1G5GA

Fragment of fusion protein from newcastle disease virus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
422
structure length
357
Chain Sequence
b'DGRPLAAAGIVVTGDKAVNIYTSSQTGSIIIKLLPNMPKDKEACAKAPLEAYNRTLTTLLTPLGDSIRRIQESGLSQLAVAVGKMQQFVNDQFNKTAQELDCIKITQQVGVELNLYLTELTTVFGPQITSPALTQLTIQALYNLAGGNMDYLLTKLGVGNNQLSSLISSGLITGNPILYDSQTQLLGIQVTLPSVGNLNNMRATYLETLSVSTTKGFASALVPKVVTQVGSVIEELDTSYCIETDLDLYCTRIVTFPMSPGIYSCLSGNTSACMYSKTEGALTTPYMTLKGSVIANCKMTTCRCADPPGIISQNYGEAVSLIDRQSCNILSLDGITLRLSGEFDATYQKNISIQDSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUSION PROTEIN
publication title The structure of the fusion glycoprotein of Newcastle disease virus suggests a novel paradigm for the molecular mechanism of membrane fusion.
pubmed doi rcsb
molecule tags Viral protein
total genus 86
structure length 357
sequence length 422
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2000-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.490.10 Mainly Beta Beta Barrel Head and neck region of the ectodomain of NDV fusion glycoprotein Newcastle disease virus like domain 1g5gA01
2.60.40.1690 Mainly Beta Sandwich Immunoglobulin-like Head and neck region of the ectodomain of NDV fusion glycoprotein 1g5gA03
4GIPD 1G5GA 2B9BA 3MAWA 1ZTMA 4WSGA
chains in the Genus database with same CATH superfamily
3W9EA 2JKXA 1NMBL 4OJAA 1HL4A 5K1VA 4JCMA 3IWVA 3WLBB 3JTTA 4J23A 2X6CA 1L5GA 2JIXD 2BS9A 3MN8A 1ITCA 4KGLA 3SGDI 3SGEH 5KVEE 1P7QA 2ERJC 1JV2A 4LLAA 4WO4A 2DWEA 2DYPB 5F93C 5EIQA 1AO7A 1SQ2N 2FQDA 2XXMB 1W80A 3S34L 4Q6IA 4PRDB 4YIQA 3AY2A 4NUQA 1RUAL 4KKAC 3SE4C 4YMPA 2VDNB 4DKFL 1A9VA 4PTTA 3ZTDC 5AW9B 4APQA 2VMDA 3DOHA 1AE6H 3QR0A 3E1F1 4OU3A 5KYYB 2LAGB 4ELKB 3RUGF 4KNTA 3EJYC 3HB3D 1L9MA 3PUCA 4M02A 4N2AA 1JF1A 1WYJA 4HETA 3JYCA 1TO4A 4NT6B 1EMTH 4B5EA 5E5RB 3K2IA 2OW6A 1JZGA 3E38A 4YGVB 5IQ9A 1BM3L 1TOXA 1PFOA 3WTSA 1KEGL 5HHOD 5LNEA 1BXXA 3FCSA 2ARJA 3KYMA 1OXYA 3DTXA 4ATTA 5D2NB 5CSBA 1U93B 4AKQA 2A3TA 3PDDA 3GZPA 3KWWB 4JFDB 3HS0A 3IJYB 2QQNH 4JRYB 5T3XD 1T21A 3H85A 1NCWH 5CMAA 1S7UA 2DQIL 2A38A 5AAPA 3O45A 2OMWB 5DEGB 2F8OA 3CZSA 4ONFL 1ZVHA 4PGBB 3TO4C 4PS4H 3C09C 4LLQB 1H15B 4GG6E 1OB0A 1WO2A 4P5RA 1EWHA 4K15A 5LXGH 1MFAL 1MRFL 1RLWA 1OGAE 2F1BA 3A22A 4KKBC 3VRIA 5BZZA 3IS0X 3GBML 3SODB 3QIBD 3FONB 1CD8A 1A22B 4YEFA 5DXWA 4UQBA 1CD9B 1ML0A 4J2XA 4FABL 1AGBA 1FNGB 2PCPA 4AL8L 5JUEL 3FU7B 4PWHA 1GS6X 3MRKB 3UZQA 1H8LA 3D5OF 2OQJB 2RR3A 3EUUA 2RHEA 5ID1A 3V7AG 3B4NA 1MCSA 3MRPA 1F4WH 4QHMA 3BLKA 3WKQA 5I1EH 1FL6A 5C3TA 4XVSL 3ZTNH 5AVQB 4ZFZB 3FRPB 5C0JA 1NGYB 4A2MA 4YLQT 1KZYA 3HBGA 5LDUA 3OLEA 4PG2A 3VRJB 4P2YA 3RG1C 4PV8B 1JOIA 4GW4A 1NCGA 4FYRA 2ZOTA 1NCTA 2F53A 1P7KA 3IJ9A 1I1CA 3MJ9H 3N04A 4XNYH 3QDMB 2YEZB 2XPYA 3ZHDA 2PPDA 2HVBA 3WMSA 2V2WB 4G43B 4JFFA 4PJXA 3EGSA 4RWHA 5T3XL 5DURB 3M17A 5AUMB 4CMMB 2ATKB 1YN7A 3B7YA 4BFNA 5EC1A 5MHSE 3G6DL 4EI5A 4O9HL 4MRCA 2FGWL 2VZVA 4JFEA 4B9JA 5D7SH 1CF1A 4RMSA 4C56D 1PIGA 2HZHA 1MREH 3LS5H 5CR1A 4X8JB 3I6SA 1LNUB 1NZRA 1QHOA 4UTBA 1DJYA 1N0XH 1VFOA 1D6EA 2E76C 5L7XL 2WNKA 1A4CA 1YY8A 3DGCR 3ZHLA 3H7BA 1OD7A 3CZNA 5SWSB 3TGXA 3WTXA 4NWTL 3OJVC 4WFGD 1N8ZA 4B95C 3GMNB 3MXVH 4XHJC 2IO5A 4XNMB 1OCWL 1B0WA 4YHYB 3WDHA 4HD5A 3GXNA 2QADD 4HUKB 3T3PB 2AABL 3DMMA 2E46A 3GRWA 2JSFA 1P4IH 3C12A 4AQZA 5EH1A 1ZT1A 3VJ6B 3IDIB 3VDAA 3S97C 3CVHB 2BY1A 1Q94A 2OP4L 4OFPA 4HIIB 2DWYA 2BIHA 4M3KB 2BSEA 2ATPA 3QQ9C 5I74C 4A6YH 3GBNL 1HFUA 2R69H 3WIIH 1OP9A 4HOWA 1SN5A 4OVVA 3E8VA 4PM1A 5BS0D 3V4VB 1T2XA 1NFAA 4G8FA 3NTCH 3ABKB 3ELAT 2HTKD 5GS0C 1TVHA 4AITA 1OT4A 1RZJL 3HUJA 4Q0XL 3V79C 1ZHBA 2ZSVA 1WCBA 3PFQA 4KPHH 4CN4A 2GEEA 4DNLA 4FLSA 4WGVB 4AMWA 1SVCP 1ZPLA 1FDLH 1E9PB 2GCYA 3STZA 3JWDH 5CKGA 4YBHA 4G9DB 5E5MA 4UM9A 3T3PF 1WAAE 4PCTA 1K8IA 5ALCL 2JJSC 4L3EE 2IWKA 2A77H 2V3EA 3L3HA 4UUJA 5T3ZE 4NRYB 4M6AA 1L6ZA 3SDCA 3U46B 3G5VB 4KRNA 4XR8C 4ZUWB 4JVUA 1E65A 2G60H 2AKRB 1XGYH 5DJ0A 4WFFD 4EAEA 1E67A 3Q8EA 3MCG1 5KJ7E 1ET5A 4HV8B 1T03L 3UTZA 1C8PA 3N1MC 3QZWG 5JIQA 1A7BA 3C8KA 1ULVA 4PJFB 4U4IA 4Z7WE 3C5ZB 3WLWD 5CNHA 4OF6A 1D7DA 2BVPB 2OMVA 1G84A 5EEYA 4TVPD 3BGFC 1BIIA 1BAGA 5I30H 1JCVA 1PD1A 2G3XA 3X14B 4R2GB 4Y9CA 2J1WA 3HTLX 3MRFA 2AEOA 4G9FE 4QRPB 2ESVD 2F19L 3OHMB 4EQ2A 1A6WH 4L1BA 1NM9A 4CILA 3MROA 1U4FA 3JBG7 1IC5H 3O0LA 1I8LA 1L0YA 4FC3E 4K5PA 5CIPB 1D9KA 2Q76A 2H0JA 2WSPA 3GHPA 4Z6AT 3TF4A 1K3ZA 1U3JA 1YNKL 2ZUYA 1VGKA 2EH8H 5I0VA 5IROD 4LLUA 3N85H 4UT6H 4XP1H 4LPTA 5KBPA 1LMKA 2ITDB 3KYNA 1J12A 2AXWA 1HXKA 5D7JA 2UXVA 2WNGA 3MRNB 4ZOAA 3RVXD 3L95B 1A21A 1NWOA 4YBLB 1E5AA 4E2OA 4PJFF 1LD9B 1DVUA 4WHDA 1ES0B 5I1HL 1VZHA 1X5HA 3MODL 3FT9A 4R4BB 3HR5B 3L4TA 1S9YA 1YPZF 1B0GB 1VFAB 1P6AB 3LZQA 4J4PC 3NABL 5FCUL 1S7XA 2JQAA 5DT1H 1A6ZA 1M71A 3DSFH 1SGKA 1B4JH 2WLLA 3KJ4B 3BH9B 4LOUD 5I17A 4ANKA 5JQIB 2UZYB 3TYFA 4TVPL 1T04B 1LTXA 4X5WB 4Y4HC 5E4OA 3B9VA 1A02N 5JPMB 3CHSA 4UOW0 3I50L 3PP3H 1J88A 2DDQH 5FUCE 4M3HA 2K6WA 1UM5H 1YEJH 1BA9A 5B39A 4X0NA 2EVHA 1OWWA 2Y5TA 2F0CA 4Y1AE 4Z0BL 3EYVB 2M8XA 2MEJB 1UENA 4G8EA 3M1BB 3BSZH 5F72S 4WU5B 3DUUA 3FN3A 3JTSB 4Z7QE 3QG6B 3X13B 4EUPH 1DQTA 3QEHA 1KWKA 1LK2B 1ETZB 1MF2H 5FV1L 3EO0B 3BT2L 1FL5B 4W4OA 3G5YB 1Z6JT 1JZ3A 2K6ZA 5FYJE 4I8DA 3TEWA 2MJWA 1RZGB 3HE6A 4UV7H 5DHVA 3VG9B 1FJ1B 3QUYC 4LL1A 2DMHA 4OZGB 5CFHA 4AH2A 4P4KC 2NDFA 1ETA1 3WELA 3FQXB 3VXPA 3WYRA 5MEOA 2LLGA 5I15H 1MAKA 1TFPA 4XP5L 1KCRL 2EILB 1A6TB 1NKOA 4U4BA 1BZ7A 3LQAC 5CBEA 5DJDB 5GGQH 3RDTC 3WN5B 3D1MC 1M05B 1R0AL 3GK8H 5IMLA 1F41A 1C16A 1JRHL 3MUY1 3OC8A 2CDGA 1VENA 4NO5A 2BSTA 5ILTH 4JZOB 4NUMA 3QDHA 5GISH 5ABZA 1AGCB 1L6PA 1UB5A 4OBRA 2CGRH 4YGAB 1E42A 2HLEB 4A7SA 1OSPH 4G80B 4KXCA 3BYTA 2B1AH 3ECVA 1FE8L 3VE0A 4FULA 1A6AA 4QNPE 1YVLA 5KTEH 1NMAL 4B96A 1PLCA 3G6JB 2K4AA 4YDLB 3UTSA 2JVUA 4OZGF 2MTAA 4Q56A 5F9JA 3R0MA 3ZMNA 9CGTA 4JDEB 2WIIA 4LCYB 4LLMA 3PQYB 3ZJAA 3DX3A 5FUCC 4YR6A 5F9WB 1QSFB 4MCZB 4L8SB 5JQ6L 3WCYA 5DWUL 1NIFA 3Q3GA 4PRHE 1PKQE 3TNMB 4GOSA 2LVCA 4PUBL 4IBYA 1JZHA 2YD3A 1NMCC 1FNSL 1VZIA 4L8CA 4ZJ9A 2YIHA 4YHNA 2EEBA 4QKTA 4K7PY 4HUCA 2NLJB 5F7NC 3AG4B 3HAEB 3DHMA 2P80D 4MMXB 3UCQA 2CIKB 3NVQA 1K4CB 4PLKC 1AXSB 2H1PH 3TESA 4W81A 1AZZC 2DQGH 3U6XA 3HI5H 1J1OL 4Q74A 1SMAA 2W5PA 2ZWZA 3T6ZA 5IUSA 5DJZB 3RWGA 1GCYA 4S2SA 2MCPH 4ODHL 4AV0A 4OGXH 3G6JF 1A7PL 2HPTA 2XN9E 5DS8B 1HIMH 4PJ8D 4HS8H 2F7QA 4QXGL 4K3JL 3SGKA 1NCBH 2ZUUA 2OMNA 1KFGA 2JELL 4HC1H 5FO7A 1OF2B 3MRBA 3UJTL 2P48B 2HXAA 4P2RB 4ZMYA 3EGDA 1MLCB 3HHSA 3OKYA 1AS6A 1S9XA 4E36A 1KELH 4AYFB 4YS4A 3AG3B 4Z76A 5E2UL 3GSWA 2V7HB 2WXOA 2H8PB 5C0AE 1CE1H 4R4FH 2JI3A 3GQFA 5GRVK 2X1PA 1OIOA 2DW5A 5L88H 4H0GA 2BSRA 1BJMA 4NQTA 4M9PA 1OP3K 3BKYH 3HPLA 5DMKA 1LE9B 4YNYA 1UATA 1ZGLP 2EDLA 1AD9A 2XPZA 4PJ7A 3PHSA 2FJGA 4WSKA 3I2CL 5J9PA 4IW4C 5E1AB 4S11A 1FAIL 3T2QA 3T0EA 4MAYD 3KPQA 5IB4B 2VR6A 5AOKA 2V5SA 1CLOL 3DJ9A 2XN2A 5TQ0L 4MS8D 3TV8A 4Z7VA 3BAIA 4DF9A 3IGLA 1XBRA 2Z8RA 4HBQA 5JW4Q 12E8L 2ZE0A 3WL9B 5D2LA 5E9DA 2ZXQA 5T33H 3GSNH 5E8PA 3STLA 2G30A 3KXFE 2OMZA 5C3IA 1LK3L 1YYML 5K39B 3F7RA 1E4XL 1F1DA 2Q1EA 3QDJA 4IBWA 3ULVF 2NX5E 2H32A 2UZXA 3ATDA 2VLLA 3N41B 4IJ3B 4AUJA 1J5OL 1MCEA 1XF5B 2EEXA 3R4RA 4N3UA 5EPMA 5JLZA 2WXGA 3GIVB 3L9EA 4MHHI 2O5XL 5TDOB 3V0JA 1DANU 1FYTE 5T1LD 4MVBC 3C5JA 5D7KE 3PL6D 4UF7C 3WS3B 5DDHB 2I7OA 3EBHA 5DFAA 5A2FA 2ICCA 5I75B 3ARDC 1MLBB 4MBRA 4Y5VC 4DFIA 3DIDA 2Q7NA 3ZHFA 2Y72A 1HXYA 5E8EB 1Q72L 4N9GB 2C3GA 2J6EL 2W80C 4OFKA 4P3CH 2EINB 1QPXA 2LAAA 3TASA 2P28B 4HKZA 1C9SA 5EOQL 1SY6H 4NKMA 3LKPA 3KLSA 1MRDH 3V4PA 1IM3B 3JUYA 4ADGA 5EWIH 2C9QA 1U8KA 2MRYA 3S36X 1KCUL 3I6KA 4OTXL 3GMMA 3DKHA 1GZHA 5E6IC 3GJEB 3M07A 3ULUD 1IBGH 1E2ZA 4X7CC 1SUJA 4ZBJA 5IMKA 1ZWIB 3N41F 2QZ5A 1QFWH 3OJ2C 4KNSA 5JIKA 4WUUA 3KWUA 1YNLH 1B3JA 1MHPL 4FF9A 3FO1A 2J8UA 4JY4B 2TAAA 4OFVA 4WKZA 1YCSA 4JAMB 4YAQB 1M9SA 1WTGT 4G6MH 4BUGA 4C58B 2NQ3A 4AXWB 3Q5TA 3V10A 3VFSB 3ZKXC 5GHWL 4Y5XB 35C8H 1PF3A 1CDUA 2WKOA 5IB5A 3VSUA 4F8PA 1BFTA 2FTAA 2C9VA 1I1YB 5K9OB 3RTQA 5CBAB 4L3FA 1MHCB 4KKCC 4AYGA 1GH7A 3QSKB 4NQCB 5A7BA 5B3JF 5L2KE 3GKWL 5DQ9B 3C08H 3PCYA 3CNKA 2AQ2A 4HWZA 4I2XB 4P05A 2FJSA 5IQLA 3HG5A 3RZCB 2V7NA 2EC9U 2IBZY 3WFHB 3PF2A 4NGHH 1YMMD 4PWIA 5KSBB 5HGBA 1IL1B 1OKEA 1MUJB 2D2OA 2Q3AA 2GUOB 1I1AB 3WKMH 3VD9A 1KCLA 5E24E 1UQSB 3VWKC 5GJTL 4JX0A 1IJ9A 1GPOL 2VN4A 3MLWL 2JWYA 2DWSA 4NN6B 1P5VA 4ZOEA 3WIHL 4IOIA 2AEIT 2XRAL 4PRPD 4KUZL 2QVIA 3ZDWA 4Z78B 1S7QA 1O7VA 2XTLA 2OKMA 2OV0A 5TDPB 2X9ZA 4M61B 4TNWF 4F2MA 1PS3A 4CVXB 5I1JH 4FZ8H 1KJ3H 5DLMH 1S78C 1WBYB 1TZIB 1QX1A 3IRPX 2G5BA 4OCXH 2OYMA 1Q9LB 3HBQA 1TCRA 3GRBA 3INOA 4Y2OA 2LTQB 4MZRA 3VFNB 2QGEA 1JVOA 4BXSV 5TPWL 4WW2A 3S5LA 3UL4A 3S4SG 3K81A 2DQCH 3NCYS 4FQ2L 3GIZH 5KSBF 2A9ML 3DRQA 2IQ9L 3MREB 4P9HH 5GS1A 4PJEB 2GITA 2IADA 3PGFH 4PJAB 2BSBA 5A43C 3ZGHA 4N28A 3MLSL 4MCYB 1S3RA 4NQED 5ID0B 1KG0A 2EYRA 3GTTA 2V33A 4QRQB 5HHVL 5CWSB 4LXFA 2RMNA 1FSKB 2IC2A 5CAYB 2DL9A 1TENA 5DRXA 4OLXH 3WY2A 2ED6A 4XP4L 4Y9EA 3W5MA 4HU2A 3R7RA 2I5YL 4LK4A 1VEOA 1WWAX 1FH2A 2E3VA 1TETL 2ADGA 1RJYB 4ZTEA 3TPUA 2AJVH 3B3IB 1T83A 3CPUA 4RMUA 1E4WL 1ONQA 3C5XA 3VA2C 2A6IA 3G04B 2N7SA 4DQOH 1PQZB 2HB0A 4AJWA 5IB2A 3VXTB 3H3KA 3IPBA 2K70A 1VKXA 2EUVA 3S37H 4L3CA 3VFVB 1XB8A 3LDBB 1HOCA 3N43B 4HUUA 2A0LC 4X7TB 3RGBA 2QGCA 4JL2A 2FX8H 4YUEL 4PJEF 4MXVE 5ICUA 4TSCL 4QXUH 5LGYA 3TH4T 3X1NA 4PJAF 3P9MB 4BZ2A 1PX3A 3K3QA 5DJ2A 4ZDHB 4NKDA 3KLAB 2Z35B 3B1UA 5HHPB 2FD6L 2LQRA 4L8DB 1VEMA 2AV1A 5H4YA 3GMLB 4NM8H 4QYOA 1HCVA 4NRXA 1B90A 1U41A 5DVOA 4HPYH 4QRAA 4HVBA 4PJDE 3FBQA 4IKIA 4YLBA 1DJSA 3G5XA 4L0ZA 3EHBB 4FCHA 1QSED 2ROYA 4K7PH 4L9LA 3VQ2C 2WVVA 3OZKA 5HYJA 3I6GA 1RIVL 2BIIA 4PD4K 2Z7UA 4Y16C 3BP7A 4CNIA 5IB3B 5F7DB 2XZQH 3K71B 1JPTL 3RL2A 4M1CC 5JHDA 5CO1A 3RFRA 3V0WL 1BPLB 1X5XA 4S1QL 1N6QH 2QPFA 4NZFA 4GUPB 5ENWA 3N43F 4KMTL 2UXGA 2XJLA 1JIBA 4TUOA 3U1QA 3MXWH 2N4IA 3CFCH 4FHJA 4H0LC 5K69A 2B1HL 2VDMB 3OLIA 3T09A 4P2QE 1X5YA 1WGVA 1ACCA 1QBBA 3OKKA 1I8UA 1QI3A 2V5TA 1XIWC 2IH8A 2VXTH 1KJVB 1II4E 1KTRL 4QHLB 4R5VA 4LEBA 2GJ6A 4TUUA 1HILA 5J13B 5E0QA 2CKBH 1IGTB 3CVDA 2HFFA 3SDXE 3U4KA 4F58L 5CJXC 3V0GA 3PP4L 4B0MM 1EA9C 5B38G 3O3BA 3LOWA 4YDIL 5IHZB 2GAZA 1ZHLA 4P23C 1X7QA 3CIQA 3RZWA 2MKLC 4YDKL 1SF3A 1URZA 1B9ZA 2IOMA 4H4NA 4I3SH 2ZOUA 5EF0A 4BFJA 2UX7A 4MD4A 5EG6C 1KT2A 2R9HC 4ANVA 1IC4H 1AFVL 2Y5EA 3ARFB 4RGNE 4TNVK 2EVIA 2NUTB 3CLEL 3GSRB 2BVQB 2ADJA 3TM6A 3LEVH 3QEGL 4ZMVA 3RGVA 1Y6MR 5GZNA 2A4ZA 2EDNA 3BZ5A 4TN9A 2J88L 2VLJE 3HZMA 3NEEA 4PP1C 1EFXB 1TVBA 4ZFGH 1GSKA 1KPVA 3VGHA 1MCOL 3H9HB 1G6RH 5IHHA 4BFRA 4HAKA 1U3ZA 3WAJA 4NNPH 1FGVL 3II2A 4QRRA 5I8OH 4DK6A 1KY7A 2AQNA 4LCWD 1AMYA 2C9UA 4ONHB 4WHCA 1MG2C 1QNZH 3OWEA 2QVTA 4BKSC 3U0TB 5D5MA 3S3DB 4QXTB 4OCSL 1E9QB 5ACLA 4XZUA 1M7DA 4AC4A 1S7RB 1WGOA 2CBMA 3RWIA 3P69A 2JE8A 3OLDA 4HXBL 3CC1A 5MERB 3LSOB 5TK2A 4S0HA 3H2QA 3HHMA 4LLYA 2YPVA 3BKCL 3MV8D 1FAKT 4V1DA 5DO2C 1S7WA 4JB9L 1N3NB 3ECUA 5TFSL 3NSYA 4PWKA 3LNDA 4JDTH 1DL7L 2WZPA 4UT9L 4R7NA 4P46B 3VFWB 2OJEB 1AZUA 1MFBH 4KHXH 3PWPE 4UTAL 4PVLA 2PWGA 3WNNA 5LKNA 4UMSA 4CC4A 3AABA 3AJ7A 4WEEA 5GRYA 4BFKA 1XF4A 4WJ5A 3FFDB 2R4SL 2VLRD 1HI6A 1NUDA 1QLEH 1AHMA 2NUPB 5FKPB 5IM7B 4UQCA 2KPNA 3VNZA 3APNA 4JFTA 3NJGA 5E2VH 5HYEA 2YD7A 3LHAA 1INQA 4TL4A 1Z9PA 1CBVH 4Y2DD 3P0GB 4RGNC 4Z7AA 5AAWC 4POZC 1YYCA 4PLJC 4QT5A 4DEWA 1N18A 1MN4A 1CTNA 1SFHA 2AJUL 4AIXA 2J55A 5KYWB 2DQTL 4EZLA 1UWEH 1IQDB 4AC2A 5LN8A 3GO1L 2X0VA 3H42L 1B2WH 4Y4FC 4W6YB 1UADC 1PZAA 2J5LB 3H6AA 5AZ2H 5C0EB 4D0CB 3FFCB 3U9UB 2Y07H 3CBRA 2ADFH 3HE7D 1Z9SB 3TVMD 4KK6D 1OM3H 4K4KA 3EZ8A 4L1DA 2H6OA 4DKEH 1J18A 1INDH 2BH0A 5KSUB 4ZFOA 2VO5A 4GO8A 4AQOA 3NIFE 3BW9A 3LZLA 4NWUH 4QHUA 3IMBA 1ACYH 1HAUA 1GJWA 2ZAHA 5JORA 4JM2B 2DJ4A 2PYEE 4N85A 2B9AA 1CMOA 2IAND 2UYLA 1AHKA 2VDRH 3FUFA 4KVNH 1HH6A 3QCUL 2F8XC 2C34A 4PN6A 4Q4EA 4GMTH 4MJIA 1OAXL 1XGRB 1D2PA 1KLFB 4FYSA 2J5WA 1XR9B 3BIAX 3O9WC 1DFBL 2P5EB 5BZWA 4OZIA 1IVTA 2HUEA 2B20A 3S98A 5C0BA 4IJTA 1XCQB 4XX1E 2WGXA 2FBOJ 3H0TA 3F7PC 3PV7A 1SJVA 3QUKB 2YXWA 3F58L 1KNOA 1WZMA 2WMPA 4APQD 3BI9X 1XCWA 3RBSA 3HPJB 3IDYB 2Z1KA 5C6WH 3ME0B 2OZ4L 3TV3H 4U1MB 3JVGA 5AVZB 2Z31C 1LM8V 1EUUA 5GRJL 1MFEH 5EU3A 2W07B 3ZX1A 3CX5K 1U8PB 4KQ4L 4DP8X 4FG2A 2J44A 5JW4R 3VB9A 2WJ5A 3JVFC 1NBQA 3O6ML 5HGDB 3U82B 5FM5O 5K9JL 4ICWA 2ZCLL 1LDPL 3FB7A 2QR0B 4I4WB 2NY3D 2NZ9D 3IDXL 4CU8A 3HMXH 4IGBC 4JM2F 1T0NB 1CICC 4BCZA 4JUSA 4JO3L 5INCA 4LCCC 2A6DA 3RWCB 5HDWA 1DN0B 5E8NA 1MH5A 3V0DA 1ITBB 3QQ3A 4CSPA 3RTLA 2EKSB 4X9BA 4CL7A 3BJLA 4AIOA 2OR8A 4IU3B 3UTPD 1J48A 4GY4A 2O1AA 3EFDH 5F88A 4JPSA 3KJ6L 2TRYA 2YA1A 4HPHA 3BQUA 2GI7A 2XA8H 3BESR 4GH7B 4WWKD 2FEDC 4P06A 4AMKH 1PL3A 3QJUB 4L37B 1PAZA 5AKTA 5ITBL 4OQTL 4DOHE 4FN0A 3ARBD 1JPGB 5FDYA 2GK2A 3OF6A 3CG8A 3MBED 4P4RA 5HHNB 5B4MC 3LN9A 3P3RA 4JE4B 4GMSL 1UZ6F 2VUKA 4BK5A 1YEDB 4M7JH 2IAMD 3M1CA 1C1EH 2CHXA 4IRSC 4EZJA 2ITFA 3NJJA 4LNRB 1KTKE 4PHZA 1HHHA 4PP2A 2UZIL 5T1MB 5DHYB 1FFPA 5I0YA 1UGKA 4LKXA 3NBNA 4O02L 4FHKA 4Q2ZB 3QIUC 4NQDE 3ROLA 3WIFA 4NBYB 3K5RA 3L3OA 4AYSA 4J3SA 1G9NH 1JTOA 3GI8H 3GC3A 2XETA 3AREA 2FK9A 3QDGA 4EDXB 4MWFA 5C09A 3WFEH 3BZ4B 4IKNA 4QR7A 1RHFA 4MDIB 4HOMA 5E9AA 3DX4A 1S8DA 1BFVL 3G6AA 5F1KC 1TG8A 1TMCB 2F53D 4KO5A 3TZVB 3QJVB 1E50A 1GY1A 2I9LA 3PV6A 3QUXC 1NCCH 5LQBH 5CCJA 2X4TB 4BKTC 4R0LA 4MXWL 3I75A 1QUNA 1IAIH 4UCFA 3SDAD 1KPUB 3SZKC 3D39A 4IMKC 1AE6L 4IRZH 3P9LB 5MI0B 4Z1PA 2EDYA 5AW8B 4XH2A 3ZT6A 5CP7A 1KWGA 1SHXA 5FYLH 2F7IA 4EN3D 1ED3A 5E00A 3TBSA 5IVNA 2XA3A 3BGFB 1G7PB 4J3OD 1WFTA 4JZNB 5C0NC 1EMTL 2AAVA 2BY3A 2WNXA 1XH3B 1B6UA 3QZOA 3NP4A 2WAQA 5J89A 3MRCB 3B7RL 1PZ3A 1KJMA 2DIBA 1TTBA 4R3SA 3RU8H 4XPTH 2F18A 5LBSA 1RZIA 5DJ8B 3T3ME 1JZ7A 4ACPA 3KPSA 1F6AA 4K0OA 3CHRA 4JL1A 3LXCA 4GQPH 4M43H 4LAJH 3W0WD 4Z7IA 1I7ZB 2BVOB 4FG6D 3VGDA 1IGYA 5JO5B 3MV7A 2P1YA 4FKHA 1LO2H 2QQNL 5ITFA 2XZAH 4IRJD 2Q0ZX 5CCKH 4TPRH 1SXSA 4K7FA 1NCWL 2VXUH 3KPLA 4G8GE 4OJDH 4YX2H 4PS4L 4JEGB 2YGQA 4F24A 1E8ZA 1AZVA 2FATH 3AQXA 5JNYB 1CK0H 3MV01 5LXGL 4GRLC 5CEZH 4JFHE 4I5BB 3VGFA 3DGGB 1ASQA 3LEXA 1Y0LB 2HKHH 3D4GA 3P77B 5BO1H 2X88A 3FAWA 5CJQL 1H0DA 2WLMA 4L3EB 1KY6A 1OT2A 2YQ2A 1FCGA 3S96B 5I1GH 4ZW6A 4OLVH 4D9QE 1JF5A 2HVJA 3F12B 4JE0A 1F4WL 2EUXA 4U2YA 3RUGA 1HK6A 3UTTE 2AJ3B 5I1EL 4GKSB 3N55A 4UM9D 5EBMB 4FA7B 5LGJB 1QRNA 4NI3A 3PIQA 3ZTNL 4NYLB 5F71A 4TULH 2ZAIA 4I88A 5HY9A 4N2KA 3T2PA 3W5NA 1DJZA 5BZDB 5BVJB 1KMGA 4BKLA 3QH3B 1NEPA 1J0HA 5ADOH 2PW1B 2WBJC 3MJ9L 4XNYL 2EIBA 2R2CA 1UD4A 4G9FB 2DYPA 4FGMA 1JNHB 3VXSB 1IV8A 1LO3H 3VFOB 1M57B 4LHUB 2WVTA 3B5TA 3JV6B 4KZ0A 4OZFG 3OZ9H 4PRDA 3FS9A 1DO5A 1PLBA 4ENEC 4NHCH 3FH8A 4DGWC 4LLVB 5EZOH 3VA6A 5LGKA 3R8BB 2B7DT 1IJNA 2X44D 1HEZB 1SLXA 2YR3A 3B7TA 1OZTG 5D7SL 2VSCA 3U7YH 5HD8D 2E7CA 1MREL 1KULA 5KYYA 4ZS6C 4ELKA 5ACZB 1IRAY 4AV4A 2APTA 1N0XL 2IGTA 4Y4KD 3VXOB 2QPSA 2ZX9A 3VI4E 4NT6A 3MXVL 1WIOA 1IBZA 4HMDA 4YGVA 3CXDH 1P4IL 5I1DB 1PY4A 2IFGA 1EDHA 4X6FB 4AWJC 4W9GC 5D71H 3CMGA 3F04A 5D2NA 1DVFB 4ETYA 4Q14A 1RIUH 1U93A 4MNQD 1R24B 3UMNA 3KWWA 5E2JA 4JFDA 3H1ZA 5A16B 3HB3B 2O6EA 3IJYA 1G9MC 3OMNB 5ICYA 1TNMA 4JRYA 3MUGB 4KJQC 4YZWA 4A6YL 4XN7A 3WIIL 1KJ2L 2OMWA 3C6LC 4PGBA 4TLUA 2NXYC 1N4XH 1QEXA 3WGVB 2GHZA 1H15A 3QB7C 5DUML 4ZTOH 5FB8A 2NY0D 4IU2B 2APWA 2MFNA 3IFPA 1D5MA 4XOEA 3S8GB 3S48A 3QFJD 5C0DB 3KBPA 4KPHL 1WFNA 4Y7OC 4HSQA 3VQMA 2QVKA 1FDLL 1BAWA 5FR3A 2OMYB 3FN0L 3FONA 1E4JA 5EN3A 3JWDL 4N0FB 4GT7A 1UEMA 2XFGB 3TA3D 3FU7A 2A77L 4ZPVB 1A4JB 3MRKA 2OQJA 3D33A 3H3PH 5F0PB 3DJRA 4FE9A 5D4IA 3BRDA 2VYRE 4TOYH 5SWQB 2YAQA 4G8IB 4P5SA 2G60L 2ZWSA 4ZFZA 1XGYL 3DV6B 3FRPA 3SBWC 1NGYA 2KLTA 3O11B 1FC2D 4NHUB 2QPUA 4LOFA 2KDYA 3VRJA 4PV8A 4Q8BA 2H2SD 3QIBB 2BMKB 4DCQB 1MJUH 5AVTB 3BRGC 2MPVA 1ZLWH 3QDMA 2YEZA 5I30L 2F74B 2A5UA 2V2WA 4LPXA 4G43A 2P5WD 4RMVA 1TJXA 4X6DB 3Q6GL 1R1CA 3ECQA 3AAZB 2W59A 1IBHA 2JCWA 5AUMA 4CMMA 4OFYA 5IFAH 2ATKA 5J1SC 2UWEE 3GJFH 1IC5L 3X1BA 1QZ1A 2XVLA 5J06A 3EH2A 3FCUB 4X8JA 2EH8L 3BUIA 5TGBB 1LNUA 3WNJA 4PV1C 4MA8H 3N85L 1AQDB 4W9JC 1DZBA 1U3HD 4GS7B 1R3KB 3I3BA 3HKFA 3A3YB 4NO2B 4UT6L 4XP1L 4Y9FA 3T4AB 3D05A 2Z91B 3EFOB 3MFGB 5SWSA 4J3BA 1P1ZB 3GMNA 4RCAA 5KVGH 4XNMA 3HS8A 3ASWA 1HZHH 15C8H 1OCZB 3QI9C 4URTB 1T6WA 5CINH 1JHLH 4H25B 5AB0A 1A1NB 1PKQB 1SXZA 4RIRB 1ESOA 4NXKA 5HGGS 4C56B 4X50A 5F7MC 5AAMA 3GS0A 3NA9H 3CVHA 3QPQD 4X6DF 4Y1SA 2R15A 3CXFA 4HIIA 4F5CA 4G1MA 4M8RA 4KHTH 1ID2A 2XV3A 1B4JL 3TBWB 1CD0A 1H3VA 3K6IA 5DK2B 3V4VA 2QADB 5EU5B 1XV8A 4GLRH 4RSVA 4PJCB 3B2UD 2XG5B 3WNIA 4BFFA 1LHZA 3L4CA 5CP3A 2DDQL 1JERA 1ECYA 1VA9A 4I0PD 1EHNA 1KBPA 2FO8A 1UM5L 1J5HA 3SGJA 3CFEB 1BCIA 2E9JA 4C4UA 2ZYIA 4Y5VB 5EF1A 1EANA 4G9DA 2GBAA 5FYKH 3CZJA 3BSZL 2WIMA 3WV0A 1AZNA 5HGAB 3L45A 3KLLA 4NRYA 1RK1B 5BS0B 2ID5A 1MF2L 3U46A 1U2HA 3TH3T 5K9QI 5JPNB 4U1GC 3G5VA 3QC6X 4LVHB 4RZCB 2WLZA 2AKRA 4PIBA 5T5NG 3TCLB 1VAHA 4WVRA 4X80H 2GSMB 3ILDA 4KJYA 1A6VH 2YD9A 4JRXD 4O2FB 4GXUM 3AC0A 2WN3A 4F7EB 3LPWA 1BW8A 1UOWA 2Q2LA 4FL4B 3OLGA 4PJFA 3C5ZA 5FLUA 5G5DB 4ABVA 5IJDC 1IBFA 1KC5H 4I0KA 4F9PC 5B8CC 4HT1H 5I15L 2BVPA 4UTBH 4PJCF 1IE4A 3G9VA 5IQOA 2WVSA 3CFBB 5GGQL 3X14A 1X5KA 3BLPX 4OLYH 3L4UA 3ZKXB 1I4FB 4WNQB 4YSDA 4QRPA 2X28A 3EF7A 4B6ZA 1K4DB 2HT4C 2D3JA 2V9QA 5DZOA 1R3LB 2F54E 4UOW1 4RBPH 4FMFA 2CGRL 3KXFB 4LVNC 3WEXB 2NT0A 3CU1A 1NLDH 2JJUA 3HRZC 2BINA 2CWRA 1QZNA 2Y69B 2B77A 1T5WB 1JZDC 1D7BA 2B1AL 4N8VG 1N7ML 4OB5H 4YHZH 1MNUL 4FQQB 1RUQH 4JS7A 1KBGL 3CSTA 4XMZA 3Q44A 5D1XD 2RD0A 1RSFA 2BP0B 2ITDA 4YL9A 1WBXA 5I9QB 5KTEL 1NWPA 2OMTB 2JJTC 3MRNA 1CXFA 1FYTB 1DLFL 4FQLH 2ESVB 3L95A 1G9EA 1MCNA 3CFQA 3CVBA 2EXWC 4UTCA 1RZKH 1LD9A 5CZVL 1ES0A 3Q1EA 2N56A 1F5WA 4YK4B 5AYQA 4R4BA 4M6OH 1RUKH 3PWLB 1B0GA 1VFAA 1CZ8H 3KD4A 1J8HD 5ISZE 1CU4H 4U7KA 2B3IA 3ZE0B 3BH9A 4RH4A 3RIAK 4LBEB 2UZYA 5D70H 3ARQA 5I73B 3D0LB 4X5WA 4JFZH 5I76A 2C9SA 2DQGL 5HGHB 5JPMA 4WK4B 4QJ4B 4M5YH 1R3JB 1WPCA 2PCFB 2MCPL 4OGXL 2G4GA 3LJ3A 5T1KA 1IB5A 4UT7H 1QFWM 4YHMH 1HIML 3EYVA 2RFXB 2AVGA 2YKKA 3FUJA 4HS8L 4WTZG 3M1BA 3BO8B 4WU5A 3AS3A 3JTSA 4HC1L 3Q8AA 3QG6A 2VJ0A 3O3AB 2Q8BL 3PS6A 5GGRY 3X13A 3X1GA 4WUUD 1LK2A 1ETZA 3OAYH 1MFDL 1V05A 2PP7A 3WO4B 3EO0A 1KELL 3HCVB 4HWEH 3G5YA 4TQ8A 3ISRA 1E6JH 2WLIB 2OBGA 3T1WA 2VISB 2DTSA 1VFMA 2VM4A 1CE1L 4R4FL 4WNJA 5DD5H 5C6TH 3ESNA 1RZGA 2BCMA 5EUOE 3H9SE 4OZGA 1H8OA 3ZE0F 3WTTA 4OFQA 5L88L 2ZKMX 3IF1A 1PZCA 3RTQD 1R75A 1A6TA 5LO7A 5DJDA 3WN5A 1IT9L 1WJ3A 1U4EA 5DUPH 1M05A 1T1WB 4Z7NB 1UB6B 5KSAD 2CKNA 2DI7A 2ZCZA 1NEZB 4X6CE 4JZOA 1T20B 1HWGB 2CK2A 1BZEA 3JWDC 3T65B 1AGCA 1CTOA 1H9VA 5T33L 2H0FA 1ZA3B 3GSNL 3PFUA 1KACB 2MSPA 3LIUA 2E9WA 4G80A 3BN9C 3LXBA 2DLEA 1QASA 2BOLA 1U58B 2DTMH 4WFEE 1VDGA 1T1ZA 5D1QE 1TZHB 4M00A 4FA6A 4P2OC 3G6JA 3AWEA 4AENB 1HYRC 2Y7MA 4LDEB 1ET8A 5AW0B 4JDEA 1OP5K 4QWWD 1BMWA 1DO6A 2DQUH 3PQYA 3T0BA 1L9SA 3DX9B 3OV6A 1T1XB 1I1RA 2QVFB 3CSFA 1QSFA 4G7SB 2YWZA 3KG5A 4L8SA 4MCZA 5ETUB 2PWHA 3FUEA 4Y16B 1PEZA 1SJHB 3TBYB 5GGSB 1UYWH 3FQRB 4P48A 4FFZA 3SQBB 3VWJC 1TXKA 2F7RA 4OF3A 4F9LA 4FQXC 3RPIB 4KOCA 5LCVA 2NLJA 3HAEA 1OZUA 1SY6L 3GSUB 3CFKB 1T66C 4GP8B 5BV7H 2CIKA 1MRDL 2GSGA 5JOPD 4MZ2A 3MBXL 2M2DA 1AOZA 4IDJH 1K4CA 1AXSA 1BECA 4OBSA 4WIQA 2C3HA 3K74B 2G3ZA 2YPLD 4NFBA 3VD0A 3KNBB 4AEFA 4F7KA 2Q8AH 2IPUG 1NBVH 1FFQA 1HTYA 1KB5A 3K2KA 4KI5E 1TF4A 4U6VH 5GQBA 5CU9A 2VMCA 2JKIS 2Y6SC 3AY4C 4G6ML 1AKJD 1YEKH 4N2LA 1OF2A 2IG2H 3QQ4B 2EZ0D 4P2RA 5E9NA 3MLRH 35C8L 4AYFA 4ZO6A 1P4UA 1V54B 2VDQH 4LLDB 4JHZA 2V7HA 2H8PA 3HW7A 4GRWF 4HFUH 4JQXA 2GKIA 1XSOA 1JHKH 4G42B 2APBA 1ICTA 1WBZB 2XICA 5F2FA 3C08L 5D1QC 5TDNB 5B1CA 4PJ8B 4QJ3B 2CJSA 2QSCH 3A6OA 4X6EB 4OD1H 3KLDA 3EJPA 1J0KA 5E2TH 3D85D 4FXKC 1HU8A 4N5UA 2HX9A 3EO9H 5E1AA 3VXUD 1KLUB 1M6UA 5IB4A 2P9RA 4QOKD 1EEZB 5JIPA 3WKML 3C87A 3FHEA 3ELQA 3ZO9A 4UBDD 1NM4A 3WL9A 1HKLH 1SN0A 2XVBA 1FG2B 3PAZA 3ARZA 2F1AA 5F0LB 1PYWB 1AH1A 2IBGA 1IGJB 4OLZH 3CSPA 5K39A 1BZOA 3C60A 3B5HA 4XN5A 2BS71 2YSSA 4G6KH 4JKWA 4MHHG 2J71A 1ACXA 4G6FB 3FSOA 1Q8MA 4NZRL 5I1JL 4FZ8L 1KJ3L 1JGUH 5DLML 4BYHA 3BCFA 1XF5A 1NGXB 2G75B 2QQKH 3EDDA 3TN0D 2WINB 3GIVA 4MAYB 4OCXL 5TDOA 2C9PA 1ZLVK 3P4MB 5DLLA 3ES6A 3S0PA 3VGAC 3ZK0A 2HN7B 1X9UA 3WS3A 5DDHA 5I5IA 2RGSA 3DXAE 3FTZA 4ERSH 3LH8A 1DR9A 5L4IA 4KI5C 4BA8A 5FO2A 2G5UA 2DQCL 4BWWA 4PBVC 5E4EB 5F0JB 1ID5I 3GIZL 2L4OA 5E8EA 4E41E 4P9HL 3KH4A 3Q2CA 5F44A 1TUPA 3MJGX 4ZXBC 3PGFL 3ZN6A 4YN3A 5J6GB 3FAXA 3D3VE 2GHWB 3X12B 3O6FD 4N24A 1F3RB 5TE4H 2PO6C 1WFUA 3GJEA 4H44C 2Z65C 3K8MA 1PNCA 1S5HB 1ZWIA 2X9WA 4A37A 4ZFFB 2NR6D 5AG9A 4OLXL 3PJLA 5ES4B 5E7FA 4X9GA 3IE4A 5KAQF 1UXLA 4JGUA 2VITA 3DBSA 4JY4A 2DM3A 4Y4FB 4BELD 4JAMA 2VLJB 3EYQD 4WI4A 3TJEH 4LEEA 3DLQR 2AJVL 2FECL 3TJHC 1JZEA 4N0YL 2W8CA 3VFSA 1JTTA 4KITB 4Y5XA 4M6NH 1NCDH 2WWMD 1PJ9A 5HDBB 3EYFB 3S37L 4F20A 1I1YA 2GFBB 3MCYA 3X11B 5K9OA 5LG6A 5CBAA 4UOQA 3NACH 1OQXA 4H40A 3X3FH 1MHCA 2H26B 4PQXA 4QXUL 5AL0A 4HIPA 3ARUA 4NQCA 3FUHA 3BCDA 3GHBH 5EEZA 5DQ9A 4ZAKC 2FLMA 4XPAL 3CC5A 3B56A 2C3WA 4QRRD 4I2XA 4H26B 1WQVT 3FB6B 4MYPA 3RZCA 3WFHA 3FN9A 4NM8L 2H0PA 5AEAA 1F1AA 2H32H 3PHQB 1BZDA 4HPYL 4KK8D 1KPRB 3O9WB 5F6IC 4OF0A 5KSBA 1IL1A 4ONOA 1AC6A 1MUJA 1HCYA 2GUOA 3ZL1A 1T7XA 4K7PL 4H8WL 2YAPA 1I1AA 4DZ8B 4GUOA 3G08B 3DX1A 4G6JL 3CDFA 3ISYA 4EIBA 3MRHB 3P73B 1GCFA 5D7IE 2E6JA 2OYLA 2IOIA 2Z31B 4TRPH 4Z78A 3QUMH 1WC7B 1HL5A 2FX7H 4GT0A 2WZPD 4N26A 5HDBF 1UJ3C 1AXTH 5TDPA 3SO5A 1A7RH 4M61A 5E70A 3MLZH 5E4AA 2ZCHH 2NW2B 3ULUF 4CVXA 5C97A 3V52H 3WI9A 4Z7OB 2HH0H 3T6VA 3MXWL 1YMMB 1E5BA 3CFCL 5KSVB 1TZIA 5D1ZC 4XB8A 1F8TH 3V4PH 1EAPB 2B4CH 4IGBB 1Q9LA 2VMJA 4PS8A 3VFNA 5A7EA 6CGTA 1B6DA 4ACTA 3FU9A 1YYLH 4NP9A 2X1WL 3MACL 1CUOA 2VXTL 2Z34A 4XWOC 2Z8WC 1J8KA 3RVTD 4PRPB 4WK0B 1WFOA 4BRJA 3HIZA 4WF7A 2CKBL 4ZX4A 1C8QA 2CDFB 3MREA 4PJEA 3EJSA 4PJAA 3T6QC 1KXQE 3PPSA 2AXJA 3KGUA 3D0VB 3ASOB 4PW9A 2JH2A 5ID0A 1SXNA 3Q5YA 1QLRB 5I66B 3P2BA 2H3NB 4PW4A 4XVTH 5IBUG 2EE0A 3U25A 1EAOA 4QRQA 4BSWB 2VUOA 3NIFB 3NCJH 5CWSA 1YY9D 1IC4L 3ZDZE 2CJUH 2D4FA 1XL4A 1OTTD 3FT0A 2FL5B 4Z7OF 3HI1B 1MVUB 1N67A 3LEVL 1GGUA 4PVBA 4Y7MA 5H35B 1U2CA 4TLKA 5KS9B 1MCHA 1ZE3H 2Y7NA 1JSYA 4F7MB 5HYQB 5KBNC 4JKKA 1CD1B 1A3QA 2GSIB 1RJYA 4U0RC 3B3IA 1NDMB 3VG0H 1NL0H 1TYJA 3OQRA 5CGYC 3G04A 3WGUB 1PQZA 1QTSA 3PDOB 1G6RL 3VXTA 3G9AB 4NNPL 1BOGB 3VFVA 5JIMA 4X7TA 4E9XA 4MJID 3TO2B 4Z23A 5I8OL 3T0VA 2PF6A 3TPKA 1QNZL 2F1EA 3P9MA 4XAWH 1XEUA 4N2CA 4CC1A 2IMMA 3IGFA 4ZDHA 4EI6A 4P5TD 2OXGB 2Z35A 3HC2A 3KLAA 4R97B 1A7OL 5HHPA 4L8DA 2JK5B 3GMLA 1W0WB 1CFNB 5HHME 1Q90A 1T4WA 1ZA6B 3TWYA 1ILUA 1YEFL 4FLRA 3X1FA 1BMGA 4HJJH 2NXZC 3WXWH 4JDTL 5KS9F 5FPIA 5J11B 2PETA 5EUKB 5IB3A 1MFBL 3POHA 4K23H 4KHXL 2XXCB 4LF3A 4LSVH 4LIQL 1TYEB 4YSPA 5F7DA 3K71A 4LB8A 4I3RL 1PLGH 1QLEL 5DA0B 1RK0B 5C07E 4GUPA 4CU7A 2P46B 5DVPA 2DYSB 3KPRE 2HRPH 4CSTA 2X0UA 3PGCB 5E2VL 2FLRT 3COOA 1IGIH 1QSEB 3O81A 1CBVL 1SJXA 3EFFB 3O8XD 3SDDC 4ELMF 5IMMB 3SKOB 4ZMWA 1WSST 4W1TA 2NQDA 4KJWD 5DD1H 4BUQA 1KJVA 4QHLA 1BZ9B 3P4OB 3B2VH 1QMUA 2O5ZH 2XCMC 4ZFQA 3IKCB 2CA4A 1IGTA 1ETJA 1B2WL 3HVNA 3BJ91 2ZCKH 5FS5A 3GLEA 5AZ2L 4JPWH 5IHZA 4XNUH 4G6AC 4UYPA 3BKJL 4U1JB 2ADFL 4MA1C 1T22B 4P57B 4NNXA 1OM3L 4EEEA 3BMWA 4DH2A 1ACZA 1DLHB 3U4BH 1CTMA 4DKEL 1INDL 2ENPA 3VD5A 4X4ME 4HULB 1NCHA 3ARFA 2IJ0C 4NWUL 1CXHA 4PJHF 1ACYL 2NUTA 5HYSG 4K94H 2E4TA 3GSRA 4TTDC 3ZE2E 2BVQA 4J6IA 1AG0A 4XCEB 1RIHH 2MOGA 2VDRL 3A0OA 3QDGD 3PWJB 5LWYH 5DD6B 1ZOXA 4HLZG 1SNRA 1VLXA 3QUZD 3IDMB 4WI7A 3BEWB 3H54A 4PIRF 2XTJE 4CUCA 1IAIM 2XG4B 1GJUA 4UZGA 2D7QA 2IGFH 5I8EB 2RAMA 4TUKH 4I0CC 4PJ5A 1JNNL 2WZ5A 5IY5B 4ONHA 2QHRL 2WBJB 2WJ7A 3SGDH 5KG9B 5I6OA 3U0TA 4HHGA 2DKUA 4QXTA 2FJUB 3TV3L 5IVXB 1E9QA 1W6LA 2ZOKB 4MD5B 4PG9A 3LH2H 2ADYA 3ZKSD 1RXLA 3LKOB 1GGBH 1HNGA 4UQ9A 1MFEL 1S7RA 4YJZL 3KM1A 3KBFA 2CO6A 2ZXDA 2X4PB 1P7HL 1USZA 2VERN 3LSOA 4GSRA 4DGVH 1MVYA 1WRFA 3CFJB 2OMXB 2NY5C 4XI5D 1LLAA 2R83A 1JGVL 1OB1B 5DD3H 3UGUA 1N3NA 2AQSA 5L0QC 3HMXL 4ALAL 5FECB 4OZFH 2F9BT 3F7YB 3LN5B 2OXHB 4HIQA 1D6VH 4I9WD 2EP6A 4P46A 3VFWA 4G8GB 4ZUSB 2OJEA 4R9HA 4B0MB 2AI0L 5A2IH 1CVRA 1RSYA 1ZGLM 4RQQB 4AJYV 1DDHB 2VW7A 5EIIB 2OL3L 3MJ6A 1MJ7H 3FFDA 4PAZA 1XMWA 2NUPA 1DFXA 2EIZB 5FKPA 3C2AL 3EAKA 1DJXA 1YSOA 3EFDL 5IM7A 2QV4A 4L4VA 1TDQA 4H1LG 3UYOD 5KVEH 2XA8L 4NJ9H 4TNVF 3MV8B 5FYLD 2B59A 4MNGB 4AMKL 2YD5A 3MSPA 5IVXF 5ABDE 4GEJA 4HAGA 5DZJA 1GTFA 4GIOA 2BVUA 4U1SB 2A9BA 3IFOB 3C9NB 2I85A 1XF2A 3OXSB 3JWOH 1ZY9A 2R2BB 4M7JL 5KYWA 1C1EL 1R34A 4LSSH 4OM0H 2VLRB 1AANA 2Y36H 1IQDA 4L3AA 2E56A 2NXYB 5FK9B 4AQ1B 3BZFB 1FZOB 5C0EA 4D0CA 2XTJC 3AT0A 3AADB 3FFCA 3U9UA 4FQHB 1Z9SA 4ODVH 5F7BA 1G9NL 3GI8L 1H19A 1E4KA 4UQ2B 1QHPA 3O2VH 1ORQB 4FNQA 3SJVE 4NN5B 1H3PH 3WFEL 4UDUB 3O4LE 3IRZA 3INUH 4HZLB 5K9KB 1VGEL 4KXZI 4LDOB 4YZFE 2UVFA 4JM2A 2WP3O 2BS8A 2EVJA 4Z9KB 3L1OH 2PYFB 3QXWA 2OI9B 1NQBA 4HZ1A 1NCCL 5LQBL 3MGAA 4GSQA 1BBJB 3SE8H 1W72H 1XGRA 4FXGC 2YZ8A 1IAIL 1XR9A 2P5EA 3EJQA 3HE7B 4NUPA 1Q0XH 3TVMB 4IRZL 1XCQA 3WJJA 3PJNA 3MNVB 4ADJA 4N87A 4X2UA 3QUKA 5EOCL 2PABA 3N42B 5FYLL 1HXMB 4M7ZB 1OE2A 3D4YA 5BJTB 3AB0C 1TZGH 3HPJA 3ME0A 1EIBA 3V5DA 4U1MA 4W9DC 1FZJB 1R6VA 2XUWA 3VYPA 3A21A 4KH2A 2IANB 2FEEI 2W07A 3ATEA 2WWKO 5F21B 4JY6B 1U8PA 2F5AH 3KYKH 4DP0X 3RU8L 3RHWK 4DPBX 3DTUB 1JMZA 2KKQA 4WSGA 3IK2A 1MW3A 4XPTL 5HGDA 3WMQA 3ZZ1A 4B9ZA 2HJFB 2ZUTA 4I4WA 2QR0A 1QPKA 3QORC 3LTVA 4DFHA 4M43L 1T0NA 2DZEA 1SLUA 4XX1G 3SCMA 2VDOL 3KDMB 3RWCA 2XZAL 4U1KA 5CCKL 4TPRL 1DN0A 1XH2A 1JXJA 2VXUL 4Y9BA 4O02B 1C12B 2EKSA 1F6LL 5GS0H 1NIAA 2WLHA 4PD4J 3CFTA 4LSPL 1L4IA 2WNWA 4IU3A 2AK4E 3L9YA 4JFDD 4BH7B 2DYRB 2X41A 3R18A 4LNVA 3RX9A 4KXAA 2FATL 3N42F 1DANT 1CK0L 3B9KD 3NIGB 5CEZL 1XD0A 1RUMH 4Z7UE 3EJZD 2MOVA 1T7VA 2NY3B 5BO1L 5KYXB 1GIGL 4GFTB 4L37A 4ZW8A 3HNVH 4OGZA 3GXTA 2NNAB 3FUIA 3UBXB 3WNMA 5I1GL 3Q06A 4IQHA 4PSPA 4OLVL 5GZOA 2VSMB 4PJ9C 2AJZB 4JN2B 1WP6A 4A2FA 2X6BA 2P44B 4LGPB 5H37A 3SDYH 4APXB 4BFBD 4BUHA 5CD5D 4DP7X 4LNRA 5F3FA 5T1MA 3N3EA 4YDMA 5DHYA 1PAMA 2VLKD 2XY1A 3B2MA 4TULL 5I8KL 4V2BA 3RRQA 3V7AE 2A73B 4YBQD 5M95B 3LRGA 4WFHE 4WWKB 4YSOA 2E7MA 1BZQK 1VF5C 2A9NH 3BVTA 3N1PC 5HVWA 3WUWB 2B0SH 4Q58C 2Y6TE 3POCA 1UA6H 1EO5A 3SE6A 1SDAB 5ADOL 3ARBB 3MRDB 4JREC 4HBCH 2HJLB 5CEYB 3U7AA 2CO1A 3MBEB 3BZ4A 3VAEA 5D4HA 3PWNB 4MDIA 3NIGF 1LO3L 1FHNA 3OJDB 1E28B 1KIQB 5LAXB 1DUYB 3TZVA 1F18A 4NHCL 2L8AA 2W92A 3CDZA 2X4TA 1CLCA 4JRWA 1OE1A 3D18B 4CC0A 4UILH 1BSIA 1P5UC 1I7UA 2Z8VC 3QWRD 1XMEB 2GTQA 2W1NA 2OMUA 3P9LA 3U7YL 2EC8A 4PGZA 4YPGB 3EIFA 1USQA 2FT8A 3QIWC 3CHQA 2VUYA 1YAZA 3E1ZA 4YHOH 5F3BB 3AXHA 3OBAA 4DZBB 2APVA 1G7PA 2WSKA 2XV2A 1JDAA 2H45A 4JZNA 5JXED 1Q9OB 1QP1A 3FCBA 4RRPA 4MB3A 1XH3A 5E0FA 3ZDYB 3U79A 3CBKB 3U4EB 3DTDA 3MRCA 4FJYA 4OCLC 2PXYC 3CXDL 2FQFA 2X89A 2XN0A 2HT2D 4OCRH 1NIEA 5DJ8A 1TEFA 2AQ1A 5D71L 5T3ZH 1FH5H 3O2DH 7CGTA 1RIUL 4XAKD 4ELME 1I7ZA 2BVOA 3BXNB 4PJBF 2XIDA 5JO5A 1I3RB 1SXCA 1MJ8H 3ATBA 3KYOB 1IAOB 1MQKH 3HG4A 4R4NC 1VB9A 5I0DA 5IBLD 3VD1A 3BPNB 3RKDD 4WUKL 5DRZA 2E74C 5ECGA 4UOZA 3HC3H 1G94A 3ESMA 1N4XL 2G0KA 4RA3A 1R9FA 4ZTOL 4MLIA 5JNYA 3MQIA 5D7LB 4I5BA 4KTEH 3TU6A 3IN0A 2NY6D 4GBXC 3ZKND 1KENH 1Y0LA 3P77A 3FC8A 5I1AB 3GLZA 3OVUB 2BNRA 4PWFA 3J2PA 3ZDYF 2V9TA 4MD0B 2ICWI 4L3EA 3OGOE 3S96A 3E2HB 2HP4A 4KFZC 3QGVA 2BK8A 2X5PA 3F12A 1YO4A 2XVGA 2PTVA 5B1AB 4F7PB 4TOYL 2QL1A 2AJ3A 4GKSA 3N1FC 5EBMA 5I6XC 5LGJA 1V3KA 4ZUVB 4NYLA 1NC2B 4M1DH 3MGOB 3ZYOA 2VN3A 4J3OF 1UOLA 1FP5A 2J4WH 2O5NA 4F2FA 1UM4H 5BZDA 5BVJA 3RVWC 2V8MA 1MJUL 3LQAH 3QH3A 2RH0A 4YH6A 1SXAA 2PW1A 1B4RA 1SHMA 2VR3A 1JNHA 1ZCRA 3VXSA 2GIYA 3VFOA 1BQHG 4JJHA 4LHUA 2OSWA 2AXFB 3DX8B 2A4EA 4GQQA 2NY7H 1W2KT 2Z4TA 5DGQA 5IFAL 4LLVA 1AI1H 1CI5A 3V0FA 1MELA 5DMIH 1BD2E 5C08E 3HZ3A 3TBVB 4N5ED 1QTPA 2AANA 1XSJA 4LBAA 1NSNH 4A6YB 5ACZA 3RVUC 1KJ2B 4MA8L 5EB9A 3T1FB 2W0FB 2J6WA 2ZUWA 4HISA 3EOTH 2WWNA 3Q2WA 3VXOA 5TF1H 3VH8B 4XVJH 4HEME 1NTDA 3KPOB 4OZ4B 3MOAH 1EH9A 4FFTA 1LEGA 5KVGL 3WHXB 4FQPA 1QO3B 2FGZA 1HZHL 1MW2A 15C8L 2BO0A 5CEZE 3ESOA 2W0LA 1G9NC 5CINL 2X2IA 1JHLL 3FTSA 5I1DA 3SE3A 3HUJF 3QAZB 1P84K 4TSBH 4EOWL 1CL7I 2YOAA 1DVFA 3F7VB 1CF8H 1R24A 3P3SA 4ZO7A 2K3HA 5BRZD 5A16A 5ISZB 2FJHB 1L9NA 3UDWA 4Y4KB 4AZUA 3GMRB 2D7TH 3GHEH 5FYJH 4PCKA 3UGEA 4L2LA 5GGSY 5IJVB 3V6OA 3MRGB 4AK1A 4M5TA 4XCFH 3B6SA 2N1TE 4LVOC 3IBOA 4JJ5B 3ZKMC 3KLHC 1FWXA 4ANXA 4KX7A 4Q9BA 5HHOA 2VAAB 4IU2A 5FO9B 2XTSA 3LZPA 5C0DA 1RL1A 4C8XA 1S9KC 1KOAA 4IKKA 2OMYA 1S9VB 4MNQB 5JZ7D 4KK5C 3HN8A 2DV6A 3BEVB 1G1YA 3HKZA 2W9EH 3M86A 3QXDB 1NGPH 3PAVA 1ZANH 1KB9K 2X4QB 3SY0A 4AEIH 1A4JA 3RNQB 4RA0C 4JHBA 1CDJA 1NICA 1U92A 1TQVA 3K4AA 1XD1A 4BGLA 5SWQA 4G8IA 2X4RB 2ICEB 4HXAH 2NY0B 1WS7A 3DV6A 5CM1A 2VDNH 3H9SB 3QFJB 3O11A 4X80L 2JTYA 4PRIE 4NHUA 4L1LA 2Z7ZA 3QIBA 1BVNT 2IWFA 5DHEA 5E2WH 2BMKA 1BLIA 1NAKH 4DCQA 1KC5L 2JMRA 4D9RD 3TWCH 2KDGA 3TA3B 4HEPA 4GSDH 2F74A 2IDFA 3FQWB 4TNEA 2E7HA 3PJSB 1W8NA 4X6DA 2I7SA 3AAZA 5IEHA 3RIFF 5I6NA 8CGTA 3ZYIA 1BHGA 4M3JA 4XBGB 3TBTB 1A1MB 3JSSA 2V5YA 4ZQTA 3THMH 3ARGD 3NYKA 1HHGB 3OR7B 4TLSA 4YHZL 1AQDA 3GNMH 1RUQL 3V0VB 3FHQA 1R3KA 3A24A 1T89A 4NO2A 3T4AA 3WUWG 3FBKA 1YECL 4HG4K 4HGWB 2DMGA 3EFOA 2ZAGA 2JI2A 3A4AA 3BDBA 4FQLL 1NGQH 1TU2B 4U0QB 4NFCA 1IC7H 1RZKL 1M42A 1SEQH 2BNQE 4H25A 1A1NA 3JZYA 1PKQA 4DJMA 4Y5YB 3R1GH 4RIRA 2NMSA 4HSCX 4BH8B 5A6MA 3UP1A 1ZHNB 4D9LL 3ZXAC 1PG7W 4M6OL 4C56A 1RUKL 2AHIA 5JA8B 4EUPB 2V5MA 1LMIA 1CZ8L 1LYQA 2Y3NA 1U3HB 3LPGA 2XKNB 3S37X 1XGPB 5AVSB 1JZJA 1P9MA 2EKJA 1XF3B 4S1DC 1O5DT 3D4CA 4WRLA 5DK2A 1AO7E 2NYYD 5D70L 1QKZH 4DGYH 2BVEA 1U21A 2ZSWA 5MEQB 5I6KA 5EU5A 4JFZL 3VXRD 4PJCA 5GRUH 2B8OT 2FUTA 4TMPA 5DFVC 4DEPB 4M5YL 3UBHA 3CXHK 5J12C 3CFEA 3NMEA 1A6UH 4UT7L 4Y5VA 2VH5H 4XXWA 4YHML 2HCZX 5K9QG 3SKUD 3VSVA 2BP8B 4K7PX 2F8VA 2IH3B 2EIKB 1I82A 5HGAA 4N2DA 2ZP0T 3O4OB 4MKMA 4M8QB 3MNZB 4NBXB 4F2EA 5BS0A 4W9HC 2H3XC 4HWEL 5JPNA 2XWBB 5KWYC 2AFNA 4U6XB 1DQVA 2DF3A 3N06B 4N2EA 1E6JL 4QLRA 2R1XA 4RZCA 5EULV 3CQQA 4QMEA 3TCLA 5C6TL 3HI6H 2E5EA 4KJPD 4TUJA 4IBLT 4LCVA 4I0PB 4U3XA 5FGSA 4CN6A 4X99B 3QQDB 4DUWA 4O2FA 1MCWW 1AGEB 3FTVA 5F97E 3BWZA 3UTPE 5G5DA 4M7KH 5I0XA 3QPXH 2F7OA 3KVPA 2Z92B 2ZNXA 1MIEH 3CFBA 1PCXA 3KR3H 2XNAB 5DUPL 1RUPH 1I4FA 3EDFA 4WNQA 4AE0A 3U2JA 5GS2H 5DU7A 3K0WA 2EUZA 1K4DA 2HRLA 4GPVA 1KTJA 4F57H 3KCPB 4FERA 5I1CH 1R3LA 3BE1L 3KXFA 3WEXA 3FQ1A 5TE7H 5EZPA 4JRXB 4KO6A 5JMOC 1IGMH 5LNDA 4QY8B 3HA0A 1M2VA 1BXAA 1T5WA 3K0YA 4KUCD 5ABAA 3ETBF 4WO4C 1NANI 2DTML 1OL0A 4FQQA 4F7TB 5C70A 5AD0B 5D6CB 2BP0A 3CVHH 5IT2H 4JHVA 2XWZA 4Q6IC 5JHLH 2OMTA 1HH9B 2YAFA 2FH8A 4P5MB 3HN3A 5F6IB 3H6JA 1FYTA 4KX9A 5HDOA 4M7LH 5IOPB 1FVEB 1RU9H 1U8HB 2ESVA 2IDUA 2EDQA 2DQUL 4FD0A 1TSRA 4K8RC 4OUOA 3BIKB 4WV1B 4FLOA 3N9GH 1GMEA 2CBPA 3FSVA 5CP3H 3KDPB 1UYWL 3C8HA 3DC0A 3IXAB 3PWLA 5FYKE 5HI5C 2ZNWA 5IROA 4HS3B 5H94B 4PY7B 2VM3A 4FZEH 4JZJB 2CD0A 5D1XB 4LSTH 4KMQA 4BK4A 1LO0H 5FGCE 3D3VB 4JFFE 5SWZD 5BUPA 4PJXE 4LBEA 3VH8G 3WNLA 3FQNA 1JI2A 3AGWA 3D0LA 5HGHA 1U95B 1Z9OA 3F01A 1XCTB 2D3NA 4KDTA 4JFEE 1R3JA 1VHPA 3D25B 4F91B 2X70B 5KN5B 1IM3D 2Q8AL 3HS0C 3LNEA 3QR2A 3GXDA 1NBVL 1DBMH 4LSQH 2A6JB 5F7YC 4ANUA 3DOSB 2RFXA 4U6VL 4YHLH 3QRFM 3NPSB 2W65B 3B9DA 1JGDB 4HH9A 3BO8A 1J8HB 2O61B 3T5WA 1OAUH 1YEKL 3NCBB 1IVLA 2IG2L 3O3AA 5AWNH 3HCVA 1O9WA 3GSNB 1T2JA 3PNRB 5IR1B 2VDQL 5KJRL 4Z7VF 3RJOA 2WLIA 3UAJA 5DZLA 1DBKH 2VISA 5A3IC 2VDPH 4HFUL 1DQJB 3BC9A 1U8JB 5DZ9A 1JHKL 1FGNH 4L5FH 1G4RA 2FSEB 3BYYA 1NCAH 4U31A 5FA3B 1OTSD 4TNWK 1HCZA 2GTZB 5E2TL 2EACA 2K8MA 4FTDA 4U0RB 5E8OB 1UT2A 3GPEA 1T1WA 4MQTB 1UB6A 4P3DA 4NFDA 1CDCA 3OR6B 4LMQE 4RMWA 5G55A 1ZV2A 3UEZA 4PG2C 2FR4B 1I9JH 1NEZA 4PRBB 1T20A 3P1VA 3RZCD 5JDSB 3HUJE 3N50A 3P4NA 3PDGA 1Y7VA 1ZA3A 3TF7C 1MCKA 3FJTA 3TCTA 4QTIH 4OLZL 5AZEH 2Y1YA 1JWMB 2FYVA 2NY4D 3I9AA 4XVUD 1I3UA 1U58A 3W82A 2O6PA 3RWFB 2X2YA 1XBDA 3GSOB 4G6KL 1N68A 1RV6X 3IS1X 5I5MA 3N0AA 1UWXH 4AENA 1JGUL 4LDLB 4OGYH 3MLVH 2QQKL 2O5YH 5MENE 5KSAB 3OKMB 3TIDB 4TV3A 4B9FA 1KXHA 2NXZB 4EI5C 4OIBA 3DX9A 2AXGB 4YPJA 4JM4H 3RJQB 1T1XA 2Z64C 2X2HA 3BAYA 1AHWA 5DZAA 1ORSB 5ETUA 2B08A 2DWTA 4NLHA 4Y16A 2P49B 3ZTCC 3TBYA 1SJHA 2H2PC 5F0MB 2X1QA 5GGSA 2LLNA 3J8F7 4OGAD 3FQRA 4XMKH 3EJRA 4LMQI 1PNDA 3SQBA 4AGQA 1DQQB 4ERSL 2XQYA 2IPTH 2N7BA 3CH8A 3RPIA 4N90D 2XFXB 5KVMC 1NFDB 4N6RB 3GSUA 2WGNB 3CFKA 5T1DH 3DMMC 2WV3A 3Q9QA 4NPKA 2YSTA 2WKOF 2ALWA 2Y7SA 4CVWA 1E7VA 3L17A 4FQIL 5TE4L 3I02B 2J56A 2HT3C 4XP6L 4MNHB 5AKSA 2HX8A 2D9CA 1A5FH 5ICZB 2WVUA 4HPOH 3KNBA 5L8KB 1EXHA 1LDSA 4M1GH 1TJIH 4BQ9A 3LZFH 2XVKA 3PRZA 1MFNA 3DPDA 4F15B 4KMLB 5C7XL 1P6FA 2P80A 3IGKA 2NNRA 3QQ4A 5E6SB 1TJGL 3W11C 4MA1B 1CGSH 3IDGB 4M6NL 2RALA 4M93C 1NCDL 1E9OB 4LLDA 4IIQA 4A2LA 2PTTB 4AOFA 2VZSA 3NACL 2YBGA 5SV4A 3X3FL 3BD5A 2YPLB 4PRNA 2K7PA 4LSDA 1NFDF 1AS7A 4G42A 4LASH 4PRAB 1WBZA 3MRIB 2JCCE 4HKBB 2DN7A 5TDNA 4PJ8A 2CBOA 4WGKA 5FW6A 4J6RH 4Z3TA 4X6EA 2I25N 1PZ5B 5HHMB 1I9IH 1AKJB 3SDCC 2H9GB 1JGLH 1OHQA 1WEJH 4FYTA 3L6FB 1KLUA 1T6VN 1X6LA 1EEZA 2WLJA 4L9DA 4TSAH 1F0LA 1QBML 3NUKA 4KKLC 4I77H 3QEUB 4HGKC 3AXLB 5C0FB 3OGCB 4WW2F 1FG2A 4HLZH 4BSVB 1AZCA 1HQ4B 2J6EA 2VR5A 4MX7B 1PYWA 3V4LA 2GEQA 1IGJA 2DIEA 3HG0A 4ZQKB 1RHHB 1XDTT 3WIAA 1DP0A 5IWLA 3QUML 1WWBX 1RZ8B 4CA4A 1AXTL 3ZU8A 1A7RL 3UERA 3MLZL 4LE8A 3D85B 4OI7A 1FBIH 2ZCHL 4HUNB 4M4RB 5KANG 2J73A 3V52L 2HH0L 2K9UA 3HAEH 3IDUA 3VXUB 1NGXA 2AERT 1ADQH 2G75A 2L7EA 2WINA 1J9QA 4MAYA 5EOTB 4LRNH 4QOKB 1F4XH 4BE5A 5L0QB 1I8LC 2B4CL 1D9KC 2HN7A 4OUUB 2AITA 1YYLL 4XTRC 1OK0A 3BLBA 2X87A 2WN2A 4O2CB 3SIKA 3UAEA 3VU2A 3WU1A 2YEVB 3EYOB 3JWNE 5D7JC 2QTEA 1KB5H 2DOCA 5EU6D 2R29H 5GRWA 3MNDA 1J0IA 3ARRA 5J6GA 4QPEA 3BPOB 3PXHA 3TN0B 3DX6B 3X12A 4GXVL 1TLKA 3QYCA 4LPWA 3BPLB 4XVTL 4EBQL 5C3LD 2IIJA 5F89A 5AAWA 3NCJL 2CRZA 1D5BB 3ZE2B 2CJUL 4HJ1A 3AQYA 1YUHA 1S5HA 2CA3A 4QHKI 4ZFFA 5C0RH 2YD8A 5C2BH 5I0ZA 1NDGA 2HG5B 1CPUA 2V9UA 1IKNA 4DIXA 2OR7A 3RWJB 1CXLA 2EYTB 4RISH 3R0NA 4FYQA 2IV9A 1W8OA 1QFPA 5B3SB 4XNAA 3QS2A 3VG0L 3UTSE 1NL0L 4JQVA 4JM0A 3MJ8B 1AGDB 3O6FB 2YMXH 3KEHA 2DLGA 1EDYA 1U8OB 2GVYA 3EYFA 4PPTA 3WIHA 4H0IA 5TQ2H 4CBPA 2GFBA 2XSKA 5A2LH 4RGOH 1LP9B 5GJSH 3NDZE 2H26A 1EFXD 3KW7A 5E6UB 4XAWL 3U2IA 4YL4A 4D8OA 5HI3C 3HG1B 1C5BH 5BV7C 1OAKL 1FLRH 1Z3GH 2CNYA 2VLMD 4H26A 3FB6A 2AJYH 4U6HB 4W4OC 4R26H 4JFUA 4FXGB 3PHQA 1KPRA 2OSLB 3QYMA 1PGRB 1X4XA 1M1SA 4GAAA 2VRAA 1A3RH 4FTVE 4HJJL 3IU4H 2B5IB 2H0EA 3ZUNC 4KKAD 3HE6C 4DZ8A 3G08A 1HEJC 3FH7A 2BIPA 2CKBB 1ZT7B 3UADA 4K23L 4LSVL 3DO7B 3MRHA 3P73A 1SDDA 4PJIB 3JWNC 1K5NB 1Q1PA 1QABA 1PLGL 1WC7A 1TPXC 3G7TA 3EJYD 4FQCH 1XXFC 4QRTB 2E8YA 3SYQA 3IT8D 2NW2A 4QO1B 2DWXA 1LP9F 4YDNA 4LARH 2HRPL 3DVNB 4KQ0A 1YMMA 5KSVA 3FB5B 3QORB 1IGIL 3AQZA 1EAPA 2QPEB 3GMPA 2CUIA 1U6AH 4IGBA 5HXMA 1D5ZB 3DJZA 1FV1B 5DD1L 1OARH 4O51A 4A2GA 2C3XA 2KC0A 2J1YA 1D5RA 2QFRA 3B2VL 3MCLH 4KO9A 2H47C 3QXUA 4PRPA 2VR9A 5JQHC 2VZ3A 1XB6A 2CDFA 1MCLA 3LKSB 4RMRA 2ZCKL 4PJ7E 1G6RB 3VXME 4JPWL 3D0VA 1OHZA 4RFNC 1H6FA 1G7JB 3E0GA 2DQDH 3QPQC 3BGAA 3T0EE 2EEAA 1QLRA 4PJIF 1T5XB 2H3NA 2PN5A 4LLWB 3TO4D 3U4BL 5K59F 4EI0A 4BSWA 3ML8A 2WP3T 5D2LE 5E9DE 2DH3A 3RFZB 4HQQL 1G7LB 1N59B 1F4YH 3MYJB 1ZPUA 4KKBD 4PJ9B 1Y1UA 2FL5A 4LPVA 3HI1A 1Q0EA 1MVUA 3QDJE 5I6MA 5H35A 3VCLB 4KX8A 3VFUB 5HDQH 3WNOA 5KS9A 4FS0A 4F7MA 1T7WA 5LWYL 5HYQA 3Q43A 1CD1A 1SOXA 2GSIA 2R51A 3OWRA 5FO8B 1NDMA 2YUZA 1MXDA 2FQEA 5FHBH 1KLGB 4XXCA 3PDOA 2F5BH 3CGTA 4TUKL 1BOGA 1FA4A 1NGWB 2DS4A 1TT6A 2ZUQB 4IMLB 5L9DH 3TO2A 2ICWA 1HZKA 1QLEB 1ZTXH 3VU1A 5HJDA 2P5ED 3N40F 3LXAA 3LH2L 3SGKC 1GGBL 3RWEB 2OXGA 2YEQA 5ERWA 2JK5A 4DGVL 2PW2B 2Q6WB 3OKLA 1CFNA 2C8NA 3CBJB 4GXUN 5CHNB 1ZA6A 2YUXA 3BZEB 3SKNB 3LNGA 3FMGH 2AQQA 5DD3L 2D73A 3KAAA 3NQIA 1D6VL 3HG2A 1T5KA 1LEKB 3BHBB 4KRPB 1T6BX 4LDCA 4OAWB 5EUKA 1NAMH 1YQ2A 2JF1A 3AM8A 3FHAA 2AK4B 1OVZA 1MJ7L 3LXUX 5BUGA 2J8UE 1KSRA 2CGYA 1DSYA 1RK0A 3L3IB 4P5TB 4EMZA 1QACA 1CQKA 1CXEA 2QQLH 4G1EB 3SPJA 1SJEB 4IYKA 2PXYB 3H2PA 4WTWA 2D03H 3T0EC 3DX7B 5KVEL 4NJ9L 5ESQB 3I9GH 4E5XG 1F3DJ 4XHJD 3PGCA 1QSEA 3K46A 3EFFA 2CRIA 4ZTPH 2DLFH 5EFIB 4HYTB 3DYOA 3SKOA 1L9TA 4KV5E 5IMMA 4GIPD 1OGAD 2Y23A 2VDRB 1BZ9A 2LVEA 1ZVSB 3P4OA 3HNTH 5CD3B 4LSSL 4OM0L 3DYPA 1NLBH 6PCYA 3PY9A 3VX1A 3O6KL 1CCZA 3K4ZA 5E1QA 2P7TB 3ORJA 4RSYA 2D2CC 5D96B 4FQJH 3QQ9D 2Y3AA 4KROC 1FF5A 2FO4B 4U1JA 3KPNB 4OZIF 4HJIA 1T22A 3EADA 4ODVL 4P57A 1GYAA 1NBZB 3L2NA 1DLHA 3O8XB 3O2VL 2ZKXA 2ODIA 5GS0D 5M94B 3CDCA 4IBUA 4LP5A 3INUL 1Z0MA 1G4MA 1JGIA 3GS4A 1CLVA 4NZTH 5FA4B 4XCEA 3CZEA 2EDFA 2GTWA 3GB7B 3AROA 4NZUH 5DYOB 4NCC1 2CBQA 3IKKA 3PWJA 5DD6A 3LS4H 4HKXB 5I18H 3SE8L 1W72L 3IDMA 4UT9A 5BZXA 3BEWA 1Q0XL 3QJHB 5JOFB 1ASOA 1VCBC 1GZHC 2XG4A 4LFHG 3TZVD 4UTAA 8FABA 5CJ8A 4CVUA 1SOKA 5MHSD 2OL3B 3ZE1E 3U30B 5HPMB 2WBJA 1AOHA 5FUOL 2R7EB 5I16B 4AKOA 5IVXA 4HJEA 2D7NA 2ZOKA 3NZSA 4MD5A 3K80A 4OCMC 4EQ3A 3LKOA 3FTGB 2OSXA 3F2LA 4J12A 3MAWA 3SPCA 1ROCA 2GJZA 4WI0B 2X4PA 1F90H 2F5AL 1HWWA 2HFGH 3KYKL 3QUZB 4HDIB 2JKNA 4CMHC 4U3SB 2OMXA 2WXPA 4EE2A 1MDTA 1OB1A 3RTQC 2VM9A 4N2HA 3OM3B 5FECA 3F7YA 2R56H 3LN5A 2OXHA 4K3HA 5K1JA 3H4HA 3WHE0 2KT6A 5CKAA 4NX0A 1YUKB 1ZE3C 4P0DA 3NAAH 1JFHA 2N7AA 4RQQA 3BFOA 4WCYH 3VFRB 5GS0L 5EIIA 5DVKA 3ARSA 3FTWA 1BQKA 2QSTA 1A25A 1CS6A 1JPST 3TXAA 5AALA 4FI7A 4XCCH 2EIZA 3V0AC 3FZUC 1OWRM 1BPVA 4A7GA 2E9IA 4O4YH 3MV8A 3NJKA 3U1SL 2DQJH 1JI1A 3EJJX 4MNGA 4XMWA 1CFSB 1IEBB 4UQ3B 2NW3B 2XZZA 1EZVY 1QQDB 4U1SA 3FUMA 4H2AA 1ZLUK 3C9NA 3AQDA 4AX3A 4CN1A 1Q9KA 5C7ZA 3OXSA 2Z4QB 2IH1A 5HJ3B 1KCKA 4QWWC 1SF5A 3NCCB 2R2BA 3ZIMA 1IMHC 3SDYL 2GUYA 2VLRA 4LVOB 5FK9A 4L3ED 4AQ1A 4DAGH 5T3ZD 3BZFA 1HX0A 5AOIA 3ZT5A 3BAXA 1OT1A 4UM8B 5F1IB 2A9NL 1DVYA 1W0VB 2WO2B 3KS0J 4P8QA 2B0SL 3BD3A 5HYJE 4Y2DA 4WW2C 1Z5YD 2OZ4A 1UA6L 1JZ2A 1ORQA 4MAUH 1G1KA 3HHRB 4B3VA 2XXFA 4HBCL 3QZWB 4XOBA 4UDUA 5I71C 3ABZA 4KK9C 1D7FA 1YEWA 5K9KA 3I3EA 4MS6A 1BVNP 3OAUH 5JHDE 1RJCA 1E27B 3UG5A 4N9OB 1HKFA 5DMGD 4I1PA 3ZIYA 2PYFA 4WENB 4K5MA 2X3BA 4AYDC 3F85A 1BQ5A 1BBJA 2QGBA 4UILL 4G9FD 4DUVA 1WA1X 2VDOB 1M3JA 3HE7A 3TVMA 3QXAB 1ZGLB 4LHUD 3KVQA 1T7YA 2R59A 1HXMA 1QEWA 2QKIB 5BJTA 2GJ6E 1CIDA 2IGLA 5IREA 2BNUB 3QBTB 1FZJA 1CC3A 3DARA 4P4KD 3APCA 4U1HA 3LKRB 3MR9B 5K33A 2IANA 1T83C 4JY6A 4JGJA 4MMZB 1EO8H 4N6QA 3D52A 3RDTD 4PBWD 1EAJA 4OQTA 3OTTA 2V2TB 3NCFB 4OCRL 3V7MA 2HJFA 1TKWB 2AV7B 5T3ZL 1FH5L 3L1EA 3O2DL 3ZDXB 1NFIB 3P0YH 4OLUH 4K94C 4KY2A 1KB3A 2X7LB 3KDMA 2QEJA 1MJ8L 2H1XA 2WANA 1MQKL 2V17H 3LRLA 4O02A 1DVFD 3U0PB 1C12A 4XC3H 4GG8B 4NZJA 4V2CB 2WAHA 3K8LA 1TJMA 3HC3L 2R27A 4BH7A 4PGDB 1D5IH 3MBWB 2PLTA 3HVDA 4KTEL 4AYBA 2NSQA 1VADB 3DUSB 4YVNA 4ZUUB 1KENL 5KYXA 3EG9B 2YD2A 2X6UA 3V5KB 2KZ1B 2KI6A 5L8LB 3C6EA 2Z9TA 2NNAA 3NIDE 3F8UB 4E0RB 3UBXA 3L3JA 5D5ME 3OHXB 1UXSB 1WUZA 4Y1AD 2ZOWA 2AJZA 3Q9PA 4JN2A 3UGXA 4D0DB 4APXA 3HS9A 2CIIB 2CRMA 3ZDXF 4PRIB 1LVEA 3B9KB 4I48B 1P4BH 2A73A 5AW1B 4WWKA 3EXLA 4V1DE 2J4WL 2MCMA 5J12B 4AEEA 1TTFA 4PLKD 1PIFA 3MUJA 1J7VR 5FYJD 1UM4L 4N2NA 3UJJH 5KYUB 2WXJA 3LQAL 3ARBA 3MRDA 2HJLA 2SEBB 5CEYA 3MBEA 3SBPA 3LQZB 3RHWF 1FO0H 3KPMB 3PWNA 2IAMA 5F7KC 3OJDA 2DLIA 1E28A 1KIQA 5LAXA 3WSQH 1DUYA 4PJBA 3UYRH 2NY7L 2VLKB 3VM7A 1AI1L 1MFMA 3D18A 5DMIL 1CYXA 3LD8B 5FW8A 1R5WB 2ZUVA 5KZCD 1ZV5A 3WFCH 1NSNL 1U8MA 2FX9H 3JWOC 1IGCH 4YPGA 1K85A 2XIBA 3GMOB 4AGOA 5KVFH 1GXEA 3EOTL 1RZ7H 5F3BA 1FL3B 2I60H 5TF1L 4K55A 3MOAL 5CN3A 1Q9OA 1ILSA 3RGVC 1L9OA 5GZNC 4GRMB 3LRMA 3VI3B 3OB0H 2WXKA 3RWDB 4GO6B 4WGWB 3IAQA 1ERNA 1XSKA 2WD0A 2DQ6A 2NTFB 3JTTB 2VJXA 2ORBH 3SDAA 4OH2A 4MQSB 4XODA 4LGSB 4PJGB 5IW3A 2VXSH 2A74B 1CF8L 4JY5L 3HLAB 1DBAH 5HBBA 1I3RA 3WFZA 4EN3A 3US0A 3KYOA 4PRHD 1IAOA 3GHEL 1L0QA 3EH1A 3OKDA 3MCKB 5FYJL 2E7LC 4YIQB 2PPCA 2JJTA 4XCFL 3VM5A 2HFEB 5T5FH 1JUFB 5L2JB 3U9PH 2G9HA 5H37H 1QSVA 2DPKA 4OZHB 3VVWA 1N64H 4MJIE 5KEZA 3ET9F 2BSSB 5D7LA 2DQHL 1PEWA 1FPTH 3MJ9A 5C0BE 3QO1B 3QWOB 3BUYB 2R39A 3W0WA 5I1AA 1T0MB 5EEVA 3VI3F 2PR9A 3M7OA 4MD0A 2HTLC 2NRDA 2W9EL 4MVBD 5CEXB 3MV9E 4CC4C 1NGPL 4IRJA 1ZANL 4NZDA 4XN2A 4AEIL 2H5UA 2XN9D 3ARTA 3FO0H 3GJFB 5E95B 4F7PA 1P6WA 2R4RH 1K6QH 4PJGF 3WEMA 1CXIA 3FCSB 3QJTB 3KYMB 3CIAA 4HXAL 4YC2C 5A6IA 3AMLA 4ZUVA 1R3IH 3S3JA 4TQPA 2CPCA 3MGOA 3PREA 2NY6B 2KHAA 2OCCB 3QZMA 5C0AD 1FQ9C 2WQAA 1NAKL 3QCVH 4Z3FA 1A4BA 1PW3A 4ZNEA 3TWCL 2YWYA 3L54A 1MCRA 4GSDL 4MB1A 3W1ZA 5B7EA 4AUUA 4FFVC 5CJ5A 2AEPH 1U2YA 4QHNB 3FO2B 3QXVA 2YOCA 2YS4A 1UKSA 2AXFA 4ZPTB 3DX8A 4KRMB 3P9WB 1UM6H 2VOTA 3FUNA 4PH8A 2AC0A 4BE6A 5TE6H 4ODSH 2RB8A 1G7IA 3TBVA 3A67H 4LQ1A 2XQBH 3L4XA 3ZHNA 1CLZH 4FI8A 3THML 2UXTA 4A6YA 4UIKH 1EJOH 1KJ2A 3T1FA 1PD0A 2H6PB 2W0FA 2H4EA 5CLYA 3GNML 4Y2NA 4Q52A 2MWCA 3MO1B 3KXFD 1V3MA 4OZ4A 3KPOA 3V0HA 4KKCD 1E90A 2IV8A 1FL6B 3H3BC 5IF0A 5IHWA 5I1IH 1NGQL 3WHXA 4D8PB 1QO3A 2NX5D 5FDWB 1J5IA 4RNRB 2OTUB 2BY2A 4Z5RB 1P69B 3WKNA 1IC7L 5I5JA 1G87A 1SEQL 3DI3B 4ZW3A 3SPVB 3QG7H 3R1GL 2UUDK 4BFGA 1FYTD 1RERA 1UEYA 1JVKA 1FNLA 3F7VA 3OD3A 5D7KD 1A7NH 3O0RL 3MNWB 5ISZA 1I3VA 2FJHA 4Y4KA 4RDBA 5C09E 3CU7A 3GMRA 3VWKD 3JVGC 4JFFB 2YO3A 5IJVA 5I82A 3MRGA 4IBZA 3W57A 3CFMA 1KXVA 1QWUA 1ZSDB 1QKZL 4NM4H 3TCXA 4DGYL 4JJ5A 1YN7B 3EOYG 1MHHA 2IDQA 5GRUL 2FB4H 3V95A 1UCBH 2VAAA 1H5BB 3D39E 1B4TA 2BFGA 3CFUA 1S78D 1A6UL 1D6EB 1NCIA 1S9VA 2WWOA 2VH5L 1WISA 3JV0A 3QQNA 4MNQA 3BWAB 5BRQA 5SX4I 3BEVA 1JNLH 5BRZB 1LL1A 4J39A 5IFJA 4J1UB 1UFGA 3QXDA 1CFQB 2WO3B 4K71B 1D2OA 1L7IL 3RNQA 2ROXA 4PCYA 3L9RB 4DVRH 2BWDA 3ERXA