1VGEH

Tr1.9 fab fragment of a human igg1 kappa autoantibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
225
structure length
225
Chain Sequence
QVKLLEQSGAEVKKPGASVKVSCKASGYSFTSYGLHWVRQAPGQRLEWMGWISAGTGNTKYSQKFRGRVTFTRDTSATTAYMGLSSLRPEDTAVYYCARDPYGGGKSEFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TR1.9 FAB
publication title Structural studies of human autoantibodies. Crystal structure of a thyroid peroxidase autoantibody Fab.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immunoglobulin
total genus 43
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 1996-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1vgeH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1vgeH01
4R2GD 4H5SA 1KJ3L 2X4SB 4PJCB 5C7XL 3B9VA 4FRWA 2LTQC 4KY1L 4Y4HD 4JLRA 2XOTA 4A6YH 5D2NE 2RQ8A 3BQUC 1FSKC 2HA1A 2APBA 1M1SA 1U92A 3G08A 2CLVB 4I5BB 1A2YA 2DD8H 5HGGS 2BC4B 3LKNA 3WNPA 2VDLH 2WBJD 3ZL4L 4X6CB 5ECJE 3TIDB 1CDHA 1GSMA 3IXAA 5F89A 3OF6A 4NSKA 4WI3A 2Y4SA 2YKLH 4OFKA 3T4AB 4X7CC 3U9UA 5BV7L 3G6JA 1UCBH 1ADQH 1PLGH 3BKYH 1N8ZB 1ITBB 3JTTB 3HB3C 4GMSH 4KQ3H 5F7MC 2IAMA 5EBLA 1T7XA 2LAAA 4RNRA 3D2UB 8CGTA 3IETA 1ZA6B 4IRZL 4QRSA 2ZOLA 4OZGB 1ZEAL 3FO9B 4C54A 3EYSL 4GW1B 3CSBA 3G5YB 5BVJB 5D72H 5DLMH 2EDHA 3BGFB 4YXHL 2AI0H 1JK8B 3UPCA 5D7IA 4D9LH 1INDH 3HLAA 4G9DA 1JNLH 2XTJB 4PP1D 5DURB 4LAJH 1MRFH 3MNWB 4HF5L 4XTRD 3TPUB 1G7QB 3BP7B 1OM3H 1DEEA 4BA8A 4Z7UB 3ULVD 4FMFA 4RAVB 3QFJA 1UXSB 1OCWH 1TJIH 4HIEA 5A43C 4JG1H 3PWLA 4FFVD 4YXLL 1JNJA 1FVDB 4XPHL 3HMWL 3OAUL 5J0BA 1DVFC 3QO0B 3N1GC 3H6JA 5DS8A 5A1AA 4Z7WA 1FPTL 2AJXH 2Y9RT 2KUTA 1K5NA 4XVUD 1YYLL 2Y7QB 3CMGA 5KSUA 4HX1B 1G6RA 4NN6B 2VZSA 4JGMA 1D6EA 4DCQB 5CZVL 3MV7E 3V5HA 1MAJA 2BNRD 4O5LL 2W0LA 4LCWE 2VDOL 2Z8RA 5SWSD 4R8WL 5D1ZD 1T83C 4PFEA 1J8HB 4R6UA 3TCLB 3QEHA 2IAND 4UU9A 3V52H 3QYCA 1U8KB 4NZUL 5TDPB 4JHBA 4LVHC 4LK4A 1QEWB 1OF2A 1XGRA 4TYUA 3BEWA 5DQ9B 1YECH 2ZUTA 4PJ8A 1A14L 4AY0A 3RUGB 2AV7A 3MCLL 2F53A 2PO6C 1I1RA 4FQJL 4NQCA 3QZWG 5FIEA 4OUOA 1V3MA 1FN4A 1LP9B 1N0LA 1MI5E 3N1MC 3TV3L 1II4E 1X5FA 4F7TA 4PRIE 3BSZL 1IKNA 1NSNH 3VXUA 4P3CH 3QCVL 4R2GC 5TDOA 3O3DB 4QY8A 3DXAB 4HIHB 1IGML 3U82B 4JHAH 4LP4A 1IGIH 5I8EA 2CUHA 5KBNC 1BM3L 1BVKA 1XGTA 4A6YB 3UP1A 1KF9B 2APFA 3UX9B 4FQ2H 1A3LL 2Z35A 1T3FB 1FYTE 2L0DA 2H3NA 3O3UN 1GJIA 2AJSL 4KZDL 1FORH 1KJMA 2CDFA 1F45A 1A7QH 1JCKA 1IGCH 3EZJB 4N68A 2FHFA 1ZV5A 1N2RA 1ZKAA 4S2SA 5L2KA 5DQJB 1F4YL 2OTUB 1JVKA 3TO4B 4HFUH 5CEZD 4U33A 5D1XB 4CVUA 4PJ5A 1AC6A 2XV6B 3DGGA 4M48L 4XRCB 1I85A 5T3ZH 2X4QB 3IFOA 4YAQB 2VLJD 5T3ZD 1KV3A 1T1WB 2ORBH 2P46B 2EYRA 1WSST 1L9MA 1JUFA 5ICXA 2JJSC 2YZ8A 1X6NA 2CRYA 3N9GL 1U8QB 3PXHA 4JJ5B 3DVGA 5IFJB 1BZQK 5EO0B 3FO0H 3NABL 1NCCL 4YDLB 5D71L 2HT2D 1HYSD 3FT2B 3ULVC 1DLHB 4LU5L 1EK3A 3ES6A 1XR8B 5C8JA 1MCDA 4Q7DA 5IJVA 3L1OH 1MJ7H 3WUWA 1SVCP 3FTGA 4FS0A 1NBVH 1FO0H 3HHRB 4BSVA 3UPRA 3JV6B 3AU1B 2VDNH 2FJHA 1LEIB 4X9IA 1NGYA 4LSRL 2HH0L 4WY7L 2PTUA 4EN3D 1CFQA 4YFDB 4YIQA 1KCRH 1XIWC 4XVUC 1RHHB 1IZJA 2XTJE 4U6YB 1F11A 4CU7A 3SGDI 2V2WA 2WINB 5C0AB 1HQRB 2DQHH 4S1RL 1QSEA 4OGXH 4Z7UE 4LMQI 1ZK9A 3QQ3B 3MGTB 4Y4FC 2V5TA 3UTTD 3ULUF 5D1ZC 5F1OB 1CXFA 1ES0B 2GJ6D 1FBIL 4L9LA 1RUAL 5B39G 1KN2H 1I9RL 1D6VH 2D7TL 1TLKA 2H32B 3LZFL 4OB5L 1BJ1J 5IB4A 4A2LA 5CHNA 2NQCA 4Q74A 4NO2A 5JW3H 3X13B 4H1LG 1OTUD 2CK0H 1A4KB 2P8PA 4HKBA 4N8CH 4BZ2H 4YDIL 1P4LA 4UV4H 2HVJA 2VQTA 2XA8H 1ZLWH 2AJUH 5CUSL 4JJHA 1AR1C 5L8JB 4Q2ZB 1J8HE 1FRGL 4CMMB 3FQXB 2W92A 1RIHH 4GG8A 3S37H 3BJLA 3H0TB 4FG6D 3LKOB 2ZCHH 5HHQA 2GI7A 1R3LA 1HHKA 1IAKB 3VA2C 3F12A 1NMAH 5LGJA 1OAKH 2DM2A 1EJ6A 2DM4A 5HHNB 3EKCA 3HI6L 3HPJB 5CJOL 1HINH 4PY8J 3BMWA 4YHMH 5DMIH 3SGJC 5T1LB 4JQIH 4X4MA 3FOLA 4BZ1L 3N1QC 1Q9KB 3FB5B 4Q9BA 3P73A 4IM8A 2LVCA 4KI5E 1JZ8A 4V2BA 3GSOB 4Z8FH 4MAUH 3F8UB 4G9FD 4TNWK 4Y2DD 4GW5B 2NZIA 4B53A 5TF1H 1Q9WA 1VACA 1W72A 3NPSC 1VESA 4JR9L 4OSUH 1AE6L 2Q76A 3DXAE 2X41A 5C0EA 5BW7A 1P84J 3QRGL 1WC7A 4BSWB 1N6QH 2VAJA 5EU5A 1W0WB 4KGLA 1VGEL 3TVMA 3DECA 2VDQL 2HVKA 5KN5B 4IIQB 1A7PH 3KHQA 4GAGL 4NNYB 3LEYL 1K3ZA 4URTB 1A22B 3WDHA 4DGVH 4FQLH 4PJAA 1HXMB 2H1PL 1U95B 4XNXL 5M95B 1R3KB 3KPLB 1Z9OA 4TVPL 2AP2A 2W1NA 2FEEI 3IVKB 4NM8H 5KG9B 1LE9A 1CE6B 4UV7H 1SBSL 1MFCL 1T7YA 1YJDC 4GRMA 4LVNB 2HT2C 4ZYKA 2XIDA 3N1FC 5IMLA 1HYSC 2ICWA 1EXUB 4UIMA 5DEFB 5F7NC 1ORSB 5F3BB 1ZHNB 3PWJA 4RGNB 5LAXB 3QULA 2NLJB 3QXAB 3BP4B 5FV2A 4LIQH 1YNLL 3C6LA 4PJ7F 4OIAA 1FFPA 4JRYA 4YNYA 4U1GB 2AXJA 4RISH 3DO3A 3TZVD 1CG9B 5F1SA 1MHHA 3SJVB 5C0GB 1XGUB 1IE5A 3QG7L 3OGCA 5F1NA 4BFIB 2Y06H 5DJAA 3KNBA 1YEEH 3PL6B 1F90H 1T1ZB 4YHOH 1FFOB 1MPAL 4IRSB 2XTLA 3CUPA 4R0LB 2P5WD 1TZGH 4L4TA 4DN3H 4KUZL 4MNGB 3P9LA 1EFXD 3JWOL 5DK0B 1MJUH 2MPAH 4LCIH 4ZFFA 3V5KB 1WAAE 3QCUH 3PQYA 3BE1L 1BLNA 1OTUC 4MLIA 5ICYA 1NAML 1S5IH 4KDTC 1KBGH 1UACL 4L8SB 2VE6B 1CK0H 1T5WB 5C0CD 5LQBL 3BW9B 1XAUA 1HILA 1NFIB 5K59F 4TRPH 1S78D 1AXSB 3EOYG 4KRNA 3WUZA 1T0MB 3BPNC 5D7SH 2BY0A 5FYLE 5TPWL 1ZHBA 1YUHB 1LWRA 5J1AA 1I7ZB 4TUOB 3JV4B 1GGIH 5HSFA 4Q9RH 3OZ9H 2ZZUT 4X7TA 2ADJA 3VXTB 4MNQA 1EMTL 1AXTL 2NXYB 4QHNB 3RWHB 3FQTB 3B6SA 1MCNA 3VWKB 4Q9QH 2X4NA 1YEHL 5JMOC 2WP3T 4MXWL 4HKZB 3TBVB 4XCYA 4NGHL 3TH2T 3HE7A 1JE6A 4Y1AA 2NX5B 1P7HL 1MRCH 4L8DB 4GMTH 3VDCA 2NY1B 4NNPL 5DJ0A 5ISZD 4JKMA 4DGYH 4OFYD 5HI5D 4ELMB 4TSBL 2WUBL 1EHLH 3O2VH 1CZ8L 4K8RD 4Y2DC 4D0CA 5I8OL 1T21B 5EU3A 4PJHF 1RJYA 3RY5A 3QDMA 4W4OC 4F9LC 4F7CA 3BAEH 4NJ9L 4QXUL 2RBLA 4QXGH 1QBBA 4Z95L 3FOMB 3ULVF 4G8GD 1GZPB 5L6YH 1CFNA 2F54B 4MWFA 1T1XB 4NCC1 2P48B 4RDQF 5T3XL 4X9FA 1S8DA 4TQEH 4NIKB 3RIFF 3T1FB 4MJ5B 4X8XA 3CX5J 3BO8A 4OZ4B 2E5EA 2A1WH 4XP4L 4PBWD 3K8MA 3MLYL 1OTSC 3ROOA 1B2WH 5E7FA 5T5FH 4KV5E 3MRPA 4HUUB 3S88H 5HYSA 2LVEA 5EC2B 1SY6A 5DJ8B 5C2BH 2CKNA 4K7PX 4Z7VA 2R1XB 1X5JA 2E6PA 3X17A 5DA4A 4WENB 3BUYA 1JWSA 1CGSH 4ETQB 1A1OA 2BFVL 5HDOA 1Q9OA 3DWTA 1G7PA 5IESH 4HGMA 3HG1B 2WANA 3L9RB 5E2WL 1MHPH 4P3DA 1EO8L 5ITFA 1J0IA 5GRZA 3C08H 3C60A 4MA7L 4ZO8A 3AVEA 3DMMB 2X4TB 3TZVC 3QEQD 3MV9E 1K8IA 3MLZH 4QRTA 3AAZA 4GRWH 4WUUD 3HI5L 4Y5YB 1JN6B 3O3EA 1ZLSL 2F5BL 2BDNH 4EQ2A 4KZEH 1A7BA 4C57C 3GSNA 3K8KA 1IEHA 5B3JF 4PGDB 4KWUA 1RZ8B 2A6KB 4AIZA 4ODXB 1T7VA 1IVLA 4FFYH 4GBXD 4JEGB 5KVFL 3OR7A 2MFNA 3BDYL 3MRBA 2I26N 1I1AD 2QADD 3QI9A 1RURH 4PJEF 3SJVE 1HHHB 4V1DB 3DBXB 3GMOB 2H9GA 5DR5L 5EZJB 3GJFB 3ABZA 5IW1B 5DUML 4I77H 2CDGB 2DL9A 3WN5B 2NTFB 3U4AA 2GY7B 2VXUH 4MNGE 4NYLA 5IB5A 4PG9A 3PHOB 2X9YA 3CXHK 3VW3H 3ARZA 3C2AH 3QEUA 3WS6A 1S7TA 3OJMB 1JNNH 1SMAA 5DQDH 1T5XA 3DYOA 3RWEB 1E6JH 4LHUG 2X89A 5DUBA 1B90A 1MOEA 3AMLA 5IWLC 2Q1EA 4JO3L 1IAOB 5B38B 1PFCA 3NFPB 3T65A 1U91B 1TJGL 1UM6L 4N8VG 1L7TL 1R3HB 5AG9A 4HPOH 4QEGA 3UJJH 1NCBL 5AYQA 1GCFA 2VZUA 2Q87A 4JFPA 1A6TA 4KUCD 3RVVD 5EIIB 4YO0A 1EJOH 3RWIB 5HI5C 4BFEA 1OW0A 4MDIB 5C3LD 1OQOA 4K8RC 3H9YA 2EE9A 1S9WB 2OXHA 1M7DB 4K94H 1AY1L 2AXFA 3VFPA 2VXTL 1FVEA 3OKMB 3QXWA 4OLUH 1NC4A 2I5YL 1BX2B 3G6DL 3LV3A 3OKDA 3DSFL 5AZ2H 3TJHC 3U4BL 1YEIL 3B2UD 2NX5E 5LCVH 12E8H 2CDEB 3O6ML 4FFWD 5KTEH 3AFLA 3I2CH 4MJ4A 3CPLA 4OLWH 4P4KB 4ELME 4OJFL 1I8LC 2HJLA 3T0EC 3EHBD 5HYJE 4JFOA 1P53A 5DJ6B 3ZKQD 1T80A 1BIHA 1D9KC 2CUMA 1EEYA 1TQBC 1UXWB 4DVRL 1FGVL 4MA3A 3GNMH 1EBAA 2F54E 2A83B 4JQXA 1CCZA 1CICB 2C4XA 3ZTJG 2H6PB 4CW1A 5I1HL 3EW3B 1CT8A 4JM2D 5FDWA 2V6HA 4QF1A 1RV6X 1UA6H 3V0VA 3MRQA 1TTUA 4PRNA 1OB1A 1FV1B 3DUUA 3GZKA 4J7RA 2Z91B 3SY0A 4J1UB 2P44B 4CAGA 1E6OL 5F6HJ 5I66A 3O4OB 4KDVA 5IV2A 4KMQA 4JFEA 2BVYA 5J1TC 5HHXL 3HUJF 1Q94B 3RWGB 2UYLA 1RUMH 5D1QA 3RX7A 4KRPD 4BK5A 4F58L 2YD3A 2EYTA 1G9NH 2CMRH 4HV8B 5F9DC 4KJYA 3UBXB 4HXAL 3C5SA 1MCKA 4BH7A 1HI6A 2FWOB 3JWDH 3PUCA 4GBXC 4ZO9A 1FCGA 4YE4L 5IGXH 1YPZA 2DQIH 4PGJA 3ARBB 4LIQE 3HG1E 2XNAA 3WFHA 4RMTA 2OZ4H 2JB5L 4X4XA 3O9WA 1I1AC 1KJ3H 2QADC 1Z9SA 3FONA 5C7XH 4GRLB 1V7NL 5BZDA 1OL0A 3LS5H 3UZVB 1DUYA 3OG4B 4QHMA 1K6QL 5FGSA 1FFQA 3LSOB 3VFWB 1XEDA 2A6JB 1Z5LA 4HS3B 4NPYA 3ME0A 2N56A 4LF3B 4ODHH 4JY5H 1PD6A 1SQ2N 2PCPB 1F6AB 4WDIB 3FFCD 5BV7H 3FL7A 2E9BA 4XVTL 3VFSA 1I1YA 4PJXB 4HH9A 3V0AC 1AGCA 3HFML 4D8PB 4OI7A 4HUVB 3ZDZE 1S9XA 1A6PA 2XWTA 3VRJB 2WUCL 1ZEAH 4KJWC 3PGDA 3ARFB 9CGTA 2ZUUA 2X1PA 3RVVC 2PYFB 5D7JA 4YXHH 2HG5B 4XAWL 1E27B 1JFQH 1TZIA 5GJSL 4U7KA 3MCKA 4HF5H 2JELL 1G7HB 1CDUA 3NIGF 2HFFB 3MV7D 2JCCA 4QOKE 4X0KA 1TVHB 4M6MH 3LN5A 3QZWB 1KLFA 25C8L 3B2UC 1BD2A 4FFWC 3HMWH 4HT1H 5GGRB 2ZNXA 5F7DB 3BGAA 1NUGA 4M1GH 4YGVA 1FPTH 4JKLA 1UH3A 1YYLH 2DLHA 5FKPB 5EIQA 1EFQA 4XZUB 4QGTA 1F3JB 3DX9A 1VEOA 3AREA 3PV6A 3HAEA 4KMLB 4PJ9B 2Q6WB 5CZVH 4UTBH 3HR5B 4O5LH 2YUZA 1H3UA 2DQCL 2GW5A 4TUJA 2VDOH 1AP2B 5SWZE 3WJLC 4JQVA 3BGMA 4J3OC 3RWFB 2HYMA 5I30L 4E41B 5CJXA 1PYWB 1I1CA 4NRXA 2FSEB 3F7VA 4JM2C 3MRCA 4QHUA 1LQSR 3TIEB 1WCBB 4X5WA 4OCXL 3QBTB 1AI1H 1LE5B 1I8KA 4YHYB 3U9PL 1FHGA 4BZYA 3QXVA 2YK1L 2G5RA 4PRID 3FB6B 5E00A 3D5OF 3T2QA 5D2LE 4XPTL 2VO5A 4JFDD 1VEPA 3E1F1 5IHZB 2VLLA 4FQJH 4OKVB 4ZUUB 5KVDH 2J5LC 4M4PA 1G9MC 4M8QB 3C5ZD 4HKXA 4FQXD 4KRPC 4U4BA 1JGLL 1KCSH 4JFQB 3IDXL 1IL1A 5C3TA 1F2QA 4HBCL 5CSGA 4IS6A 2MSPA 3O2WH 5C0JB 4UUJB 1PGRB 3VD4A 3V7MA 2A73B 5JUEL 3BSZH 3U2SB 1AC0A 3D9AL 4D9RD 2YEZB 3U7WH 1GIGH 5JHDB 1K4CA 5GXBB 5E4EC 4U1IA 4PTTA 3VXSB 1LEGA 2UZIH 1C5CL 4YGAB 1J1PL 5H37G 6FABH 4GRWE 1R5IB 3EGSA 4Q6IC 5L8KB 1U42A 5BJTA 4JGUA 1RULL 1K2DB 5M7QA 3O4LB 2CLZB 1MUJB 3QEGH 4KMTL 3MFGB 4JDZB 4WW2C 3CDGA 3VFMA 1KENL 1L0YA 2PXYD 3T3ME 3BPLC 1AHWA 5TF0A 1A6UL 2MTPA 3QWRA 1A6ZA 1BZ9B 3VGGA 2VLKB 4ZS7L 4X98B 2IH3A 4J3VA 3GM8A 3V6OE 2NW2A 3TBSB 2FX8L 2IGFL 4LASL 3D2UD 5FEBA 2CJUH 5IEHA 4M48H 5B39B 1RUKL 1MCOL 1ZOXA 3VXMB 3DX7B 1B0WA 4L8CA 1YN6B 1CE1H 1HKLL 5EOTA 4UNTA 43C9A 1HK6A 1TTFA 1U8OA 5DRZB 1WZ1L 2R0KL 5FF6B 3HC4L 1KLUA 4PJXE 1OSPL 1CDGA 1NCCH 1FL5A 3H42H 3NABH 3S36X 3T4YB 5C1MB 1A1NB 2Y36L 3QWQB 3E2HB 4LSTH 1U8MB 1C12B 4G6MH 2D7OA 4LEOA 3WXVL 3I9GL 4EIGB 4H25B 3VRLE 3NN8B 3EDEA 3GHEH 5EU6A 3G04B 1CFSA 4FXLA 3GMMA 4DKFL 3I02B 3VE0B 4NQXB 1E0OB 1U8NA 1SEBB 2VL4A 4PJDF 5KSAA 1IT9L 3MA7A 2JJTC 3NTCL 1T2QL 3OKYA 3FFDB 2X05A 3I3BA 1G6VK 4I0CC 5I6XB 4BH8A 3F58L 4Z7QF 1MH5B 4U7SA 4MJID 1JRHL 3RDTA 3U36A 1WFUA 2IPUG 1CGUA 1NLDL 3ILPB 3DVNB 2EKJA 1RUAH 1RZKH 1J10A 1VADB 4GAJH 4JAMA 1MIMH 1OAQL 2PR4H 1I9RH 3LZFH 2D7TH 4K7PL 4OB5H 2XA3A 5CGYD 3BZEA 3QJHB 3QB7C 3VXOB 4DGIH 3G5XB 3E0GA 5HHMB 4GW4B 1ONQA 3KWWA 5IJKC 3L5IA 1I9JL 4XHJD 2VZVA 1T4KA 4XNUL 5CBAA 1NCWL 5L0QC 4OT1L 3STLA 4LCCA 1NGQL 1G7LA 1UZ6F 3IGAB 4NRYA 3GK8H 5DJYB 4NQDD 4EUPG 5CUSH 5C07B 2GCYB 4RFNB 5IK3B 2VAAA 4OD3L 4AENB 3C5ZC 4LLWA 4R7NB 1I8MB 5D7KE 4FQXC 3U83A 2X4PB 2Z31B 3IKCA 4CL7A 3FKUS 3LKPA 1U3HD 4S1SH 1R24A 2NZ9C 4ZFOB 1P84K 5DEZA 2IG2H 3EOAA 4ZAKB 3PF2A 3QCTH 1KB5B 5I1GL 3EYUH 4XP9L 3HI6H 3VXRA 3E6HB 4LCUA 1EV2E 5B8CB 2VDPL 5KS9B 2KPNA 4BZ1H 5FA3B 4PJGA 4ZUTA 5D93B 4LARH 1QR4A 4N9GB 5KSVB 5JNYB 4PV9A 2BVPB 4X6EB 4HUXA 1FFNB 2GJJA 8FABB 2GUOA 4HC1H 4JN2B 3IDGB 1FIGH 4ZG1A 3Q3GB 3VXNA 1KCVL 5DSCA 3BPCA 3HR6A 2D7MA 5IB3B 3EYVB 4L9DA 2Z8VC 4KKCC 3O8XA 1VGEH 5GGSB 3TO4D 3GSNL 1L9NA 3NCJL 4M00A 2VTFA 1A9BB 4GAGH 3I75A 3QIUB 5FFLA 4WCYL 5CEXB 5CMAA 4OZFH 3MRLB 5EUKA 4RIRA 1CBVL 4K9EL 3R1GL 4PRAB 1YEDB 3NFSH 4C56A 4OD2B 1UJ3B 1YNTB 1PKOA 3BGFC 2VR4A 4TVPH 1JBJA 1DQQB 2DWEB 3MNVB 3PNWB 4AIXA 3SKMB 5IVNA 1P5UA 1SBSH 3MLSL 4NKMB 3RWDA 3I6LD 3V7AE 2OL3A 1WJ3A 2AJZA 1AD0B 1CTNA 1IEAA 1NEZA 3K0WA 3QIBB 3KPOA 2OK0H 3CH8A 5FYKU 5JW4Q 3RGVD 4NZJA 3W82A 3MA9H 3VXME 1NANI 3BRFA 1U6AH 4XNMB 1KTDB 4JM2F 4DFIA 5I1LA 2AJ3B 3SGKA 5I8CB 4G43A 3O2DL 1UB6B 4LEXL 1A6WL 2QTEA 4ZPVB 1HCVA 4APQA 5GS1A 1OTTC 4NN6C 5C0AD 1HHJB 1M05A 3QG7H 4FMKA 4WO4D 3WV0A 3VXPB 3E8UH 2XKSA 2X7LA 1T04A 3X14A 1XFPA 5ILTH 4F57L 3ZT5A 2BNQA 1MPAH 2E6QA 3WXWL 2AJVL 2XKNB 3QISA 3KG5A 2EH8H 3MC0A 3KPSB 2NY0B 3FZUD 5DVKA 4LQFL 3LN9A 5CEYB 3JWOH 3ZKXB 3RL2A 3B9KA 5CGYC 4UT9L 3HZVB 1DE4B 4RDQG 1OWWA 5I73B 3W0WD 1EBPA 1PAMA 3GRWA 1F4WL 1Y0LA 3ARGB 3BE1H 3V5DB 3QFDA 1YQVL 4XHJC 3L3KA 4FZEH 1AD9A 5MHSE 1NAMH 4RFEA 5HYQA 1ORQB 2G9HB 4K3JH 4OAWB 3QUKA 3MGAA 2QKIA 4BFBD 2J4WH 1F4AA 3SE3A 5LQBH 1RJCA 3IFNL 4PJBB 4ZXBA 4R96A 5TPWH 3F5WB 4WU7A 4R4BB 5HPMB 1JV5A 1JGUL 1XR9B 3P40A 2D0GA 2R69H 2YPLA 4BM7A 5HHME 2Q3ZA 3IAGC 5T1MA 1EMTH 1A3QA 1AXTH 3D3VA 4NN5C 3MV8A 3RFZC 1Q0XL 1YEHH 3VMOA 1QVOB 1C5DB 3VDBA 2CRIA 2FHCA 3CX5K 3MOBL 5C07E 4NGHH 5F9OL 1QLRB 4FNLL 2X9WA 5BS0D 5D9SA 5I75B 2IPTH 2IJ0C 4NNPH 4BSJA 4O4YL 1KIQA 2K7PA 1DBML 4TSBH 4NC1E 4DQOH 2R8SL 4QWWD 3KDMB 3VGEA 4GKZA 3WIFB 4PRHB 3UTQB 1EEUA 1KPVB 4HJGA 4MCZA 4X7FC 4NFDA 4MMXC 2X10A 4QCIA 4UOJA 5F6IB 4P2YA 4UQ3B 4Y16A 3BP5A 4NJ9H 5FYKL 3HRZA 4HZLB 3T0AA 4Z95H 5KS9E 3BEVA 5IHUL 5T3XH 3TO4C 4I13B 4AT6B 4QT5B 5T3XD 2X6MA 1R6VA 5D1XC 5DUPL 4I9WE 4I1NB 3GI8L 4L3ED 4BQCA 3VJ6B 1N5AB 5DJ2B 3SPVB 1FGNH 1QRNB 4FTVA 1NGWB 1WCQA 3JZ7A 4QYOB 4WFHE 4D3CL 1P7QA 3S96B 5C09B 5K9KB 3BJ91 5HGBB 3UC0L 3B43A 3BXNA 1QSFD 1TXKA 3W9EB 1ZT4B 4H20H 3QAZB 1DSFH 2VZTA 1VENA 3PWUA 2EDRA 1NDGA 4R26L 3RGVC 3H9HB 1MREH 4HH8A 4F8QA 4RGND 4LLQB 1QRKA 4LL9A 3X3FL 2FO4A 5HHOB 2PN5A 2GTWB 1X5AA 1OQXA 3HE6B 1MWAB 2R56L 5E2WH 1SJHB 4U1LA 4NNXA 1Q38A 3IDIB 5FA4B 1RJLA 3J8F7 2Y5EA 2UWEA 3SCMD 1GC1L 1HEZB 2EE6A 1KCKA 4N8VB 1ZLSH 4IRJB 4JPIB 4RMRA 3EFFA 4JFFD 3PL6D 5C0BE 1P1ZB 3MUJA 5CJQL 3T0BA 2EZ0D 1LK2A 3CFIC 5T33H 3QJFB 4CVXA 4L4VD 1HIML 4OLVL 4PJFF 1IAIM 4O02L 3JV0A 1X5YA 3L3DB 1FE8L 3T8XA 4FQIL 5DD3L 4TULL 3U30B 3D69A 4PJIB 3ZKMD 3ARWA 1DVFA 5K33A 2DTML 2V9TA 4I3SL 1KELL 4YK4B 4LCYB 4RZCB 2RAMA 5HGAB 3BKJL 4JY4A 3GIVB 1U8IB 2ZJSH 5DUMH 3N0PB 1D5MA 2JJVA 3KPSE 4U3HA 2R0LL 3VI4E 3U0PA 1IAMA 2RFXA 3MMEA 5ALBH 2CD0A 1FL3B 1FIEA 4ZODA 1A3RL 4F33B 2GITA 5GGTA 4G6AD 4KK9C 1G6RH 3VD3A 1T83A 1SYVA 1U36A 3QSKB 2UUDH 1KPRB 4XC3L 4JO3H 3VWKD 5EPMA 3QXDA 1EEZB 2F19L 1UM6H 4X9BA 1L7TH 4WUKL 3IKKA 1INQA 4ZMAT 1WV7T 3OX8A 1NCBH 4N90E 4PJBE 5JR1L 4U1HA 4X80L 3UTSB 3NH7L 2PO6A 1X5GA 2NY1D 4DKDC 3IXTB 2YD2A 3CMOL 5J12B 2OQJA 1HXYB 1ODAA 4RMUA 3K74B 1ZT1A 1T6VN 3FAXA 5E2UL 2J88L 5TQ2L 4P9HL 1NFDA 2PW2A 4OF6A 2VXTH 4NUGH 2I5YH 1B6UA 3G6DH 1U3YA 2OCFD 3B83A 3DSFH 1I9EA 3U4BH 1YEIH 4WHYG 3MUGA 4MAYB 4JDTL 4M6NL 2CR6A 3W2DL 4IIQC 2P8LB 1FNGA 3CFJB 2C3WA 4OJFH 1AR2A 4R4FL 1YEJL 4Y4HA 1TIUA 1KGCE 2FR4B 5F8RC 2DQDL 3L95A 5EBGA 4B5EA 4OD1L 1BQHB 4U6HA 3MQIA 1EO7A 4JANA 3IB4A 3KXFB 5ESQA 2D7PA 3CC5A 5IKCA 2HKHL 2WV3A 4DN4L 5FB8A 2WBJA 3MOAH 3KPNB 1TMCB 3DI2B 4ZD3L 4N1CA 4JLRB 1ZVYA 4H8WC 4DVRH 1FGVH 4XAKD 3RI5F 1U92B 3ECBB 4LVNC 4KVNH 5HTSA 5JZ7C 5I1HH 3EYOA 2J8HA 2QQLH 1OP3H 3AM8C 5GS0L 4X9HA 2AQ2A 4RGNC 2C1PA 5J56B 3IXAB 5F89B 1JPSL 4XMLH 5GRUL 2EECA 1MWAL 3LH2L 2B8OT 1FC1A 3HNVL 2A9NL 1E4XI 5JA8B 5C09E 4U1GC 1SVZA 1ZLWK 1QFHA 3SCMC 2IAMB 5HHXH 4UT6H 4PB0L 4RNRB 2W59A 3IETB 4QRSB 4O2EA 2XY2A 5IBLC 3PL6C 5DHVH 4HXAH 3UTPE 4LFHG 4IRSC 4OBSA 3IAQA 5FKAB 1DQML 2EZ0C 2VLRE 1FAIL 3D6GA 3L3HB 1DQJA 5D7IB 2JB5H 5IM7B 4KI5F 2ICES 4G9DB 1AGEA 1ETZA 4BUGA 2FHBA 2IH1B 3ZKMC 4V1DD 3ROLB 2CPCA 3IJHA 3QFJB 3OXRA 1K6QH 4L8SC 5DT1H 1DBBL 3D0VB 3EJZD 1HHIA 4HIEB 1U41A 1OAZL 3VFUA 4C55A 5MEOA 5E70A 3QUXB 4NUJB 4XXDA 4CNIB 3U0TA 2BNRA 3T09A 4Z7WB 5SWSA 1AO7D 3VFTA 5D1ZA 1KJVB 3K2MC 5JDSA 5HI4D 4G6AC 4K3DL 3WNLA 2DQTH 1D6EB 4G5ZH 2IANA 3FQWA 4PJIE 3V5HB 2BVOA 1AQDB 2NXYC 5C9JA 2A74B 2NY5H 3CLEH 5ESAA 3VWKC 4LRIC 4RMSA 1QLEH 2XPGA 4RAUA 1R5WA 4N0UE 3SGEH 3QEHB 3K7UA 4UU9B 1JZ6A 2ZKHL 4N0FA 5D7LB 2D31A 2NY1C 5CSZA 1OF2B 3BEWB 4XAWH 4PJ8B 1KC5H 5T1DL 2NY3B 3FQNA 3G5VA 4MB3A 1B6DA 3O41A 5D8JL 2HLAB 3MREA 2ADIA 1QP1A 3QUYB 4D0DA 4WVRA 5F1IA 1V5JA 4LHJB 3UTSE 1EVTC 3GSXA 1HSBB 4ZPTA 4P4KD 4K55A 4OCRL 3WD5H 5E6ID 4HCRL 4XMPL 3TJEH 1CLCA 3SGJA 2E27L 1MFNA 4F7TB 5IP4A 5MERB 4LPCA 3VXUB 1KNOB 4GO6B 4KQ4L 2P43B 4J8RA 4XGZA 3KPMB 3S3SA 1WAAF 1V3JA 5BCAA 2KQNA 3TA3B 4G8FA 4XC1L 4YQXL 5I30H 2WQ8A 5L9DL 4YDJA 2W60A 1F8TL 2Y72A 3MXVL 2NY4D 2B4CL 4GG6E 2J8UA 3S4SA 4WJ5B 5IF0A 1KJMB 2J2ZA 3TEUA 2G2RA 5DD5L 3CVHA 3GGWA 2CDFB 3NMEA 5I1JH 4X4YB 1FZJA 3B3IA 3REVA 3KXFE 1KIUA 5FYJU 4QTIL 4ZQKB 2A38A 2AGJL 1N2RB 5L2KB 4S2SB 3DMMC 4XPTH 1IAII 2VLJA 4HUKB 3SDDB 1ZE3C 5CS7A 5GSVB 5EDXA 4Y5YC 4PJ5B 3NPZB 4Y2OA 5I9QB 3AS3A 3DGGB 5EU7C 1XMWA 5DXWA 4F15B 4J3XA 4XWGH 3MLVL 1JUFB 1A9EA 5JPMA 1ZHLA 1PZ5B 3ARBD 4CADA 4MD0A 3DVGB 4MD5B 5I16A 2A6IA 4ORGA 3F7YA 1C5CH 3U0WH 4BUHA 4Z77A 1X5ZA 4KXZI 1UKTA 3ES6B 4EN3A 1NKOA 3EJZC 5LBSL 3FTGB 1PJ9A 4BSVB 4EDWH 1RULH 3LHPH 4MJ6A 2FJHB 4EBQL 1DDHA 3WN5C 3NZHL 3PHSA 5D6DC 3EO1B 4KMTH 2W9EL 1G9EA 1CFQB 4OLYH 5ALCL 3UTTA 1KENH 4YIQB 5D7IE 3ZDYF 5TH2A 3FN3A 5HI4C 1A6UH 1F11B 3IJYA 2GJ6A 5K9JL 2V2WB 1T22A 3NOIA 1G7JB 4ZS7H 3DX8A 1J0JA 2ARWA 3RZWA 1AKJD 3NCBB 3QFJE 4KV5F 1E4WH 3ARXA 1CQKA 4Y7MA 2FX8H 2IGFH 4XVJL 2JJWA 4LASH 4L9LB 3CSYA 2DJSA 4MHHG 5IB4B 3WFBH 4KDTA 3MROA 2BJML 4GQ9H 4Z7WE 1JYNA 4JZOA 3B4NA 1MCHA 4NO2B 5BZWA 3GFUA 2XYCA 4OTXL 4TSCL 5KSBA 3BZDA 4DZ8B 1BZ7B 3P0VH 3NCEB 3KPRA 1UT9A 3AS0A 5KVEH 5CGMA 1WZ1H 3CGTA 3HC4H 3OAZK 4M7LL 4HKBB 2QV2A 1XH3B 3MACL 1DBAH 3K1KC 3QQNA 1MJ8H 1F3DJ 4PY8I 4ELKB 3WXVH 5KJRL 4OCYL 3I9GH 5EO1B 1YMMD 4HK0A 5D7LE 1CD1A 4GG8B 4WHDA 2CIIA 4BQBA 4OV5A 4OF7A 4P4KC 4LLUB 4W81A 3UEZA 5HHQB 4WTZG 5J9PA 3NTCH 3F12B 4GOSA 2F53E 5LGJB 3MXWH 2NNAB 5DC0A 4PUBL 4PJ9D 1UWGL 3F58H 5KANI 5A2IH 2AEQL 2CLRB 2VXQL 4NQCE 4Y2DA 3EOTH 1G84A 3SE9L 3P73B 4JGJA 4E41D 5E94A 4YHKL 5GGUB 1FNEA 4W4OA 2R2CA 1JPGB 3ULUL 4YXKH 3GMQA 3BDXA 4CN4A 2CKBA 3LRGA 2BSRA 4HPYH 3VXUE 1VACB 1W72B 4HWZA 1BWWA 2Q76B 5C0EB 2BHZA 2BSSA 3HKFA 1HYRC 3O4OC 3BD4A 2BHYA 3TVMB 3X12A 4JRXB 5GGQL 1NLBL 3JBG7 4P46B 3BISA 1K3IA 3MRRA 3P77A 2GTZA 2HJKA 5AWNL 2GQHA 3RVWC 2X4OA 4P49A 3BHBA 1TJHL 5GRWA 3ARBC 3SKUD 1S7VB 1BQUA 1SY6H 5L2KE 5JHDD 1QNZH 4XP9H 1FZOA 4XB7A 4GRLC 5IMLB 4LSVH 3VXSD 2X44D 4UIMB 4K3EH 4PJ5E 4X5XA 3PWJB 5LXGL 1JF1A 4QRPD 4ZDHA 3TZVA 1HSAB 4U1MA 3U7YL 3Q1SL 5ADPL 3O4LD 3IJSA 3C2SA 2O26U 2QR0A 3QWOA 4JFZL 1HWGB 4LLMA 4GLRI 4ELMF 2F58H 5CIPB 4WEBL 3OR6B 1QA9B 4JRYB 4YNYB 1B4RA 5MI0C 4O2CB 1MHHB 1C16A 4WI9A 4PTUB 2P5WA 5HD8D 2VLKD 1EZVX 5GRVL 1EFXA 5F1NB 3UXFA 5DJAB 3KNBB 1JJUA 3GSNH 5JHLH 4G42B 3HTLX 5DJXA 1V05A 3CUPB 4NZRL 4CVZA 1DQDL 2VKXA 4K9EH 1VB9A 4YHPB 3O3BB 5DRXB 3ARFC 3VXMD 4P9ML 3VFRA 4PV8A 2OSLA 5C0CA 5E99L 3PQYB 4OLEA 3BZ4A 4GKSA 4IJ3C 1BLNB 3GHBL 4H1LH 4X8JA 3V6ZA 5I1EH 1CWVA 5ICYB 1QSEE 2UZYB 4WWID 3MLSH 3Q2CA 4JFHD 5EZIH 2CRMA 4JCLA 4M02A 3WFZA 1QQDA 1KTLB 4NRZB 5IWLA 4PG2C 4CDGC 1KYOJ 1ZHBB 4AG4L 4XNQA 4J3WA 4KJQC 4Z76B 4E5XA 35C8L 5GGTL 2V9QA 5HDBE 3D39A 3BKCL 2BVEA 4X7TB 3S9DB 4MNQB 3PIQA 1MFAH 3RVXD 2VDRH 3B6SB 2X4NB 4PJ9C 5ISZA 4OFYA 43CAA 3UJIL 4MGXA 2BY3A 4F57H 2HFEB 4Y1AB 4DZBA 1ROWA 5BOPA 2FD6H 1PSKL 1NAKL 1T20A 2AAVA 3GSWA 4LQFH 5DJ0B 3WCYA 4XPGH 3ZE2E 4UT9H 1LVEA 5ACLA 4GAFB 1F4WH 2EH7L 2IALA 2P1YA 3EYFA 4G8GA 4JPWL 1YQVH 1D3CA 5CD5D 4YHYC 2A2QT 5DMKB 3QDMB 5IVXA 5F96L 1TDQA 3VG0L 4F7CB 4TTDD 5ADOH 3MOQA 2X09A 2NYYD 1F58L 4X4ME 2HWZH 3A6OA 1CFNB 2O5XH 4MWFB 4JB9L 4PJEB 1S8DB 5DGRA 3CVIL 2A6DB 1EGJL 3KJ4C 4XP5H 4NC2B 2Z31D 3FO1A 3RTQD 1XCTB 1VFOA 1JF5A 1WFOA 5HGDA 4NN7C 3ROOB 2HTLD 4TOYL 3ZMRA 1IQWH 1MEXL 5CWSA 3PHQB 1A7RL 1XF2A 3MRPB 3P0GB 3RZCB 4JFYA 4Z78A 4ZAKD 5HYSB 3QQ9D 1P6AB 5HI3D 3RRQA 4AJ0A 4L4JA 2L4OA 3ZO0A 3MOBH 2HT3D 5EORL 4HSQA 2VITA 4C4KT 4XPAH 4FNLH 4ODTH 4Y19B 3K2UH 3BKML 2AKRA 3BIKA 3FQUA 4CU8A 2BSTA 3GUTA 4PJAE 2W9LA 3QEQA 2R8SH 1G7PB 1SJVA 2FECI 3GMLA 2NY7L 4WUUA 5JIHA 3CLFH 5HHPA 4P3DB 5ITFB 5CZXD 4L8BA 2VQUA 3DOSA 4WFHD 5C0RL 5HDLA 1K8IB 4MSWA 4GBXA 4QRTB 5HD8C 3AAZB 5FYKD 1JHKL 1P2CA 3GI9H 5IHUH 4LAQH 5EN2A 1IC4L 2IQ9H 1I1AA 1H3WM 3SOBH 5FHAH 5DUPH 3EOBB 2FX9H 5CINH 2AK1H 1FZMA 2EDEA 1YY8A 3ULVL 3GI8H 1TZHA 5DF0A 3QUZB 4POUB 5F88A 1FG2B 4JRYE 4Z0XA 2RHEA 3QI9B 3MJ9L 2FBOJ 1QLFA 4C58B 3AY4C 4WFEE 3GJEB 3KPPA 3KYAA 1F97A 3GKWH 5JTWA 2DB8A 4MZ2A 2G75A 2DLIA 3E2HC 2M1KA 5D2LF 3UROR 4TSAH 5CBEA 4L4TE 3FT4A 4PG9B 3RU8H 3X3FH 1N6UA 1A6AB 2EDQA 1UKQA 4P59H 1S7TB 4NHUA 5CCKH 3PP3H 2R56H 3PQYE 1FZKB 2Y1VA 4Y5XB 3CNKA 2GSIA 4U6VL 3RVXC 1GC1H 4XBEH 3T65B 1VPOL 5I6XC 3O6KL 2YA1A 3MRGB 3OAYK 1QHPA 1V7ML 4UBDD 2E7CA 1KCUL 5HDQL 3L7EA 4GRWF 5JLZA 3V0WL 4GSDL 2ENYA 4JDVA 2V5MA 4J4PD 4JFPB 5CJQH 5IG7A 3DETD 3QHFH 5L88L 1QOKA 1HIMH 1NMCC 2OJZH 1KULA 4O02H 5DMJB 3VG9B 3QHZH 2GEEA 1FE8H 3NCYP 4FQIH 4MNQE 2QQNL 1NBYB 3ARGD 4TULH 1AGBA 5F7YC 2V17L 3T3MF 5HGHB 3R8QA 3VFPB 1FVEB 1NC4B 3LV3B 3OKDB 3TWCL 2NYYC 3BX7C 4Y1AE 3BKJH 1IGJA 1S7WB 3MSPA 4RFNC 2R0LH 4N90D 1EHXA 1YDPB 2HJLB 4S11A 2Z31C 3RTQC 3ARDB 3WJLA 1RIVL 4JFOB 5CP7A 2AXGB 4BQ9A 4NC1C 1JZ7A 2HTLC 2KZWA 3LIZL 1RJZA 3BESR 5DWUL 3QDME 4WTWA 5C0IA 4OUUA 4ZAKC 5H2BA 4UB0L 4UT7L 3QQ9C 5F6HI 4M7KL 4WUKH 1JMZA 2ICWJ 4OM1H 4PJXF 4PJEE 1BBDL 5KW9L 5JR1H 1CT8B 4X80H 2DICA 5FDWB 1IGFH 4QF1B 5D93C 3KS0H 3VRLF 5JPNB 5JXAL 3V0VB 4P2QD 3MRQB 5GRJL 5CEZL 2C3VB 1OB1B 1T0NB 4PRHD 3SY0B 1KGCD 4ONHA 4NP4L 5E2UH 4E9LA 5CZXC 2J88H 5TQ2H 3BD5A 4ZOAA 5IV2B 3EO9L 5IFAH 4Z7VE 3M8OH 1LO2L 1U2CA 2UYLB 4ZSOB 5D1QB 3TF7C 1MCIA 4DW2L 1LO4L 4Y19E 2EYTB 4G6KL 2DS4A 3DRQB 4JDTH 3W2DH 3QIUC 1WEJL 3WSQL 2FYYB 1HOCA 1YEJH 1DBKH 4RAHA 2DQDH 1FC2D 1W8OA 4X4XB 3O9WB 1UJ3C 2XWBB 3IRPX 1U0QA 1CQYA 2MKWA 5D5MA 4F7MA 1QRND 3FONB 2FO1A 1L6ZA 2HKHH 5BZDB 3RL1A 1IFHH 4GUPA 3T2NH 3DVIA 2ZG3A 4WW2A 1J5OH 5HY9A 4TNVK 2JKXA 3QIBC 3FFCA 3V4UL 3V9FA 5GS0H 3DV4A 3NCMA 1NH6A 5GS0D 1BAFL 2XWJA 4NPYB 3WYRA 1G0DA 5E2VH 5I1IL 1U8LA 2R1YA 5HHOD 1J12A 5GRUH 1R3IL 2A9ML 1N59A 3HE6D 3EDFA 2BVTA 3H3KA 1L0QA 4LHUD 3LEXB 2YC1A 3BOVA 1I1YB 2YA0A 1IQDA 1AGCB 1NFKA 1DN0A 1X4ZA 2I60L 4R90L 3QNZA 1WITA 4DKEH 1S9XB 2DQUH 4IRJD 4YDVB 3LKSB 4UBDC 1MIEL 2V5RA 5JOPD 3PGDB 4MA1B 2C7UA 3Q6GL 5BQ7A 4J4PC 3DETC 1MHEB 5D7JB 1TVBA 1WFTA 3MV7A 2Q86A 2P5EB 4P23B 3QQ4A 5B22A 1KLGB 3SDAA 2Z93A 5I73C 1JWUB 1TZIB 3RQ3A 2AK4B 3MCKB 5GGRY 3ARGC 5MEND 3NCYS 4M61B 4OM0L 1IKFL 3QPQD 1B9ZA 4NKOA 1DFBL 2JCCB 4OLXL 2VXVL 4LLYA 3MBXH 1JHLL 3LN5B 5EBWA 3G6AA 3WEXA 4EIZC 2B39A 2JJTA 3OJDA 3VCLA 1OAZH 3WKML 1BD2B 3P9MB 2XZQL 5F7FA 2GAZA 1NMBL 3NACH 4XH2A 4DTGL 3CU7A 1UM5L 4KC3B 3U4EA 4PR5A 1M4KA 4S0TD 4YUEL 4K3DH 3DX9B 1MRDL 3PV6B 3AREB 5IUSA 3HAEB 5K9OA 4K7PY 4M5YL 3WHXA 5INDA 3JUYA 2VQ1A 3E3QE 3I85A 4HBQA 2GSGB 2YA2A 5IB2A 3BGMB 4I4WA 1JGDB 4P4RB 5IJKA 1A6VL 3S35H 3QO1A 3ZTJH 3ILQD 3RPIA 1XGYH 3RAJH 3F7VB 3UYPA 5I75C 5IQ7L 1R0AH 1JF6A 4QHUB 4PGBA 3T77A 4X5WB 4JFDA 1BP3B 1H3GA 1YEKL 3C8HA 5IROA 5TE7L 4DVBB 2EXWD 3C5ZA 4FQXA 1WBZA 4ODSL 2VSCA 3MBEB 5D8JH 1YC8A 5F6IC 3KAAA 4P9HC 3C8KA 2ESVD 1QSVA 5E8DH 5FHBL 1QFWL 5EWIH 4HKXB 3HMXL 3RNQB 4MAYD 1IL1B 2AW2A 1UWXK 2FZ3A 3TYGL 4P2RA 2X4SA 4HCRH 4PJCA 4IDJH 2E27H 2ZG2A 1CLOH 2GFBB 3KR3L 2Y07H 1ZLVH 4RMVA 4I5BA 1QYGH 3KXFD 2BC4A 4JFEE 4PTTB 4X6CA 4HD9A 3EGSB 1WT5A 2IBZX 1IM9B 4XC1H 4YQXH 1MHCB 1S7RA 5BJTB 2PXYA 3FB8A 5L9DH 3QAZC 3K4ZA 3NIGE 4XPBL 3FB7A 5CP3A 1F8TH 3CAFA 1FNLA 2B4CH 1YPZE 4M7ZB 3LEVH 2DQJH 3JTTA 1G0XA 5AYUL 3CDGB 3OF6D 4HS8H 5DD5H 2WIIB 4BK4A 3HE6C 3L6FA 3D2UA 1A6ZB 1ZA6A 4OGYL 4QTIH 4OZGA 3OKLA 2R1WA 1LK3H 4UMGA 4GW1A 3TC9A 1WWWX 2NW2B 2YUWA 1MCPH 2CGRH 3UMTA 4IRJC 5IEHB 3P4MA 4NJAH 3WFDL 2Z0BA 1OY3B 1BQLH 4N1EA 5C6TL 4NZTL 3MNWA 1HKFA 3TPUA 3BP7A 5FGCB 2COQA 5EOTB 4XP1L 4Z7UA 43C9B 3LDBB 4K71B 1WBXB 3DHMA 1KLUB 2E9JA 2OL3H 4X6BB 4F2MB 2XQYK 3QPQC 2EO1A 3QO0A 2LFGA 4YK4C 5CKGA 3RWJB 5C86A 1CL7L 3BIAX 2CR3A 5EU6B 1PW3A 5KS9F 4HX1A 1RU9L 3QUXD 1CFSB 3L5XL 3TT3L 2ZSVA 3GMMB 1KXTB 2PW1B 1RPQA 2IFFH 3NZHH 1U8NB 1XF5A 4MJIA 5KSAB 4MX7B 2GHWB 4QRRB 3CFKA 4P48A 1CU4L 5DK2B 2D0HA 3EJYD 4ZTPL 5GIRB 5K9JH 3LD8B 1CFVL 1RUPL 5HJ3A 3TCLA 2JCCE 2D7QA 2IF7A 3RDTB 1U8KA 4LNRB 3U36B 5ITBL 2FBJH 3OMZA 4JKPL 5E8OA 1BD2E 5DQ9A 5C71A 3A67L 4PLKC 1BIIB 5DVNA 3ILQC 3GDBA 1PQZA 3RUGA 3MLXL 2W0FA 5D7LD 3BZEB 2VLMD 3QUMB 5BRZD 5SWQB 1ONQB 2V2XA 4P57A 3KWWB 4NQDA 4TSCH 4TUKH 5J12C 1T4KB 1D5IL 2C1OA 2NY3D 3KPQA 1LP9A 4YC2C 3STLB 2HMIC 4NRYB 1U3HA 1RZJC 2ZPKH 4Z0BL 5IIEA 1QZ1A 3QUYD 5KJRH 1K8DB 1PY9A 4OCYH 1NCAL 4LLWB 4CU6A 2E7HA 3MR9A 3V8CA 4KHTL 4MXQD 4MAYC 4ORZC 3LKPB 4X6DA 4OGZA 1R24B 1OWRM 4J3TA 5FYJH 2IBBA 5E4IA 3QT2A 4N1HB 4FQQB 3EOAB 4I2XA 2FH6A 4PUBH 4MA8L 1V3LA 1VFMA 2I9TB 3BH8A 1MLBB 2IQAB 3VXRB 2AEQH 4LCUB 1HHGB 4ACPA 5H37H 3VXQA 3QDGB 2VXQH 3TA3D 1I7UB 5T5NF 1P6FA 4P2CG 3I50L 4YHKH 5SX5H 3W11D 4PV9B 3ULUH 3JUZA 4KHXL 2YPKA 1LHZA 1T2XA 1TVDA 1YY9C 3R0MA 3ULUD 1G7IB 4HUXB 2FIKB 4TNVF 2GUOB 4EXKA 3VI4F 3R4DA 5D2NB 5DQJA 2KBGA 2H2PD 2OTUA 3TO4A 3IU4L 2D0FA 5DSCB 3EO0A 2C3GA 2DKUA 4LQ1A 5DJZA 3GSQA 4OZFA 1KJ2B 4XRCA 5L2KD 4R3SA 4YAQA 2DM7A 2RB8A 3O8XB 4PRPB 3B5GA 7CGTA 3SDDD 3TT1H 4JZNB 3FMGH 5CMAB 1CVRA 3ALWA 4UNUA 5EUKB 4RIRB 3RKDD 1ACYH 4JJ5A 1H3XA 5IFJA 4PJBF 3F6IA 1KIPB 5AWNH 4C56B 5GS2H 1OPGL 2AV1A 3RHWF 4NHCL 3FT2A 1TJHH 4Q0XL 4D0BA 4ONFH 5J8OA 2YOCA 1A64A 3RGVA 2GK0B 3C6SB 4HLJA 3RWDB 3AU1A 3ARVA 4RWYL 2AJZB 3GO1H 1N5YH 1LO0L 3RWCA 1NEZB 4HW6A 3CFCH 4DWHA 1ACZA 3HZMA 1CTOA 4PLJC 4WFFD 1ZANH 5LXGH 1WAAA 1UZ6E 1RHHA 2WW8A 4U6YA 3QUXC 1DZBA 5ADPH 3L3JB 1GHFL 5C0AA 5I1LB 1S3KL 1HQRA 4PBXA 4OF0A 5FGCE 2X4RA 4WO4A 4JFZH 4LP5A 3STZA 3QQ3A 4G43B 2QSCL 2NMSA 3MGTA 5E08L 2EC9T 5K93A 1RUQL 4XP6L 1B0GA 5GS1B 4ONGH 1ES0A 1DQLH 1P4IL 1M05B 3F7QA 4JO1L 1W0YT 4AL8L 1WZLA 3U46A 2HJFA 2X7LB 3X14B 1KYOK 3W0WA 4Z7NE 3WIHL 5IFHL 2LE9A 5EU6E 4NZRH 4AEIH 2HFGL 1DQDH 3UJTL 4X7DC 1XF1A 3RL2B 1NAMA 1A4KA 1S7QB 4P9MH 4CMHB 5DO2C 4LCWB 4QRRE 5C08A 3PWPD 3QFDB 1FJ1B 4CBPA 3L3KB 1AD9B 2NY3C 5HYQB 4CMMA 4YHLH 3FQXA 3H0TA 5F72S 4UILL 4E42B 3I84A 4XBPA 1O5DT 4EUPH 3VFVA 3QUYC 4TN9A 5HVHB 4ZXBB 4R96B 4N5UA 4AG4H 4MXQC 4MJ2A 3FJTA 5GGTH 5B38G 3HPJA 1S7UA 5J6GA 5IMMA 1LO5B 1ULVA 1K85A 3VDAA 5BS0A 3D3VB 3MV8B 5LWYH 2V7HB 1Q9KA 3FB5A 1MJJA 2BCKA 4LNVA 5EUOA 2C4FT 3MYZA 1MI5B 4Y8AA 5TE4L 2EEDA 3QH3A 4GLRH 3UJIH 4W4NA 3MRHA 1LEKB 3TA3C 1BQSA 3O6LL 4KGJA 5D9SB 1UEMA 1PSKH 2R9HC 5DMGD 1AIFA 2X1OA 1KIQB 1EO5A 1F4XH 5EOQL 3W11C 2ERJB 5F7KC 2FX7H 4GKZB 3P11L 4G6JH 4BSWA 2VDKL 4HAFA 4LRNL 2EH7H 1AFVH 4QCIB 3OPZH 4PJFB 3VXRE 5I19L 3BP5B 2FLBT 1KJ2L 3HRZB 4L3EA 4PJIF 1EIBA 1HXMA 1U95A 4PJGE 3LB6D 3OKKA 1ZHKB 3QNXB 3SDDC 1KEML 3ARQA 3H9ZA 4JRXD 1UVQA 4NWUH 5B3NA 3LY6A 4P46D 3RKDC 1G0YR 1QBMH 4F15C 1PY4A 2NXZB 1QSFA 1C1EL 4TOYH 1MEXH 3T3PE 4ODVH 3RP1A 1EXUA 3MGOB 3Q48A 4FFZH 1ORSA 3AM8A 2ARJB 1K4DB 1OP9A 4IEFB 1O7SA 1TETL 3BXNB 5LAXA 3Q6FA 5J57B 4PRPE 3FN0L 3QXAA 2D9QB 3JTSA 3PWUB 3WL9A 1RK0A 1NDGB 4M3KB 4PREB 4JO4H 2XRAL 5I17B 3GKZA 1CG9A 2FO4B 3GBML 3SCMA 4C56E 4HWEL 2VWEE 3O6FB 4OZHA 1EPFA 1XGUA 5C0GA 5JIIA 3EBAA 5HHVH 4IMKC 1BMGA 4OCSL 4MCYA 4U1LB 4JFFA 3PL6A 4GXVL 2VZ3A 4JRYD 1FFOA 3UBXG 2UWEB 2B1AL 4ZOEA 4NM4H 2P47B 1JHKH 4L4VA 2Z8SA 5DK0A 3EFFB 2R15A 5BVPL 3MODH 2V2TA 1K9TA 3EDKA 4L9LC 1IAIL 3L3IB 4CVXB 3ULVH 5KOMC 1MF2L 4LBEA 4GS7B 2JB6B 1BEYH 1BOYA 4JG0L 4JN1L 4OQTL 1T5WA 3T8XB 4K2UL 4GG6F 3PQYD 3F7PC 3D69B 4ZFGH 1DVFB 1G7MA 1FP5A 1YUHA 4AM0B 2EC9U 5TJWK 1F2XK 5AZEL 1XIWD 4JY4B 4NFBA 3JV4A 5IB1B 3THML 1D5MB 3BT2L 3LQAL 1YEFL 2F5AH 2LV4A 2W0KA 3WLWD 3VXTA 3U0PB 4D9QD 5BMFL 3O45B 2RFXB 5DD6A 1HCFX 3RWHA 5GISH 3VWKA 4Y4FD 5HVWA 5IVZA 2FL5A 3G5ZA 4LRIA 1SYVB 2FATH 4LSQH 3EYQC 3GBNH 3WFCL 1T89C 3MJ7B 4ISVB 4L8DA 4N0CD 2YRLA 3CJJA 1NGPL 4LVHB 5EPMB 1P5VA 3O6KH 4LSSL 4OCWL 1NPUA 2LU3A 3DV6A 3V4VL 1INQB 2P45B 3P30L 3PG2A 3X11A 5JMRA 4FHBD 5HDQH 2AABL 4FXKA 1NCUA 4GSDH 3V0WH 4ZO6A 1T21A 2EDJA 2FIRT 3D0LB 5DMGC 1DLFL 2YPLE 3MZTA 4QTHA 5L88H 2UY6A 2OQJB 2YPVL 5FYJE 3S37X 4OZIA 1AR1D 1CXKA 5F71A 1ND0B 5K9QI 4HGKC 4TPRH 3FOMA 3AGVA 1ZT1B 3D3VE 2OI9B 2XZZA 3HNSL 3MV8E 4YWGL 1T1XA 4O2FB 3O81A 5T1KB 5D7IF 2V17H 1NL0L 3HRPA 5GGVL 4MJ5A 4UIKH 5DJDA 3GSUB 1DCLA 4NQED 3TWCH 5I18L 3WIIL 1LD9A 4XX1E 3MUGB 3LB6C 4XMKL 6CGTA 4R2GB 1MY5A 4FQ1L 4AIOA 5E5MA 3JWNC 4M6OL 2C4FU 1FNGB 1N0XL 4P46C 4PYHA 3TN0D 2YMXL 2MCPL 4WEMB 4Y4HB 1IRAY 1INEL 3L95B 4HUWA 3PGFL 1AJ7L 2R1XA 1UM4L 4Z7WF 2EO9A 2HAZA 2PTVA 3LIZH 4ZTOL 1QKZH 3RZCD 4PJFE 5IKCB 4UB0H 4UT7H 2WBJB 4ETQA 5E2TL 2Q8BL 4JM4L 2ICEB 5F7LB 3FRUA 3HPLB 1CXIA 3EYOB 1VFBB 2NTSP 3BIBX 4Y19D 5DC4B 2W9DL 1D5XB 5FO8B 5C92A 2C1PB 3QDJD 2X4TA 3INUL 3EJJX 2VDMH 1XF3B 1MFBL 5CEZH 2K7QA 3CVHH 1JHTB 2DMKA 4Y5YA 2OR9H 1JN6A 4K7FB 5C70A 4U1KB 3WLBA 5DHVA 2Q8AL 3EO9H 1U8HA 2R4SL 1RZ8A 2A6KA 1LO2H 2IPKA 1N7MH 3BVNB 5F7EL 2QQQA 4O2EB 3PP4L 3DX6B 4NKQB 4R7DB 2EIDA 3OXSB 4IHOA 3BYYA 3MNZB 2CRZA 1YJDH 3WSQH 3D25B 4YPGB 5IVOA 3C5JA 5DRNB 4V1DA 2BMKB 1R5VA 3QUZD 5JW4N 1AGEB 1ETZB 5EZJA 3GJFA 5ID1A 2UWEE 3TBWA 1DR9A 2CDGA 2DQEH 2NTFA 5D6DA 3B8SA 3IJHB 4WI7A 1H5BC 3TBTA 3O0RH 1HHIB 1AO7A 1FDLH 4OF3A 1VGKB 2XG5A 3L7FA 3RJQB 2QHLA 5MEOB 3V4UH 2VXSL 1BAFH 4XXDB 3WLWC 4AQOA 3H9SD 1MNUL 2BNRB 4WI8A 5I1IH 1KPUA 5E8NA 3O11A 5SWSB 3V7AG 4KKNA 5D1ZB 5DVLA 1IAOA 1R3IH 5JDSB 4GH7B 1U91A 1R3HA 4KAQL 1YNKH 2EDDA 4N0CC 5ELIA 1WZKA 3HC3H 4RRPG 4R90H 2APTA 3ZKSD 4BQ8A 4EQ3A 2XPGB 4MDIA 4RAUB 5DZOA 5EZLA 1OOAA 3GMPB 4N0FB 5IOPA 4HFWB 2XACC 2DBLL 2D31B 1X5XA 2PYED 5CSZB 2XQBL 5LG1A 3VGBA 5FOBA 3CD4A 2YHGA 5AD0A 1BX2A 5IEKB 4N5ED 3G5VB 1CGVA 3O41B 1IC5H 3Q5OA 4OM0H 4WFGE 1IKFH 1CDIA 1EAJA 3MREB 4P4KA 2ADIB 3L5WA 4OLXH 1JHLH 5E6IA 4D0DB 3ESUF 3TYFB 2WBWB 2EE3A 3U1SL 4I18A 5F1IB 4TVSa 2XZQH 3QNYB 5A3ID 4WI6A 2L7JA 5EH1A 5DJ6A 4ZPTB 3NA9H 1Y6KR 1KG0A 1LDPH 4HMCA 4K07A 4IDLA 1Z6JT 1MFDH 1A0QH 1PG7W 3TN0C 5E03A 3ARDD 4YUEH 3D85D 2OJEA 4A6YL 1UXWA 4AEHH 4PIRF 1MRDH 1IGYB 4M5YH 4XGZB 5TDNA 2H6PA 1EUTA 1NFDE 3RZCC 3UTZA 4G8FB 4M5ZH 4M7JL 1I3VA 1B0RB 4PD4J 5BXFB 1EEQA 2EIEA 1FV1A 4YDJB 4HMDA 3VFGL 3CK0H 4ALAL 3SDXA 4J1UA 1PLGL 5ANMA 2X1QA 2CKBH 2EICA 2J8UB 3S4SB 3GSVB 3AMKA 2G2RB 3WS3A 3REWB 3A6CL 1YEKH 3CVHB 1Q94A 4ODUA 5TE7H 1FZJB 3B3IB 4PB9H 4HULB 5HDBF 4M1DL 4QXWA 2VLJB 4KTEL 1CIUA 3DSNA 4I3RL 4O9HH 1PX3A 5D72L 1OTSD 2ZOKA 2AVGA 1QFWH 5FO9B 4YDKH 2AI0L 3VGHA 3ARBA 5CJ8A 4QXTB 4D9LL 2R4RL 1INDL 5KVGL 2ZUWA 1LO3L 4LFHD 1MRFL 3VFOB 1T0PB 2YWYA 3MV9B 1JZ5A 2BNUB 1A9EB 5JPMB 3NBNA 2CK2A 4G3YH 4CADB 1GPOL 2O5YL 3QUZC 3ZE2F 3KJ6H 4XCCH 1OCWL 1TJIL 3LSOA 2XN9D 4JG1L 1FO0B 2A6IB 3VFNB 3QI9C 4ORGB 3F7YB 2BK8A 4EN3B 1OGAD 1W0VA 1FYHB 2AJXL 2PCPA 4XPBH 4EVNA 4WDIA 3VI3E 3RIAK 4PY7A 1DDHB 3V79C 1Q9LB 2I9LB 1AKJA 5AYUH 3UTTB 4I8DA 3MRNA 3DROB 3QA3A 5H35B 3LQZB 4OQ1A 3IJYB 5B4MD 2GJ6B 2QSVA 1T22B 4HJJH 4OGYH 4Y5XC 1NCNA 5FYLL 2FCBA 2PYFA 5K9QG 3RVUD 3QDAA 1KTKE 1YECL 1HZHL 3T0XA 1YEGH 3CSYB 3WFDH 2DQGH 3DIFB 5C6TH 4NZTH 4FZ8H 2BNRE 4PGZA 1BBJA 1FCCA 5H8DA 1DN2A 3MROB 1ZS8B 2OP4L 4NO5A 5DD1L 5SWSE 4XP1H 5IT2L 5BZWB 3OHXA 3MLWL 2EIZA 1RZGA 5I1CL 4PJAF 2R39A 2P5ED 4P23D 3VG9C 3KPRB 3U79A 3BPNB 2PUQT 1SM3H 1YMMA 3QZWA 4N5EC 2AK4D 4D2NA 4PG2A 4WHTA 4QKXB 5MP6H 4RMQA 1A5FL 4LDLB 1JYWA 5I1DA 1QBLH 1UQSA 2IADB 3A6BH 4YBQD 1GZQB 4Z7OF 1CL7H 4HK0B 5CGTA 1RI8A 5E8EA 4L5FL 5H94A 5A3IC 4AMKL 1NSNL 5FKPA 5IMOA 4XZUA 4PJ9A 2FNBA 5T5NG 3HR5A 2PETA 2VUOA 3KYMA 4JHAL 1IGIL 2OTWB 1CU4H 3ARDC 1AP2A 4ZTPH 4X99B 3RY6C 2XY1A 5JIKA 1CFVH 3ARUA 1SMOA 2PF6A 3UO1L 4E41A 1RUPH 1PYWA 4K23H 1QFPA 3ZYIA 2M8XA 2FSEA 1J0HA 4K8RH 2DM3A 4GKOA 5E9DD 5BO1H 4RGOH 4JKPH 3TIEA 5ESVA 3LRSB 5HYJB 2EDXA 1FORL 1LE5A 3A67H 4JQXC 2EDFA 2OTPA 3SDYL 5E94B 2Q7YB 2VJXA 5J6HB 1AQKL 3FB6A 1IGCL 3GMQB 4OF5A 2B1HL 2CKBB 2BSRB 3TJHD 2EDLA 1J0KA 4U1NA 4GJTB 2HKFL 4HFUL 5TGBB 3H3PL 4HWZB 4M8QA 2VC2H 1OD9A 2BSSB 3ZDYE 3MBED 1M71B 1JI1A 4ZUSB 3T0ED 5FK9B 4OCNC 1JIBA 2ORBL 4Z0BH 4M62L 5C0JA 3X12B 3BWAB 3TPKA 2A73A 2R0WH 5D1QC 1PG7H 1PKQA 4HXBH 3D18A 4KHTH 1D9KD 3PP3K 4KI1A 4FABH 2J8UE 5JHDA 3P77B 4H8WL 2GTZB 2HJKB 2HRLA 3OAZH 3VXSA 2X4OB 4FP8L 3BHBB 3MV01 3OB0K 2YWZA 1JYXA 1MJ7L 4MA8H 1NBVL 1FO0L 4QRPA 2VLJE 2VDNL 5T3ZE 1FZOB 1BFVL 3LPGA 3O4LA 3B2VH 3J7HA 2CLZA 1I3RB 4HK3N 4LPTA 1IM9D 2XICA 2ZSWB 4JDZA 3PJSB 1KCRL 4L29A 1JF1B 2YRZA 5FCSH 4U1MB 4UTAH 4Z5RB 4KHXH 4FQCL 4BFGA 2VLKA 1NGZB 4OGXL 1T1YB 3IU4H 5GSRA 3TBSA 3ULSA 5B4MC 3ZHDA 1WWBX 4K3GA 2P5WB 4S1QH 5B39A 1EFXB 1KN2L 1RZFH 1D6VL 4WI5A 5F9JA 1UYWL 3HNTL 3RVUC 2VUYA 1W8NA 5DJXB 1D7FA 4WTXA 5JW3L 4H1LA 5A40E 2CK0L 2P49B 3AY4A 5FGRA 4X4ZA 5D6CB 4MA1C 4D94A 3VFRB 4PV8B 2OSLB 3DTXA 4N8CL 3UTTE 2Y5TA 5C0CB 2IC2A 3SHSA 1I3GL 4UV4L 1A1NA 1LNUB 2BERA 3BZ4B 4GKSB 3M17A 3V6ZB 2E9IA 2GJ6E 2XA8L 4Q0XH 3BN9C 2AJUL 4P23C 1WTGT 1RIHL 3S37L 4PGEA 1MSPA 3G04A 1GH7A 3H7LA 3I02A 1CF8H 2E7LC 3ISWA 4ZFZB 2WIMA 4Z7VF 4YBQC 3X3GH 3O2DA 5IQ9A 1QQDB 2HRPH 1B4JH 3BD3A 4WV1B 1GHFH 4KKBD 2UZXB 4QOKB 5DI8B 3D39B 3L5HA 1RVFH 4YHML 2QSCH 5KSBE 4QRRD 5DMIL 4P99A 1RUQH 3KPRE 2ARJQ 3PIQB 1YN7A 4JQIL 4XBGB 4XP6H 5FM5M 3MPCA 4KJWD 4NQVA 3S34H 2ADFL 5J3HD 2VN7A 2R23B 1ITCA 4Z8FL 1EDQA 2YBRB 3NZ8A 4HS6A 4MAUL 4DZBB 3WIHH 5EFIB 3CCHA 3HZYA 2HFGH 3FCTA 4KK6D 2C9AA 5TF1L 1T20B 3GSWB 3MUY1 4WNQB 4F7EB 3MLRL 3GMNB 5A16A 5LGHL 4TNWF 5SWZB 4LDEB 1RSFA 1N6QL 2IALB 3EYFB 4YHZL 5DJYA 4JZJA 2DLFH 1H3TA 3M1BA 3ESVF 5IK3A 1I8MA 2Z31A 3RTQA 4UILH 3MBEC 1DBJH 1TTGA 4DGVL 4FQLL 3VGDA 4JKKA 4QHKJ 4NM8L 4ZAKA 3FO1B 1X5IA 1TQBB 5HGDB 3FO2A 5D2LB 5EU4B 4OFIA 5EC1A 4U3XA 5I76B 1Z9MA 1XF2B 3S7GA 3IDMA 4Z78B 2ITCA 1S7SB 5TE4H 5GJTL 5JOEA 5JNYA 3QDGD 5KAQF 1FFNA 4LIQL 8FABA 1MVUB 4JN2A 1KT2A 3SE8H 2EKSB 4AH2B 1P4BH 3BIKB 3FQUB 1N4XL 4WI2A 3SGEI 3GUTB 1UGNA 5I1KH 3KYKL 4I48B 3P11H 3GMLB 3ZTNL 5DGQA 5HHPB 4M7ZC 2Q20A 4GRWB 1G9MH 5JQHC 1V3KA 5HYIA 2Y06L 2EYSA 3CXDL 3F6LA 1YEEL 3TH3T 1F90L 4YHOL 5D96B 1A9BA 4GBXB 3OGOE 3IF1B 4DJMA 4U3CA 1TZGL 1GGYA 2FH8A 1J05B 1MJUL 2JF1A 3O8XD 4OIIH 4PRPD 2W65A 3DUSA 3LMJL 4LLVA 1BQHG 1RK1A 2QADB 3QCUL 2DWEA 1IEBA 3PNWA 3HN3A 1YY8B 3SKMA 1TZHB 1N64L 3OKOA 4KY1H 4P2OB 4MQ7A 1C1EH 5DDHB 1CGWA 2E7MA 5F88B 1CK0L 3IDUA 5JXED 2JIXB 1MCSA 4HQQL 4NQSA 2MOVA 1QLFB 3LDBC 2P5WE 3ZL4H 3SDCB 4K71C 1TETH 3PDGA 4XB8A 4I0PB 2G75B 1OAYL 2AJ3A 4DEPB 1GGIL 4WU5A 4Q9RL 1QTYT 3OZ9L 5I8CA 3C9NB 5CBEB 1NUDA 3FT4B 4ZPVA 4KKBC 4Q9QL 2QL1A 5C0CE 2DYPB 3B9EA 4WIQA 3VXPA 5KSAC 4IRZH 2GSIB 1O7VA 1WUNT 1MRCL 3EYSH 4GMTL 4J4PA 3LD8C 5J3HC 5HXMA 5CEYA 4DGYL 2VB5A 5IHLB 3HZVA 2H26B 4U1JA 1MLCA 5F3HA 1EHLL 3O2VL 3L7EB 5JLZB 3ARGA 4JDVB 3V5DA 4KK6C 4B7LA 5IG7B 4NKDA 5F44A 2R2BA 5ACZA 1MF2H 1I7RB 1ORQA 4OAWA 2SEBA 3D39E 1ZLVK 4Y5VA 3BAEL 4JN1H 4LCWD 5GRYA 1IARB 2UVEA 1UZ8B 1YPZF 2ZNWA 4YXLH 5L6YL 1AGBB 4XPHH 1O0VA 3OAUH 1MAKA 4M1CD 1EH9A 3F5WA 4R4BA 1X44A 2A1WL 5AZEH 1JZ2A 2ICWI 3THMH 3BT2H 1YEFH 5BMFH 5T5FL 1GAFL 2N1KA 4R8WH 3MLTB 5C2BL 1C5DA 3PDDA 4G8GE 3MZGB 4LKCB 2XFXA 3F7RA 2GK2A 5IVXE 5C0IB 2P42B 4OUUB 3D3VD 1CGSL 5H2BB 2D3VA 4P3WA 4NZUH 2MQ0A 4LSSH 3TCXA 2I25N 1MI5D 4P2QA 3V4VH 1UENA 3KDMA 1A14H 1SYSA 5IESL 4PRHA 3MCLH 3SKJL 3TNNA 4ETYA 2FEDD 2NCMA 2B20A 2FJFB 4UQ3A 4HKJB 2V7NB 2WLYA 2J5LB 4X9GA 5FO7A 1ZLUH 1EZVY 5D2NC 4KRPB 4NBYB 1EVUA 4KZEL 3OAYH 1FYTD 3TV3H 1S9VA 4FFYL 5I18H 4AYFA 1CIDA 2NZ9D 4JPVL 3CFEB 3O8XC 2JCCF 2DN7A 4XWOD 2DBJA 5L2JB 1N5AA 5DJ2A 3QCVH 1QRNA 1BOGB 1IGMH 4MVBD 4EI5B 1RURL 1HOCB 4ONOA 1E28A 3QXTA 4WUUE 4LSUL 1INEH 1BM3H 2CXKA 4NZDA 3PGFH 1AJ7H 1RMFL 4YHIB 1ZT4A 2WMPA 4F7MB 5D5MB 1A3LH 5JXEC 2OX5A 4ZTOH 4XVSL 2AJSH 4I77L 1QHOA 4KZDH 3H9HA 4GUPB 5EA0L 4LLQA 4WW2B 3VW3L 5HY9B 5HHOA 4YX2L 2DQFB 2GTWA 1JRHI 3L3GA 2VISA 3JV5A 3HE6A 2BRQA 1MWAA 1WTLA 1JNNL 3FFCB 5CP3H 3OTTA 5ID0A 1ZVSA 2W9DH 5BV7B 2XWJB 4LHUA 3L5JA 3IDIA 3KHOA 3E6FB 4FN0A 4G8EA 2DIAA 1MFBH 4KKCD 3SKOB 1F4YH 3O6FD 4BKLB 1HEZA 1UFUA 4CDHA 4M03A 1X3DA 4N8VA 3IFLL 4IRJA 1U8JA 1B3JA 3CZFA 4LLDA 3CSPA 4HPOL 4JHWL 2Q8AH 1IQDB 4P5KA 1VFUA 2R4SH 1DN0B 1P1ZA 1QD0A 1EJOL 1HH9A 1CFTA 3W9DB 3AUVA 1YMHB 4O51B 3N9GH 2C7UB 2XTJD 5MENA 5BQ7B 5DURD 3DURA 3P0YL 3P4NB 4JVWA 5D71H 4LU5H 2Q86B 1HDMA 3TP4A 3CDYA 4CMHC 4RGMB 3SDAB 4OLUL 2XT1B 2Z93B 1CXHA 4XCNB 5HGAA 5LCVL 1U8IA 1EAPB 2ATPA 2PTTB 3I2CL 4NKOB 3U6RB 4OLWL 4LSRH 1PX4A 2HH0H 4M1CC 4WY7H 2APXA 3LOWA 3R06A 5DJCA 1QR1A 3WEXB 2ITDB 5ERWA 5SX5K 4F33A 3QIWB 5JORA 2VXSH 1OTTD 1VSCA 3LQAC 5HVHC 4S1RH 1MNUH 4HGWA 1KPRA 3U4EB 4PR5B 3HCVA 3LKRA 3IDNA 1EEZA 1GGBL 1H8OA 3GNML 5K9OB 1JNHB 2B5IC 1FBIH 3WHXB 1J8HD 5INDB 5E6ZA 2VQ1B 2O61A 2EXYD 5IB2B 4YBLB 1S9KC 4PS4L 2N7AA 3QO1B 3AC0A 5F1KC 1I1FA 1X5LA 3W81A 3T0WA 5L0QB 1ZWIA 4HIJB 1JZ4A 4YDIH 4PGBB 3CIQA 4EDXA 2FEDC 4YEEA 2ERJC 1CLZL 4J6RL 2ESVA 3SQBA 1FRGH 4FQXB 1WBZB 3TBYA 4MAYA 4JHZA 5T1KD 5J11B 4PD4K 1BF8A 1ZA3B 3CFJA 3C8KB 3JWDL 1U2HA 4KI5D 3U1SH 4HCRA 5IGXL 2DQIL 1D5ZA 2FR4A 1S9YB 3NAAL 4XWOC 2OZ4L 1BQHA 2E6JA 2ZUQB 1NC2B 4Z7NF 4CGTA 4FXGA 2FZ3B 3KXFA 4P2RB 4MVBC 5CJOH 3BUTA 3DXAD 3KPNA 3LS5L 3PDOA 4KRMB 2NXZC 5E2JA 3A0OA 3KYOA 2QEJA 3ECBA 2FGWL 5GRVK 5AAWA 2IPUK 4LVOB 2BVQA 4H26A 4O58L 3WO4B 1RZIB 5FCUL 3ZT7A 4OI9A 4MLSA 4ODHL 4JY5L 5C0DB 4M7JH 1S7RB 2PXYB 3FB8B 4HMEA 2G5BB 1E4KA 4NQUA 4JR9H 3ZHKA 3FB7B 2G60L 3VFGH 1LGVA 4ALAH 1AE6H 3RNKA 4JY6A 5E24E 3QRGH 2C3XA 3BDBA 4M93B 1DL7L 1CR9L 3O6FC 3S3JA 3A6CH 1NBZB 2VDQH 2LU4A 3AROA 3L6FB 5D5ME 5D1XD 4HDIA 4M1DH 4NO0B 3LEYH 3OKLB 2R1WB 2ZCKL 4KTEH 2H1PH 4I3RH 5FKAA 1DUZB 4XNXH 3L3HA 4DOHB 1BFOB 3FFCE 4JCMA 3P4MB 1UEYA 1WBYA 5DFWH 5IM7A 2R4RH 5KVGH 1JFQL 1LO3H 5E8PB 2ILLA 1P69B 1C7TA 2XTJC 1MFCH 2IH1A 3WNOA 1VCAA 4EKXA 3ROLA 1I3UA 1GPOH 2O5YH 5HBBA 4GS7C 4M6ML 5GS3A 3D0VA 4WWKB 5DFVD 4N8PA 5CLTA 5C0BB 1JPST 3NIDE 3QUXA 4HT1L 4NUJA 3HC0A 4CNIA 3ARPA 4M1GL 4YJZL 1UWXH 1YNLH 2DIBA 3IRZA 1KJVA 3RX8A 4ESKA 4EOWL 4Y4KB 4P0DA 1HQ4B 2ZSVB 4GAYA 4P5TB 4PJGF 4IMLB 5INCB 4BYHA 1A4JB 3PABA 3OKEA 4UTBL 1KXQE 1XF5B 4MJIB 2YS4A 1AQDA 3W39B 3CFKB 1JTPA 1XCQB 2A74A 4XCEA 2L7UA 2V5SA 1DJSA 2BOCA 5ENWA 5JW5B 3DVFA 5DTFA 5HJ3B 3W5MA 3T3PF 5FYLH 4KUZH 2H32H 5D7LA 5FYLD 1Z3GL 2EXYC 4ZUVA 5BRZA 1FQ9C 5E8OB 2NPLX 1AI1L 1HZHH 4MNHA 2WNGA 4ZUWB 1TITA 4QO1A 1M6OA 2ICCA 1PQZB 1XZ0A 5KZCB 2W0FB 4HIIB 3WBDA 1J8KA 2OP4H 1UACH 5DD1H 1VKXB 2V2XB 4P57B 5IT2H 1OLLA 3MLWH 2HLAA 3NGBB 4NQDB 5GHWL 3VWJB 5I1CH 1JP5A 3VH8B 3QUYA 3MRIA 2BHUA 5KVDL 2C1OB 1HH6B 3LQMA 2GJZA 3S98A 1BVLA 3KPQB 2OI9C 4K3HA 1KCSL 3KLHD 1A5FH 4YPJA 1HSBA 1U3HB 3DPBA 3IDYB 2J8OA 4ZNEA 2MCG1 5IIEB 3O2WL 4KK9D 4KI5C 4HWUA 2GY5A 4ZFOL 4RFOL 4RSVA 1QUNA 5MERA 2ED8A 4L5FH 5ICZB 3LAFA 4NN5B 4I3GA 3MR9B 4AMKH 1KNOA 3HZKA 5MEPA 4RBPH 4X6DB 4CJ0A 3U7WL 1KOAA 1GIGL 1KB5L 3KPMA 4MXWH 4JFDE 2KDGA 3PGCB 3DYMA 2ED7A 2UZIL 3TA3A 1I9IL 4Y4HC 2UY7A 6FABL 5ETUB 5T1LD 1MCQA 5HPOA 4I2XB 3BP6B 2WWKT 3UO1H 3BH8B 3MRMB 5FDYA 3VXQB 2LU7A 2WBJC 2WUBH 3NA4A 1CZ8H 3QEGL 3ZDXE 4WJ5A 4JKWA 2IMMA 5I8OH 1N3NB 1RHFA 4D9RE 2MHAA 3SDYH 4PPTA 1AQKH 4X4YA 5DZLA 4ENED 4MB5A 3IU3A 2YPKB 4P2RE 3RIFK 4PJCE 4ODWA 4ZQKA 1F3DH 4E0RA 3OQ3B 2B1HH 4QXUH 3P4LA 4KK8D 4L1HA 2HKFH 3SDDA 3H3PH 3EO0B 5GSVA 5DD0L 3DRTA 5DJZB 3GSQB 2CJUL 4OZFB 2X9XA 4X6CE 4R3SB 4XP4H 4M62H 3BQUA 3KLAA 3MLYH 3S6CA 1CE1L 1SBBA 1PZ5A 1A7NL 2QLVB 1WLHA 4JFXB 4PP1C 5HYSG 4XTRC 4H8WH 4MD5A 1A21A 2DI9A 2AV1B 3HI1B 3H42L 3MV9D 4FP8H 5F7HA 4YDLC 5JZ7D 4LSTL 4GFTB 4JO2L 4D0BB 4G6ML 5DFVC 3RGVB 2CQVA 4OZGE 1BF2A 4FFVC 1QO3A 3I6KB 4FQHB 2BFVH 3GHEL 1JGEB 3ETBF 1PEZA 4M6AA 1BFVH 3RWCB 4C83A 3WE6B 2B0SL 2VLRB 3HZMB 3EO1A 4IMKA 2OLDA 4DOHE 4DK3A 1EO8H 4RA0C 3B9DA 5EIVA 3MUZ1 4MA7H 4Y0GA 5I15L 3D1MC 3HS0A 5J1SC 1CI5A 2RR3A 4FQCH 1G7JA 3SJVD 2X4RB 4WO4B 4UZGA 5EG6C 3HI5H 2X4UB 3STZB 1OSZB 2F5BH 2YXMA 1B0GB 4UDUB 5IBLD 1XGQA 4IRSD 5KVFH 4U49A 1RZKL 2YSSB 4GAJL 1MIML 2PR4L 4UI2A 3U46B 2ADGA 2HJFB 3BDYH 4Q97A 1UYWH 3PWPA 3HNTH 3W0WB 4DGIL 2ZWLT 1XGPB 4DZ8A 1BZ7A 1NAMB 4MJIE 4Z9KB 5C08B 1XH3A 2DMCA 1L4IA 5DR5H 3V4PL 1I3GH 3SKNB 3GK8L 4EUPA 1P9MC 2QJDA 3CFBA 4ELKA 5IMKB 4N0UB 1JTOA 3KPRD 5EO1A 2AJYL 2XG4A 3KLHC 4UDTB 4XBPB 3TM6A 3H2WA 4LLUA 3VFVB 1I4FA 2I07A 4S1SL 1T89A 3RUGE 4OKDA 2IG2L 3QG6A 2NXYD 3QCTL 2NNAA 5C0FB 5KAQG 3EYUL 4PJ7A 1TJGH 4F3FA 4NQDE 1S7UB 4P5MA 5J6GB 5IMMB 2CLRA 1FVCB 3VMNA 5BS0B 1E4JA 2NX5D 2IBZY 3O3AB 1MJJB 2ADFH 2BCKB 1KIRA 1LP9E 5EUOB 5HYFA 4LARL 3QP3A 3QH3B 3MO1A 5GGUA 3MRHB 1JPGA 2UWEF 4J3SA 5BOZG 2R2HB 2P24A 1OGTB 4M7LT 4HC1L 5HYJD 1URLA 3EUUA 1T2JA 1XF4B 2GT9A 1FIGL 1I8IA 1AIFB 4X6DE 5C6PB 5GGVY 1ED3A 1AY1H 4ENEC 3MLRH 1QG3A 5LGHH 1F3RB 4QRQB 5JW4R 2EE2A 3FHQA 4KK8C 1FLTX 4YHZH 2HFTA 1NJ9B 3O6MH 4I2XE 2F54D 5I1AA 3OL2A 1HWHB 3R8BB 4JRXA 3S5LB 3PWVA 1R3JB 1EGJA 4ZOCA 1ZT7B 4P46A 1G1YA 1ZSDA 1H0DB 4L3EB 4GG6B 1WIUA 1IBGL 2NY6B 3AB0B 3NFSL 3OKKB 1UJTA 4U6XA 5A2LH 4H5SB 1UVQB 2YD4A 1S7VA 2VN4A 4HUMB 2DLEA 1QSFB 4DAGL 1IC7L 3G08B 2QBWA 4NBZB 2F8XC 2OK0L 1A2YB 3ZE1F 3LKNB 1U93A 3S36L 1JPTL 2ZG1A 3MA9L 3Q6FB 5GJTH 1HSAA 1KN4L 1QFOA 1X7QA 1U6AL 3JTSB 4NSKB 1FNHA 2BSED 5E0QA 3WL9B 1RK0B 4TVPE 4EN3C 3HG1D 3U9UB 3G6JB 5CIPA 1KUMA 3OR6A 1QA9A 5DVOA 1N4XH 1E6OH 3I6LE 4O2CA 3DMMD 3KYKH 3MYJA 4HWBA 3SCMB 4OZHB 4UQ2A 4PTUA 3ZTNH 2JJSA 5EBLB 1S7XA 1EHAA 3E8UL 4MCYB 3CXDH 3BH9A 4JFFB 4F58H 5ILTL 3DLQR 2KKQA 4PJHA 2ZOLB 4G42A 3LPWA 5J89A 2EH8L 3LRHA 2F74A 4YE4H 3UDWC 3KLDA 4L4VB 4R0LC 4YHPA 3O3BA 3P2TA 5DRXA 1NFDF 2OXGA 3LMJH 1U58A 4U1SA 1WIOA 3HLAB 4Y89A 2WAHA 2V2TB 2A0LD 3MJ9A 4FZEL 5C0AE 1DEEB 1V7NH 1ZTXL 1N64H 3MUHL 4LBEB 4K3JL 1H5BA 4DK6A 4IOIA 3MTRA 2J4WL 4HAGA 3GJFH 1XIWA <