1G5GA

Fragment of fusion protein from newcastle disease virus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
422
structure length
357
Chain Sequence
DGRPLAAAGIVVTGDKAVNIYTSSQTGSIIIKLLPNMPKDKEACAKAPLEAYNRTLTTLLTPLGDSIRRIQESGLSQLAVAVGKMQQFVNDQFNKTAQELDCIKITQQVGVELNLYLTELTTVFGPQITSPALTQLTIQALYNLAGGNMDYLLTKLGVGNNQLSSLISSGLITGNPILYDSQTQLLGIQVTLPSVGNLNNMRATYLETLSVSTTKGFASALVPKVVTQVGSVIEELDTSYCIETDLDLYCTRIVTFPMSPGIYSCLSGNTSACMYSKTEGALTTPYMTLKGSVIANCKMTTCRCADPPGIISQNYGEAVSLIDRQSCNILSLDGITLRLSGEFDATYQKNISIQDSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords FUSION PROTEIN
publication title The structure of the fusion glycoprotein of Newcastle disease virus suggests a novel paradigm for the molecular mechanism of membrane fusion.
pubmed doi rcsb
total genus 86
structure length 357
sequence length 422
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2000-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.490.10 Mainly Beta Beta Barrel Head and neck region of the ectodomain of NDV fusion glycoprotein Newcastle disease virus like domain 1g5gA01
2.60.40.1690 Mainly Beta Sandwich Immunoglobulin-like Head and neck region of the ectodomain of NDV fusion glycoprotein 1g5gA03
3MAWA 4GIPD 1ZTMA 4WSGA 2B9BA 1G5GA
chains in the Genus database with same CATH superfamily
3BZEA 3CHPA 1INQA 5D7LA 2MTPA 4X0KA 4QRTA 3DOSA 2X1OA 2VQ4A 1UZ8B 4JFUA 1J05A 4ELKB 5HPMA 2H1LM 1KBKA 2DBJA 2YRPA 5E99H 2QV2A 3GS4A 5ICXA 2ZOWA 3RWJA 4YX2H 1IGCL 4PJ9A 3KH3A 4GXFA 3VFMA 4WHCA 5IBTH 1FNAA 1BMZA 4YXLH 1JGDA 1HSAA 2GC7C 4Y5XB 3AUVA 2R9HD 4Y1AD 4UCFA 4YDKL 5I1KL 1RPUA 2O6CA 1TJIL 1ULVA 2VM3A 5AG8A 2LTQB 1BBJB 5J9PA 5IMKB 4HUWA 5F1KC 2CBTA 3FQWB 4NFCA 2OI9C 1NFAA 1FVEA 2QMKA 4JFFD 3DX6A 4D2NA 4P23B 4PTUB 4AT6B 5A6IA 3LEXA 2BS8A 2WQSA 4ZTOL 4OFIA 2BSDA 1OGAE 2EE0A 3BQVA 2ICEA 2R0KL 4GKNA 1HWWA 4WI8A 5ETUA 2F6AA 3EF4A 3K8KA 2BWQA 2Y2WA 4KQ3H 4LEBA 5J4MA 2ADYA 4AV5A 1UWGH 1V3LA 3BGMB 3STZA 1WTLA 1UA6H 5FUOH 4JPVH 1MRFH 1XGUA 25C8L 4OBSA 4D9QD 4YVUA 1A6UH 2CGRH 5KVDL 2ZSVB 5CJOH 5JHDD 3ESPA 5T3ZL 4TSAH 1LP9E 5G4NA 2EECA 4QRPD 5DQDH 1RZFL 5KVEH 4KRLB 1DFBL 1SHWA 1A02N 2E9GA 3QDMD 1CL7I 2DPKA 2VMCA 5AW6B 5C8JB 4JX0A 1DBMH 3QEQA 4N2NA 3ATBA 4JFSA 3OJDB 3CFBA 1A66A 1L5GA 2IV9A 1C8PA 1AGFB 1R3JB 4TULH 3RB5A 4HGWA 3GXPA 1F2XK 1C08A 3WMPA 3CN1A 3UH8A 4HWNA 5HI4D 3DHMA 4LLMB 4G8GE 4OVUA 2BRQA 5LJYH 4WCYL 3VYOA 2Z8SA 4YR6B 3TO4B 5AW0B 4WHTA 4MMYB 1JI2A 3AREC 4MNQA 1CBVH 4JRXE 4O9HL 5EO1A 1INDL 4ZMOA 1KJ2L 5HGAB 2FQDA 4A7QA 1KPRB 2YBRA 3Q8FA 3IAPA 1EHKB 2PO6D 2ZUTA 4JZJB 5I1JL 4ZMLA 2MKLC 5BRZB 1RIUH 4DGIH 4WO4D 4KKRA 3TBTA 3RZWA 3Q13A 4N87A 5JORB 5CJQH 1JV2B 4PJHB 1A8JH 3VI3B 3WO3B 4QHKI 5HDWA 3EJRA 3BZFA 3BUBA 4YUEH 1QSED 1RUML 3QPXL 4CBZA 4Y2DA 2OYLA 4F24A 4XMZA 3VXQB 1RUKL 3Q5OA 5DWUL 3NJFA 3MV9B 4IHOA 1S7XB 2XYCA 4BUGA 5DS1A 3TEXA 4TNFA 3KNBA 4JQIH 5IMLA 1OSZA 4DH2A 3N50A 3QUMA 2P8MB 1FFTB 3FS9A 3I6KA 4X5XB 2IG2L 4QTFA 1TJGL 2BSBA 4JHZA 4IJ3B 4NZFA 1ACZA 4HZAA 3DI2B 1H3WM 3BPCB 5DJ6B 3MJ7B 5A1AA 4JPIB 1MIML 1GYWA 4ZS6C 5DD1L 4N0UA 2CA3A 3AAZB 1PD0A 4LE8A 2K9UA 4XNMB 4AM0A 4QO1B 1RZJC 1ADQL 3K1KC 2LAAA 1WBXB 4PJEF 3F83A 1FN4A 3MSPA 1USQA 4U1IA 4YHML 5D2NE 3FQTB 1NIDA 5KJ4A 3B2UD 3IDIB 3RZCB 4FHJA 2DEWX 43C9A 2W60A 4JAMA 3DOHA 4P9MH 1ITBB 1WE5A 8FABB 4XPHH 4QCIA 3U4BH 5BW7A 4A38A 1EO8H 2V17H 4O2FA 2ITDA 1A1OA 1CFMA 3I84A 1N18A 3RFZA 3BPNC 4NSKA 3FN3A 2NY3C 1N5AA 4ELMF 4RH4A 3HVNA 2Z1KA 1MHHA 1UXMA 1OPGL 3HE6B 2QQKL 4XX1E 2H6OA 2Z8WC 3GPSA 4U1MB 5C86A 4M8QB 1MJ8H 4ZNCD 2IPUG 3OPZH 3ASNB 2B16A 1YEGH 2XIIA 3WNJA 3MNZA 3D33A 2NY4C 4HKJB 4LPUA 4WJ5B 1L9TA 4HUUB 3V0GA 2RTTA 3RTLA 5AYUH 3GMLB 1XWVA 4LVOC 1TYEB 3L6FB 2OJZH 3SPCA 1WFOA 5DUML 2PW2B 3KXFB 1R1CA 3UTTD 5DJCA 2Q8AL 2QKIC 3A22A 1JPSL 2ZTBA 1GC1C 4XP5L 2E5EA 5GRJL 4AOFA 4X5LA 1SHXA 1A4KB 1E4HA 2B9AA 4A67A 5I8KL 4GAJL 3HPJB 3WHE1 5DJ2A 3GXFA 1RD6A 4NUGL 1W0WA 2YPLE 3ARDB 3OKNA 4MKMA 2CM5A 1D5IL 1TNNA 4FKKA 3FFCD 4WV1C 4MJ6A 4RX4D 2O6PA 4NFDA 4IS6B 5DEGB 1GJIA 1A64A 2J57A 4GAFB 4W70A 3RGBA 3KLHC 4EIGB 4IGBD 3SPVA 3QXAA 4I2XB 1M7DA 1XCWA 2PYFA 3WFDH 3T4AA 4BKLB 3GXIA 4G72B 2G2RB 1R9FA 1R5WB 2W1NA 4NQCA 4N5EC 4NIKB 1E6OH 2R4SL 2YRZA 4JE4B 2J1KA 3S4SA 1JYWA 3EFOB 3NJXA 1IAMA 2FEDC 3FU0A 1IQWL 4KY1L 1JGVH 4MX7B 1F6AB 3BMVA 4F92B 2IAMC 2O5ZH 3APMA 1HL8A 3LB6C 1OAUL 2WOYA 4N26A 3ARTA 4R2GB 3QZLA 4X4XB 5DHVA 1PD6A 1Z6JT 1P4UA 1P6AB 2H2PC 4HIIB 4LKXA 4BSWA 3WTXA 3C6SA 3LAFA 2HJFA 2YD5A 5DYOB 1NCNA 4U0RB 4B50A 3OJMB 4DIXA 2ODIA 1DJYA 3A6BL 1DBKL 3N1GC 1FC2D 3OZLA 2IAND 2YR3A 4R0LA 1UB6B 4UU9B 4ZUWB 1XV8A 5I18L 4ANUA 5HYQB 1KEGH 5D4HA 3HVDA 2Y5EA 1B4RA 4FFZH 4Q6IC 4FQ2L 5I74B 3IPBA 3WOVA 3G7TA 3FTGB 3BKYL 5B3JF 3FQXA 5JIIA 4WW2A 2LR4A 3DGGA 2P43B 3L3JA 5JDSA 5BZWB 4OF0A 5GSVA 3HG5A 1H15A 2RFXB 3ZE1F 4MD0B 5F93C 5JPNA 1THAA 4MQ7A 4UM9A 1S9YB 1RUPH 4XCNB 1AVAA 2OJEB 3MUZ1 4AYID 4DQAA 3CLFH 4UB0L 2XA8L 5T8IA 2AI0L 3VXNB 2N4IA 4YDLB 2ZZUT 1JOIA 4I9WD 4N85A 3MI6A 2AJXH 3VFNA 1RPQA 2GCYA 3ULVC 1AQHA 3QQXA 5DUBA 2F7IA 1KCLA 1BZEA 4ZUTA 4F93B 3T8VA 1ZT4A 3OAYH 4BXSV 2J72A 3T0VA 4G6KL 3H53A 2Y7OA 2UY6A 1IAKB 1OLLA 1YYML 1PEWA 4WENB 5A6LA 4Y19E 2NR6A 4G3YH 4ETQA 3RQ3A 3LQZB 2ETWA 2UWEB 2HRLA 2YQGA 1A3LH 1PU0A 3PNRB 4JM2C 3UAJD 3ZDYF 4S1RL 1GAFH 1JGUH 1RZKL 4M7ZC 4XC3H 2OL3A 5E2VH 5AZEH 3S35H 4ERSL 4FZEH 3CJJA 5BNXD 2J25A 3H9SA 4RAUB 4HCGA 3O2VL 3TJHC 1GYAA 2QT6A 3TU6A 2Y1AA 4H0HB 4M61B 3GMQB 3DRQB 1LE5B 1NDGA 1QKZL 2WUCH 1I7ZB 2DJMA 4AGPA 4Q52A 3BQUD 5E94A 1FG9C 5LQBL 1NQBA 1VB9A 4XHJC 3AS0A 5EZOH 1WS8A 4GBXA 1R5VB 2AXHA 4U1KA 2Q7AA 3P02A 2NXZC 2D9QB 1NIFA 4JCLA 1UYWH 3VRLF 1DQKA 3MJ8A 5D5MB 2EH7L 3TA3B 1F4WL 4I48A 1GL4B 1KIPB 4XN9A 3KPNA 2WLJA 3P30H 5CP7B 5AVZB 1E28B 5C7ZA 3WYRA 1MHPL 3B8YA 5HYSB 2A83B 4LO9A 3IDYB 3FUKA 1WISA 3O9WB 3OBAA 4FZ8L 1OD7A 5GGRY 5CN3A 5F6HJ 4HMDA 3MMEA 3BGFB 5BRZE 1H3TA 1NM9A 3O11A 3L1FA 4NQVB 3ILPB 4XPBL 3SZKC 4PJHE 3WGVB 1KGYE 1MWAA 1E3FA 3L3HA 3TA4D 3VFPA 3VI3E 4IIQC 5DJ0B 5JPMB 1HHHA 3QG6B 4ZDHB 4NIYE 4J2QA 5E1GA 4JM4H 3QO1A 4Y1AA 4AYFA 3MV9E 2ZCKH 1MRDL 4EI5B 2FLBT 3STLB 1JD9A 3PWNA 3SGEH 4PJ8D 5C0EB 2C1OA 1AQDB 2DIAA 3VYNA 4JFFA 1FPTL 2CALA 1PLGL 1TQVA 5EOCL 2D3NA 1NGQL 3UO1L 1AD0A 4B9CA 3M1BA 4G9FB 1ODUA 1MEXH 3QJQB 4WW2F 3KBHE 3N43B 4LLUB 4AV0A 3S9DB 2GY7B 4FG2A 4U31A 1WAEA 3EOTL 4NUQA 2H45A 3RWHB 1U3HB 4W68A 5J6HB 2J2ZA 1T5WA 4YBLB 3TVMD 2ATKB 1RL1A 4PW9A 5D1QB 5E9DD 3VDCA 2V2TB 1RP9A 3P4MB 5JHDA 2VLRB 5A7EA 4UIMB 3RTQA 3UDWA 2Y6TE 3D4YA 4QRPA 5H94B 4AGOA 3MNVB 1OT2A 1BZDA 2ZWSA 1YEJH 4JO3H 2AGJL 1F58H 4JFOB 3QDMA 1HCFX 4JFQB 4Q56A 1K4DA 2A6DA 2HFGL 4GI9A 4J8RB 3DJZA 4JY6A 4IBYA 2FUTA 1W6WA 1QRND 3NN8A 4GIAA 3ULUC 3ZRFC 4R5XA 2ICWB 1D9KA 3ARZA 3FN0L 2MOVA 3ZTJG 2K7QA 1BWWA 2EC8A 1GS7A 1EGJH 4WW1A 3GD1C 2FO8A 4LL1A 3ME0B 1MPAL 2F54D 4NUMA 4TSBL 4XMWA 1S7TB 2L7QA 3WI9A 1JRHL 4P2CG 2QR0B 2G2PA 2XG4A 4DK3A 1DLHA 4X9FA 1SDAB 1IL1B 2Y22A 3KXFE 4GSXA 2A6JB 5E0FA 5TGBA 1Q9LA 2JVUA 4FNUA 2PO6A 5FA3A 3D0VB 4PV8A 1D6EA 1ZVSB 3TNNB 2VXSH 4XWOC 5CLZA 5INCA 2FJGA 2P5WB 4WO4A 3LOWA 2V5YA 4X9HA 3V5HB 4AEIL 5SX5H 1U8QB 4PWJA 5EU4A 4M5TA 3LEYH 3RDTB 5EF1A 4L8CB 4XVTL 5E9AA 2DLTA 2YAQA 4I3SH 3MZTA 1Q94A 1AR1C 5JHAA 4HJEA 1IKFH 5FW6A 1ZT1A 4EI6B 5CIPB 3X11B 2IFFL 1E9QA 4MTMA 4OZFB 2Y1ZA 4LIQE 3HUJA 3EXJA 3PJLA 2E75C 3G5ZA 5GSRB 4BZ1L 1RIVL 5TK4A 1SRDA 5KSBA 5EWIL 3TBBA 2NUPB 1FIGL 5HI3C 4ZOAA 2W65A 3V4VH 2GSIB 3R0NA 2Z93A 1YNTA 1S8DB 4LU5H 1XF3A 4M7LT 3WSQL 2FQGA 1JD7A 3LH2H 4H44C 5IQ9A 4JPKH 1G1CA 4E9YA 5KBNC 4M6NH 4PVLA 1DR9A 1L3NA 4Y4KB 4V1DB 4Y9GA 4HWBH 3J8F7 4WI7A 1W72H 5DZAA 5AOIA 4RA3A 3NZHH 1Q4NX 4YFLF 2DY2A 1VZHA 2EINB 3NCJH 3IS0X 3QZWA 1MHEB 1G7PB 4XC1L 4I8DA 4FFYH 4S11A 4M1DL 5D7EA 1A7QL 2IADB 1CL7L 4KH2A 4QOKA 5DS8B 1UURA 3DECA 3EJJX 1AGDA 1E27A 4GKZA 3JV6B 1O9VA 2W5PA 1L7TL 3MRIB 3MUGA 3V6FA 1RVFL 5DHEA 4AQ8A 5IB3A 1SYVA 5E5LA 5K39B 4QRUA 2YAOA 3E1ZA 3Q48A 3MLRH 1MCJA 2N1KA 2WWKT 2VXQA 3GSNL 5ITFB 2NX5D 1NFDA 4J3VA 4U05A 4OZIB 2JELL 2X4OB 1QNZL 5K9JL 1RZIA 3HAEH 1MG3C 2H0PA 4Z9KB 4BFBD 2ZAGA 3LKQA 1VA9A 3QC6X 3N6YA 3BKJL 5GGTL 3UBXG 3DTDA 3Q1SL 2ENQA 4JS7A 1KIUB 1Z9PA 1J9QA 2UYLA 4CNIB 1JP5A 4R90H 5B1CA 4UTAL 1DQTA 5DRWA 1LO2H 4G71B 2WW8A 4YXHH 3HN5A 1URIA 2F61A 1GR7A 1QZ1A 3SO3B 4LLQA 5A16A 3UTTA 1H5BA 4NRXA 3B7TA 4NP9A 4TVSa 1H9DA 3G5YB 4N9OB 3ARED 4PJXF 1K5NB 1L0QA 4OW6A 3GJFA 4FQLL 4J3WA 2ITEA 5FEBA 1U33A 1V7NH 2VR9A 4M1CC 4CU8A 1WWAX 1XB3A 1J11A 1ZV9A 1A3ZA 4A6YB 4P2OC 2Y24A 2V3FA 4GMSL 2BC4A 1X4YA 1G7LB 1BQHA 1LK3L 1SEQH 4YSEA 1T83A 2YOAA 1CFTA 5DQ9A 3B2VH 3ZLQC 3QDJB 4NENA 2FO4B 2GTWA 4EO5A 2UWEE 2IAAC 2K9FB 1MCEA 5F7EL 2XYBA 4IGBA 4MJIB 4P46C 1ZE3H 4JQXC 4TLTA 4DO5A 3WLBA 3DRTA 4HMCA 3X3FL 3SKOA 3E6HB 4JM0A 1VEMA 3VRJB 3O3DA 1XH3B 5EO9B 2K78A 4C56B 3PHQA 1JXJA 3X12B 2B4CL 1WSST 3K4ZA 1WD9A 1WEJH 2XV6B 4XBEL 3CDFA 1U8OB 1WBYA 5IT2H 3TZVC 4Z7VA 1WT5C 3KDMB 4ONFH 3WCYA 1KJMB 4UT9L 2OSLB 5D5ME 3P3UA 5CEXB 1FGNH 3CDYA 4ZS6D 1CFBA 4OM0L 3GTVA 3PS6A 3T2NH 1A14H 1I3RB 5IQ7H 4JN1H 3LRSA 4TUOA 3QH3B 3FU7A 1XVSA 2G9KA 3HI1A 4YC2C 5FHBL 4F7CB 1FYTB 1YNTF 1R3KB 4ODWA 2FL5B 2KLSA 3NABL 2IANA 4FTDA 2Y7SA 1CFVH 4FXKB 2C9AA 2V37A 3SKMB 5C9JB 3LZLA 2Z7YA 4OI7A 2FEJA 1A6AB 1OSPL 3WDIA 4RFEB 3U46A 1CURA 1BAFL 3S37L 2ZXCA 3GINA 1WG3A 3UZVA 2DLHA 1KLGB 3IFOB 2RJMA 4TRPL 4X4MA 2UZYA 1JVKA 2BVUA 2NY3D 4V33A 3VSUA 4FNSA 2EYRA 4K94C 5HGBA 3CZSA 1FHGA 2VNCA 1JMXA 3IJYA 5GGUA 1BECA 1WO2A 4ZW3A 1TTUA 2LFEA 1E5UI 4WGKA 2IVFC 4AMWA 1MFDH 1F6LL 2B39A 2APTA 2PR9A 4O4YL 1FNGA 5K59F 1FNEA 3S5LG 4KO7A 2NY4D 4JUSA 4PMFA 5KW9L 1OCWH 2HLAA 3MLWH 1T0MB 3JSSA 4G9FE 3Q6FA 1AANA 4B3VA 4WTZA 3DJRA 4XR8C 1RLWA 1A4AA 5E8EB 5I66B 1JYXA 5EG6C 2NNAA 1MFAH 1J8HD 4ORGB 5DFAA 4Q4IA 4ZSOA 3KLAA 1BYPA 3V7MA 1QFWI 4MYWB 2JB6B 4CU6A 1TVHB 3N44F 5D1QE 3ETTA 1MW3A 1VGEH 1UWXH 1MCPH 4TLKA 4GQ9L 2DQ6A 2VLRE 1WVZA 5B39G 3EO1B 2ZD0A 5CSGA 2WO3B 4D3CH 2FR4A 1H8OA 4XNAA 2VMFA 3BT0A 4C57C 4J12A 1FYHB 5G5DB 1BX2A 4PJIF 4LEXH 3APDA 2DYRB 1KYAA 4AQEB 4JFXA 2FO1A 2IDSA 2G9HB 4HCRL 1ONQB 4WFED 2IPUK 3KLHD 3IKCA 3ALXA 1LM8V 3BQUA 3ARBA 5FYKD 3PHOA 5DJXB 2BIPA 5J1AB 3CSBA 3T2OA 1BPVA 4N5ED 1C5BH 1RUQH 5EZJA 5KJ7E 1CO1A 1RP8A 2G3NA 2VDMB 2OMVA 3VVVA 2YXVA 5DTFB 2FEDD 1Z9SA 2WKOA 2CO6B 4KK9C 5HHVL 5E4EB 1Q9KA 1NCOA 1UG9A 3PWUB 2BVEA 5B38G 3LB6D 5IFJB 3MLZL 1JK8B 3K6SA 3CG8A 2H2PD 4HIHB 1RHHB 4N6RA 4JG9A 3KL5A 3QUZC 3LNHA 4G42B 1FDLL 3CXHJ 2JFCA 4MSWB 4KZDL 4Z7VF 2CK0L 5CWSA 1A6ZB 5AVUB 3PP4L 2P5WE 3HIZA 4QF1A 1F8TH 4LCYA 4PRAA 2YUXA 4JKLA 4Y5VC 4WNSA 4JL2A 3MRCA 5EUOF 1IVLA 4M8RA 4TUKH 3BHBA 5BS0B 2TSBA 4PB0H 3KPOB 4BHUI 3GB7B 4GI8A 4PYGA 3QQNA 5C0FB 4PUBL 2MEJB 3MLTA 3G08B 4XNQB 5E7BA 5TF1H 5KYUB 1DN0B 2MPVA 1P5UC 3BKCH 1E90A 4UTBA 4X6EA 1JE6A 4AMKH 1FFQA 3L3KB 5D7SH 1PQZA 2X88A 1LMKA 2CLVA 5T1KD 3FT4B 4H25A 3U7WL 1IEBA 4JJ5A 5F9JB 3WY4A 1EJOL 4U1JA 2NYKA 3CZLA 3SO5A 4NZUL 1QSZA 3BH8A 2D7TH 2WP3T 3K5RA 3DJSA 1XTLA 1TETL 3CPLA 1E5BA 5BUAA 1UWEH 2WUBH 3ULVD 3B9KB 4KXZH 5TH2A 1NM4A 2HPTA 4HAFA 5TE4H 5EF3A 2KZBA 5JXEC 2CAKA 1VFBA 1YAIA 4V1DE 1M2OA 2WCSA 3TC9A 5KVFL 1PZ3A 3EGXA 4RSVA 1D5XA 1AGEB 4X8XA 1GY1A 2YAHA 4RNRA 5GGRA 4NO0A 4W93A 2AVGA 2C4FT 1IQDA 4ZUVB 5AVTB 2ZG1A 4Q14A 1HJCA 4K8RC 5BO1H 1KJ2A 1AQKH 1EAQA 4OT1H 4XMPL 4AKQA 4MCZB 4P5MB 5IW1A 3G9AB 4JM2D 4M93B 2K6YA 3LNIA 3PLYA 2FB4H 1DVFD 4ODXB 2RR3A 1X3DA 2GC4C 1QRNA 2V2XB 3TBWA 4OZIE 4OUUA 3P54A 3TJHD 4MAYB 1I4FA 3KD4A 4LIQH 3V5KA 2NSMA 3SKJL 1A5FL 4UQDA 2KDGA 2ATAA 3KPTA 3L5IA 4L9LA 3LIZH 2QVKA 1BQLH 2YXMA 4XHJD 3G04A 3DKHA 1MVFA 4YSSA 4PGJA 2QELA 3SDDB 3W57A 3T65B 1EFQA 4YWGL 5C0NC 5A3ID 1F4XL 4H8WH 3HC3L 2A74A 2PR4L 3KW8A 3NG5A 3QDHA 4JVPA 2Q0ZX 3Q6GL 3VFRA 1J5HA 2HFTA 3QJFB 4FXGB 4HLZH 5HHOB 3KGRA 3MNDA 2OXHB 4JGNA 4FP8H 4CC4C 2XZQL 3FT3A 4PB9H 1ETB1 1WRFA 5T5NG 2RB8A 1I1AD 1S5IH 3AFLA 4HZ1A 2I26N 4N2AA 3MX0A 4ONGL 1UM4H 5EO0B 4U1LA 4M4PA 2EDTA 4MXQD 2FATH 3L7FB 3QDJE 3U6XS 4A2MA 4IBVA 4KMTH 4HV8B 5T1LB 2AS5M 2GJPA 3JTTB 1BQRA 4F9LA 1UJ3C 5EBLB 2J88H 5AFAA 4MJIE 3A6CH 3PGCA 3EYFB 4JBSA 2LGNA 3LNDA 3NZUA 4JFDB 1YECH 2VJXA 3WXVL 1ZCRA 5E2WL 1XH0A 3HFML 2A9AA 5CUSH 1JHTB 2W9DL 3FB7B 3I9GH 1A22B 4GW5A 2G60L 2BRRL 2K6WA 2Q76B 2Y06L 4ODUB 3KZ8A 3BVDB 4C56E 3DHPA 4DPRA 4F9PA 1RERA 3D09A 1M05B 1KNOA 4HG4K 3DC0A 4MCNA 5JIKA 1WZMA 1IILE 3RPBA 2NCMA 3H9HA 1FFNB 1RZGB 3IRCA 3MBEC 4G6ML 1OSYA 1A6VL 2CCWA 1CXEA 3VQLA 1TMCB 4K15A 4WUKL 3FTYA 4M7JH 5IQMA 1AYOA 4FNQA 3EFFB 4TL5A 3SOBL 4Q9QH 1CICC 3E8UH 4MMXB 4JFPB 2EDDA 3IM1A 1YSOA 1FYTE 1JV5A 1C12A 4JL1A 4BUQA 4F15B 5GZOC 1WFIA 1JTPA 1I8AA 3BVNA 4U4IA 4WKZA 1RZ8A 3CFKA 1L3WA 1HHKB 4MJHA 4N0FB 3L4CA 2CUIA 4M43L 1HEHC 1U8KB 1S9XA 3L4VA 5D2LB 4FNPA 3RAJH 5GRUL 3L7EB 2ITFA 2CJUH 2P46B 3KPSA 1LGVA 2NX5A 2VLKB 3WEXB 1WZLA 3NPSC 5JIMA 4YSAA 4MCMA 3MBXL 4BYHA 5KVGE 3ULUD 4YJZL 3GKWL 3LIUA 3WIHH 4OCSL 3IFNL 3NCEB 2OW7A 2CMRL 1U4FA 4KKCC 5I75B 1B0WA 2Y1VA 5LXVA 4QAWA 1TVBB 2VLJA 2X1PA 2X7LB 5E6IC 4AYEC 4BH7B 4Z7WB 2Z64C 3P73B 4R7NB 4UAOC 2BO0A 2KH2B 1QSFB 1N3NA 4YGVA 1ED3A 2CNYA 2HUHA 2RA1A 1OCOB 2ZOLA 2IGTA 3NJGA 2VDRL 2YAMA 3ILDA 1BG1A 3PUUA 3GIZH 3K2UL 5I1CH 2TRYA 5HHMB 4L3CB 2Z92A 1N9PA 4AXWB 2YAPA 1UT9A 5E8NA 4XWOD 1QBLH 1MJJA 4JDTL 5ICUA 3F7PC 2ZF8A 2VRAA 3OHXB 3CFJA 2DD8H 4Y5XC 3WIIH 5K69A 3D0LB 4ZW8A 1TO4A 1AR1D 1FUNA 1GZQB 1U8NA 2WQRA 4QKXB 3FZUC 1HDMB 2Y3NA 4L05A 4R96B 2OS7A 3AS3A 5HVFB 2BZCA 1IEHA 3BP7A 2XN9B 5C0AD 4RMWA 3Q8AA 3EGSA 1HINL 3D6GA 3FUMA 3DVNB 1KBPA 1ET7A 3WXWH 3SPGA 1F1DA 4NT6A 1PX8A 1YNLL 2Z31B 2VDOB 4HJJL 5HI3D 1IE5A 4BSVB 4ODVL 4JMNA 2VDKB 3G6AB 1GOGA 1WDAA 4C8XA 2AXFA 2X1XR 4U2ZA 2HXAA 3JWOH 4P4RA 3NSYA 2EC9T 3VFGH 3PV7A 1VJSA 2O5YH 2OZ4L 2IQ9H 4XO5A 2F0CA 1OXYA 2NQ3A 2OFQA 4O02L 2IGFH 5DK0B 3DSNA 4K23L 2DIEA 1NA8A 1KY7A 4QXWA 3UACA 4MNHB 1J87A 3SPJA 1RUAL 1MI5B 1U3JA 4K73A 3K91A 2ZX6A 1OF0A 4RLDA 3U1SH 3MJWA 4WJKB 4ONOA 5H2BA 3SBQA 1SY6H 3HMXL 2XNAA 4HX1B 1O9ZA 2KQMA 1BJ1H 5BS0E 3ABMB 2J44A 1P4LA 5I6MA 4JCMA 2WCGA 1A6TA 5IHUH 3CHQA 5LGJB 3L4YA 2YD6A 5GS1B 2VE6A 3LRGA 4J6RH 3UYRL 5AKSA 5F88A 1U2CA 3ZO9A 4PJ5A 2DWEB 3C9NB 4OF3A 5GS0H 2YC1B 3VMNA 1KGJA 3BUPA 3QEHA 4HK0B 4HS8H 3TO4C 4KTDL 3U0TB 4LLVA 5CD3A 4FQIL 5JHLH 2HUEA 4K7PY 4PFEA 4OAWA 5C07D 1FF5A 3P4NA 1JI1A 3IGAB 4KUCF 1R46A 3TH3T 4JZJC 5I17B 1D5BB 2Y7QA 1AHWB 4BDVA 5DQJA 4HC1H 1J8HA 2WD0A 2XWDA 5F9OL 5JZ7C 1T2XA 1DN2A 4JKNA 4L0YA 4EVNA 5ADPL 1RCYA 4KI5E 5AYQA 2AQ3A 5C3LD 4M1CD 4YHNA 2F1AA 3HBPA 5C0DA 4NQSA 4F5CE 3OAUL 5C0CB 4P2OD 1CMOA 3PQYB 3MCG1 4GUCA 2PPFA 1R3IH 4I3RH 4R5VA 1EV2E 3RWCA 4A68A 2FYYB 4DHLA 4PS3A 2QVFB 4MB1A 1EAPB 2QHLA 3ROOA 2DMHA 2NMSA 4Z76B 3RX7A 5AAPA 4P46D 5SWZA 3NPZB 3QIWC 5I1EH 3AB0B 4NGHL 1FCGA 2WLMA 1IGYA 4HUKB 4IBSA 3H6AA 4IJ3C 3PP3H 3V5DA 2D31A 4NWUH 3GPEA 4GP5B 3BCFA 5F97E 3TTSA 4OZFH 3DXAB 1PG7H 5KWYC 4GT7A 4GY4A 3D4GA 2ROXA 4XP6H 5LBSL 5T3XH 1DQDH 1RI8A 3BP6B 1IAIM 3WN5C 4WGWB 5T5FH 2XFXA 4NQED 2JJTA 2HFFA 2N0KA 4UNIA 1ILUA 1XSIA 3MOAL 3QISA 2ZX9A 3JTSA 5I1LA 2EDEA 5FFOA 4CW1A 2NZ1A 1I9IL 1ZHBB 2IAMA 2EIZB 3GSVA 3TESA 1GGBH 3VYPA 1B0RA 3FTUA 5ILTH 1G6RL 1WBZA 2EIMB 3RZCC 5GS3A 4TLSA 1XDTT 2XKNA 1QHOA 4X4YA 3VFTB 5HHOE 4PGCA 5LAPA 4GMTH 1IKOP 2CK2A 4MQTB 2HH0H 5EZIL 1SJHB 3ZE2F 5C2BH 1RK0B 3ZR5A 4XVSL 4ZO9A 3OGOE 5EU6D 4Q6IA 3QIUC 1AC6A 5ANMB 1P4IH 2BSRA 4HJGA 4WI6A 2UUDK 3IU3B 3LVTA 4GG6A 4JFDE 4K9EH 4N22A 1EEZB 3MV8D 3HE7C 5T1KA 3ZTNL 6PCYA 4L29A 2FX7L 3U82B 1SBSH 5HVHB 3K72A 4N2GA 2G5BA 4H40A 1NCBH 1JZFA 4CC1A 1YN6A 1GJWA 1URLA 4QKTA 1QVOA 1FE8L 1F2QA 2VW6A 4JRYB 3CTTA 3BUYB 3OHMB 2A9DA 2H32A 3I50H 3HLAA 2BFGA 4F3FB 1QFWL 4E68A 1YQVL 3SJVB 3ULSB 5EIIB 4BELD 3N1MC 4J7RA 1ORSA 4WY7H 5KBLA 1XT5A 3BZEB 5D7LB 1MG2C 4AL8L 4X0KB 1CLYL 4QRTB 3TOPA 1JTOA 3DOSB 4CSZA 1BAWA 2L0DA 3WD5H 1J05B 4E5XG 5HPMB 2P52A 5ICXB 2VXUL 3RWJB 3AQXA 5L7XH 4PJ9B 1UC6A 2FX8L 3H42L 3VFMB 5FFGA 3DBSA 3O0LA 1JGDB 4LARH 1HSAB 4MDRA 5E1AA 4NZTH 4JM2A 2MCMA 4XXDA 2BY3A 4HF5L 5C1MB 5K1VA 5J9PB 1BD2A 3NAAH 4JN2A 3F58H 3FU3A 4HUWB 3IE9A 2GBTA 3BEVA 3EDEA 1ZLVK 1M53A 2R59A 2VLKE 1FVEB 2J8UE 1B6UA 3DX6B 1YEHL 3JWDH 3NFNA 4R7LA 5IF0A 3RWFA 2WLYA 1OGAD 3LEXB 4PJGA 1UCTA 3L9RA 3MYJA 2WKLA 3GDBA 1QTSA 4H20L 1E43A 3ELQA 2A3TA 4PJEB 2ICEB 2XXGA 4GKNB 5ETUB 3TEZA 2KKQA 1GW6A 2BNRA 1F11A 3D12B 4EUPA 1TSRA 3STZB 3H6JA 4Z7WE 3VWJB 1FA4A 2ZT9C 2OXGA 3C8HA 1G9NL 4JO2H 3NBNA 1XGUB 4U0RC 1QSFE 4GRMB 2ZCLH 4KK9D 2ZCHL 4O5LL 2CKBA 4HOZA 3AM8C 1QFHA 3CSGA 1WUNT 5BZXA 1MVUA 3ZOAA 4YDZA 4LHUA 2HTKC 3CXDL 2OMZA 3OZ9H 2KL6A 3WUZA 3MNMA 4HPOH 5HHME 3QUZD 4AG4H 4ZFGH 4M62H 1LYQA 4QGTA 3LQMA 4OZGA 2Y3AA 2EDFA 2X3CA 4OLYL 4ODHH 2QLYA 4W9FC 3DX9A 2HLEB 2PXYA 2ZOOA 4TSCH 5I74C 4F58L 3GI9H 1C5CL 1DBAH 4IIQA 2XQYA 1CB4A 3NVQA 3WAKA 2W0LA 3CFBB 5CEZH 1CGYA 2ZIDA 3KE0A 1L5GB 2YA2A 2NW3A 4BRVA 3FTWA 2VDNL 4IU3A 1H3XA 4HGWB 1C08B 1BBDL 1NCGA 1OARH 4HU8A 5D96B 2YZ8A 2XN9E 4G8GD 1KCRH 2QTEA 4KVNL 1INEH 4YDLC 4OLVL 5KVGH 1LK2A 4X9YA 4Z3FA 3KM1A 4XX1G 4PV9A 4AGQA 5FGCB 2OCCB 4WHTB 1KB9J 4MNQB 3WTSA 1KPUB 2ADFH 5EO1B 2Z4TA 4FI6A 3MUY1 5KS9A 1NAMH 2YBRB 4XXCC 4GG6F 3ZQ9A 2E0PA 2HJLB 3NOIA 2W92A 2COVD 5AW4B 2FH8A 5DEFA 3CGTA 3TBTB 3P11L 3CAFA 2RHEA 4X7TA 2R8SL 1OW0C 5JXED 2W95A 4UOW0 1T7XA 3G6DH 4K3DL 2Z8RA 3PUCA 1BVLA 2AQPA 4LBAA 4CADA 3BZFB 1Q1JH 4WEUD 2A2QT 4ADIA 3B1TA 1A2YB 4WDIA 4GAGH 4Y2DB 5TE7L 2P1YA 4M4RA 1QI3A 1MI5E 4KHTH 4IHOB 1J88A 2VC2B 5F1IA 4TVPE 4K8RD 3HNSL 1AXIB 3ZKMC 3KNBB 3FSVA 5IMLB 3CQPA 1YUKB 2IGLA 3QUMB 4U1HA 3I6KB 3RIAK 4ZOCA 1B90A 3HBZA 3HS9A 4A2EA 5AW3B 4DN4L 4XWGH 2L4OA 2XKSA 3HAEG 4OQTH 3RX5A 4BZYA 1NJ9A 4FXTA 4WIQA 3MA9L 1EVTC 2Q1EA 3MGTA 4EDXA 1OHZA 2X05A 2J21A 4GW4A 1IGCH 1TQBB 5CR1A 2VSCA 3CDCA 1KXTA 2WGNB 4KQ4H 4N0UB 5J3HC 4OM1L 4AM0B 4N8VG 1TKWA 1P9MA 3O9WC 4NHCH 5C0ND 3RY6A 4FNLL 4PJGF 3EXLA 4J5VA 1TJIH 1T20A 1FN4B 2CJ3A 1Q0YL 1U30A 1XD1A 4U1IB 5KUKA 1QWNA 5CEYA 5E8DL 2V8MA 5LB1A 43C9B 2W60B 2DYPD 1ET5A 3NGBC 1P1ZA 3BPLC 4ZTOH 3MRGA 4B3EA 4ZMWA 4QCIB 4GFTB 4ZAKD 4DJMA 3ZE1B 4O2FB 4UT9A 1A1OB 5C0CE 1HU8A 3B3BA 3RFZB 3PQYE 1JAEA 5I6PA 3T77A 2CO4A 3X3GH 1MHHB 4X6DA 4YN3A 1U3YA 3B56A 3L4UA 5E8OB 1F4AA 2DTML 4OD2A 3ZR6A 3LRHA 4LF3A 2GY5A 25C8H 3QXWA 1CWVA 2GHZA 4OZGF 5C0AA 4ZI8A 3OB8A 3MNZB 4F2MA 2VWEC 4GG8A 5I28A 5T3ZH 3ZO0A 4QMEA 1SQMA 5I30L 3QUGA 1X44A 1RZFH 3WUWA 3MGAA 3MRDA 1CJYA 4YDIL 5GRYA 3F7YA 3DXAE 4XP9L 5IROC 1DEDA 5LCVL 4GQRA 2DN7A 1BEYH 3WKML 4HSAC 3FAXA 1YEKL 4HEPG 2IH8A 1V55B 1XGTB 3DX0A 5DJCB 3UPAA 1U3HC 2OR9L 2FYVA 2WQXA 2BPBA 4YBLC 3NSCA 3BJ91 2RIKA 3MRMA 1PG7X 1ML0A 3O6LL 5FGBA 2EKSA 3ZDYB 5I15L 3MBED 4I1PA 3INOA 5CFHA 5DJ2B 4FKEA 4M8VA 1LMIA 1W0WB 3OKNB 1CICD 4H88L 1DZBA 2YRLA 5E03A 3PXJA 4IKKA 4ZO7A 2XWJA 1Z9LA 4PJBA 5GZOD 4MJ6B 3G5VA 4LSVH 1B9KA 4XO8A 5DD3L 3SPVB 3RKPA 3BEWB 3QXAB 1M7DB 4HIXH 2PYFB 4HXBL 4KUZL 5J5EA 3T4AB 4N2MA 4M6OH 1HZHL 3DNKA 4NLAA 4NQCB 4K2UL 3IXAB 2QPDB 2D7NA 3KMDA 4I87A 2X6MA 5IFHH 5ANME 1B2WL 1D5RA 3U9PL 2ZXWB 3I74A 1CXIA 3S4SB 2R23A 1P1VA 3AT9A 2R0LL 1IFGA 1KSRA 1TCMA 3BVXA 2BJML 3EZJB 5L8JB 1RUMH 3ESVF 4H1LA 1PKOA 1RUKH 1IBYA 2EIBA 5E6ID 4JRWA 1HZLA 5DHVB 1CZ8L 1FC1A 4LKXB 1DSFH 1UXSA 1PZBA 1XO8A 2XQ0A 4ALAL 4BSWB 3FU6A 4JRYE 3QCTH 2GJRA 2HJFB 4XO3A 1IC5H 3D8MA 4R7DA 3MHZA 1RZ7H 1A4JA 3EOBA 3INUL 1P7QD 2ESVD 3SJVE 4Y4FA 3RDTC 4BM7A 2JKIS 2IG2H 4W9CC 1MCNA 4CSPA 5D7LE 3GRBA 1AJ7H 5DJAA 2J12B 2BM3A 4P2OA 1YN7A 3O2WL 2R1YA 4JDEA 5GS2D 5DLMH 4LSQH 4LOFA 3NQKA 2FLRT 2HAZA 3IJEA 4BCYA 3FYEB 2XTJB 1T1ZB 5D8JL 5DJ8A 5EA0H 2HZHA 1ZT7A 3NP4A 3FQXB 4WW2B 3W11C 3DGGB 5JDSB 4CRPA 4OJFL 3FZUD 4ZYKA 4M5YH 4XN8A 4JQXA 3KL0A 3T1FA 4Q74A 2ID5A 2YWYA 5JPNB 2EIKB 3UPRA 4YHMH 4MQ7B 4Y7MA 4TOYH 3OV6A 4J3OG 1UD4A 4DK5A 1S7RA 5EU7E 1S7SA 5L0QC 4DF9A 4OGXL 5MP6L 3IU4L 1TTFA 2IBZX 3LKRA 4PJEE 4ZX5A 3VFNB 3K6OA 4KDTC 4X4ZA 2GCYB 2NTSP 1BF5A 1OAYL 3R1GH 3T0AA 2X10A 3TZVA 4ACTA 3P2DA 2B0SL 4LSPL 2XWCA 3MLUH 1ZT4B 1OPGH 2FBRA 2UY6B 3ZMNA 1OAXL 3KLKA 4QPEA 3DO7A 4TM9A 4PW4A 1E8WA 3B83A 4HULB 4IEFA 4MQXC 3PJNA 4AEFA 1N10A 3JV5A 4ETQB 1SHSA 3NCWA 4FQCH 4JO4H 3DJ9A 4BWWA 2ZKHH 1JN6A 4XAKD 1K4CA 2JJWA 1X9UA 3ILEA 2OL3B 1GA2A 2TAAA 4MHHG 4ZMNA 3H9SB 4IOFC 3T0BA 1QEWA 3QEQE 2Q8AH 1HL9A 5L2KA 2WWMC 5T33L 2YAFA 1NDGB 2G3XA 2WSPA 5JHBA 3A47A 1BM3L 2I60L 1AE6L 1LD9B 4GSUA 4PCSA 4L3AA 4J6IA 4PJBF 3PG2A 5E94B 3QYNA 1XBRA 5AAMC 1RMFH 4KO6A 3S34L 3EJQA 2YD1A 4GBXB 3VXRD 1J9TA 4L3ED 3BX7C 1CYWA 3MV8A 3QR1A 4U1KB 4XNYL 3SDAC 4YS4A 1GC1L 3X17A 1TYJA 3MJ8B 4TQEH 3VWKA 1F3JA 4Q2ZA 4I48B 4LCCB 3TO4D 3W0WD 3F6LA 3QHZL 3BDYL 4HH9A 3KPNB 5FGCE 3VGAB 4J39A 1E8ZA 4MNQE 1HKLL 3GM0A 2AC0A 3R8QA 2OTPA 2P49B 4M6AA 5DC9B 1BZ9A 4GQZA 2ZXQA 3HHSA 2YZ1A 3TV8A 3MMEB 4P5RA 5JZ7D 3KWTA 2DQIL 3GHEL 3O11B 5J6GA 1CU4L 1DANT 1MRCL 4KXBA 3VXOB 5IWLC 1QUPA 2F53B 1JIBA 1V3JA 1MWAB 3VFPB 2W80C 3L3HB 3MJ6A 1D5ZA 1HHHB 4KY1H 3A5VA 3HW7A 2GTQA 3WNOA 3MV9D 4Y1AB 3QO1B 2A9BA 2IXQA 4P57B 4QJ3B 1HNYA 1I1RA 2P28B 4YHPA 1OAUH 4AIEA 4AYFB 1J8SA 3PWNB 4TQPA 1G84A 2C1OB 3P0YL 4L23A 5EU3A 2ZCZA 4LLYA 1OP5K 2A9CA 1K8DA 3NCBB 3QIWD 3KYMA 3A6BH 2HYMA 3V4PB 1G5GA 4UQEA 2EEBA 1AD0B 1XF1A 4BQBA 2V4LA 3W37A 5I18H 3PU7A 3PYCA 1SLUA 1E9OA 1T0NA 3SYAA 4YHOL 2X6UA 4L0PB 4NOFA 4N0UE 2BX5A 2J2ZB 1BG9A 1T5WB 3MCLH 3OLGA 4UV7H 4TPRL 4F7MA 3CE1A 5T1MB 1GHFH 3CVHA 1R4XA 3SGEI 2YAEA 3RTQB 4K71B 5B1BB 1YY8A 4QRPB 1NMCC 3RZCD 5H4YA 3QUZA 2N7BA 5B3JE 2MQGA 5I8OL 4HLZG 4ZBJA 2AI0H 3QDMB 4LOUC 4OJDH 1XCQB 3ZE1E 5CGBA 3BAKA 1K4DB 2GEQA 2A6DB 4MJ2A 3R8BB 4O51A 4JY6B 1D7CA 4W9HC 3HA0A 1D9KB 4TVPH 4J3XA 1JNHB 3QIUD 4G6KH 5E6ZA 4WW1B 1XXDC 4AJVA 1OF2A 3TPUA 3PDOA 2ZP8A 4DGYH 1LE5A 1NEZA 1SFDA 5FO2A 1T0PB 3TBSA 4QD2E 3HE7D 2VDQB 2XG4B 3QULA 3U9WA 1DLHB 1KB5L 4JHVA 4GXVH 5EHFA 3II3A 5CZVL 3L3IA 3HC4H 4WK4B 2YGVA 4OI9A 1Q9LB 4M29A 5TGBB 3F01A 3O2VH 5FA3B 4PV8B 4PY7A 1D6EB 3EF7A 4C58B 5K5YA 2EH8L 3UJIL 3ZDYE 4P3WA 4WO4B 4YLBA 3VW3H 3L4TA 3UC0H 5EU4B 2YMTA 1BIIA 3JVGC 2OTWA 2XC8A 3ARDD 3NIFB 1WWBX 3BIKA 3CZUB 4BV1A 4AYMC 4QRSA 1Q94B 3CFNA 3IJHA 1KCKA 4MD5A 1P4BL 1V27A 3OVUB 4S1SL 1GGIH 1ZT1B 3B43A 4CMMA 4HPHA 4PWGA 4J8QA 1E9QB 1NTDA 5BXFA 2F74B 2X4TA 5JOPE 1NL0L 3HUJB 4OB5L 2AJ3A 4YO0A 1FNSL 1OIOA 4I5BA 4KI1A 3VDBA 3ZTEA 1S6NA 3G5ZB 3SYQA 3VRLE 1NGWA 5F7FA 5KSBB 1WAPA 4NQCE 3G9VA 4AK1A 1L9OA 2ENYA 2PCXA 3BZ5A 3C75A 3P77A 4CVUA 3TWYA 1IV8A 4YX2L 2W65B 2WXOA 3DETC 1U6AH 3JUYA 5FUCC 2FT7A 2YLKA 2NY0C 1YNTB 2Z93B 4XPBH 3ZDWA 2EO9A 4KNQA 1XSOA 5IBTL 4YXLL 1XF3B 2W59A 2D0HA 4TXVB 1VCAA 4TNGA 4HCFA 4ZS7L 4RMUA 5IQ9B 1ZGLM 4JZNA 1OT4A 4R2GD 5D71L 1FH2A 1G7HB 1AR2A 4FQPA 3FUHA 1JHLH 3VD4A 3PXLA 3U2IA 3W5NA 4G1EA 3QZWB 4HUNB 1TTCA 2DMCA 5EORH 1K85A 1OANA 4RIRA 2HTKD 4QOKB 1AGDB 1B4JH 1E27B 3UO1H 4GKZB 3FO0L 1QWUA 7FABH 3MUGB 1UWGL 3V6FB 4CC4A 4DSYA 5HYSG 2BCKA 4P9HL 3D69A 5IB3B 1SYVB 5HVWA 4QRUB 5C7XH 1UZ6F 5I5MA 3TBCA 1HI6A 4JPVL 1CD9B 1MRFL 4OCRH 1RZPA 4O02A 3FMGH 1NFDB 5BV7B 4XODA 2XTJE 1RZIB 2BP0A 1A6UL 2B5IC 2ZYSA 3PWPA 4L5FH 3LKQB 5TDPA 2CGRL 2GJ6D 1HE7A 5CJOL 3POCA 5KYWA 2R56H 1BZ7A 4CVWA 1KF9B 5DQDL 2UYLB 5KVEL 5ICYA 3M17A 3KPLA 2XXFA 5DRWB 4GB9A 5KYNA 5PCYA 2QSVA 3ZT7A 2PTVA 3RLSA 1RURH 2X44D 5A16B 4LLQB 2IDTA 5I0XA 1DBML 1FH5H 1N2RA 1Q1PA 3UTTB 1XEDA 1H5BB 4NRXB 1KYFA 3Q0HA 4JY4A 1G43A 3N0PB 2V5SA 1YEIL 3FCSA 3GJFB 3MBEA 1JVLA 3F7KA 1HSBA 3NEEA 5I1DA 3FN0H 3FH8A 1JYNA 4HJUA 3VX0A 4FLQA 4WQOA 2BC4B 1KG0A 1CICA 1K2DA 2XA3A 5DQ9B 3KH4A 1CFTB 4LMQE 1RJCA 3AW5A 4FQXA 4M93C 4NENB 1ILSA 2GTWB 4XNZB 1CBVL 4FADA 4IGBB 5MHSE 1VIWA 3WLBB 3DRTB 4IRZA 4AVHA 3H9SE 3O6FA 4RGNC 3SKOB 5C6PB 3LPOA 1A6PA 1RIUL 3O3DB 1ZDSA 1V5JA 2WQVA 3OWEA 3II2A 4ENEC 4A2GA 4URTB 5CJQL 3PGDA 5GIRA 5I6XB 2WWNA 5D6DC 4YUEL 3C8DA 1WBYB 4U6HA 4Z7VB 4E0RA 2QL1A 5DF0A 2E3VA 3IFPA 3VXUB 1THCA 5E6IA 2GI7A 4JQIL 5D9SA 5EDXA 5FWRA 2ZKYA 5J3HD 3ZKQD 2MMXA 4JPSA 3O9WD 3LRSB 4FXGC 2XXMB 3FU7B 4TUOB 3HI1B 1CI3M 4QXGH 5CZXC 4R7XA 1P7QA 3DI3B 4L48A 2ESVA 3ETBJ 4ODWB 3BLPX 4I4WA 3W81A 5LO7A 1E6JH 4JE0A 4HBQA 2IANB 2FSDA 1IGFH 3DTXA 3MRBA 5GRXG 3EDFA 1HN1A 3D2UD 3U46B 1KDIA 3FO2A 3GTNA 4EMZA 3UGUA 5CN1A 3UZVB 4ZX4A 2XY1A 5TF0A 5BRPA 2P26A 3VGHA 2UZYB 3POHA 4Y1AE 3VXPB 5HGBB 4ZMVA 3IJYB 5EZLA 5GGUB 1QBAA 5IMKA 3LYRA 3H2PA 5GJTH 4DKDC 3WNKA 1EWHA 2KUTA 5L4MA 2YD7A 1AZZC 1FNGB 2E9IA 2WHVA 1FNEB 4P9ML 4PIBA 4Y2LA 4DP9X 4XPHL 3U4BL 4BQ9A 5HDRA 2XV2A 3AUWB 1EO8L 2HLAB 2V17L 4G9FD 4LEEA 4CDHA 4OZFG 1UKTA 1SF5A 3Q6FB 3MXWH 5IROD 4J27A 2WVTA 4FEMA 1K3IA 4UOQA 2OULB 3CVDA 3BAXA 1OWWA 2QQNH 1SOKA 2NNAB 1Y6NR 1U3HD 4ZSOB 3GBNH 3GSNH 3UAFA 4XTRC 1ZIAA 1MJ8L 1X6LA 4MMXC 3CMGA 5AZ2H 3OPZL 5K9JH 1ERNA 4D9QE 2YD4A 4F15C 2ZSVA 3BKJH 2PCFB 2WNWA 3C6EA 5DFVC 4D0DA 1CF1A 2FR4B 4KO9A 2I69A 4QRPE 4XVOA 5HI5C 2YA1A 2MJWA 3GNMH 2D4DA 2NY2B 4PY8J 4OUOA 2ZYIA 2AW2A 1BX2B 4R9HA 3EBIA 5I1GL 4DP0X 3QDME 5C8JA 4JFXB 2MQ3A 1I82A 3RVXC 4KMLB 2W38A 1UOVA 3S7GA 3WHXB 1NWOA 5CSBA 4U6XA 2N3JA 3BQUB 3ZE0F 4FQLH 3ARBB 3FCUB 3BN9C 3T5WA 4BINA 4JPWH 2ZKWA 1QASA 4L4VD 3KBFA 3VXRA 2IH3A 4L3EA 1M1SA 3IN0A 3ZMEA 5EZJB 4GMSH 4K3EL 3FT9A 3QUMH 3MCKA 4ABWA 3OC5A 2OMVB 1LK3H 3THMH 1OAQH 5KBKA 5IK3A 1IUZA 5HDQH 2NDFA 3W0WA 2DJ4A 3L08A 1HEZA 1P69B 1KFAH 2NY5H 5F7EH 4E9WA 2VDLB 5FV1L 3K6SB 1KPRA 5SX4H 1X5YA 3ES6A 4N6RB 4TNVF 3X3FH 4KQ0A 5E00A 1F56A 2IWFA 2CBMA 4YZFE 3RWIA 3FQ1A 1E6OL 3GIVA 2EIJB 3LTVA 3N5AA 5CWSB 1SGKA 2APFA 2D8KA 3PIQA 1EHXA 4AYGA 3DX8A 3OHXC 3SPHA 4XX5A 4QLRA 3RDTD 1AFVH 4QF1B 2J20A 2WPGA 4LCYB 4PRAB 3WTYA 3NIFE 4QI3A 4B7LA 3MRCB 4XBEH 4A7VA 4PJ7F 5C0GB 1C8QA 2O5ZL 3BHBB 3VXQA 1KTCA 5CKAA 1KGUA 2ZAIA 1KJ3H 2SODB 1DVQA 3EH3B 3C09C 1G1YA 1XSKA 4PVMA 2IIJA 3MLTB 3TLRA 1MH5A 4EQ3A 1Z5YD 1URZA 4BIKA 3HUJE 2BSEA 4X6EB 3W11D 2P8MA 2Z4QA 4Y2OA 1G6VK 2FJFA 2F19H 2CLVB 3QIWA 8CGTA 4X6FA 4H25B 5KSBE 1IEBB 4QXTA 4JJ5B 4BHUA 4NJAH 3RBGA 1M42A 3QZNA 4U1JB 5GJSL 4YEEA 1X9LA 3D48R 4MZ2A 3BH8B 1EHLL 1X5ZA 4HD5A 4MHHI 1A4CA 4FFZL 3CPLB 4MWFA 1TCRA 4OCYH 2ZWLT 4RQQB 4V2BA 3WN5A 3QPQD 1ZPUA 1M4KA 4WFHD 1S46A 5TH2B 4TRPH 4Y4KD 1VFBB 4E36A 2MTAA 3EDJA 3LDBB 1V3MA 1FAIH 1XB6A 1U8JA 5EV7A 5FOJA 1D5XB 2YKLH 3NTCH 4UT6A 1SFHA 3GBEA 3KWXA 4RNRB 5GGRB 4NO0B 3HRPA 1UWXK 2GQHA 2WXNA 2MIZA 3CLFL 5F1NA 1IQDB 5H37A 3WGUB 2G4GA 2GJJA 4MQXD 4QOKE 3LRKA 1ZHKA 4JFVA 3QQ4A 2AJXL 1KJ2B 5J7CC 4AENA 2NSXA 5IW1B 5IVOA 3OB0K 3QARA 1YYCA 1Z32X 4MS8C 1G4MA 2WBKA 1MNUH 2BP3A 2AEPL 3I3EA 4X7SL 3TBWB 4KXZI 1NFDE 4OUUB 4OVVA 2ZWKA 3C5SA 3DLQR 1I4FB 3EDDA 4OBRA 3V5KB 4J23A 3QIUA 2HKHL 1RKRA 4XVJL 1V05A 1CFNA 3G04B 1KTRL 3FJTA 1A3LL 2XWEA 3S98A 1DQLH 3SDAD 3HE7A 1GAFL 1JGUL 1BVOA 4XC3L 3DIDA 3SOTA 3VA6A 5CNHA 1UTDA 5E2VL 5AZEL 3S35L 4FZEL 1AHWC 4UBDC 1UB5A 1KIQA 4XNXL 5J11B 2WB7A 3UTTE 5E6UB 2WUCL 4HCRH 2NT0A 1JCVA 1SYSA 4UDTA 3H2QA 4G8EA 1K8IA 3VFRB 5AWNH 5IREA 1K5WA 4KJYA 1A4KA 5DHVH 3T6VA 3IGKA 2XZCH 3LPPA 4L8BA 5IFAH 3FT3B 2ZX5A 2VKXA 3N41F 3V79C 1XCTA 3N42B 5AYTA 1UYWL 2AJSH 3KBEA 4U1LB 3K71A 2DJUA 3QDJD 4YNYA 1RZQA 1JPST 1DUYA 1J0ZA 3AACA 3P30L 5DEGA 5CFAA 3HG1D 1Q0XH 1YMMA 3NA4A 5DURB 4MJID 4Q97A 1PIFA 3RBSA 2MKWA 4I2XA 3RNKA 3AB0C 2DLEA 4PRHD 4RDBA 3TEYA 1NANH 2NPLX 4P48A 1T4KA 1BLNA 1FDLH 3S48A 4WEBH 2CK0H 3U0PA 4ZMZA 4K0OA 3PP4H 5J6SA 3FCBA 1KNOB 4LCVA 1BDYA 5KVMC 2ZUWA 1IAIH 3B7SA 1S3RA 4PSRA 3WS6A 3SDCC 2QHRL 2VXTH 1I75A 5IW3A 4JM4L 2XHNA 3H9HB 4IKIA 1ID5I 2WZ6A 4Z7VE 4BFFA 5ACZA 1T6BX 2AJUH 4GXUN 1G9MH 5AZUA 3BN3B 3SGKC 4PUBH 1HOEA 4R5TA 4Z6AT 3DHUA 3NQIA 1IT9H 1KGCD 1OCCB 1WK0A 1DHKA 1SM3H 4POYA 2P47B 2VSKB 3AM8A 2A6KA 3NCCB 3I3DA 1C12B 4WKZB 1RZ8B 3CFKB 2IANE 1HXYA 4IBUA 4ONHA 3G6JF 1MEXL 4AJ0A 3F65A 1DUZA 1OTTC 1U2YA 1S9XB 4FEIA 4LZKA 4NZUH 3DPBA 4LOUD 4DPCX 1GGTA 2CJSA 3KPSB 4BA8A 4HHWA 3L16A 2YLHA 4X4ME 3BSZH 5A43C 2GJ6A 1Z9NA 4XBPA 5AL0A 4Y0GA 4EKJA 3QHTC 3BT2L 5KVFH 4F8NA 4MB4A 5IBLC 1UH2A 2XLLA 1F58L 4U2YA 3VRIA 3WN6A 3PF2A 2VLJB 3RIFK 4HWUA 1JZDC 1VF5C 4L4TB 3TM6A 1BQSA 4LAQH 2QJDA 2FHBA 4QNPF 4W4OC 1DQIA 1N3NB 1GGUA 1ED3B 3LZOA 4XMPH 4YGVB 1XGPA 5DJYA 1YNKH 4BFIA 2ZOLB 1UKSA 5ANHA 1E2WA 5GGVL 3WE6A 1FRGL 3O3EA 4Q4EA 4DWHA 3ZZQA 1SOXA 4XXCA 4P5KB 4ZSOE 2Z92B 3CHXA 1IAKA 5E8NB 1MJJB 2NNFA 3L1OH 4PJ9C 1ZE3C 4XH2A 1OW0A 2JJSC 3OMAB 3HEIB 5AOLA 4I13B 3Q5TA 4GFXA 3VFUA 4DVRH 1U8NB 3GMOA 4PD4J 1F4XH 1X7SA 4RFNC 1MWAH 4RAUA 2UX7A 3MR9A 5JQIB 3SYOA 2VXSL 1I7ZA 3ASWA 3ARUA 3EGSB 3ZMRA 1OTUC 2ZUXA 2A4EA 3AS1A 3UMTA 5I16A 1RIHH 1IC1A 3LEYL 2ICEC 1MIEH 4B96A 4Z7AA 1KBVA 4FJZA 1OE2A 4NT6B 1L9MA 1MREH 5IUCA 5IJKC 2EYSA 3OMNB 1JDAA 1W8EA 4FOMA 4ACPA 3VWJC 3DETD 1IKFL 5BOZG 2AXFB 1NWPA 3SKNA 4P4RB 3DWTA 5F7NC 1OAZH 1LJMA 3LHPL 4JK0D 1KXVA 5CP3A 1U8CA 1RU9L 3ZE2B 2Z3FA 3DSNB 1MLBA 2R7EA 3ZN6A 1IC0A 5KJRL 4TLUA 1A7RH 2BK8A 3LN4A 2FWUA 3KYAA 5E2WH 4W9IC 3V4VL 1FCCA 2G60H 2XIDA 4G7SB 3D2UA 1JPTH 1X5XA 4LU5L 2V6HA 3UBXA 3LH2L 1I8LA 4J3BA 4JPKL 4WWPA 5H2BB 3CC1A 3QG6A 3N04A 2XNAB 4AI7A 5BS0D 3BPNB 1LEGA 1W9XA 1P4LB 2NY3B 4HWBL 2D9CA 1W72L 1XQ4A 3IDJA 1A6VH 1A6TB 1R3HA 3NZHL 5AENA 2R0ZL 4N20A 2PPAA 3NCJL 2VE6B 5D96C 1OOAA 4FFYL 3S3BB 4UDUA 5F88B 5EEUA 1KZYA 4PJ5B 4DERA 3QEHB 2FGZA 3L2NA 4LLVB 5CD3B 3Q2LA 4OF5A 4G9FA 4GQPH 4OAWB 1QLEL 2WQWA 5FV2A 4LLUA 5F7MC 4GUPA 4PCTA 5IROA 5A2JH 3RI5F 3SGJC 3MLRL 3P4NB 1B0GA 1ZS2A 4CSSA 4D8PB 1KWGA 3AQYA 1E2ZA 3B6SA 2Y7QB 3QJSB 4BDVB 2XXCB 5DQJB 4Z7OF 3WJMA 4CGTA 2X1QA 1J8HB 1FZKA 1NGZB 3S3PA 4BA0A 4W81A 4EVNB 3KGSA 2V2TA 2HVJA 2X2YA 4GSQA 5KSAC 2J1WA 1UGNA 4YHNB 4LVHB 4R90L 5C0DB 3IFNH 4NQSB 4Y2DC 2X4SA 1LO2L 4YXHL 2IQAA 3J2PA 4OGYH 4FHBD 1UCBH 5HHQA 3D07A 3RWCB 1NBYA 4C59B 2MSPA 5DZOA 5KTEH 5LHDA 1I7UA 3JYBA 3LV3A 4W6XB 1G94A 3ZL2A 2HT3C 3RUGF 5SWZB 4NKMA 4P5TC 1IIKA 4S0HA 1QRNE 1L6ZA 3SZ6A 1V7NL 3FT0A 3NJNA 1IGYB 3V5DB 4M7KH 4RGND 5SV4A 2EE9A 1L0YA 5EDSA 4L4VA 4R4NC 2JIXD 3GUFA 1SEQL 4ENED 3S8FB 5B1KA 4KFZC 4B9PA 4QRAA 1TQBC 1KYOK 1S7TA 2BS71 5D7JC 1J0KA 2HFFB 5K9KA 3GBMH 1GYUA 5H8DA 3JTSB 2F5BH 5I1LB 4CW1B 3GSVB 3U30B 2IAMB 4A2HA 1QX1A 1E4XL 4MMZC 1B0RB 3KVPA 1Z5LA 1WBZB 2AK1H 1KBGH 3SHSA 4ETYA 1ZVSA 4Y89A 3TNNA 5SWQA 1UWFA 4GPVA 5IB2B 1P7HL 5HHOD 4X4YB 4W6WB 5CZXD 4PGCB 4OFVA 1GYVA 2OP4H 4ZUUB 1UEYA 4ONFL 5G2NA 3FQUA 3NDZE 3UCRA 3IWUA 4ZFFA 4ZRGA 2PWFA 4LGRB 1FGNL 5LNEA 5T1LD 2YA0A 4Q6IB 3T2NL 1A14L 2OZ4H 4U6YB 5IQ7L 4JN1L 3V0DA 4Z3EA 4MZIA 2BSRB 5LAXA 1ND0A 2PKDA 1RSYA 3OSVA 5GSRA 4GG6B 4K23H 2RACA 4BWUA 1JPFA 1RJYB 5T1KB 1CFVL 4L29B 1ASQA 1GS6X 3K72B 2NYYC 4W9LC 3DGDA 2G5BB 1Y18B 4HHAB 4RGOH 1YN6B 3MTRA 4LPTA 2LT9A 2WXRA 3O8XC 2B77A 5IMMA 1PX3A 2H32B 1LEIA 3HLAB 1IM9A 3QNZA 5DGRA 3QRGH 5B39A 2Z65C 3U7YH 4B9YA 4DPBX 4HFUH 1T2JA 2E59A 4XTRD 1WZKA 3HI5H 4HMEA 4DETA 2QSTA 4P3CH 2GBUA 3P3YA 5EUKA 1VERA 3Q43A 1DQJA 3O0RH 1LQBC 3I3BA 2A4ZA 2DW5A 2F7PA 1OCWL 3MLWL 3FT2A 3UO8B 5FB8A 5DFVD 1G4RA 3QNXA 4UYQA 5HI5D 5E1AB 3MRIA 5T1JA 2I07B 1JDCA 4XXDB 1I8IA 4M7ZB 1XR9B 1MFAL 2QGDA 3DPDA 1BD2B 4JN2B 3KPSE 4DO4A 1OB1A 2VLKD 3RVXD 3BEVB 2NX5E 3NFNB 5F9OH 5IF0B 4DP7X 1KYUA 4PJGB 3L9RB 2CBQA 4P06A 1KIUA 3BN9D 3CSTA 2X1WL 3GEFA 5B38A 1QWHA 4D3CL 1OHQA 2X9WA 5JMRA 1B4LA 1MCOH 2LAGB 2BNRB 3SDAA 2DRUA 4MRBA 1F11B 3J07A 4LEXL 4EUPB 1SLWA 2NXZB 2VLJE 5I24A 2ADIA 2OXGB 1SMOA 1QSFD 4L4TE 2OMYA 2C3GA 1H9VA 3OM3B 4QHMA 2CKBB 2WLKA 1UXWA 1IFRA 2C26A 1DEEB 1MVUB 2NTFA 4LHUB 2OMZB 1KN2H 1W80A 5HHMD 3V0IA 1A1MA 4I9XA 4NERA 4AH2A 1NSNL 1C5BL 3GRWL 3K0WA 4HISA 4LDOB 4OZGB 5ISZA 2LLNA 1F4YH 2V33A 4V11A 1TXKA 5IWLA 3DX9B 2PXYB 1RFDH 4U3HA 4NUJA 4K3HA 4D94A 2K4AA 2AEWA 4C83A 3VD2A 4WW2C 3HG1A 1LXMA 4Z7UA 2NW3B 5FO7A 4NNXA 4IU3B 4PRHA 5JPNC 4EAEA 1MFMA 2MCPH 1RK1A 5FO9A 4POZC 5ID1A 3QDGA 4OD1L 3DX3A 1FFOA 3CBJB 1F8TL 5B22A 1ZMYA 1LK2B 4NAJA 3X12A 3ISWA 4HXAL 2FWOA 4B5EA 5J06A 1XZWA 4TUKL 1DQML 2RMNA 4HH8A 4HJIA 4EJ1C 2N59A 1NDMA 5KS9B 2PWHA 4QEGA 4OF7A 4MBRA 3NFPA 1OL0A 5A40E 3B2PA 5TF1L 4WUUA 5I6OA 3BKCL 5EB9A 3I2CH 4UIKH 5DEFB 5TPWL 4AMKL 4X7TB 1FSKB 5D7SL 3ZE2E 3U1QA 4FX5A 2BHUA 2A73A 3MVSA 3OPUA 1BVLB 1TQTA 2WZPD 4U3CA 3ZUCA 4CADB 3RWEB 1FO0H 4ZFOA 4WJG3 4AY0A 1MI5D 4WDIB 5C9JA 7PCYA 4M4RB 2D7TL 4RFEA 3QG7H 4I1RA 5D7IF 1UWEL 3L5XL 2WUBL 1FE8H 4UQ3A 1A8ZA 5TE4L 4MS8D 1UATA 4U1HB 4R4BA 1QFWH 1MXDA 3EYQC 5IB4A 2DMGA 3RWDA 1QPPA 1FGVH 4HAGA 4AIZA 1NJ9B 1CLYH 1OK8A 2CD0A 2ZUYA 2WCPA 3MGTB 4EDXB 4DP6X 4RFOH 4Z7QF 4PJ5E 1T2QH 4LCCC 4GW4B 3VU1A 3BUTA 3MNWA 5BO1L 1AQKL 2YMXH 1UEMA 2FX8H 1KXTB 3VGAC 1ZD6A 1T0MA 5IBUB 2FB4L 3H4FA 3MLVH 4JO5A 2NW2A 3CSPA 2F68X 4MASA 1T20B 4UBDD 1L6PA 3W2DH 5FS5A 1QEXA 2FGWL 4AJWA 1J8HE 4Y16C 4LIQL 1AAJA 5CEYB 2JKWA 4JEGB 5L4FA 3LIZL 3CVIL 1UM6H 3AGWA 3LHAA 3NIDF 1KN4H 5FLVA 1P1ZB 1KZQA 2VDLH 4CA4A 4XMVA 3MRGB 6TAAA 2VJ0A 3JVGA 3PQYD 5ALCH 1WA0X 4EKXA 1DLFL 4ORZC 1VPOH 4JQIA 1J9SA 2WXJA 3O3BA 4H8WL 2YPVA 3T77B 1AR1B 3C08L 4IMKC 4XNDA 3AC0A 4OD2B 2APVA 2WLHA 4LF3B 3UIZA 3ROLA 3VFOB 2VITA 3NACH 5SWZE 3WBDA 4F2MB 4GG8B 3CXDH 3LQAH 3MZGB 1XMEB 3RVVC 2FBJH 3MROA 2AQ2A 3D05A 3DXAD 3WUWB 2XPYA 2R2CA 2EKJA 3F7YB 1UM4L 3BZ4B 4KXCA 2ZG2A 1MAJA 3TF7C 2LFGA 5EBWA 4OLYH 5CINH 2OYPA 2YIHA 4KMTL 1C5CH 3IDNA 4FMFA 2JQMA 1ZEAH 3A6CL 2EKSB 3M1OA 3VMOA 5IFJA 1V54B 1JK8A 1YECL 2CRZA 1NUNB 4JY5L 4LCUA 2HVBA 5CUSL 12E8H 3I9GL 1BBDH 4GAAA 1N0XH 5IJBC 2XWJB 3IETA 4L1DA 4Y9CA 4PJBB 1CFSA 2R29H 4OLVH 4KK5C 4RMSA 3AT8A 3G5VB 3DVIA 1IBBA 1I1YA 1NIEA 3KW7A 1OTTD 2MOQA 2BY1A 1D9KC 3PREA 2DQUL 5JOFB 4M7JL 5C0FA 3TP4A 3UJTL 1PZCA 1SLVA 2F58H 5J1SC 2FAUA 4XNQA 5EU5A 1CDUA 4Q9QL 1F18A 1ZA3A 1AHKA 3E8UL 5HHXL 4O2CA 4FULA 3V9FA 1OZUA 3QBTB 4NFBA 4PCKA 5DVMA 5J89A 3CQFA 2R23B 2PWDA 5A2KH 3FQ4A 3LMJH 3FUFA 3UFIA 4EZKA 4GG6E 1A0QH 4UM8A 5IBLD 1ZSDA 3OG4B 2RAMA 5TE7H 2WXFA 4YK4C 4AQAA 1UVQA 1QSVA 3CZKA 1UXSB 2CJUL 1AGBA 1KELH 4DGVH 4MZRA 4R7DB 4IRJA 1A4JB 1HHGA 3L3OA 4HKZA 4JDVA 1B2YA 1KTLA 4Z0XA 3SJVD 4Y4FB 5KZCD 1CPUA 3T0EB 4PMEA 2GTZA 2X9YA 2C9XA 3RWGA 1MFUA 1ZLEA 3WEAA 3QUHA 4IRSA 3V9EA 4P2RA 4N3UA 5TDOA 1FLRL 4NZDA 4JDEB 2R1YB 2JCCA 4PJ9D 4AE0A 1PX4A 5T5NF 3WV0A 3IJEB 1CD0A 5CCGE 3D2TA 3FTSA 3MLYH 5E1QA 2VQTA 2KI6A 3VAEA 5DJ8B 1ZT7B 4GSRA 4PWIA 2AMUA 5DRZA 4ZYKB 3GIZL 3T1FB 5I1CL 2XN0A 3CU7A 3FRUA 3OX8A 1ZLUH 1BD2E 1M6OA 5J12B 2V2XA 3FO1A 4OSUH 1XIWC 2BVPA 3UPRB 2E6JA 1NZRA 1QBLL 4FYQA 4OCWH 3BOVA 1D7BA 4XRCA 1OTUD 1G7IA 2JIXA 1S7RB 4PJGE 1S7SB 3QPKA 1BAGA 3S96A 2EQDA 2XX0A 2X4RA 3GZKA 3LKRB 4NI3A 3LXCA 3WIAA 3T0DA 2D7MA 4H0LC 2BNRE 1UGKA 3P2BA 4PR5A 3TZVB 1SOQA 2WLLA 3VWJD 4G1MB 1D7DA 3KAAA 3FB5B 3MRRA 4ENZA 2Q6WA 3IJSA 1A21A 2Q2LA 4D9LH 3DO7B 2A77L 2EEXA 1F3DJ 3HZKA 4FXGA 4IBQA 2DMBA 3WXWL 2ZUSA 3ETSA 5IHWA 3F7QA 2A6IA 2FECI 5BQ7A 4WI2A 1XGYH 1JN6B 4OZGE 1K4CB 1KIRA 5LCVH 4ABUA 2OCFD 5K1NA 1EMTH 2ITCA 3DX7A 4YSTA 3VFGL 4YSRA 5BV7C 1Z3RA 5FDWA 1QEWB 2O5YL 5L2KB 4KO5A 4NAQA 4LVNC 1A47A 1H6EA 1MFBH 3MLPA 3S36X 5EBLA 2BDNH 2IGFL 2G30A 4GS7C 4IW4C 5E08L 2DQHH 3HG2A 2EACA 2XDHA 5K1JA 3A6OA 4XT1C 3I6SA 3IMUA 1A7BA 3MV8B 1WP6A 4Z3IA 2WAQA 3SE3C 4LPCA 3MCYA 1M3IA 4GP4B 3RX8A 3ULAB 2BIMA 2XOTA 4YHKL 3HJ0A 5AAWA 3VWKB 3WTTA 1F3JB 4Q2ZB 4XZUA 3K7UA 5C08A 4HH9B 1SY6L 4FAAB 1ZHLA 2RH0A 1G1OA 4DP4X 3BH4A 1NH6A 1V7ML 5KS9E 1I8UA 1SF3A 5AW8B 3HHSB 3ECBA 1NUGA 3OQ3B 4J6RL 5J6GB 3FTXA 4MMXA 4YHLH 4P59H 3TTYA 2WXHA 2XWTA 2VOTA 2ZOUA 2NLJB 5KSAD 5GS0L 4HS8L 5I5RA 3QXDA 4IMLA 4XXWC 4XNZC 4JANA 4QRBA 4ADGA 4Y2DD 2MCAA 1KACB 4B5ZA 5KYXA 4Z3HA 1W2KT 4YHPB 2IXQB 2EDWA 2I5YL 3KEDA 4TQIA 4XCFH 5D2LA 3WFZA 1NGPH 3D3VD 1XH2A 2P24B 3F6IA 3L7EA 4WSGA 3FQNA 2WSKA 2ICWJ 4F91B 4JUTA 1DSYA 4NQQA 5JUEL 1KGXA 3UTQA 5EU3B 4LLYB 2HT3D 4I0CC 4P5TD 1K8DB 2JCCF 3V6ZA 3L81A 3KYMB 2IH1A 3QQ3A 3ULUE 4YSPA 4X9GA 1BM7A 5TDNA 1R3IL 4QRQA 4R4ND 4UV4H 1S7VA 3QFJD 4Y5YC 3B9EA 1E9OB 5IHHA 3SBWC 3CFMA 3O2WH 3A4DA 4R7NA 5D7JD 4LFHG 5ITBH 1J0HA 2Z0UA 5LWYL 1WJ3A 2LE9A 3UC2A 3IKKA 4JZOA 4Y9EA 3S4SG 5I1EL 3GLZA 4Y88A 3IMRA 4KDVA 2KS0A 4RISH 3UTPE 4F7MB 2C3WA 3CVHB 4FQQA 2MPAL 1IBHA 1REIA 4NWUL 1YY8B 1QLRA 1PG7L 4PRID 3M7FB 4XP6L 5AVRB 4N3TA 1DQDL 2IMNA 3QZMA 1SVZA 4M3KB 3WKPA 5F3BA 1RZJH 4BK5C 4OGXH 3PCYA 1CQYA 2P44B 4O51B 3QQDA 5AL8A 4PREA 2WOBA 5F7DA 1GGBL 2B8OT 4RMTA 4OLEA 4LSPH 2X0VA 3BSGA 3F05A 4M5SA 1TLKA 1SDDA 1XH1A 1PLBA 1AI1H 1OAXH 5C0AE 1OF2B 4ZK8A 3SY0B 3PDOB 3TPUB 3GHBH 3DOIA 3QCVL 1NEZB 4GMTL 4F2ME 5C97A 4JJHA 4LEOB 2BZ7A 2V3DA 3QULB 2B2XL 2NYYD 1TZAA 3SPIA 2DS4A 2HH0L 1QPXA 1ZTXE 2WYHA 2YUWA 2ZWZA 3AXLA 3G6AA 3VU2A 2D7PA 1PS3A 3JWNC 3S8GB 3O8XD 3ZYIA 4R8WL 1U9KA 5DZJA 4PY7B 5T33H 1J86A 3DO3A 1TQSA 1KENH 2NZ9D 1P4IL 1P53A 2FX9L 3LJ3A 4K9EL 3F84A 4NWTH 3VXMA 1BIIB 3S34H 2WZPA 1SBSL 3BIKB 1BQ5A 2NY2C 4QRSB 5EIQA 1NCBL 3IJHB 4MD5B 4PBWD 4OZHA 1GC1H 1JPEA 4PJBE 3VD1A 3CN3A 4GI6A 1BXUA 1I7RA 1CR9H 4CMMB 5FR3A 3I50L 2EP6A 3QHZH 5FYJE 5BXFB 2X4TB 1N0LA 4U6TA 4YO0B 2AJ3B 4X83A 3TXAA 5KUMA 4I5BB 1S4IA 3E3QC 3FF7A 1EGJA 3ARBC 4CVZA 3RA7H 4YHZH 2JKRM 1NGWB 4BGLA 1BFVH 2IDQA 2UUDH 3NP3A 2OSXA 5E2UH 4OCLC 5CKGA 1P84K 3P77B 5CILH 1AKJA 1WFNA 5I1IH 1AMYA 5A2LH 5L7XL 1KOAA 1EZUA 3C9NA 2BIOA 2VR6A 1PZ5A 1QFOA 1X7TA 5FYKH 4LARL 3LSOA 4NZTL 1CD1A 3ISRA 2KZWA 3K4DA 3LN9A 4JZNB 4HWEH 2K3TA 4Z7NF 5F6HI 3NAAL 1AHWA 2WJ5A 3FB6A 1JZ2A 3JWDL 4G1EB 1B6DA 1NDTA 4HYTB 1TEYA 2DKMA 3UEQA 2Y9RT 4RIRB 3RPKA 1EJ8A 1VHPA 3CC5B 2IEPA 5CSZA 4ANWA 5E4AA 3T0EE 3OSKA 1FFRA 4AYBA 4R83A 1FLTX 1LQSR 3D69B 2F08A 4RAVA 3TT1H 5FF6A 4TUUA 5BCAA 2R39A 4JO2L 1HI6B 4JFEA 4O02B 3RVWC 5DZPA 4KHXH 2KZ1B 4X8GA 1J7VR 1LP9F 2BP0B 2B7DT 4APQA 3PWPB 5TDPB 3Q2CA 2WKGA 2EUZA 3F7LA 3FDWA 5KYWB 1JERA 1BZ7B 1ECZA 2L3BA 3OZ9L 4TPRH 4HPOL 2OLDA 3AY2A 4M5ZL 3B1UA 3SE4A 3T0WA 4AG4L 4ZFGL 3M17B 5ICYB 3KPLB 4M62L 4POZD 4ZW6A 3GZQA 3CIQA 5SWSA 3K81A 3P0VL 4TSCL 3WDJA 3GI9L 1N2RB 4Z8FL 3CMOH 2WBJA 1DBAL 5E5RB 4JFZL 3EAKA 3WFHB 2WQUA 4CDGC 5I0DA 1MNNA 4JY4B 2E74C 4MAZA 1WZ1H 3LNFA 4NN6B 5CEZL 1SPDA 3O2DL 2OMBA 3SDCA 4KWUA 4G7RB 1ZHBA 4ZOBA 2QQLH 3MBEB 3DYPA 4JKKA 4PGZA 3RILA 1HSBB 5I1DB 5DDHB 2OJ1A 1OARL 3SGKA 2H32H 4GRWB 3ULVH 1CF8H 1KCRL 1KG0B 1K2DB 5J1TC 1INEL 3IGUA 4KVCH 4KTGA 5KVGL 5CXPA 3ZE0B 5GZNC 5FA4B 4WI9A 2ZNWA 4FQXB 5L9DH 3VM5A 4L18A 2ADFL 4HU2A 2VDPB 5MHSD 3H2WA 1JHKH 3HAEA 1OZTG 4GQQA 1NAML 1EEQA 1RK0A 4F8PA 4EZJA 5DVPA 1TFPA 3O6FB 5AVSB 3WS3A 3RFRA 3KYOA 5L2KE 4ZOEA 5DUPL 3LNGA 4GRLA 2X28A 4LOVA 3UZEC 2EVJA 1SXCA 3NPSB 4OZHF 2O61B 2G3ZA 3PGDB 2ICCA 1N68A 3P2TA 5GIRB 1FV1A 4N8VA 4NS0A 2DQTH 1Q1JL 1CYXA 3GEWB 3MV8E 4GAGL 3ZX1A 4U6HB 2YEZA 3TN0A 4E0RB 1WHOA 4KHTL 4E9QA 1WAAA 3CN2A 5E6IB 2X3AA 2VUYA 4XCYB 3RGVA 4FJYA 5E6YA 3OKMA 2EXSA 5D9SB 2J8OA 5F0MB 3E38A 1PPIA 3LS4H 4XMUA 4W4OA 3KGTA 3IMTA 5DYFA 5TQ0H 4BXVA 1NL0H 1FNSH 1H3GA 4EEEA 5IY5B 1EHAA 1P7QB 5I23A 4OGAC 4XWGL 3EADA 4OQTL 1QA9B 3FUIA 3IDXL 3QS3A 4Y16D 3APNA 3DTXB 3MRBB 5GXBB 2CKBH 2Z1PA 3ZRSA 3MRLA 2F53D 3GSRA 1CLCA 3FO2B 1KCSL 1NICA 3PDGA 4KQ4L 2JJSA 3DUHA 4F9LC 4ODBD 4ZS7H 4NPYA 3ATFA 4NHCL 7TAAA 2MRYA 2TRHA 3NMEA 1NBVH 3GXTA 2VDML 5D71H 3QWQB 3VFSA 4DTGL 2BNQA 5EZLB 3OKEB 3PWVB 4HEPA 2JKTM 3F7VB 4AUUA 2GUOA 5F21B 2LLGA 3GSQA 4F9PC 2H0FA 4HOMA 4PJEA 3RVVD 1IZJA 4LNVA 4Y9BA 4OLWH 3FO0H 3V10A 3HG3A 3R4DA 5C0IA 3X3GL 5IJKA 4P9HH 3AG4B 3VWJA 2YWZA 3ZYJA 2J5LB 6FABH 2DQDH 1DTUA 3O3UN 4GRMA 4NP4H 4G6FB 2YD0A 4DEWA 3QS2A 3IAQA 3Q05A 4YOKA 4ELMA 1JWSA 3UAAA 1PVHA 2WZAA 1U8IB 1UZ6E 2IFGA 3RTQD 4D0DB 3K5SA 1WC7A 4YDJA 1QFPA 1Z5HA 3D52A 1BEYL 3FOLA 2PF6A 2WXGA 1O7VA 3VUAA 4IDJH 1KFGA 2P80D 4FL4C 1U21A 3UTOA 4KK5D 5I0ZA 4PBXA 3QVAA 3SODB 3QZWG 1H3PH 5F7YC 4CVXA 7PAZA 4CAGA 1A9BB 4PHZA 2E9WA 3NSJA 5EZPA 4U6XB 1YEIH 1BZ8A 1D9KD 1J1XL 4E42A 2EO7A 2IWGA 4MD4A 1II4E 3VXRB 3MPCA 2IH3B 3OMIB 4L3EB 4Y1SA 3MCKB 5G55A 4R3SA 2G5RA 1ZPLA 5IK3B 3ULUH 1KLFA 3W0WB 4LSVL 5MERA 4APXA 1HEZB 1KPUA 2XPGA 4WFGE 4HIXL 2H5UA 3KYNA 7CGTA 2BVOA 4AQ1A 4PGEA 2ADGA 4M6OL 3SGJA 3ES6B 5MI0B 5E00B 2HJLA 2I9LA 3RWIB 2WTRA 3I6LE 3VTAA 3GIVB 5IFHL 5DXWA 3PIQB 2O72A 1O7DC 3DX8B 4ABQA 1WAAF 3WY2A 2H6PA 2AJZA 4NM8L 4L1BA 5KSAA 4NQDD 1CI5A 2ZOKA 5L8LB 2FWSA 1A2YA 4PH8A 3H56A 3UP6A 4MJJA 5IHBA 4DW2L 1X7QB 2WN3A 1DSFL 4MZ3A 3HS0C 4OFKA 3D3VA 2BSTA 3QCTL 4KKQA 1IC5L 1MH5B 2QADC 4MGXA 1RZ7L 2P45B 4ZG1A 2CDEA 1BQHG 3FULA 2Z4QB 4Y2OB 5SX4I 1E8YA 3NJVA 4P5TA 2FJFB 3QIWB 2XCMC 4X6FB 3HNVH 3ZZ1A 1AJ7L 4QXTB 1JZGA 3Q2NA 1T7WA 3VXSD 4JO1L 5GRZA 1D6VL 4D7PA 4FC3E 5DFTA 3QFJA 4F37K 1CTOA 5DLML 4LSQL 3EYVA 1KMGA 3CFQA 3MQIA 4MWFB 1TCRB 4FA7B 3WN5B 5EA0L 1CT8A 2WXIA 2VDNB 5D7JA 4K7FA 1EJFA 2OW6A 1ZTXH 2DWDA 2E27L 4M5YL 2ZJSH 3D4CA 3ZHKA 1IC4L 2J1XA 4NOBA 1U8JB 4MMZA 5DHMC 1CGWA 3GHPA 4I18C 1IGIH 2FECL 4Z18A 3PDDA 4TOYL 1CDHA 4PRIA 4QHNA 5IGXH 4U1NA 5F1NB 3I9PA 4JG0L 4QOKD 5JXAH 1N6QH 3LKOA 3CZJA 5DK3A 1ZHKB 1YEFH 3IGLA 3QQ4B 2DWSA 2WMPA 1DCEA 4AENB 2HRGA 3R1GL 2UX6A 1GSKA 5E8OA 3MLUL 1OLZA 2B08A 2GI0A 4PWEA 4W6YB 3NT0A 3C5SB 4J4PA 1QACA 2G0LA 4N25A 3PWPE 3QIUB 3A21A 1RZKC 1S7UA 3ORJA 1CFNB 4FQCL 4JO4L 4WU5A 2ZKHL 4H8PA 1ASOA 2R1XA 3HE7B 1QLFB 3DROA 4NZ8A 5L6YH 1NCWH 3DTUB 3VA2C 2CR3A 5MEQA 3GXMA 1UB5B 1KIQB 1XGTA 2KZKA 5IQNA 2OYKA 1NFIA 3MFFA 4KC3B 3UP1A 3O8XA 1JZ5A 1PDKB 2R83A 1HIML 1SYSB 4UDTB 1LNUA 4G8EB 1K8IB 4H1LH 4ZW5A 4PS4H 4KJYB 3H8NA 1RMFL 2YO3A 2EUVA 1GXEA 4LVHC 2FQFA 1U8PA 4WU7A 3H55A 1GPOH 4L8BB 2MQ0A 2BWIA 2D73A 2OQJA 5IEHA 2FJHA 4WTZG 4GRWE 1XCTB 3CXFA 1OT1A 5DO2C 4K3EH 2MQCA 3K71B 4J3TA 4TQEL 1DO6A 4YNYB 3ZE0E 3REWA 2V5MA 5EEZA 1DUYB 4NO2A 1ESOA 2PABA 5F7HA 3AZUA 3ZKNC 1YMMB 3AROA 1J5CA 3BEWA 4U7SA 1SJEA 3RNKB 1X5KA 2H7WA 4LXFA 3GSWA 1M9SA 5E5MB 3AABA 3QNYA 1T4KB 3IXAA 1BLNB 2OMUA 4OFYA 4XPGH 3VI3F 3U0PB 1R5IB 3CV5A 2WNXA 2JJTC 2PPDA 3GK8H 5J57B 2E4FA 4J3OF 1LWRA 4WO0A 1XTMA 3EJZC 1X9RA 1U42A 3MU3A 3VXUD 1T5XA 3H1ZA 3U30C 5ACZB 3HS8A 3ARSA