1G5GA

Fragment of fusion protein from newcastle disease virus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
422
structure length
357
Chain Sequence
DGRPLAAAGIVVTGDKAVNIYTSSQTGSIIIKLLPNMPKDKEACAKAPLEAYNRTLTTLLTPLGDSIRRIQESGLSQLAVAVGKMQQFVNDQFNKTAQELDCIKITQQVGVELNLYLTELTTVFGPQITSPALTQLTIQALYNLAGGNMDYLLTKLGVGNNQLSSLISSGLITGNPILYDSQTQLLGIQVTLPSVGNLNNMRATYLETLSVSTTKGFASALVPKVVTQVGSVIEELDTSYCIETDLDLYCTRIVTFPMSPGIYSCLSGNTSACMYSKTEGALTTPYMTLKGSVIANCKMTTCRCADPPGIISQNYGEAVSLIDRQSCNILSLDGITLRLSGEFDATYQKNISIQDSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the fusion glycoprotein of Newcastle disease virus suggests a novel paradigm for the molecular mechanism of membrane fusion.
pubmed doi rcsb
molecule tags Viral protein
molecule keywords FUSION PROTEIN
total genus 86
structure length 357
sequence length 422
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2000-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.490.10 Mainly Beta Beta Barrel Head and neck region of the ectodomain of NDV fusion glycoprotein Newcastle disease virus like domain 1g5gA01
2.60.40.1690 Mainly Beta Sandwich Immunoglobulin-like Head and neck region of the ectodomain of NDV fusion glycoprotein 1g5gA03
2B9BA 1ZTMA 3MAWA 4WSGA 4GIPD 1G5GA
chains in the Genus database with same CATH superfamily
1WUNT 4JO4L 3EJYD 1MCKA 2VDMH 5JOFB 2DIEA 2WTRB 1ZDQA 3MRRA 2WXKA 3VRLF 2J8UE 5ENWB 1OSZA 1CLZL 2WZAA 5EF3A 1TQUA 2RBLA 3OGOE 4WUUD 5ESAB 3U82B 1BYNA 3KW8A 1QNZH 3LSOB 2NQDA 2V5YA 4MNGE 2BWDA 3T3MF 3VXSE 1T4KA 2NZIA 2YK1H 1WEJH 3GINA 3PWPA 3O4LA 2BSBA 2BZ7A 2JNZA 1N2RB 5DRXA 1TPXB 1QLEH 5DYOA 3GJFK 2DJSA 4YSEA 1I8UA 1MUJA 2NXYB 4HC1L 1CI5A 4BWWA 1NFIA 3NIFE 3L5IA 3SQRA 1F90H 2FRGP 3PF2A 2A5UA 2EACA 3OHXB 4PJDF 5A3IC 3BKCL 3IVKA 5D71H 4MD0A 4TN9A 3STLB 1S8DA 4XWGL 3DDFA 3JWOL 4AK1A 4OM1L 5DJCB 5C0NC 1F58H 1FWXA 1QRNE 5EB9A 4NCDA 3ALPA 4H0LC 1MF2H 3NFSH 4MFHA 4AEIH 2X6MA 1F41A 5ICUA 2ZOLA 4WTQA 4Z9KB 5IOKA 1T7VA 1I1RA 2OMBA 3V5KA 5E9DE 4Z8FH 4I0CC 1R5VA 2IO5A 5IJCC 4HUVB 2J6WA 4F7MB 4X6CF 1D5RA 1BD2D 3STBA 1FIEA 2BJML 1PQZA 4W9EC 3B7SA 2D7TL 3QEHA 5C0JB 1BQSA 4ODXB 4AL8H 1R3HB 2ZSWB 5D4QA 3BUIA 4GAGH 3VXPB 3VWJA 2R69H 2WSPA 3WJJA 2VWEE 4URKA 2ZCKH 5FGSA 1CI3M 1SZNA 1D5ZA 1KBKA 1NZRA 2VXVL 4HKZB 2UV3A 4K23L 2YIHA 4QF1B 3Q1SL 4D8OA 2J3SA 2A9NH 3MCKB 1UB6A 3JYBA 2H32B 5J6GB 3HVNA 2JB6A 4B9ZA 1HZLA 1RUAL 1DDHB 4XVJL 2ADJB 1VPOL 4Z3JA 5CEXA 1J8RA 4ODHL 5BV7H 5T3ZD 3OKKA 4JZOA 4YPGA 3G5ZB 4UNVA 3WN5B 4Y16A 1KB9J 3PABB 4XNZB 4JKNA 4HUWA 1Y0LA 4U05A 5D1XC 4FNUA 1BVOA 3CZFA 2YARA 2I7OA 1CFQA 4LL9A 3O0LA 1WQVT 2P5EB 3KYKH 1UOVA 4X8JB 1TSRA 1I3GH 4TSCH 2VDPL 1CE6A 4PJDE 4ES8A 3FCTA 9CGTA 3DPBA 2H6PB 1MFAL 2FNWA 2WINB 4RMQA 3VWKD 5I76A 4ZTOL 2B4CH 1WE5A 4HH8A 4E9RA 4ZMQA 1RHFA 4CRPA 3U25A 3F7QA 2HX7A 4Y2OB 4YSDA 2VM9A 5DD6B 5DWUH 2Q8AH 2DLTA 2K6YA 2UX7A 2Y6SC 2W60B 4LIQH 3MUJA 5B1BB 4P4KC 1NDGA 3MXVH 1J1OH 4M43H 4W6XB 3OGCA 5B38B 4YHYB 1AD9B 3L3OC 1FCCA 2IPKB 3FRPA 3FT3B 2EIKB 5LCVH 2VJ8A 3QJVB 4IJ3B 1O9ZA 1QSFB 2R56H 4YX2L 5K9QI 4M93C 3B2XA 1IE5A 1EAPB 2XX0A 3QG7L 2OJ1A 3L9BA 3ZT7A 1D5XB 1EHLH 1NJ9A 4QGYA 4ZNCD 2D03H 2E75C 3MYJB 5FW8A 2EXWD 1O6VA 4GSUA 4M03A 4NKQB 2LT9A 3J7HA 1D5IH 1P7QB 1N59B 1PZCA 1MCRA 1SLUA 3FHAA 1UYWH 3IM1A 1OP3H 5BCAA 3SQBB 1WZKA 2NXZC 4IS6A 5C86A 4H0IA 1CE1L 5FO8B 4RFNC 3ZKSD 4P49A 5E5RB 3QCUL 1KLUB 4I1PA 3TEWA 3AG4B 2CHXA 1IEBA 3ESVF 3FTWA 4B5ZA 4HBCL 2F58L 2B1HH 1F4AA 2BSTB 5I1LB 2HLAA 3GJFA 2FUQA 2CO6B 1WS7A 2ZXQA 1GZHA 2WK2A 1F1DA 2VH5L 3VI3B 5KSBA 4B60A 5A6MA 3ENEA 5E6SB 2VXSL 4WZ9A 4Y5XC 1QKZH 1SGKA 5FYLD 2C7UB 1JVLA 4KY1L 4MHHI 2BY0A 2NT1A 1UM5H 2VLJD 2PXYD 4DIXA 4FZEH 3TEZA 2V8MA 3HCVB 2AXWA 4M61B 3IDIA 1F6AA 1YPZF 4N2HA 4WW2F 5B3SB 2UZXB 4MQXD 4TTDD 3QR2A 1DBAL 4LOUC 4PW9A 3PWPB 3WNLA 1QEWA 1ZA6B 4ZUSB 5G55A 2QR0B 3HZMA 2EP6A 5LXGL 5J0BA 4K15A 1A3RL 3ETBJ 3DOSA 3L3IB 6TAAA 1KJMA 4Y1AB 1CT8A 4HIPA 1HESA 4M3HA 4R7NA 1BOGB 4AQEA 4U1HB 1VFBA 4Q0XH 1O5PA 3TTYA 3HZVA 2EXYD 3T4AB 1ZA6A 2A73A 3BIKB 4PRPB 3P9LA 4HZ1A 3QNYB 4Y4KA 4PLJD 2EYSB 2Y1VA 4MMYA 2BXYA 2EXYC 2FO8A 4GKLA 1DQQB 2IOIA 2Z8RA 1QW8A 2MQ0A 1RZPA 3Q1SH 1QRKA 3LQAL 5F3FA 4D0DB 4E9WA 2FD6L 4G42A 1ACYH 5I8OH 3KNBB 4Y1AE 4DPRA 5MEQA 4BFEA 1UH3A 4HZAA 1Q9KA 2DICA 2PNDA 3DV6B 2VQTA 5E70A 1N26A 1ETZA 5ILTL 2ARWA 3CJJA 4HU2A 4LOUD 1BQLH 2X4TA 2VDPB 2YEZA 5AEAA 3ISYA 2RIKA 3GMQA 3BGAA 4GINA 4OCXH 4TF4A 5FYKH 4JRWA 3AITA 1WGVA 3T0DA 3MVSA 4JQXA 3LPOA 1IT9L 4PJDB 1J0JA 1WBXA 4IRJB 3QIUA 2AXHA 2H32H 1SDAB 2VXUL 4XODA 1Z3RA 2B9BA 4B9FA 3IGAB 1UZ8A 5GRJH 5C0DA 3X12B 1S7QA 1BXXA 4IDJH 1XH3B 4G7SB 5CKAA 3NEOA 1TZAA 3NACL 2PP8A 3GPSA 4PR5B 1WTLA 2KI6A 5IBTL 1Q94B 4LHQB 5EV7A 4K73A 3GEFA 3EH1A 3BAWA 4F2MA 2XTJB 5ID0B 3ZE2E 1S7TA 3C9NB 1D7BA 3CVHA 2GUOB 2Z4QB 4P4RA 2EICA 4B9YA 3MJ8A 4JANA 5KSUA 5KVFE 3MRFA 2MHAA 2YAHA 2BCMA 3T1WA 1M3JA 1AMYA 2EDOA 2NQCA 2UWEA 4KMQA 1ND0B 3KPSE 3ZRCC 1I4FB 3NIDE 4EZLA 4XXCA 3OR6B 4OD1L 1E9QA 4OLUH 4TSBH 4X7EC 5HDQL 4Q8BA 1KJ3H 4KBPA 4ZW3A 3Q2LA 1HEZA 4EIGB 5C6TH 2HKHL 3VWJD 1A8JH 3S5ZA 2SODB 1NBCA 1U8KB 2KDGA 2Q87A 3Q3GB 4UV4L 2BP5M 4CNIB 4HIJA 1KN2L 2YMXL 3WKNA 2VUOA 2O4EA 4DP2X 1IJ9A 3R1GL 2ATKA 4N25A 4PJ8C 4D94A 4YHIB 1BFOA 4KI1A 3CHSA 5DC2A 4PJ7F 4X4XA 4WO4A 3EO9H 4P23D 3B7TA 4G2AA 2NY3B 3VXMA 3E1ZA 3IB4A 1JBJA 3BP7B 2WXFA 4HX1B 3UZEC 2MPVA 2BSCA 3BZ5A 3MJ7A 3U6XS 1YO4A 3EOAA 4RZKA 4XPBL 3V95A 4BFBD 4F7TB 5L4FA 3UPRB 2R2EB 4WU7B 2EQDA 4GXVL 2PYEE 2WXLA 1LMKA 1KXVC 4ENED 2X0WA 2WGNB 4G71B 4OZFA 4QLRA 5EU6A 1LO2H 3Q9QA 1DVFD 2X87A 1NDTA 2VM3A 5IJKA 1TT6A 3UTZA 1TPXC 1KXVA 1VDGA 3T8MA 3TESA 4FP8L 1I8KB 1NAML 3LKRA 4CBZA 5KSBF 2AJYH 4DO5A 1GAFL 3QRFM 2WLLB 4XVSH 1EEQA 3KPSA 3LKQB 3P0YL 4NUMA 2XPYA 2Y72A 4WSKA 5HDBE 2YQGA 4HKBA 4PRHE 4G43B 4PRNB 4XX5A 3W11C 3QI9A 1CLOH 4HWBL 1UKQA 4FI6A 2HPTA 3B2DC 3F7LA 2FX8L 4FXGB 4OLWH 3AREB 5I6KA 3BP4A 4FYTA 4EF3A 12E8H 2H2SD 3FYEB 1NLBL 2A73B 3BIKA 4L3AA 4LCCA 1X5YA 4PRPA 3SE8H 1K4DA 3OLIA 3CMGA 1VKXA 3MRDA 3MRQB 5K5YA 4FQJH 3WS6A 3O2DA 1LE5B 3IRZA 2NNAB 4BV1A 3F7VB 2EDXA 2F54A 4XBEH 1IGYA 1NQBA 4ZFFB 3KPSB 3MLRL 3U2IA 4M1CC 5TPWH 4CADA 4MA1C 2BC4A 1WZ1H 1ZY9A 4U6XA 2BMKB 2A9AA 2OPCA 7PCYA 3VH8A 2C8NA 3DLQR 3JBG7 4JJ5A 4WVRA 2G3MA 5F89A 4XN5A 2J5LC 5LGHH 1IEHA 1HHHB 1XGQB 1XH1A 4AEHH 4Q2ZA 4IOSD 5GGQH 5GJSH 3TH2T 5C0CA 2YAQA 4PYGA 3OPZL 1XF3B 2XA3A 1JYNA 5DS8B 1NCUA 3T0EA 1J86A 4NWUL 2QHLA 3L1GA 3N2JA 2GKIA 4JG1H 5BOJA 4GP5B 4K7FA 5DJZB 4F7CB 1F45A 5HHQB 4KKCD 3IRCA 1OGTB 2AXFB 3RGBA 4NUJB 1T1YA 3L5XL 2Q5BA 1HYRC 1SJXA 4JFZL 5G5DA 5H4YA 6FABL 3RWJB 4OD2B 3SDCB 3SPHA 4FS0A 5F96L 3TNNA 4WFFD 5H37G 2E47A 1CCZA 1MIEH 1CK0H 2DKSA 3QNXA 4P5TD 3BD3A 4DTGL 3MRGB 1IM9D 3EO0B 3LN5B 3OR7B 5GS2D 3CCHB 4UV7H 3HI6H 3EHBB 5GZOA 2H3NB 3RWEB 1E8WA 2D2OA 4OFQA 4UAOC 5F1IA 4NN6C 5ECGA 3OAWA 5GIRB 2GIXA 1HINH 1SJVA 3RZCB 1HI6A 4ODVH 1A14H 5HVGB 43CAB 4BZ2H 4I77H 1RJCA 1UJ3C 2CBPA 5CKGA 5FHAL 1IC5L 4G9FE 3RWDA 3U4EA 5L2KA 1RERA 4PJIF 3U7WL 2A83A 3KEHA 1FH5H 2AITA 4J7RA 4NUQA 1KBPA 1A1OB 1HHGB 2NW3B 5FDWA 1MREL 4OJYA 4F9PA 1IBZA 1IU1A 1UJ3A 4FCAA 4EEEA 1KIRB 1HEHC 1OE1A 1G1CA 2KUTA 1EMTL 4DP5X 3DV4A 3CWGA 2ESVE 4ORGB 3P4NA 5JO5B 1CGXA 1L5GB 1H3WM 1KCWA 2DLHA 1TCMA 2OL3L 2Q7NA 1FNAA 4R4BA 2TRHA 2X6CA 5IEKB 1Z3GL 1Q4NX 3ULVL 5T1LB 5I8CA 1IFGA 5LXVA 5FYJL 5LKNA 2MOQA 4JFFE 2WXRA 5BVPH 3CXDH 5I0YA 4BZ1H 5KUKA 2KPWA 1NFKA 4X6CB 1R3HA 3VRIB 3Q2NA 2DMKA 4OZ4B 4AEHL 4NKOA 3VMNA 2NY5L 5DJYA 2UYLB 4Y89A 2F53D 2W9EL 1QBBA 4JFFD 4FF9A 3HBQA 4TNVK 3W0WA 2WNXA 3SDYL 1I9RH 1RP9A 2ZWNA 3KJ6H 5KEZA 4NQDA 3U46A 3JWDH 4NNYA 1RKRA 4L9LB 2H32A 4JFQB 5E7BA 3EW3B 3BGFB 1A8ZA 2ZP8A 4AQ8C 4BKLB 1RULL 5I71C 1KEGL 5KSAD 4XCFH 3KLDA 5E0QA 2WKLA 1YEWA 2F18A 3JWNG 5CEYB 1JWUB 4WTWA 1IJNA 5LGHL 1T83C 1MWAB 2AGJH 2BVPB 1TYRA 4BGLA 3PAVA 2OR9H 4X7SL 2C9QA 3C8KA 3UC0L 2ZYIA 1BCIA 1BGXH 1N70A 4UT6H 5I18L 2FIKB 3H3KA 5LG1A 5T1KB 2XV2A 4AIOA 1XIWC 5JHLA 1U4FA 3D5OF 2AQTA 2CBMA 4XNQA 3QORD 1VACA 2I07B 2ZUQC 2DMCA 4M1DH 2LU7A 3ECQA 4M9PA 4MVBD 4UQ3B 3V0FA 4E5XA 5AW0B 1GRWA 2BNQD 3MPCA 2AJXL 4WTZA 3U9UA 4FQIH 4ZUTA 2Z91B 3U9PH 1AXSB 5J1AB 3STLA 1DBAH 5J89A 1MCIA 4H8WL 2ENYA 3IFLH 3MRQA 2VR6A 3TYFA 5LXGH 2E3VA 4QY8A 5GRYA 3GO1L 4JVPA 3FB8A 2YRZA 2NY7L 4K3EH 3BO8A 2JJWA 2YWZA 5D7SL 3S97C 5I1GH 2RQEA 2KQNA 2VTFA 4N5EC 1F6AB 3MOAL 4UCFA 2EDDA 2VQUA 4RGND 3W39B 4BCXA 2JJSC 4XRCA 2NW2B 4BH8B 1JHTB 4O02B 5JQHC 2E27L 3OTTA 3GSXB 1C8PA 3F64A 3F6IA 4KKBC 4Q58C 2FQDA 1L3NA 5L6YH 3TA4D 4JFED 5FDYA 2V5TA 5C0RH 1ACCA 1GYUA 5I17B 1DEDA 5L8LB 2PPAA 1B4RA 3WKMH 4PMEA 1HHIB 4PS8A 5CD3B 1QHQA 1LGVA 1RZKL 2GK2A 3BWUF 3GJFH 4HIIA 4XXDA 4ABQA 4W4OA 4YLBA 1LWHA 4YVUA 4ZTEA 1JHKL 1FZJA 4K9EC 3D39D 5AYUL 1LEGA 1F3JA 3FTYA 3HE7B 4G6FD 1UD2A 2KDYA 1XL4A 4Z0BH 2QPSA 1E5CA 4TNEA 4O02L 5D55A 4HIIB 2W0PA 5DD5L 2Q6WA 2EUWA 2KS0A 1AVAA 3QG7H 1J7VR 3PP4L 3RY6A 1Z66A 5I1CL 1DVFB 5IVOA 4KOBA 4LPCA 2WYTA 3CZJA 1AR2A 1DVFC 2YA1A 4JN2B 1EDYA 1K6QH 3C6LD 3DUSB 4MD4A 1KIUA 1P5UB 2WTOA 4MCZA 4XVTL 1MW2A 4Y4FA 4DVRH 5FKPB 4A7UA 5L7XH 2C3WA 2OJZH 3U0PB 1TETL 5C9JA 1PFCA 4MTMA 2MRYA 3K5SA 4FMFA 3ARPA 3N1PC 3WY2A 1JPGA 3QNFA 3OF6D 4OLYL 5C0RL 4U7SA 3P0VL 4WGVB 1HX0A 1HZKA 3ZKNC 4GKNA 3TA3D 2HKFH 1U3YA 2WUBL 3QQDA 3DPBB 3NACH 2VMJA 3CUPB 3WNJA 1B88A 2R29L 4FULA 4HDIB 4KDWA 2FQFA 4HAGA 3W5NA 1PL3A 2DBJA 2G2NA 3RIAK 1A21A 4DW2H 1FFOB 5DQJA 3QYNA 1P84K 2LFGA 4S0TD 3K6NA 2H7WA 3OVUB 5I15H 1PZUB 2AJVH 2WWMD 4OCWL 4FCHA 4W9KC 1E50A 4JZJB 3SPVB 3PWNA 3HG1A 1DDHA 4KXZI 4UAOB 1UGNA 1QZ1A 5A2JH 1M2OA 5J12B 4X9FA 1URLA 5FOBA 3BXNB 5B4MC 2R51A 4JFOB 1DFXA 3VWJC 1X3DA 3DETD 4RVBA 1UFGA 3MLZH 5HHQA 1DUYB 4RNRB 2R69L 4APQD 2VXQA 1SVBA 4QEGA 1R3KB 1T7WA 3ECBA 4YDNA 4WLCA 1QQDA 4PY7A 5T1MA 3T8VA 1SUJA 4Z0BL 5GGRA 4ANXA 3IU3B 4EKJA 4LSTL 1VSCA 1MFDL 3H7LA 4AE0A 1OAKH 4HUMB 1FZJB 3RKPA 1Q1JH 4LP4A 3UJTL 2GC4C 3BKJL 5JDSB 3EHBD 4P9HC 4Z78A 1AXTL 3BSGA 1PKQB 1RUMH 1JXJA 3QS2A 5IK3A 5E8NA 4DFIA 4OZHF 4LSUH 5D71L 1B6UA 5KOVC 2ARJQ 5T3XD 4QHMB 4KI5C 4Y2DD 1YEGL 1DO6A 2MCPL 2VERA 5AZ2H 3KE0A 5CCKL 4BK5C 2HJFB 5AOJA 2ZUQB 3P4MB 4JFHE 4NO0B 5DFVC 2NW2A 3HHRB 2QSVA 4BH8A 4ZUWB 3MJ6A 4PTUB 1YNKH 5KOMC 4D0BB 4AQZA 4HAKA 1JGEB 3E2HC 1HTYA 2W95A 2QKIA 1DVSA 1B2YA 5HGDB 3B2VL 1PZAA 3MSPA 4LKXA 5IQ7H 2IJ0C 3WEBA 3RZCA 2OR7A 1I3RA 2IG2L 5D7EA 3BQUA 4JO5A 1ORSB 2MKLC 5F7EL 1KBVA 4MXQD 1EA9C 5A1AA 5T1LD 3CZUB 4ABVA 1ZS2A 5AVVB 5F1OB 4KXZH 9PCYA 1D9KA 4WHCA 1C7SA 4OI7A 3E8UH 5K9JL 2UZXA 3LXAA 2AEPH 2XTJE 1BZ7B 3UJTH 3QUGA 5T5FA 5ADPL 4FYSA 2HVJB 4KC3B 1WIOA 4UT7H 2UY7A 3ZE2F 4CC0A 2IANB 4FI7A 1RUML 5E6YA 2EDQA 3V5HB 3V8OA 4JK0D 3MBEA 1JNNL 3HN3A 4PRDA 4BFNA 2WBXA 3KPMB 4GG6A 3FUFA 3L4VA 1KT2A 1GR7A 4H8PA 4HUUB 4F91B 3QCUH 2NX5A 5I74B 4DKDC 1IAKA 3L3DA 5D96C 5FW7A 5C0AD 4QOKA 1TNMA 4ODTH 4GLRH 3AY4C 2OMZA 4U1KA 5KSVB 3EGXA 3HMXA 1DJIA 1FSKB 3TPUB 1A7QL 1FZOA 3BAKA 5IG7B 3WS3B 4AW4A 4WFEE 5F3HB 2FHCA 4NRZA 3L5XH 4LGPB 5CMAA 4KO7A 3EJZC 2F9BT 2X09A 3VM7A 5AG9A 4OF3A 2JQZA 1GC1C 3KD4A 1J88A 3EJQA 4UQBA 2WO2B 2X4OB 3L2LA 3S0PA 1WS8A 2YKLH 3LQZA 4NQCD 5F7KC 5I1IH 4JY5L 1MHEB 5IB1A 3NN8B 2QT6A 4NUGL 1IIKA 2OJEA 2BSEA 3MMEA 3NJNA 5C6WH 1YN7B 3VCLA 2C9VA 1EO8H 1XGRA 2YSSA 3FQ4A 3NDYE 3TCLA 3B43A 1T3FA 1XGTB 4LCWA 3V4VB 1JOIA 4UOZA 2Q7AA 4UTAH 1YY8A 3KYKL 1T1XA 1KELH 4G80A 4NCC2 3LNHA 1KIRA 1TDQA 1DQTA 2FSEA 1MFCH 2V9QA 3JYCA 3FB6B 4JFUA 5EC2B 4FQJL 1S3RA 5C09E 1DVTA 3CGTA 4O51A 5F7YC 1JGDB 1ITBB 5FK9B 3W38A 3PQYA 4OF5A 3K72A 1Q94A 5D1XE 2WM0A 5BS0E 5IBLD 2WLLA 2J71A 1V3MA 3U4BL 1VLXA 3BSZH 3EJPA 3HA0A 2X7LA 3MFFB 4JFEB 3FO2A 3VXNA 4HJUA 3QEQE 4MNQB 2YMOA 1LD9B 4JG0L 4OJFH 4EXKA 3OKKB 1F11A 1T1WB 4JL1A 2PCPB 1H6EA 1JIBA 4KROC 5DS1A 1FL3B 1ZPLA 3AU0A 3EYVA 1BAGA 2NR6D 1CYXA 3X11A 2JIXA 2YGOA 3MA9L 5IROA 4AL8L 2VR4A 5B7FA 4A38A 4M8QA 2GIMA 3EGXB 1ZLWK 3UFIA 3ZYZA 3LVEA 2Q8BH 4BRJA 2XSKA 4JKKA 4N9GB 2EE3A 2X4TB 1SXCA 4J3OD 1E28B 2DMBA 3ZGIA 4RGOH 3M07A 3MOBH 4MKMA 1MFNA 1NAKL 4HJTA 2WO4A 2NX5B 2P5PA 2ZCZA 3K6OA 1JGIA 3K7UA 3VD5A 1JF1A 2FR4A 1AO7A 3SCMB 1AQDA 3MJ9H 4GAJH 3ZRSA 3MV8B 3DNKA 5DJXB 3UOAB 2IOMA 2HG5B 4QXVA 2NUTB 3K71A 4A6YH 4RDQG 43C9B 3P4LA 1VIWA 4MAUL 1UACH 1X5FA 4JBSA 2LLNA 3I02B 5GJTH 4MAYD 5AVWB 1KGJA 4GMTH 4QRPD 5MENB 5D8JL 3G6JA 3O6KL 3ZKXC 1F0LA 3QDGD 5LBSL 1SXAA 2W1NA 1F3DH 4DGYH 1DBBH 5BMFH 1MOEA 5DJDB 3ZDYB 4G5AA 4FMVA 5D1QA 5I73B 2I5YH 5IQ9B 1EJOL 5F6HI 3IPEA 4E0RA 1YMME 2UWEB 3V0VB 4NZTL 5FLUA 4X6BA 1ZV2A 2PWFA 3FFCD 3T71A 3L3HA 3ULSB 3ILQC 4QYAA 2CRIA 4HS8L 3U7YH 3MLWH 4TPRH 1XCQB 2HAZA 1MJJA 3N9GH 4K94L 3V0AC 5BZDB 4Y19A 2PR9A 3CPLB 4TRPL 2BINA 4IEFB 2IDCA 1TLMA 3OKDB 1EHXA 2V5RA 3H56A 1HI6B 2OS7A 3D3VD 3LDBC 4OGYL 43CAA 5KUMA 5ESAA 1EO7A 3O2DL 4D9QD 5KVMC 3ROLB 5I1LA 4N0YH 3ZR5A 2ADFH 5HGHB 2X2UA 3NESA 2RQ8A 3VFWA 2APXA 4KK9C 5AWNH 3PP3K 4JRXA 4CW1A 2IFGA 3IJHB 2E9WA 4F57L 4PJHB 2EDHA 3HB3B 3ZE0B 3PAZA 3TNMB 5DEFB 1A6TA 5I74C 2E9GA 2EVHA 2XKSA 2DLEA 2OZ4H 1KEGH 5DO2C 1FAIL 4KVCH 3OV6A 1XGUB 1THCA 3TIDA 1BLIA 3CU7A 2QMKA 5D1QC 2J2ZB 3C12A 2VT0A 1XIWD 2FJFB 4BUQA 1SPDA 1C8QA 2RFXA 4ADJA 2X2JA 2C3XA 3EYOB 3MNWB 3SYCA 3I6KB 4CDHA 1F3DJ 2V6HA 3OKNA 4BSVA 4UNUA 1N68A 1H6FA 4Q9QH 3EF4A 4JY4B 3BVWA 4PJAF 4FEMA 4WI0B 3WNPA 1YC7A 2MFNA 2OYKA 1RZ7L 1OVZA 2IF7A 2JXMA 3GS0A 3TBYA 3HG1E 1OP5K 3QDGB 5J06A 2VR5A 1CBJA 2IEPA 2WN2A 2AKRA 5IQNA 4PVNA 5F72S 3RI5F 5EFIB 3VFUA 3VGAB 1IC4H 1BFVL 4IBZA 5D1ZB 3BVTA 4FQXB 2FB4L 1QTSA 3UXFA 2CUHA 4ZXBB 5BQ7B 3OG6B 3BZFA 2BVPA 1UA6H 3O45A 3OLEA 1XGZA 2IGTA 3QUYD 4HIXH 1FVEA 2LU4A 4G1MB 4L4JA 5AOKA 5EIIG 3F05A 2D9CA 2OSLB 4UILH 3TT3L 1MI5B 2IBZX 1JNJA 3BISA 4O58L 2MKWA 4TVUA 5F6IC 4ORZC 1WHOA 1JHKH 1AFVH 4BFRA 3WTVA 3K71B 2EC8A 1TKWB 3QQXA 4NQSA 3FCSB 4NQDB 4ZW7A 5BOZG 3QSKB 4FD0A 2FECL 4DKFH 4EI6A 2NY3C 4PRAA 4LLQA 3AB0C 4M5TA 1KCLA 3QDHA 3KR3L 2DM7A 4LLWA 3KYAA 1AY1H 1KIPB 2A2QT 1QW9A 4BQCA 2HT3D 1WAAE 3OSKA 4FFYL 4LKCA 4CN4A 2O5ZL 5HI4D 1CJYA 1EAJA 5EZJB 4K5OA 4S1DC 5H35B 4PJ6A 1VADB 3VTMA 1U8CB 1Z0MA 3HAEB 1OAKL 4N2EA 3VU2A 2P5ED 2VZOA 4N0CC 5M95B 1D5MB 4P5SA 4AQ1C 5DF0A 2Q9OA 1BWWA 3FB6A 4AEFA 4U7MA 4EXPX 2B5IB 4HJ0C 5IF0A 2BIPA 2R23B 4XPHL 2LVEA 3X3GH 2J8UB 4LCYB 1I1AA 1XGTA 1U8OA 2VR3A 4PGEA 3TVMA 1EIBA 1VFMA 2X7LB 4KKCC 2EO1A 3CFJA 3L3GA 2CLRB 5LCVL 4MB3A 1NIFA 2BK8A 3QUYA 4RCAA 4XZUB 4DAGL 1HQRA 3RWDB 3U4EB 3EOBB 3OAYH 3UGUA 3T2LA 1CT8B 4WWID 4NHUB 3ZDWA 4AVJA 1FNSH 4AEEA 2YJLA 3OJDB 1FRGH 1A66A 1N18A 5CP3H 3V6BR 1NCGA 3QUYC 5GIRA 4HWBH 4DGUA 1EO5A 3IDMB 2IDTA 1SMDA 2Y3NA 3QEQA 4GRWF 3GSNA 4ZTOH 4LPUA 5MP6H 1CDUA 2X4RB 4MAUH 5KVDH 1U3NA 2KPNA 1R0AH 4LQ1A 2ZZUT 3PWUB 2FIKA 4LLMA 5D1XA 5BS0A 1V27A 3H2PA 2CA3A 3FAWA 3GSWB 3OX8B 3BPOC 4AQOA 3BH9B 5LBGA 2YPVA 1DN0A 1XH3A 2VH5H 4QTIH 1LO2L 3H42H 4HD9A 1LO4L 2EUZA 1I9IL 3B2MA 4PB9L 2B1HL 3IDXH 1HHJA 1VPOH 4J8RA 3L3JA 4DKFL 1IM3B 3VRJA 3L5JA 4PREA 4BSWB 5EULV 5H8DA 3OQRA 4KKPA 3A22A 4IRJA 4YQXH 3WAJA 1KN2H 4RFOH 1W2KT 1EANA 2AZAA 3GBEA 3TFKC 3WHXB 3BMVA 3UIYA 1D5IL 4DGIL 3Q6FB 2EZ0D 3L3JB 3LIZH 5C0FA 3V10A 2X4QA 5ICZB 1RUPH 5E5MA 1TR7A 3QUML 4G1EB 4PPTA 4M5ZH 5LJYH 3RKDC 3ZTDC 4M6OH 4ZX5A 2W91A 4GPVA 4GIPD 1JZ7A 2C5DC 3ZDZE 3C6EA 4YXHL 3G7TA 1NFIB 4YHZL 2O61A 3RVUD 4NN6B 4JRXD 3BVVA 1FE8L 1L9PA 2BNUA 3KYNB 4MDJB 5AAPA 1TQCB 4AXWB 3TVMD 3UYPA 1MN4A 1UD5A 3WKML 4QRPB 3RDJA 4DVBA 2QTVA 4Z76B 1QFUH 3B9KC 3GXTA 2QVIA 2VDOL 1KENH 3EOTH 4JG5A 3WMPA 3Q2VA 4U1MB 1P9MC 1IGFL 5F0LB 4FADA 4GB9A 4N8VB 1A6AB 1SF3A 1DLHA 3TA3A 5J1AA 5CIPA 1QO3B 3SDXA 5I1JH 1DQML 4R8WL 3FQ2A 3JVGA 3KLLA 4Y19D 3OKEB 3ALXA 3C08H 2HT2D 5JW5A 1NMAH 3EADA 3WXWH 4Q9BA 4X99A 5E9DB 3KPOB 3NMEA 4NBXB 2HRPH 4Q9RL 3E6FA 1ZSDB 3T8XA 3RKDD 4L1DA 1KY7A 2LU5A 4JKLA 4K3JH 5I8EA 3TJHC 3WKQA 3RPIB 4Y19E 4JFZH 3IJ7A 4OCXL 3PJSA 4BFGA 5GGUB 2XIIA 2PO6D 4CC1A 4IDJL 5EO0A 4JDTL 1ES0B 4XPAH 3O6LH 3AU1B 3MCKA 3GJFB 3H3PH 1DUYA 1G7LB 2C4XA 3APMA 5FCUL 1JV2B 4NFDA 4OW6A 4Z78B 4Z7QE 3US0A 3OKLB 1KXTB 3N85H 3PWLB 4A68A 4YFLI 5ILTH 2HJKB 3MV7A 3MCLL 3UP1A 3AFLA 2ZWKA 4W9IC 1UENA 3F2LA 4HISA 4ZRGA 4GJTB 5FUCE 2Q7YA 4MNGB 2WCSA 1G87A 4ZS6C 8PAZA 2ZX5A 2UVFA 4I0PC 3IN0A 1MJ8H 1FORL 3FZUD 1PIFA 4AQ8A 2FBRA 2ZWZA 2HJKA 5G4MA 2VDRL 3NJHA 3H42L 1HU8A 3VH8B 4C83A 3FH5A 2ARJB 4KMLB 3OJ2C 4NKMB 2K8MA 2AK4A 3SOBH 3IDYB 4RGNC 5B7MA 3DJTA 4QHKJ 5EO1B 4S1RL 2WVTA 2NSQA 1IGYB 1DSFH 5IEKA 3MBXH 3JVGC 5EU7E 1M7IB 4L3FA 1OD7A 4L3CA 5F44A 3OGCB 5I1AA 1P1ZB 5K9OA 4ZBJA 2JB5H 5F0MB 4F9PC 1RJYA 3DUUA 2IH3A 4OI8A 1H6TA 3IXTA 3MRMA 5SWZE 3S34L 1S7VB 3RNKB 1S7TB 32C2B 4GQ9L 4HLZG 4X4ZA 5JIQA 4R97C 3L3OA 3I6GA 1BEXA 2YPLA 4Y4FB 1BBDL 2MCAA 4XAWH 4JPIA 3CPUA 1PDKA 2O6CA 4NQEE 4OJDH 4M48H 1JGLH 2WZ0A 4OLXL 4LO9A 5KYUA 2J4WL 1A4KB 4JMXA 2PMZA 2OFQA 3SZKC 3SDCC 3I9IA 3MBEC 4Z7UF 2HT4D 3OKMA 2QELA 2XWJB 1FV1A 3WJMB 1KBGL 4YXHH 5CHNB 3KBFA 1CGYA 1HZHL 1MCPH 4X9IA 4PLKD 2CGRL 4U33A 3B34A 1E4KA 1TQTA 3F00A 4GW4B 4RZCA 4U3HA 4M02A 4APXB 4Y4KC 4BINA 1T2QH 2PLTA 4NAMA 5D7IA 4HS3A 2BVUA 2FJGA 1J9RA 2RACA 2XN0A 4YBLB 3S98A 3CIQA 1D5ZB 3NZ8B 1HHIA 4XNUH 2QFPA 4KQ4H 3ZUCA 2ZKHH 4M7KH 2VW4A 3RGVD 2BWIA 2WSKA 4FFYH 3CVCA 1EUTA 1QLRA 4R84A 4NQDD 3FCGA 1HDMA 4YSPA 2EC9U 4XMLH 2CKNA 3C8DA 3LY6A 2R4SL 5E8PA 3JV0A 5GS2H 5F93C 2IANE 1NC4B 2ICWB 1B4JL 2QSCL 2VQ1B 3QDJB 3DJSA 4KUZH 3ZGHA 4CMHC 4EZMA 1J5OL 2DPKA 1JN6A 2AJVL 3D51A 4FERA 1HFUA 5HDQH 1DJWA 3ROOA 4G8FA 3ASNB 5B39B 4NO3B 3GUTB 4A2DA 3L8QA 3CVIH 4M5YL 5DHVH 3EFFB 2DD8H 3IJEB 4XMUA 3VO0A 2ZCHL 3CLEH 1CTNA 1FG2A 3JV5A 3PU7A 4AZUA 1AR1B 1KACB 1ZMYA 1OTUC 1KLFA 1A7BA 1ZT7A 4EDXB 5D7HA 4XBGB 1G5AA 2XBZA 3QJFB 3WFZA 4BEIA 2NX5E 5DWPA 1A02N 5EIIA 1S7VA 4XNMB 2IDUA 5I1GL 3W39A 3QIWB 3J27A 4M8UA 4PTUA 2OMVA 3INUL 3J07A 1WIUA 2X4PA 2H41A 4NNXB 4KDTC 3O41B 1HCVA 4A7SA 5AW3B 4S1RH 3BYYA 1DQIA 2JJTA 5ICYB 4L8DB 3B6SA 3S35H 1H0DB 4X83A 2DN7A 4BFIB 3BKJH 1TZGH 3ZLQC 1U93A 5E94A 2OTWA 4M1DL 4YFLF 1F42A 4MSWB 3G5YB 5CGYC 5B7EA 2D7TH 2UZPA 3EDDA 3UGEA 3UYRH 1L9SA 1A3LH 2ITDA 4N20A 4Q6IA 4TQEH 4P5TA 1U21A 3IGAA 4Z7WA 3SQBA 1PJWA 4G7VL 4UI2A 1OP5H 3PYCA 4YLQT 4UT9H 4OZGE 5EH1A 4A2FA 1ZTMA 3BAJA 4NQSB 5TFSH 3DMMD 5BUAA 1GAFH 3GXMA 2CGYA 3HR5B 4KKQA 1HILB 5F1NA 5FUZL 3D9AH 3UTPD 4Z8FL 2ZOKA 4RNRA 3S3BB 4M7LT 2H2PC 4U1NB 3CXHK 2ZPKH 2FJGB 2CKBA 4PJGF 1PSKL 4NYLA 4M4PA 1OPOA 3ERXA 4J4PA 4PM1A 4NOBA 5SWSA 1WPCA 4FHKA 1EAOA 5L6YL 3EYVB 1MRDH 3EF7A 4U6YB 1YY9C 5D72L 3Q3GA 1HS6A 2ADFL 4HGMA 4NSKB 5H94B 2AV7A 2CALA 3T0EC 3CQPA 3EUUA 2YGVA 3D2TA 1MCDA 2ZYSA 3SJVE 3KPRD 3OXSB 4H2AA 3ZTNL 1WBZB 3UZQA 1VFBB 3ZDXE 2K0RA 1XX9C 3LZRA 3NSFA 3TA3B 2AJSL 2M1KA 2X2IA 1FL5B 4WI6A 4F7KA 1AOZA 3V6ZA 1MWOA 2YXMA 1KYFA 2N7SA 1EZVY 3KPRE 4JPKL 2CE6A 2MHAB 1M1XB 3ABZA 2GSIA 3TM6A 2OQJA 1FYTB 3R4DA 4X42A 3T0WA 1HAWA 3LD8B 1YMHA 3IDIB 5A2IH 5SWSE 2BNUB 4KFZC 3K91A 3CVHB 3LZFL 3OB0K 3NGBB 4M8VA 2XWCA 4XNMA 3AS2A 1FNGA 1T80A 2XWDA 4XCNB 2BZCA 1M7DB 2X2HA 1NCWH 1FGVL 1ZWIA 4N2BA 4KK6C 5HDBB 4XPTL 1IAIL 1G7PB 1T1YB 1T2XA 5LNGA 1BG1A 1CE1H 1BAFH 5FUOL 1FC2D 1UACL 3BPLB 3CDGB 1KJVB 2E6QA 3DTUB 1ACXA 1Z7JA 3GSQB 3NIDF 4JY4A 4Z3EA 4JDZB 2IH1B 4QT5A 1JYWA 1XR8B 4QTIL 5E8EA 3V2AR 3TNMA 1KB5B 3MKGA 4MA3B 3IFPB 3MNZA 2HFFA 4JFVA 4ABWA 4G5ZH 4D9LH 2RFXB 4Z1PA 2WXJA 3QQ4B 3S96B 3CFCH 2YJQA 1C5DA 1R0AL 4FHJA 2BOLA 3LPFA 3OSVA 4JDZA 2ZPKL 1OAYH 5TE7H 4AIEA 2D0HA 2B5IC 2QADC 4XXWA 3P4OA 1KSRA 3BQUD 3X3FH 4AQ1B 3RIAF 2VDQL 4PRIA 1EAPA 3UAJD 2DQDL 5DS2A 3E7JA 4LXFA 3WBDA 5D1XB 5BS0B 3QWOB 5CBAA 5H37H 3SIKA 2NT0A 3QT2A 5FC9A 4CILA 2XV3A 4LSVL 5CHNA 5E6ZA 3T4YA 4ZFOL 5BNXD 3T2NH 1OCOB 3PXLA 5C9KA 3GRBA 5HGHA 1XBRA 5F7DA 2UXTA 3H4HA 4PSPA 5E1QA 2HFEA 3BDBA 4TQEL 2BIHA 3QWNA 3AWFA 3QI9B 1ACYL 4XPHH 1XR9A 2FUTA 3V6ZB 3X3GL 4ZMVA 5DJ6B 5DZNA 4KQ0A 1M7XA 3C5ZD 2X28A 1T0OA 4YLCA 5EBWA 1A9BA 3QIBD 4HIEB 4YC2B 2X38A 3CSTA 3HNTH 1ZJBA 4KUCF 3RPBA 1K5WA 3AJ7A 1AANA 1UTDA 5AD0B 4KKBD 3VXRD 3R8BB 4ZMLA 4AXWA 3HFMH 2PCFB 3PWVB 1MCWM 5CLZA 2ZKXA 5E2VH 2R23A 1JE6A 3TVMC 5DUMH 2HH0H 2E4TA 3ORJA 1H15B 3WTXA 1BD2B 5C0BE 4YE0A 2HJFA 2RTTA 1WTGT 4ZO7A 3FO9A 4DQAA 4E9SA 4HKXB 4J3OC 3VI3A 1CFVL 1E27A 1B0RA 1ID2A 4YDMA 2YMTA 5BPPA 2I24N 3P73A 4AV5A 5E8NB 3T1FB 1BQRA 4KRLB 2FEDD 1BIIA 3M8OL 3DHUA 5D2LA 2GEEA 5AL0A 3T6WA 4CMMB 4D3CL 3BWUC 5GGVL 2ZD0A 4M6ML 2IVFC 1QTYT 4NRXB 2ZOKB 1UB5B 2R8SL 1A7PH 1R4XA 4WNQB 4AZ8A 1C5DB 2ZAHA 5ISZA 3GSVA 4LLDB 3A6OA 1RIVL 4LASH 4V1DB 1RPKA 4QO1A 1IAOB 3IYLW 4HP5A 3EGDB 1N9PA 5E8OA 2B08A 1WD8A 3GWJA 1CIUA 4FXKC 4QRAA 3II3A 2VLLA 1SYSA 5C0AB 3BDYL 4M5SA 5AVRB 2HVKA 2ZWYA 4QKTA 1DFBL 4P99A 4WWKD 1BFVH 4O2FA 4OUUA 1BJ8A 1JV2A 4JPSA 3DA0A 5MHSD 4Z5RA 5C7XH 2OTWB 1QBAA 2B16A 3BXNA 3Q6GH 2WWKT 3WOVA 3L4YA 5F9DC 1XXFC 3G6JF 4XGZB 5DC0A 1AZRA 3VFTA 4X6FA 1BQHB 4AC2A 3QUMB 3VD2A 4MCMA 5B1AB 1CXLA 5KTEH 4G80B 1RZIB 2FSDA 5DK0A 3MUUA 3CFTA 5ANMA 3EH4B 5DDHA 5CLXA 3K1DA 1QFWM 1IC4L 3VFUB 1H5BC 1LDSA 4E9YA 3DSNA 2WKOA 4OR1A 4BFOA 5IHBA 2RAMA 3FN0H 4N28A 5GGTH 4GRLD 4LDLB 1RK1B 4PRBB 3NQIA 2PXYC 1L9MA 4GQ9H 4GW1B 4NRYA 1XR9B 2JKWA 4IU3B 4MJHA 3ABGA 1NBYB 5T5NF 1SNRA 2EDBA 2E5EA 3BAIA 1PZ2A 4XXCC 4AV0A 4EVNA 4OF0A 4JZOB 4YPGB 3PWPE 5HVHC 3MRBA 1B0GB 2YZ8A 5CJQL 4PV9A 2WVUA 2R2CA 4HUXA 1E65A 3MLSL 3ASOB 3AS3A 3HNVL 3I84A 3CHQA 3G6AA 1KJ2B 3HW7A 3NP3A 3SY0A 3MYZA 1H5BB 1WD9A 1AE6L 3QO0A 5I28A 5L2KD 2A77L 2A74B 3CDFA 3EFOB 2Z92A 2VUKA 1J10A 2YPVH 4CU6A 3D0LA 4U1JA 1P2CA 2VDRH 3FBKA 5C0DB 3QJOA 2YC1A 3AQYA 5CUSH 2GSMB 4Q4IA 5DEFA 2XZZA 3IDYC 2HT4C 4FG4A 4BZ1L 2WAHA 1F4WH 1FC1A 3DIFB 4GY4A 4JX0A 1I1AC 2FH6A 2BSSB 2WBWB 4N2IA 4LOEA 4MAZA 1C08B 4R4FH 5E2UH 5FCUH 1SN2A 1XF5B 2VZ1A 3DUHA 3JTTB 3T1FA 5JORB 2XYBA 2XDHA 3ZZSA 3DXAB 2UZYA 3HMXL 4PJFB 1TLKA 3II1A 3AG3B 4LGRB 5FO9B 3OKDA 3P69A 1DBJH 1WYJA 4JM2B 5DLMH 2H3XC 1EBAA 3HZMB 2WTPA 5LG6A 4L23A 4PFEA 3ZYJA 2X0UA 2KC0A 1NOLA 4UBDD 2H1PL 4FG0A 2Z35B 2DQEH 3T2OA 1MI5E 2J88H 4FFZA 3D85B 2I85A 4HS8H 1PLCA 3SDAD 3HCVA 1FYTA 1ZVYA 2C7FA 3T4AA 4P2RB 3B7UX 1QR1B 4XVSL 1UM5L 1RK0B 3IETB 1I3RB 3M88A 2K45A 1OM3L 1FFTB 3EOBA 3FFDB 2DLFL 3L3IA 3N41B 4L3EE 5BQDA 3UZQB 1JGVL 1AZBA 3N44F 4GI9A 3IAPA 3WIFB 5HHPA 1A47A 4FQLL 3BUBA 4LSUL 5JOFA 2J1ZA 4H44C 2CA4A 2ITCB 3IJ8A 4YO0A 2V7HB 5E99H 5A16A 4PHZA 4L18A 4DOHB 2O5NA 1E5YA 2DQCL 2ZE0A 3F7KA 2FATH 1HDMB 4U6HB 3MUHL 5DHVB 4XNXL 4J12A 1IT9H 1T0MA 3TBWA 1BPVA 3TIDB 5IW1B 1TIUA 4BDVA 1DBJL 3PWLA 1LWJA 6CGTA 2EKJA 3DBXB 4PI0A 3QDMD 3DRTB 1R3IL 2XKNA 2XYCA 3NCEB 2EH8H 3D25A 1BFOB 4ZJ9A 4GW5B 4DCQB 1TFPA 3D9AL 4JHZA 4DPCX 2DQFA 3TBWB 4RFOL 5HDRA 4U2YA 3UBHA 3VRLE 4BA0A 2BIOA 4LSQH 4LLYB 5J1SC 1WCQA 2LFEA 2LW3A 2YXWA 4NB7A 1FFQA 3CX5K 4P2RE 1ET7A 3ZU8A 4KQ4L 1GZQB 2WLIA 4WY7L 3L13A 5GXBB 2ALWA 4YGVA 1G9NC 4A7TA 4Q6KA 5KJ4A 1R33A 3UL4A 1A0QL 2JTYA 1B9KA 3PG2A 5T1LA 2F2HA 3C5JB 1EZVX 1T83A 5B39G 3P77A 1IC7H 5F7AA 5TDNA 2EUXA 5IFJA 3O45B 3QHFH 1VERA 5ICYA 1KC5L 3I9AA 3TU6A 4N1HB 4F3FB 4GQZA 2XTLA 3ETBF 2X88A 4H26A 4PGBB 4IQHA 5GGRY 1CLVA 4P4RB 5EEVA 4Z77B 1T04A 3HS9A 3MTXA 4NUGH 4OLVL 4ZW5A 3BX7C 1ADWA 3U0PA 1DJZA 3FOLB 1MXDA 2YA2A 3BOVA 5E03A 4NT6B 4HK3N 3WMQA 2EINB 1TETH 1V8HA 5J6GA 4RDQF 4M7LL 5JPNA 1BFSA 3BIBX 5LHDA 2R2BB 5D2NB 1NGWB 3K0YA 2VOTA 3ARWA 5IVXA 1ZGLA 2R0WH 2XOTA 2JKLA 1DP0A 2QPUA 2VRQA 4HWZA 5T1DL 4Z0XB 4FJ6A 2EZ0C 4MX7A 3WSQH 4CMHB 1V3KA 4GSDH 3WUWG 5CMAB 5L9DL 5DHEA 1KCBA 4LHUG 4GXUN 2E7BA 5IMKB 5D70H 3MR9A 1CICB 2AGJL 4ISVA 2YFNA 4PJIE 1WC7A 5FYJE 4YAQA 2CXGA 1A1NA 1LNUA 2Z7UA 1MRFL 4C55A 3ME0B 1E5UI 3RDTC 1WK0A 1BAFL 3Q01A 5FUOH 1IFHH 1NLDL 1RZGA 2GTZA 3T0AA 1F58L 3GBNH 1NUGA 4K71C 3ZBMA 4WK2B 3SDAC 4WO0A 2V0AA 1AGCB 2P8LA 1U8NB 2MQCA 1M05B 2GTWA 5SX4I 4XNXH 5I9QC 3RNQA 2EH8L 5LQBH 4OZHB 2YAPA 1PS3A 2E27H 4RWHA 2KZKA 4NZTH 3EFDH 4MAYB 1BMWA 4NQVA 4JQVC 5LUMA 4P2QA 1KTCA 2NOYA 4MSWA 4N2AA 4P3CH 4PJ9D 3UBGA 2HTLD 1RJZA 5D7SH 1ML0A 3R7QA 4ZFFA 4IGBA 3ZN6A 3U2SA 2Z8WC 1WWAX 4GUPB 3B6SB 5D8JH 2VLKE 2YPKA 5DD1L 1F90L 4N3TA 3WJLC 4XWOC 1RK1A 2FEEL 1E4WH 5EIQA 5GJTL 2XG5A 3H8NA 3NCYS 4J3OH 3BESR 3QXDA 4S1QH 2VDOH 1AC0A 2GPZA 4YR6A 1J0HA 1A9EA 5GPRA 3SKNA 1R3LB 5GZNC 4Y4KD 4N2MA 5TK2A 1MFEL 5IMOB 2F74B 1RZIA 5DK3A 5J1TC 3C5SA 4NIYE 3G08B 3DX3A 1YAIA 3L9RB 2OBGA 4G43A 4PRNA 1IGFH 2CRMA 3BCFA 2EVGA 2O72A 4E9LA 3FB5A 1MWAA 3VFGH 2IQAB 4WFGE 4X5XA 5TF0A 4I87A 4Y1TA 3GMPB 3VXMD 4Y88A 1OGSA 1NCCL 4P23A 1KV3A 2YD2A 4QYOB 1VESA 2V17H 4OF7A 5AKVA 4RAUB 1WBYA 1SQ2N 2YD6A 4PWIA 4I7ZC 1OCWH 5KJ7E 2ZWLT 1ZLUK 4H5SA 1NGZA 1M9WA 3FUMA 1L9QA 4IRSB 4N2DA 3EAKA 2R2EA 2R9HD 2VLKA 4YSCA 1RZGB 2GTZB 3MCLH 5D7LD 1A6ZB 1A4JA 3QQ3A 4FL4C 4P9MH 4ZZKA 3X3FL 3KPMA 1KIQB 4PCTA 1TVHB 1IKNA 1AZCA 4XN8A 5PAZA 4GG6B 4MQ7B 1FVEB 5CN3A 1IO4C 3LB6D 1J1OL 4M43L 1KPUA 2R0WL 1T4WA 5DFWH 4YVNA 1I7ZB 4IM8A 3CZKA 3HMWH 3S35L 3VDCA 4UNIA 4PP1C 4M7LH 2NY5H 4M1CD 3WUZA 3VXQA 1QBLH 3IF1A 1F1GA 5IGXH 3GSNB 4K8RC 1ZLUH 3MRCA 3BI9X 1YN6A 4PWEA 5CJBA 2YN5A 4BQ8A 3V6OE 2OQJB 3LYRA 4PRPE 3BC9A 1Z9SB 3VA6A 3HJEA 2A38A 5JW4N 1XO8A 3BUPA 4EOWL 3NPZB 1S9XA 5AD0A 1EMTH 3MGTA 4OGYH 2E56A 2ZCHH 3CLEL 3OZ9H 2JJTC 5I8CB 1CR9L 1A4AA 4QKXB 4B9CA 1H3VA 1HQRB 2EDEA 3VFSA 1KG0A 4CKVX 4BCZA 1UG9A 4NT6A 2QKIB 2HKFL 2PPEA 3KGSA 5K9KA 1NGYA 3PGCA 4Y8AA 5F1IB 2ITFA 1MJ7H 4KY1H 2W59A 3MRPA 4P5TC 5ANMB 4QRQB 4DJMA 4FG6D 4MZRA 1CS6A 3IEAA 3LKSB 1FH5L 4OCRH 2QPFA 5CJXC 1CZ8L 2HCZX 1NEZA 5K33A 5IVXE 1A1MA 1DVXA 2JB6B 2B20A 4DESA 1CK0L 1QUNB 4JZNA 3Q6GL 4M62H 5IK3B 1NKRA 3KWWA 4PWGA 4EBQH 4KI5D 2ED9A 1P7KB 2DLIA 5IIEB 3LPWA 1IZJA 4MYPA 3MN8A 3SEPA 3QUKA 4UIKL 2O5ZH 1HH6A 4JB9H 1QX1A 2EDMA 4K7FB 4HSAC 4BUGA 3CHXA 3VFVB 5IUSA 4U3SB 4ZS7L 2H3NA 3V5DB 3FTXA 2X6AA 5J7CC 3IDJB 4P5RA 5DUPL 5C7ZA 1AXIB 1F4HA 1SJHA 2BM3A 4WJKB 3N04A 3B9EA 2VDMB 3OXRA 5IM7B 1A7PL 4H1LH 3TPUA 1GJIA 5B1JC 1G7MA 5JW4M 2K70A 4AL8C 4L0PB 1N3NA 1SOSA 1HHJB 2ICWJ 3AS0A 5I1HH 1ZHKB 3QAZB 1P4BL 1NCTA 4YS4A 1MEXH 2NXYC 4L4VA 3ZMEA 5E9NA 4QRTA 3MV11 3CX5J 1MW0A 4ZO8A 1BD2A 1AI1H 5AL8A 1EFXB 3CPLA 2VLRA 4R2GD 4UU9B 5AW9B 3DHMA 3PAYA 1N10A 2D4DA 1KFAH 3MLYH 3GZQA 1AS7A 2HYMA 2R1XA 3FOMB 3ZZ1A 1G1OA 3AQZA 4ZMZA 4K3EL 4MZIA 1N12A 3RVTC 1NCJA 1D7DA 3TBTA 3VXTB 1HHKB 1U3HA 5JMRA 1YDPA 2AJXH 1KLFB 2DB8A 5EZIL 3SD5A 5FWRA 4PJAB 4HJGB 1EGJA 5I6XC 2CDFB 1U95A 3RTQB 3UC0H 1A22B 4FC3E 2XPZA 2ZICA 1JZ4A 3DO7A 4DAGH 1JNLH 3VW3L 4XN1A 1W0VA 4XI5D 1C08A 5GGVY 1ORQB 4X4YA 2H1PH 4M61A 4WHYH 3INUH 2QDWA 1EEUA 3NT0A 2WMPB 4OI9A 1I7RA 1MLBB 2JI1A 3PCYA 3Q8CA 3LNEA 1G43A 4Y9CA 4XCCH 4JO3L 2IALB 2ALAA 3TX4A 2LU3A 5DHMC 2OXGB 2B59A 1OAYL 4B0MB 4X4XB 3SDDA 3JWNE 5JDSA 2X6VA 1G1KA 4ZX6A 2D7QA 1RH8A 4DP0X 1CD1B 3OXRB 5IM7A 4HQQL 3W9EB 5HVWA 4G5ZL 2DTMH 3D48R 3GSRA 5ISZD 2GEQA 2DQ6A 1WZMA 1OE2A 4XPFL 3EDEA 2W9EH 3ARDC 4TVPH 5DJYB 3ECBB 5LWYL 3Q44A 4IIQA 1F5WA 1JWSB 3LKNA 4MS8C 2YPVL 3EDFA 5DUPH 5IMLB 4AYFB 2HRPL 3P0GB 4X7CC 3MRJA 4HLEA 2DTSA 2H47C 3QUKB 1KTJA 4BIKA 4ZS7H 1AJ7H 2FX9H 4FOMA 1DQMH 4R8WH 1U42A 1SJEA 4EUPA 1SHSA 3NDZE 3PHOB 2ERJB 4GH7B 5TTRA 5CCHE 3G6AB 4AWJC 5DT1L 5DMJB 4OD1H 4UM9D 3VTAA 3HBPA 3HS0C 3B37A 1KCVL 4Y16D 3KS0H 4OM0L 3ZRFC 3D05A 5I24A 4NBZB 1QFUL 2NY4B 5HI5D 4ZMXA 4YHZH 3FB8B 1TQSA 5CGMA 3U2JA 2J8UF 3HRZA 4L4TE 3TF7C 1FUNA 2EC9T 5AZUA 4BFKA 1W0WB 2COQA 1A14L 2DBLH 4B9IA 5AB2A 2WYHA 3IFOA 4EI5B 2J5LB 1UZ6F 1CL7H 5EUOB 3U7WH 4GKSA 1RVFL 3QI9D 4KHTH 1I75A 2CDEA 4U4IA 5DA0B 2VIRA 2MWCA 4LBEB 1NGPL 1S7QB 1XCTA 5EC1B 4YL9A 4R4FL 3CH1B 1WFJA 5D5ME 1QAWA 1LWRA 2YD1A 4JGJA 1HKLL 2AQQA 3X17A 4DGIH 3QFGA 4RRPA 3RVVC 1NC4A 2D7NA 3MFGB 3IXAA 3GBLA 5DVOA 5FM5O 1W72H 1SY6A 1QWHA 1E67A 4YK4B 2VNCA 1KPUB 1I9IH 2VRKA 3BLPX 1WV7T 3HS8A 1AKJD 4ZUUA 4MASA 3RWJA 5IBLC 3V7MA 1M2VB 3I85A 4GBXC 3WFHB 2A6JA 2Y7NA 2JVUA 2P5WD 5GRUH 5F7HA 1QABA 1ZV9A 4JO8A 3RX8A 3LRSB 3WELA 1AHMA 5DJZA 4F7CA 1J8HE 2PTVA 4KZDL 1DO5A 3JSSA 3WL9A 1BPLB 3COOA 2HT3C 4ICWA 5KVFL 2FLBT 4ZOBA 2QMJA 4QHLA 2Z7WA 1SBSH 2AMUA 5FYLE 3L4UA 1TJHH 2ZUSA 4KTDL 1NH6A 2WMPA 3BH4A 1MJ8L 5TFSL 1XTLA 2PCPA 4WKZB 2DW5A 1FV1B 4TRPH 3FN9A 5TPWL 3RLSA 4MXQC 4Z7OF 1RY7B 12E8L 1MCQA 3IN2A 3HRZC 3O4LD 5HHPB 3OAYK 3I2CL 3H2WA 4EN3B 3AXLB 5D4JA 4GRMB 2R69A 3SDXB 1EEZA 2EKSA 1TMCB 5EF1A 4OGQC 1FNEB 5AW1B 4ERSL 5GS1B 3KVQA 3QQNA 2CNYA 2IXQB 3CE1A 2HWZH 4IGBD 1ASPA 2G0LA 4HMCA 2GSGA 4QRSB 3QZLA 1L0YA 2X1QA 4QPEA 5E4OA 3MZGB 3FUKA 4HIQA 4CVXA 1QHPA 1DBBL 3WDHA 4LP8A 1MCEA 3DGDA 2VSKB 5DQDL 3W2DH 2XN9B 5HHVL 4Z7NE 4EDXA 2LE9A 4FXLA 3N0AA 5F9JA 2D8KA 3BIAX 4XTRD 4R7NB 3ES6A 3WXWL 1Z9MA 4Y1AD 3CK0L 1E2ZA 4NP9A 3TBYB 3X1GA 3HPLA 4MBOA 4CAGA 1C16B 3OC5A 2EDLA 5C3IA 1OWRM 3DX0A 4W9HC 1JHLL 3BT2H 5I1KL 4P2QB 3UTZB 4E5XB 4YNYA 1K5NA 2BOCB 1WICA 4ZPTA 2R0KH 2BVEA 3MNWA 1G9MH 3S96A 2CDGA 3ZHFA 2J20A 1TFHA 3D39E 4OCYH 4TTGA 2DL2A 4MMXB 1JK9A 4P46D 3H7BA 4N2LA 4OD3H 4PGCA 5TE7L 4C57C 1SHXA 1KYDA 5KYWB 1JXDA 4PG9A 1HWHB 1FGNH 3IJYA 4NZDA 3QZPA 3GBNL 3N41F 5K39A 2L4OA 3GSWA 4NQEB 2A6JB 5AB1A 4A39A 4HS3B 5AVXB 4M8QB 4FXTA 4XP6H 4ZOEA 3SOTA 2BJMH 2ZKHL 4M7KL 2E46A 5DZLA 5EUOE 3WMSA 1MRFH 4ZFGL 3U46B 3GDBA 1RMFL 4PJ7A 3DVIA 4RIRB 2VZVA 2F7PA 3DJZA 4ZFOA 4GXUM 3VFWB 3MREA 2FO4B 1QWUA 2MPAL 4IIQC 5AW4B 2AVGA 1CFTA 1RSFA 2BMKA 3EXJA 3I50H 1NCDH 4XN9A 3V6OA 1EHLL 1U8LA 4PTTB 1N19A 1J9TA 1WIPA 1BVLA 4UM8B 5ABAA 1KYOK 1JGLL 1BVNP 3P3UA 4BZ2L 3ARFD 4KQ3H 3BVUA 4DP7X 1OB1A 4IDLA 2VKXA 1U8JA 4HOXA 5A7EA 5JPNB 5HGDA 1E9QB 3TO2A 1W0WA 3L3GB 3TC9A 1UH2A 3G04A 1QLFA 2VDLB 1AP2A 4XP1L 5AG8A 4O9HL 4Z77A 1M6UA 3G5ZA 1C5BL 3LHAA 2GSGB 1ODAA 1JTPA 3KCWA 4TSCL 4PHXA 1H3PH 2HPOA 3DC0A 3QB7C 4P5KB 4X6DB 2AANA 3UROR 3GSUA 4QRRD 4I18B 4KZ0A 2P47B 2EYTA 3OZ9L 4QHMA 2XY1A 3IMBA 1CFSA 3CMOH 4NN7C 2NQ3A 4P3DA 4XNZC 1IAII 1Y0LB 1PU0A 2ICEC 1PG7L 3QYMA 4G3YL 3DDGA 2Z93A 4M7ZB 5IGXL 3D7PA 5LGKA 1JWSA 3LKNB 2V9RA 5D1ZD 2ENQA 1EZUA 1W9XA 5GZNA 4GUCA 2V2WB 2DRUA 3DROA 4K9EH 3TZVD 3F6LA 4IBYA 5E8OB 4DETA 5G4NA 1BGXL 1H3UA 3AB0B 3FT2B 4N0FA 4JFDA 5INDA 3GSRB 5KYYB 5JHLL 3IGLA 3WS3A 4JFYA 1PYWB 1ZS8B 2Y06L 3BWAA 1M71A 3GIVA 3V5KB 3EJRA 4W9LC 4KJPC 1IEAA 1ZHLA 1EFQA 4R97B 3U4AA 3ATEA 3WG7B 3RAJL 2EVIA 3SPIA 1N6UA 2VJ0A 4PV8B 2FTAA 4X5XB 3O2DH 2Y69B 4NO5B 4JDTH 4PH8A 4D9QE 3HNSH 4KV5F 1OF0A 3LKPA 1PZBA 1TENA 2CGZA 3PWNB 4G42B 3OKOA 3ARFC 4KX7A 3NPSB 3C75A 3G08A 2OI9C 1OWWA 4YDIH 3MRKB 4JR9H 4C56D 4N22A 1MCWW 3JWDL 3IMTA 2LAGB 3MTRA 5FYLL 4LT7A 3BWSA 2Y07L 4WK4B 2XTSA 3SDAA 1DTUA 1R3LA 1WHPA 4FNLH 5JZ7C 3QDAA 4R3SB 3SYOA 1U41A 2ZF8A 1ZE3C 3ULVH 3D30A 1INEH 3QCTL 2EDFA 3JV4A 3ZL2A 3P1VA 4F5CA 4MQSB 1CGSH 3QQDB 4ODWB 4PJEA 4O51B 2CJ3A 2Q76A 5B21A 1XL6A 1YDPB 5F9JB 3VGHA 5A2AA 2CLZA 4YDJA 2VSMB 3K0WA 1RVFH 2CO7B 2YRPA 4LEBA 4A6YL 2F74A 4PW4A 2RMNA 2VXTH 4M93B 3V7AE 2NY1B 5E6ID 4O9HH 4MDJA 1MG3C 4W1TA 1FYHB 3LTVA 2D31B 2Y3AA 3NSCA 3TBSA 2XUWA 1PAZA 3QXTA 4JKWA 1KXHA 3IJSB 3U6RA 4L1HA 5FO9A 2YPKB 1JXFA 4ZW6A 2NYZA 4M5ZL 4EI5C 1PSKH 2CUAA 2FVNA 4N1CA 1Q9OB 5DMKB 4P57A 4KQ3L 1UXWA 4L9DA 1AR1C 3HHSB 1BEYL 3AY4A 3G6JE 2VQ1A 25C8L 5CO1A 1T03H 2VLJE 1GC1L 1ZS8A 5LB1A 5SX4H 1LEGB 4IS6B 1JZEA 5JXAH 1R3JA 2W38A 3AT9A 2VLKD 3FB7A 1NAMB 3T6ZA 1YLBB 4AVIA 4DTGH 1HWWA 4LCIL 1MFUA 3I6SA 5LGYA 1ZLVH 3DROB 4YE4L 4ANVA 3EJSA 4AYGA 3FCSA 1EVTC 4YHLL 2A9DA 5I1EH 2Y5QA 4OSUH 1KTLB 4YQXL 3FFOA 3ROLA 3TS8A 4TUJB 3DJ9A 1MJ7L 3EH3B 3DARA 4OAWB 5CUSL 3K46A 1P4LA 4U6VL 2RHEA 3PGDB 5IBUG 2R7EB 4TUOB 5F88A 2EECA 2W9DL 5HGBB 4E9XA 2IANA 3V5HA 4KVCL 4ODUB 4JG1L 3ZMNA 1TVDA 4NM8H 3V0GA 2VZ3A 4KK5C 2AAVA 2QBWA 3MU3A 2OX5A 5EDXA 5LNEA 3MRPB 1MFAH 3EBIA 1X6NA 2ZIDA 4OLYH 1MRCH 1G0DA 1VZHA 3MLXL 4Y5YB 3CDZB 3VFOB 5E2VL 1XMWA 4AJ0A 2IAMB 4U1LB 3SD2A 5IB3A 3U0TA 5CSGA 4K8RD 2GJJA 3CUPA 4WUKL 2VAAB 1P0SE 5AYTA 4Q97A 1INEL 1LP9F 5EOTB 2J55A 5CBEB 4DVRL 2PWEA 1AZNA 1SUHA 1TJGL 2KZ1B 5JIMA 3G6DH 2Y5TA 1X5AA 4Y5YA 1A7OL 3VFOA 1YEKL 4XNQB 5EZOL 3RBSA 1G0YR 3FSZA 1OZUA 1UXSA 4WI0A 1GZQA 1YHPA 4PG2C 4P2QD 5AAMC 4XPGH 1P4IH 3MREB 3QC6X 4XNDA 1NBVH 1XGPA 2XTJC 3H9HB 4F24A 4Z7VA 4WK0B 5JOPD 5L7XL 2JKSA 3EZ8A 2HA1A 2IGFH 4L4VB 5TQ0H 2GBTA 5TDNB 3CVBA 4MBRA 2FJFA 3O2WH 5D6CA 5GSVB 3HAEA 3H0TA 3DRTA 5E56A 3CFBA 3QZOA 4G6ML 1RZJH 4KNTA 2WHVA 4GRWB 4XCFL 5F7UA 4L8SB 1HSAA 3A47A 4LHUA 1UM6L 5C08D 2P80D 1TTFA 1GIGL 2PP9A 5GSRB 4ONFH 4GMTL 4WW2B 3VSVA 1UASA 1K85A 3LIZA 2F53E 4GXVH 4A6YA 3O4LE 4F15B 3A24A 1JDDA 1EH9A 2CDGB 3BVNB 4NZUL 2VDNL 4NGHL 4PJGB 4DP1X 1RV6X 4JFWA 3K8LA 4A1RA 1I7TB 2QL1A 3ZQXA 1MI5A 1PW3A 1RIVH 4LASL 4LNRB 5CD3A 5HGAA 2J44A 1T7YA 2CM6A 3OKEA 5TGBB 1J9CT 2GITA 4PQXA 3GZOA 4O58H 5GSVA 3VI4F 4RGOL 5FA4A 3HC0B 2FATL 1HQ4B 4YDLB 1QFWI 1U33A 3GIZL 4LVHB 2XN2A 3KMDA 3HG1B 1SDDB 4U6HA 3BSHA 5E2JA 1E0OB 1EHAA 5EBLB 3RWHA 4FFWC 1USQA 1TZOA 4K94C 1F18A 3UTOA 2VUYA 3V0EA 2F19H 4ONOA 2J6EL 1TTGA 1EHNA 4XP1H 3AM8A 2AK1H 5EA0H 4DN3H 5ACZB 5I30L 2DQTL 1V3LA 3PHSA 4X9GA 3O6FA 3NIGB 3HZVB 1NFDB 4WJ5B 4CU8A 3H6JA 1CL7L 3NN8A 4ADGA 3M7OA 1EJFA 4H8HA 2VITA 4WTXA 5I6PA 5KG9A 3RI5K 1E6OL 2JXMB 5HDWA 5C3LD 1OANA 5TE4H 1IVTA 3NP4A 2DBLL 5DZAA 4FTVB 5C2BH 1MAKA 3S3SA 5HD8D 3WKPA 4HJ1A 1EGJL 4AE1A 5AUMB 4MD5A 1FPTL 4X6EB 3WHXA 1L9OA 1JSYA 3KM2A 1NFDE 1BX2B 3BAYA 4DZBB 5JR1L 4BA8A 2NPLX 2NY6C 4EZKA 2PYFB 3SCMA 4G1EA 2G75B 1CD8A 3RIFF 3BP7A 1BIHA 3D69B 1T0NB 5AZEL 2IPUK 4ZS6D 1TTAA 3UTTD 5JLZB 3QRBA 2KL6A 3VGFA 3DX6B 4JY6A 1Q8MA 2H26A 3CFMA 3ILDA 1KCRH 4KHXH 3FBQA 4IRSA 1U2YA 3ETTA 4FNPA 1SYVB 3X11B 1U58B 1RJLA 3RVTD 3WTSA 1NGXB 1XF2B 1Z1WA 4ELMA 1S5HA 1S9KC 3VX1A 4POUB 2R29A 4KKZA 1VHPA 4X6CA 1XV8A 4TNWK 1J87A 5IFAH 4HULB 1YEIL 4BXSV 1NGWA 1CLCA 5E5LA 3QR0A 1BG9A 3QO0B 2K9UA 1J8SA 1CF1A 2WZ5A 4B7LA 5IJBC 4Y19B 1RLBA 4D9RE 4KITB 2XWBA 2OL3H 5ACZA 4AGPA 3L4ZA 4OB5L 3WE6B 3GI8L 4HUXB 3QEUB 2HFGH 2XXMB 3QH3A 5EWIH 4OCSL 3ULSA 3VFRB 1EX0A 4LVEA 4R96A 3FTZA 3ZL4L 5IQMA 3EYUL 3LB6C 3I50L 3FT4B 1R47A 2XFXB 4NC1E 4D9RD 4P2OC 5KSBE 3V4PB 1PEWA 4DN3L 2XWBB 3ARYA 2E74C 1JZFA 1IQWH 2X53A 2J6EH 2KMWA 3L1EA 3B9KD 1XSJA 3FQTA 4PJBB 3PHOA 5ISZE 3LVTA 1VENA 5BMFL 1H8OA 3N50A 3T3PF 2CIKB 4Q6YA 4BFFA 2VN5A 3OMNB 1EJOH 2AABH 3QJRB 2L3BA 4PW3A 3K81A 1TXKA 1VACB 2I07A 5C8JB 3QUMH 1KB5H 2XZQL 1P4BH 4PUBL 4Z7WE 5ERWA 2OSYA 3ZO9A 4E9VA 2EIZB 3R06A 2ZKWA 3ILEA 5BOPA 4MMXC 5J6HA 3NTCL 5I1DB 2QHRL 5LLIC 1D5BA 4LLQB 4U1IB 1UWGL 3DX9A 3PIQB 3CFDA 2P7TB 5SWZD 1TG8A 3W9EA 4OCYL 4HX1A 4HLJA 4ZFQA 1Z9NA 1JP5A 3ZHKA 1EWHA 1JV5B 4I4WA 3ILPA 2Q8BL 1VZIA 3T77B 5E24E 2X44D 4P04A 4C56E 4DN4L 4AUYA 1J11A 2E7DA 2L7JA 1VEMA 4RH4A 1CICA 1ZE3H 5CFHA 5GS0D 2AJZA 4LMQI 2UX6A 3QHTC 4LDCA 3F65A 1N7ML 1YJDH 2ODHA 2BSDA 1A64A 1GCYA 5I1DA 2NY7H 3VRIA 4H20H 1E4JA 5B1JA 2G2RA 2IGFL 1OTUD 1WBYB 3FT0A 2RALA 3IDGA 3OLDA 1T5XA 3R1GH 5AVSB 4LARL 2FWLB 2R0ZH 3GHEH 2L7QA 4NN5B 3FO0H 2Q2LA 1L7TL 3H9SD 3FU0A 3CH8A 2B77A 3HR6A 4N8VA 2BY3A 4P5KA 5KVEL 2DS4A 1T1ZA 4CU7A 2YA0A 1YVLA 4JO4H 2EXTA 3MROA 5JIKA 2G5UA 3DV4B 3SE8L 1OSYA 1JGEA 4NZJA 3WTUA 1UC6A 3OQ3B 1UEYA 4JPKH 3LH2H 3S34H 3SHSA 3BAEL 1HHGA 1HE8A 3H9SA 4A7QA 2P48B 4JKPH 2D2CC 2B8OT 5EWIL 2XG5B 4Y2DC 1H8SA 5EN3A 4LLAA 3PREA 2N1KA 5HYJA 5D7IE 1TNNA 4HKJB 4L8SC 3P4OB 4RMVA 2DQDH 3E3QE 3RGVA 2A9BA 5C0AE 1NL0H 1SVZA 4GBXB 2X4QB 2W65B 3RWIB 3GJEB 1HCFX 1MRDL 1NMCC 3E9UA 3BZEA 1LP9E 2IIJA 2YGNA 3BRDA 3S88L 4X0NA 2I25N 4KUCD 4U4BA 4LLUA 3SKJL 4NOFA 5IG7A 3P2BA 3GMQB 1P84J 4Z95H 4EQ3A 4Z23A 1KCUH 5HDBF 3MLSH 4HHWA 5CR8A 4EPSA 1WGOA 3WFCL 5JXAL 2E76C 4GAGL 3D4CA 3P3TA 2EDYA 2JF1A 5SWZA 3L81A 3CFCL 3ZKMD 3HE6A 3LQMA 1JNNH 2AJUH 1LVEA 4GW4A 1KZYA 2WYZA 4G7RB 3KWUA 4QWWC 1WLHA 4A04A 3VFGL 1CQKA 5HHNA 1N5YL 5DC4B 4QIRA 2MCG1 4FXKA 4UIMB 2QQNL 3ZJAA 1ORQA 1LILA 1EFXD 2B1AH 4W9GC 1MF2L 3NFSL 1BF8A 1NA8A 4ELKB 3HB3C 3R8QA 1I82A 3ZTEA 1MFEH 4Y0GA 1JF6A 3NSJA 1PNCA 3Q5OA 3UTQA 3JQOB 3RDTA 4AGMA 4F33A 1T2JA 5FF6A 1ZGLB 1DJXA 3LHPL 3MV8E 1A6PA 3QIBA 3QVAA 1QZNA 2FYVA 3FPXA 4PP2A 1H8LA 5CZXD 2BVQB 3U0TB 3C5ZA 1S3KL 4FRWA 4FKKA 3VXUA 4O2CB 3DOIA 5I19L 3ESOA 1IM9B 5JOPE 2QKSA 5DK2A 2QPDB 2Y7QA 3B9DA 3V0IA 2BVTA 2CMRH 2EEBA 4HEPA 4PG2A 4G8IA 3WFEH 1P1ZA 5K9OB 3IF1B 4ECNA 3QCVH 2ZXGA 3ZTNH 5A6IA 3W11D 3TOPA 4YSUA 3KL5A 1N8ZB 2UVEA 1IBGH 3DTXB 1PKQA 4NKIL 4O00A 5EO9B 3G6JB 4PR5A 3U9PL 4IBWA 3APCA 3BPCA 3QCTH 3RWGA 4G70B 1HILA 2VLLB 4LPVA 3M1CA 1LL1A 1MHPL 3LNIA 4U6YA 1QSEB 5AZ2L 3EFDL 1ESOA 5JXEC 1PD1A 5EU4B 2CH8A 4XNAA 3W9DA 3PL6D 3DMMB 1O75A 4HFUH 1VFUA 4LFHG 3RJOA 3PRZA 4QNPE 3GXIA 4JAMA 2G3NA 2D03L 3D25B 3CD4A 2CHNA 3UX9B 2ATAA 1BWMA 3X1FA 4KJQD 2QFRA 1A3LL 4N87A 3E8VA 3AREC 2XWRA 1ZV5A 3GLZA 1O0VA 2W07B 3O0RL 4G82A 1V7NH 1NLBH 2QVMA 4I88A 4CUCA 1GSKA 4X5RA 2WZPD 1IGJA 4OZIE 3LQAH 3TH4T 2ZOWA 3PFUA 3ZHLA 2V5SA 4PV9B 5I15L 4KNSA 4WCYH 4JREC 5C0GA 3BUYB 5DMYA 5KBKA 1YEKH 1X5JA 5EZOH 1P7HL 5JHDD 3BKML 1QLFB 2Y5TB 2IMMA 3F8UB 3P9LB 3G5YA 1HEZB 3NCJL 4KKAC 4LCUA 7TAAA 2MQGA 1KG0B 5J9PB 3VM5A 4M6NL 2OMWB 5F6HJ 3IMWA 3Q9PA 3RTQA 3F62A 2IBGA 4EAEA 1MCSA 1ND0A 3NCCB 4IHBA 1JK8A 3QUHA 3UTQB 3ZKMC 4EOWH 4Z3GA 4TOYL 1MQKH 3ZSTA 4C4KO 3T6QC 3GBML 3HLKA 2I27N 2OZ4A 3T5WA 1K8IA 3H9YA 3EO0A 3LN5A 3MLXH 3OR7A 4G8GD 2OX5B 3WE6A 3QUMA 5F1KC 4B5EA 2XBDA 5DD3H 2PUQT 5T1KA 3HN8A 4IRJD 2YKLL 5I1IL 2OJEB 3MMEB 4OD2A 1KGXA 4MAYC 5IFHL 3Q1EA 2R4SH 5HJ3B 5KS9F 5SWZB 3WCYA 4HW6A 5JHBA 1V7NL 3FU7B 2RCSL 4P3WA 5SV3A 4JO1H 1ZT1A 1G84A 4KUZL 1GZPB 1I1YB 2OMTB 4FNSA 2E7MA 5DD5H 4FQ1L 1QNIA 2CR0A 5DS8A 4XNYH 3DI3B 4RBPH 4ALAL 4HS6A 5I1CH 3FB7B 1I1CA 3G5XB 4XVTH 4EBQL 1FDLL 4W93A 3HB3D 5HHOE 4N0FB 4R2GB 1AGFA 2I26N 3IFPA 3MNZB 1NEUA 2YBRA 3NEXA 1KTRL 4IMLB 2QQLL 4Q4EA 4WNQA 1QSEE 4GOSA 4XH2B 4HF5L 2CWRA 3BEWA 1WWCA 4Y9BA 4MJ5A 1A4KA 3GTNA 1T0NA 5I8KL 3BDXA 3BQUB 1E2VA 4HKJA 3EJJX 3FUNA 4RWYH 2RD0A 3US1A 5F7EH 3L2MA 4MVBC 3RTQD 1GGTA 2Y9RT 4FQLH 2PWGA 3CV5A 3PWUA 3IVKB 2BXZA 4APXA 3WKYA 3L3OB 4XCNA 3G9AB 3R19A 2E8YA 8FABA 4HD5A 4JUSA 1W8OA 3AMKA 4L0ZA 4K7PY 1I1AD 3ARGB 3ZSSA 5DWUL 4MJ6A 2GSIB 1TQBC 1WEJL 2CO7A 2OTUA 4QOKE 4Y2OA 4FI8A 3SYAA 1DE4B 3NH7L 5SWQA 4E68A 2X89D 4F3FA 3B4NA 1XQ4A 4FEIA 1A5FL 4BBWA 5JHDB 4X5QA 3D3VA 4BYHA 2ENSA 5HYJD 3AW5A 5TF1L 5F7LB 2AHIA 1U0QA 4JQIA 1XTMA 1RJZB 3GRWA 5ITFB 2H9GA 3O9WD 4ZZFA 4O2EB 3RWCB 3V79C 5KS9B 3TBVA 3DK2A 2DWDA 2NDGA 2PPDA 1N64L 4JHWL 5EOCJ 3TVMB 2J88L 3AG1B 3H6AA 3JVFC 5DSCA 5C0GB 1E8XA 4X50A 5HPMA 1TTRA 3PL6A 1I8IA 4B41A 1MFDH 2KYIA 3CZEA 4PRIB 4JHAH 5D1QD 2DQFB 3CSFA 1W80A 4WGKA 5F21B 5AAWC 3BVDB 3UZVA 5FAAA 4Z5RB 3QXVA 2F15A 3OKLA 4M7JH 3HPJA 4K23H 4OF8A 4G9FD 4LCCC 3QUZC 2HLFC 3L54A 2FO1A 1QOKA 4J3UA 1YECL 4LSTH 2XZAL 3EG9B 4XMZA 5LGJA 5IJVA 1QA9A 1CTOA 5DJ8A 1E5AA 4M4RB 3O6LL 5IHUL 3NABL 2FCBA 5LN4A 5C0CB 3M46A 4AGNA 1FLRH 4J5VA 2IH1A 4MJID 3OBAA 5SX5H 2H4EA 1FCGA 1F11B 1YQ2A 3EH2A 4HPYH 1F8TH 3KDPB 4Q0XL 4DHLA 1K5NB 5I5MA 2YUWA 3AQXA 1ANUA 2J1XA 3VG9C 1EDHA 4KI5E 1QPPA 1TQVA 4MJIE 2DH3A 3DURA 1QO3A 3GPEA 4FQPA 3TBCA 1CDCA 4BUHA 2EYTB 4TSAL 5ITBH 3ZR6A 3I74A 4JFXA 3BW9A 2QSQA 3FOLA 3VGDA 5ANME 3MRHA 4UUJA 2AFNA 1V55B 1FGVH 5KZCB 1LQSR 3SO3C 4W6WB 1V3JA 5BO1H 2CCLA 4NC1C 5IZ7A 3ULUD 1KJ2H 1CLZH 2K4AA 2TSAA 2X10A 3FUJA 3LXCA 3BEVA 3OZLA 5DRNA 1F00I 2VJXA 3S5YA 5ES4B 5L2KB 1Y6KR 3QZMA 4XBPA 1O7DC 3CZFB 5DJ0B 3FU3A 1IKOP 3DKHA 3GXFA 4GUPA 4X2UA 3RDTB 3UPAA 3MGTB 4L2YA 5TDOB 5I5IA 3LXUX 5DGQA 4RA3A 2C3VA 2ZXCA 3N1MC 1OGAA 1U3HC 2UZIH 4LPWA 1DUZA 1A2YA 3HS0A 3LKOB 3SGJA 5AOIA 2CIIB 1FF5A 4LCWD 5C7XL 4WTZG 2Y6TE 4RIRA 3F58H 2V4LA 2WLZA 5CZVH 1RXLA 3OMZA 2O61B 4ZQTA 2D3VA 2IBZY 4KTYA 5CBAB 1KIUB 3IMUA 4NNPH 3M1BA 5ICXA 3RFZA 1Y18B 2EIMB 3C60C 3MV7D 1I31A 4R7DB 3V4PL 3D0LB 1L9NA 4G9FA 4N26A 4HK0B 1LTXA 1NMBH 1U92B 4NXKA 3S48A 3T0EB 3RFZB 3F5WB 4ZSOB 4R2GC 1NAMA 3WFCH 2F53A 3RVWC 2ZUYA 3A4DA 4Y9EA 2BRRH 2JQMA 1G9HA 4XHJC 2AAAA 3B1TA 3FMGL 1PVHA 4U3CA 5IW6A 4J3TA 2BIIA 2XVGA 1IARB 2F7OA 4N3UA 1EJ6A 1KJVA 4X80H 5E8DH 3TN0C 3HUJE 4P2YA 3VSTA 4HWZB 3LN9A 2PPFA 5FO2A 5C92A 4S2SB 3CK0H 3Q48A 1JHLH 1YEJH 4PSRA 3N40F 3U6RB 1YNTB 3T9WA 1WSST 2FB4H 3U4BH 3Q06A 4GAYB 3B8YA 4FQIL 5MP6L 2R1XB 4KKLC 4OFYA 1GOFA 1MY5A 3KYMA 3D09A 5EF0A 4JL2A 4I3RL 4JANB 3SBWC 5KSUB 1PZDA 3FQYA 5JMOC 1BA9A 4AT6B 3BAEH 3S7GA 3TXAA 1BLNA 4WY7H 4KKLD 1JUFB 5EBLA 3RWHB 4DEPB 3FKUS 1VB9A 1PD0A 4PI2A 1M7IA 1FL5A 1PBYA 4G11A 4XVJH 4MCNA 2VXQH 3EFFA 1U91A 4WI3A 1GY1A 3SCMC 4KDTA 4W9ZA 1NIEA 2YXFA 4TQIA 4ZW8A 2WLYA 2UXGA 3THML 3ULVE 4NKMA 5E2UL 1FQ9C 4MCYB 2I5YL 2QZQA 4KJWD 3TN0D 3TO4B 3BFQG 5C0IB 2HVKB 4BKLA 2R0ZL 3GHEL 4KXBA 3DIFA 3S36L 2X0VA 3X12A 4JFFB 2C3HA 1WFTA 4ODSH 2K8QA 4OLZL 5F7FA 2NYYD 1ZLEA 3EGDA 4A7GF 1UT9A 3EYSL 1KGCD 2WQUA 4E9QA 3SDYH 3MUGB 1TQBB 1QA9B 3PV6B 4Y2DA 4OZ4A 5IVZA 2YGQA 4I9WD 3H4FA 4XC1H 4GAFB 1PG7W 3KGUA 2FT6A 2ESVB 2IDFA 2RGSA 1CICC 1P7KA 2FYYB 3CQQA 3MOQA 4L29A 5IIEA 1HH9A 2DEYX 4G6JL 3RWFB 4YAQB 2YUZA 3WIAA 5BVPL 4WEMB 3EXLA 2KT6A 2HT2C 4TUKH 5A2LH 4XWGH 2FQEA 4LF3A 4MDIB 4FFTA 1OARH 1I3VA 1HSBB 3WO4B 3D33A 4OCMC 3QIWC 2HLEB 2E4FA 4L4TB 4PY8J 1UXSB 1I1FA 2EYSA 2DQJL 4O5LL 3IMVA 4CSZA 4S0HA 4Y4HB 2I9TA 1CXEA 1JZHA 1CZ8H 4O2CA 3D6GA 4JDVA 4IBLT 4OH2A 5KS9A 1QI4A 3ARFB 2HJLB 4FKHA 5CBEA 1KJ3L 4PRBA 1NCWL 2G60L 1HT6A 5IT2H 1MH5B 4NQCA 4DEPC 1HJBC 4UM8A 3WFDH 1BYOA 1HHKA 4U1MA 4IBQA 4OLUL 4NO0D 1NUDA 2FDBP 2Q3ZA 2ERJC 3O3AA 1H9DA 3S36X 3FUDA 2FT8A 3QI9C 3IFNL 3VXQB 2GUYA 4JGNA 5DT1H 3FAXA 1YN7A 3VCLB 1OL0A 5C07B 4GMSH 4ODUA 5IFJB 3LDBB 1NOAA 5D72H 2V9UA 4JN2A 1RZ7H 5LBSH 3BHBB 3IKKA 5IR1A 1L3WA 1GHFH 2JTDA 5FF6B 1J8HB 1PX3A 2J7LA 2UXVA 3EJUA 5ITBL 4NO3A 4LOFA 1P9MA 5FGCB 3ZTJG 3DIVA 5TQ2L 3CCHA 4HCIA 1TZIB 3MBED 2Q7YB 3TYGH 3UEQA 3QQ4A 3JT0A 4LU5L 1Q9LA 2ZX6A 5EEUA 1S6NA 4JRXB 4S1DD 1EXUB 4HS6B 3OMIB 5T3XL 2PETA 4OFIA 2OMUB 5T8IA 5I0ZA 2XXGA 2P5WA 1XCXA 5KYXA 4TL4A 5D4HA 1E40A 3FCBA 4Z7WF 1PY4A 2B15A 1P6WA 4FLRA 2A9NL