1G5GA

Fragment of fusion protein from newcastle disease virus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
422
structure length
357
Chain Sequence
DGRPLAAAGIVVTGDKAVNIYTSSQTGSIIIKLLPNMPKDKEACAKAPLEAYNRTLTTLLTPLGDSIRRIQESGLSQLAVAVGKMQQFVNDQFNKTAQELDCIKITQQVGVELNLYLTELTTVFGPQITSPALTQLTIQALYNLAGGNMDYLLTKLGVGNNQLSSLISSGLITGNPILYDSQTQLLGIQVTLPSVGNLNNMRATYLETLSVSTTKGFASALVPKVVTQVGSVIEELDTSYCIETDLDLYCTRIVTFPMSPGIYSCLSGNTSACMYSKTEGALTTPYMTLKGSVIANCKMTTCRCADPPGIISQNYGEAVSLIDRQSCNILSLDGITLRLSGEFDATYQKNISIQDSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUSION PROTEIN
publication title The structure of the fusion glycoprotein of Newcastle disease virus suggests a novel paradigm for the molecular mechanism of membrane fusion.
pubmed doi rcsb
molecule tags Viral protein
total genus 86
structure length 357
sequence length 422
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2000-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.490.10 Mainly Beta Beta Barrel Head and neck region of the ectodomain of NDV fusion glycoprotein Newcastle disease virus like domain 1g5gA01
2.60.40.1690 Mainly Beta Sandwich Immunoglobulin-like Head and neck region of the ectodomain of NDV fusion glycoprotein 1g5gA03
4GIPD 4WSGA 2B9BA 1ZTMA 3MAWA 1G5GA
chains in the Genus database with same CATH superfamily
2PP9A 5I6XC 1CLYL 1MJ7L 2JK5B 2W9DL 3GLEA 5T1KA 3VFVB 1T4WA 2Z4TA 4O2CB 4AIOA 3KJ4B 1S7XA 3HC3L 5EBGA 4JFOB 4LSTL 4RA0C 2CPUA 1XAUA 4PJGF 3MA7B 2H0JA 4PGBA 1GJUA 2W9LA 3BP7A 3JT0A 4NOBA 4NO3B 3AT9A 2ED6A 4RRPM 1YN7A 2UX6A 1OAYL 3SOTA 3T3ME 1QFWM 2QKSA 3OZ9L 4MNHB 4WHTA 4P07A 4Q0XL 2FJHA 2FLBT 4CVWA 3SGKC 5KBKA 1G7IB 2A6DB 2COQA 4K8RH 2IANB 2R2BB 5GXBB 4KK8C 1QAWA 1NL0H 4K2UH 2QKIA 1X5MA 3KLKA 4ABWA 2F68X 4PJXF 4Q9CA 2BNUA 4XNYH 5B3SB 2ZG3A 1J86A 4DSYA 1WA2X 5K9KB 2J3SA 4XXCA 3KNBB 5DJAB 3O4OC 2DLFH 1B0RA 2V5MA 4XVUD 3H9SB 4X7TB 2JV6A 3S3PA 3ARXA 5KJ7E 5FM8A 4WI4A 1UD8A 3SOBH 2M26A 2VLME 1PKQE 1PZ5B 3LIZL 1BIIB 1ACYH 1U8IA 3KPTA 4RGND 2VN5A 2D2CC 3O81A 4G3YL 3GMRA 3ZTJG 2YKLH 1JHTA 5LB1A 1BMGA 3ES6A 2VN3A 1FNGB 1K3IA 4NQXA 1FHNA 5CGYD 2H6UA 4KKQA 3MR9A 5LGHH 4P3WA 1HHKB 3FFOA 1UJ3A 1TTBA 2ZWLT 5IW3A 1IL1A 1CYGA 4E2OA 3WHXB 3KLSA 4U1JA 4C4KT 4KAQL 1FYTB 2J4WL 4HFUH 2F58H 1YEHL 1FZJB 2E27H 1X6NA 5DLML 4U3HA 3ZE0B 5JO5A 3UBXG 2YD5A 3OKMB 2A9DA 2VR8A 1ILSA 5F9OL 4D7BA 2B1OA 2XPGB 1JXDA 3ISYA 4XMPH 3V4PL 1IVLA 4L23A 3IJYB 5AVWB 1AD9B 1WAAE 5C7ZA 3GRWH 2AITA 1LM8V 4GW5A 3VXPB 2F53B 3MBEA 5MEND 2FRGP 4NN6B 1ODAA 4ZUTA 3DROB 4N6RB 3T8XB 5GRYA 4OKVB 4WO0A 2DEYX 5CD5D 1VPOH 1MFCL 1SYSB 1OALA 2NDGA 2FCBA 3MKGA 4HIEB 2JB5L 4AQ1B 4CGUB 1A3RH 1YEJL 1KCUH 1QSFB 3E3QC 3HE6B 5DEZA 1OLZA 3QDAA 4LPUA 1NAMA 2VAJA 4PJ8C 3AUVA 1A9BB 5ITFB 2VN4A 4LHUG 1CBVH 2Q6WA 2A6KB 4X7CC 1G6RB 4NQEA 1BQHB 4POUB 5JYLA 1MDAA 3LZFL 3I50H 3KYAA 2WXJA 4P4RB 1L5GA 4P2OB 5DUML 3CSTA 1JFQH 2NT0A 4O4YL 5IB2B 2VXVH 3G5ZB 3HA0A 1KLUB 2VLJB 4YSEA 2HYMA 4PR5A 3BVVA 1N4XH 3F12A 2F8IA 4YBLB 3N0AA 1IZKA 3PPEA 4NXSA 3ULVF 1JP5A 1DBAH 2APTA 1I9EA 3C8DA 1FSKC 3KVQA 4G6FB 3SGDH 2BS8A 1URIA 5F1NB 3PF2A 4WRLA 3UPCA 5J12B 3HN8A 5AB2A 5I23A 1EERB 3LZNA 4LT7A 5J3HD 1MCCA 2F1BA 3K0YA 4MA7L 4X5LA 5C0CE 2Y3NA 3ULSA 2BP8B 4PLKD 1F4YH 2KUTA 3MRBA 1XV8A 4MJ6B 1NGQL 2ENQA 4RMQA 3GZQA 2EDLA 1TEYA 2D3LA 2ZX5A 2RQEA 4ZPVA 3WFBH 4K5LA 2WZPD 2R1YB 1D7BA 1CT8B 2WLLB 5KTEL 4XC3H 1SVBA 4LOVA 1YYCA 4YH6A 1I1YB 4LMQE 3C8KB 3HKZA 4A2GA 5C0FA 3W37A 1NCDL 2DJSA 3DSNB 3KPQB 4JY6A 5D7JB 1RFDL 2V9TA 4Z0BL 3WLWC 3L4WA 2UZIH 1ZIAA 5K5YA 5GRJH 1Q9WA 5A2LH 2CGZA 2X53A 3D50A 1DSFL 5BXFA 3ZJAA 3ZX1A 2EO9A 1NANH 4YGAB 2DL2A 4XGZA 3DYMA 2J1XA 1RK1A 3E6FA 4WI3A 4CNIB 3JQOB 2FIKB 1Z9OA 2OMVB 4ZAKA 1U8MA 4XWOC 3RIFF 4QTIH 3QEHA 4NQTA 1UOWA 3FSOA 3IJ9A 5DO2D 1FFOA 4X6CB 5GGRY 4XH2A 4DAGH 2GSIA 1NMAH 4PS4L 3QB7C 4LVEA 1XF4B 3SQOL 2P42B 2RQ8A 1T6WA 2VERA 3D3VA 3ECVA 3COOA 2RIKA 5DMIH 4Q14A 2OL3L 2OTPA 4IBUA 3SO5A 4PD4J 3PDGA 3E6HB 3FQXB 1TTAA 3DTDA 2WWMC 2ZSWB 4HJTA 4MD5B 4X4YB 1MLCB 3GXMA 2W07B 1KPVB 4ENZA 4PBXA 3EW3B 1IGIL 2MJWA 3T0DA 4KXAA 2N4IA 2PO6A 1GA2A 3VXMD 2K9FB 3TH2T 5C0RH 2ATAA 2XRAL 4PV9A 3UTTD 2WTRA 5IB3B 3TBCA 4Y16C 3UZEA 1WZMA 2A74C 4WJKB 5ID0A 3OMNB 5EU7C 1OGAE 1E2WA 4GRMA 4BH8A 1JN6B 2CO7B 2G3NA 3KPRB 1MFAL 3SSGA 5LCVL 3MNZA 1GS6X 3S96A 3LDBB 2WB7A 4XCFH 5IEKA 1H8OA 2Y36L 4KKCD 4FNLL 7FABL 2ZNXA 5B38A 1E65A 1K4DB 3T3PF 1X9UA 4JQVC 5HPMB 3QULA 4YVNA 1CYWA 4XNXH 4O9HL 4PV8B 2Y7OA 1KZQA 3P0YL 4RH4A 4RRPG 3BN9D 4JO2H 4Z77B 2CBOA 1HEZB 1LMKA 3ISWA 4PCSA 5K59F 3WLBA 4X80L 1FVCB 4LASL 2FO1A 4XN8A 1FNSL 2XIBA 4GLRH 2LLLA 3QZPA 2DEXX 2NZ1A 2BCMA 3BKYL 3ZBMA 4KJWC 4TUJB 3GTVA 5G5DB 1RP9A 3RWJA 2X40A 4JZNB 1USZA 4RIRA 3SPJA 3F7VA 3KH4A 5KVFH 4PRBA 4J3BA 3HHSB 2PPAA 4P2RD 2I26N 4WFGE 1S9XB 3VTAA 1JG9A 2Z92B 3NESA 3E7JA 2KERA 3CVIH 1MJUH 4XCEA 2VLRA 1DUZA 2AJZA 1JPGA 1MW1A 3VW3H 3B7TA 2O5XH 3GI9H 2XXGA 3VXUD 5B1CA 4LPCA 5D7IA 4QR7A 3WEXB 1WJ3A 1HIML 4NSKA 2PYEE 3UTSB 2FB4L 4WCYH 3EJYC 1CXIA 2NY0C 3TA4D 3ZHKA 3II2A 4CSZA 3QO0B 4JFYB 4Z3IA 2P8LA 3O3DA 4WI9A 2VNCA 1QFPA 4WW2F 3CFCH 2DQDL 3IRPX 2NZ9C 4Z7VF 2A6IA 1PVHA 1YYMH 4X6DA 3K3QA 4HH8A 3LIZA 1H9VA 4H8QA 2HRPL 1I7ZB 1QVOA 3MNWB 4XOCA 2AEQL 4WIQA 1X44A 2IG2H 4G9FA 3VH8G 3UTOA 5HDBF 2WWKO 4MD4B 3MJ8A 2LVEA 2UXTA 1NLBL 5D1ZB 1EHNA 1OP3H 4F24A 2C3WA 4J3WA 5DHVA 2ATKB 2NW3B 5JW4M 1P6WA 3V5KA 4AV4A 2DQGL 2VZ3A 3UPAA 3H2PA 2B4CL 3IJ7A 3QEGL 2WN3A 2OV0A 4JHVA 4E9XA 1JHLL 2OXGA 5INDA 2Y7QA 3V79C 5I1CL 1OD9A 3EYOB 1KLGB 3FHEA 3AADB 3MJ9H 5IQ7L 1T7ZA 1KJMA 1ZTMA 1MCWW 2KQNA 2NY3B 4ONFL 4JHUA 1K4CB 4KRPD 1XB3A 2EDBA 3GK8L 3A5VA 1U8PB 1G84A 1IKNA 5K93A 1OPGL 5T1DL 3V4PA 3D85A 2H1XA 3EH3B 2ZX9A 3BAYA 1Q0EA 3H9ZA 3G04A 4NZDA 3S3CB 4EXKA 4LVOC 5JXEC 3A24A 4FKKA 1AZCA 3QA3B 2VC2L 4IBTA 1YNTF 4LU5L 5IBUG 1FAIH 1BPVA 5JIHA 3ZE2E 3UJIL 4ZG1A 4YS4A 4WEMB 4YZFF 1YJDH 3VXQA 1JWSA 1VEOA 1LQBC 4JMNA 1PZCA 3QUXC 2BNRA 1HTYA 3AT8A 2P8MA 1RQ5A 3U1QA 2XZQH 4FNRA 4Z7OF 4RDQF 1HK6A 2CE6A 2WW8A 4JFED 3TA3B 3EGXA 4WI5A 4OBRA 5FDWB 3MO1A 4WI8A 5DZOA 3FUJA 4AOFA 3BKJH 3NABL 4MA1B 1NMCB 3OLEA 1A4JA 4FNPA 4U6HA 2Q86B 1AI1L 1FI8C 4FRWA 4YWGH 1I9IH 2CIIA 2OTWB 4JFFE 4AQZA 4TQHA 5FWQA 3W11C 4GXVL 1GIGL 5IFJA 1W6WA 2ZKHL 1A8JH 1S7SB 4RZCA 4GOSA 5C09E 4TQEL 4P4KB 3HRZA 1YLBB 3FCSB 2YSSB 1KN4H 2CXKA 4WFHE 3OXRB 3REVB 2C4FU 3LKPB 2OYPA 1WCBB 2VRKA 3MYJB 2FZ3A 4AYDC 1UXWA 4N90E 3RWHA 1M1XB 2IWKA 2CJTA 5DF0A 3SE9L 4RDQG 4AMKH 3MNVA 1X9RA 4OZFG 4HC1A 1SEBA 1UEMA 4UIMA 4NQEE 5EUKB 3IRZA 5B1BB 3EYFB 4LIQE 5IVZB 4X5QA 2FX7H 3IPBA 3MBWA 3ARDA 2J1WA 3S3SA 4JDEA 1H6FA 1YY8B 2ZAIA 2ALWA 3OPZH 4JFDB 1M7IA 1NCNA 1E7UA 3O8XA 4ICXA 3FB6A 3M8OL 1BVKA 3SDDA 5IUSA 2X4UB 5ESQB 2R1XB 3U2SB 1RUML 2ICEC 3FFCB 1QR1B 3HS8A 2JIXD 1TJHH 1F4WH 2YEQA 2BVYA 3FUKA 3EDDA 1KPUA 4ZSOA 1AE6L 2QDVA 1C08B 1XAKA 4OIIL 5EIVA 5A2IH 1JZHA 5DHYB 4S1DD 2XCMC 2PXYD 4AWJC 3HLAB 5D1QB 4B9KC 3NRPA 4NKDB 4XP1L 1PNCA 2VERN 5KYYB 4ZO6A 3QFJB 3GT6A 1C16A 4M56A 3BQVA 4MJ2A 1P69B 2OL3A 1CDYA 1UA6H 2EIZA 2HN7A 4I3RL 4NQSA 1BMZA 4B3VA 5ETUA 2WLYA 5C0BA 3QIUC 4LVHB 2MHAB 1IRAY 4QRRE 5EWIL 2FEDD 4X42A 4OFIA 3UJTH 4GAAA 1HHGB 4A6YB 3WJMB 2IXQA 2YGPA 4M6MH 4O51A 1IM9D 2AF2A 4KXZI 1IGFH 4BSWB 3MJ7B 5I76A 2VJ8A 5ACZB 1OEZW 3V4VH 2CO6B 4DKEL 1JF1A 4PJCA 4I4WB 1AS7A 3MLUL 3MV8B 3P3UA 2FECL 4GSDL 4N8UA 4PM1A 4JG0L 2NUTA 3OSVA 4AT6B 5EV7A 4GP8B 4L9LC 3U6XA 4A63A 4U1HB 5JZ7C 3VFUA 3G6AB 2WZAA 4F3FB 3H85A 4HHAB 4KK8D 3SE4C 1U8OB 1AZVA 4UI2A 4YDKH 4MRBA 3F64A 4F7MB 2EUXA 2RALA 1HCZA 1HH9A 3NK3A 3S6CA 5L8KB 1KJVB 3ULUD 3LEVL 4DZBB 1OP4A 3RWFA 3PFUA 3PLYA 4X7SH 2D7TH 4F9LC 1MQ8A 2NY4C 1G9MH 1M05B 1RP8A 4HKZB 1BQ5A 2A9AA 5KVGL 1R17A 5AL8A 2VLKE 4U1IA 3US1A 2JKWA 3PQYB 1TO5A 5EBLB 3FC8A 4ZDHA 3DUSA 2ZX6A 3RU8L 4A7GF 4BDVB 1EMTH 1NLDL 1ZA3B 1WFOA 4PJDA 4PMFA 3BOVA 5HHQA 4P9HL 4KXZH 4HLZG 3U0PB 2V2WB 1ADQL 4QRPD 4JPQA 2BY0A 1ITBB 2BVEA 3PRZA 2YUWA 4M1CC 4IGBB 2YC1B 4NGHH 5DRNA 3N5AA 2CHDA 4JO4L 4NDMB 1IAKA 2V6HA 3KPSA 3D25B 1ZSDA 2IADB 2X1WL 4XXDB 2BDNL 4MXWH 4NNPH 4O2EB 4IS6A 1EEYB 2QGBA 1ZV2A 5CZVH 4DT2A 1GMIA 1TVHA 3RB7A 2L7UA 3TIEA 1U41A 3L4XA 4NI6A 4GEJA 2IAMA 1BYPA 1Q94B 5EO9B 3TWCH 1V3LA 3MHZA 3ZZLA 4TUOB 3NJLA 2FDBP 1KB5B 3NQIA 5DZAA 2D03H 2X9XA 2DQTH 3WG7B 1PU0A 1AKJA 2O6CA 3OX8A 1MRDL 3FUFA 4MHHI 4FXKB 1UACH 1UH3A 3S4SB 4C55A 4TVSa 2H4EA 4MNGA 1NDGA 4UAHA 5AOLA 1Z3GH 3SIKA 3CSFA 4TQPA 3WUZA 5E2UH 2E6JA 4PJ8D 1L0QA 2WBJB 4LKCA 2E9GA 3UP6A 4FXGC 1UWYA 1T2JA 5CN3A 1CG9A 4EKXA 1QFUL 2O26U 2H2SC 3EKCA 4HPOL 5KW9L 3ARPA 4WDIB 3IDUA 3IDNB 2A2QT 2FJSA 1CPUA 5FO7B 1Q1JH 4RX4A 1UD2A 5GS2H 2LTQC 1DBBL 5I0YA 2BOBB 1G0DA 2Y24A 3STBA 4JBSA 4MVBD 4KVCL 3BPNC 3IWUA 5FK9A 1G7PA 3P40A 2H5UA 4XAWH 1BZ7B 2YAFA 1RMFL 1IKOP 3HB3B 2MCPL 4G9FE 4Q6IA 1XF5B 4P57B 5T5FH 5TFSH 5A2KH 2DLEA 1XCTA 4JEGB 4M4RB 2QQKH 5IJVA 2RAMA 1K85A 2WXLA 1OT1A 3CFNA 3DBXB 3OJDA 2D0FA 3PWJB 1MFNA 3P2TA 2KH2B 4G1MA 4PJFA 5AZEH 2WTOA 4P2AA 3CPUA 4MMZA 3QZNA 2UY7B 4JRXE 3U9PH 3FT4B 2BNQA 1CVSC 3ARFC 3WLWD 1CFQA 3B8YA 1O9WA 2OKMA 4N2BA 4Z7UB 4M7JL 2JJVA 2G5RA 1S5HA 4F1ZA 3F65A 3OAUH 3GKWL 3MLVH 1CICA 4F92B 3P77A 3VYPA 5KJRH 2X3CA 1J8HD 4YAQB 3BIKB 4YSRA 3ZRCC 4DK5A 3VI3E 5TE7L 1PX4A 3STLB 4JMXA 3EBHA 5K9OB 1KCSH 5DJZB 5HI3D 1ZXQA 4X99A 3GO1H 5CAYB 3WAKA 3MRJA 2BOCB 2APWA 2YS4A 4U0RB 1OARH 1MJ8L 4P3CH 1IU1A 4WI0A 2X89A 1JUFA 3A22A 1FGNH 2J1KA 1X5HA 1BFVL 5DUPL 1X7QB 2CDEA 5DZVA 4R96A 1RHFA 2N59A 2XICA 2R4SL 3WY2A 4Y16D 1R3JB 5AZ2H 1I75A 3US9A 5L9DH 2PTTA 2ETWA 1SZNA 1P7KB 1NWPA 2WNWA 3GUTA 5I17A 1T1WB 3DVGB 3ETSA 4OLWH 3PNWB 2PPCA 2B39A 3BAXA 3BXNB 3DO3A 4QAMB 3V7AE 3DOSB 1FO0L 3GSRB 1KF9B 1P4LA 4XCCH 3PWLB 1R0AH 4W9LC 3EOTH 4FJYA 3V6BR 3X1EA 4G2AA 1N70A 2KLTA 1UTDA 1CJYA 3BUYA 3HG4A 4PREA 2XWBA 3MGOB 1UM6L 2UVFA 2WCSA 4OV5A 4HS3B 5HHME 3O0LA 1CTOA 3RVUD 1UENA 5B8CC 2WJ7A 2X4SB 1DQLH 1HNYA 1I9JL 4P59H 2GITA 3WIIL 3KM2A 1KIRB 1AIZA 1OF2A 2ZWNA 2ZCKL 1GSKA 3BEWA 3O6FD 4AZUA 3QNYA 1PW3A 5ANHA 1HI6B 5FYJL 3N85H 3ZT5A 3SE6A 3FTVA 4G8EB 3NOIA 1KJ3H 4XB7A 1N2RA 1NM4A 4ZSOE 5TDNB 3ZRFC 1V7NL 2VR9A 3CN0A 5F1IB 5GGVL 3DGGA 4F20A 1RHHA 3QSKB 5E70A 5DJDA 1XR8A 4IMLA 1LHZA 4JGJA 1XH2A 3DIDA 4ZYKB 5JUEH 3DHJA 2A7BA 3QZWB 5FUOL 1OAUH 4EI5C 5J6GA 1G7JB 2VXUL 3EJYD 5FCUL 3LRMA 2NY0D 4M7LT 4QUOA 5I74C 3WO3B 1YNKH 1F2XK 1WV7T 4PIBA 3GIVA 4JM2B 4MLIA 5EU6D 1B4RA 2OMNA 1MSPA 4G5ZL 3NJJA 3EF4A 1YDPA 1R3LA 1PBYA 2NZ9D 4MWFB 3BAEL 1A6WL 3IDMB 4FKEA 4KKBC 4MX7A 3EBGA 3B7RL 3D4CA 2GJ6D 1A7QL 4R7XA 2I60H 1QQDB 2P44B 4JO1L 4RFOL 3KPPA 3BZDA 2BINA 5E2TH 4Z7NB 4HH9A 2AEIT 4PJ5D 2DQEL 2E9IA 1DBJH 4L2YA 1GGYA 1S9WA 1D2OA 4UQDA 3UBXI 2EKSA 5B1JA 2P80D 4N2HA 4PCTA 4QOKD 1ADQA 4X9BA 1RZIA 4D8PA 1MI5B 4S1SL 3HMWH 1CMOA 1AACA 1CDJA 1TJIL 4OF8A 3K72A 6FABL 4MXVE 5EOCH 3FFDA 4PCYA 4GI8A 2ZXEB 1S7QA 3HOGA 2W0FA 1A6TB 4IU2A 1DQQB 2IDSA 1NOAA 3F85A 3IFLL 4AVKA 4PWKA 2PYFB 2EE9A 1CFTA 4FE9A 4G8IA 4EIUA 4B9ZA 5E5LA 1L3NA 3K80A 4AC4A 4ELMB 5JHDB 2R7EB 5BV7C 3BSGA 1B3IA 4IDJH 3BD3A 1OW0C 1E28A 3GWJA 3O3BA 3RDTA 3SJVB 3SO3B 3T2OA 3MPCA 4PJDE 5E4AA 5JXED 3ELQA 3BHBA 4FZEL 4X2UA 4U1NA 4A67A 2WP3T 2GI7A 5D7IF 4HGWB 5KS9B 3MCLH 1EO7A 1BGXH 1QSEA 2W0PA 1QKZL 3VGGA 2WGXA 3PFQA 5L0QB 3QUXD 3N0PB 4GSQA 4H88H 1Z0MA 1V10A 1KGUA 2IQ9L 2P5EA 4OW6A 4W9IC 2ADGA 4DHLA 3DX9A 1SOKA 2X1OA 1AGDA 3OL2A 2JJTA 2JMRA 3F01A 4YR6B 5EG6C 3SCMA 1OSYA 5JMRA 4FFYL 3N41F 4KQ4L 3TEUA 5C08E 3LZRA 2PWEA 4OZHE 4X6DF 3T04D 2IGFL 1AXIB 1WS8A 4Y7MA 3FT3A 5FYLE 1S3KL 3U7WL 3W11D 4S1RL 1ZT4B 2E46A 4DPRA 3HZVB 1ZLSL 3QQ4B 5H35B 1QNIA 3VD1A 2Q8BL 4XN9A 5GRZA 4B0MM 2HVJA 3L5JA 1LNUA 2ZXWB 3C6EA 5E4EC 1CLZL 3QUYB 4DFIA 2VDPB 5FKAA 3DX1A 4N2NA 1JK9A 2R0ZH 2EVFA 4PJBA 4YL4A 4ZZKA 1JJUA 4L4VB 3EO1B 3QFGA 1GGCL 1ERNA 3TNMB 3P4MA 1JWMA 3BP4A 4ODBD 5HHNA 4GQRA 1EV2E 4B9PA 4IRJB 2VZVA 1LO0L 2QLYA 3BIAX 2ODIA 3VGAB 5I15L 4OLUH 1RZJH 2ZOTA 5AWNL 5I8EB 4KTYA 2D7QA 4ODVH 5IJBC 4R7NB 4X5WB 5IB4A 4JDTL 3CD4A 3PXLA 3I2CL 4PJIF 4FQHB 3PPSA 4AEIH 5IMLB 2HCZX 4Q9QL 4YOKA 3D2TA 4PWFA 1XF3A 1D9KB 3EOYG 32C2B 5MHSE 2BP0B 3GSNA 1GOGA 4IKJA 2K1MA 4M00A 1K2DB 1PIFA 4UOW1 4X8JB 1NZRA 4Y19B 3HNVL 1RUQL 2ADIB 2Q9OA 4HAKA 1HDMB 3QPXL 1HINL 4IRZL 4W81A 2VXQH 1AFVL 4HULB 5B39A 3V0WL 3QIUD 3ETBF 4ODHH 1QTSA 5I0VA 5AOZA 1A3LH 5K39A 3MYZA 2R29L 3R1GH 2C8NA 1EGJL 1J0KA 4ABQA 1O75A 2BSCA 4YHLH 2DQIL 5ADOL 2OCFD 1T20A 4AKQA 2G30A 4M8QA 1ETZB 4DOHB 3A67L 1XB8A 1KOAA 1QBML 2GCYB 3L48A 3T65B 4LSVL 4X7DC 1OWRM 4HPYH 3MTXA 3FO9A 3X3GH 2AJSH 4YLCA 3AC0A 1EEUA 2YJLA 4H8VA 5C92A 5JZ7D 4CJ1A 2ALAA 2F54E 3N42F 5CJOH 1FO0A 2HKHL 5FGRA 4U1LB 5L2KE 1FQ9C 2DQUL 3VSUA 1A4BA 1HSAA 1EZVY 2WK2A 5FO9A 5DQDL 3U82B 5B7FA 4OFPA 5GIRB 4S0TD 2A73B 4OZ4B 3N04A 4U33A 3KEDA 5KYUB 4WY7H 3KL3A 2WKOA 3RUGB 1EIBA 3SDAA 3N43F 1LK2A 1VB9A 4U1KA 5DRZB 5AVQB 1FH5H 2KL6A 5SWSA 2LE9A 2HFEB 1A7OH 4XPTL 3Q2WA 2V5YA 5C07B 5JHBA 1NGPH 4S2SB 3G5YB 2QTEA 1W8NA 1B0GB 5CGTA 4W9KC 1DVQA 3UYOD 5JOEA 3HG1D 5B22A 3CVHL 3DJ9A 2J5LB 3V5HB 4J3OH 3L9RB 3NJHA 4W4NA 2XA8H 3HUJB 5F3FA 5K1VA 4F2MA 3IFPB 1UB5B 4DP1X 4TRPH 4IYKA 2GJZA 3A4AA 4M1CD 4APQC 3RAJL 3WN6A 3IVKB 4MD0A 4LCWD 4LFHD 3DX7A 3QXVA 4MJIE 2NCMA 2YPLE 1E5AA 2ZG1A 4QAWA 1T1XA 4FF9A 1T04A 4X8GA 4RISH 5BUGA 4G70B 2AQ1A 3L3GB 3H9YA 1OANA 3LNEA 1KTDA 3FO0L 1S3RA 5HGBA 4JNXA 1T0OA 2WSPA 2OQJA 1Q9LA 4U6YA 4HUWA 5DJ8A 2FH8A 1IEAA 1ASPA 1KT2A 3LY6A 1E50A 2DS4A 2AJUH 4RGMB 5KVDH 3P3YA 2VMJA 2XSKA 4PJCF 3QHFL 5BS0E 2ZJSH 3IJEB 2P47B 3SPCA 4G6ML 3O2WH 3KBEA 4YXLL 2FNWA 1XXFC 3UAFA 4P5TB 3AROA 5IESH 3W5MA 5ICZA 2KHAA 5FYKE 2YEZA 4DWHA 3L9EA 4L4TE 1KYAA 2CM5A 4OJFL 4YZWA 2HVBA 1GJWA 3QPKA 5CEZL 5KG9A 4ZMOA 3DXAB 3EJSA 2MPVA 1E9QA 2XX1A 2H2SD 4KNUA 4LLDB 1DUYA 4OJEH 4JO8A 3F6LA 2CO1A 2RGSA 3JVGA 3MRPA 3CSGA 3V4VB 5D72L 2QQNH 4V2BA 4PRHB 3IAQA 1G6VK 3WFEH 4K7FB 4E41B 1NSNH 1IGYB 1NBZB 2R1WA 3N9GL 1E8ZA 3T0XA 1I1CA 2LFGA 4NQDA 4XNMA 1K5WA 1UT9A 1WYJA 5D1XC 3OKDA 4AQ1C 3SBWA 1MPAH 4QMEA 3NPSB 2VIRA 2XWXA 4NRYB 1JBJA 4RBPH 1P7QD 4OM1H 2DH3A 4X6BB 3B37A 4UWQB 3SN6N 4WNQB 2DI7A 5JYMA 4RFNB 4WEEA 1KGCE 4H5SA 3POCA 1XGPB 5HHPA 2FLMA 43C9B 4P2OC 5GSVB 5AG8A 5IMMB 1GW0A 1NCUA 3S2AA 1TETH 2QSCH 1QABA 4YBLC 4QRSA 5HY9B 4XNZC 3Q1EA 1CDBA 4FFYA 5BZWB 2DV6A 2ZXDA 5A43C 5J12C 4J6RL 4NZ8A 4PJEA 4GUPB 3NUKA 2QJDA 4FABH 2NYKA 4R8WL 4ZFQA 1BZOA 3O3EB 4BCZA 1GGUA 5FV2A 2VJ0A 3MRCA 3AQYA 1JV5B 4J8QA 4I9WD 2OW6A 1QRNE 1IGJA 3LQMA 2ARJA 4DERA 5D7JC 1IQWL 3TV3H 2P5EE 5CCGE 3LNGA 1G7QB 3H8NA 3D2UD 1QPKA 4QHKI 4YHOH 2G3MA 3J7HA 4PI0A 1G6RL 2B08A 1JGUL 1VCBC 3X3FL 3DUHA 1X5AA 1FL5B 4AQEA 5E8PB 4PJ7F 1Y7VA 2WQVA 2J8UB 3Q01A 4FG6C 4XPFH 4MJHA 4PP2A 2J71A 1AZUA 4M6NL 4AH2B 5AKTA 1DTUA 4Z5RA 3WGVB 3MOQA 2ZZUT 3PNRB 2ORBL 1UFUA 4MMXB 3WY4A 2P5WA 3BDYH 1W8EA 2XG5B 4M61B 4PJFF 3GXPA 4P23A 4KRMB 3QO1B 2Z31C 1INEL 5DFAA 4X4ZA 2VT0A 5DSCB 2ADYA 4FQIL 1KFAH 1T7YA 4XMXA 4LSDA 5DUBA 1AIFA 4PS3A 2XPZA 4IRZA 3W57A 2C1OB 1O7SA 4L48A 4HIIA 4UM8A 3ATFA 2GY7B 1BX2A 4KI5D 3MCKA 4FQXD 2DICA 2R29A 4G6AC 3HI6L 2ZPKH 1EGJA 1FJ1A 4FP8H 3BUQA 2DLIA 4R97B 4ZUWB 4ADGA 4PUBL 1KWKA 1EZSA 4NIYE 1VAHA 4U6XA 4BUQA 3ERXA 4DGVL 4QRAA 4LB8A 3UO1H 3KWWA 1DBKH 3KXFD 4L05A 5KEZA 4HUVB 3NYKA 4XPGL 3V0AC 3SYPA 2EIEA 1VZHA 5I16A 2OR7A 4GXUM 1HESA 3QS3A 5CWSB 1JD9A 3QEQD 1MLBA 2IPKA 2AK4E 2D7OA 3OJMB 4NFDA 3U4EA 4EI5D 4KZEL 4BCYA 1KIQB 4HWZA 5E9DD 4RNRB 1E27B 1YCSA 4YC2B 4HWEH 1T5XB 3BZ4A 2ZSVA 4PRAA 5ENWB 1AGFB 4ODUB 5I1DA 2H41A 2Q2LA 2VR7A 4Y4HC 1EZUA 1JGEB 3RWIB 2DMBA 1U9KA 2W5PA 4KKBD 5BRZD 5T1LD 4A2DA 2AJ3A 4P49A 3MV9B 3B2VL 3NCEB 3VFNB 3JWNC 3T4YB 3ESUF 2NY5L 5JDSA 3CFIC 1A7NL 3BAWA 1A1OB 3QDHA 4ES8A 4GAJH 2KYIA 4LKXB 5IQLA 3TU6A 2CU9A 3CVHA 5CLXA 5KSBE 3HR5A 4FAAB 1NCHA 2XKNA 3HKFA 4GIPD 2XLLA 5L2JA 2JKRM 2LU7A 1QA9A 5ECGA 3GJEB 3RP1A 3U4BL 1LEGA 5I1KL 3HZ3A 1YNLH 1WC7A 3D12B 4LSRH 5F70A 4HYTB 2ZOLB 4Y9FA 2EABA 1CQKA 3N6YA 5DD0L 3H1ZA 4JR9H 5F88A 4ZX3A 1U8QA 4MQ7A 1U8JB 3CE1A 4MAUH 2BSRB 1XF2B 1A4CA 3BD4A 1DEDA 1XCQA 5A7EA 1E3FA 4UNTA 1F42A 3TWCL 4YPGA 5TGBB 1WHOA 5C0AD 1PFOA 3FL7A 2X9ZA 3F7PC 4JFOA 4QRBA 4AM0B 1TPXC 3MA7A 2PWFA 1XWVA 4NO3A 4JG1L 4K7PX 5D1ZC 5I5JA 1IBYA 4F2ME 1F2QA 1JNJA 4U3XA 4JUSA 3TVMA 4GS7C 2FSEB 2AXGA 4LQFL 4NHUA 3IAPA 4CVXB 2CSPA 5CN1A 4FYRA 1G7IA 1N64L 2A6DA 5EF1A 1DANT 4N2FA 5IG7B 5DGQA 4I9XA 2CHWA 1WAPA 5FA3B 2VQ1B 2N1TE 4UQEA 2GPZA 1NIAA 2VB5A 2GT9A 4LOEA 1T83C 3IXAB 1QO3A 4UTBL 2VAAB 5FW6A 4LLWB 3W0WB 2VUYA 3KNBA 3TO4B 4H8PA 1F4XH 1PEZA 5IVXE 2DIAA 3LQAH 4OLVH 4X7TA 3SE3A 3RX7A 1DJSA 5GGRB 2V2TB 3OV6A 3GS7A 4X0KB 2VDKB 1J5OL 3VFGL 1P1ZA 3DIFA 3X12A 4QLWA 1U2CA 2A1WL 3BX7C 3CFKA 1B2YA 3PWPE 3GSVA 4M1GL 4PG9B 4FNTA 1Q0XH 3KDMB 5SWZD 3R18A 1KYDA 4H7VA 1BF5A 4NPJA 2Z8SA 1R3KA 3BQUA 2Z0BA 1FNGA 3G9AB 4L4JA 5A2BA 4JN1H 1DN0A 2CALA 2WYTA 1THAA 5EZIH 3TA3C 3QORB 4G8GB 3GHPA 3L3IA 4K73A 4Y2DA 2HJKB 3QHZL 4MA1C 1NMCC 5ITBH 2ZG2A 3DO7A 3MXVH 5TK2A 1LEKB 2NOYA 1SGKA 4ABVA 1AP2B 4MYPA 1FZJA 2BHUA 4GKNB 4KQ3L 1Y6NR 4MBRA 5B7EA 1LO3L 3NVQA 2OX5B 2YAHA 2X4NB 5HYEA 1TZOA 2VABB 4FA8A 2XPGA 3CZFA 3B9KB 5HDRA 1RZ8B 1RLBA 3BGMB 1AD9A 1YEFH 3FHQA 3ABMB 3EDEA 3H6JA 3U6RA 3OKYA 2DWDA 4TNGA 1QFHA 4PJGB 5D9SB 3HN3A 3Q2NA 4QHNB 1JZGA 3QZMA 3DROA 4N6RA 1BF2A 2EYSB 2XWJA 2UZXB 4W6WB 1QYGL 4ORGA 3AY4C 4G6KL 2HAZA 4M93B 5HGAA 1JVKA 2DWEB 3F7QA 1ZS2A 1RIHH 3TIDA 1P4BL 4L5FL 3H3KA 3S34L 4NRZB 1A9BA 2HB0A 1ZEAH 4MXQC 4HD9A 5IT2L 1G6RA 5K9JL 2IH1B 1T6VN 2EE0A 1MRFL 4CMHB 3P9LB 1OLLA 1S7VB 1KC5H 5IB2A 2BIHA 4KUZH 1R75A 2H1PH 3AT0A 5I30H 3D39A 5DEGA 2J20A 2VDMH 5KANG 1LE5B 1MIML 2KZ1B 4OF6A 4L3CA 2Q3ZA 3VNYA 5FHAH 3TBTA 5JIMA 4GMTH 3SPIA 5IOKA 2RACA 1P5UA 4GYBA 1OM3H 3UBXB 3U36A 4FULA 4PJBF 4AYSA 3C2AL 4OFKA 4Z8FH 4XCYB 2GFBB 4PRPD 1J8RA 1GS8A 2DDQH 5F96L 3RPIB 1IEBA 2BP8A 1QUNB 4HUMB 3DMMB 3JWDC 5IGXL 4LVHC 4Y1AB 5HVHB 2ZWYA 4HIJB 3PL6D 2R1YA 4M5ZH 5D93B 3GB7A 3C87A 4H8HA 3U1SH 4YX2L 4CC4A 4PTUA 5A6LA 2GTWA 3A47A 3VXRD 5KSVB 2DPKA 4JJHA 3RTQD 2BZDA 2V17H 3RWGB 1RZFL 3DSNA 5SX4H 4N3UA 3RA7H 3NTCH 1ILUA 2E6PA 3N91A 1M53A 2K6ZA 5DA4A 4AYFA 4QTHA 3P4OB 2VL4A 3IDIA 4PD4K 3QIBC 1MHPL 4ALAL 4K94L 4WU5B 5IQMA 2IAND 2WV3A 3AAZA 5GRXG 4PVLA 4CNIA 4ZMPA 4QXWA 3UIZA 5FGBC 3CFDA 1VGKB 1W8OA 3GSQA 4NP4H 2F0CA 3UP1A 1J1XL 3BGAA 3F62A 1XDTT 4FNSA 1XF4A 3UROR 4X6FA 3M1OA 3ZKND 3H9SD 2XN0A 4DJMA 4Z7QE 3WTWA 4ANWA 5E2WL 2O5YH 3LKNB 3N40F 3OKLB 4GKSB 5LUMA 4MD5A 3IFNL 5LQBL 1MLCA 3KGTA 4ZMLA 1BMWA 3QRBA 4KVNL 1RIVL 4QHUB 3UZQA 1FUNA 4FZ8L 1A66A 3OAWA 3KHQA 5MENE 3MLWL 3PG2A 3P3SA 1HHHB 3MRNB 2BIOA 5JLZB 1LE9B 2BC4B 5A2JH 2PMZA 2FR4A 5B39G 3IKCB 1HX0A 4QGYA 1S7WB 2W94A 5B3JE 2EH7L 1HKFA 1MFEH 3K6DA 4Y4FB 3HRPA 1CGTA 3ASWA 4XP5L 3UL4A 1AGCB 2B9AA 4ODTL 1UYWL 4KMQA 1R3IL 5IFHL 1EFXB 2DQ6A 2WKOF 3MA9H 5KAQF 4Y5XB 4XMTA 3AACA 1J7VR 2I69A 2B3IA 1IC4H 3QRGL 1Z9LA 1TVBB 2BJML 2B2XL 4I77L 1GOHA 4P2QB 1A6AB 4L8BB 4UDTA 1OCZB 4FHBD 3ME0B 3I9IA 5FW8A 4JPIB 3NIDE 4LF3A 1XCWA 2XQBH 4UT9H 5B7MA 4B7IA 3VGFA 3EOAB 2I7OA 3K1DA 2ADJB 1FIGH 1HXKA 4FXKC 5IMKB 5D1XD 2E0PA 1NC2B 1J1OH 4Y5VB 1QSFD 1ZK5A 1SOXA 5E00B 5KAQG 2WBJC 1D7FA 3K2KA 4DGIH 2AKRB 1AR2A 4PWGA 4U31A 3MRMA 4HBCL 2B15A 4V11A 4P2OD 3DKHA 1NIEA 4TLUA 5FM4A 2X4TB 4ZBJA 3IFOB 1DJHA 2DJ4A 1YAZA 5DVLA 2WC7A 5EUOE 2OZ4L 4N2EA 3I3DA 2VLJD 3WEXA 1YEIL 1HXMB 3PS6A 4XBPA 3QG7L 1D5XB 2G5BB 1FP5A 2OULB 4ZOBA 4UTBA 1TJGH 4FG0A 4G6FD 1BYOA 1U21A 3BVDB 2B59B 5JOFB 3ETBJ 3QO0A 2VDOL 3QIWD 3M17B 3HB3C 2VLLB 2HXAA 3ATDA 2JKLA 5ISZA 5EA0H 1RSFA 3D48R 2QELA 4ZS7H 3QDMA 1OP9A 1PSKH 3NFNA 4K5OA 1LXMA 4YEFA 3TWYA 1HILB 5MEPA 1TJMA 4PGZA 4ISVB 3SGKA 4FMVA 4HSCX 2OCJA 3CXHJ 3L81A 4C59B 2DBLH 2J1YA 3MLPA 4MQXC 1TVDA 2AXFB 1XGUA 1VACA 4F57H 3DECA 3K71B 1UXSA 4L3FA 4YXKH 4XB8A 5T3ZD 4KUCD 1O9VA 2CKBH 2DH2A 3B8SA 1J11A 4GRWE 1CGXA 4H8WH 5DDHB 5GZND 1H3PH 3NJKA 1QNZL 1NCCH 3LSOB 3R7QA 3UTTE 3VXME 1PTZA 2X70A 4HFWA 3BWSA 2XQYK 4Y9BA 4H0LC 4LEXH 4XE0A 4ODWA 1IKFH 3FYEB 1KLGA 1QWHA 2H0EA 1KGIA 5CSZB 2SODB 4JPVH 4K8RL 4EUPG 1QG3A 1UVQB 3VXOB 5DRXB 1BBDH 2MKWA 3L4YA 1XH0A 1HHIB 1NL0L 3DI3B 4K2UL 3ZO0A 1QI5A 3T3MB 2YLKA 3ZYZA 4A66A 4XNYL 4U0RC 1T2XA 3W1ZA 3S88H 2Z31D 4AV0A 3FQTB 1I8AA 1U8HB 2JTYA 1BREA 4HIXH 4LLYB 3WTSA 2DLFL 3STZB 3OQRA 3UH8A 1SMOA 4X5XB 3ZU8A 4DW2H 1DQTA 2YGOA 3LZPA 4OFYD 5BW7C 1U2HA 2IH3B 4LGRB 3RQ3A 3SOBL 2VDNH 1OAKH 5E5MA 5F0MB 4ZNEE 3MAWA 1RIUH 1ACYL 3WEOA 3KPRD 4G6AD 4ZMWA 4NYLB 4PBVC 2VO8A 1SQ2N 4HXAH 1NFDE 3VXSD 2CBPA 2YKLL 2NY2B 4AJVA 3LJ3A 1GHFH 5LGHL 4L37A 3X3GL 1E5UI 3FCTB 4P2RE 2CIKB 1DQIA 4HXBH 4W9EC 5H4ZA 4Z7VB 3GJFA 4E42B 3T77B 1S7SA 3VGBA 3O2VH 5ID1B 1DVFC 4XRCB 5IQ9A 4P4KA 3FCSA 4HFUL 3D18B 1HL5A 1GC1C 2E27L 2F58L 5F7EH 4XO4A 5F9WB 5IROA 1LDSA 1PD1A 3L3OB 1BECA 2A6JA 1WCBA 4PJ8A 1QLRB 3BAJA 1JV2B 4PGCA 1HU8A 3QK0A 5I28A 4RSVA 4HALA 4BHUA 3FB8A 4XMPL 3NIFF 2CLRB 2X09A 1HL8A 3GRWL 1RSYA 4Y4HD 5SWQB 3WL9A 1EHKB 5C1MB 1GR7A 5EU4A 4MYWB 5JW5B 5C9KA 1GKOA 4R5VA 4OTXH 4JJ5B 1RV6X 3QI9B 4L1DA 5LO7A 1A3RL 1ZVNA 5T1JA 3WE6B 1KCUL 1EXUA 3RL1A 3RJOA 1RVFH 2CUMA 3C6LC 2D9QB 4MNQD 2OJEA 1IGTB 1CBVL 1UT2A 3K4AA 3BESR 3UTSD 4XBGB 3I50L 1UT1A 3JV4B 3SGJC 4PGEA 1HWWA 2JB6B 1JFQL 2XV0A 1XH3A 2HT3C 2R4RH 2VXVL 3D0LA 3WMSA 3CLFH 4JM2C 5E8OA 5EU5B 3FB7B 1NQBA 1OHZA 1N4XL 1I8IA 1TEGA 2XN9D 2OMZB 2CHZA 5DZPA 3LHPH 3VYNA 3DGCR 3X11A 1DBAL 3MGTA 3P9MA 1I1AC 2Y72A 1BZ9A 4HC1H 5E6IA 3NCBB 1CFMA 4QNPE 1JZ4A 2XVKA 3ZSTA 2QVMA 4AIZA 1F4YL 3LRKA 3NCWA 4ONGH 4BSWA 2FEJA 3I6GB 2EDFA 3MJ7A 2AXHA 5BMFH 4WTZG 5ANMB 3WFBL 5D1ZD 3O45B 4BKSC 4N8VA 3BUDA 4LGPB 2JQMA 4XC3L 4Q7DA 3VFTA 4P46A 1NGYB 4LEEA 2MPAH 5DK0B 5B1AB 3K74B 2BVQA 3FOMA 5C0CB 2VXTH 4NO2A 2Q20A 2G2PA 2VUOA 2ZP0T 4F3FA 5JPNB 2UZIL 4C56D 1G7HA 1Q38A 1U58B 4TVPD 5GRJL 5TK4A 4HV8B 3LMJH 2HUHA 4JFEE 3ARGC 4U3SB 5HHOB 2GHWB 2HVKB 3SKNA 2G60H 1SLVA 3N1MC 1KJVA 1RZKH 1KY6A 4HKXB 4DZBA 3LKRB 4Z3TA 1KN2H 4HWUA 4IEFB 4TL4A 3SO3C 3C5JB 2H6PA 3WIHH 2YD8A 5FOBA 4QTIL 3WKPA 3CHXA 3VX1A 1S9YB 1P4IH 4DAGL 1WWWX 3BUPA 1NMAL 4HKZA 3V6FA 4RQQA 2PPEA 5DMIL 2P9RA 5EBLA 3RHWK 5L0QC 3V6OA 5LXVA 5EN2A 1SDYA 3L5HA 4Y1TA 3S5LB 4PJ9C 3SZ6A 5E6YA 1ZJBA 1ZD6A 3P2BA 1RJZB 3PAVA 3NDYE 2OMUA 4MA3B 4PY7B 5HGGS 3WY1A 4M5TA 3DV4A 3TEYA 1CXKA 2JJSC 1L9NA 3CPLB 3TA3D 4I13B 3PWUB 4J8RA 2HRHA 2PW1A 4Z3JA 5C0RL 4B9CA 4BK4A 3AWGA 4UDUB 2OZ4A 4H1LG 1AQDB 2CK0H 3VM5A 1HN1A 1ZDQA 4NWTH 1Q9OA 4CMMA 3O6FA 1YAIA 4PY8J 3U2JA 5C3TA 2DKSA 4JFPA 4JVUA 5PAZA 2L04A 4XCFL 2OW7A 1NC4A 1W2KT 1WPCA 3QUYC 1OGAB 2UWEB 3KW8A 4MLSA 5JQHC 1CBJA 1U95B 3T4AB 3V0VA 4XNXL 3B5HA 4Z7WA 4WTQA 2IVFC 4JO2L 3K2UH 4JFZH 3TCLA 3EG9A 5FUCC 3ROOB 2AMGA 4DPAX 3VQ2C 3NIGE 1MCDA 2WZ6A 1SN5A 2YQBA 2WXPA 4L18A 2ZWKA 3UPRA 5HVFB 5FKPB 3II3A 4JFDD 3VGAC 5IK3B 3ABZA 4MXQD 3DYPA 1HT6A 4QXTB 4HS6B 1T5WA 1FAKT 3PDOA 4FLOA 5DR5L 5GS3A 1V8HA 4DVRH 1HCYA 4WDIA 3FFCD 2PCPB 3DPDA 5I1LB 5KUKA 2DWYA 4Y4KB 3PIQA 5IHWA 5KVFL 3OHXA 3O3UN 1G7MA 5MI0B 3ZKSD 1SYVB 2LV4A 3V10A 3FSZA 1BW8A 5LGKA 1R34A 3D06A 3MU3A 2BOBA 4A2LA 1JPSH 2XV3A 3ZDYE 4LHQB 3CVIL 1MJUL 4MJ5A 5EU3A 4UM9B 1SOQA 5DEFA 1GZPA 2NXZB 3OKKA 4PJ5A 3C08H 3VW3L 1MHCB 2O5XL 3CLEH 3GI9L 3QFJD 4HOWA 1DQMH 1VFBB 4ZFFA 4J7RA 3HBZA 5D4JA 1UA3A 4QOKA 4HCFA 4WCYL 2EICA 1XF5A 1J10A 5FYLH 1NIBA 5F7AA 1X5XA 2F6AA 4XN4A 3FPXA 1GTFA 3PUCA 3PV6B 3QJSB 3ZOAA 3ULUE 2YXFA 3CFCL 5F6HI 2WVVB 2PYEB 4YQXH 1IBBA 1CCZA 2D0HA 1YYML 3OR6B 4Y8DC 5T3XH 2W95A 2E9JA 4PJIE 4AQ8C 4QRUB 2UY7A 3BMWA 1NMBH 1S7XB 4GRLD 5DA0B 1NPNA 2EEXA 3FB5B 3QIBD 3MV8D 4PY8I 2GIYA 5DJ0A 4PGBB 1BEYH 1YQ2A 2IG2L 3BP7B 2GVYA 1QFOA 4NM4H 4TNVF 1SDDB 4QRPE 1NEUA 4G5AA 1AR1B 4WHTB 1WRFA 3NJFA 4YAQA 2A9NH 2Q7NA 3GMOA 4TXVB 3SY0A 4WEUD 4QI3A 4HUUA 2WY3B 3G6JE 2Z7UA 1DO5A 1MIEH 1TJXA 1GMEA 3MJ9L 5CKGA 5DJZA 1KCVH 2QKIB 4JM4H 3I3EA 1KSRA 2VSCA 3P30H 1MZZA 2BNUB 3MRQA 4N0CD 3V4UH 5T8IA 1CDCA 2X0UA 3M7FB 3PQYD 1B0RB 1VFAA 5CP7B 4JM0A 3GRWA 3L2MA 2X2IA 5JR1H 2WPGA 1QHPA 4K5PA 4L1BA 2K3HA 3X13A 4UQCA 1YPZE 1FAIL 3U4KA 3AS2A 1DEEA 4YSCA 1U8IB 5DD5H 2HZHA 1YJDL 2G4GA 3GMRB 4H25A 2NX5A 1JHTB 2CXGA 1GYAA 5E51A 3ES6B 1BQHG 3OKNB 2XZQL 3E3QE 2IDCA 3G6DH 1S9VA 3MR9B 1ZE3H 3GSRA 1C5DB 4J4PA 1MG3C 5HP5A 3SGEI 4YHKH 3Q7JA 3HVNA 4L2LA 1IL1B 4XVSH 4HOXA 3BKJL 4U1JB 3NCCB 2ED7A 4AL8C 3KWVA 5F3HB 3K0WA 4YWGL 5CF3A 1I9IL 4OZIE 3BH9B 2AC0A 1T89C 5JO5B 2X42A 3WOVA 5IJKC 5HGDA 2X4SA 1DANU 3ZMNA 2MQ0A 4DP7X 1KIRA 1Q90A 1SFHA 1T22A 5DWPA 1KN4L 2AXWA 2ICEA 1M71A 3OB0H 3ESVF 4DP9X 2XJKA 4JFFB 2QPEB 3NDZE 5G2NA 4GW5B 3CBRA 4EN2A 3IGKA 3MBEB 2EDJA 4AMKL 5HY9A 1BDYA 2WBJD 3LV3A 4UOJA 4IW4C 3L6FA 4GG6E 1PAZA 2WUCH 2FX7L 1CE1L 2PW2B 2KZBA 4WENB 4FQ2H 1NAMB 4N0UA 3OPZL 2YMOA 5HYJA 1A9EA 4ODXA 1OZUA 3CZLA 4NQEB 2C3VA 4ORZC 2PCYA 1RAMA 4Y9GA 5DHMC 4H13C 2Y1VA 1TJHL 1F4WL 3GF8A 3OQ3B 4J27A 4R0LB 4ZUVA 3MUY1 3T6ZA 1A6ZA 3A6OA 4CSPA 1PZSA 1K9TA 4PR5B 4WWPA 2GBAA 1B88A 3HB3D 3NPSC 2NPLX 1MREH 3F12B 3QXWA 1J8HE 3IDMA 1N10A 3FZUC 1KCKA 4RAVB 1WBZA 4RFNC 2YFOA 3JTSB 4V1DA 4HJ0C 1MHHA 3QJFA 2E4FA 2K9UA 3V0IA 2HLAA 1UA6L 2AAAA 2X44D 3INOA 4D3CH 1DE4A 1OIOA 1N12A 1OWWA 2QR0A 3MRBB 3ATEA 2WO2B 3ARBC 4UOW0 4JZJB 1YA5A 4J2XA 4ZPVB 3SDXA 4JO3H 3ZTJH 3UJTL 2OP4H 3KM1A 4UV4H 4QIRA 4M6ML 2XDHA 1IARB 2GQHA 1IGFL 1JPFA 5FYKH 5C0FB 2E5EA 4JY6B 4XN1A 4R7LA 1C5BH 3V4VL 5IMOA 3FQNA 3RIFK 1MQKH 5EU7E 2Y7NA 1WEJH 1CFNA 4NOFA 1N9PA 5TQ2H 2R7EA 5BXFB 2IDUA 2PPFA 4XCNA 1HS6A 5C3LD 3HG1A 4XZUA 5KSUA 3CFBA 1M4KA 1RK1B 2FT7A 3E6FB 1SXAA 3DVNA 4KO9A 3ZKMC 3SJVA 1EEZA 4ZAKB 1MCOH 4YDKL 3QEHB 3O3AA 2E7LA 3L5XH 4XH2B 4XODA 4K07A 4FXTA 2NY1D 1NCBH 4NBYB 4QEGA 4FS0A 3D3VB 4KK6C 2F7PA 4X7SL 2D7TL 5LG1A 5KANI 1G9ML 4NZFA 3B7UX 1XSJA 3V6ZA 2L8AA 4I5BA 1MEXH 2XIIA 4K5NA 2FAUA 2AGJH 3QXUA 1UQSB 2PO6B 3SB3A 1EMTL 3JWNG 4PV9B 1Y18A 2WTRB 4QXGH 4I2XA 1U36A 4MMXC 1P9MC 3S3BB 5DD1H 4KPHH 5GRVL 5ID0B 3Q48A 3KBPA 2OR8A 4GRMB 4BH8B 1EX0A 4YHPA 3ZQXA 2VLKB 4YE0A 1ZANH 1H9DA 1WZAA 3MNZB 4Z7WE 4NGHL 1RLWA 4CBZA 3ELAT 4H2AA 3S96B 1DVFD 1UEYA 1ZA6A 2KLRA 1LWRA 4HMDA 4KWUA 4ANXA 1F58H 3ZN6A 1CGSH 4NQVA 5B38B 2WQXA 4RETB 3CFTA 5AVTB 4NN7B 5LVEA 2FUTA 4MXWL 3QULB 5J11B 2WQ8A 4NNPL 5IFAH 1DDTA 3N44B 5CZVL 4WNSA 4KDWA 3B5GA 5EU6E 2WMPA 3EO1A 4JN2A 4OSUH 3F7RA 4R97C 4LLQA 5BCAA 2D03L 4FJZA 4N26A 4YHNB 2DQTL 1JPEA 2WLJA 4HX1A 4IRJA 5F97E 2GJ6E 3U2IA 1LLAA 1UACL 4MAYC 4L1SA 2LABA 4X5WA 4PJ5E 1Z3GL 3RWJB 2OSXA 1SXBA 1KBKA 4RIRB 1JXGA 4OGQC 5E2UL 4QO1A 1RPUA 3C6LD 4KV5F 3OVUB 4TSCH 1P7QA 4QOKE 1DDHA 1D9KA 32C2A 3KCPA 4WGVB 3FUDA 5AVUB 4YDZA 1K2DA 4FCAA 3ZMRA 1F56A 1NGXA 3CFMA 1DUZB 4YC2C 1JPGB 1CB4A 4H44C 2HT3D 1BLNA 1UWXH 1G7LA 1MRCH 4JM2D 5D7IB 1Q1JL 3NSFA 4M8VA 3NPZB 3B1UA 4G6JH 3MJ9A 4NSKB 2QEJA 2C5DC 4K23H 2NYYC 4BWUA 2ZYRA 4ZFZA 4PJHA 4BEIA 2WVTA 4OJCA 3KWUA 1TEFA 2PN5A 4QPEA 1I1AD 2P8LB 3O3DB 4PWIA 3BC9A 1MY7A 4XAWL 3ARED 2FSDA 4UNUA 1JYXA 5T5FL 5TFSL 3TESA 2E8YA 1NPUA 4XVTH 5J1AA 4X6DB 2QQKL 3BZFA 5J1SC 3IJHA 1QVOB 2ZAGA 3MUZ1 5M94B 2GCYA 5IB5B 5AZEL 3A4DA 4E9YA 1GKEA 5FEBA 1MW0A 4G9FB 4YLQT 1LGVA 3QZBA 3ZDZF 5DTFB 4WHYG 4ZW3A 1D6EA 3MJ8B 2NNAA 3IT8D 5JHDD 3ARGD 5DHVB 4ZQKA 3BDXA 4HJGA 3BE1H 3V5KB 1MCIA 5IV2A 3OAUL 3MLVL 3TJEH 3WNMA 4Z7AA 1NFKA 3MLRL 3Q9QA 4OZ4A 5CSGA 4B6ZA 3GFUA 5EEWA 5INDB 1AVAA 2Y7QB 1PX3A 3WCYA 4JRXB 3RUGA 2K7QA 5KJRL 2IGLA 1S7RA 4URKA 1KJMB 5I6KA 4P5KB 5D55A 2HFEA 1F4HA 2CMRH 1FFTB 3RKDD 5C07A 1RERA 1EO8L 1AQKH 1F13A 1IT9H 2XTSA 3V4PB 3B3IA 3D85B 3GLZA 1KCSL 1ZTXH 5BO0D 2VN7A 3GO1L 4RMUA 4YSQA 3G04B 4JZOA 4FTVD 4PJ9D 1ZPUA 2J12B 3EFFB 2EDDA 1OARL 4APQD 5F7UA 1VERA 3VI3B 2GBTA 3HUJA 4P3CL 4EDWH 1UB5A 4N28A 4CW1B 1FGNL 1Z7JA 2FUQA 2E9WA 1DP0A 2BSDA 3IGUA 4PHZA 3VXQB 3T6VA 5GGSY 2BNRB 1G9NC 1OTTC 2P8MB 5AZ2L 4KJYA 2IDFA 5L9DL 2YPKA 1JF6A 3SYCA 5AAMC 1OGTA 4FQXA 2CJUH 4KTDH 4HOMA 4OLWL 3MO1B 4NQQA 3JZ7A 3Q5TA 1QPPA 4QJ4B 3O11A 1WBYB 1A4JB 3Q2LA 1TR7A 4U6HB 2MTAA 5BPPA 3ARTA 4ZW7A 1BXVA 2B1AH 1R24A 4XHQA 4XCCL 2NY7H 4OIBA 3C5SA 3EOTL 5FUZH 4XMWA 1R0AL 3WMQA 2OBGA 2YRPA 2NY6C 2V3EA 5E2VH 3HRZB 3RL2B 4S0HA 3QORC 4IBQA 5FLUA 2FZ3B 1UXWB 3O6KH 2DQFB 5HI4C 1DQLL 4P59L 4DP0X 2F18A 2FJGA 3MNVB 1WISA 3DXAA 4QGTA 5E9DA 3WELA 4UIMB 5BNXD 3BCDA 3DNKA 3ESNA 3N42B 4M02A 4OVUA 3A4FA 5E4OA 3LS5H 3ZIMA 3N85L 4A55A 5HHMB 2PWHA 1BFOA 4L8DA 5IB1A 3MBWB 3ARDB 1KJ3L 3FU6A 3WKYA 2A9CA 4JDEB 1ADWA 5BRZA 5HTSA 3V4VA 4LRNH 1M7IB 1BXXA 1H3WM 3FB6B 4PCKA 3N43B 2F1AA 1BVKB 3SDDB 1TZGH 2O6EA 2Q87A 1U91A 4U1MA 5JUEL 2QADB 3A6BH 3HJEA 3WTXA 4Y19D 2HT2C 3HAEA 2UY6A 5BVPH 4BK5C 5KSAB 2DYPD 4HIQA 1UG9A 4HUNB 1OAUL 2H3NA 1KPUB 4ZSOB 3HC2A 3VGEA 4M93C 4MB4A 1JNLH 1MFMA 1XGZA 1F3RB 3P0VH 5T1MA 1GXEA 7TAAA 1YNKL 1B6UA 3CZGA 1C16B 2GEQA 5DVPA 3GXTA 4CMHC 4ABUA 3G9VA 1EJFA 4NM8H 2OL3B 4OLXH 2EIZB 2HN7B 5IMMA 1FWXA 4NQSB 2XV2A 5C0BB 1FE8H 2EIDA 3HEIB 4UCFA 2I60L 4NO0D 4TSBH 5E2TL 1CGVA 4F8OA 1DBJL 1XX9C 4MZ3A 3HG1E 4LLUA 4O51B 5BZWA 4U1GB 1E4XH 5I76B 4JUTA 2IMNA 3W56A 4Q6YA 3A3YB 1WA0X 1JZIA 3PJNA 3ZW3A 3HMWL 4GSRA 4OLEA 4PJCB 3DMMC 4HJEA 4OI8A 5EOCL 3C60B 2NUTB 4Q8BA 3WMPA 4EQ3A 4R7DA 5AOJA 4LCWE 5HVHC 3TPKA 1Q8MA 4D9LH 5D93C 3D4GA 5ILTH 3VFUB 5D7LA 3T0EC 1P84J 2Y7LA 1FGVH 1HZHH 2ZX7A 5CIPH 4B96A 1HH9B 4Y89A 4IDJL 3UAAA 5LGJA 3UCQA 1J0HA 1WAEA 4E9WA 3RWFB 5CLTA 1CDIA 1GYUA 2A9MH 3LS4H 1KG0A 1UM4H 1YMMD 4HQQH 2UUDK 2FH6A 1ACCA 2W65B 1QZ1A 4YHMH 5J4MA 3QAZC 1LO5A 3PAYA 5HJ3B 3MCLL 3II1A 1BGXL 4OLZH 4YFLF 4U1IB 3WTTA 1XGRA 2ZCLH 3ABLB 4ZDHB 3DUSB 1DSYA 2GJRA 2DMHA 3RDJA 1ZGLB 4WAFA 5SWZA 2ENYA 3K5SA 4H88L 4PJDB 2Z6FA 3NH7H 2PP7A 2R2CA 1C7SA 3E8VA 3HE7A 1L7TH 1E2VA 1UCBH 1PQZA 1WWCA 4I18A 5EHFA 5DRNB 5DSCA 4WJ5A 1VSCA 4JQXA 4OF5A 4JKPH 1ET7A 1YC7A 2YRZA 3KPSB 4P9MH 4UQ2B 1MXDA 1ZSDB 1KIPA 2EEBA 3FF8A 3ZT7A 5AENA 5CBEA 5DVOA 3NA9L 4IS6B 1QRKA 4OGAD 5I71B 1ZY9A 3GBMH 5E03A 1TZAA 4N1EA 5ADPH 4GUOA 1TVHB 5DURB 3TIEB 3L5WA 5FW7A 1WZ1H 2IAMB 4FI6A 4Y4FC 5GS1C 1IO4C 4AVIA 3CVCA 1BIHA 3ULVC 3WNIA 5GISH 1TTUA 2XYBA 3GXUB 4K7PY 2R0ZL 2PNDA 3OX8B 3MLSH 3DETC 3PJSA 3VG0H 4D9RD 4DIXA 4OT1H 3QEUB 5LJYH 1JDCA 1NDGB 2KBGA 3BVXA 4KDTA 1D5MA 5LBSH 5CWSA 3K6FA 4LXFA 3RB5A 3HG3A 4N8CH 4LKCB 4OLUL 1RZJL 1IAIH 1V27A 4PRHD 1DCLA 4ODVL 3PP4H 3MV7A 3M6DA 2VQTA 1SDAB 5IR1B 1MCFA 4AEIL 1AXTH 1ML0A 1WZLA 4FHJA 2OFQA 4F9PC 5DD3H 4TVUA 3KLHC 1B0WA 4Y5VC 4NC0B 1HVXA 2DM4A 3TH3T 3FZUD 4XT1C 3IE4A 5FK9B 3WN5A 3VFNA 1G7PB 3IMRA 4Y5YA 4MZIA 1Y6KR 4QHLA 1A5FH 2EXYC 2YAPA 4HJ0D 2H0FA 5C0JA 4I9WE 3U1PA 2VXQL 1I8LA 4I7ZC 2HMIC 3TPUA 4Q6IB 2C3XA 3VRLF 3X14A 4JDVA 5A6MA 3ARBD 1MZYA 4ODHL 2VC2B 4YDMA 1XCTB 5IJVB 1A3LL 4YPJA 3WKMH 4BQCA 3PL6A 3R1GL 1RPQA 3OJDB 4PJFB 3LVEA 3OMIB 4G1MB 5TQ0H 1F86A 5AVSB 1ID2A 4HLZH 1QEWA 4PVBA 4YHLL 3VXRA 1ZHLA 4TNFA 3RTQA 3IPFA 4MMZB 3M7OA 3UZVA 4HCRH 3WHE0 3L4VA 1R33A 2BNQB 4QTFA 1CFQB 4HUCA 2XI9A 4MDRA 3KJ6H 1D5ZA 1DFBH 1U8JA 3ILQC 1S5HB 4HPYL 1JGDA 2FK9A 3B1TA 2AJSL 3F04A 3QPQC 3OR7A 1V7MH 4LLMA 4N4YB 2ENSA 5AW4B 4OAWA 1HCFX 1IILE 1CICB 3HFMH 3RGVC 4DP8X 3QQXA 3VNZA 1KXTA 5CJOL 1KXQE 4URTB 3P77B 5DO8A 3C09B 4XN2A 3FU3A 2CLVA 3I9PA 3GHEH 3W9EA 3UAJA 2WBKA 5I24A 2MCMA 4WY7L 1FVEA 1B9KA 1FZKA 2QQQA 4X99B 3IDYB 2JJWA 5AQ0A 1FH5L 3MRJB 4ECNA 1A7OL 3N1FC 2QDWA 4O5LH 1NGPL 3MJGX 2EYTA 5D5ME 4GQ9H 5GS0C 5DGRA 4KI5E 3ZYOA 3CC5B 1IGCH 4WI0B 3TZVD 1JUFB 5DI8A 3GEFA 2P24B 3V9EA 3KCWA 1VZGA 2COVD 4G7SB 4R96B 4XXWC 1VADA 3RY4A 4FYSA 3WTVA 2XA8L 4W6XB 3TO4A 4O00A 5D6DA 1TU2A 4TRPL 3GUTB 1NKOA 2W81C 5I17B 3KXFE 3QZWG 5GGRA 5EPMB 1E43A 5I66A 1A1NA 1ZS8A 4BFNA 3QEQE 5EEZA 3HNTH 4RISL 1TQBB 1P4LB 2WNKA 3L2NA 4OIFA 4G82A 4L3ED 1V5JA 1WP6A 1A25A 5E9DE 1CL7H 2ZE0A 1MDTA 3UYRH 4ZW6A 3BUYB 3WDJA 4PREB 2XWBB 4MJIB 2AJUL 2IGTA 3NSYA 5KVDL 4DZ8A 4ETYA 2O72A 2ZKMX 4OV5B 2FQFA 2ZD0A 4PJAE 3VYOA 1A6PA 2ZJSL 1E4KC 5DJCA 2NY2C 4ELMF 1U8KB 1U3HA 3FQ2A 2K78A 3O2WL 5A16A 5BRZE 4DO4A 1H0DA 3S37H 3NACH 1WFJA 4WW2C 5IESL 5EF0A 3BEWB 3S5ZA 4BRVA 5LDSA 3HFFA 2CKNA 4ZMYA 4MAYD 2ZKXA 5F9JA 4P5MA 2APVA 4GRWH 5FB8A 4IMKA 2BY3A 2VABA 1WIPA 4A7TA 4GW1B 5F9WC 3L3OC 4LAQH 5ES4B 1LDPH 3DGGB 1RHHB 4PU2A 3E80A 1XR8B 4IMLB 3WV0A 1W0WB 3I02B 1XGTA 1SBSH 2KDGA 4IIQC 4X4MA 3BFQG 4K9EH 1X5FA 4L4TB 1LMIA 3ZYIA 2UZXA 4JW3A 2QQNL 5T3XD 4PRID 2HX7A 1OL0A 1RUAH 1KBBA 2ED9A 3WFEL 3CZEA 2V33A 3T2LA 1NSNL 2DAVA 1FRGH 3CHPA 1LP9A 4Q2ZA 4XX1G 4LARH 3VMPA 3ZR6A 4BD4A 4KO5A 1T6BX 3V9CA 4BZ1H 3QI9C 5C0AE 1MCRA 1MPAL 4I0KA 1YDPB 1R3LB 3AM8A 3P9LA 3QIWA 4O58H 2EIJB 3QRLA 1ET5A 4MX7B 4OM1L 3U7YH 2BVPA 4XPAH 4KX8A 2XKSA 1UJTA 1EUTA 4F8LA 2WUBH 1I9RH 2D4DA 3H3BC 2ZXGA 4CAGA 4PAZA 4CKQA 1KGJA 2AQSA 1S9WB 2GBUA 4P2YA 3SBRA 1I8KA 3ETTA 2EKSB 1TETL 3VSTA 5E95B 2QSCL 5JHLH 4FHKA 5D4HA 1RZIB 2OJZH 4TUUA 2GFBA 4D8PB 4KRNA 1CD1A 2AMUA 2WVUA 3DX8A 4WO4A 3T5WA 1CFVH 4LRIC 1PAMA 3K72B 5CU5A 3FFDB 4Y1AA 1GZHA 4OV6F 1S7QB 5I9QC 1BJ1H 2W0FB 5GZNA 4IU2B 4FC3E 1QBAA 4AQOA 4FABL 2DJMA 3GM0A 4TYUA 3EZJB 4PRNB 3V0JA 4TPRH 2O93L 3B4NA 1IFHH 3VFOA 1TMCB 1KCBA 3R7RA 3VI4A 2E8ZA 2WVSA 4GBXC 4KZDH 5L88H 3LEXA 2XJLA 3EJZC 2EQDA 4ZODA 1J1PH 1RJCA 3RDTB 1E5BA 5SWZE 1AS6A 1LE9A 3TV3L 2R27A 3WY3A 4IRSC 3BHBB 4U1NB 3OWEA 4YHOL 1G4RA 2Z31A 1KMGA 1QSEB 4YE4H 1FCCA 1MCEA 2PP8A 2RFXB 2H6OA 1T80A 4PJHF 2VDRH 3W0WD 1RKRA 4OZGE 1OTTD 1I7UA 4M62H 2P5EB 5A6IA 3GBEA 2ADGB 3DX9B 4XPFL 1AGDB 2XXFA 1ROCA 3JWOH 5BJTA 3SCMB 4L9DA 3LKNA 5JDJA 5LWYH 4CN6A 4AMWA 2A4ZA 3VXSA 3W5NA 1ASOA 2A4CA 1KTCA 3BDYL 4K9JA 5I5RA 1MAMH 2VDLH 3KYOA 4PG2A 3FT3B 2JCCA 2QGCA 4WU7A 4JGNA 1PG7W 2CRZA 3BP6A 4XPHH 1PDKA 2JE8A 3F8UB 5D2LA 4ZFOL 3C5ZB 2NY6D 1HHHA 1KFAL 3K6IA 3KLAA 2P52A 4S1QH 2HVJB 3FTUA 1YRKA 3PREA 4DGUA 3UTPD 4LEBA 2VXQA 5TJWK 2Y1ZA 4WNJA 5HI4D 3ATAA 1NGZA 3ROLA 2OJ1A 2JWYA 1JK9B 3I6SA 4LSUH 5DZJA 3ZHDA 4AGPA 4DK3A 5J13C 4PJBB 5LLIC 1TYEB 3RUGF 2ZOUA 1MJJB 1OT4A 4XMZA 2ZPKL 4IKIA 1KB9J 4FP8L 3WJJA 3P4MB 3BP4B 4Y4HA 5HHNB 1HZLA 2BVUA 2QSQA 4JANA 3UO1L 3L5IA 1DBKL 5D7SH 3T4AC 5IB4B 1UWFA 3OWRA 4UTAH 4KHTH 2HT2D 3JT2A 1URLA 1J05A 5AW8B 1FZOA 2ADJA 3HUJF 2PR9A 1GGTA 1HZKA 3BSZH 3EZ8A 4PRPE 2DM2A 2VITA 3GSNB 1NC2A 3DVFA 2I27N 4WI6A 5DMKA 3IBOA 2YRBA 4HWEL 1MWOA 3DLQR 4RMBA 1A4AA 5E0FA 5F7YC 3VXRE 4Y4KC 2FHCA 5B39B 2XN9A 2FGWH 2KQMA 4AUUA 5EN3A 2IEPA 2ZUVA 3ZLQC 3QG6A 1GGIH 2YD7A 3EGDB 1Z5YD 3CXHK 1D5XA 5A2CA 4GAJL 2AI0H 3QNZA 4TKWA 4CC0A 3JYCA 4LGSB 2NXZC 4N5EC 3V4LA 4I1RA 3OAYK 3EFDH 2IANE 1T20B 3KS0J 4M8QB 4WK2B 3E9UA 1KBPA 3KEHA 1YNLL 1E0OB 3DMMD 2GUOA 4LSRL 1SUJA 3FO9B 2F19H 1CIDA 1C7TA 1HILA 4P04A 5C0IA 1UUNA 1W15A 2BSEA 4JR9L 1FO0B 2H45A 4Z95H 3T0ED 1OE1A 3H9SE 1I7TA 1WGVA 1VFMA 4MAUL 3ZGHA 1HSAB 3QNFA 4M5SA 2QVKA 1SMAA 2QSTA 5EOTA 3JSSA 3WDHA 1I85A 5INCA 1E2ZA 5CHNB 2V2XA 3SDAB 1HOCA 1LK2B 2I7SA 4Q58C 4U1KB 3VA2C 1JRHH 5SWSB 3GNMH 3KYMA 3WNKA 4LCVA 4Y0GA 2BLFA 2RH0A 4CGTA 1RCYA 3WFHA 4F2FA 3VRJA 4EF3A 1AR1C 5IVNA 3M1BA 4G7QB 4N25A 4OY9A 3OXSB 2A77H 2C4FT 3L4TA 3UG4A 4D0BA 1WFNA 1UVQA 3VXOA 2ICWA 5DRXA 1HL4A 2VCOA 4YSOA 5JNYA 4TM9A 2QKIC 4F2MB 4FNUA 3ZE0E 2GJZB 1PG7H 4FLRA 3VFWA 5IIEA 4UQ3B 3EJJX 4MD0B 3U48A 1MELA 3D08A 4XXCC 2BVOA 3MUUA 3QS2A 4LLAA 1F4XL 3HNSH 4N2CA 3OLGA 1T1XB 3LQAL 1T04B 3HW7A 4OLVL 3SDYH 1T1YA 2WXMA 3O9WA 5H37H 3G3LA 2IH3A 3Q3GA 5HGBB 2OQJB 3SKOA 2OM5A 1Q9LB 4U6YB 4HUWB 2BHFA 3EYVA 1IEAB 5DJ8B 4WUUD 1N26A 3ULUH 5D1XE 1Q0XL 5C70A 3QUGA 5C6PB 3NSJA 2VR4A 2X38A 5IVXB 2VOTA 1QSFE 3ULVD 5IQNA 4R90H 3CXDH 1EFXD 3WS3A 1M3IA 1UJ3C 5EZIL 1PKQA 4YLBA 3RTLA 3SD2A 3IJSA 4WF7A 5E08L 4EKJA 3RIAF 3QQDA 2YEZB 4X4ME 4E42A 2J2ZA 4H0GA 5ITBL 3CMOH 1UOLA 3AQZA 4FTDA 1TG8A 3MXVL 4UOZA 1YEJH 1XGYH 5AUMA 5KG9B 3E1ZA 2NTFA 4P2QD 2VLJE 1CFBA 4YK4B 4AJWA 1E9QB 4JQIH 2J6WA 1QI3A 4LSQH 5DRWA 3K8LA 2WZ5A 4BHUI 4N3TA 1EZVX 1DUYB 1SEQH 1NOFA 1ZHKA 1VDGA 4LPYA 1AC0A 3MRPB 1JDAA 1YEFL 5AKSA 1WWBX 3KLHD 1TSHA 4H0IA 3MBEC 4I0PD 4AW7A 4ONOA 2A5UA 2D8KA 3LEYH 3VFPB 4NQDB 4XNMB 3P02A 2R51A 2EXYD 1M9WA 2GTZA 3DTUB 3OKDB 1T7VA 5EMYA 3SYQA 1UKSA 2HMID 1RIHL 2V5RA 1VKXA 5E6UB 4NZTH 3U0TA 3LXCA 3N3EA 1RK0A 1EJOH 4PN6A 1ZEAL 4IOSD 4HJJH 5T3ZE 4H5SB 2A99A 2F74A 4XTRD 5A3IC 1J5CA 4UT6H 2JB6A 5JW4Q 1XZWA 1KC5L 5CXPA 4KUZL 4GT0A 1KELH 4MKMA 3F84A 5HPOA 2IQAB 1OQOA 5JQ6H 4WI2A 1AAJA 2H1PL 2P45B 4L0PB 4QHPA 5EU5A 5I30L 3FB7A 2VDML 3CDZA 4MSWB 4QRSB 4GRLA 5LNGA 3ILQD 1JZFA 2ZOKA 4AEFA 5FHAL 4X6CE 1YUHA 4GMTL 1N68A 2QVTA 3QIBA 4YBQD 5I19H 1Z9SA 3QPQD 4JFTA 1OM3L 4ZX6A 5KYXA 1HH6A 1GGBH 4PJEB 4LPWA 3RGVD 4Z8FL 3D0VA 2DDQL 1U8CA 5CN2A 2EXWC 3TYFA 3WTUA 1W80A 3QWOA 4K7PH 3TBWA 1R3HB 4WI7A 1R5IA 4ZFOA 3MRCB 1NUGA 5AFAA 4M5ZL 1PD0A 3AMKA 3GSWA 1KGYE 3U1SL 5K9QI 5KVEH 3LVTA 3TBSA 4KH2A 1IGJB 2YPVA 1I53A 5E94A 2V17L 5C0CA 5FHBH 2R23A 3DRTB 3NTCL 3RA7L 5ABAA 1K5NA 4A2EA 1ZLWK 5GS0D 3CFJA 3IXTA 2YQ3A 3KPRE 1KDJA 2DTMH 3DJZA 3VXSE 2HVKA 4LIQL 1CE6A 1DZ0A 3B2UC 5TF0A 4JRLA 4C83A 5TH2A 4ZAKC 1ZHBA 2JCCE 2O6DA 3EAKA 4HIPA 4N0YH 2C9QA 4PP2B 5E8NA 2GW5A 4NP4L 1S9YA 4Z5RB 5AVVB 2CUIA 3T8VA 3W82A 3ZPDA 1QACA 1YHPA 3BW9A 5DMJB 3TXAA 4Q9RH 1H15A 2Z8VC 3ILPA 2P5WB 2O5YL 1XVSA 3S5LA 4P23B 4APXA 5HYQA 3V0EA 4PY7A 4C47A 4NFCA 1XL4A 3ZT6A 2ZXBA 1ASQA 2NCEA 4NUJA 1Z5LA 5DUBB 1N7MH 2FLRT 1KYOJ 1AIFB 3CPLA 3P0YH 4JFSA 5I0DA 1J5IA 2PO6C 2K6YA 4OCNC 5CILH 1EAJA 3BVNA 3S3DB 3IN0A 4HIIB 4Z7QB 4UM8B 3UZEC 1O6TA 1TLMA 4GW4A 3OLIA 4P06A 3UABA 5C0DA 1BX2B 3MLYH 3JWNE 2K3TA 1E90A 2ZF9A 4KX9A 2LLGA 1P0SE 3MRHA 4KC3B 3RFZA 1MFEL 1FJ1B 3ARVA 2ZTBA 4KI1A 1LL1A 1E8WA 3NMEA 2HRGA 2XWEA 3T6XA 2NSQA 1E3ZA 3VD2A 4U6XB 2LHAA 2EDWA 3MA9L 3R19A 4MNQE 3MLTA 2Q1EA 3KWWB 4N2OA 2APBA 1OGAA 3UTSE 1NDTA 2JXMA 2X87A 4NN7C 2C1PA 5J11C 1EXHA 5CD3A 4BKLA 1ZLVH 5I16B 1IC4L 3FYIB 3UADA 2WXOA 3REWA 4DNLA 1MLBB 2IPKB 5ECJE 5DK2A 3U4EB 1SLUA 3F6JA 3RZCA 4HCIA 4LAJH 3NCJH 2XN9E 2F2HA 4NLAA 1A64A 2XQBL 1FG2A 4UT9L 4YDJB 1JI1A 3BZ4B 5DLLA 1FIGL 1QMUA 1AOZA 4ZMVA 2ZSVB 1VESA 1ICTA 3QI9D 4PRAB 2GC4C 4QXTA 4HS6A 4ZFGH 5B4MC 1J1OL 2Z65C 3RWDA 2ZXCA 2AJ3B 1YN6A 4IBSA 4DGIL 4MB3A 3CVDA 4ZD3H 2I07B 2V7NA 5TPWH 3QWNA 4DP4X 3J2PA 2E47A 3HR5B 4UIKH 1VFBA 2XKNB 4FYTA 3VJ6A 5JQIB 5KYNA 3HBPA 4MDJA 4AEEA 4JB9H 4C56E 3N2JA 1QA9B 4CJ0A 3ATBA 4TVPE 4XVJH 3KPLA 1LEGB 4POYA 2CAKA 5IWLA 1WC7B 1TJGL 5IKCA 1S7UA 4GUQA 2WIMA 3MLXH 2OMWA 3DX4A 5EUOB 4RWHA 3RVXD 3ZKXB 1F0LA 1U8QB 4MQ7B 5I1CH 2WVVA 1EBPA 3AGVA 2PYEA 5EA0L 3B56A 3OR6A 2W80C 4KFZC 4BE6A 4ZS7L 1PSKL 1XCQB 4QRUA 4GBXD 5H2BB 3FQ1A 3NZHH 4YPGB 3FB5A 2DBLL 3LN9A 4G8FB 4LPVA 3CJJA 3HC0B 3Q6GH 1XEUA 4OF0A 1ZLWH 4F57L 5GHWH 4ZS6C 2G2RB 4DGWC 4IRSD 4YXKL 1SDDA 3BUIA 4GAYB 4PS7A 5EULV 4YSPA 2CKBL 3TVMB 1D3CA 1YYLH 2AXGB 4R2GD 2HRLA 4NHUB 4U7MA 1UC6A 5DS8A 3PE9A 4H8WL 4BKTC 5C2BH 5HHOD 1NCCL 1LP9F 1VENA 1LEIA 1O7VA 2X9WA 4LEXL 3EGSA 4IKNA 3FUNA 1IKFL 2QPFA 4GFTB 4O02H 1EAPA 2GT9B 1QO3B 3T2PA 1YC8A 4KTEH 4WEBH 4JPVL 4E0RA 1IKNC 4OJAA 2H0PA 1BQLH 4LCCA 1BBDL 3UTTB 5CP7A 5EZPA 1J9CT 1IX2A 4IHOA 1MUJB 1GZQA 4N9GA 3DTXA 3EFOA 3PP3H 3S88L 4KY1H 1MVUA 2WIIB 1P1ZB 1WICA 4HIXL 3DIFB 4UV7H 3X12B 5JW3H 3SQRA 3CFKB 1BWMA 3DRQB 2DKMA 4I3SH 4DW2L 1CQYA 3GSVB 4OM0H 4TF4A 5FFOA 3T0BA 4BQ8A 3NJIA 2VDNL 1OAKL 5J0BA 1R3KB 1CXHA 3MQIA 2NZIA 3BQUB 3OKNA 4OD1H 1H3VA 1RIUL 4JFDE 3VWJA 1DN0B 2WLZA 1C5DA 3BYYA 4HT1H 4LEOA 2B20A 4HXAL 4Q74A 1OB1A 3L3IB 4Y2DB 5CLZA 1AO7D 1DL7H 3FFCE 3VI4F 1GHFL 3DO7B 3B5TA 2DTSA 3BWZA 4Y88A 2CGYA 1B0IA 5F3HA 1FIEA 4GT7A 3BH9A 3JZYA 1TNMA 1D6VH 1DQKA 1KTJA 2Q76A 1DJIA 4HXBL 5DJXA 2XPYA 4N85A 4QHMB 2E76C 3O2VL 4FLQA 3SGDI 1QW9A 1NFDB 4UT7H 4I0CC 3HRZC 3QFJE 1BHGA 4L29A 3CZFB 4FG4A 5F7EL 4YDNA 3MFGB 3C6LA 3IU4H 2ITEA 4JFFA 3FONB 4AZ8A 3U6RB 2DWDB 2DLGA 5GJTL 3ZO9A 4AIEA 5F89A 2OPCA 3L4UA 3WSQH 5C09A 1BA9A 1UASA 2XETA 2XWJB 5I8KH 5IHHA 2PCFA 4ORGB 2JKTM 2EVJA 4XPBH 4CVZA 2DMGA 4AX3A 5HGAB 1PMYA 1M56B 2PW2A 2HJFB 3ARDC 4Y4KD 4G7YH 5C6WH 3TIDB 1J0ZA 4I3RH 4F8TA 3GS4A 4OTXL 2QFPA 3AABA 3LRSA 3O8XC 2RMNA 3SDDC 1I1AA 3DX0A 1AHWC 5EWIH 2QADC 1J8KA 3MV8E 3CU7A 1NANI 1V54B 3ALWA 1JHKH 3AREA 3E38A 5D2LF 1USQA 4OCYH 1RVFL 1T21B 4R0LA 3TT3H 1BXUA 1FNEA 1GOFA 3D39B 3TC9A 5DEGB 3MUGA 5FGSA 4L3CB 1CN4A 4RAVA 5D70H 3TBTB 1G1KA 2I9LA 1GVIA 2R4RL 3MZTA 1B9ZA 4I89A 1P5UB 3CLFL 3JTSA 2XTJB 3O41B 3U36B 4QF1A 3AQDA 2WXGA 1GH7A 4JFQA 4ZTPH 1BVNP 4JRWA 4K71B 1IEBB 4TTGA 2H3KA 3LHPL 4HUKB 2FBOJ 3QUZA 5T1KD 5C9JB 3Q8CA 4JZJA 1NFAA 3R06A 4HC1L 3GB7B 2AEPL 3KVDD 2W9EH 3PQYE 4BXSV 2YOCA 4FQCH 4HMEA 4PTUB 2IFGA 4LBAA 2GTWB 4NAJA 4ONGL 2Q3AA 5C0EA 2OXHA 3IMBA 5BMFL 3NSXA 1AR1D 2VL5A 4NKOA 4AYFB 5J8OA 4QTHB 3NJNA 4HEPG 4QRRA 3FQRB 2ZUSA 1KDIA 3IDIB 4PLJC 5J6SA 4WFFD 2MPAL 5JOPD 1W91A 4HK0A 5F7MC 2VXTL 4JGUA 1EDHA 1W0VB 3AAZB 3FQUA 3VA6A 4APQA 2Y2WA 1CK0H 3LMJL 1VIWA 3CFDB 3CQPA 1H3GA 2IALA 2UV3A 3GSQB 3UACA 2G60L 2O5ZH 1RZKL 2WGNB 1IC1A 3UXFA 1Z0NA 4KVPA 1KN2L 3PDDA 5F9DC 4X6FB 2X6UA 4MAZA 4GSXA 3WIHL 4E9QA 1GAFH 3QUMH 1OSZA 1YEEH 3SDCD 1P4IL 4GLRI 4KXBA 3LPOA 4UT9A 1CXEA 4I3GA 4NUGH 3OBAA 3T2NL 4PYHA 4NIKB 1XMWA 3T6WA 5E56A 4BZYA 3UZQB 1EH9A 1S8DA 3OLDA 1AGEA 1UQSA 2ESVD 4EVNA 2UZYA 1UZ6E 4QYOA 3LQZA 5L4MA 4AVHA 4HUXA 4BWWA 2FR4B 1CUOA 2EDNA 2VLKA 4KXCA 5GGSB 1HYSC 1UFGA 2IDQA 3BIBX 3GUFA 2CK0L 1XHHA 3AB0B 3QDJD 4CC1A 3S8GB 4B9IA 4NWTL 3ZGIA 3VVWA 2EIKB 2WO3B 4ELKA 3ENEA 1KJ2A 2VDQH 5I71C 4K3GA 4NZJA 4TL5A 4PEEA 2DN7A 4UDTB 2IAMC 2L0DA 4AYBA 3LKSA 1QWUA 4JG5A 3MBED 4LF3B 2FJFA 3BPCB 4YHNA 4RESB 1KCWA 3K2UL 4WWOA 4JFZL 3EJUA 3VE0A 3WU1A 4R6UA 1KEMH 5AVYB 4DKTA 1PF3A 4YHYB 3T3MF 2DYPA 1ETB1 1WCQA 3BJ91 3U6XS 1KULA 4B27A 2R0LH 3CSPA 3MLZH 2CKBA 4AMXA 1OAXH 1J9QA 4Z7UE 5A3ID 3MRMB 4DVRL 3M45A 4PHXA 4GINA 2B4CC 4R4BA 4MCYA 5D7HA 4HJIA 2DJUA 4GUCA 4GXFA 2X9YA 3FCGA 3QCTH 4IBYA 4XBPB 3T9WA 2X2JA 3MUJA 1JPSL 2C7FA 2GKIA 3QXDB 4NO0A 5ALBH 5E1HB 1YY9D 3C08L 3FU7A 3CLEL 2ZX8A 1