5TPWL

Crystal structure of amino terminal domains of the nmda receptor subunit glun1 and glun2a in complex with zinc at the glun2a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
212
structure length
206
Chain Sequence
DIVMTQAPATLSVTPGDRVSLSCRASQSIADYLYWYQQKSHESPRLLLKYASPSRFSGSGSGSDFTLTINSVEPEDVGMYYCQNGHSFPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLAAGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis for Subtype Specificity and High-Affinity Zinc Inhibition in the GluN1-GluN2A NMDA Receptor Amino-Terminal Domain.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Transport protein
molecule keywords NMDA glutamate receptor subunit
total genus 37
structure length 206
sequence length 212
ec nomenclature
pdb deposition date 2016-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5tpwL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5tpwL01
1FL5A 4J3SA 3OKOA 4M1GL 3GSUA 2ICEB 4N5ED 4TSBL 1U8PB 4XX1G 4CKVX 3QPQD 3OAUL 1UB6B 1QKZH 5DMIH 1XZ0B 3QHZH 4OJFL 5DMKB 1N5YL 1IT9H 3AVEA 3GM8A 1LEGA 1MCEA 4ZFZB 5MI0B 3FHAA 5E8OB 3SBWA 4LPVA 1IGJB 2C5DC 3KPNA 3FO9B 4GLRI 2ESVE 3VJ6A 3KS0H 1OP3K 3BZFA 5JHDD 3N1FC 4XAKD 5M95B 4I9WD 1HI6B 3F7RA 3ULSB 2CRMA 1MJ8H 1DP0A 1U8IB 5DQ9B 1O5DT 1X7QB 4HGKC 1CICC 5FUOH 4PJGB 4LIQH 3AB0C 3SKMA 2MOVA 4WTZG 4HHAB 3CSBA 5DJ6B 3EOYG 4U0QB 4LPCA 3QUXD 1ACYL 2OL3A 2VXUH 4AG4L 3B9AA 3K0WA 3PGDA 2RIKA 2HVJB 3MOBL 4PJIB 1U8NA 3GMMB 4LSQH 1PD6A 4JQIL 1SM3H 4YXLH 3DGGA 3T0EE 4KDTA 2CO7B 4WI6A 3LSOA 2Y6SC 5FGRA 1VFBB 4W81A 2AEQL 2ZWLT 4BSWA 5ALBH 1HEZA 2G60L 4YXLL 4KUZH 2XTJD 3HFML 3UCRA 3NN8B 5F9OL 3R1GL 4HBQA 1MRFH 4PS4L 1XCQA 1CD0A 1XCTA 1UB6A 5I1IH 1DVFB 5DRZA 5E8EA 3VD3A 1S78D 1MQKL 3BDYL 4JM2B 5TPWL 2Q86A 4ZG1A 3BPCB 3CX5J 1I7UA 5F9OH 3BN9C 5F1IB 2QEJA 5IFAL 4RMUA 2FIRT 5HHQB 3EOTL 1LE9A 5I1DA 1OAKH 1Z9SA 1A6TA 1OB1A 1FHGA 3VFTB 3C6LB 1MHEB 3UX9B 4ELKB 3BZDA 3WIFB 8CGTA 3VDBA 4GW1B 2NLJA 5IFAH 4OUUB 5T1LB 5I8OH 2BMKB 1DBML 2DJSA 1L0XA 4JZJA 4OF8A 5IM7A 1FNHA 4RDQG 4YBQC 4JZNA 2YK1L 1KIQB 3PF2A 5T1KA 4PJHE 1SBSH 4XC3H 5ITFA 3QJHB 4FTVB 4Y19D 3MNWA 1B6DA 5JLZB 3G5ZA 5E8PB 2CLZB 1XGQA 4G8FB 4Q6IA 1JI2A 2EDKA 2R1WB 1EEZB 1QVOA 3KNBB 1SBSL 4U1MA 2AGJL 4UB0L 3PWNB 3HR5A 3BX7C 1N59B 4WFFE 4EZMA 4EEEA 1P53A 4P2QA 1FORH 4F80A 3ARYA 4Z7OF 1JGVL 1FAIL 3U0TB 1D5IL 1D9KC 1CDGA 2XKUA 3F6LA 4WWID 3SDCB 4KI5C 5C0CE 3D2UB 3QPQC 4WEBL 4CMHB 5GS0D 1X44A 4O4YL 3MV8D 3QWOB 1X5KA 2XTJE 4KJYA 1XCQB 2VWEC 4WENB 1JMXA 1MCBA 2R56H 3HE6B 1OHQA 5B8CB 2C4FU 1YEDB 4PGEB 1S5HB 2WLZA 3HZVA 1TPXB 2EE3A 5CIPB 1OAUL 3WS6C 1V8HA 1Z6JT 3EUUA 4YR6A 1KEGH 3BSZL 4QXUL 5IKCB 3MYJB 5I76A 3SGEI 3RVTC 4X98B 3GMMA 4K8RL 5BXFB 4NQVB 1MCPH 1AI1L 1NCWH 5K9QG 2BCKB 3TPUB 1Q9KB 3TIEB 2EXWD 3DROB 1NC4B 5E9DE 4AZ8A 2B8OT 1P84K 4IRSC 3BKCH 4Q2ZB 2F53A 5HDQH 4ETQB 1CFTA 2VLKB 4UILL 3QH3B 5E5MA 4JKLA 5MEOB 2IQAA 3QUMB 5DJ2A 3QI9A 1ZT1A 3L5WA 5FB8B 3RTQD 1R5IB 4ONFL 3UTQA 1MIEH 3IXTA 3MCLH 2YD4A 1K4CB 4WV1B 1F3DJ 3VXRD 3LS4H 3BZ4A 4XMPL 4ZUWB 1X7QA 5AG8A 1TXKA 4R8WH 3P30L 1JTPA 3MLYH 3KJ6H 5CJ8A 5A2LH 1S78C 4ZYKB 1W72H 1YMHA 4YQXH 4FA8A 3GKWH 2OR9H 3TH4T 3T0EA 5EFIA 5CGMA 2CKBL 5E9DD 4D9RE 4DN4H 4GOSA 2XRAH 1QO3A 3A67H 4RMRA 1NCAL 5C2BH 3VFSA 1LQSR 4PYHA 4AY0A 1FZKB 4RDQF 5C2BL 2OR8A 1BLNB 4LCUA 1CFVH 5EG6C 3WMSA 3K74B 3GUTB 4CDGC 2X89D 4Y2DA 5AYUL 3RIAF 3RTQC 3HLAB 5DD1H 4LDLB 4K9EH 1X5IA 2R23A 4ZOAA 1N6QH 4R26H 1A22B 3BHBA 5FM5M 1TENA 3TP4A 5HDBE 4X6FB 4Y16D 2DJ4A 2ESVA 5ESAA 3HZMB 4NN6C 1GZQB 4TTDD 4HUNB 4GT7A 5DJ2B 3V0WL 4LK4A 4OZIB 3BE1H 2NY1C 1TMCB 3K7UA 3PWJB 2F53B 4X8XA 3BO8B 3D69B 5D7LB 4ONHA 4P59L 1AD9B 3MRQB 3MRRB 4UNTA 5J3HD 5F21B 4OI8A 4RNRB 3LRSB 4LCWD 3G08B 1S7RA 1D7FA 2W60A 4JY5H 4KK9C 4ZO8A 5BVJB 4ZFZA 4CVZB 3QRGH 4JM2D 4ODUB 4LLDA 3D9AH 4C4KO 1YNLH 3HAEA 3P3YA 3WFBL 3OGCB 2PO6D 2CR6A 4PTUA 4L1HA 1ODAA 4HKXA 3GMLA 3OJMB 3O41A 5FO9B 4RQQA 4K9EC 5CHNB 4HUKB 2PW1B 3GMQA 4OKVB 2DI8A 1Z9LA 1XF3B 4JDZA 4HPYL 4Z95L 3QEHB 1FLRH 4DGVH 1V7ML 4NPYA 3H7LA 3UZEA 4MA8H 2AJSL 2FL5B 5LWYH 4NQED 2ZCLL 1JPFA 2JB6B 2BNRD 2ZNXA 3MX0A 2CK0L 2YC1A 1NC2D 2JLLA 3HR5B 2MPAL 3D3VA 1K5NB 1WT5C 4AH2A 3KPMA 4PJAB 1OW0C 3PXJA 2NCMA 4YAQA 2BY0A 1ORSB 5DEFA 5E6IC 1DUZA 2C3GA 5BW7A 1NQBA 1PKQE 1P2CA 5IOPB 4YHYC 4EI5A 2A6JB 4HFUH 4MMXC 3KPRD 2X2YA 5KSBA 3MRHA 3OAZH 3QQNA 3ALWA 4JRYA 3KYNA 4HZLB 1PZ5A 1UJ3C 4IOFC 2IGFH 3TNNB 4HH9B 4I5BB 5CBAB 1FG2A 3SDCC 4HV8B 3QAZC 4UQ3B 5EU6B 1KLUA 1U3HC 1XFPA 4U1IB 4LSSL 3G6DH 5BZWA 3HZMA 1ZANL 1W8NA 1F3RB 2VH5L 5EZLA 3VRJA 2VOTA 4WRLA 1W0WA 1BREA 4G6FD 1CQYA 1XF3A 4XNXL 2GT9B 4S0SD 3OG4B 4XCEA 3QDHA 1ZWIB 2YPKB 3CK0H 4AMKH 5FAAA 3O41B 4UV7L 5SWSE 2DQEH 3QEUB 4FQCH 2DM4A 1KB5L 3VG9C 4HK0B 3DRQA 3I50L 4KPHH 5C07E 3FRPA 3WSQL 4JGMA 1U8MA 4I4WA 5C0GB 5HI4D 5BO1L 1NAMA 2HMID 1PKQB 2HFTA 1YPZA 3ZYOA 3QXDA 4HEPG 5FA4B 3GSVB 3OKDA 3T2NH 2IJ0C 4CU6A 4XPBH 1T7ZA 2W0KA 1NSNL 5J3HC 3VGHA 1UC6A 4PG9B 1J8HD 1BFSA 5DD5H 1XEDA 1VFAB 1JUFA 5HJ3A 3GMQB 3SDYH 5C0EA 5M7QA 2DICA 2FLRT 3D0VB 4P5KB 4YBHA 1F8TL 4JM2C 3QXDB 1S7WA 4YHZL 4ZFGH 1J86A 3T2PA 4OT1H 4PLNC 1BF2A 3A6BL 1EJOH 5TDNB 3U48A 4Q9RH 3QJFA 1DFBL 2DI7A 1BEYL 5F7DB 4JKPH 4W4OC 4NM4L 4KKAD 2XFXA 1UZ6E 4LSRH 1U6AL 3MACL 4PBWD 2DL9A 1OTUC 4X0KB 1L4IA 3LQMA 2I5YL 3ZDZF 1UWGH 2DM2A 3U9UA 2PNDA 1W0WB 3BAEH 5D7JB 3BMWA 3NFNB 1VHPA 4NM8L 3UTZA 1TETL 5D1XA 5D72L 1KXVC 4XBEL 4DGYL 5EU4A 3UP1A 1SYVB 5MEND 2H41A 1X9QA 1S3KL 4BK4A 5IIEB 4Z18A 1P84J 5IW1A 1HCVA 2WIMA 5I1DB 2CRZA 2Q6WA 1NMAH 3U6RA 1MFEH 1OSZA 1JJUA 2J88L 4P23D 2NR6C 3GSNA 4RAHA 4WJ5A 1CE1L 4LASL 1NMAL 1GZPA 1MCWW 3LQZB 1IGFL 4G5ZH 3TPKA 3BT2H 4X83A 3V4UL 4O00A 3MXWH 3MYZA 1K8IB 2HT3C 43CAA 3DUHA 2LU7A 4X5WA 1PZUB 2XTLA 5EOCL 1U42A 3OAUH 4XMKH 2VDPL 3EKCA 2CLRB 5ICXB 4HJ0D 4WDIA 5CMAB 4NWTL 4KHXH 3T65A 3Q6GL 5KTEL 4MAUH 5D71H 3VI4E 5GGRA 4G7VL 1HH9A 3T4AB 5IG7B 5I1JL 1CICA 2N56A 4NNPH 4MXVE 4KHXL 4ELMA 3C9NA 4RFEA 5JPMB 3VFMB 2EEAA 4IDJH 1N2RB 2DB8A 3BDBA 3O11A 5FUZL 4QRRA 1GH7A 3S35H 4QTIH 2NY0B 3S37X 4NPYB 1JYWA 3NIDE 3QNXB 1ZHNB 4LCCA 1YMMD 4OM0H 3MV8A 4GG8B 2B1AL 3O6FB 4IRJB 1MY7A 5D4QA 2C9AA 4NZRL 1J0KA 5DD6A 1HKLH 1ACYH 3ES6B 3V52H 25C8L 4IHOA 2CJUH 3EO0B 4ENEC 3RJDA 5D93B 1C1EH 3ECBA 2DQFB 2FATL 2R0KL 5KW9L 4OZ4B 25C8H 4Y0GA 1MCOH 3ARBA 4B41A 4S1RH 3OHXA 4Z0BL 5EU5A 4NCC1 4GFTB 1HNFA 4NHUB 3EYUH 4K8RC 2ZUWA 3I3EA 4M62L 4IOIA 4NQDA 1ND0B 2BNUB 3OKOB 3QCUH 3CVHL 4K3JL 4QO1A 5IB2B 1UGNA 3OGOE 4KKLD 1ZEAL 5I1IL 2NMSA 3EYUL 4QXGL 4WTXA 1CFBA 5CUSH 3KPSE 3S35X 3HPLA 4OD1L 4XPTH 1NGYA 1T22A 1FRGL 2AXFB 2EE2A 3GRWH 4G6JL 5LKNA 4CADB 2JCCB 3FJTA 5BMFL 4LCWB 3T0XA 3MXVL 2PYEE 3FQNB 1EGJL 2JCCF 1M05A 4K2UL 4MVBC 3FOLB 4WFHD 4RWYH 3DVNB 1E27B 4X7EC 3B83A 1I8MA 1QNZH 5IB4B 1FFPB 4N0CD 5E2UL 4IRSB 4X4XB 4JE4B 5HVHB 1RZ8B 2RB8A 3ABZA 3C9NB 5IBLC 3QQ3B 4ODVH 1ZVSA 4JFDD 4FQLL 4K23H 4U49A 4MQXC 1QD0A 3FB5B 4ORGB 4KRPC 1RZGA 35C8H 3QDMB 4GSDH 1NANH 1RAMA 4O5LH 5DRNB 1HQRB 2YRLA 3PJSB 1A9EB 5GRJH 2QL1A 2FD6L 1DQQB 2R2HA 2FSEB 2R56L 4P2RE 2A83A 1F4WL 3MCKA 3NCMA 5JW5B 5KS9E 1GRWA 4OCNC 2D0GA 2XPGB 4OZFB 3V6FB 2OTWA 1F4YL 4GG6B 4HZLA 2OZ4H 2XQYG 3ZE1E 3MRKB 4OIIH 3DYMA 3QFDA 1S7WB 5JQ6L 3ZYIA 1KG0A 5H2BA 4JY4B 4TNWF 1A9EA 4DWHA 5JA9A 1MCPL 3IU4L 1OGTB 4JJ5B 2ESVD 1ZOXA 4UDTA 2QSCL 4Q2ZA 4HUWA 4NN7C 5IMLA 4PGDA 4XVSH 3HPJA 5EU3A 4W70A 2RQ8A 5TFSL 5GJSH 2VLKE 3Q5YA 2OZ4A 3HLAA 1EPFA 4BQ9A 3PG2A 4M1DH 1FE8L 1YY8A 2VLRE 1A1MA 4LOUC 5FV2A 1YJDH 3KYAA 5C0RH 2X4SA 3L3IA 1PAMA 1OSPH 2VR5A 2H8PA 1ZHKB 1CLYH 3V5HB 1WISA 3DRTB 3SDXE 2MJWA 1DLHA 3TBSA 2J8OA 5FCUL 2FYYA 1BZQK 2GSIA 3LOWA 5DD0L 3M8OH 1YEFH 2V5SA 4HIEB 5FM8A 1B88A 3SJVB 2JB5H 4QRPA 3QISA 1FYHB 1LD9A 2DDQH 3FN0L 3SQBA 3L6FB 3G9AB 5B3JF 1W72B 3DIFA 2OR9L 1E28A 4MWFA 3U36A 1UZ8A 3MCLL 5CJQH 2VABA 1IC4L 2YUXA 1NLDH 5C09E 3SJVE 4TPRL 5CJOH 3IFPA 3QB7C 2IPKB 3G5XA 4D9QE 3T09A 4F37K 4R96B 1R5WB 1WWAX 3F8UB 1SY6A 3KYMA 4N8VG 4HC1H 2OSLB 4WFGD 2MCPH 2ZSVA 5K9KB 3ZTJG 3D3VB 4RBPH 1OAZL 1Q1JH 2P42B 2BNRA 2J8UE 1J8HB 1KIUA 1QPPA 1UWXH 3P0VL 4NZJA 4HWZB 3HI1B 4IHOB 4YAQB 5C6TL 5I73C 2J1KA 5FUCC 5CEZD 1GZQA 3P0VH 4FQQA 4OZFH 4P5MB 4M48H 1T21A 5J6HA 15C8L 5ESAB 2WZPD 1MCLA 3P9LA 5TQ0L 3TJEL 2P8LA 5IQ7H 4O2EB 4BQCA 1SYVA 4FQIH 4D9LL 1ZAGA 1DVFD 3IDXH 4LPXA 5B3NA 5I6XC 3R06B 4Y5VA 1JIBA 5B38B 4P59H 1ZA3A 2YUZA 3GHEH 4CW1B 2IQ9H 3DV6A 1F4XH 2CQVA 1IGYA 1LNUB 5F72S 1P4BL 4HS6A 4K71B 4K3GA 4UQ3A 4RGOH 4O02H 1KBGH 2XIDA 5DA0B 3I75A 4AIZA 4H25B 1NGYB 1ZLWK 3UROR 4Y1AB 2CGRL 3VXSD 4KZEH 5HHMB 5JIIA 2ARJB 1P7HL 3D9AL 4NT6A 1JI1A 2RJMA 5ANME 5MI0C 5ISZE 1FIGH 1XZ0A 1WWBX 4MCYB 4L4JA 2BNUA 3JXAA 4YDIH 1G7JB 3QCTL 2ID5A 4Y19B 1H8NA 1JF1A 4OGXL 1G9NH 2YD3A 4RMTA 1FIGL 4KMTH 5AZ2H 1KYOK 4NBZB 3LRSA 1HWHB 1TZHA 1N5AA 5TQ2L 4AEHH 2IFFH 4GMSH 2VLLB 3HC4L 5DYOB 1NDGB 4AENB 4X5XB 3RDTC 4PJ7F 4OLWH 3L3GB 4U7MA 4IJ3B 3M1BB 5JOPE 3LN9A 5TF0A 3GIVB 1Q9WB 1B2WH 2OX5A 4WVRA 3CUPB 2FECL 3RY5A 3AAZA 2G5RA 3BD4A 1AFVL 4OAWB 2FHCA 1WC7B 4K94L 1T4KA 5E56A 1GPOH 5FOBA 3BGFB 1YN6B 4U6HB 4PJXB 4KUZL 2ZG2A 4GKZA 3G04B 3E8UH 4I3RL 4MA8L 1TVDA 4EDXB 2E8ZA 3CC5A 4MA3B 4Z76A 2IPKA 1JZ6A 1W2KT 3MBED 3IDNB 5HI3C 4YHYB 4Y1AE 1RMFH 3L9RB 3S4SB 1V3MA 4ZS6D 3AUVA 5TE7H 1A3QA 2AJZB 2R4SH 3GHBH 1HYSD 1C5CH 2ARJA 5FYLH 4PJ7E 3TCXA 2QADD 4HH9A 3JVGC 2ZUQB 3L7FB 1KLGA 2P8PB 3FZUC 4MA7L 4HFUL 1I8KB 4XXCA 1FYTE 1MCIA 3RL1B 3NACH 1XGPA 4U05A 2JJTC 5EWIL 5EN2A 1XT5A 3QZWG 3GSRB 5HHNA 5A16A 1S7RB 5IQ9A 2B20A 5JMOC 3N85H 2EZ0C 5GS0L 1FFOB 5DQDL 3MLVL 1MCFA 2CR3A 3QIUA 1R24A 2HJFA 4YZFE 5DK0B 3GMOB 3IXTB 4KROD 5FHAL 3FFCB 2AJUL 3D39B 5IVZB 5B39B 3VXTA 4GO6B 1BM3L 4N5EC 1WTLA 4PJFA 1QSEE 5EU4B 2YA2A 3C8HA 3ZL4L 3RVXD 2PCPA 2C1OA 5I1CL 4PV8B 1SY6L 5IP4A 1S7QA 4AMKL 2DQCL 4HJGA 1ZHBB 3E0GA 3QUZB 4JFPB 2C1PA 2HFGH 1SY6H 1CDYA 3KR3L 4NJ9H 1ZT7A 4U6TA 5T3XH 1L7IH 1MCCA 2DQHL 3NABL 4AL8H 3BN3B 3VA2C 5JW4N 2GTZA 4OF7A 4NJ9L 4OD3H 4GXVL 3W0WA 4TUJB 3CXHJ 4TSAH 1CD8A 3S4SG 3CFDA 1CWVA 4CU8A 1AE6H 3QCVL 4Y4FA 3MRFB 5DHXB 1P2CB 5D5MA 1F6AA 1CFNA 2NW3A 3P73B 5CEYB 3VGFA 2AQ3A 3IKCA 1CDUA 2DMCA 2AJYL 3TC9A 2UVEA 4JO1H 4ODSL 2DQFA 4ZFOL 1MFBL 4BJLA 1BOGB 4LLAA 2AJYH 4K71C 2UUDK 1JGEA 4PJ8C 5I74C 3RWFA 3WV0A 5DJAA 4YJZL 2PW2A 1KCVL 4I8DA 3KDMA 4HCRL 1IEHA 2VTFA 2C4XA 3VFVA 1YUHA 3FT3B 3UZVB 4Z5RA 1EUTA 5I1AB 1LO5A 5T3ZH 3L7FA 1VSCA 2YN5A 3ARED 2BMKA 1EO8L 5DUML 5EU5B 2IBGA 4B53A 4Z7WB 5SX4H 2QV2A 3ROOA 4LQ1A 4NQCA 2OQJB 1EO8H 2C4FT 1OGAA 1R6VA 5DHVH 3RFZC 3EYVA 2EDHA 3EDKA 4M3KB 5DC0A 4JFHD 1J1PH 3DPBA 4GKNB 2XQYK 3P4MB 4WFFD 3GI9L 2VDRL 4OD2B 1TTGA 1EHLL 4HWEH 2C1OB 1WWCA 3DJ9A 3PE9A 1Y18A 5F7LB 3DURB 4XPAL 2EE6A 3DSFL 2OI9C 3MRBA 3QWRD 4F7PA 3CH8A 3MRKA 1ZLVH 1MWAH 3L3GA 3GFUA 3QDGE 4LKCA 1MJ8L 4JB9L 4LEXL 2FO4A 5FUOL 3WIHL 1PX3A 3SO3C 4ZAKA 1MHCA 1U8NB 4PG2A 4JO4H 2BVOA 2YR3A 3AM8C 3GJFA 3B9KC 3KWWB 3OX8A 3ORJA 4MXWH 5K59E 2D7TH 1C5BH 1G7MA 1JGDA 5HHOB 4PJ5D 4UT6H 2CLVA 3G5YB 5D8JL 3S35L 4PRBB 4DZBB 1Y0LB 2AQ1A 3JV4B 4KGLA 1NCDL 3R1GH 2EIZB 2X4NA 5A3ID 4OZHA 4DCQA 3P4NB 4O2CA 4Z7VF 3KYOA 4H8WL 1U58B 1MCNA 4QOKE 4UNUA 1KENH 3I6LE 4PRNA 4KJPD 3X12B 1A6TB 1NL0L 3BFOA 3CH1A 3EOTH 1IC1A 3LKQB 4TRPH 2YXMA 4LF3A 4GRWH 1RUQH 2AKRB 2D31B 4K7PX 4C4KT 4P23A 5TPWH 3OZ9H 3O3DA 4TNVF 4WY7L 2XY2A 4BYHA 2FYYB 3MFFB 4RWYL 4Y1AD 1YUHB 3FT3A 4F7TA 5DJ0A 2PXYB 2NY4D 3B9KD 1ZLVK 4EN3A 2C1PB 3GBML 1XH3B 1AGEA 1P4LB 2NYYC 1SEBB 3ROLB 3L5XH 4G6JH 3QUZC 4IIQC 5E1HB 4NJAH 1CD1A 5DA4A 4O51A 3GBMH 5JHLH 3FTGB 3D48R 4YXHH 2YPVH 4XWOD 1JPTH 3RNQB 5LXGL 3INUL 1R5WA 4L8CB 4H88L 4JPVH 2JB6A 2VZSA 1J1OH 3FKUS 3LB6C 1U8HB 3O45A 4WEBH 5D9SB 2F19H 2VXTL 2CD0A 3MGAA 1F4WH 3WJLA 4P3CH 1FORL 2MHAA 2W0PA 4RGMC 4UT9H 1YMMA 1ZT4A 1PYWA 4WEMB 1RJYB 2A6DA 2F54B 2NR6D 4JQXA 3H2WA 2MFNA 5SV4A 3V0VB 4HT1H 2ICWB 5J12B 1TZGL 1MUJB 4Q9QL 3PIQB 1GC1L 5GXBB 1PVHA 1CFSA 3TYGL 1B4RA 3CH1B 3BZ4B 1JNHA 2P5WD 4RRPA 2AV7B 2ADJB 3TM6A 3NCEB 4K3EL 4KI5E 3VRLF 4CNIB 1UEYA 2A9NH 2P5EA 3QQ4B 1ZA6A 2A6IA 5EULV 3WEXB 4PJ8B 5I74B 1KEGL 1RI8A 2HRPH 2J2ZA 2Q8AH 3VXTB 1ZT1B 5F7FA 3X14B 2LVCA 1KB9K 3V4VH 4MNGB 2FZ3B 4HUMB 1P7QB 4LSPH 4X6DB 3D87B 3VXSA 4NDMB 3AFLA 3A6OA 4NP4L 2BDNL 3O6FC 5ID1A 5JORB 4QF1A 4YZFF 3VFWB 1IGIH 4C56E 1YJDL 3TN0A 1ZHLB 4RZCB 3LN4B 1YZZA 3HA0A 4XBGB 3SDDC 3RIAK 2NX5D 3AMLA 4OF6A 5CSGA 5BJTA 3VD7A 3P77A 2NX5E 3TBWA 3UTTA 2YZ8A 4ONFH 1REIA 2B39A 1YEFL 3L3JA 3C60D 3ET9F 1MREH 1JPST 43C9A 1YEIH 3Q3GA 3CMOL 4NM4H 1G6RH 1HZHH 5DT1H 3UJJL 5CJXA 3K4ZA 3JV5A 3IDNA 3SCMA 3NCYP 1DN2A 1DQQA 2R2HB 1A6VH 1YEIL 2V2WB 1YMMB 1XF5B 2YC1B 3QFJA 4YQXL 1FGVL 2ZG1A 2FR4B 4F33A 4MX7B 4GKZB 5T5NF 3ILQD 1IAKA 2OP4L 4Y4KA 3QWRA 5DD1L 1FNAA 4OCWL 2B4CH 1KTLA 3S98A 4LHJB 3QUXA 4KVCH 4HBCL 3EDFA 4XGZB 1YDPA 5IHZB 3O9WC 3PP3K 5C0FB 5C92A 3DO3A 2N4IA 1Z0MA 3NIFE 3K2UH 4PJ5A 3TO4A 2WQRA 5F89A 2W9EH 3B5TA 4M48L 5HY9B 3KJ4B 5HYJE 1V3KA 3W82A 5CD5C 3MPCA 4TSBH 3RPKA 3VFWA 2Q1EA 3ULUD 2IANB 3EDDA 4HGWA 2CGRH 1QKZL 2XKSA 4ODHH 3SQOH 2V5TA 1CDCA 4KRLB 2Q87A 3BKJL 4N0CC 5L88H 1NBZB 4R4ND 4QYOB 3H9YA 1KC5L 4JKKA 4NRYA 5E5UB 4WO4C 4N9GA 1WUNT 1U8OB 4ZSOA 3OR6B 2P24B 1BZ9B 4BSVA 4AEHL 3P9MA 4PJAA 5F88B 3VWJD 2C7UA 4WEUD 3FOMA 4R97B 2F5BL 5GSRB 3QQ3A 3Q2CA 5E03A 2P7TB 3VI4F 3J8F7 2ENYA 4WCYL 4PUBL 5GJTL 3VFGH 4L8DB 4WW1B 2Z8RA 2MSPA 4LSQL 4WCYH 2FX8H 4HS3B 4MD5A 5D7IA 3QDMD 5E8DH 4IRZH 3QO0B 3U1SH 5D7KE 4QHLA 1Q9OA 1AJ7L 2AK4D 3GBNH 3V5DA 4UBDD 3O6FD 1NGPH 5HHVH 3W0WD 1ORSA 3B2UC 3AU1A 1I7TA 4L3AA 1BJ1H 4V1DB 3UBXI 2WWKT 3MO1A 4L8SB 4WW2A 2BRRL 2J8UF 5LAXB 1YDPB 2HTKD 4LFHG 1ZV5A 1D6VL 1NC4D 3IKCB 3JTSA 4PRIA 3IU3B 1RJLA 3THMH 1CR9H 3PGFH 3IFLL 3RUGA 2HTLC 1MCQA 1RUPL 3STZB 4NO2B 5BRZE 5IM7B 1RMFL 4GS7C 4WI8A 3GZKA 5GGSA 4ZQKB 3U46B 3THML 1RZKL 2YPLD 1VFUA 3ULVL 1JHKL 2X4RA 4LNRB 5GS0H 1GGIH 5B3JE 4XP5H 1S9YA 4Y2OA 3LV3B 1XIWC 1TCRB 2P5WA 4L9LC 4JHWH 1JRHI 2ICEA 5HVFB 3NACL 4Z8FH 4NO2A 4GMTL 4UBDC 4BZ2H 3CK0L 3AS1A 3MRDB 5IMOB 4DW2L 5ENWA 5DJ8B 3DRQB 3LEVH 1KTDA 4FP8L 4XBGA 3QEQE 3GNML 4YO0B 5SWZE 4NNYB 4F15B 2F9BT 5DS8B 1BWMA 4UV4H 3K8LA 1S7TA 5IB4A 2FCBA 1Q94A 4U1JA 4BFIA 3N1PC 1U95B 5ID1B 1YYLH 1T89C 2FLBT 4CMMB 5BQ7B 4WDIB 4ZSOB 4FQXB 4QNPF 4APQA 2SEBB 5B8CA 1I7ZA 3VXRA 5GZND 1MLCB 4A2MA 5D6CB 5I66A 5C07B 5HJ3B 5GRUH 2R1YB 4XBPA 5EC2A 3B9EA 1RV6X 3SN6N 1P5UA 1BD2E 4HZAA 1FPTL 3O3UN 1NUGA 2BHUA 4OLVL 4W4NA 4WUUA 4WI9A 1HXYA 2DQHH 1MHHB 4LLQA 5TJWK 1CT8A 1QZ1A 4F9PA 5CP7A 1OL0A 1MUJA 2DTMH 2OBGA 3SDYL 3BXNB 2DLFL 2FRGP 5CLTA 5AUMA 4XBPB 4Y19E 4F57H 3SE3A 1F8TH 3BYYA 3VH8A 4Z77B 3VXQB 4F33B 5CZXC 3C6SB 2VR4A 2YD5A 3F62A 3RX8A 1PX4A 3HZKB 7FABH 4FFWD 4FFZH 4N0UE 3DETC 4YNYA 3P4NA 4WUKH 3MLSH 4G42B 4XNYH 3VXPB 1ED3B 3MJ6A 4KQ3H 2DBJA 4TTGA 4PRDA 1A21A 3MV9B 1H15A 4MJIE 1Q9KA 3O4LE 5FCUH 5EIIB 1JGLH 3C5JA 4ZFFA 5JIKA 3RVUC 1MFBH 1KPUB 3HC0B 2ICWI 3HUJA 4HV8A 4LDOB 4NN7B 4OFDA 3WL9B 2YRZA 4ALAL 1JPSH 4X99B 2DBLH 2I27N 5BRZB 3HMWL 1TETH 3BWUC 4XX1E 1KCVH 1CE1H 4LLVA 5H94A 1T3FA 4OJFH 1J18A 1BQUA 1IC4H 4JDVA 4LCWA 3N9GL 4J1UB 3EBAA 3CFIC 3ZHLA 2NY2C 3D1MC 2FECI 5FF6B 2RFXB 2VQTA 5E94A 1QBBA 2Z35B 4OD2A 4EN3D 1SJHB 3RIFK 2XN9A 3N9GH 1CVRA 1CZ8H 1LK2B 3RWCB 3UTOA 3DV4A 1U2CA 4MLIA 4R4BA 3CX2A 5CP3A 3VW3H 4DKFH 1PGRB 3B6SB 2Y36H 1IC5H 1W0VB 1XIWD 5JOEA 5KSAC 3I6GA 1MFNA 1CIUA 5TDPB 2FL5A 1N7MH 3PWNA 4M7KL 3RWEB 5FYJU 4J3XA 5F3HA 1UXWB 4KTYA 1IC5L 1J88A 3WHE1 1MFCH 3IAPA 5IQ7L 4E5XA 2OL3L 5KVDH 2DMBA 4QRRB 1MPAH 3KS0J 2FX9H 4RRPG 2AK1L 4M8QB 5L8LB 2LV4A 1IAOA 1HSAA 3BIKB 2VLRD 3X17A 1CK0L 3BE1L 3P0YL 4KKNA 3MC0A 3I2CH 1GIGL 5EIIA 3UTSE 1C16B 1N3NA 1MPAL 2MTPA 5GZOC 1HHJA 3WUWB 3ULUF 1Y6NR 5MEOA 1NAKL 1IAIH 4JLRA 5EZIL 4OM0L 2KBGA 4RIRA 3J7HA 1CF8H 4YGVB 1FFQA 5JW3H 3TIEA 5EU3B 3VH8B 4K7PH 4PJHF 3GSXB 3S37L 5HGAB 2RFXA 3IDYB 1CFQA 1M7IA 2JJSC 4KROB 1N64H 4MB5A 4QRSB 4OGAD 3MRGA 1U92A 3ZKQD 2HFFB 5I8KH 2EKJA 3PWLB 5TQ2H 4BQBA 2PYEB 4HLZH 4OZHB 2ED9A 4HIIA 3BEWA 5FEBA 1HQ4B 1EAPA 1RUQL 1A7NL 3PP3H 4HUUA 2VNCA 4JFFB 4X80L 1FH5L 2AI0H 1QNZL 1TCMA 3PWPE 4GBXC 1ZT7B 4KKCC 1NAMB 3QEGL 3VGAC 1NGZA 2AJ3A 3OXRA 4UT7H 4E42B 4LAQH 4IJ3C 4U4BA 1LO0L 1I75A 3SGKC 2BERA 3O45B 1FVDB 2Q7NA 3VG9B 3MOQA 4EIGB 4GSDL 4F37F 2ICWJ 3G6JE 1KJ2B 4XPHH 2NTFB 3T0EB 3JWOC 1VADB 1FZKA 5D7JD 3ARGA 4E42A 3GHBL 4GG6E 1U3JA 3W2DH 2XTJB 1HXMB 1J8HA 3I02B 1YY8B 3B6SA 3VU2A 2DI9A 1DN0A 3QULB 1I1RA 4OLEA 2GJZB 4ACPA 3DXAD 1U36A 1A3RL 2V2TA 5GRWA 4LLYA 4S1DC 1WCQA 4YFLI 4XP6H 4HMEA 4LBEA 3QDME 1NUFA 2UWEE 4UINH 2H2SD 4ENED 2D4FA 1OB1B 4LGSB 4R97C 3VFTA 5TDOA 3O8XC 1E4XI 4JO3L 1P5VA 4TQEH 2OYPA 2HLFD 2VZ1A 3LEXA 4P9HC 3MJ7B 1W72A 3DIFB 4PB0L 5I6XB 3JWDC 2BVEA 4PRAB 3K3QA 3O81A 1AGFA 1BBJA 1OARH 3GSOB 5CZVL 4WO4B 1DL7H 3S36X 5ADOH 3SY0B 1WCBB 4L5FL 4QWWC 4OQTA 1UCTA 2OJZH 5D7JC 5IB3A 4XVSL 3E6FA 3G6JF 4Z7WA 1Q94B 1QRNE 5H37H 3WD5L 1XH3A 3JV6A 3QWQB 2DQDH 4OZGE 5T1LA 3BPOC 1R3HB 3DSNA 4KQ4L 4UU9B 5H35A 4KAQH 3RJQB 4QHNA 3E3QC 1FP5A 3LRGA 1F42A 5FYKL 3VI3E 3OKYA 1T21B 2HH0L 5J6HB 1BF8A 43C9B 4YWGL 1XF1A 3U7AA 1P1ZB 5IBLD 4LLQB 4UTAL 4RFOH 1U8IA 1BEYH 2J5LB 1LO3L 2MCPL 3RWHA 5DMGC 5IUSA 2IBZY 5CJXC 1I8IB 5I16B 5JHDE 4N5UA 1LO2H 2AK4A 2I07A 4UDUB 3MRQA 4KDWA 3RUGB 3S8WA 2ZOLA 1CTOA 1Z9OA 2CDFA 3KG5A 15C8H 4JRWA 2LU3A 1F2XK 1FJ1B 2KUTA 4PRHB 5M94B 3EYQD 3GI8H 3NA9H 1NC4A 4DJMA 3TT3L 2YD6A 4PFEA 4QRRD 5D7IB 5HY9A 5BS0B 2ZJSL 2CUMA 3IDJB 3TO4B 3DOSA 3O9WA 1HSAB 3BIKA 2EDRA 2O93L 4OKDA 2AV7A 3ULUE 4I77L 3STBA 1E4KA 3Q0HA 4EUPA 5J13B 1WBYB 5B39G 2VDMH 1A6WL 2BX5A 4U1SA 2EDTA 4MCZA 1I1AD 1T5XA 2AXGA 1X5GA 2B4CC 5DMIL 2P5ED 2Q86B 2Y4SA 1D5MA 5I0ZA 4KHTL 5LBSL 2V5MA 32C2B 4OCXH 5DJXA 2PXYD 2ARJQ 4NQDD 4R7DA 1MCSA 4KK5D 3CPLB 1T1WA 1G9NL 1RU9L 3BUTA 4KROC 2W0FB 4G7VH 1S7SB 4HJGB 3PGCA 4Y5XA 4ZTPH 1EFXA 3QP3A 3QIWC 3ILPB 1D6EB 3P0GB 4UUJA 5GGUA 2E6PA 3L3OA 3RNQA 5CEZH 4RFNC 4IDJL 5F7UA 5FUCE 4ZTPL 1WV7T 2R29L 4CVXA 4PREB 2R1WA 4OGXH 5HVHC 5LQBL 2DLTA 5ETUB 1P4IL 3G5VA 5HDBF 4HX1B 4I48B 4OBRA 1NBYA 4WFGE 1S9WB 3UYOD 1PG7X 5JDSB 1G6RB 5GRYA 3K8KA 2CJUL 3ULSA 2ZUVA 1JWMB 3RKDC 3GSRA 1BD2B 5HHNB 4OV5A 2Z31C 3L3HB 1B4JH 1T1XB 2GW5A 3GKZA 3LKNA 4YPJA 2W1NA 2IH1B 4JQVA 1S9XB 4PJGA 1KIRB 3B3IB 3OBAA 5ILTH 3ARZA 1ITCA 4KY1L 4K94H 5GGVH 4TULL 1CXHA 1MAJA 4DKDC 2B0SL 4S0TD 5F7DA 5CCKH 4X6CA 2WP3O 3PWVA 1F6LL 2W65B 3CVHH 1DQTA 4EOWH 4NCDA 1JHKH 2YPLE 5IBTH 2AJXL 1MRCH 3O2DL 3DTXA 2AJVL 1TQCB 1ORQB 1J05A 1I9RH 4PRHE 1WF5A 1A7OH 5TE7L 3LKSA 4JHWL 1VPOH 1K4CA 4L4VA 4M7JL 2Y7QB 2DQIL 4PJ8D 4JY6A 5I8CA 3EYOA 5H37G 3UEZA 1MHPL 2EKSB 1ES0B 4L9LA 1U3HA 5EBMA 4NYLA 4EUPB 5IEHA 3BRFA 4HKBB 1VFAA 3T08A 3PGCB 4Y5XB 4YXHL 1GXEA 2Y72A 3LN4A 2VXSL 4BFIB 1YQ2A 4GMTH 1RZJL 4BZ2L 3NCJH 5D70L 1LE5A 4MJ4A 4OFYD 5HGBB 5BO1H 3IS0X 3UPCA 3HKFA 32C2A 5F93C 35C8L 3RI5K 1NEZB 1BLNA 3LKNB 3D39E 1FNEB 1YN7A 3LEYL 5IVXA 2W0FA 1DQDH 4HS3A 2JE8A 4MD5B 2E9JA 1R5VB 2Y25A 3BDXA 3O6MH 4AM0A 5I16A 2WSKA 3EZJB 1QLEL 1CBVL 4P46A 3RP1A 3SO3B 1QO3B 3LEYH 4NNXB 5HD8C 4QRTA 3TH2T 3FL7A 4U6VL 2BC4A 4YR6B 3KPRB 4PJDF 3CXDL 3EOBB 4Q58C 4OLXL 1CYGA 4KK5C 3SKJL 5IBUB 3KYNB 4AL8L 3TBYA 2F54D 5MENE 1H3WM 4KJQD 4F3FB 1FNGA 4MSWA 4R7NB 1QSEB 1ZS8A 1N0LA 2J3SA 1GOGA 2EH8H 3QIWD 3SE3C 4OCSL 1I3GH 4JAMA 5IROC 5E2WH 3FFCE 3MOAH 1L9MA 5GGSB 3HZYB 2IG2H 1CTNA 1KGCE 4R0LA 1IGTB 4MB3A 3SGDH 3HAEH 2WBJC 3KYKL 1OT1A 2KPNA 1DSFL 2OM5A 5JOPD 3UXFA 1JGEB 2O5ZH 3DX7A 4XC1L 5AZEH 1DBAL 5DMYA 4YHKH 1P9MC 2R4RH 4GRWB 4MNHB 3CU7A 2P44B 1AGBA 1G7PB 1GL4B 1HHJB 3M8OL 4XC1H 1T0NB 3PNWA 5AZEL 4G8FA 4HEME 5C6WH 3VCLB 2JJVA 3WDIA 5FKPA 4U1KA 1PG7W 4KFZC 1J9CT 4X7FC 2AABL 2EC9U 3PQYD 4ODXB 4NOBA 4XB8A 3AB0B 4HF5L 5CGYC 3D39D 3U7YH 1DQML 1T04B 1IGCH 4DOHB 2PXYA 1X5LA 3O8XB 2AABH 1NBVH 4OCRH 4P2RD 2JCCA 4XI5D 3MV9E 3IRPX 4D3CL 1NBVL 3V0AC 4MD4A 4HS8H 3HNSH 2A0LC 2DAVA 2WBJD 3QUZD 2VIRA 4HIIB 1T2QH 3D2UA 4YHLH 1JF5A 3CDGB 1ACZA 4NQUA 3AXLA 4OZGF 1SJXA 4I0PC 3OKLA 4J4PD 4Z9KB 1BAFH 3VFPB 4JB9H 3B43A 3TFKD 3WE6A 3TJHD 4BK5A 3DV4B 1H5BC 1GIGH 2OLDA 5HYEA 4DOHE 3DUUA 5MP6L 3QZWB 3JWDL 5HYQB 3GMNB 2Y5EA 3V0WH 1JZ2A 1G7MB 4CU7A 3BKYH 5JDSA 2FSEA 4LCCC 2OL3H 5KVDL 2HVJA 4M1CD 4N1EA 1QFWI 4MLSA 1ONQB 1C1EL 2DWEB 5J9PA 1KCRH 4PD4J 3BQUC 3KPSB 1H15B 2BNQA 1WBZA 1IGMH 2GJ6E 3OXSA 2UWEF 3BUYA 4XPFL 1NL0H 3HUJB 4MA1C 4KK8C 1BQSA 5CAYB 2ZOKB 2YMXL 2DS4A 1KOAA 4X6EB 5TF1L 4JCLA 4KXZI 1TVBA 1YEHH 4XVJL 1J5OL 2VO5A 3WXWH 4GRLA 3HMXH 5L8KB 5IMLB 1NPUA 3MMEB 2JJSA 1GVIA 3L3DA 3CFEA 2VDKH 3MV7E 2XWTB 4GG6F 3PV7A 1F13A 1X5XA 2D03H 3QUYA 4X80H 5J12C 5IMKA 4Z7VB 4MJ6A 4RNRA 4HIEA 3MLZL 1I1YA 1SQ2N 1CU4H 3HPLB 3GSQB 1IM3A 3HMXA 4PP2A 1V7MH 1I4FB 3DGCR 1LO0H 4QLRA 3ARTA 5LWYL 1IAMA 2D4DA 3FONB 3U0TA 3X13A 2XT1B 3HCVA 3H3PH 1B0WA 4KVNL 5I18H 4EUPH 1WQVT 1RIUL 3I9GH 4NBYB 5LXGH 1KEMH 3SO5A 3RQ3A 3TWCH 4JGJA 1VDGA 4FG6C 5T5FL 4ESKA 2WWMD 3LN5A 12E8H 2X10A 1H3GA 3VWKB 3ZYJA 2MKLC 3BGFC 3HI6L 3SPVB 3LAFA 2LU4A 1DBKL 4OGZA 2DN7A 5DJYB 1QQDA 4NKIH 1BHGA 5IJVB 3HI6H 4OI9A 2BRQA 2WINB 3HZYA 3ULVH 3HB3C 3QNXA 3FQUB 4LCCB 4U1IA 4UINL 4XXDB 4U7KA 2Z4QB 5JQ6H 5DFVC 2F54A 1CXLA 3FMGL 5TE6H 4P3CL 1EO7A 3CZJA 3L3DB 1H5BB 4G43A 4P2OA 4PRAA 1EGJA 1A3RH 5DK2A 5GS2H 4LP5A 2QSCH 3AREB 3FMGH 1IGYB 1BECA 4O58L 5CEXB 5ADOL 4NZTL 1VKXA 5L6YH 1PW3A 3OB8A 2X1OA 4IMLA 3VFOA 3SKNB 4KJPC 4FXLA 2ED7A 4JFOB 2WAHA 1MOEA 4X7SH 1I1AA 2PTUA 5GSVB 4DUXA 2EC8A 3UO1H 1I7RB 3QNZB 5E8PA 1OLZA 3QDAA 4L5FH 4HKZA 1CFTB 5I1KH 3KPPB 3OKEA 3U4EB 1MIEL 3T2NL 3PQYA 3WXVH 2ZSWB 1S7TB 4JFDB 3BQUD 3LN5B 3B9KB 4EN3B 3MNZB 4HG4K 1MRDL 4HAGA 4ZPTB 4TNVK 3FB7A 4YDVB 5C07D 4RAUA 1QFWM 1T7VA 4ZPVA 4Z7UA 5E6ID 4Z7VA 1TQBB 3VFNB 1N0XL 2DIJA 4TOYH 3K1DA 5JR1L 4P2RB 1F3DH 1OGAD 5E4EC 4E41E 4PP2B 5KSUA 1YEJL 4YHOL 4XH2A 2OJEB 4JFEB 3HE6A 5GS1A 2A77L 3MJ9H 1A02N 2YWZA 1KJMB 3QIBC 4YHNA 4YWGH 4G8GB 3NFPB 4ZUUB 2WBJB 1Q1JL 4QXTA 2EDEA 2OP4H 5DHVA 4YHOH 1E6JH 1OQOA 2A77H 3MROB 1G7IA 3MRHB 4H25A 2MHAB 1GHFH 3MLXH 4EQ2A 3CZFB 4U6HA 3MJ8A 5AYUH 1LO4L 3QO1B 2BVTA 1AP2B 3BP4B 1YECL 3OKKB 1GOFA 4H20H 2XA8L 2X4PB 4YPGA 3MV9D 5IW6A 1JZ3A 1WBYA 1LILA 1S7XA 4NGHH 1LWRA 5A43C 2DF3A 2HLAA 2D7MA 2EIZA 2Y5TB 3LY6A 5GISL 1T83A 4EDWH 3BH8A 4PJCB 3WS3A 4O9HL 3B5HA 3SDXB 5D7LE 1A5FL 1BBJB 3DXAE 1T1ZA 2ATPB 5GQBA 2MCG1 4JFZH 5EC1B 4X7CC 4U1NA 4FZ8H 4FXKB 4GBXD 2HMIC 4JZNB 2J12B 2V9QA 3LV3A 1ZGLM 3OR7A 3ZZ1A 2BXZA 3OV6A 1ES0A 1J11A 4L9LB 4M6OL 4JKWA 5KN5A 3WLWD 2X9YA 3VFRA 3QRGL 1WBXA 7CGTA 2ZCHL 4OKVA 3U30C 3O3DB 4YDIL 4DK6A 2HT2C 2CKNA 1KJ2L 3OB0K 4WI7A 3DARA 5FGCB 1ERNA 1Y18B 3RZCC 4JFOA 3BEVB 4MD4B 3IFPB 2PN5A 1OPGH 5J0BA 2OR7A 5AZ2L 2XWTA 1U8KA 3LKPB 4Y5XC 3O3EB 1KJMA 3U0WH 4QNPE 5DJDB 5TDNA 4JQIH 5DVMA 5IVXF 3RZCB 2NX5B 1PG7H 5CD3A 3TZVC 2EDXA 4X4ME 4GXUN 5D7KD 2E9WA 1OTUD 1DEEA 4LSTL 2A6KB 3HFMH 3Q3GB 1AJ7H 1T1XA 4QHLB 1OT2A 1MRFL 3RPIB 1WAAA 4POZD 2CIKB 2J6EL 4LAJH 1RQ5A 3T1FA 5TGBB 2MPAH 2X4UA 1UM5H 1O0VA 1F11B 1HHKB 3LZFH 1BX2B 4JQVC 1RJCA 3C5SA 3C6LC 2R0KH 1G7HB 2R2EA 3ARFA 3DUSB 2C3WA 1F3JB 3OPZH 3O2DA 1E6OL 2HLAB 2Y5TA 5E2TL 3STZA 1EJ6A 2DTSA 2XV6B 4X6BB 5FDWA 1AHWC 3P73A 4AIXA 1P6FA 1NCTA 5ACMA 2VLKD 1NFKA 4FN0A 3IDIB 2ITCB 1RZKH 4IMLB 1WZKA 1A7OL 2V17H 5ISZB 1KCLA 4NFBA 3MJ8B 3PV6A 1IQDB 5EWIH 4XAWH 4MAYD 1F3JA 3DMMC 5A1AA 3QIBD 3ZHKA 1IAII 1UKQA 4LVHB 5K9JL 5AD0A 4PJEE 5DGRA 4XXCC 1MRCL 3IFOB 3TBTA 5D2LF 5KVMC 3PWPD 4F7MA 1N8ZA 4LEOA 4RFNB 1NFIA 5ERWA 1DDHA 1J87A 5ESQB 3C60B 4HLZG 2VDLH 2EO1A 4BKLB 2YD9A 4OUOA 4D9RD 3STLB 5DVLA 1IL1B 3ARWA 1IFHH 2Q6WB 4KI5F 4ZOBA 2X1WL 1S8DA 3OR6A 1MAMH 3KPRE 3JV0A 2FEDD 2NY7L 4PJFB 1TVHA 3OL2A 3PNWB 2ORBL 1BQHB 5KZCB 3TN0D 5EUKB 3W2DL 2KZ1B 2SEBA 2UUDH 2WBKA 4KJQC 4FG6D 5L9DL 1BX2A 2WWMC 1YQVL 3NABH 1TZIB 5GRUL 2H26B 4XCYB 2WANA 2YUWA 1FZMA 4PJ9D 2CLRA 1QYGH 1XGUB 5D1ZA 1KG0B 5H2BB 3LD8C 1RZJC 3UTTD 4QRQB 4K8RH 2NNAB 1KJ3L 1TVHB 3FO1B 2EYSB 4Y16B 5EO9A 4L4TE 3BJ91 2HT2D 3WO4C 1T66C 2QQNH 3RDTB 5L2KE 1IJ9A 1UXSB 2DTML 4R7NA 1S5IL 4FQ1L 3GM0A 4TUOA 5DRWB 4UAOC 4NZUH 3CXDH 5GRZA 3QPXH 2KQMA 2RGSA 2OMNA 5BV7B 5F7MC 4K3EH 4F2MB 3ARQA 3MACH 2UZIH 5BS0D 1DLFL 3UJIL 1RUML 2O61B 5C0FA 2BJML 3LHPL 1TVBB 3RY4A 3QWOA 1ORQA 5HGDB 5IJKA 1WJ3A 2W38A 3GK8H 5CKAA 5SWSB 2H2PC 1JWUA 2N7AA 2VRAA 3DVGA 3CLEH 3EO1B 1D5MB 1T5WB 3QNZA 3H0TA 4GRLB 3DVNA 4PLJD 4ALAH 5JQHC 1MCRA 3MA9L 4PJ8A 4XI5C 2FJGA 3CLEL 5GPRA 2HG5B 4IEFB 4X5LA 1H3PL 2H32H 4YE4H 4X98A 5D2LB 4G8IB 3CAFA 3FN0H 3IYLW 5SV3A 3U7YL 5I1AA 5CJBA 1KJVB 5DK0A 3CNKA 4BQ6A 3ZDYF 2JJWA 3RHWF 3MSPA 1M4KA 4ZXBC 3FQWA 1OM3L 1WFOA 4GAFB 2R2BA 3LVEA 1AO7A 1D6EA 3T4AA 1W72L 1JHTA 3MXWL 5EB9A 3C08L 4OFYA 5DQ9A 4PP1D 4G9FE 4ZAKB 2AXFA 3QXAB 1OF2B 2BNRB 4F7TB 1T03L 2UY6A 1J1PL 2FBOJ 2A6KA 2JELL 2Y36L 4OCRL 4N1CA 4LVHC 1P7KA 1YJDC 4PRPE 4WHCA 5MHSD 4HWEL 2H2PD 3L5JA 4NO3A 3TGXA 5K59F 5L7XL 3MRPB 3WE6B 1T03H 2I9TB 1QBAA 4RGMB 4Y88A 2PTTB 5DJZB 2PYFB 1CFVL 2IAMD 3GB7B 3GJFH 3GI8L 3NA9L 3WNNA 1RHHB 2M1KA 4O2FA 2ILLA 3TCLB 1S5HA 1OAQH 3NVQA 1IC7H 3NAAL 3C8KA 3QXWA 3E6HA 2DYPD 5EO0A 1FFNB 4NO3B 4CBPA 1HEZB 4F9LA 3G04A 5E5RB 5E6ZA 1ZT4B 4X6DE 3V8OA 5E95B 4OCYH 1LP9E 4LKXB 4LCIH 3ZT5A 3T2QA 1GC1C 3NTCH 3WHXA 5ACZB 4WFED 2ZZUT 1KBGL 4MD0A 5DK2B 5DUBA 4QF1B 3WFBH 4HUUB 3BKYL 4JFFA 2A6DB 3IJYA 1BVKB 2XACC 5LVEA 1FVEB 3MZTA 1KJVA 2E7HA 5T3XE 1PDKA 2R69H 3REVB 1T0NA 5JW4Q 3RBSA 5IEKA 2C7UB 2ZUYA 1A7BA 4GW4B 1CDJA 5EZIH 3FTGA 4IMKA 5IFJB 4HMCA 4OQTL 2D7QA 5ISZD 4Z95H 3X12A 5FYJL 1FYTD 1BGXH 4HKJB 5DJCB 5EA0L 3ZKSD 1EV2E 3VXUE 4KZDH 4GBXB 5HYIA 1PEWA 3EO1A 2GY7B 3AC0A 4ZD3H 3S37H 5BMFH 5EA0H 3MRRA 4MNQE 2AI0L 3LMJL 1MJJA 4GUPA 2O5YL 2NY2D 4AEIL 3KLHD 1XF2B 3FRUB 2ZG3A 4P9MH 3BGMA 1P4LA 2VB5A 1NGPL 5HHVL 5BQ7A 4D0BA 4N68A 1KT2A 3TBVA 3QUZA 4JFPA 2B1HH 1H3TA 3V6OC 2PF6A 1IM9A 1I9JL 1DBBL 5IHZA 4M7LL 3GGWB 1KXQE 1JMZA 3MUY1 3QEGH 1UACL 3VXOA 1K6QH 1ETZA 2IPTL 5EO0B 3FT2B 2B0SH 1OD7A 4PJ9A 3TWCL 4ONGL 4X8JA 3TA3C 1FSKB 5EZJB 4M5YL 1UACH 4KGJA 2HKHH 2HKFL 3B8YA 5I17A 1AC0A 1F58L 2COQA 2GITB 4KKBD 4K3HA 2HP4A 4OBSA 1TLKA 2FZ3A 5HGDA 1UM6L 5C09D 4R0LB 1QSVA 3W5MA 4OB5L 3VH8G 4I3SL 4HXBH 2I24N 2R0ZH 4MNQB 1AIFA 5K9OB 1MFAL 2B2XL 4ONHB 3ARDA 4PRBA 3MFGB 5F7KC 1UH2A 1MNUL 1NGWA 3IB4A 4UTBH 3U46A 3VG0L 2NW2A 2VLME 4NKDA 3ZE1F 5DZNA 2IANA 5I1LB 5T1KD 4K7FB 5C0DA 5FHAH 3WS6A 2AJZA 2RBLA 2VL4A 4PTTA 3EYOB 1TQBC 5F89B 1FV1B 3CFEB 4DVRH 4JDTH 2FH6A 4UMGA 4JO3H 4MDIB 2XKNA 3IRZA 2R0LH 3IJYB 4ETYA 3VDCA 4R7DB 4I2XA 4UILH 1F00I 3ZE2E 3ZKMC 1LEGB 3DX9A 5DD5L 2VLJB 4M6MH 1TJIH 3I75B 3UYRH 4IRSA 4X4ZA 1CI5A 1PEZA 5GHWL 4DAGH 5T3XL 4NQEA 3IFNH 3TJHC 2NQCA 3V6OE 1CN4A 1INDL 4PJHB 1FZOB 1VFOA 4I2XB 3TT1H 5KSVB 1MCWM 1PLGL 5HYFA 3SDDA 5GS1B 5JDJA 4Y7MA 3IDJA 3P2TA 4ZNEA 1RUAH 4U1GC 5TDPA 4UIKH 2XI9A 3KPRA 3NOIA 3ARXA 3NGBB 4NQXB 3BP5A 2O26U 4YIQA 1F90H 4TOYL 1DUZB 1OCWL 5FO8B 1CLOL 1RUAL 4UDUA 2I9TA 1RIHL 1OOAA 4ODSH 4RFOL 3ZKMD 1MJUH 1DSFH 1XGTA 3QSKB 1E4JA 4EXPX 1MFEL 5CBEA 3TT3H 1UKSA 4C55A 2BY2A 2P8MB 1XR9B 1EXUB 2PKDA 5DMKA 3KPQB 1NMCB 3S36H 4DFHA 4X6CB 3H9HA 4PY7A 4R26L 4I77H 1YA5A 2IF7A 5H94B 4L4TD 4M8VA 3RTQA 2W9EL 5F7WC 1MI5E 1J1XH 1UKTA 3VGDA 4OLUH 5D1QD 4MJ5B 5IW1B 5E7FA 2FB4L 3ETBF 2IMMA 2Z8WC 4GAJH 4NKMA 3SQOL 1IL1A 1JVKA 3Q6GH 4KHTH 4CW1A 2FB4H 1U41A 5SWSD 4PJXE 3HI5L 5I30L 1YEEH 3AS2A 1IT9L 4XPGH 1NAML 1S7QB 4H5SA 2E7MA 4ERSL 1KACB 3OKNA 1VB9A 1Y6MR 4FXGA 5EU6E 5IV2A 1RD6A 1FV1A 5IR1B 1M7DB 4NSKB 3RZCA 2XKNB 1IKFH 4QTIL 4U1LA 5FECA 3VXMA 2IEPA 2XZAH 2HT3D 3QA3B 2LE9A 5FGCE 4BFBD 4GMSL 1IKFL 1PY9A 3MTRA 4K07A 4LSTH 4DZ8B 1AQKH 1GGYA 4PJXA 5D1QC 4LNVA 5F96L 1SJVA 1XGUA 1U93B 8FABA 1KPRB 4FQXA 3BMVA 3I2CL 4JLRB 3MOBH 1N6VA 5F96H 1MLCA 1IEAA 3QBTB 1NCBH 2X4UB 5LQBH 4GH7B 4NZRH 4U1HA 4N90D 4XCFL 3F58H 4IRJA 3QO0A 1BQHA 1MI5A 1X5ZA 1YNKH 4YUEL 3VD5A 1ZTXH 3QCUL 1OQXA 4PJEB 2AERT 3VXOB 1JCKA 1CL7H 2DLGA 2O5XH 4U3XA 5KW9H 2CXGA 3ARGD 3T0DA 3WNKA 1SMOA 5TF1H 5ENWB 2EXWC 3CC5B 3T4YB 3IJHA 4OD1H 4XPTL 4NQVA 2V17L 4EOWL 1FBIL 1SHMA 3RPIA 1OW0A 1G9MH 3P4OB 3BYTA 4P3DA 4QHKJ 3ZDZE 3DXAA 4L3EE 1G7QA 5DRZB 5E8EB 5D7SL 1PBYA 5BW7C 3V9FA 1AGCB 2OCFD 5E2TH 4KDVA 5BOPA 1U8OA 2DQIH 5IR1A 5DI8A 3RAJL 1U3HB 3SDXF 4FFYL 2YXFA 3DX6B 4QRUA 4Z78B 3NCBB 3O2DH 3MLVH 1SJEA 3UPRB 3FO0H 3IDIA 5F1NB 2H1PH 3ARPA 4KKLC 4K7FA 3SDCA 5C0DB 4MB4A 4J12A 4UOW0 1MAML 4GRWF 5E2VL 4JDVB 2R15A 4NKMB 4IOIB 4NQDB 1OAXH 2R0WL 4M7LT 3M1BA 4U2YA 1FYTB 2GTWB 2DQEL 4JFHE 2BP3A 3UDWC 1X4ZA 1DZBA 3ZHDA 3ZL4H 5E2VH 2F74A 5E6IB 3U7WL 12E8L 3O4LD 5JIHA 4HWZA 2NY7H 3H9SE 1D5IH 3L3KB 5C70A 3HG1D 3ZKXC 3CFJB 5A2KH 3SDDD 3TPUA 4GKNA 4FHBD 3IJHB 1F6FB 3MODH 1F4YH 4X4XA 2M8XA 4P5TB 2RCSL 1DQDL 5HHPB 1T0PB 2FEEI 5T3ZE 1K4DB 3WKMH 3OAYK 2BOBA 4JZOA 2RCSH 4HS6B 1OAUH 4EBQL 1HILA 4S1QL 4PLJC 3EJJX 3MRIB 3C2AH 3U82B 3LKRB 3CFKB 4XNZB 4NKDB 1NUNB 1EMTH 3GB7A 1M6OB 4D94A 2HAZA 3MBEB 1Y6KR 4WV1A 4W6YB 1QACA 4CAGA 1HQ4A 5ESVB 4NZUL 3UBXA 4GJTB 5E8NA 5EU6D 1EMTL 3EJZD 2YRPA 5DC4B 2J4WH 5MENB 4U1MB 3V2AR 5ICZA 4N0FA 4CRPA 4MAYA 4JN2A 1S9KC 5KN5B 5HGAA 3KXFA 4R8WL 3RVWD 1Z9MA 5D5MF 4Z0XA 4H5SB 2J4WL 4KK8D 1FN4B 1JPSL 1YEKL 3MLYL 3M45A 3RWJA 4EXKA 1FDLL 4R4FH 3MZGB 3QEUA 2W0LA 1VEPA 1X4XA 5F8QC 3SDAB 2J88H 4CNIA 5C0AB 4P9HL 1FIEA 3K4AA 1DQMH 2HH0H 3HHRB 1QA9B 4EKXA 1FDLH 5T1MB 5JR1H 4XP4L 3VGAB 4X4YB 4Y4HA 4POZC 4Y2DB 3BVNB 1AXTL 1HOCA 1T0MB 3TNMB 3VDAA 3CUPA 1I4FA 4TNWK 3UPRA 3S3PA 5CJOL 3FO9A 3UJJH 5GGSY 2XY1A 4J8RB 3VXUA 3A67L 2V2TB 5IW3A 3PJSA 5K9KA 4JM4L 4FABH 5I17B 1CDBA 4YHNB 1A9BA 4XT1C 5FYLD 1UVQA 3RL2A 1UYWL 1YECH 4XPAH 1MFCL 3MGOB 1UXSA 4X8JB 3VXNB 4W68A 3LEXB 5KVFH 2IADB 2X7LA 5MP6H 4EQ3A 4JFFE 4LPYA 1N6QL 5TQ0H 3TJEH 4X9IA 2UYLA 3E2HB 1T1YB 4FQIL 4V1DD 4D9LH 2EDFA 5KOVC 1UENA 4H1LH 4JY5L 4FZ8L 1I3RB 4NKOA 3SBWC 2EDDA 2AP2A 5J9PB 4X6DA 4EIZC 2HT4D 1OP5H 5LCVH 5EOQH 1RIVH 3LDBB 3QCTH 3WKNA 1NGXA 3K2MC 5L88L 3DECA 5T3ZD 2ATPA 2BNQE 3H42L 3QQ9C 2X6MA 2YMXH 3OKMA 1BIIB 1HH6A 2IFFL 4JRXD 4U7SA 2HG5A 4H26A 1K9TA 4YHIB 1KTRL 4BH8B 3C5JB 3OMZA 2AVGA 4P49A 1A7QL 4G3YL 4OV6F 4PRPA 3OGCA 1G7JA 1AGCA 4JANA 3OJDB 1KFAH 5FECB 2FBJH 3CVHB 2GUOB 4L4VD 1T1WB 1PG7L 2GAZA 5GGQL 3MNVA 4XP1L 5CINH 3H7BB 1CS6A 4G9FA 1WFTA 2YZ1A 3M17A 3ZTNH 3HC4H 4JG0L 1AO7E 1L0YA 3PABB 2VDKL 1Z0NA 5HDOA 2YSSB 3BD3A 1QFUL 5DLMH 3VD9A 4YEEA 4JANB 3TA3D 2Y9RT 5BVPH 4XTRC 3C87A 5KSBB 4NQXA 3PL6B 4CDHA 3WLBB 3SHSA 1RULH 5C0EB 2YPVL 1KYOJ 3RNKB 1U0QA 1UZ6F 3KLDA 1KTKE 3WJJC 5BVPL 3D0LB 2NY0C 2JCCE 2W92A 5KS9B 3IU3A 3PWUB 2DLIA 4M4RA 2P49B 2XQBL 5I66B 3C8KB 3O4LB 5BCAA 1DQLH 2Q7YA 4ZO7A 3X3GH 4JZJC 3RWEA 4HLJA 1KELL 1FC1A 4G6KL 5T5FH 4KMQA 3ES6A 3ARGC 1FZJB 3G6DL 1NCCL 1TJGL 1IM9B 1OP5K 3O4OB 4HXBL 3AY4C 5I19L 5IB3B 1IAKB 2OZ4L 1CIDA 2JK5A 4MDJA 1G0DA 1DBKH 2HKFH 1VPOL 4W6WB 5EN2B 5EBWB 3CU1A 1G0XA 4GAGL 3ISWA 5HHOD 3BD5A 4FQCL 3ARDC 2NY4C 5SX5K 4JFDE 4L4TA 3MRIA 3BKML 4RX4D 3T3PE 4PTTB 1I7UB 1QFHA 2NZ9C 3FZUD 2B2XH 1DL7L 3VWJC 1IEBA 3QG7L 4LLDB 1N8ZB 3DETD 4HFWA 1HIMH 3FCTA 5EOTB 3D85B 3VFRB 1BWWA 4PJBE 4D9QD 1T6WA 4OF0A 1NKOA 5IFHL 1R5VA 2GJ6B 1NUDA 2BDNH 1WBXB 3PWLA 4JFDA 3PHSA 1HSBA 1YYLL 5HVGB 5EPMB 2G75A 4YC2C 3U2SB 1MRDH 5CMAA 5DURB 4GKSB 3SE8L 4WFEE 2IH3A 3SDAA 4ZMAT 3B2UD 4XPBL 3T0ED 1JZ7A 5FV1L 4M43H 2PETA 3D39A 1XF4B 3U83A 1N0XH 4YBQD 4NNYA 4LSRL 1F2QA 4KMLB 5C9KA 4JO1L 4YIQB 3VXNA 1J0HA 4M4PA 3SGJC 4C83A 4P5KA 4F8QA 1FL6A 2K1MA 4PJEA 2DLEA 4FQHB 3IVKB 4YX2L 3D25B 1A6VL 4LP4A 2R1XB 5J4MA 1E6JL 4CN1A 5JW5A 1LO2L 3WIIL 3O0RH 3BP7A 3G5VB 2GI7A 1INEL 1D3CA 2Y06H 4OGYH 4LNRA 5E0QA 4KK6D 2VQ1B 5IK3B 4WUKL 4HIJB 4QHMB 4J4PA 1R3KB 1A1NB 3ARUA 4TN9A 2WINA 1OCWH 4Z7WF 4W6XB 4YGAB 4GXUM 1AR1D 1JZ5A 3O6KH 3GSWB 3MA9H 2Z0BA 2R1XA 3VE0B 4OLUL 2ZUUA 3P4OA 4P3DB 1JYVA 2E9IA 5C3TA 5D72H 3TVMB 1Q0XH 3T0EC 4H8WC 3QDJB 1IGFH 5L2JB 1LDPL 2EC9T 3CGTA 4UOW1 1ITBB 2DQGH 4MQSB 1XGQB 4X6CE 1KCSH 3JUZA 2RAMA 4OM1H 1Z2KA 2CSPA 3L95B 5KVGL 3DMMD 2DQGL 5CLWA 5D71L 2VYRE 1TJHL 2VLMD 2B5IB 1HOCB 1T0MA 2EH7L 5C0GA 3TNMA 2JELH 4NO0A 1QLRB 3NZHL 1CGXA 5EC2B 4XMKL 2VDPH 3L5HA 3GUTA 3HNVH 2AXJA 4C59B 4RCAA 2VKXA 1ZGLB 2BOCB 2MNUA 2WUCH 3WFDL 5DRXB 5FOJA 4G6AC 1NEZG 2VDQL 4X9FA 5EIVA 3MLTA 3NN8A 3H3KA 4P46B 4Y5YC 1NCDH 2EIBA 2Q3ZA 3D3VD 4OCYL 1R3IL 4FNLL 4S11A 3RDTA 3OF6D 4K3DH 1CXEA 3SOBL 5I1EL 2QQQA 3ULUC 3CX5K 3D69A 5D7LA 4DKAA 3S7GA 5FFLA 3F7QA 1HDMA 2QTEA 4C83B 1FC2D 2E7LA 1J0YA 3P11L 5E00A 4LRIA 5DK3A 2HT4C 2AV1A 3JTTB 3ULUL 3Q5OA 4LKCB 4OLZL 1HINH 2OTUB 1ZKAA 4OQTH 3HPJB 4QHUA 5KANG 1FRGH 3LZFL 4U1HB 1BGXL 2QSQA 3QJHA 2CDGB 3VXSB 1AXIB 3PHOA 1GAFH 1CGSL 5HHMD 5J1AB 3MYJA 3RVVC 5I76B 3H0TB 3T0VA 3WNOA 4NRYB 4RWHA 5E08L 2D03L 1GGIL 3U4BL 3BISA 4M9PA 2WW8A 2BSSA 4G8EA 4G42A 4IS6A 5GGRY 1WT5A 4NT6B 4E41A 2VLJD 1MEXH 3QDJE 1UM4H 3QRFM 5DXWA 3HRZA 2ZP0T 4L1DA 4XWGL 1NDMA 3RVXC 5DRXA 3TESA 1U8JA 2AK4E 4FFYH 2NY2B 1V3JA 3WLWC 2NY1B 3LEVL 3PHQA 5JHDA 4LVEA 1WSST 3UAJD 4G8EB 4IS6B 4KV5F 1FNLA 2BOCA 5E2UH 3PP4L 4LU5H 4ODXA 1UCBH 5IB1B 3HRZB 4ZXBD 2IALA 4WHYH 3LD8B 4G9DB 4RBPK 1HK6A 3FN3A 3UYPA 1JYNA 4GAYB 1UCBL 2GJZA 5FO7A 5D1ZB 4O5LL 5D9SA 5C6PB 3MODL 1JPFB 4P2QB 1QSFD 4WI3A 3CDYA 2KH2B 3VWKA 4UT9L 3ULVE 3PUCA 2OTUA 4QHUB 5H8DA 3EFDL 1XGTB 3VXQA 1H8SA 1R3JA 1S5IH 5JW4R 1VGKB 2AV1B 2DJUA 3WDJA 3BWAA 1G0YR 4YHMH 1T1YA 4ELKA 1AE6L 2CK2A 4Q9QH 1SVZA 5C9JB 5DMGD 3BKCL 4JY4A 1I1FB 3TYGH 4UQ2B 3QDJA 3MOAL 1AP2A 3BP4A 4RISH 5CSBA 3U9PH 2X70B 3UBXB 3HAEB 5JUEL 1AI1H 3RL1A 1LD9B 4WV1C 2H9GA 4YDJB 2ZUTA 4EBQH 4HGMA 3ARBB 4MJ6B 5DVNA 3TO2A 1EAPB 3HRPA 1K2DB 1UEMA 4NKQB 2JB5L 4R0LC 1YEKH 2BHYA 2DDQL 1E4XL 2K7QA 1X5AA 4JM2A 2GUOA 1KN2L 1BJ8A 1ZHKA 2OMBA 2YUVA 2BJMH 3LHPH 4ZOCA 1QLRA 1IGIL 5CJQL 1T5XB 2AXGB 2MQCA 2DQUL 2YN3A 3KJ6L 2WUBL 3WNPA 2PTTA 4X6EA 4W4OA 4G9DA 4X4YA 4PRPD 1HZHL 5DT1L 3RGVA 1ADQL 5BJTB 5INCB 4PIRF 2HN7B 2A74B 3QDGD 3CMGA 1CCZA 5FM4A 3IDUA 1NCAH 4L3EA 3OKMB 2F74B 4XMPH 3O3BA 1WIOA 3G6JA 1H3PH 1X5JA 5KAQF 3L7EB 4Y4HC 1QRND 3FFDB 4UTAH 1YEJH 4XNQA 5D2NB 3X13B 2PXYC 4NUJA 2AK4B 2I07B 3NPSB 3CSYB 4WUUB 5GS3A 3KLHC 3MV7A 4ZDHA 5TE4H 1OM3H 2JIXD 2Z4QA 3MRLB 3VW3L 4BUGA 1ZLWH 1UYWH 4M61B 1ZS8B 4MX7A 1YYML 4E0RB 4QY8A 2VQ1A 3E6HB 5DO2C 2CUIA 4JO2H 1D9KB 1OP9A 5JXAH 4ZUUA 3MRFA 4ZS6C 4MQ7A 1T7XA 1K4DA 4KK6C 1WK0A 1MWAL 3IT8D 3RVUD 3HC3H 2VZOA 3V6ZB 1KJ2A 4MMZC 2V2XB 4Z7QF 5BVJA 1I9EA 3GMRB 3U30B 1MCKA 2QBWA 4GRMA 5A3IC 1KSRA 1DLHB 4E0RA 4N0YL 4O2CB 3B3IA 2JK5B 4MDJB 5I8EA 3PWPB 5FGBA 1OAQL 3W9EA 1C7TA 1KCUH 4JM2F 4F2MA 1U8PA 3NPSC 2GYSA 1HDMB 5CIPA 3FQUA 5FHBL 3UTZB 3DV6B 2Z92B 2DD8H 1EUUA 4U0RC 4TSCH 4LLUA 4I0KA 5EU6A 3PQYB 5IMMA 3L1OL 4NQCD 5FHBH 2YD7A 5J06A 1LO5B 3N1MC 5I8EB 1A7QH 4G3YH 1C5DB 5DTFB 1U9KA 5AD0B 3UZQA 5JMRA 1T6VN 3RWDB 2FBJL 5INCA 5IVZA 1P6AB 4G7YH 3T3PF 3FQRA 2XZAL 2WBWB 1TTUA 2IC2A 4E41D 1AQDA 3OWEA 1B0RA 1DVFC 2F5AL 1A1OA 1BOYA 3O3AA 3T3ME 2WP3T 1AFVH 3MLZH 1JRHH 4XVTH 3ALPA 1KN4H 3CDGA 4XMLL 2UWEB 4XCNA 1FAKT 3D6GA 3BPLC 3O2VH 4QYOA 1BVLB 1NCNA 3ARBC 4ZDHB 3VFGL 4XP1H 3FCTB 2EE9A 4XVTL 5CINL 4ZD3L 3MR9A 1A14L 1N4XH 3MNVB 2ED8A 2XN9E 5KSBF 3QEHA 3FT2A 3WJJA 2JTDA 3FB5A 4P2OB 4ZXBB 2CK0H 3WN5A 2P47B 5F6IC 2NW2B 3EHBC 1LHZA 1E6OH 1FBIH 3IDGA 2P7TA 3EJZC 1A6AA 4Y16A 1EZVX 1IQWH 2C3VB 3JWOL 3PGFL 4PRDB 1GJIA 2EYTB 4PJBA 3FFCA 2VWEE 5JOFA 1XR9A 1D9KA 3HUJE 2R0ZL 4J3OC 3F5WB 3RAJH 3WJLC 2VLRB 1CDHA 4RGNE 4MA7H 1A3LL 2CMRH 2WM0A 1I8LC 2Q7YB 5MENA 5IGXL 2UY7A 4LARH 4HT1L 4ZUSA 5IQ9B 4U31A 3FAXA 1NBZA 2HTLD 2H1PL 5FXCH 1OVZA 5BXFA 1PZ5B 2EDOA 5FK9B 4NZTH 1EEYA 4OZGB 4HFWB 5CWSB 1R24B 5EOTA 5HTSA 3AREC 2ZCKL 4J1UA 5CEXA 4XP9L 3VWJA 4UAOB 1INQB 2PO6A 4RAUB 4TVPL 1MCJA 4Y19A 2AJUH 1FNFA 5EC1A 5E94B 3CVHA 2I9LB 2ADIB 4L3CB 1L7IL 3QT2A 2W9DL 4JVPA 1HYSC 4K8RD 2IANE 2X4RB 3LKOA 3C2SA 1FZMB 1UA6L 4LRNL 4DVRL 5C0CB 3U2SA 5IESL 2IAMB 1JV5A 3BZEA 1FFRA 5MEPA 1I8MB 4LRNH 5ALCL 4YHZH 3RHWK 1LGVA 2E7BA 4OTXH 3O6FA 5DDHA 4AYFA 1HKFA 1AQDB 4MZ2A 3X11A 3UPAA 1NSNH 3DHMA 2AAVA 4ZODA 3T77A 2FJHB 3SE9H 5MEQA 1LE5B 1YN6A 3SKJH 1H0DB 4OFVA 3EZ8A 3S34H 4P4KB 4PJGF 1QRNB 3CFDB 1BFTA 2QHRL 3WIIH 1G6RL 3FB6A 4PRHA 2DLFH 5I0DA 1PLGH 1I1FA 1A6ZB 4DVBA 3O6LL 5E2WL 1FGVH 2YPLA 1A7RH 1GHFL 3MLXL 3OB0H 5SWQB 2R1YA 2DBLL 1EFQA 4FQJL 4LVNC 9CGTA 4J4PC 4WJ5B 4OCWH 4B50A 1NJ9B 3TVMA 4JPIA 1RIHH 1EEYB 1KB5A 2ADFL 4H0GA 4A6YL 5GISH 4MNQA 1FNGB 5F6HI 4DGYH 2GSGA 5BRZA 4XNUH 5F97E 5JNYA 4U2ZA 4BH8A 3RUGE 2VDML 3C5ZD 1CZ8L 4JRXB 4XP4H 4FS0A 1GYAA 4LSUH 1IAIM 1IKNC 3HI5H 1TJHH 5GS0C 3BQUB 4U6XB 4JFFD 1AXTH 1BFOB 4UU9A 5H35B 4DGIL 2NYYD 2XICA 2AEPL 3DRTA 4U1SB 5GGTA 1BQHG 2ZCHH 4NRZB 2IALB 4MNHA 1KJ2H 5T1MA 1IEAB 3QXUA 2IPUG 1MHEA 3BPNC 4NNPL 1MJ7H 1T22B 1V05A 3A6CH 3GMLB 1C08A 4R6UA 2XFXB 3I3DA 4DKFL 4E41B 5E70A 1JHLH 1MJ7L 1WWWX 43CAB 4DZ8A 1I8IA 1R3LA 1EFXB 1JHLL 1U8HA 3KPNB 5KG9A 1BVLA 4FNLH 2C26A 3V52L 5CFHA 4Y5YA 1JE6A 3MO1B 2FHBA 2AEQH 4ZNCD 2J6EH 1UJ3B 3VWKD 4YXKL 4NQTA 3JTSB 2APTA 1IM9D 1Q38A 4K7PL 3CDFA 5J6GA 1A4KA 3GJFB 3X3FH 1MVUA 5D8JH 4RMQA 2OL3B 5IEKB 1QSZA 1N64L 1HE7A 3IJSA 1JK8A 5D1XD 5K93A 5I8KL 4ODWB 1HINL 4JHBA 4LRIC 4S1SL 1QOKA 4G8IA 3C6LA 3EYSL 2D0FA 3KXFE 4U1KB 4GRWE 4XVJH 3P11H 3WXWL 5HYJA 2FIKB 4S2SB 4ORZC 4J3TA 1AHWA 1FH5H 5DJAB 2VAAA 5GGQH 4ODWA 3QIUD 4HUVA 1MEXL 4JPIB 5T33H 4JN1H 3ZDXE 4HWNA 2CH8A 4LLMB 5EUKA 2FH8A 1S7UB 4FFVD 3DMMA 4MHHI 2GSGB 3BUYB 4NQCB 3RKPA 1I1AB 5GSVA 2VISA 4R96A 5EORH 4P9ML 4JY6B 2YWYA 2PYFA 1F4AA 2YHGA 5IB1A 1XIWA 3VWJB 1GZPB 3FQXB 3H8NA 4K23L 4NYLB 3V5KB 4LAQL 4RMWA 4PJCF 3STLA 3DX8B 3TFKC 3PL6D 1E28B 5F1SA 5I1GH 4NSKA 2BHZA 4M7LH 3ULVC 2BOBB 4HXAL 1G7LB 2VISB 5MHSE 1QRNA 2A73A 3NIGE 3QHFL 6FABH 5L0QB 4G6ML 5IMKB 5EH1A 3H9SA 3MRBB 3PP4H 3FT4B 3UTTE 2KL6A 1CGTA 4H0IA 1F5WA 2XZQH 2EDYA 6FABL 1HXMA 1NCCH 1TJGH 5L2KA 3QIUC 1FAIH 5DDHB 4Q97A 4LCYB 1T89A 3E3QE 4WIQA 1DEEB 4BZ1H 2YS4A 4QOKD 3OF6A 2DKSA 3QQ4A 3WEXA 5D1ZC 4NQSB 1J10A 4XP6L 4NN6B 4C58B 4P4KD 1MFAH 3FT4A 1FVDA 3N1QC 5DHVB 3NH7L 4YBLB 3VXSE 2HWZH 5F7EL 3TCLA 3BKMH 2BNQB 3KAAA 4ZTOH 3NIFF 1A47A 2XA3A 3V4VL 3T0WA 5DR5L 3QG7H 1DLFH 1RUMH 3PL6C 4F9PC 1S9VB 4OLYH 1TFHA 4M6AA 1CLZL 4QRPB 1Q0YL 2E27H 1NGWB 5F7YC 4H1LB 2VN4A 4CVZA 4BFGA 3OHXB 3GSQA 3KDMB 1DE4A 4YHPB 3JWNC 3WFCL 3PV6B 4UQ2A 5BRZD 2FGWL 4EUPG 4ELMF 4LQFH 4XHJC 3BO8A 2J8HA 2OK0L 1ADQH 3WXVL 3GMPB 4ORGA 3HMWH 2NXZD 1NLDL 1GGBH 4U3HA 3TN0B 2OSLA 3EW3B 2WLYA 4LQFL 2XWBB 4LMQI 3DBXA 1ETZB 3DNKA 2H26A 4XCYA 3EO9L 2Z93B 1WFUA 1N2RA 3VRIB 2Q3AA 3H6JA 3JBG7 3ARSA 2HVKB 3QUXB 4ZXBA 4P9HH 1T04A 3EO9H 1RSFA 5C6TH 1TIUA 3MROA 4RSVA 3REWA 2GK0A 3RZCD 3IDGB 1T2XA 1NGQL 3MLRL 3Q5TA 2GTZB 4FZEH 4HDIA 1OD9A 2APVA 4K9EL 1QPXA 5CKGA 8FABB 2X4TA 4F7EB 1WAAE 3VXME 5KVFL 3MLRH 3IDXL 3VRLE 3BXNA 5DC9B 1G9EA 2BVUA 3T8XB 5KSAA 4CJ0A 1A0QL 2BFVH 2R9HD 1RJLB 2D9QB 1XR8B 4PJIF 5F8RC 1LDPH 5IFJA 2AK1H 4POYA 5DD3L 4LCIL 4HWBA 3MUJA 2V7NB 3QDJD 1AGDA 5IHBA 1AIFB 5K9OA 3F7PC 4FRWA 4LVOB 4ZUSB 5DD3H 1H3UA 1M6OA 1KCRL 4HUVB 2LAGB 1NGXB 4WWKB 3H42H 4CMHC 3QI9B 3S3SA 3C6LD 3X14A 1KPUA 3HC0A 2XWJA 4MD0B 1KCUL 3RU8H 2F8VA 2A1WL 2VAJA 4PJBB 4EVNB 2GK2A 4HK0A 1KC5H 3HMXL 2H6PB 1PQZB 2X41A 5DHYA 5CHNA 1NCUA 4P23B 3K46A 1VKXB 5LGKA 1UG9A 2Z92A 3NPZB 4G9FB 3B9KA 3NCCB 3GGWA 4IMKC 4A6YA 3IXAB 1S7SA 2IBZX 4MDIA 1FLRL 3QDGA 4I0PB 4DGVL 2VXUL 4AG4H 2YSSA 3LMJH 3HI1A 5IF0A 4OSUH 1QFUH 5DLML 1B4JL 3MRJB 1GPOL 4DEPB 3GSNL 1FVCB 3SDCD 4LCWE 3MR9B 1IARB 4NHCL 1UJTA 1VGEH 2XXCB 4NC1C 4U3CA 4N8VB 5I75C 4ZNEE 5F1OB 4J3UA 3WO3B 3VMNA 2X42A 4NWUL 4P2QD 3O2VL 1B0RB 1JWMA 5D7IF 2JIXA 3PDOB 2I60L 3BH9B 1G6RA 1EBPA 2ZPKL 4MSWB 4EI5B 2P4AB 3I85A 1Q9WA 2B7DT 2P8LB 3V6OA 3O4LA 5DF0A 1QHOA 5FYLL 3CXHK 4NQEE 4N8VA 5AYQA 4KY1H 2G9HA 1RULL 4P5TC 4M5YH 2PTVA 4HIXL 5F6IB 5HHPA 1J7VR 3BPOB 1CD9B 3N50A 1EVTC 2FJHA 4Z7VE 5I19H 4Z7UE 5D7SH 4I2XE 5JOFB 3IFLH 4LSVL 1EXUA 3MLUH 5F70A 4HJJH 1IQWL 3GSWA 1I9RL 4HJ0C 4D2NA 4DW2H 5TE6L 5CSZB 3V4PH 4LLUB 3MREB 1MAKA 4LSVH 1CGUA 3PQYE 1AR1C 2YPKA 1KIRA 4XCEB 4UV4L 1NFDF 3LKQA 2CMRL 2VITA 2I9LA 4KPHL 1KPVB 5I1CH 3JUYA 3SGDI 3AREA 5E99L 4HKBA 1NKRA 2PO6C 3VXRE 4NN5C 3QG6B 1RZJH 3FHQA 5I75B 1ZGLP 4QHNB 1FLTX 1FO0H 1TJIL 3UYRL 2ORBH 3S6CA 4NO0B 4UOJA 4U6VH 4HC1A 5ALCH 1L9NA 3IDMA 4XZUB 3UC0L 3W0WE 1VERA 3RWGB 3SJVD 3VFNA 1SEQL 4U0RB 2DQDL 5ACLA 1LP9F 4OFKA 3FQWB 1KIPA 4R4NC 2BVOB 4HIHA 4DK3A 1T7WA 1LP9B 1UA6H 3UTSD 3FO2A 4NCC2 1XF4A 3HZKA 3S34L 5EZJA 1Q72H 2QQKL 4JG1H 1ZHNA 2QQNL 4OTXL 4WW1A 3T4YA 3AU1B 1P69B 1F11A 1HHKA 4A2LA 2IH1A 4S1QH 1MFDH 1OTTD 2QQKH 5C09B 4XNYL 4OQ1A 4I18A 1QSEA 1CG9B 4KQ3L 1UVQB 3RL2B 4OT1L 3QAZB 1DBAH 1CLOH 3QI9C 3R0MA 3LRHA 3QUML 3NFNA 1MVUB 2X89A 4PBVC 4LSDA 4PGCB 1LVEA 1FO0B 1XCTB 4XBEH 2IG2L 3NFPA 4HCRH 4Y4FB 4IOFD 4PV9A 3O6KL 4NNXA 4Z7UF 1J05B 1LO4H 4LHUG 2X70A 4M3JA 3ESUF 4F58H 3V5HA 1S7VB 1FL3B 3IDYC 3MMEA 3Q6FB 1G7QB 1XR8A 1IGCL 4WHDA 1J1XL 4ODUA 4LPUA 4EDWL 1OTSC 3U0PB 3GSUB 3DI3B 5FKPB 4HGWB 1QFWH 3GIZH 4R4BB 4X6BA 5FDWB 1KCSL 1KGCD 1IE5A 2CKBB 2R2BB 2DOCA 4NUGH 5D7IE 5GIRA 5CSZA 1KTDB 4QRPD 3REVA 4P2CG 4Y1AA 1IKNA 4WU5B 3VFVB 4KUCF 1LP9A 5IIEA 1DBJH 4Y5VC 1NAMH 2EXYD 3HCVB 3GIVA 1HNGA 3A6CL 5ABDE 3QUXC 4OCXL 2GJ6A 1OAYL 5I1JH 1HI6A 3O3BB 3CDCA 4PJAE 1JPGB 1KCKA 3MFFA 4HHAA 3HNSL 4UNVA 1CFNB 3S88H 5J11B 5DURD 4ZSOE 4JHAL 3GI9H 4X9GA 4RMSA 5FKAA 3MLTB 1NC2B 5D5MB 1NMCC 4V2CB 1V5JA 1B0GB 5DEFB 3UTPD 1OTSD 5J8OA 4JHAH 5E2JA 1C5BL 3L9RA 3VFUA 1VADA 5JW4M 2J8U