5TPWL

Crystal structure of amino terminal domains of the nmda receptor subunit glun1 and glun2a in complex with zinc at the glun2a
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
212
structure length
206
Chain Sequence
DIVMTQAPATLSVTPGDRVSLSCRASQSIADYLYWYQQKSHESPRLLLKYASPSRFSGSGSGSDFTLTINSVEPEDVGMYYCQNGHSFPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLAAGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords NMDA glutamate receptor subunit
publication title Molecular Basis for Subtype Specificity and High-Affinity Zinc Inhibition in the GluN1-GluN2A NMDA Receptor Amino-Terminal Domain.
pubmed doi rcsb
source organism Xenopus laevis
total genus 37
structure length 206
sequence length 212
ec nomenclature
pdb deposition date 2016-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5tpwL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5tpwL01
1SJHA 1IGMH 3RU8L 1UZ6E 3MJ8A 3QULA 4L4VB 1T22B 1XIWB 4U49A 5J6GA 4LPCA 5ISZA 3LQAL 2COQA 3D9AL 4JFQA 3QWRD 3UMTA 1QFWL 5INCA 5I1IL 1QO3B 1KTDB 2DM3A 4JFFE 3CMOH 4QHMB 4MXQC 2FATL 1U8OA 2X4UB 1DBAL 4GRLA 1OAYH 1BEYH 3JWOL 4X6BB 3AAZA 5T1KA 1QSFE 1HH6A 5TF1H 3P0VH 4KQ4H 2AJUH 3X11A 1NCDH 1EAPB 2VOTA 1EO5A 1QP1A 4AQOA 2WIIB 4D3CL 3VE0A 3GMPA 1JZ7A 5FDYA 2ZUQC 5F72S 4F7MB 3BKYH 2FL5B 3AC0A 4GW1B 1DBJH 5D7LB 4ZNEA 1BF2A 3IETA 2A6IA 4OQTL 1MWAB 2XPGA 4NKIL 4PJBE 2ZKHL 5I8KL 2BNQB 4AEHH 1MY7A 2L4OA 3MNWA 4UT6H 1WWCA 3FAXA 4ZTOH 1RUKH 5IQ9B 2X4PB 4X4XB 5B39G 3QJHB 4FQCL 1CTNA 1P84K 3BPLC 1FORH 2BY1A 2Z92B 1AKJD 2OI9B 1X44A 3VXPB 5F8QC 5ANMB 4XBGB 1T1XA 4HQQH 4HC1L 4NWTH 5ESQA 2Q7NA 2HJFA 4Y2OA 1S5HB 1MRDL 1DANT 2GAZB 4P2OC 4J4PC 3O3BB 3VFMA 1Q0XH 2DBJA 2OL3B 3QIBB 1P7HL 4J2XA 2O5XH 4P5KB 3TO2B 4LLQB 4O2CA 4DUWA 2J6EL 4ZFZA 1J8HB 4LVNC 4QWWC 3TBWA 4JG1H 5JZ7D 3PL6B 4EN3A 3FONA 2IPKA 4P2QD 3AVEA 5JMOC 5DJ0A 5IESH 3BZEA 4ZFFA 1WBXA 2FLRT 1SBBA 4ZOCA 3FO1A 2XACC 2IAMC 4CVUA 1JGVH 1IRAY 5E95B 4PG9B 2VMFA 3MMEB 4Z0BL 5HGBB 3MRMB 5I75B 3MLVH 3VXUB 3ZMRA 3CFEA 4S1DC 5F9DC 2VL5A 5EZLA 1A7NL 4OGZA 2EDHA 1YY8A 2F54E 2BFVL 4WFHD 3SDCC 3RVXD 2H26A 4DTGL 2E9IA 5B8CB 1B90A 5TDPB 3BPOB 1TTGA 4PV8B 4Y5YA 3MLRL 1U8NA 1Y0LB 4ACPA 3O81A 1HHKB 2H1PL 4CL7A 1ZLUK 2CKBL 4XT1C 4QHUB 1L9NA 3LQZB 5AZEL 4PRDA 3RPIA 4MNQE 1FZJA 1CGTA 3ZKQD 4LKCB 4KKBD 4N1HB 5C08A 5BJTA 5CEYB 3TWCL 2FEEI 1NFDA 2W9EL 3QZWG 3DRTA 1QBMH 4Z78A 4JFOA 3TT1L 1WICA 3WCYA 1QFUL 1D5ZA 1FFOB 2NY3B 2VIRB 3B2VH 2IAND 4XPBL 4MQXD 4C59B 1MFAH 2HAZA 3MJ8B 2WK2A 2B1AL 1AD9B 3REVB 2AGJL 5ISZB 5DUML 1K8IB 4Q6IB 1JN6B 5CUSH 5CJOH 5FYJL 3F7VA 3PDOA 2H45A 3IDGA 1ZHNA 2X70A 3ZE0E 2CPCA 3L3OA 4JR9L 2YOCA 3QUZB 4GRLB 4YLQT 2O5YL 2PYEE 4NIKB 4A6YA 1P4BL 1IEAA 3HAEH 2ARJQ 3DYMA 1WC7B 4XX1E 3GHBH 2HJLA 1KFAL 2VO5A 5KSVA 1P7QA 1A6PA 3VE0B 3GMPB 1T2QL 1N5YH 1F8TH 2Z4QA 2D0GA 5IB4B 4X6DF 2JCCB 4IRJA 1NBZA 4EI5D 5LXGH 3QDME 4WCYH 3FQRA 4Y16D 1YECL 3MNWB 2VISB 3FN0H 2BVUA 5E6ZA 3ZTNL 1BIHA 4AENA 5EC1A 1VFUA 4C56B 3I6KB 1MHPL 1CDHA 1KJ2H 4WWKA 1T89C 3TEUA 3F8UB 5HHMB 5CD3A 4I4WB 4Z6AT 2UVFA 1UG9A 5MP6L 3G6JE 1F90L 4LP5A 4R96A 4JY5H 2JELH 5JLZA 1DL7L 2PTVA 4ALAL 1QFWI 2DN7A 1OSPH 1ADQL 5ESQB 3RWCA 4I5BA 2HJFB 1IILE 3Q5TA 2PTTB 5DFVC 4O2CB 1T83C 1I7RB 5JA8B 2D7OA 4YK4B 1FGVL 3OXSB 1NLDL 1CR9L 2IMNA 3WJLA 2EH8L 1VKXA 4EN3B 4G8GE 2FJGB 1YEIH 3MCKA 3VI4F 4ZFFB 1CGUA 2NY2C 3WO4C 4Q9QH 3PV6B 4MA1C 4NNPH 5DQDH 3I3BA 3WIFA 3VFOA 3KLAA 5F3HA 3SE8H 5FM4A 3U0WL 5FK9A 2XXCB 3LS5L 4KAQL 2VL5B 3VGEA 5EZLB 4DZBA 1T6VN 4PGCB 5JTWA 1YY8B 2P44B 3D0VB 5F96H 3JVGC 4Y5XB 2H26B 1CICA 1RHHB 4I48A 5EUOB 1YUHA 4MXQD 4YNYB 3FO2B 3TA3A 1LP9B 4MJIE 2YPKB 2DBLL 1I9JL 2XXMB 4PRDB 3RPIB 4ZTPH 1WITA 4G6AC 1Y18B 1BBDH 3S97C 3KPRE 5E99L 4U31A 3CXDL 3QSKB 1WJ3A 5E8PA 4W81A 4RWYH 3J8F7 3MRKA 2CUIA 5C08B 5BJTB 1MJ7L 1MJJA 2EDNA 5C09E 3V4VL 2P5WA 4RFOH 1ZAGA 4Z78B 2CRZA 3QDHA 4LCIL 5C70A 3F7YB 4HDIB 5F9WB 4P2QE 1IGFH 1YMHB 2Z9TA 5FYKU 4YX2L 4AIXA 3QR2A 3UAJD 1MIMH 5EBWA 1RJCA 4ODHH 3KS0J 2D7PA 2ESVE 5CEZD 4M02A 4M6NL 3ZTJH 3DYPA 5SV3A 3BT2H 1N2RA 1W0VA 2G75B 3K2UH 4FFZH 2J8UE 3U9PH 3V0AC 4NGHH 3F7VB 3PDOB 1KELH 5E0QA 5DHVB 3MGTA 3QWQB 5J1SC 4Z8FL 3VG0L 3WEXA 1ZHNB 2X70B 2QBWA 2FO1A 1PKQA 5D7KE 2JB6A 5I76A 2R2EA 5CJBA 1KIPA 4PRBB 4HFUL 1FVDA 5ALBL 2KZ1B 1T04B 1IEAB 4Y4KC 5GZNC 4JVUA 4NBZB 4HV8A 1ACZA 4FQLH 4LLAA 4M1GL 4O2FB 6FABH 1EEYA 1LEIA 4P2OD 4J4PD 2I26N 1JPGA 3LKOA 4LVOC 1P7QB 4LLMB 4X5XB 4CNIA 2AEPH 3ARFA 3ROOA 1KLUA 3CUPB 3GSOB 4XCEB 4KJQC 1NUNB 5FO9A 4IRJB 4J8RA 1K9TA 4QWWD 4JPKL 3S98A 4WFGD 3BMVA 3AROA 5D70H 1NBVL 4BSWB 3D25B 4J6RH 4LQFL 4D0DB 3T0DA 5D1XB 4B5EA 3F7RA 4AENB 3HI6H 3BSZL 5LWYL 1MHHA 1L6ZA 3TFKC 1F4HA 1H0DA 2FR4A 3IGAB 2BXZA 4YHOH 4MDIA 4EIZC 1NEUA 1I85C 4S1DD 2W65A 3KXFE 1A6AB 2IPUK 4JZJA 4QRUB 2AEQH 1CDBA 3EO1B 2APVA 1A64A 1XGQA 2VXSL 3RX7A 2Y23A 1KEML 3NZ8A 1H3UA 5F44A 3KYAA 5ENWA 4CADB 4OGYL 1TJHH 1I1YA 2DIAA 4I0CC 1G6RA 1T0MB 5GJTH 1HQRB 5D71H 4YUEL 5GRWA 4KV5F 3ROLB 4JFHD 4LARH 5KAQF 3TF7C 1RZFL 4L8DA 3S88L 3CSPA 25C8H 1VKXB 4IDJL 3WIIH 1KENH 3TJEH 4U7SA 2AEWA 1SBSL 3MCKB 4DVBA 1SM3H 4BZ2H 3WIFB 3QUXA 3A0OA 4NQED 2ZSVA 3BZFA 3FFCA 4XXCA 2P5ED 1OM3H 5GS0H 4PJIA 1U9KA 3B9AA 2DQDL 4PRAB 4MQTB 4I48B 4NUJA 3BRFA 2VLRE 1GZQB 3BD3A 3CZFA 5T1DH 3I75A 2P8PB 3KYKL 3O9WA 2BY0A 2AV7B 4NHUA 4LK4A 4YHLL 5IVXE 1C5DB 1H3PH 1KBGL 1PAMA 2WLZA 4PP1C 5LGKA 3HE7B 3DO3A 5IHLB 3FT4B 3MRKB 3TJHC 1P5VA 4U1NA 4Z77A 1MJJB 1M7IA 2P5WB 1OQXA 4DUXA 3PNWB 1OTSC 1UZ8B 4N90E 4RMUA 1JGLL 2I25N 1IJ9A 2WMPA 3BD5A 2ZUTA 2NY5C 4LKXA 5F70A 1EX0A 2DJUA 1PEWA 3QHZL 2A0LD 1RIHL 3V0VA 2Y07H 1N2RB 1RZGA 1W0VB 1MNUL 4WI9A 2B5IC 4DGVH 3IRPX 3MGTB 2MPAL 4QLRA 4WGVB 1PKQB 4ZFOL 1F4YH 1LE5A 5I76B 4G6KL 3DXAA 5C0RL 2WBJA 4LBEB 3BE1L 4DFIA 3TVMC 1S9XB 5EBMA 1PKOA 3LPGA 3WUWB 4XAKD 1JTOA 3ETBF 1R6VA 3IJYA 3RA7H 5FM5M 1JPGB 3VWKA 1LEIB 2D7MA 2JF1A 2ZCHL 1UXWA 3ARFB 1NL0L 1KLUB 5TFSH 2D7TH 2IBGA 5DFVD 5FO9B 2I5YH 4U1GC 5DJDA 4MA8H 4WENB 3WFDL 1QSZA 2Q8BL 3C6SA 3EYFA 1G9EA 3S36H 3PHQA 3SJVD 5LBSL 3N50A 3K46A 2BJML 4PB9L 4F2MA 5MEND 1KLFA 2NY2D 1MCOL 1PLGL 3NH7L 1NFIB 3Q6GH 1BBJA 3BIBX 4RFNC 4R2GC 3IF1B 5C07A 2UV3A 3FB8B 2NW3A 1AO7D 2YD1A 1Z2KA 1JHTB 4LGRB 4N0RA 1OT2A 1YEKL 3L1OH 4UTAH 4M8VA 4G9FD 3SKUD 1QPPA 1CF8H 4ZPTA 4OLZL 4ZODA 3NZ8B 1AXSB 2XNAA 4Y5YC 3MUHL 2BK8A 1UJ3C 2V17L 3BXNB 4UOJA 1I1YB 4G6AD 3EBAA 1NUGA 4Z7NF 4MVBC 2VDPL 5D7SL 1YMMA 1JPSH 3D3VB 2AK4D 4ZYKA 5DRXB 4NZJA 1N0LA 1KGCD 2VXUL 1RZKH 5JNYB 1XFPA 2ICES 1I9IH 5KVFL 2VB5A 1F6AB 4PJHE 1A6UH 1I3GL 5CSBA 2BX5A 1DN0A 4HUUA 3GK8L 3HAEA 1TJIH 3F65A 3D2UA 3NACH 3H9ZA 4PREB 5IJVA 2QSQA 3QUXB 1YJDC 5GJSL 3NFNB 2XYCA 3FFCB 1X4XA 3BZFB 4EZMA 3PWUA 4Y2DC 2EIEA 3NTCH 4J3WA 4PJIB 1IC5H 1MAJA 4TPRL 3NBNA 4H0HB 3HI5L 4MX7A 3EZ8A 2CIKB 3CDYA 3EO9L 2XT1B 3BEWA 4BYHA 3UTTA 2LTQC 1IGIL 1S3KH 3THMH 2DQUH 4PY7A 5EB9A 3IKCA 4KVCH 4DJMA 1VFMA 1MUJB 3PWNA 4XMLH 4JZNB 5ITFB 4NHUB 4M43L 3MOAH 1G84A 4HEPG 4Y4KD 5GZND 3L5WA 5TQ2H 1KJ2A 3T65A 4MNHA 1MCHA 4I0PA 4XNYL 5FA4B 3ILPB 3U0TA 1NGPL 2CXKA 1IBGL 4PJXA 2BNRE 5HHXL 1EEZA 2DTML 3U30B 1EUUA 4KJQD 2VDOH 4LHQB 2F5AH 4F8TA 4PB0H 5TPWH 4P9MH 5GRUL 4PJEE 3ARUA 3LQMA 1WTLA 4WO4D 1IGYA 4XHQA 2QQLL 5GSRA 3O2VL 1J8KA 4KTEH 5A2LH 1RZGB 4L5FL 5LGJB 2DI9A 1GPOH 3QEQD 4WEBH 5L2KE 3U46A 2BHYA 3QYCA 4YXLL 5BCAA 2WM0A 1JYVA 1N7ML 1T21A 4PJ9B 2WQ8A 1LE5B 1UXSA 1ETZB 4N9GB 3RHWK 3B83A 3WFCL 5C6PB 2V2TB 4WWKC 4GO6B 3SGKA 5GQBA 3TV3L 5CMAA 4IMKC 4Y4FA 3GBML 4LLVA 1QRKA 3S8WA 1ZHKA 4JFEA 3O3DA 4NQVA 3QCVH 4N9OB 1FAKT 4NFBA 2BSTA 2DWDA 1KCRL 1CBVL 2P49B 4WFED 4P9HH 1CD1A 1J18A 3GB7B 1EUTA 4TVSa 4ZXBA 1X4ZA 4M7ZC 1EFXD 3MXWH 4U0QB 4G6ML 1UXWB 3HCVB 2D0HA 3Q2CA 4MS8C 4RNRA 4FQIL 4PJHF 3BIAX 2BC4A 5T1MA 4JEGB 2DD8H 5DK0A 4N8PA 3DRQA 2DKSA 5I1EL 5I1CH 1VFBB 3I6LE 1XZ0A 4GKSA 5KW9H 3WJLC 1YEHH 2FZ3B 2EEAA 3TNNA 3U36B 2WIMA 3MA9H 1AIFA 4XPHH 1CXIA 5KSBF 2J88L 4DN3L 5KSUB 3M17A 5IFJA 4XP9H 4GG6A 3BGMB 5C07B 1KB5H 5KS9A 4EBQL 5FYJU 2E5EA 3LAFA 1EMTH 1P9MC 2XQBL 3U2SA 2YRPA 5C2BL 1WAAE 2GIYA 1NAKH 3IFNL 1CICC 2KZWA 3L7EA 4U7KA 1NEZB 1C1EL 1QSEA 3H0TA 3TA3C 1AGEA 1F4WL 2JB5L 5FUZL 4PP1D 5T1KD 4ZYKB 3P0YL 1OARL 1FNFA 5E08H 3TJHD 3MXVH 3RKPA 3V52H 4YXKL 4FQQA 4N0UB 3X12A 4WI3A 4WW1A 5BO1H 4LOUD 3BGFC 2NLJB 2Y1VA 1GCFA 2G5BB 1I8IA 1S7UB 5SX5H 1AI1H 5IMLA 3D2UB 5FUCC 2EDWA 1BZ9B 3LKRB 1OB1B 5KJRL 4DGYH 1T7WA 3ECBA 3F62A 2J1KA 2VL4A 2XZCL 1ZSDA 2ATPA 4PJDA 4L4VE 4MX7B 1OF2A 3BEWB 4G9FE 4Z95H 2XRAL 4H1LB 2KL6A 3IKCB 5DUPH 4OBSA 3AU1A 1EFQA 4NQSB 2FO4B 5TE4L 2NZ9C 3TVMD 5HDQL 3BAEH 4NPYA 3TT3L 3L5WB 3MLWL 5BRZA 1DVFA 1KJ2B 1MF2L 3QA3A 1ES0A 1FVEA 15C8L 3GHEH 4OF0A 3CLFH 5BV7B 4PY8J 1T0PB 4HKXA 4UNTA 3FB5B 4WI7A 1HDMB 5F89B 4MNGE 3MBEB 3OKOA 4KI5C 3QNZA 5CJ8A 4YBHA 4P3DA 5D6DC 1R5WA 1SJXA 2O26U 4G6JL 4Q9RL 5D7LE 1PX4A 3FQWA 1JIBA 5B38A 2HMIC 2FIKB 1MFBL 1LEKB 3CVHL 2BNQE 1A6VH 4LNRA 2HVKA 3MV7D 1W8OA 3SDDA 1INEH 1JVKA 1H5BA 2QQNL 3GGWB 5F9AC 3KPPA 4U1IA 1WAAF 3BP4A 4YFDB 4HULB 2DLTA 3LKNB 4JZJC 3O3DB 2ZUUA 4WI6A 5LKNA 4NQVB 2NMSA 5EZIL 5GISL 4WY7L 4BSVA 2WUBL 3HZKA 4YDIL 2BSTB 1KG0B 3R0NA 5IFHL 3D39D 1CD1B 1ZT7A 5ANME 4ZXBB 1BGXL 4UT9L 3OR6A 2ZG3A 5JORA 4I77L 3L6FB 5CZVL 1T1WB 1M7DB 1J88A 1JFQL 1OWWA 1QSVA 2ZCKH 4EQ2A 4MVBD 2J2ZA 2QQKH 2VABB 4RNRB 5DUBA 4KHTL 5AUMA 4JO4H 2BC4B 2VXTL 3NFSL 4JKLA 5TQ0L 1IC4H 3KWWA 4G80A 3DV4A 1LDSA 1AXTH 1EK3A 3O45B 2R4RH 1IKFL 4H25A 2BOBA 1J8HE 2APFA 1J1OL 1RUQH 2VC2H 3TNNB 1I3RB 1A22B 1AIFB 1MI5A 1TNNA 4Z5RA 3M17B 4FOMA 2AJSH 4URTB 3IB4A 5IFJB 4GG6B 1A5FH 2IC2A 3QDJA 5KS9B 4Y2DD 2GFBA 1DANU 4OKDA 1OTUC 1GIGH 3VXUE 3U6RB 5JXAH 1R3LB 3IXTB 5DZLA 3SGDI 5IIEB 3MV8B 3U2SB 4UDTA 4OFIA 1A7RL 1RIVL 1TVHB 1Z0MA 2OR9H 3SDXE 3WMSA 3EOTL 2ADFH 4FZEH 1MFEH 4OIIH 4WFEE 3H0TB 4EDWL 3VWJC 3O9WC 1AGEB 4E41D 5ALCL 3L5HA 5HYSB 1F3DJ 4HS8H 2MCG1 3L5IA 5I1JL 1FFPA 1S7RA 4FQQB 5HYQB 5GXBB 3X12B 2B2XL 1RUMH 4QTIL 4WI8A 5L0QC 3V6FB 4PRHD 1R5IB 1BJ8A 4K7PH 3I02A 2WBKA 4KK5D 5C0CA 3UTPE 5IMLB 4QNPF 3H7BA 5D6CB 1UWGL 4JGJA 4Q58C 4WJ5A 3K81A 5L88H 4LVHB 3ECBB 3Q5YA 2C3XA 1NMCB 3TNMA 1ZSDB 2C1PA 1QZ1A 2YHGA 3K80A 1WLHA 5IHUH 5FECA 2HT4C 3O6FA 2NNAA 2LV4A 4GQ9H 1NCWL 5DJ6B 5ISZE 5DK2A 3F58L 1HI6A 5IOPB 4GAGH 3BKCL 3OMZA 4NC1E 2EXYC 3RL1B 2WBJC 1MRFH 1FGNH 1R24A 3QXDA 4PJ5A 1CFNB 1OQOA 3NFPB 4NPYB 1WZMA 4Z7UA 2I24N 5EU5A 4HX1A 1QQDB 4UV7H 3GIZL 3RWIB 4OLYL 1FYTD 4OZGB 3UYPA 3QH3A 5EBLA 1FH5H 3DX9B 3VWKC 2EDTA 2EDJA 3FT3A 5JMRA 2E7LC 1RZ8A 4MS8D 5D2NC 4POZC 1AGDA 3QNZB 1A7PL 1R5WB 2FX9L 4OFYA 2JCCE 2VDRL 3KHQA 4MWFB 4M6OL 3MNZA 5F7YC 3UTZA 3ZDZF 4QHNA 4OSUL 3C2AL 1XGYL 5CEZL 3KPPB 4C56E 2OR8A 3BP4B 4HPYH 5EDXA 3SDXF 3RWDA 2R29H 2GYSA 4LHUD 4C83A 4BA8A 2W9DH 2DS4A 1PBYA 1FLRH 3QG7L 3SJVB 5HHME 4U0RB 4BSVB 2C3GA 2Q76A 1OD9A 3HZKB 1I3VA 3I9GL 3FB6A 4WFFE 1CICD 3GMRA 4RISL 3TA3D 5GS1A 3O11B 1JWUB 1FG9C 5D7JA 1AO7B 3ZL4H 4J7RA 3KWWB 3DV4B 1MCCA 2DQIH 4WW2C 3GSNL 5FF6B 1UM4L 3BDYL 1B2WH 2DMCA 4H25B 4GKZA 3SO3C 1H15B 4H5SA 4OCLC 3VW3H 2VLKA 2R69H 1BFVL 2IADA 3QWOB 4Z5RB 4DW2H 5KVGH 1NLBL 3HPLB 5ICXA 5B3NA 1F58H 2VKXA 3E6FB 5JDSB 5ESVA 5I73C 3TBSB 2VSDA 2DB8A 2GFBB 1LQSR 1W8NA 4GH7B 4C4KT 2R4SH 3OX8B 4ODUB 1XF2A 4ZPVB 4E9LA 2V2WA 2XWJB 4OM1L 4UDTB 5E00B 1MHEB 2EKSB 1S9VA 2JIXA 1NCAL 1WZ1H 1MVFA 5IBLD 5I30H 4OZFH 1KJMB 3VH8B 4GMSH 1NDMB 1LP9E 2NZ9D 1LO3H 2W38A 4K7PY 1N8ZA 3EDFA 4XAWH 4ZAKC 1O5DT 3LCYA 4LSUL 3I85A 4IJ3C 1S7RB 3VRIA 1HINL 4I0PC 2YPLA 2HG5A 2K7PA 3T8XB 5C08E 5BZWB 5JHLH 2LABA 2EH7H 3FOLB 1K5NB 2E8YA 5C0CB 1S8DA 4R9HA 4KI5D 2KQMA 2AAVA 2PW2B 4OF6A 4WJ5B 3SPVA 1EVUA 2GTZA 5D5MB 3IDYC 1BOGB 4GMTH 3WHXB 4F57L 1NMBL 4M1CC 3LIZH 4P49A 4GUPB 2HMID 1QLRA 3KAAA 3NAAH 3RL2A 4MJ6B 4UB0L 3O6FB 3WFBL 5A16A 3G04B 2ZG1A 1EO7A 3PGDA 2QR0A 3TCXA 1T66C 2LAAA 1HI6B 4Z7QE 4TSBL 1NMAL 3CH1A 5K93A 1E0OB 4MA3B 4WO4B 4Y4FC 4PJ5B 1DQML 5DRWB 2W0PA 2BERA 1JV5B 3MOBH 4B7IA 5J1TC 1U58A 4N0CC 1KB5A 4HX1B 5HD8C 3QEQB 3QUML 3VXQA 1WCQA 2A1WH 4R90L 4RRPA 43C9A 4XZUA 3NGBB 3QH3B 1IFHL 2ERJC 3NA4A 3GIVA 1P6AB 1RZ8B 2G9HA 1T03H 4HWZA 5D93C 5C0JA 1AGDB 4YGVA 4JY6B 5F6HJ 4S1SL 3MODL 3H9SA 4I18C 3KPSA 1BD2D 1RJYA 1BVLB 4X6CB 5IK3B 3UJTH 1SEQH 4HIIB 1FNEA 3HI1A 3QNXB 4K8RH 5H94A 1TQCC 3EDEA 1DSFL 3HAEG 3IDMA 1I9RH 2XKNA 5FGCB 3KJ6L 4ZUVB 1FDLH 2AV1A 4M6AA 4K3JL 1IM9D 2XZZA 4O58L 4E42A 2AABH 1OTUD 2EEDA 1YY9C 1CFVH 3LB6C 3HRPA 4TUOA 2B1HH 1WVZA 3MLXH 4X4MA 4PGZA 1J05A 1KCSH 3WHE1 1NPUA 3G5XA 3VWJD 3O9WD 2B0SL 5J56B 4QXTA 4YXHL 2VTFA 2J3SA 4HLZG 2DQEL 4BKLB 4L8CB 3VMOA 3RFZC 3KPMB 1CK0H 1NFDF 1JP5A 4WNQA 5HDBF 3ZYZA 5DTFB 1UYWL 4HJJH 3SE9H 4GKZB 3V6ZB 1F4AA 2RFXA 1LO0H 4H5SB 4LU5L 5FGBC 1OLLA 4WWID 4IOIB 4DKFH 3O4LA 2F53A 5GGTA 3OAYH 3RVUC 3EFFA 3EYSH 1ACYL 5L7XH 4LSRL 2O5ZH 3RRQA 3BFOA 2HT4D 7FABL 1T4KA 1X4YA 4U6VL 2V2WB 5JR1H 2ZNXA 4RMSA 3RGVB 3WJJA 2JIXB 1OT1A 2I27N 2WUCH 4X6EA 1EH9A 5GGSY 1JGDA 4JFZH 5IW6A 2JJVA 2F8XC 4O02L 5DWUH 2EXYD 4LSSH 3DXAD 4QCIA 1LO4H 4BZYA 4KJPD 4O4YH 1B3JA 5C86A 5E94B 2RCSH 1DVFC 4G6FD 5CGMA 4I3SL 3CC5A 4NN6B 2BMKA 2R1XB 3G5YA 4GXVL 3VWKD 4M03A 2HH0L 4UBDC 1OWRM 1XR9B 2P5WE 3WFHB 3UPRB 2ADGA 3LV3A 4JM2B 3S4SA 5LGHL 3UTSA 5FUCE 5SWZD 2F5BL 5DD0L 5K9QG 2GTZB 3LHPL 1LHZA 4CBPA 2VRAA 1V7MH 2KKQA 2J5LC 2MNUA 2LU3A 1Q1JL 1VPOL 4OZIA 4QRQA 4TN9A 4NWUH 5A16B 2RQ8A 4CDGC 2CLVB 3SDDC 2QR0B 4CN4A 3G5ZA 1MWAL 1AQKL 4F9LA 1H5BC 4NUGL 4K55A 4OJFH 5CJQH 4PJ8A 1ND0A 1CLZL 1SY6H 1N6QL 1PKQE 2NTFA 2ZOLA 4KRMB 4FXGB 3LEYL 4FHBD 5EZOH 1GYAA 5HYJB 3DVGA 4OCSL 3ZTJG 2FHFA 3MBXL 43C9B 3U9UA 4XZUB 3EYVA 3OKDB 5E9DA 5J11B 3UO1H 3VD7A 4JO1H 3J7HA 5IBTL 3MRQA 4Z7VB 5C2UB 5CINL 3NABH 5E7BA 5C0JB 1T1YA 4YGVB 5IEKB 2W0FA 4P4KA 1YYLH 2GCYA 2PNDA 3MCG1 4ORGA 4HXBL 4PJGB 3HG1A 1RJYB 3O2WL 4RGNB 5D1QB 4L1DA 5HGDB 4AH2B 4Z0XA 5B3JE 2APXA 2OLDA 1WFOA 2CXGA 1JTPA 4R0LB 4KTYA 3VXSA 5HYEA 1U42A 4S1QH 5TDNB 1A0QH 1A14L 5DI8B 2F58H 1OP5H 3BO8A 2M8XA 5KVEH 4WUKL 4MCYA 1UENA 2OBGA 4HH9B 3VDBA 4NN5B 1CGXA 3HRZA 5J1AA 3VG9C 5BVJA 1CE6A 3QNYA 4K7FA 3UTTD 1KEGH 4TUOB 4HIJB 1Y6NR 1FG2B 2EC9U 4ONFL 3NMEA 3WXWL 3ZKMC 1Q9LA 1E6OH 1CFTA 4QXTB 3HUJA 3V6BR 5E2UL 3LRGA 3OXRB 4ZAKD 2DQCL 3UYOD 4MXWL 1DP0A 3D3VE 1BVKB 4PRIA 4PV9A 2NX5A 4I0PD 4TUKH 3X3FH 1T3FB 4YDLC 2X1PA 2X9WA 4P5TA 4U33A 2XFXA 4FQHB 1A21A 2RFXB 5F7KC 1R3IH 1I7ZA 4P2RA 5CP3H 3ULVH 3O3AA 3CNKA 4Z7WA 5JQHC 3O4LB 1DQJB 3EFFB 5J12B 1IAIH 1LEGA 3QXAB 4JJHA 3UDWA 4E41B 3V6OC 4OT1L 2V2XB 1NQBA 5SX4I 4GAYA 4M1CD 1N4XH 1ZS8A 4MB3A 1W72L 1MREH 5B38G 3FFCE 4V2CB 4PJIE 2WZPD 1T66D 1NCCL 4NO0D 2CIIB 2Q6WB 5BVPL 5H35A 4LGPB 1JGDB 1OAZH 1XAUA 2VDMH 5HHVL 5IW6B 5J0BA 1I8MB 1JE6A 5AWNL 2IPTL 4Y4FD 1MJUL 4JFED 4MGXA 5E8NA 2F9BT 4FQXA 4N0CD 4P4RA 4DAGH 2LVCA 5HD8D 1F2QA 2QHLA 1BX2A 3T2NH 1DR9A 1F6FB 3U82B 2VDLL 5GRXG 1HYSC 5J06A 2BMKB 3G5YB 1ZV5A 2NY1B 5DEGA 1LK3L 5C3LD 4KI5F 1AD0B 3IDIA 1MH5A 3I50H 4PBXA 5B3JF 4KJWC 3OTTA 3TN0C 4BFEA 1YQVL 4OD1L 2AEIT 1KNOA 4XPAH 4LCCA 1YNTB 5ESAA 4PS4L 3MREB 4WU7B 2NYYC 4OZIB 3E8UH 1RJZA 4Z7OE 3M8OH 3MRFA 2YKLH 2HKHH 2I60L 2R0KL 5C8JB 2NY5L 4U1LB 4YZFE 4K71B 4NBYB 1SVCP 4XP6H 1OP9A 1WFTA 3FO9B 2EDOA 1CQYA 1KJ3L 2NTFB 1YY9D 1KSRA 3DJ9A 3LB6D 1G9MH 2AP2A 3EFDL 4M61A 4JQIH 1BM3H 4X7TB 1X6NA 2Z91B 4WUUB 1QR4A 4TTGA 3AXLA 4XNMA 3GMMA 2OR7A 1A2YB 4JRYD 3EKCA 5GS1C 5IKCA 1T1YB 5D7JC 1BAFH 1C5CH 4OZFA 5TDOA 1GAFL 4LHUB 3BH9B 3HG1B 3O3EB 5FO7A 5SX5K 3JV6A 4PRNB 1FO0B 5GGRY 4XNXH 3LEXA 5JIIA 1EO8H 4OD3L 3T0EB 5A1AA 1CGSL 4MAYA 3S5LA 2EDDA 1VFAB 2AXJA 4LSVL 5GGSA 1ZANL 2XG4A 4UMGA 2IBZY 3RVUD 4U2YA 3VXSB 2W92A 4JPVL 5JHDA 4ORZC 2IFGA 4PJIF 5DJ8B 3DURA 1U41A 1K2DB 3RVVC 1EEUA 4MCYB 4NP4L 1JZ3A 3PHOB 5C07E 1EVTC 4RQQA 5C3TA 1CE6B 3HTLX 3U4BL 4K7FB 2ICWA 4EUPB 5HHOB 4ZS7H 1U8MA 3NIFE 2R9HC 35C8L 2R2HA 1HH9A 5ADPL 5C0IB 3VXRD 3OKNB 4TNVK 2R8SH 3I6GA 4KQ3L 4UTBH 3D85D 1X5IA 3HUJB 4NYLB 3EUUA 1CIDA 1G7JA 1YMME 4PV9B 3LSOA 2NX5B 5E6IB 3UP1A 4OI7A 2EYTB 3HLAA 3PUCA 4UBDD 2XFXB 4KDTC 4ZDHA 2Z31A 4FP8L 3O3AB 2VJXA 4P9HC 4OCXH 5EU7E 4RAHA 2EDQA 4ELKB 2QSCH 4Z7OF 3PE9A 2ICEA 3QXWA 1I1FB 4NC2B 1ZS8B 4YZFF 3PP4H 1XF5A 5IQ7L 3JBG7 4Z9KB 3HE6A 4F3FB 3WNOA 4M7KH 1SEBA 3CLEH 4NBXB 3SDDD 1NANH 3N9GL 2R56L 4JZOA 2AXFB 3R1GL 3C8KA 1HHHB 5H35B 5TE7H 4I3RH 5FM5O 5GGVL 5C7XL 4AMKL 3QBTB 4K94H 3SE3C 3INUL 3P11H 4HK3N 3RTQB 1ORQA 4P4RB 4FQXB 5E8NB 3T09A 1BX2B 5F6IB 2SEBA 5MEPB 1T5XA 1JPTH 2EYRA 2HFGH 3QCUL 3QQ4B 4GG8A 4ONGH 4A6YL 3QAZB 4PTTA 4YDVB 1INDH 1U91B 3IDIB 3ALWA 3QFDA 3DUUA 4PJXE 2W07A 4PJ7B 3SKJH 1T2JA 4FFVC 2BSED 4JE4B 3BUTA 1JNNL 1KXTB 3LOWA 2JE8A 4LCYB 5HI5C 2D7QA 4XC1H 3MGAA 1HKLL 5I8OH 3DETC 1NGXB 5INDA 1CL7L 2R0LL 3QIWB 1EHXA 1DBMH 4AIOA 1MI5D 2FLBT 1XT5A 2XWTA 3AREA 3LD8B 3B6SA 2A6DA 2XV6B 3QDJD 3HC4L 4UUJA 4NJ9H 1PEZA 4HZLA 4ODVL 4JHAH 4HCRA 4NRZB 3PDGA 2NY4B 3MRJA 1X5KA 4JFEE 5DJYA 2AJZB 2VZSA 3RWJB 3LMJH 1MELA 4KVNL 1H3WM 1Q9WA 1HHIA 2Z8SA 3U7WL 3GMMB 3ZKMD 3MRCB 4WHYH 2CQVA 3RNKA 1E4WH 2I07A 1S7QB 3V4PL 3H3KA 4N5UA 1E28A 4UINH 3VFTB 3QEHA 4WW2F 3N0PB 2MQCA 5TDOB 5AZ2H 2K1MA 1U3YA 4RSVA 1AGBA 1YEGH 5HPOA 5KTEL 2XTJB 1X7QA 3JV6B 1OHQA 1U95B 3BWAB 1CTOA 3LEXB 1R3JB 3W0WB 1OTTC 1YNLH 3S5LB 4MAYB 3MLSH 1A7QH 4NZTH 3PQYA 4M7JL 3P9MA 4H26A 4C57C 5F7WC 1LD9A 1IAOB 2W1NA 5GGSB 3QO0A 5HPMA 1T7XA 1NDGB 3PGCA 2OK0H 1QBLL 4YHML 4GG6E 4XVTH 4HS3A 5KS9E 2VN4A 2H32H 4R26H 1ED3B 4Y7MA 3KPLA 1U8MB 1IAIM 1G9NL 2PXYA 1MQKH 5DSCB 3DSFL 1CDGA 4JRXA 3JWOC 1JUFA 1QSEE 4YR6A 2PW1B 4TQEL 3CFDA 1G7JB 1SY6A 4KMTH 3LSOB 2YEZA 1D6VH 1HYSD 1ZK9A 1E27A 3PWJA 4PJXF 3V79C 4OV6F 4DN4L 4FFYL 3RNQB 43CAB 2Z31B 3UC0L 3HZMA 5DJZB 5IBUB 4KJWD 3TN0D 3W2DH 3UBXA 1CLYH 4N0YH 2QEJA 4OZ4B 2P48B 3BP5B 2NYYD 4PJBA 4F37K 3HE6B 1FVCB 5KVDH 4PJDE 1SEBB 3DUSB 4X7SH 3K7UA 2NY6C 1XF3B 3OZ9H 4JAMA 4F9LC 2FB4H 4HFWA 3VFNB 4HG4K 5SWZB 4QYOA 1YZZA 1KPRB 4PJ8C 1QRNA 1I3UA 5HHQA 3QUYA 2A73A 4M1DH 5LQBL 1ORQB 1XGPA 1ZT1B 1CQKA 1AY1L 5GGRA 3EYUH 3T77A 1N0XL 1T5XB 4R8WL 3QT2A 5BRZE 1DLFH 4I1NB 5HVHB 2EYRB 3LY6A 1U8KA 4L29B 4OZGE 4PTTB 2EIZA 2V9RA 4P59L 3C09C 4X9HA 1DBKL 3DUUB 4P4KC 4XPGH 1QKZL 1BIIA 1KCUL 4XVJH 2VAJA 4E5XA 4EEEA 3PWVB 4YQXH 4XPTL 2P8LA 3BN3B 1Z6JT 1IC7L 3QIUA 4JGUA 2G60L 5INDB 3NZHL 2VH5L 3LH2L 1KN4H 4NN7B 4BK5A 4QOKD 3ULUH 4JKMA 3VFRB 1DQDL 3LRHA 4IOSD 1CDJA 3B6SB 1HZHL 3B9DA 2A6DB 4LIQH 5CGTA 4JQVA 1KIQB 5CP3A 4YDKL 3RVVD 1WZLA 2NW2B 4IRSA 4RFEA 1M1SA 1UWXH 3CPLA 5T3XH 3MRJB 4AT6A 2OTWA 2R9HD 9CGTA 3VGAC 3LZFL 1Q9WB 3Q3GA 1HHIB 3WKMH 5I6XB 3B9KA 1QYGH 3RNKB 2I07B 5DJAB 2E3VA 3S36X 1K4CA 2Y7QA 4CJ1A 4R97C 3OQ3B 5GRVK 4MNQA 1CCZA 4RZCA 4KH2A 4XMKH 3LN4A 2WLYA 3MRNA 4APQB 2YPLD 5CFHA 3G6DH 1G6RL 4P5TC 5CBEA 3WN5C 5I71B 4ZD3H 2AJXH 5BXFB 4H26B 2YZ8A 3CMOL 1ORSB 1T5WA 2NXYC 4QT5B 3T04D 5JOPE 1TIUA 5D9SA 3S4SG 1OAYL 1BEYL 1A9EA 4PJDF 1MCFA 3HNSH 4HF5H 5TF1L 2V5TA 4KQ4L 4QRPB 4YC2C 3QDJE 4HS3B 1NCDL 1S7XB 3BPCA 4OFVA 3RU8H 1CL7I 3QFJD 4BK4A 4LPTA 3FRUB 3LQAH 3D9AH 2IQ9H 1GRWA 4LLYB 2PXYB 3BKYL 5DRNB 2GSIA 1U8QA 1G1CA 4ZUUA 3GO1L 1DBJL 2OQJA 4NQCD 3U79A 4FQ1H 4J12A 4PJFA 1NGYA 1D5XA 3CFDB 2FGWL 1AGCB 3WE6B 3PP3K 5IFAH 1TPXC 4P57A 2YEZB 4ZTOL 4BH8B 1RUKL 1KYOK 4GS7B 4TSCL 1JGEB 3HZMB 1FORL 4Y5VA 3DVNB 1DFBH 1VB9A 4FFVD 2QADB 2V5SA 4D3CH 5C0CE 3H9SD 2BSSB 3S34L 2FSEB 5HI5D 4YGAB 4LCCC 4UAOB 4YO0B 3QDMA 4XCCH 5MHSE 3EIFA 4NWTL 4X4ZA 1FNLA 2DKMA 4F7EB 3P77A 2B8OT 3MRHA 2DOCA 2O5XL 5CSZA 1FNHA 3E2HB 2C7UB 3HR6A 4YHPA 4QYOB 3MX0A 1QRNB 4UV4L 3UPAA 4JG1L 5C1MB 1DE4A 3EGSA 5IF0A 4D8PA 4PJ5E 4G7VL 5GGRB 2EDKA 3T77B 4Z7UE 1T7VA 1R5VB 5IESL 4NQXA 5FEBA 1U8KB 1B4RA 3PWPA 3KNBA 4MSWA 1MRDH 5EFIA 3E0GA 4BSJA 2O93L 1AC6A 1CXLA 4RIRB 4E5XB 2DDQH 3OAYK 2P8LB 1KLGB 4JDVB 1OTTD 3GMOB 3RJDA 2BVOA 2H9GA 4K07A 2F53D 3EOBB 4UNVA 2IG2H 3ARBD 1JTTA 5FGCE 1JF1B 2P24B 1J0HA 4RFEB 1XCQB 4G8IA 2VLJB 4Z0BH 4NRXB 4ODXA 1FN4A 3MZTA 4AT6B 1PYWB 3Q3GB 1YEEH 3B2VL 3QXTA 1MFAL 3WLBA 4U6HA 4UT7H 1OCWH 3Q48A 3CCHA 4HIXH 4JFYB 3KPRA 3BKJH 4FA8A 5CUSL 3LN4B 5C0AD 1N6VA 3MRNB 4S2SA 1LE9A 4WTWA 2XQYK 5K59E 1YPZB 5CBEB 1FPTL 3VXRB 2V9TA 2EIBA 4JFDB 3TWCH 1DLHA 1T5WB 2W9EH 3EOYG 2VLKE 5D9SB 3F5WA 4N5EC 1A9EB 3TT1H 4N0FA 4V1DA 1IC1A 1EZVY 1QFUH 4NQDB 3RDTA 3QRGH 2ESVA 2Z8RA 1P7KA 3GHBL 1NC4D 1S9YB 5C0EA 4N8CH 2LFGA 2J8UA 1GGIH 2NY6D 1CZ8H 3L3IB 1N5YL 4X98A 1F8TL 2ARWA 2R0ZH 4K8RC 4U3XA 1QFPA 5KBNC 1CG9B 4L8SC 5CWSA 1U8QB 3FT2A 4MD5A 4LDOB 4M8QB 5D7IB 2AJYL 4PJ8D 2OQJB 4M7LH 3PIQB 4Z7UF 1KCVH 3ARTA 4PJFB 3DPBA 5KOMC 4KUZH 1J11A 5LXGL 4WCYL 1NGYB 3CFKB 1CWVA 4OZHA 3BHBB 1X5LA 1BJ1J 3FN0L 4P57B 4C54A 2FEDC 3O2DH 2CRMA 5I66B 2YPLE 1ZLUH 1G7HA 4POUB 4Y5VB 4S10A 3IFPB 5DMIL 4P4KD 4OZFG 5D1ZA 2GY7B 5E8DL 3C5ZA 5DD3L 4P23B 3QPXL 3SBWA 3NPSC 4JY5L 2JELL 2HT2C 5DMKA 3A67H 3S5LG 3V5DA 1OSPL 4NM4H 4KXZH 3MRHB 3C6LA 3HHRB 5CSZB 3AREC 2OTUB 2YXMA 1IGCL 1ZA3A 3GI8H 4HGWB 5DRZB 1GJIA 1DE4B 3STZA 3EGSB 3V5KA 4D8PB 4WTXA 1FRGH 2E27H 5I8CA 1DUZA 1YEIL 4UIKH 4ZFGH 4XP4H 2H32A 1FIGH 4Q9QL 3IDJA 5DQDL 4NNPL 1NUDA 3P4MA 4P46B 3DVFA 1L0QA 4ALAH 1KT2B 2Y06H 3SE8L 2Q8AH 3DI3B 4WDIA 5F9OH 5EU6A 2Q86B 1U36A 4PLJC 4QRTB 5FV1L 4U1SA 1QFHA 4PRID 5F96L 3D69A 2Z35B 2FX7L 4PJGE 1QEWA 4LSTH 4IM8A 3KPSE 4P5TD 4RGNE 3TLRA 4JREC 4PPTA 2BVOB 1N6UA 4P2RD 1TETH 2NXYD 3FQTA 5DLMH 2GJ6D 4ZTPL 3BVNA 1PSKH 4XB7A 4WV1A 4LAQL 4RWYL 2N4IA 4G8IB 4TULH 4ODXB 4L9LA 4KAQH 4RFOL 3BPNC 1I4FA 1A3LH 3WKNA 4JLRB 3QEUA 3EDDA 2IH1A 4ETQB 1IGFL 2E7MA 2OL3H 4X4ME 1MIML 3L95B 1HXMB 3AS0A 1V7NH 3FQUB 3O8XC 2JJSA 4L3EA 2IMMA 3BT2L 3CCHB 2DQFB 5IVXA 3QISA 4FFZL 4YPGA 3U9PL 4H8WH 1JPST 4J1UA 4MQSB 1R0AH 3T4AA 1VCAA 1KELL 5CCKH 2X4RB 1MFDL 3V4UH 1KULA 1X5JA 2RB8A 3NN8A 1DLHB 1YYMH 2P43B 2BY3A 1KC5H 3RP1A 4FNLH 3F5WB 2ZWLT 1B6DA 4PTUA 3O4LE 1RPQA 4V1DB 1D5MA 1UB6B 8FABA 1T20A 5JIKA 4YX2H 2I9TA 5DC4B 2R0WH 1URLA 1FZKA 1P7KB 4FQLL 1F11A 5C0EB 1KJVA 1K6QH 4GW4A 5FA3A 4XXDA 3SKOA 3DMMA 3EYQC 3SGEH 3VJ6A 5IW1B 2AEPL 1CE1L 4X98B 1Z3GH 2X4QA 3RUGB 1K4DA 5ACMA 3MR9A 1FFRA 4QTHB 1JHKH 4FZ8H 1K3IA 3NCYP 2DM4A 3IFOA 3QUYC 5D70L 5I0ZA 4K7PX 1BREA 4J6RL 4HFUH 3QI9A 1D5BB 1A3QA 3GDBA 3MRIA 3QHTC 2Q87A 1C16A 3N85H 1ZVSA 4HUVB 2VLMD 4YHOL 3ARDD 4OGXH 3RY6A 3UJIH 5CJXA 2GY5A 2UWEA 5D2LA 1S9KC 3O6KH 3GSQB 2AEQL 2RR3A 4HKJB 1A6TA 4LPWA 3UTSE 4U1KA 4LRNH 5EO0A 3QIUC 3OBAA 2FYYB 3V5DB 4AL8H 4JPKH 1NGQH 4OZIE 2CLRA 1BZ7B 4JM4H 1A6WH 3MLUH 1M71B 2VWEC 3OPZH 2DLHA 5F1NA 4PG2C 1HNFA 5AD0A 2VN7A 5GJTL 4UZGA 3DROA 5LWYH 2P8MA 5D71L 5MEOA 3ULVC 1I1AA 4OB5H 2ZSWA 5IHZA 4LARL 4IRSC 1ZA3B 1IZJA 1MLCA 3NIGF 1N26A 2E6JA 2UUDK 25C8L 3ES6A 4NKOA 3SCMC 3WIIL 1KENL 3TJEL 3ZKXB 5I8CB 4KZEH 1SM3L 2WWKO 2H32B 4BZ2L 1NJ9A 1S7VB 4WUUE 3B9KC 5EWIH 1QNZH 5C0BA 5E9DE 3QUKB 2X7LA 1PVHA 1OM3L 5AAWA 1OLZA 5GS0L 4LSQH 2ZOKB 4TTDC 3DX7A 4KHXH 1J0IA 4QHLA 5F8RC 3K1DA 3WYRA 1QVOB 3HG1E 1R3KA 2C26A 5EOCL 5KN5B 4MLSA 1Q9KB 5JXEA 3BJLA 3RZWA 5T1DL 3T0EE 4KK9C 4IDJH 1NC2A 1YEJL 2XI9A 2YD8A 5I74B 5ITBH 5EOQH 3UBXG 1MJ8H 5FB8A 4HSQA 4X7CC 4P2YA 1H3PL 1FQ9C 3VXSE 3KLDA 5J7CC 4WI4A 4PRPB 1RU9H 2CLZB 2HT3C 3U7AA 3MRDA 2YUZA 2LQRA 2F8VA 2D9QB 3KS0H 4L9LB 5IEHB 4YHYC 1BPVA 3CFBB 4R4FH 1I4FB 4OI8A 5DMGC 4K8RD 3QEUB 5HHOE 1XH3A 1EAJA 3LN5A 2H6PA 5L8LB 4U6TA 2XTLA 3SGJA 3MUGB 1JJUA 5F88B 1MEXH 5T5FH 3HUJE 4XBPA 4L3EB 1SMOA 2Y07L 2W60B 3QFJB 4J1UB 3CJJA 3T4AB 4DGVL 3MGOB 1RJLB 1VERA 2FEDD 1WQVT 2DJ4A 2NX5E 3P4LA 4X8XA 5B21A 3W9EB 1G9MC 3SKMA 1NGWA 3WUZA 4XCYB 4NQCB 2BNRA 5ADOH 4P2RE 4UU9A 1E4XL 4FXKB 4XCNA 1D5MB 8FABB 1UB5B 4PJEA 2I9TB 3BDBA 5I16A 1FZKB 1MCNA 1D9KD 2YWYA 4KDWA 4BFBD 4ZQKA 3RA7L 4XXDB 1YQ2A 3DMMB 1FHGA 1FSKC 5K9QI 5TFSL 3ARED 5DDHB 3MLPA 2D7TL 1A47A 2I5YL 5IW3A 1QHOA 3OF6A 4MA8L 2RIKA 4J3UA 4R4BB 3S36L 1TZIA 3EW3B 4IIQA 2C3VB 2UZIL 1G0XA 3QJFA 4UOW1 1T0NA 3T2PA 3Q6GL 2IBBA 5E5MB 1C16B 3B2UD 5HVFB 4HS6B 3FTGA 4RAVA 4Y19A 5HXMA 3B4NA 4PLJD 1CU4H 3I2CH 5D2LB 5L8JB 4CMHB 2ZCHH 4RMVA 4EOWH 1NL0H 2ILLA 1A6TB 3L1OL 4UTAL 4PJ7E 3OHXA 1CF8L 3OL2A 4U1KB 2JKXA 3R06A 5BS0B 4PJCA 5DHVH 2EIDA 5DFWH 4B0MM 5JQ6H 4ENEC 1TTUA 2F19H 1LNUB 1NKOA 1JPSL 2P8MB 2DRUA 5C0DA 5KSAB 1I1AB 4F33A 2ZSWB 5IHZB 4W4OC 1NAMB 2EDXA 1MLCB 5TH2A 4XWOC 5IROC 5HHPA 5I18H 1A6UL 3ES6B 4NKOB 4LCUB 2ZP0T 1TFHA 3HZVA 1CXKA 1TJIL 2GJJA 4TOYH 1MHCA 3NACL 3EJJX 4JRXD 5GGQH 3ARBB 4JFFD 1SYSA 1U92B 2C1OA 3O8XD 3NTCL 2CUHA 2QTEA 1CDCA 3DX7B 2ORBL 3ZZ1A 1QSFD 2VDPH 2Q7YB 4N8VB 4AEIH 3BRGC 3BW9A 2YC1B 2XTJE 1S3KL 2ED8A 3THML 4XX1G 5JIPA 1WWAX 4Z7WF 4YBLC 5TGBA 2FBJH 4KVCL 3W0WE 4TVPH 1BQSA 3DTXB 4XMLL 2DQJH 1I3GH 2PO6A 4XNUL 3O2DA 3MOAL 4W4NA 4Y4HA 5FO8A 5I9QC 5TQ2L 1IAMA 1ZHLB 5JHDE 3IJHA 3RDTC 3GJEA 1U3HB 2FHCA 2MWCA 1FV1B 4EQ3A 4M6MH 3FFDB 2P46B 4OM0H 4ELMA 3TO4D 3T1FB 2VDOL 3RIFK 4PR5B 2F5AL 4PB0L 1QO3A 2JTDA 4PYHA 1QLEH 4F37F 3QUYD 1JGUH 4QHMA 3BJ91 4KTEL 2X4UA 4D0CB 1GC1H 5E4EC 2MJWA 2DTSA 4GKNA 1GPOL 4WEBL 5T1LA 4LLDB 2BVQB 3OKMB 1RMFH 1BFOB 5EZJA 4KPHL 3IDXH 2FBOJ 4NQTA 3SKMB 1LK2A 1ZLVK 4DOHE 1SQ2N 5IVOA 1Q94A 3A6BH 3GSRB 2WIIA 5D1ZC 3QCVL 4F7MA 3C5ZC 4QRRA 1DUYA 3SBWC 1AHWB 2A77H 3QIUD 4I0KA 2CJUL 4P9HL 2Q3ZA 5DEFB 2ZJSH 4PP2A 1PY4A 4ZQKB 4YIQB 2QQLH 5F7DA 3HFML 3ARXA 3TBYB 3MXWL 4GJTB 1UWXK 2A38A 1AJ7L 3C6LC 2A74A 4JO2H 3RBGA 3ULVD 2DF3A 4KTDH 2DD8L 1JZ6A 5IQ9A 1QPXA 2MMXA 4HJ0C 4IRSD 2X4PA 4X4XA 3QJHA 3JTSB 3WFCH 4B53A 5I1CL 1RURH 3VXMB 3SCMD 5KW9L 4HPOH 1YEHL 4IIQB 2Z92A 2F54D 1V3JA 1OAXH 3MA9L 2DLFH 4XPHL 3VXPA 3KHOA 3B9KD 3DYOA 4PJAF 5ANMA 3TC9A 5AG9A 3ARGA 3PF2A 4XP9L 1NUFA 2FEEL 1PDKA 1KB5L 1RZ7H 3AMKA 2YD9A 4TTDD 2YA1A 3O3BA 4MNQD 2OL3A 5JW4R 3QIBA 1EMTL 3TH4T 4ZSOA 3BZDA 3OHXB 1CS6A 3FMGL 2Z93B 1NAKL 2CKBB 4MA7L 4PJCB 3AGVA 1J8HA 4KK9D 1U8LA 3ZHDA 2M2DA 1DDHB 5E2WH 12E8H 3T0XA 3K2MC 3RY4A 3PL6A 2YD7A 2ZPKH 1TVDA 2Y36H 1QG3A 5FCUH 4KRPB 4WV1C 4EDXB 5C0DB 4FQ2H 3UROR 5E08L 5CP7A 4F15C 2HT3D 3MXVL 3V52L 5HGBA 3MMEA 3FOMA 4WU5A 3MCLH 5TH2B 3CFJA 5BO1L 5HHPB 5MI0B 3K0WA 5CBAB 2EZ0C 3QHFL 5DMGD 3N1QC 1AI1L 5I19H 5B8CA 5IJKA 3BDXA 5TDPA 4DGYL 2C1OB 2UYLA 3GBLA 2CKNA 4B50A 1HHKA 2PYED 2JJSC 4QHUA 4DK3A 2JB5H 5FUZH 1OARH 1F3JA 4Z95L 4LKCA 3MLYL 2ADIB 5DUPL 4YXKH 3IYLW 4X80H 5CEYA 2XWBB 3PQYE 3NIDE 2PR4H 4WHYG 2IBZX 3BAEL 2AQ1A 2ENSA 3L3KB 1FFOA 3IJHB 2VIRA 1J10A 3GJEB 3GHEL 3QDMD 3FJTA 4XRCB 4LRIA 4QRPE 3CLFL 5GGTL 1AD9A 3REVA 3ZDYF 4ELMB 5IMKA 1K8IA 4Q6IA 1JN6A 3WIHH 4LMQE 5ACZA 1J9CT 4NM8H 4B41A 3ULUC 4L4TB 5TF0A 4JRXE 2NXZB 4BQ8A 4EI6B 4F58L 5AG8A 4I9WE 1AQDA 3QUZA 5DHYB 2BNUA 4XCFL 3DVIA 3QI9C 4GKNB 1A6VL 5T1LB 3TT3H 1OGAB 5JW3H 5EZJB 1INEL 4NJAH 1HSAA 1LK2B 2UY7A 3QQNA 3PWPD 5H8DA 1WC7A 5K9KB 5ELIA 1V5JA 1Q94B 5IWLA 2PN5A 2OP4H 5EIIA 5GS2D 3REWB 4HWNA 1EHLH 2GEEA 3LKPB 3IAPA 4I13B 1NBQA 2IF7A 3BZ4A 4LCWB 3R0MA 1DUYB 4QRRB 5IB4A 2JCCA 4XB8A 1RIUH 3O4OB 1JMXA 5DZNA 2E6QA 3L3JB 1BQLL 5IHBA 4PP2B 2XIDA 5F7DB 2B7DT 3A6CH 1JZ5A 4G8GD 4ENED 3ARDB 5D96B 2A74B 2VISA 2WP3T 1V3KA 5EIVA 2QQKL 4JO4L 2VXVH 5FV2A 3GSXB 4GRWB 1IC4L 4C56A 2MSPA 1H9VA 3I6KA 1AXTL 5H37H 4XWOD 2R4RL 1QRNE 2CDGB 4NO2B 1RUAH 3H2WA 4HH8A 4I4WA 1RUQL 2VC2L 3DI2B 5CZXC 4RGMB 3BWUC 2N1KA 2WINB 3JV5A 3ARGB 3RZCD 2AJSL 5E1AB 4DZ8A 5DF0A 1A5FL 4MJID 2XKSA 5ICYA 2O61B 4NHCH 1JZ4A 2YUXA 4I77H 3ARPA 3KR3H 1BLNA 1GIGL 1JFQH 3O6MH 3KPRD 5JXAL 5JUEH 3DGCR 1LO5B 4ZSOB 4D2NA 5KZCD 4HGMA 3OKLB 1MY5A 2PTTA 3H7LA 4QXWA 3VI3E 2OR9L 1I7RA 3PABB 4HJGB 4DEPC 5C09D 5JXEC 2ADFL 3OXSA 4FZEL 1U8LB 1MFEL 1ZKAA 1KB9J 3S96A 4X7FC 3R8QA 3TIEB 5T3ZE 5B4MC 2FJGA 1UZ6F 2VWEE 1NCBH 5EA0H 2M1KA 4HS8L 1SJVA 3PV6A 3RDTD 2H3NB 2OXGA 4PLKC 1MCEA 3MA7A 5CP7B 1PQZB 3ULVE 2ESVD 4FTVA 1EBAA 3FOMB 3NA9H 4WU5B 1RD6A 2EDLA 3CFJB 1RUML 4OIAA 2VLJE 4LEOB 3OJ2C 4U1MA 4TSAH 4PGCA 4K7PL 4D0BB 3D0VA 1DZBA 4Y5XA 2YUVA 3W5MA 3KJ4C 1A7RH 1RHHA 5D7KD 5L88L 3GJFH 3EOTH 2UYLB 5EUOA 2DIBA 4XP1H 4X0KA 3FO2A 4YNYA 1LP9A 4EDWH 5IHUL 5AYUH 2YPKA 2YD4A 4LLUB 1I9EA 3AMLA 2OZ4H 5DD6B 1Y18A 4GQ9L 2IALB 2J8OA 1KTLA 2VXQH 3MSPA 1F3JB 4PGDA 5I1JH 1X5AA 3KPQA 4OLXH 3FRPA 2CMRL 4K9EH 1HCVA 4GAGL 1UEYA 2B2XH 5JO5B 3ZKNC 4JFDE 1FGNL 5D1ZD 3JV4B 1KB9K 3JWDH 4PJBF 4LGSB 3C5ZD 3SQBA 3F7YA 4HDIA 1DQLH 1YMHA 3ZE2E 1FZMA 4UV7L 1FFQA 4H88L 4NQDE 3NVQA 1WIOA 4GBXC 4XI5C 1FH5L 4LPXA 3NCMA 1WF5A 2XA3A 4X6FA 5J3HD 4N68A 3RWEB 3DOSA 3C6LD 3C5JB 2G75A 3MJ9H 5IMKB 1PX3A 4P48A 3JV0A 5DHVA 5ACZB 4HJ0D 3TIDA 5J4MA 3JZ7A 3F58H 4FMKA 5HVGB 4MHHG 3BKCH 3KXFD 3C60B 1FFNB 4PJFE 1S78C 3NCJH 1D9KB 1AQDB 4PRBA 4MCZB 3QDGB 4MD4B 2BNUB 2GW5A 3U48A 1YN6B 4X6DA 5SWSA 2PYFA 1T04A 3BQUB 1YEDA 1HSAB 2EDYA 4OLYH 3VGBA 4O2FA 2K7QA 5IVZB 4HPYL 5EIIB 2MCPH 3VI3F 3T3ME 2N7AA 4LLMA 2R29L 4X5XA 5F7NC 3M45A 1P53A 3OWEA 1FLRL 2NY0C 3CUPA 3BZ4B 3GSOA 4XCEA 1Q9OB 4L4JA 1A7PH 1FLTX 1OGTB 5A2FA 2FX9H 2DQTH 2XOTA 4BSWA 3D25A 4H1LH 1OW0A 4CAGA 4J3TA 3ULVF 3MO1B 4D0DA 4GW5B 4YWGH 5D1XA 4OIBA 1E4JA 1Q38A 1F3RB 2CK0H 1HEZB 3IGAA 3NPZB 2MKLC 3BD4A 4HHAB 2DQIL 1B2WL 2EZ0D 3S37H 1A6AA 4QRUA 3VW3L 3EO1A 2R69L 5BV7H 3IS1X 3QG7H 4HXAH 3OSKA 5TJWK 3GUTB 4DW2L 3EDKA 2BSRA 5KVGL 4OTXH 2VLRD 1F58L 4DZ8B 3C87A 3CDCA 5F7EL 3L3GB 4CADA 5ICYB 3PWPE 1BOYA 4Q6YA 1BLNB 1T0MA 4Y1AA 1HQRA 1GGBL 1F3DH 1SVZA 3ROLA 1WZ1L 5I30L 1UM4H 3R4DA 3ME0A 1G6VK 4PD4J 3S96B 2VDKH 4JANB 1I8KB 4N90D 2PO6C 3ARYA 1LO3L 2A6KA 1MRCH 4Y4HC 3SO5A 2UY6A 3G9AB 4XAWL 2MFNA 3MA7B 3V8CA 3MROB 1KN2H 5I1AB 3SDAB 3MV9B 4FTVB 1UM5H 1UQSB 1XIWC 4U1MB 5EOTA 2X4OB 5GRVL 3V7MA 4HWEH 4P3CH 5JHLL 3ZE0F 2EH7L 5EULV 4DVRH 4PRAA 5I8EA 4PJFF 1OAKH 1N3NA 4ZO7A 1NCAH 1NCNA 4GMTL 1GZQA 1H3GA 5E2JA 4X0KB 2IEPA 3LIZL 2P8PA 3O0RH 3NAAL 3P4OB 3GBNH 2AV7A 4K3EH 1KTLB 1TQBB 1C5DA 4ZFOB 3TO4B 4PGDB 1ZT4B 1A3RH 3HE7A 3KPQB 4PLOB 5DGQA 3FT4A 1QBBA 3X14A 5I15H 5JPMA 1ZGLP 3L3DA 2V5MA 5HDLA 4Z76A 4AIZB 3PNWA 3MOBL 1UZ8A 4V1DE 1FZMB 4D9RD 1B0RA 3VFVB 2A1WL 1UWEH 1WBYA 5M7QA 2NTSP 4X6FB 3QEGL 1T03L 4UB0H 8CGTA 1FIEA 2HA1A 5FYKE 3RWGB 1D3CA 3TIDB 3L7FB 3RUGE 3G6JF 3UJTL 4TSBH 1SEQL 4JB9H 3D6GA 2HVJB 1INQB 4YFLF 4K8RL 1M4KA 1HE7A 4X6DB 5CZXD 5SWSB 4LBEA 4OZHE 2PYFB 1S9XA 2OI9C 1I9RL 4OFDA 1YEDB 2XZQH 1FDLL 2ITCA 3WUWA 4QXUH 2AABL 3L5XH 2ARJB 4XH2A 5I17B 3QIBC 1MCPH 2DWEA 3AB0B 5EU3A 2F54B 1AKJA 3AY4A 2ADJB 2B1HL 4WEMB 1FNGA 3MLXL 3P4NA 1S9WA 4IOFC 4MDJB 2P4AB 3IDNB 5GRYA 1Z5LA 1KCSL 1KIUA 3FCTB 1JYWA 4NSKA 3C8HA 4LPYA 5B4MD 3PL6C 4WHCA 3GM0A 1NFIA 2IAMD 4PLKD 1EJOH 1CK0L 1D5IH 1HIMH 3VXTB 3QG6B 2VQ1A 3IF1A 4HJJL 5F1OB 3TZVB 3FB8A 4NCDA 5I75C 3VFUB 5FYLE 3VXNB 1JHTA 2VDQH 2CDEA 1LO0L 3C08H 3SDCD 1SHMA 5JOFB 3FN9A 3LDBB 2BSRB 5TE6H 4DKFL 3RWFA 3EYSL 2XG5A 4HCRL 5L7XL 1AXSA 5B8CC 5IJKC 4NNYB 1DTUA 3BPOC 2O5ZL 3BXNA 3WIHA 3KG5A 4YXHH 1FL6A 5EU6E 1HHGA 2DYPB 5DD5H 4X8JA 1EA9C 3RI5K 2DQEH 3HZYB 3ZLQC 1K85A 4J23A 4X99A 3D3VA 2IQAB 4Y1AB 2JJWA 2Y9RT 2D31B 5ID1B 4OKVB 5JR1L 3KPNA 5DRXA 3BKML 2WUCL 5JNYA 4BELD 1IE5A 4K23H 1QUNA 5HGHB 4JFZL 2C9AA 4X9IA 5DWUL 5J6HA 1F6AA 2V7NA 4LSSL 3ZKND 1LO4L 2BNRD 1HK6A 1MCRA 1VEOA 2Y5TB 2A6KB 4U1JB 5J13B 2BVTA 1PW3A 4O4YL 2CRYA 4CGTA 4PREA 2RCSL 4I8DA 2HKFL 2NY3C 4G7YH 2J8UF 4KROB 3T4YB 4PRPE 3NFNA 4LRIC 4GBXD 4XI5D 4IS6B 7FABH 5L2KD 5EOTB 3HMWH 1ZGLB 2JJTA 2CIKA 4Q6IC 5I8EB 1N3NB 2CR3A 3OF6D 3WNLA 2A2QT 2BOCA 5F3BA 2CSPA 4OZHF 4NC1C 1MUJA 4XP5H 1H8NA 2XN9B 1S78D 4JZNA 5ITFA 2X9XA 3QUZC 4NWUL 4GRLC 4L3EE 3AM8A 2PF6A 3D5OF 2XZAL 1FJ1A 4FABL 3RIAF 1VFOA 5CGYC 3X14B 3G08A 3MYJB 4OJFL 5JPMB 5FA4A 1SY6L 5IWLC 2HH0H 3ILPA 3L3DB 4Z76B 4M62L 2NY0D 3EJYC 5EZOL 3VXOA 2CRIA 5DD0H 1B0RB 4BQBA 3I6LD 2AVGA 3FB7B 2B4CH 1CN4A 1WBYB 4JKPH 4JO1L 3RX8A 3WS3A 1JNJA 2H8PB 5LGJA 3NABL 1MIEL 3S35H 3PDDA 4CVZB 1YYLL 3DO7B 3ARRA 4PJ9A 1AQKH 3ULUE 1ETZA 4N9GA 2V2TA 1WWBX 3H3BC 1N6QH 3WSQH 4EI5A 1UACH 4LIQE 2VZ1A 4G8GB 4JGMA 3GMLA 4Y16A 2J12B 2ATKB 3EYOB 1OD7A 4OCSH 1CYGA 2JK5B 3MRPB 4S1QL 2ITCB 4QY8A 1A0QL 4M93B 3GB7A 2F58L 5T3XE 1RZJH 1LDPL 5KVEL 4WHDA 5B39A 4MD0A 2ICWI 4XH2B 3CZJA 3FN3A 3IFLH 3STLB 3WO3B 3HCVA 2UWEE 5D2LE 3IJSA 2DWEB 3GJFA 1OY3B 1W0WB 4R6UA 5EU3B 1AKJB 1M05A 2VSCA 2WAHA 1KEGL 3V7AG 3S3SA 3W81A 1FNGB 2EC9T 1IEHA 3P4NB 1S9WB 3BN9C 4D9RE 4U7MA 1Z5LB 4YK4C 2OZ4A 3RZCB 5BS0E 1VFBA 2D3VA 1E6OL 4NSKB 5KANI 1RVFH 2FZ3A 2PO6D 4MJIB 4OCNC 4Y4HD 4EN3C 5I2IA 3U36A 5E6YA 5F21B 2AERT 5LAXB 5KSUA 4PGJA 2VQ1B 4DGIH 2XICA 4TUKL 1IZKA 3BGMA 4Y8AA 3X3FL 1MCLA 4L4VD 1HQ4A 4MAUL 1XIWD 4WUKH 4JY4A 1BQHB 2CDEB 3ULVL 3P30L 1UEMA 1WEJL 3WXVH 1JNLH 1EV2E 4Y5XC 3RWFB 1IEBA 2W9LA 2YWZA 4P2QB 1JYXA 5IVXF 3MJ9A 1NEZA 2A83B 3OGCB 5C0BE 1IGTB 3OJVC 2VZOA 5J57B 1MREL 2UVEA 4HMDA 1FL6B 1HHGB 4X8JB 3SE4A 4X99B 2YPVH 2ENYA 3KPNB 4KFZC 1G7QB 3FL7A 4N0UA 1OAZL 2VDML 1JBJA 5J6HB 1G7PA 2V7NB 5CHNA 4L8BB 3OV6A 4P5MB 2NLJA 1OAUH 2G5BA 4NKDB 4UILH 1S7UA 2YSSA 1A4JB 5F1SA 4DAGL 3DARA 5F9WC 3MC0A 1BZ9A 3LKRA 1OB1A 5D7LD 4IHOA 1FE8L 4ODTL 3DHJA 4NKMA 1W72H 2BNQD 3ARZA 4XWGH 2X4TB 2HLAB 3ULUF 3TYGL 5F9JA 4BZ1H 3QZWA 3QQ9C 1DBBH 1ITCA 2WWMC 4H1LA 2BOCB 5F3BB 5BVPH 4XPAL 3CVHB 4X9GA 5HHVH 2FJFA 2IANB 5DYOB 4NQSA 4X83A 2FO4A 4HUWA 5FHBH 2OS7A 3M8OL 2YKLL 1FJ1B 4M3JA 1A7OH 1L7IH 5HGAB 2GT9B 4XP6L 2VDLH 2UWEF 5D2LF 4ZO9A 1JNHA 3VFGH 3G08B 1X3DA 3WNMA 3FB5A 3QIBD 3CU7A 1G9ML 2FNBA 1HDMA 3DNKA 5F89A 4JQIL 1BM3L 5DS8B 3TM6A 3VXOB 1UFUA 3MBEA 2IPUG 4P0DA 4OD1H 5CLWA 4IRJC 3I3EA 4IOFD 2Z8VC 2GK0B 4QKXB 1J8HD 3CX5J 4PS4H 3WS3B 3ZHLA 2FIKA 1OW0C 3PL6D 1LEKA 5D1XC 4J4PA 5FOBA 1XCTB 3ZT6A 5T5NG 1BAFL 1C5CL 3TFKD 5L6YH 3C2SA 1AFVH 3GGWA 1S5IL 4ISVB 1FC2D 4XNXL 3SQOH 3VXUD 5DJ2B 1EO8L 4EI5B 1KJ3H 3LKNA 3OR7B 2AJVH 3VXME 5KVMC 1F97A 1V05A 4Y16B 3GMLB 3T0WA 4NRYB 3EOAB 5IB5A 5ICZB 1P6FA 4QY8B 1KG0A 5IT2H 3C8DA 3OKKB 1JWSB 2KPNA 3L6FA 4OF3A 4MD0B 4Y19E 5B39B 1T1WA 1M7DA 3IXAA 3QPQC 5KSBA 4LMQI 3U4EB 3IJSB 1J5OH 2VABA 3GJFB 4PGBB 5E24E 4KJYA 1M05B 4ZS7L 4ZUTB 3STBA 1GC1C 1I7TB 3O45A 4IMLB 4IRZH 2R8SL 4PJCE 4UTBL 3U1SH 1CGSH 1SJEB 2BDNH 4QRSB 3UTPD 3E1F1 5I2IB 1I3RA 3CXHJ 1FCCA 2HFFA 3BH8B 2NY3D 5IB1B 3ET9F 1S7WA 5JW4M 1ZEAH 4WGWB 1HQ4B 4JY4B 4XNZB 4G43A 4NP4H 1IL1B 1G9NC 3BP6B 4JDZA 3UXFA 1QA9B 3UBXI 1JWMB 3MACH 5KG9B 5ISZD 3U6RA 3LS4H 1R3LA 3IXTA 2OX5A 5IIEA 3GKZA 3MV8A 4GRMA 1KPUA 1AR1C 4OCXL 4RAUA 3U4BH 1IEBB 2QSCL 2NR6C 1TVHA 3NCCB 4M9PA 4DCQB 2OJEA 3PP4L 4F7CA 3E6HA 3QUZD 4GRLD 1MPAL 3C9NB 2MQ0A 5HYSA 3CLEL 1CGYA 2HJKA 5CGYD 1M6OB 3HE7C 2NY7H 4I3RL 5HYQA 2HYMA 4LF3B 1G7PB 5CHNB 3V6FA 3HR5A 4PJEF 4X5WB 3P11L 4U2ZA 1R5IA 1OTSD 2H2PC 2R2CA 1GOGA 2YSSB 5FXCH 5D6CA 4E0RB 4F9PA 3BIKB 4IHOB 2HFGL 3K1KC 4NKMB 2C5DC 2AJ3B 4ONGL 4H20H 1F4XH 2DQHH 5F9JB 1YJDH 4L9DA 3QZWB 5DJ6A 3B43A 4ELME 3SKJL 3N9GH 4C56D 2ZUQB 3W39B 5GHWH 5F7UA 5IOPA 3CSYB 1HILB 4XC1L 2FJFB 4ERSH 4L4TE 5I8OL 5JW4N 3RL1A 2DICA 2G5RA 4HUWB 5HHMD 1CFNA 3NFPA 1DBML 4UQ2B 4WFFD 4NO5A 2EDRA 4WHTA 1QQDA 1OGAE 3RWIA 1JNHB 1IAII 1MCSA 4OZGA 3RY5A 3E3QC 3DX9A 4NJ9L 3BPLB 1KOAA 3ARFC 2FJHB 1BJMA 2X41A 3UYRH 5FIEA 3LRSB 3AS3A 1TITA 3LMJL 3UZEA 1JNNH 4LCWE 4QRRE 3BN9D 1L7TH 4KY1H 5A3IC 2Q20A 1E4WL 4MWFA 4ODSH 5CJ5A 4EN3D 3EJZC 4UINL 4P2OB 5FOBB 5IR1B 5BMFL 1VADB 3GSNB 5DEZA 5AZ2L 1YEGL 3GSUB 4AG4H 4ZO6A 4MJ4A 4R2GD 4YAQA 1T83A 1AP2B 4B7LA 3ARQA 4JFXB 3GJFK 1YNLL 2N56A 3MLSL 4LVNB 1A7QL 4NZTL 4PJHB 3ZDXE 1I75A 5IM7A 5A43C 3IU4L 4XMPH 3VDAA 3SJVA 2WANA 5IB5B 3P3YA 4UNUA 2GHWB 2IAMB 2YMXL 4XVTL 3O11A 4R26L 3IXAB 3WL9A 2P7TB 5KSBB 1JWUA 1VACB 4GT7A 3HPJB 1AO7A 3CDGA 4KJYB 5CILH 5ILTH 3ABZA 2X42A 5HYIA 4ZSOE 5MERB 5KTEH 3L5JA 2EE3A 5DQJB 3SDCB 3MTRA 4XVSH 2VZTA 5E4IA 1MQKL 4F8QA 1C08B 5C08D 3K3QA 5FF6A 3GNMH 1H15A 4M7JH 5I1HH 2DM7A 4JPWH 5EU4A 3QWOA 2HFFB 5L8KB 3IKKA 1QLFB 3UX9B 3HPLA 3JTTB 4KMTL 1S7WB 1D6VL 1Z0NA 3QUXC 3E6FA 4RA0C 5JDSA 5T33H 3SOBH 2X44D 3TBSA 4G43B 4XXCC 1FNAA 4JDZB 1I7UB 3PGFH 4M4RA 3OX8A 4ODUA 3QQ9D 4RAUB 4GRMB 1KPUB 5ID0A 4ZPVA 2XWJA 3W2DL 5E00A 2WWMD 1CLYL 1MHEA 2ZUVA 4N0YL 2EKSA 4KUCF 4I2XA 4YHZH 1KJMA 3VH8A 2OJEB 4F7CB 4NQEB 1NDMA 3E6HB 1FO0H 3KPOA 5HGGS 5KVDL 4M5YL 2P5EB 2VQUA 3AM8C 3N1PC 4X7SL 2HJKB 1YDPB 3SKNA 1NFKA 3WUWG 1J87A 3V7AE 2EYSB 4KMLB 3T8XA 1P7QD 3HR5B 3OAZH 5BZWA 2R39A 3UC0H 4OLEA 3QUMB 4M1DL 3FOLA 4YFLI 2AXGB 1K5NA 5D8JL 3GI9H 3U30C 4ODBD 5F1IA 3EYUL 2PW2A 4IRJD 4JHWH 1DLFL 4LAJH 3OAUH 5D5MA 1BOGA 4EUPH 3WHXA 2D0FA 4GUPA 4MJ6A 4XPFH 1H3XA 3HNTH 3CK0H 3G04A 1ZTXH 3ZDXF 3RPKA 4XVJL 4PJ9C 1IMHC 3F6IA 4YQXL 3W5NA 1ZLSH 4M7LT 4WWKD 4D9QE 1CGVA 3MRGA 1VGEH 4MA3A 1TZHA 2HN7A 3N1FC 4WO4A 1R3HA 1KN4L 1D6EB 5DRWA 3ULUL 1JV5A 1GGTA 2OXHA 4NO5B 4WHTB 1N0XH 3SDYH 3U4AA 3QEQA 4CRPA 5DD1H 4LIQL 4CU7A 3H42L 1GH7A 4Q2ZB 1N5AB 3W82A 3QPQD 1I85A 4RMRA 5T3XL 4JY6A 1UC6A 4Q7DA 1UKSA 4PBWD 1KCUH 1NANI 1HNGA 1BVLA 4X6CA 4J3XA 5IK3A 3WKML 4HIIA 5H2BB 5HBBA 3QNXA 4C55A 4JO3H 4JKWA 1P4IH 4K9EC 2VZ3A 4ZUVA 2DKUA 2X5PA 4XMKL 4YAQB 4ZS6C 3JWDC 4M48L 3G6DL 5IM7B 4RMWA 3G5VA 3QQ3A 4ZD3L 3B3IB 3VGHA 3X3GH 1MFNA 4H0IA 1BWMA 3KYOB 4XNQB 4G9DB 4L3AA 4WI5A 3JXAA 1SYVB 2NR6D 5MENB 5IV2B 3LZFH 2NY2B 3WO4B 3HNSL 4MA1B 2HRPH 1AE6H 4HF5L 3RBSA 2EICA 1E6JL 4NT6B 3MRBB 3WL9B 2XKUA 4BKLA 4L8CA 3CDGB 3SE4C 5H37G 4AM0B 2YBRA 4S1RH 2IQ9L 3KPMA 3HE7D 4G9FB 5EO1B 5IG7A 1P84J 3LKQB 5DTFA 3V6ZA 1G6RH 2P5WD 4FQ1L 4HT1H 4CJ0A 2H2PD 1ODAA 5EU7C 1MCWM 4HUNB 5EU4B 3P0GB 4IOIA 3OG6B 2J4WH 5IFAL 3LPFA 5IMMA 4EIGB 2AK4B 5EN2A 1DQQA 4UDUB 5F7FA 1XGUA 1YEFH 3MV9E 1S7TB 4FTVE 4G3YL 3CFCL 4JPIB 3QXUA 1DFBL 3GSWA 3ALXA 5ID0B 4UIMB 3SY0B 4MNGB 1EXUB 2X10A 4XBEH 4NZUH 4UOW0 3RGVA 4LASH 1TZGH 1Q72L 3HN3A 4I2XB 3IU3B 2X1WL 4FFWC 3GO1H 5EUOE 3UAJC 4XCCL 2QSVA 5FUOH 4EJ1C 1IQWH 3DWTA 3KPOB 5DR5H 2KUTA 5CKGA 1BMGA 2FHBA 2FGWH 5DJCA 4OUUB 5E94A 1FBIL 3SKNB 1ZMYA 3BESR 2R1XA 4O2EB 5BV7C 4HGKC 4TSCH 3WD5L 1KPVB 1F13A 1L9MA 3ARFD 2JCCF 1XR9A 4N1CA 4D9LH 3WFHA 5FHAL 3UPRA 4JM2A 3B5TA 5F1IB 4Q97A 3T0VA 3MBEC 5GIRB 3TVMA 3S34H 4Y4KB 2FRGP 5A3ID 5DK3A 1XGRA 1ZXQA 1ROWA 1ZHBB 4F7TB 4HBCH 1CLOH 3CIQA 3LKSB 4NOBA 4O51A 4OCWH 3EJZD 4LVOB 5E8OA 1GGCL 4PIRF 2CLVA 2DAVA 2MHAA 4HK0B 1T7YA 1DJSA 2DDQL 1QFOA 4QO1A 2CD0A 3MRGB 4UV4H 1CVSC 1TVBA 2P45B 1TZHB 2HN7B 1ZE3C 3SGKC 1Z9LA 5FKPA 1R3HB 4FXGA 3M1BB 4G7VH 4QHKI 2FX8H 1JCKA 3HNVH 4X6DE 1YNKH 5SWSE 5HYJA 5E03A 1OPGH 3QO1B 4LL9A 2IG2L 3MV7A 1JPFA 3LEVL 1GOFA 1NEZG 3OKDA 4ZXBC 1TCRA 4Z7VA 3PP3H 3CH8A 1UCBH 3TYFA 1CT8A 5IEKA 3D3VD 4PJGA 2XA8H 4DQOH 3Q6FA 3SDXB 2QL1A 5D1QA 5HGDA 1YEEL 4AH2A 4M00A 5T5NF 3D39A 4KRNA 4NO3A 2OM5A 2OSLA 3RI5F 4UT7L 1UJ3A 1EFXB 3CSGA 5LCVL 1OCWL 1A1MA 4R0LA 4HIXL 3BUYB 3BKJL 1N64H 3QUXD 4GSDH 3UJJL 4TVPE 5TDNA 1KACB 3GMQB 5DI8A 3FFCD 5EUKB 3BOVA 3G5VB 3QQ3B 4HH9A 4TRPL 3TPUA 3PJSA 5I1GH 3PXHA 2E7HA 3OB0H 5HHNB 5K9JH 3GSVA 1KUMA 5EUOF 2JLLA 4CMMB 1W72B 4HIJA 1LP9F 4ZOAA 4H1LG 1FG2A 2FCBA 4OFPA 5I1KH 4JG0H 5DVLA 1X5HA 3QRGL 4YHNB 4ODWA 1LVEA 4YDJB 1SJHB 1RFDH 3VFPA 3M07A 3QULB 4Y2DA 4N8CL 3VI4E 3DV6A 4K3DH 3S9DB 5J6GB 1GGIL 3OXRA 2YBRB 1CZ8L 4JFQB 3NCYS 1BVKA 4Y1AE 2R0ZL 4DKEH 5IG7B 5INCB 1W2KT 1T3FA 4M7LL 2X40A 4FQHA 1KCVL 1FPTH 4KUZL 3GFUA 4JDTH 4RMTA 1U8OB 5E2VL 1DQJA 1NBYA 3QXAA 4E41A 4F9PC 5IMMB 2V2XA 2GITA 3AAZB 5T1KB 1B88A 1HH6B 4LVHC 5EN2B 1DQQB 3O2DL 1NMCC 1XGUB 4RWHA 3X11B 4GAJH 4Z7QF 4JKKA 3GSWB 4DFHA 3MLZH 4PRHA 5GRJH 1IVLA 4PJ9D 1FCGA 2CIIA 2Q6WA 1J1PH 3ELAT 4HUXA 2AJYH 2AQ3A 1I8MA 3IETB 2WBJD 4U6YA 3A67L 2A6IB 2XPGB 2VITA 2XN9E 4NM4L 5A2KH 5BQ7A 4MJ5A 5DJCB 5DT1H 2A0LC 2B5IB 32C2A 1VEMA 2OJZH 1BZQK 4MHHI 4M5ZL 4HLZH 1WISA 3H9YA 3GI8L 1AD0A 4POZD 4D94A 2EE6A 4IMKA 2RBLA 4YHKH 1Q0YL 4YBQC 1UKTA 5DMIH 1FRGL 2E27L 3TVMB 4UIKL 5E8DH 4ZFGL 4AZ8A 5DD3H 4XP4L 1FIGL 4QXGH 3QPXH 5E2TH 1XGRB 1YNTA 2BP3A 2ZCLH 3MUY1 3MREA 4WU7A 1T1XB 1FYTA 2Y06L 4O51B 2Q8AL 5E8OB 5F9OL 1LMKA 3VFMB 5C8JA 4U1LA 4KZDL 2MHAB 2BHZA 3FO9A 4U1GB 4LSTL 4ZS6D 5GS3A 2FD6H 5C07D 1IGCH 1TVBB 2QSTA 2AI0H 4ZFZB 5FKPB 3TBWB 1TETL 3T08A 5DLML 4X7TA 4U0RC 3WFEH 3FONB 2IPKB 3RJQB 2Z91A 1PSKL 3MV7B 4WUUA 5DJ0B 5GS0C 3BZEB 1ITBB 1WBXB 1JPFB 3FO1B 1TCRB 4RFNB 1X6LA 3E3QE 4R2GB 1A2YA 5DMYA 1EIBA 3O41A 4TULL 1F42A 1MQ8A 3TYFB 3CFEB 1CT8B 1YMMD 5HYSG 3V5HA 2OTPA 1A3LL 3BH9A 4LHUA 1P9MA 3O3EA 3Q6FB 4PRNA 1FO0A 2FX7H 3HC3H 3MUZ1 2OL3L 2X4SA 4S11A 3D39B 3T0EA 4NO3B 2OSLB 1II4E 1C5BH 3HMXH 4Y5YB 1U8NB 1V7NL 1UJ3B 1VFAA 5GZOC 5IP4A 1A1MB 4OLVH 1JZ8A 3D2UD 2NQCA 4H8WL 1R0AL 1FZJB 5DJ8A 3ALPA 3QCTH 5CCKL 3V4UL 1K2DA 4LAQH 3TPUB 3PHOA 1ERNA 3PJSB 4OLUH 3WS6A 4RBPH 1X9QA 1NFDB 1YYML 4DKAA 3GSVB 3DRTB 3OB8A 4KV5E 1KC5L 1KV3A 2B4CC 3PWLA 4FNLL 5HHOA 3V0WL 4EUPA 2VZUA 4JFOB 4U1HA 3ZYOA 2R15A 3T1WA 5C0IA 1D5ZB 3OKNA 4FFWD 4ODWB 2R0WL 1XF1A 3VFPB 4Y2DB 3DV6B 1K6QL 4NYLA 1WIUA 2A9NL 1BJ1H 1Z3GL 5T3ZH 4LVEA 2LTQB 5E6IA 1UH4A 2EYTA 3KLSA 4KK8C 2HFTA 2APWA 1MFDH 4WFHE 1JHKL 3IDGB 4X5LA 4FZ8L 3L3OB 2LU4A 2W91A 3MLTA 3MBED 1RZJC 3PHSA 1NBYB 4ELKA 4A6YB 2GITB 1I1FA 5IMOA 4G5ZH 1PG7H 4X7EC 3N85L 4K2UH 3LVEA 4OGXL 2KQNA 2HJLB 4F3FA 1OSZA 3UJIL 5KSVB 2VUYA 3O6FC 3O6KL 4PRHB 1CE1H 3FAWA 2AXFA 4HKZA 5K33A 1HHHA 1V3LA 2Z4QB 2K9UA 1YC7A 4HUXB 5C6WH 5D6DA 4LRNL 1NBZB 2PUQT 5L2JA 4U6YB 4RGOH 4AL8L 2IANE 2Y5EA 2VITB 3RTQA 5BQ7B 4WO4C 4CVXA 1NGQL 4MJ5B 1FNSH 2ED7A 3FQRB 4JM4L 1A6WL 3MLUL 1YA5A 3OPZL 32C2B 5MEPA 5EC1B 2EKJA 3RHWF 4ZXBD 4OB5L 3QQ4A 3NGBC 4NZRL 1GOHA 1LO2L 4YDVA 1U91A 4WWKB 2OYPA 3RVTC 3ULSA 2B20A 1ULVA 1WIPA 4PJ7A 5CD3B 2W0LA 4KZEL 1GHFL 4LCYA 2NCMA 4R96B 4HW6A 5JLZB 2XY1A 5EWIL 4OCRH 4BH7A 1QNZL 1NGXA 1FYTB 1RY7B 3QIWA 4M7ZB 1VESA 3RWCB 4I5BB