA 2X4OA 1I8KB 3IDGB 3HMXH 1XF5A 2QBWA 3S3JA 4JFEA 1RK1A 4QF1B 4AG4L 3ROLB 3FO0H 5IESH 2HVJA 4E41E 4NYLA 3RPKA 1FG2B 3TCXA 3NZHH 1CGSH 3QFDB 2HN7B 4KPHH 1E28B 5CEXA 3NIGE 3GMQA 3PE9A 4P4KA 1HDMB 5LQBL 1X6NA 4FQHA 2ZCLL 3VD9A 2NY3C 1U8OA 4NCDA 2DIBA 5IW1B 5HYJE 4M1CC 4Y4FA 3O2DL 4JKPL 4MD5B 1AR2A 4HK3N 1IT9H 4ZSOE 3NCBB 1ZHBA 1T5XA 2BNUB 3SO3B 4PD4K 3P3YA 1U58A 1CE1H 4M7KH 2HWZH 2MJWA 3K46A 3L5WB 2G75B 1XEDA 3PIQA 4JRYD 2R1WB 1U95B 4Y4KA 3MGOA 3CGTA 1FFRA 1E4XL 3O6KL 4Z7OE 2CKNA 1W72L 4KJWC 4AMKH 2H8PA 3W9DA 3HC3L 2CLRA 4UQ2B 5F9JA 4NRZB 3I75A 5C07A 3VXQA 3GZKA 2VUYA 2R1XA 1OSZB 4QRPB 4E41A 3QUKA 4HFWA 2VR9A 1BJ1H 1A6PA 5C0IB 3SQOL 3HNTL 5DD0L 2YRLA 3HNVL 5JNYA 1MCOH 2Y7QA 2JELH 1S9YB 1NCBL 3VI3F 2MCPH 3MX0A 4P9HH 4ZQKB 3UTOA 3BEVB 3DGGA 5DJ8B 2FLRT 1W0VA 2AJYH 1K4CA 4DQOL 5DUBA 2DDQH 2F8VA 3FMGH 3H7BA 4O02L 5CD5C 3VRLE 2VL4A 2XWJA 4Z0BL 1ITBB 5D1QD 5F7DB 4WUUA 5D7KD 4KY1L 3TIDB 5E24E 1NBVH 4QXTA 1CZ8L 4F15C 1AY1H 4OZFH 2XNAA 1CFNB 1LHZA 1CDHA 1QBML 2QSQA 3SJVB 1KB5A 3TPUA 2V5MA 4KZDL 4TNVF 2EDDA 1DQMH 3RQ3A 4LSSH 1BF8A 1ZVYA 2BSSA 2Y07H 3DNKA 4N1EA 5JIIA 2V7HB 3CDYA 3VFOA 4WU7A 1HSBB 5DMKA 4KKBC 4LLWA 1W0WB 2YA0A 1P7KB 3TBTA 1F3JA 3MLSH 4OLXH 3FO2A 1UH2A 3CFCL 4R8WL 2OJZH 4QOKB 3RL1A 5F1IB 1KC5H 4PJAA 5SWQA 1OTUC 1TVBA 3HNVH 3DETD 2JK5B 3EO1A 4BQ9A 2PO6B 3JWDH 2BVYA 3S4SA 2VITA 4BH7A 1NGZA 3O3BA 3OB0H 1AR1D 4G8GD 4L1HA 5TH2B 1BFSA 4OZ4B 4JG0L 4KTDL 4Z8FH 3H9SE 1Z0NA 4JY6A 3DRQB 5F1OB 2EKJA 2BZDA 1N2RA 3F7QA 3HI6H 1E4XH 3CCHB 1T89A 5J11B 3QWOB 1QFWL 1R3JA 3KPLB 1W72A 3D3VD 4ODXB 1ERNA 3KPRA 2Q86A 4XNQA 5DS8B 1CT8B 3GSVB 2DQJH 1JWSB 2EYTB 2C5DC 3FOMB 1CGWA 2XIDA 1LEGA 1J18A 4MWFB 4X4YB 4ONOA 4D94A 4FHBD 4PB0H 3TJEH 4Y1AB 5IMKB 3HE6A 3MLUL 3E1F1 4XCCL 5JO5B 3U0PA 3F7VB 1CQYA 4GRLD 4F58L 5D6DC 2YR3A 4WW1A 3T2NH 5D1XB 4OCRH 5GGRB 4OZIA 2CR6A 1NCWH 3BMVA 2XRAH 5DWUH 3P4NA 4XCFH 1S78C 1B6UA 1I4FB 1FAIL 3ZDYE 3ARGC 1MQKL 4HBCL 2AEIT 3K8KA 1CF8L 3RNKA 1RZ8A 5LVEA 4CU6A 1MRDH 5ALBL 3NFNA 3DMMA 3GM8A 3UO1L 3D3VA 2BFVL 3MJ9H 1DEEA 3D39E 5IVZB 1L7IH 2APFA 3WLBB 4NWUH 3TIEA 1XIWD 3B5TA 2B1HL 4XNZB 1NGPL 4QHLB 2NY5C 3ZMRA 5KW9L 2B8OT 1MHPL 3CFBA 2OX5A 3P0VL 4I2XB 4Z95L 4JFFE 3MR9A 3QIWA 2XFXB 2AJSL 4D0BA 1B4JH 4WEUD 1WT5C 2R2HB 2WWKT 2OR9H 6CGTA 3UAJC 1AQDA 4L5FL 4EUPG 5LJYH 2J2ZA 1IEBB 1EK3A 2CKBB 1H3PH 3RL2A 1FO0H 4QLRA 3BO8B 1QR1A 3QIUB 5J9PA 1XGUA 1L0XA 3QULA 4G9FE 5E5UB 3MODL 3IFOA 5HYQB 3LSOA 4G43B 4NZDA 4PV8B 3RPIA 2A83A 4IRSD 4QTHB 4HKJB 2YPVH 1Z9LA 1G9NL 5D1ZC 3KLDA 3I85A 2E3VA 2J6EA 4NKIL 4UILH 3CDGA 1AGCB 4LKCA 4MCYB 5F1NA 4G6KH 5J12B 1FFOB 2ITCB 4OCXH 3MNWB 2XWTA 1AFVH 5GGTH 5LGHL 4QNPF 2W92A 5KOVC 4LLUA 3UBXG 4QRTA 3Q5OA 3QEGL 5DMYA 4PTTB 4Z6AT 4TSBL 2X05A 2EYSA 1KPRB 5AYQA 5IHLB 3RY6A 3A0OA 2V17H 1G6RH 5IW6A 4PUBH 1FC1A 5DK0A 5D2LB 1ORQA 4NPYB 2X4OB 3O6MH 4I9WE 1TZGH 3PP4H 4KAQL 4YAQB 3EDDA 1N59B 3D0VA 3ZDXE 1IQDB 3QEQB 4LVNC 3C8HA 1C12A 4J4PD 3PWLB 4NUGL 2VLLA 2B0SL 1OARL 1FPTL 2WIIB 3MO1B 1Q94A 3AREB 5JW3H 2HJKA 4EIZC 3L3IB 2CDGA 5TDNA 3QIBB 5ESQA 1M1SA 1K8IA 2IFFL 1GAFL 3VWKA 2B0SH 2UY6A 5JQ6H 1UWEH 5CJQH 1NBQA 5JW3L 1CFVH 1UWXK 1IM9A 1MHHB 1WWCA 35C8H 5FCSH 2FEDD 1N8ZB 3OGCA 12E8H 1CBVL 4N0FA 3HFMH 2N4IA 4DK6A 4MQXC 3GRWL 1W8OA 5EU6A 3ZTJH 2HKHH 3DYPA 5A2LH 5AYUL 4Y4KB 2VAAB 5DRXA 3MGOB 4RNRA 2BNRD 3U46B 5SX4I 3Q1SL 4OKDA 1H5BC 1TENA 2Q8BH 4DK3A 2D03L 3I75B 2R0ZH 1EO5A 3Q6GH 4PIRF 4Z0BH 3O4OB 4QKXB 4U6XB 1U3HD 1FNSL 3QG7H 3UTSD 1OSZA 1N4XL 3Q0HA 4PJFF 3O41B 1RUKL 2I9LA 4XMLL 1HILB 4HJ0C 3LH2L 3DARA 1MRFL 4PGDB 3BW9A 3W5MA 4UINL 1A1OB 2NW3B 5IV2B 1GXEA 4ONFH 4O9HL 3IDMA 1YC7A 1F4WL 4JM2D 5GJSH 3OR7B 1U8IB 3X3FL 3MLWL 3WIIH 1AO7E 5DQDH 3BI9X 1K4CB 3DMMC 2NXYC 5E9DA 5GGSB 4NNXB 4H0HB 2DQHH 3P73B 3REVA 1D3CA 2PXYA 4UQ3B 2HH0H 3DVGA 4NZRL 3HS0A 4NFDA 1ZMYA 4LLDB 1P7QB 4R7NA 3ZE2E 2DOCA 5KANI 1I9RL 2NXZD 2XKUA 5HHOB 1YN6A 3T04D 4POUB 1TZGL 1NDGA 5D72L 1D9KC 5BV7L 2OZ4L 2FIKB 4K23H 5C0CD 1VDGA 2NX5A 4J1UA 2PUQT 5B8CB 1FGNH 1BFOA 3O2DH 1NAMB 4OUUA 4GKOA 4OQTH 4KMQA 1S7WA 3PP3H 5DJYB 2H2PC 3DJ9A 3ULVD 1NBYA 3WKNA 4XCNA 1BD2B 2OR7A 3LOWA 3B8SA 2LU3A 1R3KA 4Y7MA 1JJUA 1WQVT 3OPZL 1E0OB 1R3IL 4GRWE 3WEXA 1OW0C 4JPIA 4HXAH 3U79A 2D2OA 1YMHA 5C3LD 3VXUA 1TVBB 4JCMA 5D1QC 5FOBA 4WRLA 2HLFD 1FVDB 1ZAGA 5KS9E 3EGSA 5C0AE 2XZQH 3OKEA 4LPTA 2PYED 5FHAH 3RGVA 4D9RD 2IBGA 2NY6B 2PW2B 1DCLA 1EGJA 2CSPA 4L3ED 1GHFH 2R1YB 3PL6B 2BOCA 4JLRA 1T21B 4FNLL 5HY9A 3UDWC 1ZWIB 5ERWA 3UTZA 5DSCB 1I7UA 4LNRB 1FV1B 2JB6A 5BV7C 3RY5A 3NTCL 3LS4H 1UENA 1UG9A 3BH8A 3BPLC 5MP6L 5E08L 4OLUL 3PXHA 1FVCA 3GSVA 1VFOA 1F58L 2PETA 4KRLB 2VZVA 4X7SH 4ZTOL 3U82B 2X4RB 3RVWD 4OCNC 1WC7A 4TVPL 1CK0L 3UZQA 1NPUA 3FQWA 5FYKL 3PG2A 4IJ3C 4AIOA 4GRMB 1B0GB 1C08B 2AJZB 5INDA 4YE4L 1ZGLM 1IMHC 3JVGA 1CGXA 1QEWA 3RVVC 5KSVA 5CCKL 1HHKA 1I9IH 2GK0B 4Y2DD 4WENB 3GIZL 1KCKA 1UVQB 3QDJE 1LO5A 5GGSY 5DK2B 1DTUA 1J88A 4PJCA 3VXMD 1YMMB 5E2TL 2P49B 2LAGB 4JFXA 4NT6A 5IB2B 4CMMB 2CIKA 4HCRH 2EIBA 2DJ4A 3VRJA 1I1AB 5IHZB 2FATL 4G8EA 3TH4T 5C71A 5EZIH 4XBEH 4RGOH 3F7RA 2GTZB 5J1AB 4PREA 1AGDA 4ZMAT 1F90L 5D96B 1P2CB 1XZ0B 5GRVK 3T4YA 1IC5L 4YWGL 4ODWB 2ZOLA 3GHEL 3B9KB 4M6NL 5ELIA 5EU4A 1UWXH 3MNZB 1DUYB 1GC1L 4K7FB 2CH8A 2Z9TA 3OKMB 2DQIH 2P46B 1VEMA 5E8DL 3IFLH 5GRWA 4DWHA 4XP4H 1YNKH 3T77A 3GB7A 1IKNC 3QHZL 2WUBH 1ZXQA 1A7RH 1LO2L 1A4JA 4RAVB 1IAIM 4PRPE 1EO8L 4NUJA 4NQVB 2OTWA 3TN0B 4JZJB 3AU1A 3BHBB 3ALWA 4M5YH 2VR4A 3C2AL 1XAUA 4JM2F 1H8NA 4HWNA 2D7TH 5FM5M 1A4KA 2NY0B 5TE6L 2A9NL 3NA4A 5I15H 1AKJA 3ES6A 1IVLA 4QHKJ 4P5TC 2EKSB 5I1HH 3BZEB 4HIHB 4M5YL 1NAKL 3A67L 3OBAA 5EU6E 4C59B 5GSVB 4W68A 1YQVL 2BVEA 4R4FH 5CINH 3ARGA 4HF5H 3SDCC 4HG4K 1TVHA 2X4QA 4LSQH 5E6IA 2D0HA 4YDLC 5FF6A 3VGAB 5FUOH 4P23D 5ACZB 3MNWA 5CAYB 1XCTB 2GUOB 4U7SA 4DAGH 4H0IA 5T5NG 5CJ8A 2ZUSA 1MF2L 5B21A 4Y16B 2VLJB 2X4SB 4ODHL 1IQWL 4YK4B 1OAXL 3JTTA 2R4RH 4IRJC 4R90H 3M8OH 3T09A 4YWGH 3MOBH 1QRKA 5CWSA 4WHCA 2PNDA 4AL8L 4G6MH 1D9KB 2DQGH 1VADA 3MCKA 2UUDK 2FJGA 2NYYC 3P40A 1B90A 4I18A 2AK1L 3AM8C 1YC8A 3IJYA 3MACH 4XNUH 4RMRA 1FHGA 3OAZK 4KVCH 4NKDA 3RZCB 4EOWH 4NO0D 5TPWL 1Q0XH 4YNYA 4HAFA 4D9LL 3EOAB 1A7OH 5H35A 3D9AH 4U1JA 4R4BB 2OYPA 4X0KA 3MZGB 3TNNA 2LV4A 4YPJA 4PJ5B 5TDNB 2IWGA 1B2WH 1BF2A 5FO9A 2DI9A 1UZ6E 1N6VA 1Z6JT 4YHPB 4YK4C 5FA4B 2DJUA 1XF4A 5SX4H 2ENYA 4JFOB 2J7LA 2VZ3A 2HVJB 2XZQL 1T0NB 2A9MH 5DMGC 1LILA 3G08B 2RBLA 3GMQB 5CHNB 3NH7L 2EH8H 4UV7H 2FCBA 4X6DA 4NN7B 2EXYC 1T2QH 3RWCB 4OZGA 2GFBB 2P44B 5TDOB 2N7BA 1GGBL 1A7NL 2ESVD 1EV2E 4NOBA 2A6IA 3FFCE 1HWHB 1H5BB 2JB5L 1WCBB 4FQXD 1LWRA 2F53B 1YEIH 4BA8A 4HMDA 4KDTC 4JAMB 4YHYB 3VFSA 1IGIH 2VLKB 2AP2A 3HE7B 5IG7B 3SCMA 3SGJA 1WBZA 1L7TH 2G5RA 4GRLA 4NQXA 4UQ2A 3OXRA 3JBG7 2NTSP 5T3ZH 5D1ZA 5FHBL 4Z7WF 4PUBL 5F3BB 4YPGA 5HVHB 4Q6IC 4ZUSA 1UCBL 5E9DB 3VFUA 4D3CH 1RUPL 1OSPL 2Y23A 4JDZA 1R5VA 1UQSA 4PY7B 4R97C 1I9JL 4UQ3A 4XVSL 3WSQH 3DVGB 2B2XH 5CZVL 1YY9D 3ZKNC 3CX5J 1X5JA 1CLCA 1OD7A 3QZWB 3DXAD 5D93B 4QCIA 4XVTL 5HHOA 2F5AL 3H7BB 5C0BD 5K9OB 3QQNA 2YC1B 4NZTH 5CILH 1KJMB 2F74B 2X1PA 1JZ3A 5E8EA 1GC1H 4PJBE 5JHDE 2AXGA 5L9DH 4JVWA 1JZ4A 1TTFA 1NAMA 1V3JA 1ACZA 2QR0A 5DJYA 5DR5H 5I1GH 3SCMD 1HEZA 1RULH 4KRNA 4XXCC 4JM4L 4RZCB 4WTZA 4B5EA 1AH1A 2WBKA 4JG1L 5ENWA 5GJSL 5I1DB 4JPIB 3ULVF 5DC4B 7CGTA 4M8QB 1XR9A 3LEYH 1DVFD 2IANE 4M6AA 4WVRA 3VFPB 3T0EC 2X4PB 3DURA 5KAQG 1FJ1A 1QR4A 4ZUUA 3U4EB 1AD0A 5TDPA 2FO4B 4BQ8A 4JLRB 4UDTB 4LEXH 4GUPB 2IG2H 3CSGA 1H15B 2HT2D 3C60C 3QHTC 1FNLA 5HYSG 4N8VA 4JE4B 5HHXH 5DDHB 1E28A 3EUUA 3QEGH 2ZUVA 2WP3T 4JO2H 1QYGL 3SGEI 2DQUH 1EJ6A 3ZSSA 3D85D 1KJ2B 4P2OD 1U8OB 2YXMA 1WVZA 1F8TL 3MROB 4FQ1L 3LN4A 3M45A 1FCGA 4YHKH 1JFQL 1UXWB 4M3KB 2X4RA 3L1OL 1Z3GL 1L7TL 1YYLL 2HP4A 1HKLH 4HWUA 3V0AC 4P3DB 4CAGA 1J1XH 4HH9B 1SJHA 5CGYC 3L5WA 4QWWC 2V2WA 2HFFB 4PY8I 3PIQB 4IDJH 3T2NL 4U3CA 4C55A 4PJAE 5GIRB 1MFBL 3U36B 1QEWB 1A1MA 5KSVB 3GMMA 1R24A 5GS0C 2JB5H 2AABH 1UADC 5BOZG 1QVOA 2AV1B 2A74A 2IH1B 5I73C 4KXZI 1PY9A 4OZGF 4TSBH 4FTVA 1UM6H 1YZZA 5DK2A 5HYJD 3HC4L 2C26A 9CGTA 1N5YL 2PN5A 4ZXBD 4CKVX 2R1XB 1AFVL 1DFBL 1GRWA 3CH1A 3QDGD 3CXDL 2CIKB 1FLTX 1C7SA 2VERN 3FZUC 4CNIA 3ARTA 3O3DA 2NQCA 3MLZH 3NPSB 5IEHB 1A6WH 1TFHA 4RFNB 3VXSB 3W39A 3SKOB 4MD0A 4R26L 1W0VB 3MRBA 5L9DL 2H32B 1UH4A 1DVFC 5IMMB 1DBMH 1MCJA 4V1DA 4UZGA 1TPXC 2XWJB 4FQXA 4OM0H 3S35X 4I9WD 3OR6A 5IROA 3RWDA 1HYSD 4I18C 5ITFA 1GC1C 2VXQH 4ZFOB 5C70A 2P42B 1F42A 4L5FH 2XZZA 3RIAF 3LPGA 2I60H 2WK2A 2YZ1A 4KK9D 5MEPB 4OJFH 2BRRL 3TIEB 3WO4C 5DD1H 1J0ZA 3DHJA 2YS4A 5GHWH 4OSUL 3PWNA 5IKCA 4X8JA 4WU7B 2XOTA 3ES6B 4R90L 4YDKH 4HGWA 4MS8C 4JO4H 2DTMH 3RGVC 1U6AL 2XQBH 2H3NB 5EZIL 4PLKD 3SKNA 2CKBA 4NFBA 2VDKL 4XNYH 5DJCA 5CSZA 2YEZB 4QTIL 1D5ZA 5AZ2H 1NFDA 3QFJA 4M7JH 3TBVB 3O6FB 3IRZA 3OWEA 3FT3A 2NR6C 3DV4B 3GSOB 3IFLL 3L5XH 1NGQL 1T04A 5KSAC 3DVNA 2Q8BL 2W59A 1NGZB 3ILPB 4LEXL 3BISA 3U7AA 1ULVA 2ADIA 4YHOL 1RZKH 2AK4D 4YHNB 1BHGA 1A5FL 3TZVD 4WU5A 3E2HC 2DQCL 1ED3B 4UNTA 4APQB 5KSBA 5DRNA 4I3GA 3WFBH 1RHHB 2PTVA 1K4DA 1WFUA 2ZUQC 1JWMA 1BZ9A 2VWEC 1VEOA 1FCCA 5K9KA 2C1PB 5C08B 4GAYA 1CFTB 4R8WH 5LXGH 1XR8A 1CG9B 5AG8A 5EULV 1OW0A 4GW4B 4OLUH 4MD5A 2W60A 5EOCL 1NUDA 4YNYB 3QO0A 1BVZA 2Y1VA 3KPRD 4ZS6C 1YEGL 2V5YA 4WI9A 5IJKC 4QOKE 3A67H 1A6VH 1IEAA 1A7NH 3K4DA 5EOQH 1EPFA 4WUUE 2MTPA 3BWUC 2CRIA 1OCWH 2I9TB 4NN6C 3RI5F 1QZ1A 3ZYOA 3MA9L 1IQDA 2D4DA 4XNMA 1JGLL 3LKOA 4NSKB 1CL7L 1IGMH 2HRLA 4WO4D 5M95B 5HGHB 4WI2A 1GPOH 4WFFE 4FFWC 4FQJL 3QXAA 3BYTA 1U2HA 2P8LA 4UOW0 4BSVB 2EEBA 4JHWH 5TQ0H 5MHSD 2HJKB 7FABL 2X4UA 5CHNA 3PUCA 8FABA 1UCTA 2ZCKH 4X6BA 4RCAA 3O45B 5T3XE 1NBVL 4OQ1A 4WY7H 2X9XA 5I30L 2F19H 5TDOA 1NSNH 2CDEA 4OLEA 5AAMA 5I75C 5EWIL 3R0NA 3JV6B 2FBJL 3MBEC 3ULSB 1U8LA 4U1SA 2IAMD 1T2JA 1Z9MA 3L3JB 5DYOB 5GHWL 1CDUA 5C09A 3QIUC 2HT4D 5TF0A 4AMKL 5CJ5A 4YUEL 3RTQB 2MSPA 3QT2A 4XPTH 4AZ8A 3EFFA 4HUXA 4EBQH 2I26N 3L5HA 1I3GL 1G7MB 1QACA 1RUAH 3UZEA 2WWMC 3HE7A 1A64A 2CPCA 2Z93B 4ORGB 2ADJA 3MV8B 3NN8A 2GTWB 3TO4B 4YUEH 4KHTH 1B0WA 2ICEB 3M8OL 4O2CA 4NQDB 5FYLH 2IBBA 4G3YL 1VEPA