5FDYA

Crystal structure of the voltage-gated sodium channel beta 2 subunit extracellular domain, c72a/c75a mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
b'SNAMEVTVPATLNVLNGSDARLPCTFNSAYTVNHKQFSLNWTYQEANNASEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLME'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium channel subunit beta-2
publication title Binary architecture of the Nav1.2-beta 2 signaling complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 29
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fdyA00
4Q9BA 1A7NL 4G5ZL 3MJ9L 2Q86B 4B7IA 3IJSB 1LEIA 1U8OB 1JVKA 1TQCC 2VLKB 2JIXA 2VDNH 1FNGA 1HINL 1H3PH 3UTPD 5C0FB 3MJ8B 1WV7T 4XPHH 3HC0A 2BFVH 2HN7A 1PQZB 1IQDA 1YJDH 4WWKD 1NJ9A 3UTZB 1HILA 1MJJB 2P5EB 4KDVA 2HKHL 1YJDC 4WI2A 2XQBL 3T0EE 4L3ED 4ODHL 4JN2B 4CU7A 3BFOA 1NGYA 5B4MD 3QULB 3GJFA 4HX1B 1EBPA 5TF0A 3F7VA 3BJLA 3VMOA 1LE5A 1FYHB 3QI9D 1BBDL 1P7KA 4HH9B 1ZVSB 2DQGH 1C08B 4NQEA 4OD1L 5GS0L 3CFDB 1KLGA 2W9DL 4I3RL 5ESQA 4JRWA 1S8DA 1S9WB 1ZOXA 5HDLA 2XXCB 4NFBA 5L2KB 3F62A 3PP4H 1NKRA 2R1YA 1G7MB 4ZUSA 3TPUA 4OV5A 1R3HA 3ZYOA 1WBZB 3MV8B 4BSWB 3O3EB 5C07E 2EYRA 5DI8B 1GSMA 4JZJA 4PRIA 4TUOA 4ODXB 2Z92B 1T1XB 4Q9QH 4YO0A 4JCLA 3PABA 5DK0A 5EO1B 4MA1C 2OZ4H 4QO1A 4OLUH 4XHJC 3GSRA 5CJOH 4Q6YA 3RWFA 4YDJB 3AUVA 3K8LA 3MRNB 4WVRA 3UJTH 1J0IA 1N5AA 3V5DB 1MIEH 3WUWG 3BPLB 4S1RL 3O8XA 3CVHH 5D6CB 5C8JB 3QIWC 4QHKI 5DRXB 3FN0L 3VJ6B 4JG1L 1KCUH 1DE4A 3O6ML 1SM3L 4ZS7H 4P49A 1QLFB 4AY0A 4TVPH 4F7EB 3MLWL 4HIEB 4HV8A 1FJ1B 3ZSTA 3KHOA 1YC8A 2PCPA 1J8HD 5D2NE 2R15A 3X3GH 3QXDA 4PRID 3WFZA 5JOEA 3CH1B 1TJGL 3RBGA 4XPAH 3NFSH 5EA0L 4NSKB 5IVOA 3RDTC 1S7TA 3CMGA 3HAEH 1KENH 3W0WB 3OHXB 3ARBC 5E8OB 2FX8H 4Y16B 2GK0A 1NSNL 4HMEA 1J86A 3QUYD 1CXIA 2V17L 3PGDA 1HEZA 3IU3B 4E0RA 2VLJE 2DQIH 5EFIA 1OM3H 1KBGL 4EBQH 3WFEL 1A1OB 3BO8B 3M17B 2ESVD 4R8WH 3MV7B 1BIIB 4X4MA 4HXBH 3BP4A 5JUEH 5D1QB 4ZO9A 4F9LC 3BKJL 1RUKH 5F1OB 3E0GA 4APQD 3MRFA 4OCWL 1NAMB 1IM9A 1ZVHA 2NY6D 3ARDB 5B39G 5HHVL 4S1QL 5CGYD 1ZTXL 5FYJU 1L0XA 3NIDF 4L4TD 1Y18B 1YYLL 4WRLA 3I84A 4JFHD 5DQJA 5SX4H 1KXTB 1GOFA 3T0AA 3L3HA 2CKBB 4WY7H 1Y6NR 4O9HL 3AY4A 4NZUH 5SX5H 1E4XL 4X7TA 1RZJL 3OG6B 4XTRC 3RUGB 3EZJB 2WIIA 4G6AC 4XAWL 2BSSB 4AEHH 1U8QB 4F58L 4NQCD 4NGHL 1JUFA 2YRPA 2A38A 4P2QE 1QNZL 4WU5A 4PJEB 4R0LA 3QRGL 3T0EA 3LRHA 2CRMA 3MBEA 5KOVC 1A5FL 5L7XH 5D7KD 1M7DB 2AJSL 1CK0L 4C83B 1KLUA 5GGVY 3QT2A 4FFZH 4JJ5B 2ATPA 2VZ1A 3IFNL 1ED3B 4OCMC 5IMLA 2IANB 4NM4L 1N3NB 1C5CL 4JPWH 5DQDL 3UYRH 3G5ZB 2RBLA 4WCYH 2F5BH 3QEQB 1CTOA 4POZD 4Y5XC 3LIZH 4HS3B 4KI5E 5FHBH 5KVEL 1EX0A 2BRRH 3GMPB 1J0ZA 5IMOA 1KJ2L 4DZ8A 3P0YH 3GJFK 4PJHF 2UYLA 2GQHA 5FECB 4ZAKC 1LO4H 4I0KA 6FABL 3DO7B 1N5YL 3GSOA 3RWDA 1BX2A 2DM4A 3RVUC 1IGFL 4B0MM 3QUXB 3NCYP 5SWSE 4JY5L 3CLEL 4HJGA 2YUXA 4U1GB 4BSVB 2F54B 4S1SL 4YQXH 4U1HA 1DBJL 1JN6A 4JKKA 1ORSA 1K3ZA 3CUPB 2FJFA 1CD8A 5T1LA 5GS0D 4ZPTB 5JW3H 2VDNL 1H3PL 1FORH 4EI5D 4PJIF 2XA8H 3BYYA 1WFOA 2BFVL 4YFLF 1D5IH 1M6OB 5D2NA 1G0XA 5ICYB 3MRCB 1YJDL 4LVNC 2P8LA 1N2RB 1KPUA 4OQTL 3EFDH 2VR5A 3MGOA 1WF5A 2O5ZH 4FNLH 4N8VA 3OR6B 4Y2OA 4OBRA 3IKCA 2NR6D 1JV5A 3O11B 1MCKA 3BQUC 2FZ3A 4KPHH 1K2DB 2XNAA 3IJYA 1SY6H 5SWQB 4MX7A 4XWGH 5I1GH 5DT1H 3ARZA 4DVBB 1UXSB 4XCNA 1AI1H 3ZL4L 3NCCB 1CFSA 3ZKMC 3X12B 4OD3H 1N0XH 3FFDB 2G9HB 4OFDA 2IFFH 1BFVH 1OP5H 1KYOK 2X4NA 5KJRH 3KHQA 3PP4L 1PY9A 4NO5A 2DKSA 1H3XA 4LNVA 1DBAH 5CEXA 5F21B 4MAYA 5BCAA 1O0VA 1P2CA 3I3EA 1F4HA 1SJVA 4Y4HD 5AUMA 2NY1B 1S7SB 3TESA 3D3VD 3BEVA 2LU3A 4Q9QL 4I5BB 4QRSA 4HZLA 1DQDH 1KEMH 1PD6A 3TIDB 5CJOL 2OZ4L 4OLUL 5ACMA 3LN4B 3NCMA 4GKOA 3Q5YA 3UJTL 4LPTA 1MIEL 2QV2A 3CVHL 5KVDH 4PTTB 2LVEA 5JOPE 3VGAC 4BFEA 2VZSA 2AKRA 4JDVA 3CCHA 1KCUL 1CD1A 2AJUH 5EU7E 5IJKA 4ZS7L 6CGTA 4TVPL 2R4RH 3L3KA 3O3DA 4MAYD 2F74A 4OGXH 3X3GL 3GMLA 2XWBA 4YHIB 2W0LA 4D0BA 1S5IH 3UX9B 4ZSOB 3GBLA 3CZFB 4XPAL 4FQQB 3NFSL 3SQOH 3VG0H 5EOCJ 3QIUC 2VR9A 5I1LB 1SMOA 4Z7NE 4KJWD 1KENL 1DLFH 3OB0K 1F97A 4PB9H 3WS3B 1I3RA 5DD0L 2A83A 1IAKB 1A4KA 4PJCB 3RGVC 1AGBA 2MTPA 4UV7L 1KN2H 2IQAA 3HRZA 3CPLA 2DQIL 1OM3L 2FWOA 4EBQL 3TBSA 4NNYA 4PRAB 5T3XH 4P2OB 3S34H 4R8WL 4Z76A 4W70A 5DVKA 3WV0A 1BQHB 3QDJB 4HXBL 5JUEL 5B3NA 3ZZ1A 2BNRE 2VQ1A 5J11B 1RUKL 3VWJA 4Z78A 3MROA 3P0VH 4S2SB 3MRKB 4LHUA 3X13A 1AQDB 3M45A 3BPCB 2R2HA 4GG6E 2H3NA 5E8NB 2R29L 5GGQL 4M7JH 3HUJB 4O58H 2ZUYA 5DC4B 5HPMB 1GGUA 3EUUA 2NNAA 3QDMD 4UUJA 1YEIH 4NZUL 2C1PA 3C6LC 4PGDB 5CP3A 4TSBH 5HDOA 1A22B 4RGNB 3SGDI 5F1IA 2GSIB 3SGJA 5E4EC 4JHWL 3FQNB 4CNIA 4AEHL 2OTUB 2HRLA 2ED9A 4QF1B 1RK1A 1YN6A 3LKNB 1ZHKB 3JWOH 1J1XH 3AS3A 3HZYB 4LLAA 4MA7H 4PP2A 3VCLB 1Z2KA 3JWOC 2HFFB 1R6VA 4LHUD 5CBAA 4HCRH 2KL6A 3TA3A 3WO4B 5IBLD 4G43B 2NZIA 3MCKB 4FFZL 2BVQB 2A1WL 2GY5A 2NY0C 4LSUH 5DRNA 5EU6D 3FB5A 4FXGA 5IJVA 2NY3C 3TGXA 2W0FA 4RDQF 4EIZC 5CUSL 5E99H 4JM2B 2NY2C 3UYRL 5CWSA 2XY1A 2M1KA 4WCYL 1KJMB 3MRRA 1T0MB 3LIZL 4D3CL 3U7AA 5FHBL 3C60C 4H1LH 2BRRL 4G9DA 1BFTA 2AQ1A 3R0NA 4C56B 3P0YL 3ROOA 3B6SA 4KDTC 3PWJA 1NGWA 1FZKB 1LO4L 5L8KB 3MRGA 2APTA 4KTYA 3T0DA 1F4YH 3MR9A 1NUFA 3PHSA 4LLUB 1EJ6A 3X11B 5F93C 5I8CA 1HHKB 1IARB 4KI5F 1OGAE 1A6AB 1NFDA 4YQXL 4QHLB 5L9DH 4MD5B 2GT9A 3SN6N 4YHPB 4ODUA 5JW3L 3GMMA 4U05A 4EXKA 2NYYC 1QHOA 4MMZC 2WINA 3NAAH 5F9JA 1FORL 2I9LA 2XA8L 4E42A 3AMKA 4RFEA 4XCEA 1AC0A 1D5IL 1K8IB 4JVUA 4G8GE 1YMME 1C12A 4W6XB 3LEXA 1E4KA 1FIEA 3EFDL 1F3JA 2X42A 3TO4C 4FNLL 2O5ZL 4I77H 1TVBB 5HGDA 5IV2B 1UB6A 4X5XB 2YD3A 1S7WA 4XHJD 2V5YA 3GRWH 5GRYA 5F8RC 2PXYC 3GSVB 3FOMA 4KPHL 1V5JA 3N1FC 1H8NA 4WV1C 4XNUH 4LP5A 3KWWB 3VFNB 4NZDA 4LF3A 4AENA 3QIWD 1SY6L 1HXYB 3PIQB 5J1AA 3HZVA 4XWGL 3L9RA 5I1GL 3GI9H 5DT1L 5ID1A 3BP7B 4JRXD 1N6VA 1X5AA 3ILQC 1B4JH 3EJYC 4OD3L 1N0XL 1U8NB 1IGCH 1X4YA 4QRQB 1U8IA 3BDYH 3L7EA 5DR5H 1BFVL 3ETBF 4TVPD 4GXUM 1DSFH 1Q38A 4PGBA 1FNEB 2BNRA 1DBAL 3E6HA 1T0PB 2CDFA 5KSAC 3AB0B 3RDTD 2CUHA 4KH2A 4X6CB 1D5MB 2NXZB 5KG9A 1JGDB 3ARBD 1DQDL 5EB9A 3VFVA 4GG6A 2H45A 4N0UE 3QI9B 2QL1A 5EUKA 1P1ZA 1MLBA 5DJ2B 2MSPA 5KVDL 5LWYH 4QRTA 5TF1H 1N7MH 1P84J 1BVZA 4F7PA 1B3JA 5JHDE 2XA3A 3D0VB 3ARFB 3FO0L 2R4RL 3FCTA 1VGKB 1FO0B 3BXNB 3W82A 3O45B 2X1WL 4OGXL 4RCAA 3BRGC 2MHAA 1HYRC 1T5XB 4YNYB 1S5IL 4ODVH 5L2JB 3SQOL 3HMWH 3VG0L 5T1MA 4BFGA 2FLBT 2FX9H 3IDYB 1GHFH 1DLFL 2X4PB 5ILTH 2IBBA 4PB9L 5D6DA 1QSZA 4PRDA 2FO4A 1ZA6B 1KN2L 2XXMB 3QXTA 4YHYC 4XTRD 3MV9B 1GZQA 4G6AD 5BZWA 4QXGH 3IAPA 4DZBA 2H32A 5D96C 1RAMA 5F9WC 1V3LA 1MEXH 1J8HB 3BH9A 4Z7NF 4RAVA 1Q9LB 5HDBE 5A16B 4WUUE 1NEUA 3ARPA 2W0KA 1DVFA 1Q9WA 3EO1B 1CQKA 2VQUA 3P0VL 4NBZB 3NTCH 3JV6B 3VXOB 3DROB 5FM5M 3SE3A 4PJXB 5D72L 1A7OH 3SKMB 5EIVA 1NGZB 2VXTH 3OJDA 1WK0A 3QUYB 4M7JL 1VSCA 5B3JE 2X4QA 2H1PL 2HT2C 4M6NH 3LD8B 1KIQB 4K94C 3FTGB 4O58L 5JDSA 4CU8A 3H0TA 1W72B 4Z7UB 2FIKA 3UC0H 3GSUB 4HV8B 2ESVB 4ZXBC 2IBGA 4TSBL 2EDKA 1GZPA 2C7UB 1XF2B 1UQSB 4UI2A 4XP6H 4ZUTB 5D7LD 3TC9A 1PDKA 4G8GA 1YMMA 4ZAKD 4WHTA 4APQB 3JWOL 4GG6F 4NZJA 1JI1A 5DD6B 1J1XL 4MA7L 1RZIB 2NY6B 3RVUD 1JHTA 5D2LE 1FZOA 1G7JA 3U0PA 4NC1E 3TBYB 1AGEA 4HCRL 1MH5B 3GIVA 4L4TB 2A6DB 1I4FA 4JFXA 4KVCL 3QWQB 5I1CH 3JTSA 4LSUL 1A6ZA 3EDDA 4ETQA 3PGDB 4EUPH 2B2XL 4QHMB 4P48A 5JPMB 3RPKA 2D7TL 3D48R 2OR7A 3D85A 5E99L 5F7EL 4M61B 4W4OC 5FF6A 4M5YH 3DYOA 5TH2B 3O2DH 3G6JB 3LQZA 2GTWB 3NGBC 4ONFH 3PWPD 3U9UB 4L3AA 5J9PB 3BP4B 4IRZH 4JFEE 1QSVA 1AQKH 4Y5VA 1NMAL 1YMMD 1H3GA 4NQCB 5DA4A 5KVFH 2NCMA 5LAXA 1LHZA 3PXHA 2DLHA 1HHGB 3QFJE 3GMQB 3DXAB 5BZDA 5JORB 4NQVA 3QEGH 4ACPA 5E08H 4J3VA 3OKKB 4AQ1B 4ZD3H 1F4YL 1GRWA 5JO5A 3W5NA 5D9SA 1CGWA 1MCCA 1JYNA 4JN1H 5C0CB 2Z35A 3FQUB 3GB7B 4PBXA 3UTSB 1JBJA 3D85D 1G6RL 1KCLA 2Q7NA 3H9SE 4S1DC 4PJDB 5HYJE 3P73A 3U6RA 4NN5C 4YBQC 1BMGA 3ZKMD 4HT1H 4OLZH 2FHFA 3WHXB 4LK4A 5JHDA 3GJEA 2JCCE 3NAAL 1I3VA 1N59B 4JM4H 1EAPA 3P9MA 2BSRA 1P9MC 4BFIB 1D9KC 1UWXK 4OF3A 4KXZI 3DVNB 4W68A 1RULH 2VL5A 4PJ5B 1XGPA 5C92A 2KQMA 4WI3A 3HHRB 2ICWB 2QKIB 2IADA 3O3AB 1U2HA 3CU1A 5HHXH 2BXYA 3QIUA 5FKAA 3LEYH 4UINL 3GRWL 4P59H 5GSRA 5HHQB 2XZAH 2QJDA 3WE6A 3MJ7B 4U3HA 3FFCE 2P44B 1EHLH 3UTTB 5SX5K 4QYOA 5HBBA 3IDGB 4WFEE 3GI9L 2KPNA 1QEWB 2F58H 3QJHB 4EI5B 1FL6B 3FO1A 4NPYA 3W81A 1HSBB 1I7ZA 2GSGA 1UWGH 3BDYL 5DR5L 5IW3A 2XQYG 5CILH 3V0WL 3C8HA 4TVSa 3QNXA 4G8FA 4LSPL 4EOWH 1DSFL 2DLEA 4XMPH 1RFDH 3K46A 4WUUA 5CHNB 5IMKA 5IHUH 5GIRA 4ISVA 1H5BB 5DVNA 3QIUD 4PRPB 2I07A 2O5YH 3CXDH 3VXTB 1BPVA 1CQYA 5AZ2H 1KN4H 2ICEB 4L4JA 4MVBD 2VZ3A 4LFHG 4NN7C 3RGVD 4P5TA 2Y25A 1AGFB 5IEKB 4X6BA 4LRNH 4OSUH 1MCJA 5TF1L 1A02N 1N7ML 2EECA 4CKVX 4Z9KB 4WU7B 4F7TB 4JQXA 4UV4H 5JW4M 1ZHNB 4X6FB 5T3XD 5K9QG 1NGQH 1BAFH 1LE9A 1NGPH 5FYKE 4LCUA 1FL5A 5AYQA 3MUJA 4GRWE 4Y4HB 2YZ8A 3HR6A 4RMRA 3U4AA 3W11C 5EO9B 3KYMA 3D3VB 2PYFA 5K9QI 4X4ZA 4ODVL 1IGYB 4NUJB 2IBZX 5EN2A 1FFRA 3QUKA 3HMWL 3EYUH 1A9BA 3DBXB 4QOKD 3MBXH 5JW4R 2FX9L 1J1PL 3HE6C 3VH8A 4HCRA 1GHFL 1XIWA 5ILTL 5CMAA 1OAYH 3MUGB 4GG8A 1AKJB 1FZJB 1JZ2A 3C6LD 3D5OF 1RJZA 4XC1L 4JFEA 4ZQKB 3FB7A 3C60A 4YHOH 3VXRD 3MV01 3ISWA 2CR3A 3B8SA 3QFJA 1QFHA 4NFDA 1MEXL 4KDTA 4LPYA 2OJEB 1R3KA 2X7LA 4HJJH 3UPRB 4ZOAA 4WDIB 3JWDH 3PGFH 1RZKL 3JTTB 1OTTD 3WNKA 5HVFB 1A7PH 2IEPA 5CINH 5ICZB 2DKUA 4I2XE 3JWDC 1U91A 2Y7QA 3KGRA 1HSAB 3NTCL 5E8DH 2LE9A 2NY0D 1UH4A 5GS1B 1XIWD 2MQCA 1A7OL 3H9SA 5HYJA 4K94L 5MP6H 2VXTL 2NY2D 2NY4C 2VXSH 4M6NL 2YUVA 5C0BD 1BLNA 4MB3A 3OKEB 2JCCA 1N6UA 3C60D 3NCBB 1U95B 3GSXB 5HDBF 1ACZA 2YUWA 3C5SA 5HGHA 3ARQA 1XGTA 3P2TA 3QFJD 3QNYB 1A9EA 1I7RA 3ARGA 4XP6L 2EO9A 1YEFH 4AJ0A 3SCMC 1S9YB 2I9TB 3LEVL 2P46B 2Q20A 4TSCL 3LH2H 3OKNA 1XR8B 3BIBX 4ZNEE 5B3JF 5C0IB 3H9SD 4KJYB 3P4OA 4M1CD 3WL9A 5HYJD 3WKMH 1LEKB 2Y6SD 3F12A 1MCOL 3FFCA 2QSTA 1ND0A 1XGQA 3THML 5EC2A 4RX4D 1YY9C 2FWOB 4TQEH 3QDMB 3CK0H 4M5YL 3GUTA 1FL3A 3O2DL 4WFGE 3L3IB 1WCQA 4ONFL 5E9DA 1KJ2B 4PJBE 3QZWB 4ZUVA 2N56A 4IRZL 1DQQB 5FO9A 1AQKL 2NW3B 5D2LF 1SYSB 4HUWB 5ESVA 1YEDA 5KVFL 3NH7H 4NKDB 2NLJA 3NFPA 4AZ8A 4ERSH 4WI4A 3TO4D 4JFDE 2XPGB 4PP1D 3T0WA 1CT8A 1RZFL 3TZVB 1LO3H 3K4DA 3QEGL 4JFOA 4LHUB 5FOBB 5E08L 4K23H 3T2QA 1VDGA 2C3GA 4M43H 5E2UH 1JCKA 2PXYD 5IK3B 5MEOB 1TTUA 4MD0A 4FXKA 4ZD3L 3FFCD 5EU6B 2OL3H 3BPNC 2Y5EA 1TQCB 4JN1L 4ZPVA 3BKCL 5E6IA 4DOHE 3OV6A 2R1WB 1BEYH 2KUTA 4ETYA 5GRUH 5ID0B 4AT6A 3PJSB 3PHQA 3RY4A 4KMTL 1RZ8A 5EBLA 2XKUA 1JHKH 1GYAA 5MERB 3EJYD 4HT1L 4OLZL 4K07A 5E9DD 1TDQA 4HWZB 3DVFA 4JM4L 4LPXA 1HXMB 1BGXH 5I1HL 2IBZY 5KSAD 4P2RE 4Z7OE 5HGAB 5EU5B 5BO1H 5ISZE 1NCWH 4HK0B 5DRNB 3AMLA 3EYFA 4ODWB 5J12C 3MLXH 5BRZE 3HC4L 4IMKC 5HHXL 3U4BH 1TZIB 3LEYL 4M1DL 4P59L 1BZ9B 2XZAL 4X98A 1JPGB 2JCCF 3WXWH 4F7CA 1OLZA 1KB9K 3N1QC 3LKQA 1JF1A 1EHLL 2DLIA 3GHBH 2BVPA 3ECBB 1FFQA 2Y5TB 1RIUH 3V4UL 2VABB 4PJ9A 2F58L 3DRQB 4FQXC 3QG6A 1TCMA 3DUUB 3QCTH 1EJOL 5FGBA 4XMPL 1RHFA 1RFDL 1LDPH 2VZVA 5E8EA 5HI3C 5IB4B 5DUBA 1T4KB 2FD6H 1C1EH 4C57C 1CGYA 3P4NA 1X5FA 1TVHB 2O5YL 3SBWC 5KS9E 2DM2A 1R5WA 5DDHB 4FHBD 5AZ2L 5K93A 2P4AB 3QIWB 2EE2A 4TUJB 3CFEA 3CVHB 5DRWB 2HFTA 2PNDA 1Y6KR 4JRXB 5HHOB 2I9LB 4LRNL 4OSUL 4KRNA 3OKOB 3E2HC 5KSBE 3EOAA 3L3JA 4UV4L 1F3RB 3TNNB 1OP3H 2GFBB 1ULVA 1NGQL 1BAFL 4X8XA 2X1QA 3IJHA 5EC1B 4OZ4A 1ZSDB 1G7QA 2R23A 5IOPA 3EOBB 3RDTB 3BKYH 4ZNEA 5C0GA 2X6MA 2VLME 5IWLC 3I6GA 3ARBB 3F5WA 4HKZB 1RPQA 1XGYH 3EYUL 3HAEB 3MBXL 4NQSA 2VLRD 3B9KC 3KPRE 1NFIB 3FQTB 1ZE3C 2CPCA 4LLMA 1OAYL 1TITA 2JB5L 3K2MC 3SPVA 2VZTA 4EUPA 4ZXBD 3L7EB 3IFPB 3UPAA 4HFWB 5CEZE 4PJBA 4GRWF 4CADA 4LP4A 4YHOL 2QR0A 1ZA3B 3C5JB 1CDUA 2XFXB 1T20A 4M7LT 4HJJL 2R39A 4JLRA 3GKZA 3JWDL 1D5XA 3K4ZA 4PJ8C 5CLTA 3T08A 1QFOA 1ZWIA 1A7PL 2PYEE 5CINL 5H2BB 1NGXB 2FDBP 2Z91B 2HH0H 3VE0B 3PWUB 3PNWA 4F3FA 2PO6A 3WD5L 4QWWC 4TTDC 5TFSH 1KACB 1A6WH 5CBEA 1D6EA 2H9GB 4JAMB 3LSOA 2QQNH 4WFGD 3TM6A 5A3IC 4Q6IB 5MP6L 4FRWA 3MRJA 2VXSL 1ZHBA 4LMQE 3DTXB 3V2AR 4OZFH 1GAFH 32C2B 4QGTA 3HPJB 5EBMA 3PL6C 1IEBB 3KPPA 2D2OA 5KSUB 1P9MA 1D9KA 1UKSA 4P2RA 1TNMA 1YEFL 2CGRL 2CLRB 5ISZA 2BNQD 1A3LH 2EDJA 2VLLA 5HGGS 4FQHA 1FC2D 4RQQA 2EDTA 3LH2L 5DJDB 3RWJB 5BRZA 1OSPH 2PO6D 4NZRH 3RFZC 1QPXA 4UT9L 1FFOA 2BZDA 4S1DD 3F6IA 1LMKA 3STZB 2E9JA 4YBQD 1RZGA 4Y5XB 3B9DA 1ZGLB 2YN3A 1FFNA 4U6HB 1LEGA 2G60H 5BZWB 4TQEL 2Z8RA 3CK0L 1RHHB 1AGDA 1OY3B 1GVIA 1KV3A 2WBKA 2Z0BA 5ANME 1T66C 2IAMC 1D9KD 4X9FA 2AJVH 4P2RD 3TBVB 4DKAA 3D6GA 5D7LB 1HDMA 2AV7A 3O41A 3WNLA 2CMRL 4P4KC 4ZAKB 1KLFA 3MYZA 4ZTPH 4ERSL 3FT2B 2IMMA 1WWBX 2GJ6E 5KVGL 2VISB 5B8CC 1LO3L 2ICWI 2WK2A 2LAAA 2HJLA 1PZ5A 4K23L 4M43L 2DMKA 5E2UL 1WITA 1QLRA 4PBVC 3VRIB 3FT4A 5DMYA 2OL3L 3B83A 3N1GC 4L9LC 2N4IA 1B6DA 3HI1B 4PJBF 5E2JA 1DN2A 3F7QA 1BEYL 3CFBA 1BWWA 3A6OA 5GRUL 2WANA 3BGAA 3QNZB 4K7FA 2BMKB 1CFNB 3FT3B 2WM0A 1JHKL 2BDNH 1WISA 3PWPB 4O2EA 5KSBA 1EVUA 1CXLA 4MNGE 2UVEA 4U1SB 3REVA 4M3JA 4LVNB 4KKBC 4JPIA 1BF8A 2AJYH 2ZSWB 4M48H 1BGXL 4W4NA 1NCUA 5J6GB 5MENB 4PR5A 4YIQB 3B4NA 5F1NB 4YEEA 1UADC 2HJKA 5D8JH 2YS4A 1T04A 3BQUB 4PREA 3MRQB 2YSSA 1NCWL 3WS6A 3G6DH 1P6FA 3RA7H 4N5EC 1AIFB 1I9RL 3MLXL 3VFSA 1ZEAH 3U4BL 3KPRA 1JWMA 1MCQA 1UVQA 4ORGB 3HE6A 3HMXA 3J8F7 1XZ0B 3OAZH 1L9MA 2WBJC 3WXWL 4K7PH 3NN8B 1JL8A 2G75A 3GHBL 4XWOC 4Z5RB 4IHOB 3QDAA 3MLYH 4Z7OF 4NUGH 5FYKU 2YPLE 4DK6A 3V0VB 4X4XB 5JXEC 1AR1C 1OHQA 8CGTA 2FL5A 3W11D 1DQLL 2DWEA 4IRJA 1LDPL 2M2DA 2IGFL 3MRPA 3SDDA 4D2NA 1LK2A 5DJZA 1XF5A 2PYEA 4OJFL 2FD6L 1IKFH 4F57H 4UTAL 3HE6D 3ZKQD 4L4VB 1K4DB 3VGAB 5SWZE 4F80A 5LG1A 3D1MC 1ZT1B 5IB5A 5FUOL 1FQ9C 1IT9H 2Q8BH 2DMCA 4JREC 1E6OH 1OVZA 1EEYA 5D93B 2LU7A 5BMFL 4HKXB 4NJAH 1OCWH 4OKVB 3EBAA 5KS9F 1MWAA 2FJHA 2R56H 4P23C 3BT2L 1FE8H 3T2PA 4K9EH 2FR4A 2ZSVB 4CW1B 4R3SA 5E7FA 3BKYL 4K9EC 5DXWA 3V7AG 5AZEH 3IAGC 1J10A 5KSBF 3LPFA 3RGVB 2AXFA 5EH1A 2NY4D 4HLZG 4U1LB 2P8MA 1M71B 4X5WA 4NHUB 4PG2A 5C1MB 4FS0A 1DLHA 5ANMA 5JPNB 5D7JB 1KIRA 3S96A 1E4XI 3GO1L 4B7LA 3AU1B 3MGAA 3O6KH 4FFVD 5AG9A 4HBQA 3O6LH 1I1YB 3SO3B 1NDMB 3SCMD 2ORBL 2PETA 1IJ9A 4XHQA 1PYWB 4MDJB 3V8OA 2UZYB 2GJ6A 2VO5A 3BJ91 4R97C 4NJ9H 3VXUE 1UCBH 2WZPD 4WJ5B 5IFHH 4L8CB 2DBLH 1QHPA 2ZOLA 2EXYC 4QOKB 3O3BB 4LEOB 1LO5A 2HH0L 2EO1A 1WBXA 4LVOB 4ZOEA 4HEPG 3VXPB 5TFSL 1VFBB 1YY9D 2MKLC 1MLCB 5C3LD 3OWEA 4NQDB 5I17B 3V5HB 4JO3H 3ULSB 3QZWG 4FQLH 3C6LB 1NH6A 2CLZA 3U1SH 3BEWB 4JKMA 2VIRB 4N9GB 1YPZB 4X9IA 4MNGA 4WIQA 1BM3H 4RISH 5E4EB 5E95B 1I1FB 5LXGL 3VXRB 1U92A 1GAFL 3HE7C 2DQJH 3CC5B 3L95B 4MS8C 3H3KA 1AHWA 4LHUG 3I85A 3WIFA 2GJ6D 3ME0A 2ADGB 2IPKB 1FV1A 3QP3A 1QFWH 1CFTB 1ORQA 2A9ML 2EE6A 1A3LL 4ZO8A 1NCTA 1Z5LB 2VKWA 5GGVH 4J23A 4XCFH 1OSPL 2NY0B 1I7UA 4NZRL 2ITDB 2NY3B 4IMKA 3E6FA 4GG8B 4GOSA 2ARJB 4C4KO 1FN4B 1U8LB 2OSLB 2NY2B 4X80H 3HG1E 2XG4A 1UJTA 2LVCA 5C0BB 2R2EB 2C3VB 3ZTJH 4EIGB 4LQFL 3C60B 2G60L 2EEDA 1QSEB 2YPLA 4NQXA 5IIEA 3P4MB 1MFBH 4H1LB 1FG2A 3DX8A 1EXUB 4GSDL 1Q9OA 1BQUA 4LDLB 2AJVL 4ZUWA 4D0CB 4OB5H 2DN7A 4JDTH 1T6WA 3O3UN 3MLRH 2IPTH 1T1WA 5KSVB 2VWEE 4NOFA 4DEPC 3SBWA 3FQXA 3BE1H 3QISA 4X9GA 4M7KH 5FA3B 3V95A 1G6RB 1BOGB 2DIBA 5GHWH 3SDCC 4HF5H 4MCZA 2CSPA 3IXTA 3QWRA 5HJ3A 3MYJA 4H5SA 2VQTA 1BFOB 4XNQA 3ZKXB 3W9DB 1ZLVK 1S78C 2BDNL 1SBBA 2H8PA 5TGBB 4R2GC 3HKFA 5JZ7C 3IU4H 4GS7C 1I7TB 1IL1A 4D8PA 1DUZB 2MPAH 1S9XA 2AJYL 5HI3D 2CLVB 4M48L 2APWA 3U4EB 3TO4B 3P77A 1H15A 3RU8H 3OKDA 2RFXA 3NOIA 4O51A 4JQIH 4GKSA 2ATKB 5D8JL 4LCWD 2PXYB 5IWLA 4W6YB 4WV1B 3G6DL 4OCSH 1OGTA 2Z31C 1R5VB 1YNTA 5I71B 2XWTA 1ZEAL 2D4DA 3EYSH 2G2RA 3INUL 1KYOJ 1WT5A 5E1HB 4MQXC 4MJIE 5GSVA 4K7PL 1EFXA 1XGRB 1NDGA 2YOCA 4LLWB 5FM5O 3MLYL 4MNQE 3G5YB 1I9IH 1D5BA 2HVKB 1OSZB 1R0AH 5AAMA 5I73C 4Z7VE 5F7FA 4K55A 4XAKE 5GS2H 5KSAB 4IIQC 3VXUA 2RQ8A 1EHNA 3HAEG 2W60A 5IB3A 2X4OB 3KPMA 1FBIH 4KRMB 1PY4A 5KANI 4NWUH 5DF0A 2XTJC 1MHPH 1D5ZB 1S7RB 8FABA 5HHPB 4Q9CA 5L88H 1HKFA 4JHBA 2P42B 5DS8A 3QIBC 3M1BB 4E41E 2OXGA 2IQ9H 2AEPH 5HTSA 3OJMB 2Q8BL 4XNYH 2XN9D 2UY7A 3TBTB 3QQ3B 4NJAL 4PJ7E 1WEJH 1NANH 2DQUH 4C55A 4RA0C 2R56L 4KKLC 4GBXC 4PJ8D 5EULV 3QUZB 1FE8L 1UXWB 5DJCB 2MFNA 3MX0A 4K9EL 1AD9A 1G9NH 3FRPA 5DEZA 3SGDH 4QWWD 3SGEH 1G9NC 2AI0H 5AZEL 3BP5A 3HG1A 3MLVH 5CFHA 1G9MH 5A3ID 3T77B 1F4AA 3D69A 5SX4I 3ZE2E 2CXKA 1U8HA 3ALPA 1MFEH 1G9MC 3EDJA 1F5WA 4NO3A 5I9QC 1ZVYA 4L8SA 2AXGA 5D96B 5CZVH 5F9WB 1BF2A 3PL6D 1LGVA 4LBEB 5L6YH 3O6KL 1WTGT 4BH8B 2OP4H 3O6LL 5I2IA 2YPKA 3SKNB 5HYIA 4DJMA 1UJ3A 4MLSA 3EDFA 4HPYH 5I1KH 4U6YA 2C1OB 1LNUB 5J89A 4NJ9L 1CICA 4WW1A 1T83A 2DBLL 1JGVH 2ICES 4HQQL 2VLRB 4IOIA 4DCQB 1DBMH 43C9A 3LV3B 1RVFL 2FYYA 1QTYT 3WIIH 4JO3L 4Y1AA 5GGUA 4ZXBB 3ZTNH 4FQLL 4J8RB 3HCVB 1T66D 1BM3L 4RISL 4LIQH 1FVEA 4UNUA 2DQJL 4P4KD 4PGZA 5JIIA 4JRYE 2BXZA 2X4UA 4M9PA 5IQ9B 1KG0A 2YD7A 3RQ3A 3DGGA 3DURB 1QFWL 2FO1A 2BVOA 3VDCA 4YHLH 4PRBB 3MXWH 5GGVL 3FO2B 3P11H 2JELL 1RK0B 3LKPA 3AAZB 1FLRH 4HFUL 3WBDA 4MJIA 2J8UB 4Y1AD 4X80L 5JXAL 1J7VR 1RURH 2XYCA 4RZCA 5AD0B 3OSKA 1M7IB 2BY0A 4OIBA 5ABDE 1IILE 3NGBB 4M1GH 3DX6A 1IC1A 1FGNL 3W39B 1OP3K 1A14H 3WJLA 4MNQA 1TZGH 3F8UB 2LAGB 3LRGA 5E5UB 3KAAA 5EZJB 4PUBL 1MFBL 4KKBD 1OF2A 2VE6A 4Z7VA 2KQNA 4YHMH 4Z0BH 3UJIH 2GTZA 1BZQK 2BNQB 3DIFA 2F19H 5DJ8B 3TYGL 4I4WB 4WEBL 4HGWA 4JDTL 4M6OH 1OAZH 4PJHB 5C0JB 1L0QA 3SE9H 3MLRL 2D7PA 4N5ED 4KMQA 1I75A 3WDIA 2IPTL 5MHSE 3TYFB 1S7XA 3BZFA 1ZLWK 3FB6B 2HLAA 4MJID 3LSOB 1T89A 2QSVA 3BE1L 4Y19B 4Y4KA 2WBJD 3PG2A 4I9WD 5FK9B 1A2YB 1OW0C 3MXVL 5GHWL 4E41A 4O5LH 1Q72H 4HF5L 4MNQD 2CDEB 4LPUA 3EYVB 3T1FA 2EDRA 1AR1D 4CVZA 5D5ME 3KPQB 3VFGH 1CE6B 4CMMB 3WNOA 2BVEA 3OKLB 4LNRA 3PV6B 4FQHB 2EH8L 1BJ1H 1FDLL 1P4IL 2HP4A 2L7JA 3FHQA 5B39A 4TYUA 2Q6WB 3EYOA 4JQIL 1TMCB 5FM8A 4G8IB 1S7UA 4K3EH 1A7QH 4OF5A 4OCSL 4PJAE 1F2QA 1KUMA 3CFCH 4PPTA 3LN5B 1BREA 3R06B 4C59B 1BZ7A 1FFNB 4E41D 1I1AA 3EYSL 4H25A 5SV3A 5B38B 4EDXA 1OTUC 5IG7B 1U3ZA 3QQNA 4X6DE 2DQDH 3U82B 4HIJB 3F7YA 3MACH 1U8MB 1YY8B 3BMVA 5HYQA 3ARDC 3MFGB 5DC9B 1I9IL 2VDKH 5CD5C 1H3VA 2AK4A 2B1HH 1CWVA 4PJFB 4P23D 2VERN 4X4YA 4BK4A 5C09E 3DHMA 4UDTA 4HIIB 4NYLA 1X7QA 1QLRB 3LKSB 4OZGB 3IYLW 4ELME 3RNQA 4JHAH 3DECA 5TE6H 2JJVA 5EBGA 3GSQB 1IC4L 4G80B 5JTWA 3MRLA 4NWUL 4MXWL 3KDMA 4NN7B 4NDMB 3CFKA 1YN7B 5C08E 2EDXA 3A6CL 3U83A 1BQSA 5MEPA 4I3SH 4EVNB 1W8NA 4HPOH 3TO2B 1BVLB 2R0KH 4GKZA 4G42A 4Z7VF 1M4KA 1WAAE 2IQ9L 4BKLA 2QSCH 3TCLA 5DJAA 2AXJA 3OR7B 4WGWB 2EXWC 4RAUA 4PLNC 2AK4D 5C07B 3TV3H 4XNYL 4NWTL 5F97E 3SDXE 1H0DB 5BS0B 3R8BB 3V4PH 5GRZA 1T04B 1RMFH 4KUZL 1G7LA 2DQUL 2DTMH 3TEUA 1DN0B 5ETUA 3SKOB 2FX7H 1Z9SA 3O4OC 3TCXA 2EXYD 1NBYB 1YEEH 3QXVA 3OGCA 4CDHA 3KPSE 2BVUA 3ZYIA 1FIGH 1HOCB 4NNPH 5C0EA 1UA6L 3B5TA 5DSCB 2AI0L 1MRFH 2EIZA 4LOUC 1G9ML 3HI5L 4FQ2H 1DFBH 5C7XH 5C0DB 1MFEL 2JK5A 3AXLB 4ODSH 4PJ7F 1KNOA 1MPAL 5IKCB 2EYSB 5ALCL 4F2MA 3VI4E 3OKMB 2FL5B 4MWFB 2NTFB 3HE7D 3IFOB 4TNWF 4MS8D 5CZVL 3JV4B 5L6YL 1CVRA 2B4CH 4P46A 4ZG1A 2OP4L 3RHWK 5EPMB 1KB5A 1XF5B 1G7PA 2B4CC 5D1ZC 4U1GC 4J1UB 4AG4H 3VH8G 1JNHB 1DQJA 2V2WB 4HPYL 1LK3L 5DJ6A 5I1KL 3IVKA 1HHJA 4JY6B 1A1MA 3ZE2F 1EAJA 2DWDB 2VLKE 5CP7A 1I3GL 1TETL 2Q3ZA 3MNVB 2VLJB 1A1NB 1DBML 4YWGH 3ZYZA 5IP4A 2PTTA 4H1LG 1SEBA 5I1AA 1UG9A 1XR9A 3ZTNL 2HFEA 4AH2A 1TCRB 3IGAB 1KGCD 5D5MA 1E4JA 1DEEA 5BVPH 2ADIA 1WGOA 2A9NL 1UT9A 4LIQL 1J0YA 3SCMB 2YXMA 1BQLH 4RGOH 2YD1A 3WIHH 4G6KH 5I15H 4RRPG 1MREH 5IM7B 5MHSD 3GSNH 4K3JH 3ZSSA 4X99B 2OR8A 1MJ7H 4YBHA 2FJGB 2CR6A 3A6BL 5ACZA 4GQ9H 3BD3A 4YHLL 3ALXA 3MXWL 4PJAA 4RA3A 5JIKA 4O4YH 2AS5M 3H7BB 3MMEB 4HKBA 2Z31A 1W0VA 4MD4B 3MPCA 4RIRB 1FLRL 1PLGL 2XICA 2H26B 3SDCD 5L2KE 5JR1H 1DLHB 4X6DA 4OT1H 1KIRB 4EQ2A 3FOLA 4TNWK 5F8QC 1S78D 4M1GL 25C8H 4R2GD 4YFDB 1U8KB 5JZ7D 4Y4FA 1TZGL 4P2QB 2NY1C 4AIXA 3SE8H 3PWLB 4Z0BL 4YHML 3UJIL 3HPLB 5C09A 2F19L 4IIQA 2BOCB 3K8MA 3TVMA 1J5OH 4M6OL 1OAZL 3NCEB 4ELMA 3VFTA 4Z0XA 1GH7A 3SE9L 1WBXB 2Z31D 1J11A 3BPNB 4XRCA 1U6AH 2OL3B 1UACH 5C08A 4QRPD 1V05A 1BBJA 4PLKC 3V79C 1EEZB 3WN5A 4O5LL 4QNPE 3ZT6A 1M05A 1X5JA 1LO0H 1I8LA 4XBEH 3QHZH 1T1ZB 4OAWB 1QFPA 1EO5A 2DBJA 1J05B 1ADQH 4JKLA 2Y07H 3MGTB 4XVJH 1S7VA 3QXAA 3NFNA 4L3CA 1BP3B 2GAZB 1RUQH 3TVMD 5LVEA 1KJVA 1G7IA 3DRTB 2VXQH 5SWSB 4LPVA 5I76A 3BIKB 2DL2A 4LHJB 3W0WE 4GBXA 4LKXA 5J12B 1I7UB 1HHHB 5HSFA 1CVSC 3QCVH 2OLDA 4I0CC 4UOW1 3RIFF 2XTJD 5EIIA 5CGTA 5F3HB 1A7QL 3FQRB 3H3PH 3CFCL 5D1XA 4ZO6A 1AE6L 3HR5B 4P2OC 2W65B 3QIBD 1KT2A 4R9HA 5D5MF 2R8SH 5C9JB 5IGXH 1FVDA 4XNXH 1B2WH 3RTQC 2D31B 3I02B 4U6XA 3MV7E 4FQXB 4PGEB 4XGZB 1I8MB 3ARXA 3MACL 1MCWM 2VDKL 2ADJA 2B1HL 1DUYB 3D2UD 4GBXD 4KKLD 4PJAF 3ARSA 5J0BA 3MA9H 3MA7B 4JPVH 3U0TB 4LCWB 3WFDH 2EDHA 1VFOA 2Q86A 4QT5B 3IJSA 1U8OA 2E9BA 2VLKA 1U8PB 5TE6L 5D1XD 4X6DF 1R3JB 4JPKH 1WIPA 3UTQB 5EIQA 5C0FA 2DICA 4TSAH 2HTLD 4XCYB 4A2MA 2JLLA 3MJ8A 1X44A 3Q5OA 1PQZA 2OTWB 2H8PB 1YQVL 5HI5C 3Q1SL 1KTLB 2COQA 1ACYH 5FDWB 5TQ0L 3UTZA 2VZOA 3ET9F 2LABA 1MJJA 2P5EA 2QSCL 4KK8C 2J7LA 4PJEE 3JUYA 4Z7WB 5IR1B 3TV3L 1PKOA 1HWHB 3CGTA 3P77B 1H15B 4JGMA 4ELMF 4JN2A 4R7DB 4G6JH 3KLHC 4UQ3B 3QULA 1NC2B 3V4PL 3WO4C 1B6UA 1RMFL 1G7HB 2DTML 1T1YB 4PS4H 3RIFK 3B5HA 4HH9A 1NCNA 1ZVSA 4HC1H 3VGDA 1C08A 2FX7L 2H41A 2XWTB 5HPOA 2IANE 1YEEL 3CFDA 1L7TH 5DEGB 3B9KB 2DAVA 1WAAF 3QEQE 4OCRH 1S9WA 4ONGH 1FIGL 4NNPL 1FCGA 4YPGB 4DGYL 4X7SH 1MRFL 3V6OE 4FQ2L 4Q0XH 5M94B 1PEWA 1U8JB 3SDXF 5C7XL 3JV0A 3TWCH 2BY2A 2P5ED 5DWUH 1G7MA 4ODSL 4ZUUB 2R0LH 1WBZA 4OM1L 3MV8A 4N8PA 3O3EA 4BSWA 1C7SA 4LAJH 5DI8A 2XN9B 3BGMB 4HUUB 4ODXA 2Z92A 2O61B 1T1XA 2B4CL 3SKJL 1VADB 1MOEA 5EO1A 2VUYA 4PJ8B 3WXVH 4HBCL 4YDJA 4AG4L 3FAXA 3V5DA 3LS5H 3ZYJA 1Q8MA 2F54E 2IALB 5D6CA 5C8JA 3BH8B 1A64A 4EUPG 5DRXA 3VJ6A 5IF0B 3VI4F 2VZUA 1G0DA 4FQPA 3RX5A 1QLFA 4KGJA 4F7EA 4HIEA 2OQJA 4QXUL 1FJ1A 5CEYB 3MV8D 5EO0B 2AK1H 1CYGA 2H2PC 5DQ9B 3B9AA 5I66B 3CH1A 1CXEA 1NCCL 2Q3AA 3PL6B 4OZFB 5BVPL 1VFMA 4CVUA 4DKFH 1BQLL 1HE7A 4RGOL 1J12A 3WIHL 4NSKA 1HIMH 1FAIL 2YC1B 1TTGA 5IW1B 1MREL 4U0QB 1Q9KB 3GSNL 3IETB 3OHXA 4K3JL 5E8OA 3ZE0E 1MJ7L 4GQ9L 4XC3H 4JKPL 4QRRD 4ZYKB 3B2UC 3IU3A 5EOCH 4O4YL 4OI8A 1CGSH 1QLEH 1A1OA 3BO8A 3M17A 3QFDB 1U3HC 4JGJA 1Q0XH 3PXJA 5FGCB 5JR1L 4M4PA 4U6TA 4XXCA 4OT1L 3MV7A 1BIIA 4NRXB 4YXKH 5D1QA 1UKQA 1QR4A 2IAMB 5ENWB 25C8L 2DS4A 3P0GB 4BZYA 3SHSA 4P4KB 1RV6X 3QR2A 1NAMA 2LFGA 2QQQA 1JF5A 3ARDA 5C6PB 4X6EB 4JFPA 1JTOA 3SE8L 4MDIB 3DMMB 4M62H 3OGOE 4YFLI 3U46B 5B8CB 1FPTL 1Y18A 4MA3B 3KR3H 1GCFA 3KLAB 5LQBH 1J5OL 5B38G 4L9LB 3WYRA 2CKBA 1U6AL 4NFCA 3ZT5A 3BWAB 3D0LB 1ZLUH 1P69B 2NX5E 3V0AC 1UACL 1KXQE 1FO0H 5J3HC 1G84A 1OTUD 3RUGA 1ZT7B 3WFBL 1U9KA 3CSBA 2BSSA 5DUPL 5D1QD 4J12A 1U8QA 2GIYA 1IAIH 2DDQL 1Y6MR 3EJJX 5E6ZA 4PJEA 1WC7B 1JYXA 1LO0L 1GJIA 4XBEL 2OS7A 3ARDD 1C16B 3Q5TA 3EO0B 5CD5D 3IDXH 1ADQL 1M7DA 3DGGB 4ZSOE 2Y07L 4C83A 2IH1B 4XVJL 3TN0C 1NKOA 1RUQL 4JJ5A 1URLA 3FZUD 1ED3A 2AEQL 4QLRA 2OMNA 1QO3B 3M07A 2IANA 3TH4T 1KB9J 1EEQA 1NAKH 1OGAB 1N3NA 3WFHB 4PG9B 4QKXB 3QCVL 3QEQA 1E28A 4QNPF 4PJCE 1WTLA 2J8OA 4J4PA 1R3LB 4HS3A 1GPOL 2WBJB 3V6OA 5J13C 5F6HI 3GMPA 2R8SL 1WZ1H 1ZK9A 4MJ6B 5IGXL 3HB3C 4D9QE 4XNXL 1EHXA 1B2WL 1LO2H 1OF2B 1P7QB 1HKLL 2EXWD 3KPLB 4WGVB 3C2AH 3QDJE 4KROC 5FECA 2J3SA 3DO7A 4KKNA 3DIFB 3OAUH 4OUOA 5HY9B 4YXHL 4HGWB 4JQVC 5DFTA 3QUXA 4X9BA 1MCPH 3N50A 3KVQA 4BSVA 2F54A 1QVOB 3MA9L 4JPVL 1B0RB 5IB2B 4NQUA 4LLDB 3CUPA 5ADOH 1MQKH 3HUJE 4ZPTA 1SYVB 1QOKA 4HWUA 2V7NB 4LOUD 3UJJH 2HWZH 5C0NC 4TSAL 1INQB 1FNHA 5CSBA 4HMCA 1IC7H 3L1OH 4QXTB 4RGNE 1M6OA 4HUVB 4JEGB 2NTSP 5ICYA 2R69H 4JREB 4LSVH 3MRCA 3QBTB 1ACYL 1N2RA 4NRZB 1QRND 1W8OA 2AJXH 3OR6A 1NLDH 4XCCL 3O11A 3G5XB 4P23B 5D1ZD 2DJSA 4G6JL 5K9KB 3IDUA 2J5LB 3T65B 1K2DA 1U0QA 4LSTH 1OQXA 1IRAY 4N0UB 4PS4L 3F7PC 5SWQA 5IMMB 1J1OH 3CFJB 3LRSB 4DVBA 1UXSA 4NIKB 2EKSB 1L7TL 3ULVH 2AV1B 3X12A 5FDYA 4ONGL 3FFDA 2G9HA 2WW8A 3ULVC 4Y5YC 4PJEF 4X7SL 4Q0XL 2QEJA 2WWMC 5DMJB 5DWUL 4LCIH 4XPBL 1KTRL 2R0LL 3ZKNC 4LGSB 4PBWD 5CZXC 5FYLH 1S7SA 5FM4A 2X1XR 4I5BA 4OD2B 3MJ9H 3JVGC 3KPNB 3TIDA 5BXFB 3Q48A 3LN4A 3PQYB 3C6SB 4G9FD 1OPGH 4LSSH 3LS5L 1SBSH 1CGTA 4PTTA 5I74C 4BQ6A 4QRUB 3OXSB 3R4DA 3CXHK 1GIGH 5H35B 2NY7H 1FYTB 1F11B 2AK1L 5GS3A 3IDMB 4AIZB 2NY1D 5I8EB 3HE7B 2QQLH 4YHIA 3M8OH 4Z95H 4OKDA 2J2ZA 3KXFD 4ZSOA 2APBA 3CZFA 4FQQA 1AXSB 4U1MB 1RJYB 4DKFL 5I1LA 1JGEB 1HIML 3BZ4B 3LDBC 4LVHB 1E27B 5GGTA 3DSFH 5T33H 1WVZA 1A4JB 4QHUB 3WS3A 3C5ZC 5E1AB 3RVVD 1CL7H 3LKRB 1IAKA 1T21B 4XPTH 2FGZA 1J0HA 2VN4A 4OLXH 4PJCA 5DLMH 2I60H 4XC3L 1CN4A 2VTFA 5EOCL 4XXDB 2A74B 5EBWB 3UTPE 1D6VL 1QLEL 4PLKD 1CFQB 4PRAA 5E94B 4P2OA 5GZNC 1Q0XL 1OD7A 3ZE1E 5KW9H 2PN5A 1EK3A 3DX9B 2OI9C 2FECI 5LBSL 1TIUA 1BQHA 1QBMH 3QDJA 2VAAB 4YXKL 3VD9A 3B43A 5I1DB 5H8DA 1V7MH 2BJMH 2YMXH 3ZE0F 1UB5B 1CLOL 3OQ3B 4S2SA 1MUJA 3MRKA 1AQDA 3BPCA 2X41A 4NZTH 4EN3C 5E8NA 5FB8B 3D39B 2APXA 4DEPB 5LQBL 3HUJA 4HUNB 5HPMA 4X7FC 4LFHD 3S5LB 3T1WA 1C5BL 4P2OD 1SMAA 3SDCB 4PGDA 5CIPB 4TOYH 3RTQD 2EDQA 2GSIA 4HAGA 2HTKC 3FQNA 4L9DA 2OTUA 3BHBB 1IAIL 3OMZA 4R2GB 4QF1A 3DVGB 1IE5A 3LKNA 1OAXL 3HZYA 4DK3A 3TJEL 3VCLA 2BCKB 4CVXB 3KYNB 1Y0LB 2HFFA 4FFWC 1DL7L 1ZMYA 4G43A 3MCKA 2BVQA 1FFPB 3W2DH 3GEWB 4U6VH 3SE4A 3WFEH 1NAKL 2YD2A 2RR3A 3EZ8A 4JM2A 1KJMA 1D7FA 4QRPB 4HC1A 1T0MA 1CDIA 4MA8H 5DRZB 3NIGE 2A73B 4DUWA 4K7PX 4MXQC 1HNGA 1ITCA 5DJYB 4P5MB 3BMWA 5HI5D 1QACA 2ZUUA 4C56A 1WZ1L 1EPFA 1KPVB 4KK8D 4MB4A 1LO2L 2PW2B 1J8HE 5JQ6H 1FZKA 5HHVH 2MOVA 3C2AL 4UILH 4XBGB 3KLHD 4XPGH 3EW3B 3OAUL 3MO1B 4LU5H 3GNMH 4WNQB 4PJCF 4XI5C 4LLUA 5TPWH 3X11A 1HHKA 4PJXE 1EGJA 1T7WA 1A6AA 4X9HA 4JM2D 4QHLA 4MD5A 1E4XH 2VAJA 2XTJB 1FHGA 3SQBA 4YHPA 1MQKL 4I0PC 2MCPH 3OAYH 5F7NC 3EOYG 1ONQB 3UJJL 4Z7UE 3QIBB 2ID5A 4C56D 2HWZL 2ESVE 3AREC 2VDLH 4DVRH 1EZVX 4ONOA 3L1OL 3EKCA 3VI3E 4F33B 3CX5K 1K8IA 2ZJSL 2R69L 4OLEA 4LSVL 1MRDH 2AJXL 5IV2A 1TVBA 1GGTA 1NLDL 2DIJA 4KK9C 4XH2B 4X5XA 2ERJC 3HUJF 3D2UB 1I1RA 1GL4B 1C5CH 3GSVA 3RWIB 3ULUE 4L4TE 3VFNA 3KWWA 4A6YH 4JFHE 3RJQB 1HXYA 3PIQA 5F7DB 1J1OL 4IJ3C 5GJSL 3BP7A 5IEHB 5E8PB 4CJ1A 3ULVL 4XMKH 2XQYK 1MI5B 1EEUA 3G6JE 5DHVB 1U8NA 4QRQA 4OUUB 5I9QB 3AM8C 2BP3A 5J8OA 2H2PD 4OZFG 4PY7B 4NQCE 4HIHB 2B8OT 1FNEA 2O93L 4LCIL 4KAQH 4JY5H 3DXAE 5FYLL 5EU3B 2DJ4A 1WLHA 2AJZB 5DYOB 4S1SH 2DF3A 1DBJH 4X6CA 5D70H 1D5MA 1JGDA 4JM2F 1QPPA 4KRLB 3QI9A 4GW1B 5C0CE 1OPGL 3UDWA 4KUCF 4LSSL 2F53D 1SBSL 5DJ2A 4J3WA 3B2UD 2JJTC 4ELKB 4PB0L 1UM5H 4PJDE 1A8JH 3PWNB 4OLWH 1U3HD 1CG9B 1Q0YH 4PGJA 1X3DA 2V9RA 3D0VA 3ARFA 4OQTH 4CMHC 1GIGL 1VGKA 4HUXB 1FO0A 3BXNA 2NY7L 2A6JB 3O45A 3DSNA 3V6BR 1S5HB 1T2JA 1WQVT 1H9VA 2QQLL 3SOBH 3MCLL 1T5XA 4X7EC 4YNYA 3M8OL 4Z95L 3SJVD 2NXZD 2F5AH 5L2JA 3DLQR 1IAOB 2A6KB 4I2XB 1MHCB 1SQ2N 5T5NG 4HWNA 1XGUB 4OLYH 2H2SC 2EDDA 2X4PA 3DSFL 3ZL4H 2X09A 5T33L 3TIEB 1VEMA 4K7PY 2GCYB 4DKDC 3WNPA 1CL7L 4XPTL 4P3DB 2JE8A 1AXTH 4OLXL 4PV8B 5DLML 2I60L 5C0AB 1ZA6A 5J3HD 4G7YL 3RWGB 3MV9A 3ARFD 1PVHA 2DI7A 2CJUL 4PRHD 4E5XB 4DQOH 4KQ3H 4V2CB 2UWEB 3T3PE 5KW9L 1J8HA 1HCVA 1QBML 2BOBB 5A43C 1Q9LA 3U36B 5A16A 3EO1A 1XF4B 1V7ML 2BJML 2YMXL 2XWJB 3K74B 5TDPB 2WP3O 5JIHA 3TN0D 4JQVA 4ZFGH 2BY3A 3JV6A 3DROA 3VXOA 4PJXA 3SKMA 2MQ0A 2OJZH 3O4LA 1NGZA 4NZTL 3QUYA 4QRRB 3ZE1F 2CXGA 1KIQA 5GRJH 1JK8B 3FTGA 3MV9D 1EZVY 5CD3B 1W72A 2XG5A 4Z7UA 3Q6GL 3GSUA 1OWRM 1BJ8A 1NEZB 2ESVA 2OQJB 3FMGH 4XB8A 1E4WL 4TOYL 3E1F1 2C7UA 5I8OH 4YAQB 3HB3D 3MLTB 5E00B 1XF2A 1UQSA 4ZUTA 2WUBH 5TDOB 4KROD 5A2KH 3K81A 4XNMB 1MHEB 3NA9L 3QEUB 5FKPB 4APQA 5GPRA 4L5FL 5DD6A 1W0WA 1RZIA 1AH1A 1YEHH 4JFDB 1UC6A 3D3VE 2PTUA 4J6RH 3TBYA 5A2IH 3T2NH 5DD0H 2WWKO 1MH5A 3O4LD 4L4TA 2A6DA 1A0QH 3V52H 1MFAL 5J7CC 1OB1B 5FUCC 4N5UA 4UV7H 1WFNA 3BP6B 3RKPA 5D4QA 1RUPH 4QHMA 3W2DL 5JPMA 5C2BL 4U6VL 1PKQB 5J4MA 4XVTL 4M61A 5TH2A 3G6JA 4HDIB 2GTWA 3DHJA 2DYPB 2ZUSA 4MA8L 3U9UA 4KGLA 2SEBB 5J9PA 3U2SB 3FAWA 4RBPH 3WJJC 5IW6B 1IAMA 5FOJA 4CN1A 3LAFA 4NQCA 3S37H 2IH3B 4JY4B 1P7HL 3CH8A 4JZNB 5KN5B 4YDKH 1DBBH 1HHGA 3GMQA 3DXAA 5JQ6L 1QFUH 5JORA 1CD0A 4JFPB 2VDRH 2E7HA 1ERNA 1KIPB 2P45B 3P9LB 4UILL 3ULUD 1NBZB 4XPGL 3OKKA 2R29H 4LU5L 5GGQH 3QCUH 3JVGA 2BRQA 3GNML 5C0CA 2YK1H 3H9HB 5TPWL 3FQUA 1VCAA 3NIGF 3GB7A 3MJ9A 3UTSA 2Z4QB 1WCBB 1MCHA 2AGJH 4Q6IC 3I75B 4PJDA 4YFEA 4ZO7A 3E3QE 5LJYH 4MQTB 3V7AE 4H88H 4JHWH 2C4XA 1TZHB 3WHXA 3ULVD 2MCPL 4WFHD 5D7IB 2VNCA 1N59A 2Z93B 1XH3B 4KK5C 3K80A 2VDLL 4BFIA 1JNNH 4DVRL 3DXAD 5E5MB 3ZKND 5CZXD 2EIBA 3TJHC 3DVNA 2FBJH 4BUGA 4PJXF 4PJ5A 5FYLD 2ICWA 1MRDL 2A1WH 2QKIA 2QHRH 3O3AA 5C0CD 2JJWA 1F8TH 1DANT 5CUSH 3UTSD 3O4OB 3RX8A 3ESUF 5HHQA 5KS9B 5IFJB 4ORZC 4Z7UF 1E28B 3MJ7A 4J3OC 4A6YL 4DW2H 3BI9X 1X5IA 3GSWB 1VGEL 3UTTA 4D3CH 2N7AA 3PV7A 3IDGA 3TNMB 4ZFOL 1QKZH 1WFUA 1QP1A 3VI3F 4GRMB 1QEWA 3QJHA 4EI5A 3QDME 4LRIC 1FL6A 4XMKL 1HSBA 4NM8L 4G3YL 3D87B 5IB1B 3R1GH 4O2CB 3PHOA 4LAQL 2DIAA 1QRNB 4PJ5D 5IUSA 5CHNA 1I9JL 2WMPA 3MLUL 3ULUF 4YR6B 4KAQL 4JR9H 3VGEA 1H5BA 4PRPA 5D1ZB 3VXTA 1INEH 3MZGB 5EU4B 4D0DB 5D70L 5EU6E 3UTTD 1QFWI 2RGSA 3G6JF 3TPKA 2ICEA 4LDEB 5I6XC 2F8VA 4NCDA 4LLQB 1AGFA 5IEKA 3B9EA 1UM5L 4OLWL 4UDUB 2P43B 3ZTJG 1KCKA 4WU7A 4BH7B 5GZND 4F7TA 5E03A 4HLJA 1ZHNA 1J87A 1Q0YL 4X6FA 1ZT4B 4QCIB 2Y9RT 3VXMD 3JWNC 5T3ZH 4WO4B 4Y4HA 4IRSC 4P9HH 5EO9A 4L8BB 4PRPD 3N85H 2UZIL 3SOBL 3D3VA 2ZUQB 4UAOC 1I85A 2YD4A 4P9HC 1T5WB 1XCTB 2F5AL 4X0KB 1IGYA 3U9PH 4NUJA 3CAFA 4PJDF 3VXSB 4NO0D 3DBXA 5IROC 4F15C 3GSNB 4G9FB 4EN3D 3S5LG 3DUSB 3VGBA 3SGKA 4OLYL 1N4XL 4C4KT 3MUGA 5DD3H 2EZ0C 1AKJA 1EV2E 4LEXL 2UUDK 1JFQH 3S4SB 5HGBB 1ETZB 1FZJA 1AXTL 1DQMH 4CRPA 2Q76B 1L6XA 4ZQKA 4GW5B 4UQ2B 2HTKD 1ES0B 2IG2L 4QTHB 4DGVH 2FH8A 4K3HA 3SDAC 4DQOL 4IDJH 3ES6B 4KQ3L 4ZFFB 4CGTA 1HI6B 2OJEA 3MUY1 4N8CL 5E0QA 2JJSA 3UPRA 4WDIA 3KXFB 2WBWB 3QQ4B 3JTTA 3BX7C 4NKOB 2IWGA 5ICZA 1QSFD 5FV1L 1HSAA 4ZFGL 2N7BA 5JLZB 5GS1A 1NFDE 1OOAA 3LS4L 2GJJA 4KK6C 1AKJD 2OJZL 4RMVA 4EI6B 3T4YB 1J8KA 2MCG1 5JW4Q 5TJWK 3T3PF 5GRJL 4JRXE 1OWWA 3QUMH 3OKEA 4ZNCD 5HHOE 1DZBA 4MXQD 3FO0H 1U95A 1S7QB 3GSXA 3FMGL 5D93C 5F7KC 4JVWA 3QNYA 5HHNB 5I8OL 4HK3J 4TVPE 4UIMB 1RUAL 2E6JA 5DTFB 2WUBL 1S9YA 3ROLB 2Y06L 2I9TA 5KVMC 3RWCB 4LCCC 4ZFZB 4Y2DB 1TVDA 4GAFB 2ZUTA 4FTVA 1UM6H 1XR8A 1YEHL 5HHMD 5C0IA 3BPOC 4XI5D 4J6RL 5BJTB 2ITCB 4KJYA 3T2NL 43CAB 3V52L 1A0QL 4JB9H 1LEKA 1F3DJ 4WFFE 4H26B 4Y8AA 1CGUA 1RUPL 1CS6A 3ZO0A 3QDMA 4XNZC 3IKKA 5D7JC 3L3IA 1CDGA 5M7QA 5J6HB 1KJ2A 3RTQB 3QZWA 2VXUL 3L3DB 4YUEH 4Z8FL 3VW3H 1DQQA 3SO3C 1P4BL 2NW3A 1P84K 2J6EH 1SYSA 4HUWA 3S37L 4NKDA 4YDKL 1DBBL 4FTVD 2XPGA 2D3VA 1MUJB 1QFUL 4M8QB 3TZVA 2VDRL 5D72H 2V5SA 5FOBA 3O2WH 5LCVH 3VU2A 5IK3A 5MEOA 4MSWB 3V5KB 4LPWA 5EU6A 4LVOC 3QCUL 4NP4H 2P5WD 2H1PH 1NANI 3KJ4C 1SJXA 2YK1L 2R1WA 3RVTC 4H0IA 2AGJL 5ID0A 3PJSA 3VFUB 4JHZA 1NL0H 4ZTOH 5MERA 3SGEI 4H88L 1GGBL 3ELAT 3RNKB 1YEGH 1R5IB 4HWZA 3IFLH 3I9GL 1HXMA 1JNNL 2KKQA 1MVUB 2EE9A 3TZVD 2E8YA 4OQTA 4UBDC 2ZNWA 5HGAA 2ZP0T 5EU5A 2FBJL 3P9WB 4HK0A 4KVCH 4BYHA 2V9TA 2QHRL 2P24B 3IS0X 4ODWA 4RFNC 3KYAA 3I2CH 2B2XH 1TZIA 1F8TL 2D7TH 5F7EH 4BA8A 1BZ9A 4XPFH 1JPGA 3AC0A 3UZQA 1SVZA 4DW2L 3QO1B 3STLA 1BVKB 1FG9C 1ZANH 2JB6B 3ECBA 2Y5TA 1QKZL 1NMAH 2VABA 5IHZA 3DRQA 4K2UH 5F88B 2ZZUT 4QHKJ 1AO7D 3DUUA 5MEQB 3MC0A 1MCSA 1A7RH 3I3BA 5HI4C 3KYOB 3R1GL 5D7LE 2D03H 3DUHA 2WAHA 4WI8A 2GEEA 5IB4A 1T4KA 5FYJH 2OYPA 3VFPB 4GAGL 4JR9L 4KZEH 1CR9H 2NZ9C 1TVHA 4OV6F 3L3GB 3T04D 3GDBA 5A2FA 1G6RH 1INEL 4YXLH 4PLJC 5DDHA 2OZ4A 2V5TA 1GGYA 2LV4A 3CD4A 4PY8I 3QIWA 1X5LA 3ILPB 3CVHA 4TUJA 5DRWA 1K3IA 4TPRL 4MCYB 1TFHA 2HG5B 4JRXA 4LLVB 4U7MA 4UT7L 5HHOA 1X5KA 2QHLA 3LCYA 3K3QA 3ZKXC 5MI0C 4NC0B 1K5NB 3OKOA 4L1HA 3PWPE 1O7SA 3I6LD 4WHCA 3QB7C 5BW7C 1KCVH 3TNNA 1FVCB 2GFBA 2GUOB 1EVTC 5TE7H 1AJ7L 2UV3A 4YK4C 5EC1A 1X6LA 5T3ZL 5C6TH 1K6QH 1ZSDA 4GO6B 5MENE 3VFOB 4P9HL 3EOBA 4UINH 3UBXB 3N85L 3RDTA 3ORJA 3X3FH 3ARBA 2UVFA 5I71C 3U9PL 4HKZA 2XT1B 2E5EA 1NC4B 3HAEA 2HLFC 3E8UH 1IGJB 2F53B 3OAYK 1NEZG 1NFIA 3FQTA 1U2CA 4I18C 5HHOD 2DI9A 3QHTC 5DD3L 3ZDYE 1JFQL 2CO6B 3V0WH 1LD9B 1U3HB 3IFPA 5BQ7B 4HFWA 4Z77B 1DQML 4LSPH 3ZDZE 2EDOA 3WJJA 1U93B 4F9LA 4DGVL 1ZA3A 3C5JA 3ZLQC 3RWEB 2XFXA 4IDJL 4CJ0A 3T4AB 3RWHB 2X10A 3HNVH 3QDHA 1KCRH 4FQ1L 3SJVB 1YZZA 2A77H 2YR3A 3K7UA 4TN9A 3D25B 4RMTA 1OTSC 4WFFD 5JNYB 2EDEA 5H2BA 1NGXA 5DUMH 2Z91A 3VE0A 3PWUA 3KLDA 1JZ7A 2B1AL 2P8PA 3DX7B 1UM4H 4Q9RH 4P2CG 5GRVL 1FZMB 4X7CC 2J4WH 5GGSB 2H9GA 4JAMA 4Q6IA 4KY1L 1IM3B 3I6KB 4H0GA 1BD2A 2X9XA 3QUML 4R4BB 2MQ3A 3DTXA 4URTB 4PRHB 32C2A 3QWOB 1N8ZB 3HPJA 4UNVA 4OGZA 4NBXB 3MRIB 1MY5A 1IEBA 4WWKC 5KSUA 1GGIH 1XCQB 1PGRB 2CLRA 1IBGH 1NFDF 2BSTB 2ZCLH 3QUZC 3GMOB 4MJ4A 1J1PH 2KBGA 3TN0B 5DJDA 3RWJA 1UM6L 1RY7B 5GGRB 3HN3A 3O6FB 5ERWB 5ADPL 4V1DB 1HHIB 2FCBA 3LQMA 1NMBH 3RBSA 4JB9L 5HYSA 5FAAA 3STZA 4OFKA 1BD2D 2YUZA 1SEQH 3ZKSD 4XC1H 4Y5XA 1ZGLA 4BELD 4U6HA 3D9AH 5EWIL 5J13B 1RHHA 4AM0B 3MZTA 4LRIA 2PF6A 4KK5D 1AFVL 1QQDA 4YUEL 3TBVA 3VW3L 2C5DC 5D7LA 5T3XE 1RZKH 1FH5L 2J6EL 4KROB 3GJFH 3QDGA 4ZAKA 2F8XC 3TJHD 4LSDA 1RZKC 1CBVH 4MQSB 2EC8A 2O26U 3FT2A 3C9NB 3C08H 4NHCH 2VISA 3S3PA 3T0VA 3KNBB 3O2WL 3O4LB 4K94H 2NXYC 5LCVL 4QOKE 3VRIA 4M7ZC 3PGCB 4NP4L 5I16B 5FHAH 3HI1A 3WUWB 4MAUH 2X4RB 4JZOB 3QNZA 1OAUH 4NQDE 2BMKA 1CFNA 2W9EL 3FT3A 5IFAL 1NL0L 4DTGH 4ZTOL 3PWPA 4B50A 1PSKL 1YPZE 1YEGL 4U1SA 1KULA 3QDGD 3IFLL 3LEVH 3TT1L 3VXRE 4TSCH 4JZJC 3BZEB 5FUZH 2ZSWA 4GAJL 5GJTH 1W0WB 1Z0MA 2QQKH 5J6GA 5MENA 1AXIB 4YIQA 3FN3A 7FABL 5F1NA 1FNAA 2A2QT 4U1IB 1IEAB 2VDML 3BQUA 3MRQA 5H37H 3CDGB 4HW6A 3N9GH 4CN4A 1K8DB 1MCOH 3O8XC 3THMH 1T0NB 1AIFA 2R1XB 3I2CL 3NZHH 5IVXB 3R8QA 3MRBB 1MELA 2P7TB 4ORGA 3HTLX 1JMXA 1SY6A 4XPFL 1XZ0A 3GIZH 1FRGH 4EZMA 3S8WA 4JDZB 4RNRB 3NN8A 5DK2B 1ZANL 5C0BE 4Z5RA 1VACB 2PW1B 1L6ZA 5CCKH 4Y5YB 2N1KA 1HH6B 5DMIH 4IHOA 5BOZG 3L7FB 1QSEE 4K2UL 1NCBL 2B5IC 4X4XA 3V0VA 5I75C 4KC3B 5JOFB 4HIXL 4CAGA 5MEND 1RZFH 3VG9C 1RU9H 5BOPA 5ICXB 1A7RL 3NCJL 2R2BB 1K4CB 4IRSD 3MOAL 2D03L 3BQUD 4PJ7B 5T3ZD 2IMNA 3QPQC 5FYJL 4OM0L 3IF1B 2ZUWA 5CGYC 1K9TA 3BKCH 4KZEL 4G6FD 1CR9L 2VDOH 4XVSL 3UZEA 1CE1H 4YXLL 2V9QA 3S4SG 4L4VA 4KMTH 1K4DA 4HH8A 5I74B 1CXKA 2RHEA 5CAYB 2EZ0D 4OZHB 4JFZL 1ZT1A 4U33A 4IS6B 4UOW0 5IBUB 4H20L 3DV6A 1RSFA 5I1HH 2CH8A 1B88A 4LMQI 2ZOKB 4PRNB 3FONB 3SDAD 3S98A 4HKXA 1KCVL 2DLFH 4OKVA 5TE7L 4HKJB 4YGVA 4JFFD 1K6QL 5C6TL 3HC4H 3QSKB 3VD4A 2ZSVA 4M1DH 1F2XK 4CW1A 2HA1A 4LQ1A 3LDBB 3NZ8B 4AQOA 3X3FL 4HUKB 4L4VD 3UEZA 4LARH 3OB8A 4KK6D 4JANB 3C5ZB 2WQ8A 2D7QA 2E27L 3L3OB 5GRWA 3RGVA 3AY4C 3E8UL 3V4UH 4AMKH 3NBNA 4HS6B 3RY5A 4QGYA 2CIKB 4U1LA 1RJCA 4EDWL 1M71A 1QA9B 4ODTH 4NHUA 2BC4B 4HGMA 3U7WH 5E9DE 5JPNA 2IJ0C 5D7JA 1EIBA 2XIDA 4YPJA 1EJOH 3PHOB 5DGRA 2OI9B 4KMLB 3AU1A 5EOTB 2PTVA 3D18B 5E7BA 3TH3T 4R0LC 1YMHB 1I1YA 3VXMB 1NDMA 3T0EC 2R0ZL 3MBEC 1PYWA 4MDJA 4JRYB 4OGAC 4KJQC 3HNVL 2D7NA 1KCRL 2A77L 2DLTA 4WJ5A 4L8CA 5JW5B 3LKOB 4NO0B 4QOKA 1MCIA 3O3BA 3Q0HA 4LEOA 5DUML 3ZDYF 4EN3B 3EGSB 3EFFB 4MNHB 3G5VB 4HWBL 3VXPA 5I1EH 3ZDZF 3ARVA 1UM4L 4Q9RL 1VFBA 1W0YT 1WUNT 4WW2B 4XP1L 3V6FB 1MLCA 5I17A 4NQDA 2J4WL 3V5HA 2VDQH 3ULSA 1BQHG 5D7JD 3C6LA 4RGMC 2BNUB 3BEWA 2VIRA 4N9GA 1YPZA 4HS8L 1I1FA 3VXRA 3TBWB 2X4SB 3S3SA 3IDNB 3CC5A 3QPXL 3L95A 5ITFB 3C8KB 4GKNB 5FA4B 4YDLB 2HT4C 2ADGA 4N0YH 1GGIL 2IPKA 1CFTA 4UIKH 1IBGL 4DWHA 5I1IL 3UAJC 2ZCLL 1WWWX 4P0DA 1QSFB 1Z5LA 2VB5A 4KU1A 3BDBA 1IZJA 2ITDA 3C09C 2JB5H 2FRGP 1P4LB 4WI9A 3EHBC 3IDIB 4NQDD 1NMBL 2ARJA 1FN4A 3RVTD 1U8LA 2OSLA 3BD5A 1DDHB 5C0BA 1SEQL 3T09A 2R2EA 3D9AL 2C3VA 5DFVC 3MLZH 1QSEA 5D2NC 3P4MA 4XP9L 4BZ2H 1S3KL 1EUTA 4H1LA 1EXUA 2HJFB 5BVJB 3BISA 4YC2C 3N0PB 3OL2A 4BK5A 2EYTA 4D0CA 4UBDD 3H2WA 1ZGLM 5ELIA 5CKAA 1CBVL 2GITB 3WD5H 1S9VB 5HHMB 1HWGB 4NHCL 3C08L 4RRPA 2NY3D 5KSVA 4BSJA 4BUHA 2G5RA 5DVOA 3RY6C 5FA3A 1ROWA 5EZLB 2VLRE 1OP5K 1T03H 4YX2H 3K0WA 3MREB 1G6RA 1BOGA 5FHAL 4RX4A 1PG7H 4I0PB 4MAUL 1DQTA 1QSED 1IGTB 2DM7A 3SY0B 2EC9T 1OAUL 1BFOA 3AREB 3W9EB 3W9DA 4DTGL 1JIBA 3EDKA 5TGBA 1CF8H 1KTDB 4DKEH 2CGRH 1Z3GL 4MAYC 3SO5A 1I7TA 1YECH 1DUZA 2AEIT 4NO2B 5FUZL 3RAJH 2CLVA 5GJTL 3U4EA 3TO4A 2QQKL 4FTVB 3FN9A 2WNGA 4D9RD 2ERJB 2NZ9D 2ARWA 2ATKA 5FYJD 4UT9H 1IQWH 2PXYA 4OZIB 3N9GL 4WV1A 1R5VA 2P5WB 3GRWA 2EDLA 3NZHL 4IDLA 4QHNB 3HNTH 1SJEB 1Q94B 4FXLA 4A6YB 3VFRB 2NYYD 1YPZF 4IJ3B 4M6AA 5F9DC 1DJSA 2J8UE 3MRHB 4ZFOB 3GIZL 1FRGL 5IJKC 1XGRA 1TQBC 4ENEC 2ZUVA 5CCKL 1F6AB 4LLWA 4M03A 5DMIL 2E7LC 5IT2H 2ZCKL 2CMRH 1I9EA 4HHAB 3Q6FB 1ZLSH 1P5UA 5J06A 1LP9B 1MCFA 3G5YA 5A2JH 1F4XH 2HVKA 1OSZA 2W1NA 4LSRL 3SDXB 2XZZA 1U58A 1RU9L 2HAZA 5KVGH 5KSAA 2YBRB 1JRHH 3VXNB 2BNQE 3VWKB 5GGSY 4QY8B 1HQ4B 4DN3H 2X4OA 3UBXI 1QR1B 2X40A 5LKNA 3QJFB 4JFYB 5EDXA 2VDOL 3U7YH 3P4LA 1CE1L 2HLFD 3QH3B 1D5ZA 1S7RA 4KI5C 1YUHB 1C5DB 2XKNB 3ILQD 5DJXB 5HHPA 4Y19E 3CXHJ 3OXRB 3M1BA 1CFVH 5F7WC 2OTPA 2RIKA 2DJUA 1XF3B 1NCAL 1YDPB 5DJ0B 3WO3B 3O9WB 4CMHB 1RI8A 1AO7B 5GGRY 2DD8L 1JNJA 1T3FB 3TBTA 3QQ3A 5I0DA 3VWJC 2DLFL 5TE4H 4A2LA 5T1KD 2YEZB 2H6PB 1XEDA 3QUZA 1I9RH 1OTSD 3WSQH 1UXWA 5DJCA 1HH9B 1RQ5A 4GLRH 2W9LA 4LARL 3STLB 4H8WL 3UP1A 5CP3H 3T77A 2PUQT 2ZUXA 2YKLH 5IHZB 5HDQH 4AMKL 5FO8B 5FEBA 4NKMB 4NQTA 4ODTL 4POUB 1MHHB 4R7NB 3SGJC 3BESR 3U7WL 3BD4A 5INDB 1LVEA 1DQLH 3VDBA 3VA6A 3B3IB 4LBEA 5INCB 1Q1JH 2IGFH 2PR4H 4BH8A 4F7MA 3SKNA 1IAII 4OJFH 3DPBA 4YHNB 4PJFE 4CU6A 3QUZD 4LKCB 4UTAH 3TA3C 3X17A 2C1OA 1LNUA 1UZ6E 3REWB 2E6QA 4OZGE 1OQOA 2ZKHH 4OFIA 3CMOH 1AR2A 2JIXD 2VLRA 4DCQA 2A6IB 5FUOH 4HSQA 5I1EL 1KXVC 3T8XB 3LV3A 2VDQL 4ZXBA 5D71H 1SJHB 5BMFH 4J8RA 3JSSA 2EH7H 3HCVA 1AY1H 4FQCH 3U0WL 1A6TB 3T3ME 2D0FA 3BT2H 5BS0E 3NPZB 5IQ9A 5D7SH 3FQWB 4J3TA 4N0YL 5F72S 3DURA 5FO7B 4M9OA 4UIKL 2MMXA 4PRBA 2NXYD 4R96B 3FO2A 1B0WA 2W59A 1YYMH 4NQED 4HXAH 1Z9LA 1RK0A 2HT2D 3AAZA 2X4TB 3VRJA 1OAQH 1EBAA 1AP2B 2J8UA 3JXAA 4W4OA 1UEYA 1L7IL 5EU7C 5AD0A 3TLRA 1M7IA 1WJ3A 1FNSH 3GO1H 1BJMA 2HVJB 3W39A 3O2DA 3MLZL 2ORBH 5EZJA 1CGVA 1F02I 1MCWW 1N64H 4PJGB 4BZ2L 5CJXC 4HWEL 4YBLB 4XZUB 1E4KC 3QEHB 5F89B 4LPCA 2FATH 2BNQA 5DJ8A 4I4WA 2VUOA 4PJHA 5C0JA 3O8XD 1QRKA 2FSEB 1JPFB 3TYFA 2P8PB 4GW4B 3OG4B 3FB6A 3IXAB 3TT3H 4Y19A 1BD2B 1RZ7L 3LVEA 1T03L 3O0RH 4YX2L 3HZMB 5FK9A 1A2YA 5C0RH 1PG7L 3KS0J 1AD0B 5LXGH 3CX5J 1HZHH 2CDEA 5F9OH 2O5XH 1NMCC 4KFZC 4P9MH 3EYVA 3DV4B 1A6VH 4HUMB 1CF8L 4PJIA 3KPQA 4DKEL 1CE6A 4CMMA 2WV3A 3OKLA 1YECL 2A9MH 3PV6A 3L6FB 3QA3B 3NPSC 4IMLB 1UWXH 1H3UA 3RAJL 1HQRB 3QPQD 1IGIH 1AGCB 5ESAB 5T5FH 2Q6WA 4YH6A 3VXQB 1MCNA 4G8IA 1IQWL 3MLSH 1JP5A 5HYSB 2FHCA 4Y19D 3G04B 3LN5A 3R06A 1KIUA 2KDGA 4I48B 3HNTL 4PV9B 5IBUG 2ZPKL 4LQFH 4J3XA 3HS0B 5B38A 1I8KB 5IG7A 1QG3A 4FQJH 2F15A 1QQDB 4GSDH 4DFHA 5F3BB 1YQ2A 4YJZL 1CCZA 1NQBA 4HIJA 4N90D 3GHEH 5IT2L 3QDGB 2QADC 3RZCB 1U8MA 1YY8A 1ZLSL 5EORH 1F4XL 1IM9D 4PJFA 3DMMC 4M6MH 4MQ7B 1JRHL 4JO1H 4HIIA 3LKSA 4OZGA 2AJ3B 4DN3L 3DGCR 2J8UF 3MRDB 3GSQA 4G80A 5I6XB 3U7YL 5D6DC 4TULH 4O2FB 4NDMA 4NCC1 1YN7A 2FECL 5E70A 1CDCA 2EKJA 4FOMA 4EVNA 2H32H 1B90A 1JHLH 3TO2A 4ZS6C 1BVLA 1CL7I 1CFVL 4GRLC 3IS1X 4ONHB 3OR7A 1MFDH 1KC5L 5C07A 3T0ED 2CIIB 1H0DA 3MBED 5BS0A 1DVFC 4IRSB 3WEXB 4OGAD 2V2XB 4KJQD 2FLRT 5TE4L 4UAOB 1DN0A 4UU9B 4AL8L 1VEPA 3SE3C 3FB8B 3SKOA 3TFKC 3WSQL 4G6FB 4F15B 1NBYA 3GMNB 2Q7YB 4S0TD 3INUH 1HOCA 5DSCA 3RL2B 2YD9A 1H8OA 1T22B 1JWSB 3CLFH 2YKLL 5C0DA 3VFWB 5HDQL 3V6ZB 2DQEH 3AXLA 1F45A 4GAYB 1Z6JT 4XPHL 5IKCA 2EYSA 5C07D 3OKMA 4MWFA 2W0PA 2NTFA 1KPRB 1ZV5A 5BS0D 3IFOA 3SDAB 1TPXC 4L8DB 3JV4A 2HT4D 1Q1JL 2PR4L 5I8KH 4F8QA 5EPMA 4J1UA 4JFFB 3UAJD 1JNHA 3CSYB 1TXKA 1ZXQA 2ENSA 2V2WA 1VPOH 4LCWE 4JY6A 3BUYB 3LOWA 4KKCC 2ZKHL 2DWDA 5T1LD 3CMOL 3EHBD 2OM5A 2DQGL 5F70A 3RY6A 3VFMB 3MNVA 2VLJA 1A1NA 5EUOB 1NFKA 3MNZB 3DV6B 4UNTA 5DFVD 4PGCB 5H94B 5D71L 3QUMB 4Y5VC 4PJFF 1TCRA 3IGAA 2L4OA 4NRYB 3RPIB 4E9LA 2EH7L 1RJLB 1AY1L 4FQCL 3SCMA 1UZ6F 5TDNB 4YGVB 4Z7WE 5F1KC 1G0YR 4OZGF 4XB7A 2J5LC 4LCCB 3L5IA 5IM7A 2G5BB 4X99A 5D7SL 2FJGA 1T7YA 3BPOB 2W07A 1P6AB 4OBSA 3PF2A 2RB8A 4P57B 1JE6A 4Z7QE 4U1JB 1YYML 2X70B 2VLJD 3H7BA 3MMEA 4HXAL 4NNXA 4GH7B 4LGRB 4MD4A 4MXVE 4RIRA 2H26A 4LLYB 1OAQL 2NX5B 1JWUB 2GJZB 4XNZB 4LSQH 3NMEA 3T3MF 1RUMH 4Z18A 1FNSL 3G6AB 5DHYB 4M93B 5LGHH 4LCYB 1U8KA 3KPOB 4P2QA 3S37X 4XT1C 2E7LA 2XN9E 1N64L 3HLAB 3IT8D 2VOTA 3QXWA 3PWLA 3HPLA 2FATL 1FSKC 2BOCA 4G8EA 1NCDH 3GK8H 3L5WB 4HQQH 1WIOA 4P4RB 4JVPA 4IBLT 3KJ4B 4EJ1C 2FX8L 2P48B 1RVFH 2OL3A 3WHE1 3BVNB 4MVBC 3TT3L 3MTRA 1UH3A 2VSCA 3O0RL 1EEZA 5C0RL 1UYWH 4ENED 4PTUB 4P2QD 1HZHL 5F9OL 1QYGH 3S7GA 1V7NH 1PX3A 2O5XL 3HNSH 4OFYA 4OAWA 1T1ZA 4P9ML 5I0ZA 3QO0B 3MFFB 1J05A 1A6VL 3RVXC 2HMIC 4PIRF 3MGTA 2GAZA 4LVHC 3PWVB 5KBNC 3DRTA 3GBNH 5SWSA 1KCSH 1JZ3A 1YC7A 2GKIA 1IGIL 2JELH 3BIKA 5FIEA 4RFNB 5T5FL 1HHHA 2APVA 4HFUH 3MLSL 5JXAH 3HZKB 5F3HA 4P5TC 3FQRA 4KI5D 5K9OB 3IDJB 5DMKB 2V2TB 1FGNH 3HR5A 2BVTA 2W65A 4WY7L 4NCC2 5C9JA 5DFWH 4JQXC 5DVLA 5FGCE 4PUBH 4OFYD 2D31A 3I02A 3WLBB 1MFCH 4FQJL 1R24B 5TQ2H 4FQXA 3AVEA 4PGEA 4XGZA 5DEFB 2EYTB 3GHEL 1I8MA 3TYGH