1KT2A

Crystal structure of class ii mhc molecule iek bound to moth cytochrome c peptide
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
182
structure length
182
Chain Sequence
IKEEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFASFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGEPNILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLTFLPSTDDFYDCEVDHWGLEEPLRKHWEFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class II histocompatibility antigen, E-D alpha chain
publication title Structural basis of cytochrome c presentation by IE(k).
pubmed doi rcsb
source organism Mus musculus
total genus 36
structure length 182
sequence length 182
chains with identical sequence C
ec nomenclature
pdb deposition date 2002-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kt2A02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 1kt2A01
1OHQA 2P1YA 4AQ1B 5DURB 4MJ2A 3CFEB 4JDZA 3CDYA 2BNUB 5J56B 3JUZA 1NDMA 3EKCA 4PJGA 5FIEA 4GKZA 1KIQA 1VACB 4X6DE 5GS1C 4E42B 3RIFK 5C7XH 4QXGH 3G04A 4UDTA 3T4YB 3BPLC 3M07A 1C5BH 4R96A 4YHML 1G6RH 3MA9L 1ZHNB 3T65B 1CXKA 3ARED 1CI5A 2VR4A 5MEND 3VW3H 3KYKH 5T3XL 2A6JA 1PFCA 4U1JA 3PGCB 1QHOA 1BJMA 1PG7W 1EV2E 3EO1A 1BD2A 1XCQA 2DLFH 1REIA 1BQHA 3RVVC 3HE7D 3GKWL 3MYJA 1WK0A 1KGCD 1F4HA 5DQ9A 1I1RA 1YECL 2OSLA 4WU5B 4X0KA 5ISZA 3CSGA 3SN6N 3LN4A 4GRMA 3LQAL 4P4RA 5IVXF 2E9WA 1QR4A 5J13B 4GMSL 2VDPL 5IR1B 2P5EA 3TT3L 2XXCB 3EYVA 1XGPB 3QXDB 1UKSA 1E4WL 2PXYA 3JWOL 5F7LB 2IGFH 5CS7A 3RWGB 4PJ8C 4XTRC 4CNIB 3U9UB 5JLZA 4IIQA 5J57B 4NQSB 4LVEA 4ODVH 3W0WD 1XH3A 3BIKA 3IAGC 4TVPL 3LEXB 5I6XB 4OZHE 1K85A 3MXWH 4Z5RA 2RR3A 3H9HA 3UJIL 4HG4K 3BDBA 3TJHC 4WFHD 4Y5XC 4LQ1A 4MD4B 4QXUH 3LKNA 3ARTA 1NMAH 3VXMD 4KY1L 1DQDL 3VGDA 4RFEB 4OM1L 4HW6A 4X6DA 2D03H 1U91A 2FO4A 4P23A 1KPUA 3G5XB 5T5NG 1YQVL 4ODSL 3T8XB 1N6UA 3S36L 3PWVA 3DV6B 4HIJA 2DM4A 1BIIA 2F5BL 2AV1A 2VXUL 3C8KB 3QJHA 2CXGA 4HKBB 1HHKA 1QNZH 1SY6H 3KNBA 2I60H 4Q6IA 5I19L 1MIMH 3DECA 4EN3B 4G7YL 5AYQA 2DTMH 1OSZB 3D39B 3N9GH 4PRDA 4XCEA 2RB8A 1OGAB 4LLQB 4LLWB 4LEOA 1OPGL 5I1IL 1K3IA 3FRUA 4WCYH 4NN5C 4ALAL 4PJCB 3CK0L 1FC1A 3IDYC 1MCEA 4O9HL 1MHCA 2N7BA 3LCYA 4PFEA 3SKNA 3K7UA 4EVNB 2V5TA 3UBXI 3TO4C 1KYOK 3FO1A 5DJ2A 5BRZD 1HHJA 3VGFA 1ZLWH 2J88L 4GG8A 5LWYH 3S37L 3KAAA 3GSUA 3MLWL 1KTLA 1IM9D 5DJ0B 4K3DL 5L9DH 2X1OA 4HGWA 1JMXA 4Y2DB 4WW2B 4DKFH 2VZ3A 1U3ZA 2PUQT 4HUUA 1IGTA 5HGAA 5EO0A 4M7LL 4OZHA 3WO3B 4CMMA 3NBNA 3NCYP 1HKLL 4JHAH 5F9WC 3UTTB 1O0VA 4IS6B 2KUTA 3H3PL 2PR4L 3T0EE 3R06B 1G7LB 3O2DH 1A7NH 1RSFA 4P59L 5I1GL 4GAYA 4JVWA 3MOQA 4L29B 5E2VH 4KK5D 4DZ8B 3MV7D 4HH9B 4P2QD 3BE1L 4KROC 4XVUC 4LU5H 4JO2L 4ODXB 4JDTL 2ZCHH 2GSIB 1T7VA 4JDVA 5HHOA 5C0AB 5T3ZD 4ZTPH 3WXVH 4Z7VE 5BZDA 3QNXA 3V0VB 2FD6L 1M05A 3CSBA 3TPUA 2X2YA 3WHE0 4FQPA 1BFTA 2DIAA 3DIFB 3HI5L 4K3GA 5CINH 5D7IE 4JN1L 3E3QE 1R3LB 5HVFB 1DR9A 4JZNA 1A9BB 4UTAL 5DEZA 3UTSA 1U2HA 1C16B 4NM4L 5AYUL 3QQ3B 1BZQK 2NW2B 5DD1L 3C2SA 2VAJA 5INCB 5I1HH 5AWNL 1FC2D 5ABDE 1OOAA 2ADGB 2P8PA 1ZA6B 4PJGF 2IANB 4QHLB 3WN5B 3ARFB 5D1QA 4DGIH 1JRHL 4RAUA 3VJ6A 4S1QL 5FF6A 1ZT7A 3C6LB 2VXVL 5JHLH 1NAMB 1P7QD 1SYVA 3GO1H 4WRLA 4L3ED 3U4EA 3VXUA 3ZE1E 4MNGE 4DKEL 3CPLA 1MLBB 1X3DA 2BK8A 4TOYL 1RFDL 1IQWH 1Y6MR 4P23C 3ZO0A 3FFCE 1S9YB 3MREA 5F44A 5TDNB 4LFHD 3HB3D 4YC2B 4WY7H 4WFGE 4NQCE 5D5ME 4S1RH 1TVHB 1IL1A 5DK0A 1ADQA 4G6FB 1UM5L 4FFWC 4N0UE 4Q6IC 4JHZA 3P9LB 5CEYA 1J0HA 1OD7A 3KYMB 2FJHB 4DN3L 2V7HA 3WFEH 1ZS8B 4OIIL 4PJEA 2DF3A 3MLVH 4OZIA 1NFKA 4QXTB 2HT2D 3NZ8B 4ZODA 4DTGH 3STBA 4F80A 4JHWH 3ARBB 1IFHL 4BKLB 3FQXA 4HWBL 5DURD 1NAKL 4J3TA 1AIFA 1UH2A 1AE6L 3M8OH 4XNZC 3HZMA 1S7UB 1XGQB 5DJAA 2NTFA 4M7KL 4Q2ZA 1YY8B 4KRNA 2Y7QB 4ENEC 3BSZL 4YDKL 1PLGH 3KLSA 2DQDH 3CVHH 5MEOB 2V2WB 3DVFA 1DFBL 1CVRA 1K8IB 1N5YL 4I5BB 3DUSB 2DQHH 3VFGL 1AGEB 1UENA 3VA6A 5GS2D 1MQKL 5JPNB 4XNYL 2G5BB 4WTZA 4HHAB 4P2RA 1QFUL 3FFCA 4U1NB 4YXLH 3CFCL 5DJ8A 3N1QC 1CR9L 1GGBL 2OCFD 4ZFOL 3NCJL 5A16A 4L8SA 4TN9A 4QNPF 2ZOKB 2J4WL 2BHYA 1XF5B 3U30C 2Y6SD 4RQQA 2E6PA 4MNHB 2CDFB 1ZGLA 4QRRE 4Q0XH 4M93B 3KJ6L 4LP4A 3MJ9L 1HSAB 4TRPH 3PWPE 4XC1L 4PY7B 5D7JA 1PDKA 5DWUL 3L3JA 3T1FA 1BWWA 5F8QC 1RMFL 5FOBB 4KKCC 3QHZH 4OZHF 5D1QC 3KYOA 1LE9A 4JPIA 1RZ8B 5HYJA 1ORQB 1RUQL 2XNAB 3L3GB 4OV6F 4QHNA 3MLRH 1LP9A 1N0LA 1KCSL 4F9LA 1JPTH 3O4OB 1EGJA 4C54A 5J9PA 5IF0A 4WNQA 4FQIL 1UH3A 4KAQL 2A74B 5HTSA 4G9FA 4U6VL 4HKXA 2R1WB 4XPGL 5CJ5A 3EDKA 2HYMA 5HDOA 4PJBE 3V0WH 3MO1B 4EN3D 5I15L 1ACYH 3K2UL 2OL3B 1WZ1H 2R39A 2VC2H 3D39D 2W9LA 1TQBB 1EX0A 3V4PH 4WUKL 4M5ZH 1T2QL 1CGWA 1OGAD 5C0FB 1F4XL 3PG2A 2XG5A 1N2RB 2EICA 5GGRA 5IHBA 3FONA 5FO9A 4AEHH 3BPOC 3DVNA 4NKQB 3O2VH 2APWA 1DVFB 2JF1A 5DYOB 2ZNXA 4N5UA 1FG2B 5IW6A 1ETZA 1QSVA 3D1MC 1X4YA 3DROB 1NGPH 4OUUB 3TF7C 1IE5A 4XGZB 5K59E 1K3ZA 3B8YA 4R26L 3KHOA 3O6LL 1LEKA 5F89A 3BDXA 1NCDL 1FORL 3GSQA 2CUHA 4JM4H 1JYNA 4Y2DD 3VGGA 1MRDL 2ZUSA 2E9BA 4ODTH 5TDOB 4KRLB 4NN7C 2LU7A 5EULV 3P4LA 3UTTD 4R2GB 4JJHA 4LPVA 1I9EA 3CFDA 3MMEA 1NFDA 5DJZB 1TPXB 5CJQH 4LBEB 3TT1H 4HWZA 4OZFA 4F8TA 4X5XA 5E2UL 4HD9A 3L5IA 1YEIH 3B6SB 2XQYG 3CFKA 1IC1A 4D8PB 5LXGH 5C0AD 4U7KA 1XGUA 5JORB 1G9EA 3DWTA 4JFFA 4PP1D 3VH8G 4QRPE 1QSEE 4FXKA 1P9MA 1GAFH 1LILA 5DJDB 5FDWB 2Y72A 1K8DB 3P9MB 3GJFA 4PJEF 4KJWD 4OZIF 3DO3A 3HNVH 2KH2B 5K33A 4YLQT 2YZ1A 4UT6H 4F2MA 1OY3B 1BBDH 5F1SA 2LU3A 1FCCA 4L8SC 2IPKB 2K9UA 5DJ6A 5C0BE 4GMTL 3LHPL 4X7EC 2ADJB 3EYSL 4HJGB 1T7XA 3RVWD 4AJ0A 3I3EA 4XI5D 2FJGA 4FZEL 1AGBA 1ZKAA 5HDLA 4HQQL 2JJUA 1TZHB 4HDIB 3ARFD 5HPMA 2PNDA 5IFHH 2XWJB 2AGJH 4ZFFA 1QBLH 3C6LD 1J5OH 4O5LL 5D7JC 5DGRA 1RU9H 1BGXH 4ZOEA 2Q7NA 3W39B 4N0FA 3HI1B 2EYRA 1ND0A 1EDQA 2BOCB 4UQ2A 5FKAA 4BSWB 4EZMA 3WFHA 1FNEB 5DEFB 4YUEH 4ZYKB 3SOBL 3DBXB 5HHMD 4LCYA 4JY6A 4UTBL 1B0RA 1C5CH 1CE1H 2A9MH 4JZJA 4F9LC 2Y06H 1MRFH 4HK0B 1JWUA 2HWZH 3W2DH 4G6FD 4X98A 5GQBA 4L4JA 4OGZA 1U92A 3MJ8A 1CGVA 1S3KL 1JGUH 4H1LA 2FECI 3BDYH 4LNVA 3WFZA 1JNNL 1MI5B 5GZND 1VGKA 4NNYA 4BQ9A 4Z0BH 2B0SH 2BRRL 2UVFA 1IGFH 4LSPH 3WKML 4WFFE 2J6EA 1KEGL 4WW1B 2ZG2A 3LMJH 2QSTA 3H3KA 1T2XA 4L8CB 1NBYB 3OL2A 3IXAA 4G7VH 4X99A 4Y4FB 2AKRA 5ILTH 4GAGL 1PSKH 2EEDA 4KRPD 1WBZA 3MLSH 4Z0XA 1ORSB 1V8HA 1BAFL 3L3KA 4G6ML 1QRKA 3L9RA 5DI8A 2AJUH 3QUKA 4X4ZA 4PRHD 4KKAD 3OPZL 4BSVB 4NO0B 1VERA 3SDAA 4JFDB 4C83B 1DBJL 5E1AB 3G6AB 3QI9A 4MHHG 5F7FA 3IFPB 4M6NH 1LP9F 5J0BA 4KUZH 4XNXL 1GZPA 3DX8B 3WKNA 5DD5L 2IPUG 1BX2B 1DQTA 3KPLA 3W82A 1TVBB 3FCTB 3RNQA 4HXAH 3L1OL 2A9NH 3QSKB 4YHLH 3UJTL 4CL7A 4GQPH 4OZGA 4WI8A 3ZSTA 3HZKB 3IB4A 1UT9A 2FGZA 1AY1H 4P9MH 1NEZB 4XPBH 4GXUM 3DMMB 1IKNA 1DBBH 1XIWA 2OM5A 4GLRI 1P9MC 2E6QA 3BVNA 3OKEB 1OM3L 1LGVA 5JMOC 1YPZE 3F7RA 1IJ9A 1Z0MA 2AJVH 3R1GL 5D1ZD 3V7MA 1MWAL 4YIQA 5IFJA 4P3WA 4IRJB 4D94A 5CEZL 4OCSL 4AEIL 5I8CA 1TXKA 3MRBB 5LAXA 4I0CC 1KJ3H 1F6AA 3MJ7B 4ISVB 3WO4C 2RFXA 1FH5H 1WIUA 1ZHKA 1T22A 5DK2A 4JPKL 5I73B 5JR1H 1G7QB 3GK8H 2ZSWA 1HH6A 4H88L 5JZ7C 3U4BH 4MA8H 4DVRL 2YRZA 3MV8E 5HDQH 1B0GB 2BVPA 1AXSB 5D70H 5D1XB 5JHDE 1GGUA 1NFDF 2AABL 2NY2C 4LCCB 4OLVL 4KV5E 1IGYB 1YYML 4MJIB 1ZVYA 3BRGC 1T20A 3K1DA 3UZEA 1HXMB 3IDJB 1T04B 4OAWA 4YHOL 3QO0A 4ZD3H 5E8NB 3VFTB 1JNHA 3WBDA 2M26A 5HVWA 3MRHB 4JZJC 3MA7A 2IG2H 3E6HA 4NQVB 4RISL 1J05A 3REWA 1UA6L 4NT6B 5DGQA 4BFEA 4YX2H 1LE5A 4OLZH 2DQEH 2EDHA 5JUEL 3SDXA 1I8IA 3FB6B 1HNFA 2R23B 3AROA 4MS8C 4B7LA 1JGDA 1I7TA 1DVFD 3IS1X 1W0WB 4OCNC 3GSRB 3DRTA 3BZFB 1Z3GL 1RJLB 1S7SA 3BZDA 5DD3H 1BOGA 3VFMB 3V52L 4JQIL 2AXFA 1QLEL 2CIKA 1II4E 1TITA 1J10A 5TQ0H 3WFBL 2EH7L 4P5MB 1KEMH 4HWNA 1PW3A 3F7YA 3U46A 1ZMYA 4HK3N 3WLBA 3KPSA 3ES6B 4JY4A 5IMOA 5K59F 1H5BA 3OJMB 4H8WC 4NCC1 5D7KD 1J7VR 4FXLA 2VDOH 1B3JA 5C09A 2A6DB 1FSKB 3F7PC 4XMPL 3ILQD 4LVHB 3QRGL 5KANG 4R2GD 1RHHA 4KTDL 5E6IA 2EDNA 3D0VB 2BVOB 1YUHB 3W5MA 1CN4A 3SDAC 3MV8A 4QY8A 5DRWA 4ZS6D 3CDGB 5K9JH 3QI9C 3QG7L 2K7QA 1FVDB 3HMXL 3X12B 4AIZB 5FCUH 3S4SG 4OD2A 1Y6NR 3RDTD 2ZKHL 4JRXA 1JIBA 2XFXA 1E6OL 2BX5A 1B6DA 2Q7YB 3DO7A 3U7AA 1F4WL 4M48H 3RVTC 3O8XA 4NC1C 4ZFGL 8CGTA 4Y4HB 1FLTX 4ZDHA 3VDAA 5DFVC 1A6WL 1IC7L 3O4LA 4FA8A 2BSED 1RUPL 3VFPA 3CD4A 4K07A 2YPKA 1GC1L 4PJAA 4QHMB 3C5JA 1IKNC 1XIWC 4UI2A 2R4RH 4EI5A 1M7XA 2R29L 1A1OA 3WUWG 2ZZUT 1IGML 4GRWB 4Z76B 2DQFA 1A02N 4LKCA 3CFIC 4Z7UB 4YHPA 3HG1A 3IU4L 5DR5L 5KZCD 3A6CL 4LDOB 3TA3B 2OQJB 2I27N 1RURH 5CGMA 3N85L 3A0OA 3MUZ1 3F58L 3MROB 3PWNB 4ELKB 1JZ7A 4RRPA 4H20H 4M7JH 5FGRA 3GSVA 1CFSA 2E27L 1MFBH 2GK0B 1U8HA 5DUML 4U6XA 3MRFA 5T1LB 4P9HC 1OWWA 1NLDH 1EGJH 2GJZA 2HT4D 4DQOH 1W8NA 4GRLA 1JPST 4U33A 1NCAL 4R7NA 4NKOA 2YPLB 1U9KA 1SJVA 4M1CD 4OCWL 2UVEA 5E2TH 4AH2A 7FABH 2XZAL 3Q6GL 1GIGL 5C0EA 3LIZL 4PJ5B 1U8KA 3DARA 1J8HB 4P46D 2APFA 3BD4A 1QFOA 4FQ2H 4OZGF 3MRCA 4K23L 5J8OA 2HTKD 2L4OA 3EJZC 1MI5D 5EBLB 4MMXC 4JFYB 1JYWA 1JMZA 2NZIA 5FYJD 1QYGL 3FRPA 2YMXL 5C0IB 1KG0A 4U1MA 3MRMA 2GUOB 3Q6FA 3SDDB 1U8OB 4HIXH 1CFVL 3LAFA 3F65A 1FGNH 4Y4FD 3QPXL 5B8CB 5CEXA 1D5IH 5GGUA 4XP9H 2GSGA 4FS0A 5A2JH 1A3LL 1FO0B 1KPRA 2DAVA 4EOWH 3PHOB 3BMWA 2F5AH 3KLAA 4H0HB 1JGLH 3RWJA 3FMGL 1H5BC 3ROOA 1BQHG 4OZFH 1YJDC 1B6UA 4NO0D 1LK2A 5D2NB 1CG9B 2HRLA 4N1EA 5B4MC 3BWUC 5BV7B 5E6IC 4U7MA 5IV2B 4MXVF 4QWWD 3GI9L 1U3HA 4TUKH 4KQ3L 2GJ6E 3P4OA 1KFAL 4KWUA 3MGTB 3GJFH 2ZSVB 2VSCA 3KR3H 1FL6A 4LPUA 1S7TA 3TIDB 3GBNH 3SJVE 4L9LA 4DK6A 4NHUB 4UOW1 3O8XC 4H0IA 5DO2D 5TF0A 3SDXF 3C09B 5ACZB 5E5MB 4GBXB 1I7ZA 5DLMH 1SYSB 2CMRL 2V2XA 4MD0A 4AG4H 1T7YA 1I3VA 1JV5A 3EDFA 3WYRA 4IRJD 1D6EA 2DJSA 3O3EB 1CE6B 25C8L 4EI5C 2VLLB 3IDIA 1JHKH 4O02H 2XRAH 5I1DB 2ZPKL 2VABB 5ADPL 1N6QL 2EIZB 3V5KA 1I1YA 3ARXA 3M1BA 3D9AH 4IDJH 3GMNA 2PO6A 2Z91B 2ESVA 4WI6A 1IAIM 1IQDA 4HUXA 4DUWA 1S8DB 4MAYD 4JZOA 3I9GH 1RK0B 1ZLVK 2UZIH 2EDYA 4FQXB 2BVEA 3VGAC 1B0WA 4Z7OF 1NFIA 2Z93A 3BGAA 2BNRB 4GRLC 4RMVA 2MKLC 5D7LE 5AEAA 2B5IB 3JTSA 4MVBC 3EOAB 4H1LH 5J6HA 4MX7B 4HIHB 5C0DB 2VDKH 4FQHA 3VRJA 5C7XL 5IWLA 4QXGL 1MCRA 4J7RA 1J0ZA 2EDBA 1F00I 1R5WA 1U8MA 1NMCC 3ZL4H 1C5BL 2WM0A 2GJ6A 3LSOB 1G6RL 3T0DA 5GHWH 4OUOA 2P46B 3FT3A 1EXUB 5IB2B 1VEPA 3KYKL 1AO7A 3VW3L 4U1SA 2NYYD 3FO0H 2F54E 4FG6C 1CK0H 2GFBA 1A64A 2UUDK 4PJAF 2NNAA 1HI6A 4H8WH 1JGEA 2KDGA 4L8BA 3IETB 2DLFL 5GZOC 2IFFH 2Y5TB 4ODBD 5IFAH 1AFVH 3F7VA 1J1PH 3K4DA 4N68A 2W65B 2JCCA 1XR9B 1FVEA 1T1XB 1JZ8A 5J1SC 4XH2A 2MQ0A 4DKAA 2XXMB 2AJSH 2R15A 2Z8SA 1U8QB 5B3NA 2VL5A 4X6BA 3ZE2E 1KELH 5KJRH 2IGFL 4OGAC 5HI5D 4QRSB 2BSTB 4E41A 1Y18B 1D5MB 4G8IB 3B9KA 4ODVL 3O3BA 5EIIA 3HRZA 5FK9B 4PLKD 1H0DA 4MXQD 3MXWL 5FDYA 2DD8H 2A73A 4M9OA 4DOHE 1KB5A 5TGBB 1G6VK 1W72B 4BH7A 4QXUL 1EHNA 4WFED 1NMAL 3MOBH 5GRZA 1IM3B 4ONFH 3RBSA 3QYCA 1FZJB 4MQTB 1MCDA 2D03L 4Y4HD 4M43H 5I1LA 3H2WA 4I48A 4H26B 2A0LC 2OP4H 4ZOCA 4RBPK 1CFQB 4PV8B 2C4FU 4L9LC 1X4XA 4EQ2A 4GLRH 3M17A 1QNZL 1SY6L 1HOCA 2C7UA 1RULH 2BNQB 2F54A 2I60L 1MIML 2JB6A 5E08H 4WO4A 3IGAB 3M45A 4P9HH 5E2WH 3RKPA 4KK6D 4WI4A 3E6FB 2DTML 4B7IA 4PV9A 1T0PB 3N9GL 3MRPA 3VG9B 2ITCA 4ZSOA 4N5EC 4S0SD 5IMKA 5AUMB 4Y1AB 3R4DA 4CN6A 4WCYL 4IOIA 5DS8A 5T1LD 3C5ZB 3FN0H 5L7XH 3TYFB 5GRYA 1FAIH 2F15A 1DN0A 4GW1A 2PO6C 2YPLD 4LLYA 4F7EB 5I1CH 4TYUA 5LWYL 1VFMA 1UVQA 1MIEH 3OAZH 4K94C 4F15C 4Z6AT 2P44B 5L9DL 1KULA 3CXDH 4DN4H 2XKSA 4DVBB 3SKJH 1M7DA 3SGDI 1IAOA 2G9HB 3TJEH 4X7CC 4PJ5D 4DKFL 3KPQA 3IF1A 3EZJB 5J3HD 3RI5F 3BGFB 4JHAL 5IWLC 5DEGA 4HUWB 4U49A 3MV01 4ZPTA 1RVFH 5I1JH 3E8UH 5D8JH 1M1SA 4HPYH 3S3SA 3L3IB 5J12B 1MCWM 3O2DL 1A7NL 1FZOA 2LAAA 2NR6D 5E2VL 4PLJC 2VITB 3FQUB 1MHEA 4LU5L 1NGYA 4U6YA 1JZ6A 2VLJE 3ZLQC 4DAGH 1JZ2A 3SDDD 2ZCHL 3FAWA 4ZTPL 3WXVL 2D0HA 4DK3A 2X1PA 3UC0H 1X4ZA 2JJSA 1PEWA 2BCKB 5E6YA 2ZOLB 1UKQA 4X6CE 4YEEA 3G9VA 4R0LA 5MENE 5E95B 5ENWB 3ULUC 1G7MB 5CINL 2J8UB 3HR6A 1L9NA 4WTZG 1EBPA 2IALA 4JFXA 4NN6C 3G5ZA 3ESVF 2ATKB 4PRID 3RUGB 3LV3A 4UAOC 5EH1A 1QSFD 5K93A 4QTHB 1KGCE 4HIIB 1SM3H 5I1HL 1HE7A 1AR1C 1A6VH 1UH4A 5DC9B 5AD0B 1NJ9A 3OR6A 4MA1B 5E8OA 3L5WB 4S11A 3B9KC 1QEWA 4FMKA 4DGIL 2XWBA 5JHLL 3QFDB 3GO1L 5T1DH 1A4JA 3HNTH 1NH6A 4BQBA 3P11H 3PDDA 2A1WH 3SGEH 4WEMB 3Q2CA 4EUPB 2D7OA 3BH9A 5EZIH 1L6ZA 3IDGA 1IQWL 2CLZB 5CCKH 5K9KA 3W0WE 2Q6WA 1Z9SA 1LO5A 4WY7L 3U1SH 3H6JA 5I74B 4S1RL 1EMTH 1ZWIB 4AT6B 1JL8A 2E8ZA 5J11C 5IBLC 4HS6A 3VXME 4H25B 1PJ9A 4S1DC 2JCCF 1KJMA 2X9XA 2RIKA 4KMTH 4XWOC 3ULUF 4J3UA 4WO4C 3KPPB 2HJKB 1F8TH 5D93C 4NO3B 4Q97A 3WFEL 3T2NH 3RQ3A 3MLVL 2QQQA 3AREA 4X6CA 5HGGS 5MENA 1RUAH 1GHFH 3FQNB 4X80H 1UZ6F 4J3VA 1L0YA 4DTGL 4JHWL 3RKDD 2FJFA 2GAZB 2UV3A 4FQXD 5EU5B 1WWWX 5DRNB 5H94A 4ZQKB 1DDHB 4RGMB 5ICYB 1GGIH 2BNRD 3MUGA 3M8OL 5I66A 4PS4H 3HE7A 4PJ8B 3GBMH 5A2KH 2HLAA 2QR0A 5EU4A 4FQJH 1UJTA 1PLGL 1MAMH 2DQDL 3CVHL 5E7FA 3ARSA 1LEIB 4XPHH 2WWMC 1HWGB 1KT2B 1WF5A 2JB5H 1NCWH 2DQHL 4C56D 3VU2A 5BRZE 3L3OB 2FO1A 5CSGA 5D96C 4U0QB 3IKKA 4LSUH 3T0AA 4KQ4H 4A6YA 1BJ8A 3RVUD 2A6KA 5C9KA 3FOMB 3FQTB 3SKMA 3VI4F 3W0WA 2NY1C 4YHYC 2Y36H 3VFUB 1WISA 4POUB 5DMIH 3OKNB 4XXDB 4YXLL 2BVQB 4KFZC 4IRSB 1W2KT 3VXMA 2R2HB 3L3HA 1PX4A 4HC1H 2NXYD 4LSQH 4OZFG 4NRXB 2IC2A 5DXWA 2JJSC 4OFDA 3MCKB 2DLEA 3QZWA 5F7DA 3AMKA 1I7UA 5A2FA 4P2QE 2PW2B 1LHZA 3GIZH 3PQYB 4TQEH 2FIKB 4CVZA 1ONQB 2P24A 4NN5B 1TVDA 4U1GC 4O2CB 4Q0XL 4YDVB 3B5HA 3SO5A 1CD1A 3B2VH 3T77B 4TRPL 1FJ1A 3L3DB 5ICXB 3QIUA 1FNHA 3SCMD 3QEQB 4DKDC 1F90H 1FL3B 5GSVB 2DKSA 3H7LA 2G2RB 4UINH 3UZQA 3W9DA 2Q3AA 4W81A 3QHZL 2OI9B 1NGZB 1OP3H 3KXFB 1YC8A 2VISB 3MLRL 4M1GH 4K8RC 5ITFB 3CZFA 1JPTL 4OLEA 3ULVE 3QWOB 1Q9WA 1MAJA 5FGSA 2BNQD 3VXTB 3V0WL 1N5AA 2JK5A 1IM9A 5C0RH 1ACYL 1WZ1L 4KH2A 2VC2L 2DYPB 3VE0A 1VESA 3V4PL 4L3EE 3QCVH 3GJEB 4M5ZL 5SWQB 5A3ID 2R4SH 1JHTA 4U7SA 1FFNB 5DHVH 3TM6A 1LEGA 3WL9A 4Y1AD 2WWKT 2X1XR 4AEHL 4K94H 2CO6B 3ZKND 3O2VL 1HINH 2YA2A 3KPOB 1K9TA 3C5ZD 4ONHA 2CRZA 3PHQB 4YFDB 3X3FH 1N7MH 4LLMA 2NMSA 2NZ9D 3AREC 4W4NA 3VXRB 3RJQB 4F3FA 1NGPL 3U6RA 3MV7A 2Y4SA 1MFEH 1EERB 5CBEA 4P4RB 4H1LG 4Y16B 1OTUD 1ZLSH 3CCHB 4BFBD 4XNUH 4FQ1H 2AK1H 1KF9B 4ODWB 5I75B 4JM4L 1JGVH 3HE7C 4JFED 4ODTL 1A7RH 5J1TC 1OP5H 4GAJH 2YOCA 4QEGA 3SE4A 1JF1A 1XGRA 4YHIA 1CS6A 4J3WA 2XA3A 4JJ5A 1W0VB 2UZYB 3FO2B 4F33A 5CJQL 1DSFH 3TT1L 1NPUA 5JW4R 2BMKB 2Z4QB 2X4QB 5FECA 3ULUH 1ZVSA 1UM6H 1EJ6A 4LCWE 1YEIL 5JDSA 4XVSH 4NOFA 1MNUH 5LXGL 5EO1B 5TDPA 3QAZB 3GFUA 1T03H 3B3IA 5F6HJ 3BP6A 4MSWA 2YD9A 5EN2A 1QR1B 1GAFL 1P7QA 2C1OB 4L3EA 3EW3B 3VMPA 4L3CB 1AJ7H 1OP9A 1VSCA 2JIXB 3V6FB 3ZDYF 3HNVL 5DQJB 3H9YA 4UT6L 4APQA 1BBDL 4M02A 3LKPB 1AHWA 4ESKA 1E27B 5GSRB 3GSXB 2AI0H 4YBQD 1YN7A 4UNTA 3QO1A 1JWSA 3UPRA 1KB5H 5HYSA 1XF3B 1EHAA 1I4FA 3V5HB 5HHPA 2X1WL 3GMLB 5IFHL 4WHTB 2CPCA 2AGJL 1QBLL 3QIUC 3I6GB 2WBKA 5HBBA 1J5OL 2BOBB 1RU9L 1BGXL 1N59A 3O6FB 1V05A 4WGVB 3GHBH 1WLHA 4PGJA 5C9JB 5DHXB 1YEDB 2P45B 3EJJX 5E99H 4YUEL 3BEWB 2GI7A 3RX8A 1I9IH 4XHQA 5C07E 1UADC 3CFEA 1I3RB 3O3DA 5L2JB 1C5CL 4ODHH 1CE1L 2V9TA 2A9ML 2BNUA 1LO2H 2Y06L 1MRFL 3VXQB 2HWZL 4R97C 3W2DL 3UPAA 2W0FB 2OXHA 1HHGB 1YY9D 2R1YB 1VACA 1WC7B 4E42A 1JGUL 2M1KA 3T4YA 3BDYL 3AM8A 3S6CA 3V4VH 4G6AD 4O4YH 1ZHNA 3HZVB 3BN3B 5TJWK 3T65A 4Z0BL 2B0SL 3UO1H 4ZOAA 1IGFL 4LSPL 1A6ZB 3BQUB 3LMJL 3PGCA 3IDMB 4GW4A 4YDLC 4G7VL 2HMID 1A5FH 5ILTL 1PSKL 2YN3A 1IILE 4TNWF 4KK5C 3FT4B 4HJ0D 3U30B 5AG8A 3MLSL 4EDWH 4WU5A 2F9BT 4ZOBA 2JKXA 3PNWB 5I0ZA 2R0LH 3TCXA 1IGCH 2H41A 2AJUL 5FYLH 5K9QG 5KSBE 5IR1A 1XGPA 3QXDA 4HKJB 4NO5B 4NWTH 1CXLA 3AGVA 4CDGC 5LGKA 3RWGA 1M7IB 3SE4C 4M6NL 4CNIA 2YXFA 3U9UA 4KUZL 1MCWW 4NQSA 4MXWH 2YWYA 3K8LA 3X17A 4HXAL 3LEXA 2VYRE 2A9NL 2EH8H 4YHLL 3TIEB 2VN7A 4GQ9H 1ULVA 4IRSD 3BKJH 1A6TB 4OT1H 2DDQH 1AY1L 4P9ML 4MD4A 4XPBL 3N1FC 2NX5D 4RFEA 1VCAA 5HI4D 3T0EB 1DBBL 1PZ5B 3X3GH 3V95A 3I6LD 3G5XA 4LMQE 3PQYD 3T8XA 2AJVL 1IGJB 3B9AA 4JVPA 3DV6A 4F57H 5C0AE 3C8KA 4HKBA 3OZ9H 1AHWC 4Z7VB 1CTNA 5C2BH 4EN3A 4V1DD 1KJ3L 5KW9H 1OSZA 3D39A 3RRQA 1X7QB 1FH5L 2QBWA 4K8RH 4OI7A 3QEQD 4DCQA 1OGAA 4LLQA 4LLWA 5D7IB 5JR1L 4P2CG 3GK8L 3WFDH 2FLRT 4A2LA 4QYOB 3U4BL 4MA8L 2HFTA 2AK4E 3KXFD 4PJCA 2YUVA 5HDQL 2WLZA 1I8MB 5E9DD 5EBMB 5D70L 3DVIA 3LDBB 4EVNA 4EIZC 1T5WB 1ZV5A 1NC2B 2BC4B 4PJ7E 4IMKA 2HT2C 4RRPG 8FABB 2DM7A 1J1XH 1AGFB 5DJ0A 5EIQA 4ZD3L 1BREA 1A8JH 3K4ZA 5F9JB 2DYPD 2YUZA 5FUOH 4Y2DA 3ZKXB 1IBGH 1X9QA 4WW2A 2IG2L 3PWLB 4MNGB 4YX2L 2WBWB 4MCYB 2BY1A 4OLZL 2DQEL 3UTOA 3UTTA 1IEBB 4IS6A 5HHME 3WDJA 1JRHI 3AM8C 3UX9B 3R06A 3P0VH 2YUWA 1G7LA 5DD3L 4NQCB 5D5MB 4LCUB 4DZ8A 1RZ7H 1DQJB 4L29A 4HH9A 5TQ0L 1Z0NA 5CJOH 5DUBB 2P49B 4N0UB 1KEML 4Y16D 4ODXA 5KG9B 2KKQA 5EOTB 2GSIA 3NFSH 1FFOB 2DB8A 5C0AA 4URTB 1ZTXH 3FRPG 3MLTB 3N0PB 2VDOL 3OGCB 3DIFA 1R3LA 5F3HB 4A6YH 3LB6D 1B2WH 4ZS7H 1A9BA 5J13C 1C16A 3QQ3A 3NOIA 2NW2A 5K9JL 5INCA 1O7SA 2Y6SC 5FCUL 4XAKD 1MELA 1G9NH 4V2CB 4D9RD 4Y0GA 4E0RB 1OAZH 2R2EB 4HMDA 3OAYH 2ADGA 3WN5A 1ZA6A 2IANA 4PRHE 4QHLA 3ARFA 3Q5TA 3TH3T 4M48L 2BVUA 3OF6D 5I6XC 3C6LA 5DRXB 1NAMA 3Q5OA 1RJYB 2JIXD 1MLBA 3ECBB 3ZDZE 4GOSA 4H5SB 2R4RL 1YZZA 3MRKB 1S9YA 5TDNA 1INQB 2ADFH 3OV6A 3RGVB 3MLXH 4B0MM 1C12B 2QQKH 1TVHA 3UROR 4FMFA 3RWFB 4M4RA 1RURL 1L4IA 3P9LA 2P8MB 4EN3C 4H20L 4M7JL 5FO8B 3KYMA 2FJHA 1MFBL 2WQ8A 5GXBB 4NNPH 4W4OA 3O6FD 1ZS8A 4MAUH 2W9EH 2LAGB 1NLDL 1EGJL 4DQOL 4QXTA 4QRRB 3NZ8A 3ARBA 4BKLA 3PWPB 2VJXA 5E2TL 7FABL 2MHAB 1CLOH 3PV6B 1S7UA 1XGQA 4IMKC 1QKZH 4GS7C 1YY8A 2Y7QA 5ID0A 4KI1A 4L5FH 4FQ2L 1YN6B 4BYHA 2WLYA 4M7ZC 3TYGH 3RVXD 3ZKMD 1NGWB 1F2QA 5MEOA 4Y2DC 3LKRB 3NCEB 2V2WA 4WW2C 3X13B 2PW1B 1K8IA 4ETYA 4I5BA 3DUSA 3ZE0E 5FB8B 4TTDD 1AGEA 1X5IA 3BQUD 1UCTA 4PJBB 4MDJB 4EI6B 5T3ZH 4FP8H 5JPNA 2G5BA 4HHAA 1F42A 1HHHB 3NN8B 4HIXL 1FGNL 1D5IL 4YPGB 3GJFB 3JTTB 4XP9L 4U6TA 4U1NA 1HQRB 1WVZA 2MNUA 1U0QA 4EOWL 2CKBB 1FYHB 2F5AL 3WXWH 1JGLL 3EHBD 1SEBB 3R8QA 1PG7X 2OTUB 4PP1C 4XPFH 4HLZH 3GM0A 3HNSH 4PJCF 1YEGH 3DV4B 4M6MH 2ZOKA 5JIKA 4JCLA 5EWIH 1XF5A 4KJWC 4UQ3B 1UM4H 3CLEH 4MNHA 2CDFA 1RV6X 4GKSA 1HSAA 3D3VD 3HUJE 4TUKL 2JE8A 2NY2B 4PY7A 1HDMB 5CJ8A 3KR3L 4GUPB 3RVWC 1GOGA 5AG9A 4XI5C 3ULSB 1JPFB 4WUUB 4WW2F 5FOBA 4ZUWB 4YHZH 3GBNL 5DSCA 3WN5C 3ARFC 3T0ED 1KIUA 4M7LT 3VGHA 5DVMA 1RZ8A 1OWRM 3C6LC 2EXWD 3QA3B 1ORQA 3MNWB 4JGUA 3VGBA 5HPOA 5DLML 1GOHA 2XNAA 3L3GA 2AEPH 5D6DA 3UAJD 4OFKA 4AG4L 3KYAA 4AYFA 2A74A 2EDFA 2R1WA 3MO1A 4O02L 1JHKL 1VENA 2XRAL 4NNYB 2VXTH 4YC2C 2OL3A 4QRPB 1QSEB 4LAJH 4QHKI 4JAMA 3VMNA 1TLKA 2FHBA 1FDLH 1JNLH 3LD8B 4S2SB 3J7HA 5C0FA 3RPIB 2NY4B 1N2RA 3LN5B 3D9AL 4IDJL 4IJ3B 4X99B 4F37F 1DVFA 2E7BA 4MMZC 4RMTA 4W4OC 5DYOA 3I9GL 1FG2A 2X6MA 2UZIL 5C0BB 1K4CA 1A14H 2YPVH 1NC2D 3DROA 4OUUA 1M6OB 3BYYA 4XGZA 5CJBA 4NDMB 2IBZY 2RAMA 3EYQD 5DF0A 2VDKL 1S7VB 1FNFA 3ZL4L 5M95B 4WI7A 4FTVB 2D3VA 5GHWL 5TDOA 3BT2H 1DP0A 1MJ8H 3BH8B 1F3JB 5GS2H 2E6JA 4G8FA 3MRQB 5JPMB 3FO0L 1JTPA 5F6IB 5A2IH 2B4CC 1CK0L 4KKAC 5DJZA 4NQCD 1GJIA 4LBEA 4H8WL 2UWEE 2IFFL 5IFAL 1AFVL 2CO7B 4BUGA 1J1PL 1VPOH 3NIFE 4BZYA 3B6SA 3EFFB 4M3JA 3OKOB 4D8PA 2JELH 5JORA 4HFWB 1UB5B 2OS7A 2H1PH 1RZIB 2AJSL 4BUHA 4P49A 5HGDB 5FYJE 3ZKSD 2IEPA 3WS3B 5DJDA 5FDWA 1K8DA 1KELL 3P9MA 5KJRL 4JG1H 3C87A 4DUXA 1TETH 5HJ3B 3WNPA 5T1KD 1GYAA 2IPKA 2P5WE 4B5EA 1G7IB 4WIQA 1J11A 2WUBH 2ADJA 4HJGA 5D1ZC 2DD8L 1A1MB 4HX1B 5F7NC 2XQYK 5E2JA 2NY0B 1TZHA 4J8RB 3RY5A 4HDIA 3MOBL 4ONFL 4NKDB 2XWJA 1CDHA 5I16B 4M43L 4LF3B 3TBTB 5EORH 4OSUH 3W39A 3HI1A 1I8LA 2OP4L 2BOCA 4BSWA 1FNEA 1U8PB 5DEFA 4ZYKA 2KL6A 3MV9E 5IQ7H 3DBXA 1RULL 1MFNA 1MSPA 3E6HB 2W92A 3RGVD 1QG3A 3SKUD 5E08L 4P9HL 2X4UA 5E2WL 4I3GA 3HR5B 5D6DC 1SMOA 1PY9A 3O4OC 3WNNA 4HK0A 4LIQE 3MLPA 2HAZA 2B1HH 3TESA 1TQBC 9CGTA 2IBZX 1YPZB 43CAB 2V5SA 1E4JA 1MI5A 3FN0L 1LMKA 1QACA 5L7XL 4KI5E 3CXHK 3LEYH 1FAIL 4NKIH 2MMXA 1T0MB 5I1CL 4WW1A 4QT5B 1DVFC 1MIEL 4PBWD 4L8CA 1NBYA 3MCLH 4HEPG 4YWGH 3CXDL 4Y4FA 4DN4L 4KKLD 3SKJL 4XNQB 3RPKA 3QDMB 1N64H 3TJEL 4MD5B 1NBVH 1WTGT 4N8VB 1ORSA 4OKVB 4Y4KB 3B2UD 2FX7H 4HGKC 4OQTH 3S34H 3FZUD 2CIIB 1QVOB 4MJ4A 4Z9KB 1RVFL 3CC5B 5I1JL 3E8UL 5D8JL 4HPYL 4BSVA 5JHDB 4NO0A 2AEIT 3BPNB 4JFDA 4NQTA 4ZAKB 5E1AA 3G6AA 1ZLWK 3ILQC 2WQRA 2COQA 3IFPA 4R2GC 4X8JB 3WDHA 3LKOB 3ZDXE 1BWMA 3OB0H 3DX8A 4DAGL 1BX2A 1TVBA 4KDWA 1TPXC 3FCTA 1WFNA 4HXBH 4ZS6C 1OSPH 4MB4A 3UC0L 2C3HA 2W0LA 3TVMB 3C5JB 3HZKA 3RDTC 1I1FB 1NEZA 3V6OE 2FB4H 3DMMA 1UACH 4K7PY 1GRWA 3OKEA 5DTFB 1LO0H 4X4XA 4UOJA 2ARJB 4J4PD 4WVRA 1T4KB 1SM3L 1A6VL 4Y8DC 4IRJA 3IKCB 3QH3B 5D9SB 2IPUK 1T66D 4XXCA 3MRBA 1A21A 4JREB 4KXZI 3QZWG 1Y6KR 3MJ7A 4ISVA 1NAMH 4J3XA 4Z7NF 5SWZE 1T1WB 5T1DL 2C1PB 2VDLH 4LSSH 3HNTL 1MVUA 1OCWH 1G7QA 2XG4A 3GSNB 3P11L 4WUUD 3TBVB 5KVEH 2A1WL 3L5JA 4K7FB 3RAJH 1L6XA 5EZIL 4Y19B 2MPAH 5CCKL 4J3OC 1B0GA 3EYFB 1WITA 1AXSA 4OCYH 3GB7B 5D1XA 1DE4B 3QDGB 4UOW0 1QSZA 1FZMB 4LCCA 1G7PB 3U1SL 2HT4C 2NY6D 1IGYA 3L6FB 3SO3B 1EMTL 3QPQC 2XPGB 3DGCR 4MJIA 1HXMA 3CU7A 2X4SB 1FNLA 1T04A 3IDJA 4P5KB 4M1CC 4KMTL 5E8NA 1DLFH 1QSED 2VDNH 4QRPD 5F71A 1BQSA 3VFTA 1F8TL 1F4AA 3MRHA 3SQOH 3T2NL 3HPLB 4NQVA 2NY4D 4NT6A 3GKZA 2ZUQB 2F53E 4PJFE 2BXZA 1RUAL 2V9RA 3FB6A 3K46A 1GHFL 3BISA 2UZXB 1JI1A 2R23A 4X80L 1SEQH 3V6OA 1OF2B 3S88H 2HTKC 3KLHD 3BZFA 1RJLA 1CIDA 3RJDA 3VFMA 4XMKH 1GGIL 3RWEB 4PS4L 4X4MA 5MI0B 3GBML 1QFWM 1FL5A 4P5MA 3MRGB 2VNCA 2YKLH 2B4CH 3MRDB 3ES6A 4FQJL 1QZ1A 4Y4FC 3MBEB 1MAML 5F7HA 4X7TB 4MA7H 4FTVD 4XPHL 5AZ2H 1FFQA 4C59B 2JB5L 1NCWL 3V7AG 2A6DA 3RX5A 2YPLE 2WSKA 2IPTH 3DJ9A 4I1NB 3LVEA 2EKJA 4HAGA 4LSUL 4OF8A 3D0VA 2BVOA 2DN7A 4KQ4L 3S35X 2OMNA 1YUHA 4ZUVB 1PYWB 2YS4A 4D0DB 1XF2A 2Y36L 3VRIB 4PJ5E 3CDGA 3EO0B 5DMIL 5CUSH 3UP1A 1FVDA 2EKSB 4K7PX 3X12A 4AIZA 3IDXH 4WHDA 43C9B 2Q7YA 2D4DA 1Q9KB 2CUMA 3TBSB 4HC1L 3NABH 3NIFF 4LSQL 4HLZG 4Y4HA 2VUYA 3G6JE 3MACH 3VFSB 4JFPB 4WEBH 3QIWB 3GIZL 4TQEL 2X5PA 4QHMA 3DMMC 4UBDD 5DO2C 3TNMB 1F4YH 3B2VL 4NQED 3D0LB 4Z76A 5DHVB 4Z7UA 5BVJB 1F90L 2NY0D 4IRJC 1CL7H 3TA3A 2OQJA 4XXCC 1TZIB 5L8KB 4UINL 3MROA 3PWNA 4ELKA 3LS4H 3T3ME 3SDYH 3MGOB 2GK0A 4LFHG 4PRIE 1QSFE 2GCYB 3RP1A 3BGMB 1VFAB 2DLIA 2EDTA 5T1LA 5HYSG 2A38A 3BKCH 5I73C 4M1GL 5CP7A 3DXAD 3KJ4B 2XOTA 3MUY1 1MCLA 2CSPA 2D9QB 2AEWA 2YPLA 2OL3H 1FE8H 4MAYC 3ME0A 4XCYB 5C0RL 5D1XC 2G60H 5GIRB 2VWEC 4LCCC 1SBBA 2CRMA 4O51B 3QCVL 3EGSB 5JIHA 4PJ5A 2R4SL 1CDCA 1J8HA 1V7NH 2J7LA 1I1AB 1I7RB 1T0NB 2FYYB 3SJVB 4OCMC 4PRAB 4K94L 4YFLI 4MNQD 1HINL 5CGYD 4NRYA 5D6CB 1O5DT 1WQVT 3I85A 5EBLA 3X3FL 5IK3B 4EIGB 4JFYA 5TE7H 1NEUA 3D18B 4RZCB 1N7ML 1JK8B 5EUOE 1O7VA 1MFEL 5C0IA 3V6OC 4NJAH 2GUOA 1MCSA 3P3YA 3SDDA 4NCC2 1ZLSL 2B1AH 1U8OA 4XNUL 4FQ1L 2AK1L 5B8CA 3K8MA 1JGVL 2WIIA 3QDMD 1RUKH 1FO0A 1A7RL 4Y4KD 3VI3F 4MA3B 1H3GA 4L1DA 5GGSB 5A2LH 4GAJL 3TFKD 5C0JB 3V4UH 4LLUA 4P0DA 4RFNB 5DVLA 3L5HA 4CMHB 5CD5D 1VKXB 2FR4B 3SGJA 2DL2A 1KLGB 2BY0A 4OGXH 5JHDD 1MREH 1DSFL 2BNRE 4LLVB 5D2NA 2X4PB 4UIKH 4ZAKD 5D7LB 1CG9A 1FSKC 3ULUL 3T09A 4LVHC 1UM6L 5HI5C 4XVSL 5FYKD 1RI8A 4NC0B 5IV2A 1MNUL 2JTDA 1U8IB 4OI9A 3T0XA 4JEGB 1A1NB 2DIJA 5EZLB 3ZDXF 1T03L 4CKVX 3MGTA 3V6BR 2EYSB 2ZSVA 4PLKC 4MXQC 4C56E 3TVMD 1AJ7L 3TIDA 4NHUA 1C8PA 2X05A 4NBZB 5D93B 4Y4HC 1KXQE 4R9HA 5LCVH 5ACZA 1I9JH 1DEDA 5E5MA 2AI0L 4GBXA 1SYSA 4OFIA 1KB5L 1FNSH 3A6BH 1WBYB 3O3EA 5DS8B 1CE6A 3BW9B 5JQHC 4WJ5B 4K3EH 4X5LA 2VLLA 1IKFH 4RMRA 3QRFM 4NP4H 4P5TB 5I1DA 4KK6C 1OB1B 2VABA 3GNMH 2QQNH 1ACZA 2EIZA 2CQVA 1AP2B 3GHBL 3ZHDA 3TA3C 1WWCA 1CFNB 4RMSA 4PGEB 5E99L 4Y19D 2Z91A 2BP3A 1FVCB 2VLKD 3CMOH 1X5XA 1S8DA 1RK0A 1I9IL 1OQXA 3QDGD 4FQXA 4ODHL 4W6WB 2EIEA 1VEOA 4Z77B 1HKFA 1R24B 2BNRA 5KOVC 4DOHB 1LO2L 4AEFA 3EOAA 4AENB 4MX7A 4HIHA 5C0DA 1JNJA 2GIYA 2N4IA 5CSZB 5E1HB 5CWSB 5FYJH 2YA1A 4CN4A 1S5HB 3V4VL 3LSOA 1JZ5A 4O4YL 1NGYB 4X8XA 5AAMA 3GUTB 5J3HC 2MCG1 4TUJB 1EXUA 3UO1L 5IB2A 5ID1B 3CDCA 3FB7B 1NLBH 1V7MH 5J1AB 1H3XA 4OIBA 4GJTB 4HUMB 5M94B 1ZHLB 1G0YR 3IETA 1A5FL 3MRLB 2Y5TA 2NR6C 1A0QH 2W65A 4GRWF 4Y7MA 4AM0B 2XTJD 5GS0D 1XR9A 4EDWL 4P57B 4Z7UF 1IAIH 1YQ2A 2W59A 5GRJH 1T1XA 3SY0B 1UWGH 3DHMA 2R0LL 3SDDC 1IGCL 3MBED 5B8CC 5FYLL 4FFYH 1ZT1B 3N06B 1U8QA 4HSQA 2Z35B 4NWTL 1UWXH 5T3XE 3REVB 3PDOB 3WIIH 4QRSA 2BSTA 3SGJC 1Y18A 1D5MA 2XWBB 1KJ2B 3QXWA 4G8IA 4CU7A 4MXWL 2VN4A 1KB9K 4JFEE 5FK9A 3OXRB 2EH8L 3NIDF 4GQ9L 5BV7C 4NGHH 2DS4A 3BKJL 3MOAH 4OT1L 5TGBA 1W72A 2DDQL 3BI9X 3O3AB 3HPJB 1IM3A 4MCZB 1FZJA 4OLUH 3X3GL 4PGCB 1R3HB 4H26A 3QIWD 4LDEB 5FCSH 5JXAH 4LSTH 3B83A 4F57L 1CFQA 4PV8A 2FL5B 2VLJB 5KVDH 2CR6A 2WBJB 5F70A 2Q86B 3C09C 3OZ9L 2BNQA 5C2BL 3IGAA 5KW9L 3C08H 4YFLF 3E6FA 5CLTA 4K8RL 5CIPB 2B2XH 4MHHI 5AUMA 2HT3D 4Y1AA 3WFDL 3NFNB 4P4KB 5B3JF 5F7WC 3C5ZA 2NQCA 1H3UA 3TYFA 1ZA3B 2C5DC 2XZQH 1FQ9C 4F7EA 3V2AR 2CXKA 3RKDC 1J1XL 2F19H 4EQ3A 4FQXC 5IJKA 1X5HA 2I26N 4DVBA 3UBXB 5FUOL 3FB8B 2G9HA 1IBGL 3CX5J 4OGYH 4JR9H 1JFQH 2B5IC 1I1AD 3SJVD 3SHSA 4L8DB 4LOUD 3ESUF 2EZ0D 1CD9B 3H7BB 4HUWA 3MCG1 5EBWB 1F2XK 3I02B 4YZFE 5MERB 3GRWH 3L3IA 3P0VL 2NCMA 4JLRB 1RZFH 1RZ7L 4ZNEA 4U1KB 1CBVH 2VITA 3FQUA 5CJOL 3EBAA 4AEEA 2AJ3B 1WBXA 4RWYH 3NFSL 2QHRH 3WIFB 1ZTXL 2BCKA 2W38A 2ZOLA 5INDB 1EUUA 3NVQA 5ENWA 1G7MA 2B20A 2J8UA 1U8LB 4FN0A 5SX4H 5DMKB 3GSWB 4M4PA 1WSST 4A6YL 1B2WL 3S36X 5DJYA 4ZS7L 3P0GB 4GH7B 2ATKA 3AS1A 3RUGA 4QTHA 3WJJA 4HIIA 3DYOA 3S35H 4PP2B 4HT1H 3WNMA 1G9NL 5AD0A 1T80A 1E28B 1CICB 1OAZL 1YMME 3EOYG 2QQLH 1PQZB 4K7PH 2V5RA 4LAQH 4LKXB 3QFDA 1CGSH 5BRZB 2H3NB 4WEUD 1XGTB 4EUPA 3DLQR 1IM9B 5CKGA 2CLZA 5DD0H 4GRWH 2K1MA 2ADFL 1LEGB 4PGZA 3MLXL 2QQKL 3K0WA 3OQ3B 4NM8H 5CGTA 1ZWIA 5ESVB 4AT6A 5I8KH 4H25A 4B50A 2NX5E 5IHLB 1BQLH 3VFNB 2Y07H 3KPPA 2HJKA 4P5TD 4NO3A 3WEXB 4NNPL 4P2QB 4MAUL 2W9EL 3GHEH 1JWMB 4Z78B 5A3IC 5HHQB 5FOJA 4NQDB 2NW3B 3U4AA 3FQNA 3EYUH 3ZYJA 3ZKNC 1X6NA 2APTA 4V1DE 2GAZA 3WD5H 3C5ZC 5EU5A 5DRNA 2WP3O 3E2HB 3B4NA 4ZQKA 1DDHA 1CLOL 1MFCH 5ICYA 2NZ9C 4PJ8A 2X4TB 4WWID 1QKZL 4PJXB 3UCRA 5KS9E 3HTLX 5E24E 1DZBA 3WMSA 4L5FL 1C1EH 3ARGB 1OTUC 4AK1A 1VFBB 3TYGL 5IJKC 4JHBA 5E9DE 3QEHB 1LEIA 2CKNA 1KT2A 3W9EB 4U0RC 1JPGB 3L3OA 4MLIA 4LK4A 4HS3B 3PE9A 2AQ1A 4P2OB 5ANME 3VD9A 2HFFB 5IB4B 5T3ZL 4FP8L 4KHXH 1B4JH 3FOMA 3FQTA 5J12C 1FO0H 2IQ9H 3VFUA 4Y8AA 1ZT4B 1EEQA 3OKNA 4XXDA 2BVQA 5HI3D 1OLLA 4D9QE 4IRSA 3OGOE 2DWDB 3QBTB 4PJHE 4EJ1C 3WXWL 2R2HA 2P5ED 2MWCA 4NRXA 2MFNA 4XPFL 1FYTD 2PXYD 3MCKA 3BXNB 3HNSL 3H8NA 1YEGL 3O45B 4M6ML 1OT1A 2PW2A 3PQYA 5BV7H 5F72S 2FIKA 1ONQA 5EWIL 1UM4L 3CLEL 3O6KH 2F8VA 3K80A 3EO9H 1ZSDB 4O2CA 1TFHA 4YDVA 2C3WA 1LQSR 3T77A 4BQ6A 4P48A 4YBQC 3L3DA 3WJJC 1WIPA 1Z9OA 3GMRB 5ICXA 3C2AH 3UTQB 1BECA 5JOEA 1Z5LB 3QEQA 2ED7A 1FL3A 5GSVA 3U36B 3B9EA 4MA1C 5L8LB 2VB5A 2FEEI 2G2RA 4YHZL 1NGZA 3O3DB 3KXFA 3U0PB 1OAQH 4D2NA 1S9WB 5E9DA 1KBGH 4XBPB 2VISA 1HYSD 2AEPL 1AD9B 5ITFA 4HG4J 2WZPD 4LCWB 4XAKE 2VLJD 4D9RE 2WBJD 4JKPH 3QWOA 4GSDH 4U1IB 3SPVB 3VXTA 3S5LB 4M62H 2XT1B 5C86A 1B9ZA 2VXTL 2DYPA 5I74C 3GJEA 4OV5B 1FDLL 1JNLL 3BWAB 5SWQA 3LQMA 1FFNA 2W60B 4QXWA 2VAAB 1YY9C 5ALBH 4GW4B 1IZKA 4GXVH 2Q8BH 4P4KD 2J8UF 1S78D 4KZDH 4JKLA 3KPOA 3PHQA 4G6AC 1JZ4A 3OJ2C 2H2PD 4NYLA 1A14L 2YPVL 3RUGF 3VXRA 2BY3A 5IT2H 4I3RH 4Y16A 1JCKA 4LRNH 3CCHA 1RPQA 4ODWA 2HMIC 4RGMC 1L0QA 1KXTB 1QP1A 4XP1H 2YXMA 4HJ0C 1KYOJ 3C8HA 4X6FB 3BT2L 1MJ8L 4OFYA 4S10A 1XT5A 2VDQH 3INUH 3I6KB 1X6LA 1W0VA 5C07B 2C4FT 2I25N 1BFVH 3FO2A 5KN5B 1H3VA 2BMKA 2W9DH 5L88H 2Z4QA 2X4QA 1U58B 3QR2A 4YZFF 1VPOL 1RIHH 1GOFA 2JELL 5EO1A 4YR6B 2C3GA 2H1PL 5C0GB 1NUNB 3OF6A 3IXTB 3HAEH 1QR1A 2C1OA 4MB5A 4IRSC 3BP5B 4HWEH 4L3CA 2JIXA 4FFVD 3V6FA 4JG1L 2WW8A 5F1OB 2GT9B 4GKNB 5DQJA 1TETL 2X9YA 3X11B 1RZJC 5HI4C 3LKPA 4ZMAT 3RBGA 2E7LA 1E27A 5GSRA 4DCQB 3QEGH 3BESR 3GSXA 1P4BH 5I1AB 3T1WA 1CF8H 4JM2B 2DM3A 5HGBB 2WUBL 5C71A 5KVGH 1W72H 1XF3A 1NEZG 1W0YT 3UTPD 4KKCD 3V5HA 1MRCH 4YBHA 1WEJH 1CICD 4UU9B 3GMLA 4WV1B 1UKTA 5CZXD 5KSBB 4WHTA 3K2MC 4PR5B 4CJ0A 4Q9RH 3I6GA 3VXUD 3A6OA 2OJEB 2BOBA 3O6FA 4MB3A 4QGYA 4K71B 5GJSH 4GS7B 5EORL 4OSUL 1L7IH 2FEDD 2AV7B 5C9JA 1YEDA 4KRMB 1X5LA 3JV0A 2OI9C 4M7ZB 4W70A 2D0FA 3BEWA 1GCFA 3CSYB 5IQ7L 4W68A 3D3VE 3QJFB 1U41A 4RIRB 3QNYB 1I3RA 1YC7A 5L2JA 3O3UN 3ORJA 3F5WB 3VRLF 1DBKH 2R56H 3VXQA 3T0BA 2DBJA 4N8CH 3RNKB 5IHZB 2W0FA 1HHGA 2R1YA 1WC7A 5IIEB 2B1HL 5T33H 2IMMA 5IBUB 3PGFH 4GFTB 3HZVA 3IVKB 2DJUA 4NQDD 1EZVY 1CDJA 3LEYL 4ORZC 1A6ZA 4NKIL 1F11B 3BQUA 1KTRL 3IDMA 4YE4H 3S97C 1ZGLP 1UEMA 4RA0C 3MCLL 3VG0H 4YWGL 1NANH 4U2YA 1N64L 1Y0LB 3FT4A 1NBVL 1OW0A 4XPAH 1G9MC 1BM3H 1OAKH 4WTXA 4C57C 2FX7L 4OQTL 4Y16C 3PNWA 3S34L 2AK4B 3ARGD 2HN7B 1BOYA 3H9SE 1YEHH 5I75C 4PJ9B 2W91A 2QADB 3NMEA 3RWCB 4HKJA 5DVOA 4NO5A 4PJ7B 4XB8A 3LH2H 3ULVD 3RZCB 1M7IA 4R90H 1D9KB 4BFGA 4P2OD 3LB6C 3V5DB 3HC3H 3OAZK 1MVFA 1LVEA 4YHKH 3TV3H 4HXBL 4NCDA 4QRTB 1OSPL 5F6HI 3LQZA 3TIEA 1K5NB 3QULB 1U95B 1A6TA 4NQUA 4XZUB 4P99A 5LGJB 4Z18A 2B8OT 3HC4H 5HHMB 2Q20A 2FB4L 4J3SA 3QAZC 3T0EA 2ZCLH 3QEUB 1UACL 1BFOB 4NBYB 1PZ5A 2VR5A 2I9LB 3DNKA 5I30H 1FZKB 1LO0L 3MTRA 3NIGE 4P3CH 4X4YB 2EIBA 1IGJA 5GPRA 3WNKA 1TNNA 5JW3H 2Z9TA 5JOFB 2J5LC 4Z7VA 2E7LC 1UWEH 4X7DC 1NAML 2DOCA 1AGCB 1X7QA 4YAQB 4OM0H 4TSBH 5D7IA 4EUPH 2VDLL 4PJDB 4LSSL 5DA0B 1OCWL 3T0VA 2BSRB 1QO3B 5KVEL 2EE9A 3RAJL 4QYOA 4NZUH 2MSPA 5HYJD 2MPAL 3WNLA 1I8MA 2DQCH 3O6FC 4KRPB 5EBMA 4OCYL 1IVLA 3OX8B 1T5WA 4LCWD 2BC4A 1NC2A 1D6VH 2VXQH 1NUDA 3DUHA 5CEZE 2O61B 2A83B 8FABA 4PRHB 1AKJB 1WAAE 1AGFA 1EZVX 4X6DF 5F9JA 1DLFL 2VDNL 2X40A 3JZ7A 5E4EB 1HWHB 2Z31B 2FWOB 3SQOL 3PWLA 4MNGA 4MCYA 5F7UA 1RHFA 3WHXB 1HNGA 1KCVH 1MHHB 1H15B 1IEBA 3RVXC 3ZKMC 1SEQL 2DI9A 3HCVB 3S88L 3NCYS 1K4DA 4NQCA 5D5MA 3DHJA 3BOVA 4LCUA 4XMKL 1DQJA 3PXJA 2DQGH 4TTDC 4NFCA 1LDPH 4XP5H 3T2OA 5DUBA 2GTZB 3PIQB 3HLAB 3THMH 3BQUC 4N0UA 2YKLL 5KG9A 1V3JA 2B4CL 5EOTA 1FFOA 3H0TB 5MP6H 5JIPA 3IRZA 4MJ5B 4X7FC 2QSCH 5GRXG 4MA7L 5D1ZB 2XN9B 3GDBA 3MLTA 5DMGD 5AZ2L 1OW0C 1PVHA 1R3JB 3OGCA 4DGVH 1CXHA 4GG6E 4XHJD 4GKSB 5F3HA 2IPTL 5KSUB 3C6SB 4R7DB 3EHBC 3Q1SH 5C07D 4U6HB 3BZEA 1X5JA 1F97A 5DSCB 4LNRB 5CUSL 4D0CB 5L2KE 5MHSD 1BIHA 3IDXL 5CBAB 4E0RA 2R2EA 1RZJH 5I9QB 5KVFH 2EC9U 3B9DA 1HH9B 2DWEB 4S0TD 3NABL 1WAAA 1KNOB 4XAWH 1VDGA 5DDHB 5DRXA 3LPGA 3MACL 3MGAA 1BVZA 3NPSB 4WEBL 2APVA 1RJYA 3H42H 3CAFA 2HJFA 1TJIH 3ECBA 5JTWA 4G43B 5GISH 4H5SA 1MJUH 3T0EC 4JAMB 2LVCA 4NSKB 4JO1H 4NZDA 3RWIB 1F4YL 3F12B 2EXWC 3MRKA 1BZ7B 4U05A 1INQA 1S9VB 4JM2D 3RGVA 5EU6B 5E56A 3MFGB 4JY5H 1C12A 3UAJC 3RWFA 1UYWH 4UB0H 5F7KC 3DSFH 1CL7L 4KKBD 5BO1H 5IMLB 1HSBB 3MJ6A 3TCLB 5DA4A 2P8MA 3LS4L 5FO8A 1K4CB 3SDYL 4ODUB 4ZUTB 1P53A 5IM7B 3BKCL 3E3QC 1P84J 3N1PC 3TBYB 3GM8A 4QRRA 2YSSB 3S3PA 3C9NB 3VA2C 4PRPB 4QF1B 2OL3L 3HUJB 1FE8L 4KUCD 5LJYH 3PWPA 4JO3H 3RI5K 3L95B 4CVXB 1V3KA 4CVWA 2MHAA 3LDBC 2G60L 1ZLUK 3PV6A 4WUUE 2O5YH 4G8FB 1V7NL 2WNGA 3BHBB 4AMKH 1BLNB 1KJVB 1P69B 1YN6A 3IU3B 3EYQC 1NGXB 5IEKB 4RGOH 3U7YH 4NKMB 4PB0H 5EFIB 1NGWA 5JA8B 3LKRA 3ZKXC 3SE8H 3X13A 3NPZB 2PW1A 2GKIA 3H9ZA 4XPTH 5TE7L 1TMCB 3RDTB 1G9MH 5FB8A 2EIDA 1FGVH 1JTOA 2IADB 3CSPA 2HJLB 3QDJE 1WCBB 4PJBA 4MDJA 4NJAL 4EI6A 1MEXH 2NPLX 2YR3A 2E8YA 3JWNC 1HHHA 2DM2A 3NN8A 2B1AL 1Z6JT 3VD7A 5CSBA 4YPGA 3JTTA 4Z7VF 1RUKL 1RZKC 1XR8B 1KCUH 1HQRA 5JXED 1TCRB 2AK4D 2CKBA 2BXYA 3PABB 5D7IF 3V4UL 4LCIH 4FQCH 1DQLH 1SEBA 4PJ9D 2OTUA 3O41B 2FNBA 1M4KA 4OGXL 1WCQA 2QADD 2OBGA 1MREL 2J1KA 3IDUA 2DI8A 5KZCB 3DV4A 4J23A 1UXWB 4UIKL 5L6YH 2HVJB 3RZCD 1D9KD 4GXUN 3QUYB 4J4PA 3CH1B 4UQ3A 1ES0B 5CFHA 2W1NA 3NAAH 4BJLA 3T3PE 4G5ZH 3LPWA 4FTVE 4CW1B 4NPYB 1HDMA 3FTGB 5B22A 4GUPA 4UNUA 1OP5K 4RMUA 1JPFA 1TNMA 3ULSA 1GH7A 4WUUA 3ZE1F 1BEYH 4ZUWA 2H32B 3GMPB 1E4XH 2QKIB 2KZWA 4NOBA 2CK0H 3MFFB 1A7BA 2X4UB 2LE9A 3MQIA 3VGEA 3KYNB 3GMOB 5LCVL 2FHCA 2UWEB 1I9JL 2EDWA 3QA3A 3MNWA 1J12A 3MRRB 4P46B 2AJYH 5D5MF 1FNSL 1YDPB 3MNVB 3A6BL 4JFQB 1CGXA 4HCRH 1WFUA 4U2ZA 3S96B 1P5UA 1ZVHA 4K3EL 3ISWA 1IKFL 4QOKB 4MQXD 4QRPA 1QSEA 3RGVC 2APXA 4NP4L 4UUJB 4S2SA 1L9MA 3EJYD 3GNML 2QQNL 3RPIA 3LN5A 5EC2B 5SX5H 1YNKH 1KC5H 2ENYA 3VXSE 3CMOL 4KGLA 2P5WB 4NQEE 5SV3A 5C0BA 2IAMB 5IHUH 1H3WM 4X9BA 5I71B 2ERJB 3QUXB 1BVKB 3SKOB 4YFEA 1M6OA 3FFDA 4NDMA 1AKJD 3VXNB 1ZE3C 1S7VA 2PYEB 1LNUB 2ZUWA 3QQNA 4KKLC 2Z31D 4OTXH 5FYJL 5EU7E 4FTVA 3DXAE 1WAAF 2DJ4A 5ERWB 3NH7H 3B2UC 2YBRB 3BH8A 1SQ2N 1F3JA 3FZUC 3MV9B 5CJXA 3MRQA 1NLBL 5JPMA 3U2SB 1V7ML 2ORBH 4NFBA 4L9DA 3BZ4B 2XIDA 5D2LB 1EAPA 2CLVB 4BH8B 3FN9A 5BZWB 2O93L 2Z92B 1F13A 4DFHA 1CD8A 3W81A 4LVOB 1A0QL 3OR7B 3RL2B 1IMHC 3QUMB 3EFFA 3OKOA 5KSAB 1IAIL 5GRJL 1WTLA 2LV4A 3KPSD 1UWGL 4MNQE 3T2PA 4HFWA 1UB5A 4KJQD 4X4XB 1RZIA 4FFYL 3QG6B 5HGDA 4PTTB 2HLFD 2XN9D 1ODAA 2N56A 3WS3A 1VADB 1T21B 4XBGB 1QUNA 2XZCH 1FCGA 3TZVB 1G7JB 4R4BB 1NBZB 3WIIL 5HJ3A 1MJ7H 2H6PB 5F97E 3UYPA 4G8EB 2IFGA 3RTQB 3QDME 2X4RB 1EH9A 2XY2A 1MVUB 1G7IA 3P40A 1T7ZA 3DOSA 4OCXH 4J4PC 1A22B 1A1MA 4HX1A 1ZK9A 4NGHL 3MOAL 1T66C 4J8RA 1MCIA 2MQ3A 2X41A 3IJSB 3O8XD 4MAYB 2VZOA 4NKDA 5J06A 1WZKA 3ZYOA 4OLUL 2J12B 5I16A 4LF3A 4WDIB 4JG0H 1MCPH 3TBTA 3LKSB 2BHZA 12E8H 3MV11 5JXAL 4LSTL 3DXAA 1KTDB 2FH8A 5FYKE 1VHPA 1U8PA 2PN5A 5KVDL 1FP5A 1YEEH 5E5RB 5K9QI 3LRGA 3BO8A 4PJBF 5EU6D 3C08L 1P6AB 3HR5A 2NY6C 1EEZB 4FQQB 2B2XL 2EYTB 3QCUH 4EUPG 5ELIA 3MRIB 2ARJQ 4LQFH 5ESAB 1U42A 3FQRB 1KLUB 1TQCB 4I2XE 4ERSH 1DQMH 1KACB 1YPZA 3IJYB 3LD8C 43CAA 1FL5B 1CT8B 3ET9F 4GRLD 3DURB 4OZ4B 2NY4C 4PJIE 2KQNA 2D7MA 2XZQL 4MVBD 4LHUB 1D5BA 4IJ3C 4PRPD 4UT7H 1T0MA 4QT5A 3KLHC 2F19L 5SWZB 5KTEH 4XNQA 5EZJB 3QDMA 4MD5A 4W6YB 4JGMA 4OGYL 4N8VA 4JR9L 4OKVA 4Y4KA 5IB5B 1JFQL 4D3CH 1R6VA 1CDUA 4Y19E 5F7MC 1MJJA 2VLKE 1XF2B 2CIIA 1QVOA 2FDBP 3PP3K 3CC5A 4M5YH 3UXFA 4NJ9H 3PP4H 3QDGE 4LSRH 5JHDA 3GRWL 5FAAA 4MJ6B 1RZKH 2BVYA 4N90E 5JOPD 1N8ZB 1JYVA 2D7NA 4CDHA 1RZFL 4ZAKA 5CZVH 1CBVL 3SGEI 5CJXC 4X8JA 4KJYB 5F6IC 3LKOA 4Y2OA 5CLWA 4RWYL 2QHRL 2PYFB 3QQ4B 2JJTC 4I18B 2F53B 3KLDA 4LL9A 4PJFB 3KHQA 3TVMA 1I1FA 4XNMB 2F74B 4DWHA 1EHLH 4R6UA 5DTFA 4XVTH 3I2CH 2ARJA 3QUYD 1T4KA 2XTJE 5SWSE 3S35L 1A6UH 5BQ7B 4HT1L 3IKCA 2H2SD 3QH3A 4JN2B 4UBDC 5D9SA 1XEDA 1U3HD 3QHTC 3VWKB 2QQLL 4K7PL 4XP4H 4NHCH 5CP7B 5B39B 1IAMA 2V5MA 3TEUA 4LAQL 1KSRA 1T1WA 1CGSL 1IC5H 1FIGH 2C1PA 3HE6B 2NY0C 5A43C 1IEHA 1XMWA 3GSNA 3TBVA 4PLNC 1EJOH 4LRIA 3S9DB 4PTUB 4K7FA 4Y19A 5D7SH 5DD0L 2JJWA 5H2BB 4J1UB 2CR3A 3AY4A 3EYFA 2ZNWA 3GB7A 1DE4A 3QDGA 5EU7C 5IGXH 1FZMA 4NRZB 1G7PA 3L6FA 3IT8D 4NM8L 2XPGA 5I8KL 1KN2H 1P1ZB 1T1ZB 4NRYB 3OAYK 4KTEH 2XY1A 2RJMA 2X4SA 4P5KA 4XC3H 4QOKD 1BQLL 5HYQB 5GS3A 2VZVA 2Y07L 3TO2B 3G6JB 2H9GB 3UZVB 1U8JB 4O00A 3HPLA 3GHEL 4L4VB 4X83A 2ZUYA 3CMGA 1FFPB 4TNWK 2CDEB 3EYUL 1OF2A 4W6XB 5CGYC 2WIIB 2P5WD 1EFXB 3WD5L 5BS0B 2IAMD 4IOFD 3QUXD 5D4QA 4XX1E 1MFCL 4G8GB 4LPTA 1VFUA 3VXOB 5IVXE 3RWEA 4F7CB 3FB5B 4LLUB 1JTTA 3I3DA 4KZEH 3FOLB 3MRGA 3VWJB 4KK9C 5E8PB 1C1EL 2PF6A 2PYED 1RJCA 4HC1A 4PRIB 1EHXA 1QSFB 3MRDA 1DL7H 3KPRE 3MBEA 1WZMA 2QL1A 4X7TA 4OI8A 4Y4KC 4NO2B 4L4TB 1AO7D 5GGSY 3FL7A 3RHWF 3MV9D 1ZAGA 2XWTA 3TFKC 2LTQB 2MTPA 2A6IB 4KHXL 4N9OB 1B4JL 4ZUVA 1PYWA 4D0DA 1FO0L 3BPNC 5TE6H 2IQ9L 3VRIA 4ZAKC 1MCOH 3EO0A 2CKBH 2EKSA 1DEEB 4Q9BA 3W5NA 5T5FH 3TLRA 5KSAD 1JYXA 5IW1B 43C9A 1Q9KA 3TBSA 4YXKH 2G5RA 1QFWH 5EUOB 3VFSA 4JFPA 3TVMC 3PDGA 4KI5D 1YPZF 3QIWA 3TZVD 5BV7L 5GGVY 1EBAA 3T08A 15C8H 3O6KL 3EO9L 3TNMA 3RTQD 2VKWA 4ELMB 1QRNB 2HTLC 3P73B 3D0LA 4PBVC 3C2AL 1S9KC 3TWCH 5DHVA 1MF2H 5BVJA 3H3BC 1UG9A 5CZKA 4QRQB 2ID5A 3OKMB 1TZIA 4JREC 2EDEA 4LSVH 2LU4A 2AXJA 4U4BA 3MGOA 2W0KA 4U3CA 1EK3A 2GCYA 1OAQL 1GPOH 1VFAA 3BGMA 4WENB 1J18A 1S7QB 4D0BB 1KBGL 2QLVB 2EXYD 4PD4K 4LRIC 3G9AB 4KV5F 1FFRA 1KPVA 1TIUA 1RK1B 4JKPL 4N9GB 1Q72H 1CLCA 5GRUH 4KKNA 4GSDL 3K4AA 3AY4C 4XCYA 4M62L 5J6GB 5GIRA 4Y5YB 4C56B 4O51A 3SO3C 2EDOA 3EGSA 1SVCP 4RAHA 1BFSA 1BPVA 1QQDB 3ZYZA 1NUFA 1I1AA 1E4KC 1I7RA 1T0NA 2FYYA 4HKZB 3SJVA 4E5XB 4K55A 5ALBL 4PRAA 1OAXH 4YNYA 2Q8BL 4GXVL 1NCTA 1SBSH 2Q8AH 4KGJA 4KZDL 1ITCA 3EDEA 4LPYA 4WHYH 5D6CA 4ZUUB 4PGBB 5IK3A 3D18A 4RZCA 1JK8A 2ZUQC 2FRGP 1U6AH 3ARUA 4LHUD 1ZEAH 2Q87A 3OSKA 5IT2L 2NXYB 4I3RL 1KIRB 1RZGB 4LRNL 2RGSA 1MCKA 2ICWJ 1CU4H 2NY3B 3E1F1 5JO5B 4HMCA 5SWZD 3TH2T 1CGUA 3HAEB 2YEZA 4XP1L 5E5UB 5MI0C 4K2UH 5C08E 4MA3A 2DQJH 3NCMA 2XTJC 3A67H 3TN0B 4YHNB 5GS0C 5GGSA 4TSCH 2VDQL 3T4AB 5C0JA 1VKXA 2FR4A 1BZ9B 3INUL 3MBEC 1KLGA 4OFVA 2QSVA 1BFVL 1TJHH 3SCMB 5JW4M 4LLVA 4PJGE 2W9DL 2X4PA 5L88L 5D7LA 5IG7B 2EEAA 1S7XB 1UXSB 4XVJH 1RIHL 1U8IA 1A1NA 1FN4B 5EZLA 4PYHA 4I8DA 1D5XB 2EYSA 2ZUUA 5TE4H 2F53D 3U0TB 1A47A 4FZ8H 4HWEL 3UPCA 1I3UA 5B38B 3IDNB 4JPWH 1BD2E 2VUOA 2FZ3B 3QEGL 1P4BL 2EDLA 1CF8L 3QIWC 5KVGL 3DTXB 1W72L 2VMFA 2FX8H 4WGWB 5CILH 2C3VB 1WBYA 1MRCL 1WEJL 3BW9A 4WJ5A 2PCPB 2AXGB 2P5EE 3VWKD 2HRPH 2VOTA 4JE4B 1FYTE 4P5TA 4Q9RL 4QKXB 1OB1A 4P3DB 4OB5H 3HE6D 5GJSL 1MOEA 3LOWA 1AP2A 4FABH 1L7IL 2F58H 4O2EB 2SEBB 1CFNA 3NA4A 4LLAA 1A9EB 2HT3C 5CP3A 1RUMH 4PGEA 4JRWA 1BF8A 1FVCA 5DUPH 5DJCA 4JFEB 3FKUS 3Q5YA 3N1MC 4U0RB 3MLYH 3KJ4C 1DBKL 4JKKA 2R56L 4Z77A 1R24A 3FN3A 3UYOD 3QDAA 1WT5A 4N8CL 4AENA 2DQIH 2FGWH 4JPVH 5T33L 2P42B 4C4KO 3QXTA 5T1MB 1C08B 4X9HA 5CSZA 3PGFL 3PL6B 4GAFB 5CWSA 1S5HA 2DMCA 4L4VD 2ZCKH 1T3FB 3PV7A 3GUTA 1I1AC 4J6RH 4TUJA 2DIBA 1WBXB 5ID1A 3FB7A 4LOUC 5HHXH 3NACH 5FUZH 2EZ0C 5J1AA 2AW2A 3UDWA 1WFTA 1EFXD 5BS0D 4YE4L 1A6AB 1ZHLA 3VG0L 3WJLC 3MRLA 4G8GD 5H35B 3RWHB 4QO1A 4G80B 3D69B 1X5FA 4AM0A 4XPAL 3D5OF 3VWJD 1BM3L 5DJYB 1OAKL 4P57A 1R3KB 3G5YB 3SY0A 4QNPE 1BBJB 2R9HD 1YEHL 2ICWB 1ZT1A 1JF5A 5EZOH 1FYTA 1CLZH 4PREB 4L4TD 2Z35A 4QGTA 3BP4B 1HHIB 3V6ZB 2ZG3A 3LH2L 2F8OA 5FYKH 4R90L 3PDOA 3REVA 4G6KH 4RFNC 4CMHC 4PG9B 3HC3L 1KJ2A 4YHKL 3RL1B 3TV3L 1WZLA 3NZHH 3NFPB 4CVUA 2XZZA 2CJUH 2E7CA 4O58H 4LVNC 4NNXB 4OF3A 3OXRA 5E00B 1MUJB 4I9WE 4LGSB 3ARRA 1MCHA 2VH5H 5F7YC 1J86A 4NZTH 3O3AA 4CRPA 3HPJA 4KVNH 3HC4L 3HKFA 4MCZA 5I17B 2ZCLL 4UV7H 2CDGB 2NTSP 5C8JB 1MLCB 5I30L 4PGCA 1R3HA 3P30H 5EUKB 3B5GA 2BDNH 4P3CL 5DVKA 3GI8H 4YK4B 5I76B 1BHGA 4EXPX 3HHRB 5EA0H 3OB0K 2FL5A 5HHOE 2VLJA 2WBJA 5SV4A 1NDGB 5JW3L 3ZMRA 2HA1A 2Q86A 1N0XH 1UWEL 1MFDH 1QRND 3QIUD 2H8PB 4JB9H 4TTGA 3GSNH 4F37K 5CIPA 4OM0L 4TSBL 4F7TB 3UTSE 1T83A 1A2YA 4NZUL 4XCFH 3NFNA 4P4KA 4P5TC 2DQCL 5EPMB 5FM5O 3VFOB 1GXEA 3GGWB 1RJZB 2N1KA 3TPKA 5HXMA 1MCCA 1UJ3B 1ZA3A 3UTPE 1F45A 4GW5B 2GK2A 4KJPD 3D2UB 1D6VL 2VXQL 4MDIB 1P2CB 1A7QH 1EUTA 2O5XH 3RY4A 3BRFA 1YMMB 2AXHA 3HZYB 1F58H 3VXUE 3JV6B 1EVTC 3UBXA 3FB8A 3IFOB 1R0AH 4IHOB 1IT9H 1T5XB 1WT5C 3QT2A 3VFWB 4L8DA 1MCJA 1KCVL 1MCNA 2X9WA 2R0KH 3H7BA 5EBWA 2QJDA 3OMZA 3I02A 5MERA 1T1YB 3P9WB 5F7EH 3VFRB 1EAJA 4QRUB 4JLRA 2ARWA 4O2FB 5GS0H 4U1KA 2DQGL 1H3PH 1L7TH 3FT2B 2DRUA 1LDPL 4XP5L 1HN1A 2NX5B 3THML 3UDWC 2AJ3A 2ZJSH 2NY3D 4PJEE 5MP6L 4OZIE 2QSCL 3TNNB 3WIFA 2I5YH 5INDA 4LGPB 4NQDE 3TN0D 5HI3C 4DGVL 1HEZB 3ZE2F 1U8LA 5DMKA 3GSWA 3O9WB 4NUGH 4V1DB 1HCFX 3Q1SL 2X4NB 2PXYC 4WHCA 5FEBA 3N1GC 2D31B 1QPPA 3QNZB 4PJXE 3AU1B 5KS9B 2DL9A 2MCPH 4IIQC 4OD1H 4PP2A 2OR8A 2N7AA 1E28A 1CICA 2OK0H 1RZJL 5KVFL 1NCCH 5E9DB 2HG5B 3DX9B 1PQZA 3STZB 1BF2A 4LKXA 4XAWL 3BUYB 4N0RA 5BRZA 2H3NA 5FM5M 1XGTA 1G0DA 5D72H 3H42L 3QXUA 1QLFB 5ANMB 1TJIL 3S3JA 2OR9H 4APQD 4P2RE 5GISL 1AC6A 3MZTA 1MJUL 1C7TA 1Q1JH 4JO1L 4E9LA 4HULB 4WI5A 1KOAA 1OQOA 4JY5L 1P7KB 1HYSC 3MODH 2P7TB 3BKMH 5ESVA 4QCIB 1UYWL 2WBJC 4UB0L 3DSFL 1INEH 1DLHB 4PJHB 1T89A 5BO1L 4XRCB 2H26B 4N0YH 3VFNA 4QHKJ 3KS0J 3BJLA 4NYLB 35C8H 4YO0B 3WEXA 3FHAA 1AQDB 4P2QA 5T3XD 1JWMA 5GGRY 2GY5A 4Z78A 2R1XB 2Z8WC 3ZTNH 2FEEL 1J87A 4HUNB 1T83C 5HHQA 1SMAA 3C5SB 4NQDA 4NIKB 1UEYA 5E8EA 2NW3A 2VQUA 4UILH 5IVNA 4P4KC 1DCLA 3CH8A 1S78C 2WP3T 3AS3A 4JO3L 4MWFB 5F96H 2NY5C 2YD1A 2H2PC 5IP4A 1PKOA 2X4TA 2O5YL 3SE3A 4PJXA 1QHPA 2P47B 4AMKL 4ZFOB 3ARGA 5HYJE 1TTGA 1VFBA 4RGOL 5IOPB 3U7YL 1PX3A 4PB0L 4WHYG 1LP9E 3QEHA 3PL6D 4PRBB 5I1EH 5GJTH 3SE8L 1HCVA 1UCBH 4XPTL 3W9EA 5F1IB 1JPGA 1G9ML 1FGVL 4G9FE 1SJHB 4HS3A 1TJGH 2YD7A 4P2OA 1IEAB 4HK3J 4P2YA 5HHNB 1NCBH 1UZ8B 2HFFA 3BN9D 5IB4A 4RX4D 4TVPD 4WI3A 1MEXL 3HRPA 2ED8A 3ZTJH 3KVQA 1J0JA 3MRNB 2D7TH 5HGHB 1K2DB 1ZT4A 4LSDA 3OKDB 4I4WB 1G9NC 1KCUL 3SEPA 2PTTB 4X6CF 3DX7B 2DWDA 3F6IA 3STLB 2J5LB 4DZBB 4LCIL 3IJHB 4FQCL 1DQLL 4Q7DA 5C0CB 5MEPB 3BXNA 3O45A 5L6YL 3B43A 1R5VB 5JDJA 4FFVC 2CK2A 2OR7A 1RIVH 2AJZB 1ZSDA 3ZKQD 1F5WA 3NAAL 3PWJB 4G5ZL 3GMRA 3NCCB 1QFPA 3UMTA 5EO9B 3UTQA 4TNVF 1Z5LA 5GGVH 3ZT7A 3U36A 1CDIA 3HI6H 1BEYL 1NFDE 1CICC 1E4XL 4KVCH 5CZXC 2CK0L 2ITDB 3VD3A 4CGTA 4R4ND 1J1OH 5KSVB 5HD8D 3QB7C 3U0PA 3UYRH 1S9WA 1H3TA 1LD9B 4XBPA 4EEEA 1AD9A 2I07B 2FEDC 2AJYL 4HZLB 4LCWA 1V3LA 2X4OB 5MHSE 2VZSA 1AC0A 4HCRL 4JFFE 4U1IA 3SPVA 3S5LA 1HQ4A 3SDCB 4TULH 4HBQA 5ITBH 1JZ3A 4OV5A 3MSPA 4NZJA 3BWAA 5CP3H 2LFGA 1NGQH 2W60A 1T89C 2VAAA 5L0QC 1YNKL 1KC5L 4UV4H 1KENH 2DQUH 4K9EC 1U2CA 4MQ7B 5IHUL 2VERN 1F3RB 3D2UD 3EFDH 1XZ0B 3T2QA 1YMMD 4I77H 3J8F7 4ZXBB 3SBWA 3OG6B 4N1CA 3E2HC 1WFOA 4PRNA 4JFOB 4OTXL 3JV4B 4LHJB 3SE3C 3NH7L 4X6FA 5I8EB 3FQWA 2FHFA 3ARGC 4I3SH 4M6OH 3D3VB 1SHMA 2ORBL 5E0QA 3I6KA 1F6FB 7CGTA 5C07A 5DZNA 3LQZB 5J7CC 5IMMB 5KN5A 1G7HB 4N8VG 3QFJB 1U58A 4OD3H 3VD4A 3ULVC 1Q9OB 4UIMB 4BFIB 4FXGB 4P2OC 3AAZB 3B9VA 5F1NB 1U8NB 1I75A 3HC0B 4YR6A 4PLOB 5C0GA 3IXTA 4AIXA 2MKWA 2XZCL 3BP5A 5IBTH 1HZHH 1KJ2H 3RA7H 3O9WD 3LY6A 2GT9A