5FDYA

Crystal structure of the voltage-gated sodium channel beta 2 subunit extracellular domain, c72a/c75a mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
SNAMEVTVPATLNVLNGSDARLPCTFNSAYTVNHKQFSLNWTYQEANNASEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Sodium channel subunit beta-2
publication title Binary architecture of the Nav1.2-beta 2 signaling complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fdyA00
1UB5B 5E2WL 4YX2H 1CGSH 4WNQB 4AM0A 1AGDB 3QIUA 3N50A 2HVJB 4U6XA 3OKKA 4RMTA 1IZKA 2ATKB 4L4TB 1DQQA 2VYRE 4AEHH 1C8PA 4Z7UE 1FE8H 1OF2B 3ZHLA 4ELKB 3ZE1F 3F58L 1TJGH 1U6AL 4Z7VF 5ERWA 1D9KA 3FQNB 4JRYA 3L3JA 3V6OC 4Z0XA 5I19L 3QQNA 5F3BA 4BSVA 3ZT6A 5D96C 2FWOB 3BJ91 4YHNB 1T4KA 2HFEA 2V2WB 1A4KB 4Y4HB 5JQ6H 3DUSA 2A83B 5I73B 3EDDA 2DQGL 5E8OB 1BQHB 3L3HA 2AXJA 5MI0B 4HS3B 2XQYK 1K4DB 1IGJA 2YD7A 5F9WC 3T0ED 7FABL 1WBXB 3DYPA 3B6SA 4KRPD 5F3HA 1UACH 1FO0H 5D71H 1G9NH 4X6CB 3RJDA 3H9SA 1QP1A 2VAJA 2X7LB 3MJ8A 2XICA 3EO9H 2WSKA 1R5WA 5FB8A 4BKLA 1M7IB 2YA2A 3DHJA 1JTPA 3KPNA 3UTTB 1BD2D 4AG4L 2ADIA 3EOTH 3E6HB 1HHKB 5DJ6B 4JM4H 4R90H 4NWTH 3VH8A 1UT9A 4PD4K 4G6AC 4L8SC 5JLZB 2EEDA 4NWUH 4LRIA 1JPGA 3HUJB 3CFIC 1PGRB 1VEOA 2EC9U 3BZFA 1JN6B 1IT9L 4OQTH 4LVEA 4TVPE 1UJTA 3LSOA 4P5KA 3UPRB 4NHUA 3C8KB 5TFSH 2N4IA 5EU4A 4PGBA 1INDL 3RHWF 3ZZ1A 3SKJH 4H8WL 1T7WA 3PHSA 1NCDH 3O3BB 2HP4A 1P7KA 3O11A 4J8RB 3UJIH 1CIDA 4M3JA 4TN9A 4JO1L 1PZUB 5EN2B 2B4CC 3T1FA 1NC2A 1DVFC 3QCVH 5FYKL 2YD3A 4JPKH 5F7MC 4Q9RL 4E5XB 2NY5H 1S7SB 4PJEE 1GGIL 5H37G 3G08A 1N5YL 3MRRA 1AKJD 1A1MA 3BEVA 1CZ8L 1W8NA 1EHAA 4QYOA 1JWUB 1QLFB 3NCYS 1T83A 1GOGA 1I3RA 1OM3L 1S7UA 3RWDB 1YY9C 3RWEB 3VI4E 3V7AG 3OR6A 4JN2A 5B8CB 1YMMA 1MHCA 4TVPL 1M6OB 4GW5B 1Z0MA 4HULB 2IADB 3PGCB 4NHCL 4PV9B 5D1XB 4PJ5D 4FQJH 5IIEB 1I75A 4G6AD 3DHMA 4PB9L 2B1AH 3CVIL 1PYWB 3GHBH 4PUBL 1FORL 1KOAA 3H42L 1CYGA 5JW4M 1F00I 4RZCA 1YN6A 1U8NB 1C16A 2J1KA 5HHOD 3QDMD 3ULUC 1H3PL 1PLGL 1TCRA 5FFLA 2QQNH 3LEVH 1TQCC 4OKDA 5I1LB 5SWQB 3MV8E 5F8RC 2VLRD 5FUOL 4F58H 5IHZB 1KGCD 2AXGA 1UG9A 3S35X 4AEIH 4R3SA 3STLA 1CDGA 4GRWH 4XNZC 4F3FA 3G5XA 3HPLA 2EH8H 5D6CA 2GYSA 4HX1B 2Z31A 4MJ6B 4GRMA 5TQ2L 3EO1A 2R1YA 3D0LB 4GMTH 3T4YA 2J8UB 3GIZL 1EX0A 3OG6B 4P4KD 3RWGA 3GNML 4WFED 2D0GA 4OAWB 3M45A 1BJ1H 4MQ7A 2L4OA 4UTBH 4XI5C 5TQ0L 4PJHE 4DJMA 1DQJA 1YY9D 1EGJA 4U6VL 5INCB 2XQBH 3PXHA 1HHHA 3KPRE 1SMOA 2G5BB 4D8PA 2YPKB 5AAMA 3LN4B 4Z0BH 5C07B 3ZT5A 3KPQA 4JKPH 2EDJA 3FFCA 4FP8H 2WBJB 3LKSB 1W72L 5CEYB 3C5ZC 3ULUD 4IHOA 4PFEA 2F8OA 5TPWH 2G75B 4JB9L 1BZ7B 2FX7H 1G7JA 3O2WL 2O5YL 2ZUYA 1YNKH 1EHNA 3WD5L 3PL6A 4MD4B 2IWGA 5LWYH 1TNNA 2Z4QB 2VABB 4MNGB 5BO1L 2EYSA 4TNVF 3O3DA 2NY3B 4YXLH 4Y5YA 3QEQD 3HC4L 4LCUB 4XT1C 2DQDH 1CK0L 3S37X 1UB6B 1P5UA 2ITDA 1MHEB 2VDQL 4EXPX 5JR1H 1M7DA 5GS3A 1CFSB 4R26H 4GAYB 2PYEA 3D87B 5F1IB 3HAEH 3NGBC 4JHAL 5M95B 2YMXL 4N9OB 3ELAT 4U6HA 3SGKA 4TPRL 5J8OA 2WP3T 5IGXL 4LSPL 1RV6X 3GSUB 4J3VA 4XI5D 1KTLB 3TPKA 2EDQA 1EHLL 5D9SB 1KG0A 1QHPA 4QOKD 3VGAC 1N4XL 4ZO6A 5DC9B 5FDYA 3IGAA 3GB7A 1M1SA 1YYML 5I30L 4OCLC 4PRIA 1JNLL 4HZLB 2GIYA 32C2B 5BVJB 1BJMA 2HFFA 1J5OL 2FIRT 1PZ5B 1XCQA 5IOPA 1NMCB 3ARGC 1NFDE 4RDQG 2OL3H 1KB5A 3PWPE 3C5ZD 3GK8L 2LQRA 5IR1B 4PP1C 1QACA 2V5RA 4PGCA 1WITA 4IJ3C 4WFGE 5J13B 4E42B 5H2BA 3RZWA 2WNGA 4G8EB 3SQBA 5C0FB 1MUJA 4G3YH 2O93L 4GFTB 4JDZB 5I74B 3F65A 4APQC 4FQXD 1A4JB 1CLZL 5D70L 4PJ7F 3H3KA 5FCUL 4M93B 5GGVL 4BSWA 3O9WA 4PJ9A 5K9OA 3UC0H 3W2DH 4TNWF 5ACLA 1YQ2A 4LLVA 4PTTB 1JMXA 2A9NH 1AR1C 3GZKA 5DK0B 1ZOXA 1EAJA 4J12A 3DGCR 4AQ1B 4R97B 4W4NA 4OJFH 1IQDB 1U92A 1JZ8A 1B6DA 5ALBL 2RFXA 3HMWH 4XPHL 3X13B 3I02A 2DQEL 1VKXA 4Q9QL 1BAFH 5JPNA 4ZFGH 4DGVH 4OLYL 4EUPG 5AWNH 3BIKA 3GSWA 1TLKA 1FGNH 1FZKA 5F21B 1CLCA 1MPAL 3NVQA 3IDYB 3QDGE 1ZA3A 5KVDL 4LSVL 5DHVA 5DF0A 4OFYA 3S36L 2R2BB 3RZCA 1T0NA 1K6QL 3CLEH 4FQIH 1W2KT 4PRDA 4XVSL 2HG5B 3UTSA 4C58B 1J1PH 3IJYA 4X9FA 2NQCA 1I9RH 3F7VB 1RZGB 1S9XB 4XC3L 3UJTH 1P4BL 3LEXA 3LKQB 3ARGD 4PJAA 1QR1B 5ICXB 2IAMB 4FQ1H 3ZE0E 4L4VA 1I9JL 3LS4L 1A0QL 4QRSB 1ZLUK 4PP1D 3TO4C 3BUYA 4Y19B 5DS8B 5C0BE 1U8PB 4GLRI 1K4CB 5IB4B 5BRZE 3CFKA 1I8IB 3ZLQC 1H3TA 4BA8A 4CVUA 2DF3A 4ZTPL 4Y7MA 2Z92A 4KFZC 4F9PA 4FFWC 4APQD 2VDOL 1FG9C 4O2EB 4KTEH 3VD4A 2UZIH 5DYOA 1NCCH 3O3EB 4IS6B 5EU6D 5LCVL 4IBLT 2RB8A 5FYJD 3MFFB 4Q0XL 3C6SB 1AR1D 3HMXL 2WZPD 3VD7A 1RK0A 1ROWA 4PBVC 2IGFL 1NCBL 4K3DH 4FN0A 3ILQC 4WFFD 1KCUL 3EFDL 4PY8J 5HYJE 1G0YR 1W0VB 2ZCLH 4WW1B 1D6EA 1DJSA 1FPTH 4JZNA 3VXUB 1ZGLP 1KJ2L 4X8XA 1BIHA 4M7KH 4R4BA 5I1KL 2BZDA 1FFPB 5F72S 4PJBA 1ZVYA 4XMPL 4X4ZA 2UWEE 1XEDA 4M48L 3V7MA 4DZ8A 3W0WB 1A7QL 4PP2A 3IRPX 5DK2B 4NFCA 2EECA 1I7UA 1OLLA 4J7RA 5E2VH 4Z7QF 2RCSH 4OZFH 5L2JB 3N1FC 3EBAA 4ONHB 4PJ8B 1OAUH 4KRLB 1EAPB 3RNKA 2VDNL 1QLRB 1RZIA 2CJUH 1IKFL 5KS9F 1EJOH 2OL3A 4Y4HC 4WY7H 5I73C 4HKXB 4LP5A 3TO4D 1EMTL 3MLZH 3V5HA 3QCTL 5MI0C 1CFNA 3CFJB 5AYUH 3RIFK 5ITBL 4QRRB 3WIHH 2ADFL 5JIIA 2X4SA 1S5IH 4BH7B 1FL5B 1WJ3A 5E1AA 2NMSA 1OTSC 1YNTA 4FFWD 4KQ3H 4WW2A 5F7UA 4X4ME 2DS4A 2E27L 4XXDB 2JIXD 1CFVL 3ZYJA 3VG9B 2APVA 1OAKH 3QIWA 2KKQA 4QRUA 3UTPD 4P2CG 4XMKL 4ORZC 5GRUH 1P2CA 3INUL 1GC1H 4M7LL 3E6FA 3X11B 3KWWA 4L8CA 1MJJB 4ODTH 2XTLA 3ILQD 4OB5L 5ICZB 3GHEL 4P2RA 4AM0B 5I15H 4G6FD 3QQ9C 3ULUL 3OKKB 3WXVL 5C8JA 3TT1H 1HXMA 3E1F1 5GGUA 3WN5A 3WS3B 1DQQB 4L4TD 3N85H 2P48B 1DBAH 4LLUA 5J11B 3NTCL 2C26A 3GM0A 2GJ6B 3LDBB 3LKNA 1MRDH 2EDXA 2Q7YA 3I3BA 3IDNA 5T1DL 4K9EC 5IESH 3L3JB 3WV0A 4Z0XB 1GRWA 4MA7L 4NO5A 3KXFB 4BSVB 4P9HC 2APXA 5EBMA 1U8HA 3W5MA 3OTTA 4NJAH 2HFEB 4GG6A 4HIIB 2JE8A 1NMAL 1ZS8B 3DUSB 4NBZB 4Y4HD 5EOQH 2MQ3A 2XZAL 4Z7WE 4F7TA 4HBCH 4J3SA 4XNUH 4ODSL 1IGJB 3ZTNH 2PN5A 5F1SA 5TE6H 4H0IA 1GAFH 1TVHA 1OTSD 3H9SB 4N5UA 3KPSB 4UIKH 3QUYA 5DQJB 5TGBA 2NY2B 1R5WB 4K3JL 5FB8B 3R1GH 3UCRA 4BKLB 4ERSL 3QHFL 3I85A 3KPNB 4O4YH 3UTTD 2PTTA 2MCPL 1MJ8H 2MPAH 3KHQA 4BK4A 4U6YA 3T65A 4UILL 4I0KA 5FM5M 1U9KA 5B8CC 1WIUA 4YZFF 5BQ7A 5CMAA 1OWRM 2IPTH 4HGMA 2UUDK 2QSCH 5D1XC 2V9RA 3Q48A 5E70A 5I8CA 4M43H 3S5LB 3BUTA 2R69L 3LIZL 1WZ1L 1I8MB 1CXLA 4ONGH 4X6BB 4K8RL 2OSLB 4ZUTA 3QH3A 1R24A 4FTVA 4NHUB 1ZSDA 1HXYA 3TBSA 1MCPH 3K74B 5EU4B 3DX7A 2BY2A 3GI8H 1F90L 1ZLUH 4I8DA 1MY5A 2IPKA 4N0YH 1TPXB 3BO8B 5IROA 3NFSH 2LTQB 5FHAH 4OD1L 1U95B 2D7TL 1NC2B 2X9XA 3P73A 1IC7L 1MJUH 1G9EA 5HDQH 1MF2L 3MLXL 1IM3A 4JR9L 5EU3A 4Z8FH 4NKQB 1A21A 3V0WL 4J23A 5AYQA 1QSZA 4MD5B 3CU7A 3WIHA 3G6JF 4OLXL 4AMKH 4P3DA 3BGFB 2YK1L 1Z6JT 1X5ZA 4ZFOB 1A47A 3BEVB 4OUOA 1JYNA 4YDJA 5HGHA 3O6LH 1I3RB 2XZZA 1S7UB 2CKBH 4GRLA 1BFOA 1CL7L 2ZOLA 1NANI 4PYGA 4NZTL 2GSIB 4C59B 3SY0A 3MNZA 3LV3A 5D1XD 5IJVA 1J8HE 2JB5L 1DANU 4GG8B 3PQYA 3MLRH 4O5LL 2WBJC 4E9LA 3JUZA 3CNKA 1NGQL 4ZTOL 3DARA 4RZCB 1YN6B 3GRWH 5DJDA 5E08H 4LVOB 1FRGH 4RFOL 2AW2A 1G0DA 1MIMH 4KROB 2DL2A 1U8MB 5JHDE 2XN9A 3QIBA 4ZDHB 4PV8B 3HFMH 5DD3L 1AGCA 2Z8RA 4PJXE 2XKSA 2NY3C 3UZEA 4ELMA 2MMXA 4R3SB 1Q1JH 3X12A 1HDMB 5H37H 2X4QA 2OMNA 2W9LA 4X9GA 5DUMH 3G5XB 4L1DA 1SJVA 1T7ZA 3D2UD 3DJ9A 3HPLB 3O6FA 5D6CB 1R0AL 3AM8C 2Z31B 2OK0L 2N7BA 3E3QE 2CR3A 2R1YB 4HJJL 4OCSH 4PLKC 3SDDA 2GUOA 4K23L 3IDIB 3RWGB 3GSXA 4Y5VA 4M6OH 3PUCA 2VB5A 4MQ7B 4P9ML 4XP1H 4DQOH 1MLCB 4FQHA 1JTOA 3QUZA 1FL6A 4S0SD 4WU5A 5GZOD 2W0FA 3Q6FB 4FXLA 1DQJB 3SE9L 1QTYT 1BVKB 2XQYG 5DGRA 2DQTH 3CFBA 3V0VA 3M07A 2I60H 3P4MA 5TE4L 4XBEH 3PWLB 2ILLA 3CX2A 2B1HL 4DFIA 1CFTB 1HEZA 5C07D 3KPQB 4KI5F 1ES0A 3TT3L 2QHRH 2WBJD 4ZPVB 4ORGA 2BFVH 5H8DA 5IT2L 5E2UH 4Z78A 1NMCC 1EA9C 1B0RB 1TZHA 5E8EA 1KLGB 3ZTJG 1U8KB 3SHSA 2AJZA 2FECI 4Q6IB 1LO2H 3WFHA 1RUMH 5DFVC 5J13C 3O3DB 3WLBB 2OCFD 4Y5YB 2NY3D 4JFFE 4PRHE 1C1EL 4LASL 3HG1A 2ITDB 1FBIH 2YZ1A 5I74C 5BXFA 3WS6A 3L5XL 1M7DB 3BP4A 3TYFA 4A6YH 2JJVA 4M93C 2PYEB 3BOVA 1A6PA 4MNQE 4OTXH 1KCVL 2VXSH 3MR9B 5FGRA 4Z77A 1RJZA 2FJFA 2MHAA 1JGUH 1RJYA 2JJSC 4P59H 4XTRD 2XKNA 4ACPA 4EEEA 4NM8H 2GTZA 2FHFA 4R97C 4HIXL 1EIBA 1CE1L 4KKNA 3Q0HA 3OAYK 1DL7H 5DLMH 1F8TL 2DQIH 4PD4J 1YMHA 5GISH 3OKEB 2OLDA 4JPIB 1KG0B 3W39A 2R29H 4J3WA 4R7NA 1AGFB 3Q6GH 4KWUA 5L8JB 4R96A 3IDYC 5GGRA 3GB7B 5FV2A 3VXOA 4BZ2H 3JVGC 5DJAA 1OY3B 4KK6C 4PJCA 4OLWH 4XB8A 3MMEA 3VXRE 2H45A 4XPFL 1M05A 4OF6A 2FYYB 3PWVB 1XT5A 3WXWH 2E8YA 1S3KL 3U7YL 1Q72H 4LQFL 3FL7A 3DVIA 1LP9E 5LAXA 1S78C 2IAMC 2AJSL 2ZP0T 2YPLE 4FMKA 3U46A 4LPVA 2HJKB 4PGCB 4YLQT 2C4XA 4OM0L 3PHQB 5DFVD 4XBGB 1J1XL 3I2CH 3M1BA 4X4YA 2YPVL 1MUJB 5DWUH 2DLFL 3CK0L 3MROA 5DT1L 4KDTC 5I1HH 1G7LB 5IP4A 3DBXA 1IAIM 3AREA 4O2FA 5A16A 5LQBL 1IGML 3V9FA 4LLQB 4HV8A 4NP4H 4PJ9B 5E56A 3MLSH 4LLVB 2HH0H 3W82A 2AK4E 4MNHB 1E4XH 1B9ZA 4LGPB 1G7QB 3P40A 2RFXB 3VG0H 4HXAL 4JFEA 3MJ9A 3MV9A 1OSPL 4O58H 5JPNB 2BVQA 5HPOA 1RURH 5EA0H 4X9BA 1G6RB 2AJUH 1BFVL 5E8DH 3JV4B 4NKMB 2GITB 2EDRA 4B5EA 5DVOA 3QFJD 5CHNA 4M62L 3V6FA 4JY6A 3WL9B 3KR3L 1ZHLB 1TTUA 4KK6D 2YOCA 3GSQB 3IJYB 4QRPE 4LCIH 4M00A 1OGAA 4WWKA 4WEMB 3LEXB 1P7HL 5B3JE 3GMRA 5BV7B 1T03H 3CSYA 2KL6A 5C9JA 3EFFA 4PJ8C 1P69B 1DBML 1CIUA 1W0WB 2XXMB 1S78D 2FR4A 2IAMD 2RBLA 2HKFL 1JF1A 3BUYB 4Y19D 1NGXA 1WAAA 4JKMA 4RWYH 5I71B 1X6LA 2ZUSA 2X4OA 4PG2C 4ETYA 1JK8A 5AEAA 4BYHA 3SGJC 3MOBH 4MDIA 3FO0L 5DYOB 2N1KA 1FFQA 3ZKXB 3QULA 3D25A 4I18A 1I9IL 5T3XL 3VG9C 2FEDC 1IRAY 5DQ9A 2YD4A 4X7CC 5CD3B 1RPQA 4EUPH 5T1LA 3ULVE 1Y6MR 1JNNH 5HJ3A 4JN1H 2R0KL 4GRWF 1GGCH 4IRJA 4YFDB 5EO0B 1PY9A 3SCMA 3CFCH 1ORSA 3DPBA 1BWWA 5GS0D 1CGWA 4JZNB 1XCTB 1JHTB 3VXUD 4KHTH 1OAQH 4L5FL 1F4WL 1FLRL 1BQSA 1FN4A 3T8XA 1FVDB 2P49B 3QNXA 2Y36H 4GUPA 5J11C 3MGOA 3LDBC 5E7BA 1J0ZA 3W0WD 4R0LA 2E9BA 4WENB 5GGTL 3HPJA 2ARWA 4ZD3H 3G5VA 1JPTL 1JRHH 5GGSY 3DURB 3C8HA 4XH2A 4Z7OF 3UYOD 4WHYH 4PJ8D 3VFTA 1MI5E 5E8NB 2CDEB 3RNKB 1RZIB 3U0WL 2P1YA 1QSFB 1O5DT 2XA8H 4HAGA 3O41B 4Z7UF 4K7FA 3AS3A 4JY4A 2WIIA 4QRRD 1MFCL 2BVPB 1MFAL 1DBKH 4YDLB 4YUEH 4YNYA 3BDBA 4C54A 1D5MB 3ULVL 5E1AB 4DKDC 2C4FT 3EYOA 2XIDA 2JKXA 3TBWB 4X7SH 5D7KE 3LQMA 4V1DE 1D5BA 1OTTC 4UQ2B 1HYSC 2NY2C 2D7NA 3VRJA 1Z9OA 5H35A 1CGVA 4OLUH 4Y2OA 2FEDD 4X80L 3BISA 5C0CD 4N0UA 3TBVB 5BVPL 3IFLH 1P2CB 1GVIA 3E6FB 3QISA 3KWWB 1KF9B 2D9QB 1P7QB 1MHPH 4EZMA 5T5FH 3PJSB 4P2RB 3KLSA 1E27A 3QWQB 1LVEA 1IGFL 3H3PL 5SWZA 3FHAA 4NBYB 5DMGC 2D2OA 4NNPL 1E4KC 5K9JL 1LEIA 3VFWA 3WN5B 3X3GH 2EE9A 1EEZA 2ADGB 3B8SA 4LEXL 2D0HA 5CEZE 4HPYH 4JFPA 3ARVA 2GJ6D 2Q7YB 3IDNB 1MCBA 2JCCA 5E24E 2DL9A 4HH8A 4LCYA 3HRZA 4C57C 4LF3A 3MA9H 4NO5B 3U1SH 3KXFD 4I3SH 3PGDA 2FGWL 1MCLA 1UM6H 1F3JB 1TPXC 2F54B 3OX8B 4GG6B 3FT4A 2LTQC 2GJZA 3SJVE 3PV6B 2Q86A 4NN5B 4FFYL 5CZXC 5AZ2H 2VXUH 1S9WA 3WNKA 4EI5A 5I8OL 3MYJB 1T1YA 4OF3A 1OP5K 5JW5A 2OZ4L 4FZ8L 1JZ3A 2DJ4A 3S4SB 4NQEE 4MJ5A 3IDUA 5C0RH 3H9SD 3BGFC 4UIMA 2QSVA 3KPSD 3VXNB 5DZNA 1J05A 1OTTD 4CJ1A 2NY2D 2R1WB 2VDRH 4J1UB 1S7QA 4Y2DA 1JWSB 2GTWA 1FNSH 4Y1AA 2PTTB 3VDBA 4U6YB 3HNTH 3W5NA 1HHJB 5GRVL 1FL3A 5KVGL 4WW2F 1RJLB 3LPFA 4PJEF 3RPIA 4EUPA 1HKFA 3P11H 4K3GA 2EC9T 4H1LG 3H8NA 4Q97A 1QBAA 2D4DA 2C5DC 5DMGD 5IMLA 4K7PX 8CGTA 2IMMA 4U3HA 2FGZA 4EIZC 4LVOC 3OXRB 1S8DA 4FFZL 3VI4F 1VFBA 3QH3B 4KROC 1R24B 4P2OB 3QEGL 4FTVB 1ZSDB 4OZHA 3D18A 4MXWH 2F53A 1FG2A 2BNRE 4WGVB 4YJZL 1MJ7H 3VFRB 3VW3H 1IAIH 5CKAA 3DX7B 2Z8WC 1N3NA 3U82B 3VXMB 1GYAA 1GPOH 5FO8A 2FD6H 1TETL 3X3FL 5C7XH 3QI9A 3ZSTA 5I1EL 3LKRB 5IBTL 4NGHL 4BUGA 4MJIB 1EPFA 3P73B 5DJXB 2YD5A 2A0LC 5KW9H 1NC2D 5I1CL 3NOIA 2IQAB 5DD1H 1UA6H 1JZ4A 1IM3B 1J86A 5EU3B 2Z31C 2ICCA 2FB4L 7CGTA 1T21A 2VIRB 5HDBE 4JDTL 4PLOB 3E8UL 4JFDA 3WUWG 2ZSWB 5CZKA 4QRQB 3UPCA 4YO0A 3D69A 3WEXA 5GJTL 3DYOA 4JZJA 4ETQB 5FKAA 3OMZA 1SJHA 1WF5A 5J12B 2BC4A 3RY4A 3O3UN 1JCKA 4GRLB 1BFOB 2HJLB 3F62A 5MENE 2ZNXA 2VZUA 1C5DA 3SY0B 2P42B 2EXWC 3C2AL 1RZKL 1DSFL 3QUMB 4JE4B 4YDIH 3FOLA 3O8XB 2BNUA 1R3IL 1RQ5A 1MCSA 1B0GB 4PJHF 2C3XA 3MODL 1PY4A 2AABH 4KROD 1KIUA 1AXTL 4Q6IC 4P5TA 3QIBB 5I17A 1I7RB 4P4RA 5IVOA 5FOBA 1AGCB 3NH7L 3DVNA 3FJTA 4MLSA 5DRXB 4Y5YC 4QKXB 3TJHC 2SEBB 4ELMB 3FMGH 1ZEAH 3D85B 1NL0L 3V6ZA 5F7EH 3X12B 4LU5H 2YRLA 2CIKA 1ZVHA 3T04D 4POUB 1VADA 3HB3C 1IC4L 2Z31D 4P23A 3EDFA 2Y6SD 1ACYL 5LJYH 2J6EH 4YHOL 2GUOB 3SGKC 1I4FA 3GSXB 4Y5VB 1QBMH 3MV7E 2C7UA 3FQXA 4TRPH 5DMKA 4UDUB 1IC1A 2X09A 1S9VA 4K71B 1FL6B 3ETBF 5EBWA 5K59E 4WU5B 2HFTA 5GXBB 1Y18A 1VERA 3REVA 2X4TB 2EC8A 4PJGE 4HWBH 3S96B 4W4OA 2CLVA 4JFYA 3CFBB 3P4MB 4NQDA 5IV2A 4RX4D 1WISA 3G5ZA 2EDKA 1MFEH 2EXWD 5CEZH 1ES0B 3O2VL 4ORGB 5D2LA 2DI7A 2IANE 2V9QA 2HMIC 1TZHB 3ARFA 5FF6A 4RISL 3ARXA 2F74B 2AJZB 4S1SH 4QCIA 3NCBB 3V8CA 3SE3A 2Y07L 1U58A 3BH9A 5JXAL 2DLHA 3GSRA 4I13B 5DUPL 1QKZL 1AH1A 3WIIL 2AI0L 2DI8A 4XP9H 4G5ZH 3VWJA 5L0QB 4LLAA 5GQBA 3IETA 2YRPA 2C3VB 4U2ZA 3MLVH 3OKLB 1OP5H 4GAJL 1NFDF 3FB8A 3GBNH 2PYED 4LCWA 3MRHB 4PJ9C 4PRBA 3DTXA 3K4ZA 3HB3D 4Z77B 1RJZB 5ID0A 1NCTA 1UKSA 4WTWA 1AP2B 3SO3B 4N0FA 4DKEH 2XKNB 2CLRA 4DN3H 3UJJH 1KB9K 1RD6A 4M9PA 1ZLSH 1FNEB 5D1ZA 5KSBE 3ECBA 4POYA 1YMHB 4C83A 1U3YA 1M71A 4JDVA 5CAYB 1N0XL 2LU4A 5IBLC 2ZCKH 4K07A 4HIJB 4NQCE 4R96B 4D9LL 2VR4A 4Y5XB 1NBQA 3DX8B 4MDJA 4ODVH 4PJCB 2HVKA 4HJGA 3MMEB 1R3KB 2ICES 1M05B 2GSGA 3CXHK 1JUFA 3CCHB 4DCQA 3RQ3A 3ZTJH 2K7QA 1UJ3A 2QQLH 2ED7A 5BV7C 2HMID 4JQVA 5LAXB 3IU3A 2W65B 2FATL 5C0AE 1GHFL 3T77A 4HLJA 1QNZH 1NGPH 3U46B 3QQ3A 5KSAA 1IL1A 3C60A 4U3XA 5GHWH 1Z0NA 1I8LA 4UQ3A 5TF1H 3M1BB 4X4YB 5I71C 4AEFA 3PP3K 1H0DA 3K1DA 3KPMB 2VOTA 3MROB 4CADA 1A7NL 5BZWA 2Z8VC 5B39B 3AREB 5LBSL 2GK2A 5A16B 3TNMA 2F5BH 4I48A 1V3MA 4JPWH 5ACZB 5EDXA 3ZKXC 3GMPA 4PJ9D 3ZE0F 1NJ9A 3GMLA 3U4BH 3H42H 1KC5H 2B2XL 1PX4A 1F4XH 1HHIA 1G7PB 3V6BR 1QG3A 3IFNL 1PLGH 2IH1A 4HLZG 2BVQB 2DTSA 4X98A 3S97C 5DJZA 5FUOH 5CSGA 1JGEA 2O5XH 3BH8A 5J1TC 1VGEH 5IBLD 1I7ZB 4HUVA 5IQ9B 3SGEH 3SDXA 4JY6B 1CGUA 1UZ8A 5JNYA 3FB5B 4PGDB 4NCDA 3A6CH 2OTUA 3SDYL 4JFHE 2R8SL 3MRBA 4P2QA 3QPQC 3LHPH 5EZOH 1UWXK 3WIFB 2EKJA 3GFUA 5C0EA 5DDHA 1JF1B 1CR9H 1HZHH 4KZEH 1XF2A 1N2RB 1FZJA 3Q3GA 1BX2A 2IFFH 4ZFOL 2UWEF 2I5YH 4YDLC 3OAUL 2I25N 1CD1A 4PRAA 3HCVA 1BOGA 3QULB 3LEYL 4WJ5A 3L95A 3VWKA 4ZSOA 3CVHB 3WDHA 4LCCB 1MAML 5ENWB 2YN5A 4F2MA 4OZIE 3NAAH 4P5MB 4YBHA 4FABH 1MREH 5T1LB 3RIFF 4MB4A 2XWBA 4FNLH 2BHYA 3RNQB 4X7TA 5HJ3B 5DJ8B 3O2WH 1D7FA 3GJEA 4EBQL 1KBGL 1ORSB 5IQ7L 3WN5C 1MELA 3BXNA 1GJIA 3QNXB 1G9MH 4GUPB 3MGOB 2DLTA 3RA7L 2E8ZA 4G6JH 5CP7B 5A1AA 1K5NA 3HPJB 3BGMA 3U7WH 2YMXH 2V2TA 3PHOA 1OQOA 1P4LA 2X70B 4PY8I 2H6PB 5E8PA 3L3IB 2PO6A 3QPQD 5C0GA 2Y9RT 1A6AA 4WO4B 6CGTA 1QSFD 3B5HA 1RZJH 3ABZA 2H9GA 5HPMA 4NN5C 5HYQA 3RPKA 5FKPB 4JY4B 2P45B 3RWIA 2W60A 2DM7A 1U2HA 5KJRH 4YNYB 4S2SA 4QO1A 1KJ3L 1YYMH 1MCOH 3EYOB 3A6BH 3CSGA 3RU8L 1RUKL 5ANME 4K3EL 3VA2C 5H35B 5GIRB 3EJJX 3UDWA 4JREB 1FDLL 3QEUA 1K8IA 4B0MM 4F9LC 3O2DH 2ZCHH 4Z7WF 4MA3B 3B5GA 3QEQE 3NCMA 5JIPA 2R4RH 1MH5B 1FFNB 1PQZB 3OGOE 2ZG3A 4FZEL 3RUGE 4AIXA 3B9KA 4RCAA 4EDWH 1P7QD 2AGJL 1JNJA 1QOKA 1NBZB 4P2RD 1TZGL 5SWZB 1LD9B 1OQXA 4HQQL 4R7DB 4AT6A 3VRLE 5DFWH 1OARL 4LHUB 1LEIB 1BVZA 5IEKA 1D5ZA 2A77L 5JHLH 5C1MB 4R4FH 3MRNA 4JFPB 5D70H 5C0NC 2BOCA 3LRGA 3HS0A 4YGAB 3S88L 4G6MH 3OKNA 4P2OC 5F96L 4YAQA 4ZOCA 4L3EA 3HRZB 1RK1A 5CJQL 1FFOA 3L7EA 3PGDB 5H94A 4XNQA 1BM3H 3L5WA 5IROC 2F54D 2BNQE 3FT4B 1A3RL 3OR7A 3PP3H 3WSQH 5ISZB 1WT5C 2P5EA 4JLRA 1ZTXH 4XPAH 1OPGL 1QSEE 4XNXL 2MCG1 4N9GA 2KDGA 5DC0A 3T2NL 3QO0A 3FCTA 4EI5B 2VDLL 4PB0H 5JW5B 1MCCA 3L1OL 2P8PB 3IYLW 4XVJH 5IMOA 4U1KA 4AEEA 4RQQA 4LSVH 4MJ5B 4PR5A 2IBZX 1RIVL 4UIMB 4NDMA 1J05B 3TJEL 5I8KH 4MQXC 2FBJH 3G6JB 4OD2A 2DRUA 4OCWH 4KJPC 2AV7A 5IG7B 5J12C 1ADQL 1NGYB 4GRLC 3FFDB 2Z35A 5A43C 2DLGA 1W72A 2A6JA 3H7BA 4TUKH 5T1MB 4QHMA 5DHYB 3RPIB 1KUMA 1KNOB 1AQDA 4GSDH 2ZJSH 3BP5B 2XZCL 1C5BL 1I7TA 4NOBA 4U1JA 2OQJB 4KUZH 4JEGB 4LAJH 4ZTPH 1HSBA 1MCNA 3O8XC 5E4IA 3CH8A 2R9HC 1CD8A 4UT7L 4X6DE 4YHIA 5C0ND 2GFBB 1KIPA 1RIUL 3D6GA 5LGJA 1ED3A 1VFBB 4G8GE 1QFOA 5IW6B 4P2OD 1F11B 4HWUA 1V3KA 3D18B 4FTVD 2F53B 1FG2B 15C8L 3TYGH 5I1AA 4R9HA 5ALCL 1UWXH 3QIBC 3I75B 3SOBL 3MA7B 4M1GH 1P6FA 3VXMD 5FO8B 3P9LB 1RFDL 4CL7A 1NUGA 4LMQI 4KTDH 1XGPB 1OAYH 2JCCF 4AY0A 1KCUH 4MJID 4XP6H 2Q6WA 1S7RB 3KPOA 5EUKA 4ESKA 5K33A 5FUCC 1KJ2H 1S7WA 3PDGA 1EEQA 2H8PA 3T1WA 3N9GH 1G6RL 4O9HL 4K94C 4CRPA 4JFDB 5IM7A 4LKCA 3ET9F 4U6TA 4Y5VC 1WTGT 2Q20A 3TGXA 4XCEA 4PJXF 4GW4A 1SM3H 4K71C 3WNNA 4JZJB 4MQXD 2XPGA 2B4CH 1MNUL 4EOWH 1SJHB 1WTLA 3ARQA 4XC1L 5D7LB 2M2DA 4KJPD 3DMMC 2BC4B 4XVUC 4G42A 3REWA 3FOMA 4GRLD 4LSQL 1Q9KB 1DANT 1Z9SA 2Y72A 5FO7A 5DEGA 1QRNB 4NC2B 1F4HA 3NACH 4KHXL 4UV7H 4HS6A 1FV1A 5EFIA 4M02A 2XFXA 1IE5A 4AL8L 1U8IA 3O8XD 4OF8A 3QZWB 5EOCL 2APFA 2R9HD 1QD0A 1AD9B 5IEHA 4JFOA 2FECL 3OPZL 4HUUA 5ESQB 1V7ML 2HWZH 3RKPA 1SYSB 5CSBA 1BD2A 3VXQA 4WUUB 1TQBB 3SDAB 4P5TB 2XN9D 5I17B 3QIBD 4P4RB 1N64L 3EOBA 5FOBB 2AS5M 3P30L 5ILTL 5L0QC 1MCHA 4OT1H 3V6ZB 3D85D 5E6IB 1L9MA 3DUUA 2A6KA 1KACB 3MLWL 2FJGB 5CILL 3ULUH 4EKXA 2R0WH 1FNAA 5C08B 5D7IE 4P23B 5GRXG 4NKDA 3HC3L 5DVLA 5GRZA 3SO3C 3L3DB 4HSQA 5FA3A 2VR9A 2F5AL 3JV6B 4XGZB 2C7UB 3FQXB 4JY5H 3V6OA 4OIIH 2VH5L 2VXQH 2XRAL 1KXTB 3QUZD 4JCLA 2K9UA 5FO9A 4KAQH 3GKWH 3WO4B 3H2WA 2VXTH 4MA7H 3VFPB 4TUOB 4WCYL 3ZYZA 2DQFA 4MCYA 1U8JB 4HWZA 4AYFA 4F8QA 3BEWB 3QUXB 2Z91A 3KPTA 3RX5A 3UX9B 3HI1A 1NDGA 1A3QA 4Y5XC 4AIZA 5C0JB 1NLDH 2HLFC 4XCCH 4PJDE 2CK2A 4OFIA 1FO0B 1AKJA 4OZGE 4PJIA 4UOJA 5EIQA 3MRKA 1FAKT 1IM9B 2R15A 2XV6B 3WBDA 3ARFB 5FF6B 3NIFE 2ARJA 5D6DC 1KTDB 2G60L 3UXFA 1XH3A 4NZDA 4QCIB 1Z5LA 4X7FC 5D8JL 4UTAH 3ZKSD 3SE4C 1IGCH 1UEYA 3OJ2C 1LE5A 5FECA 3ROLB 3IKCB 4PJ5A 3MCLL 3IB4A 4AJ0A 3IETB 4UDTB 3HMXA 4QXUH 3KLAA 4BQBA 3QDHA 3MCG1 3VGHA 3NIGE 4LSSH 1EDQA 5JW4R 1DEEB 1LP9F 4LCWB 3NZ8A 4PRBB 3DTXB 3EOAA 1NGWB 5DD0H 5HHOA 3QDMA 4YXKL 5ID0B 4U33A 3AS0A 4N0FB 1TZIB 2R69H 2CH8A 2P7TA 3N1PC 2CLRB 1KJ2A 1JPFB 1N59B 1CXEA 5BZDA 4NC1E 1VDGA 4JHWL 3HNVL 1T1WA 2VDPH 1DP0A 3TF7C 5D1ZB 4X5XB 1M71B 1YC8A 4JDVB 1F90H 2EIZA 1WFUA 1DVFA 2X4RA 3CFEA 4X6CE 3TCLB 4JRXB 3WNLA 4UT6H 4OD1H 2D7TH 4MDJB 1YYLH 2HLFD 4H1LA 3NFPA 4JR9H 4RAUA 4DCQB 4MAUL 1EO8H 4LPUA 5IK3A 3AAZA 5INDA 1RHHA 4GAGH 4QXGL 1UKTA 1CG9A 1SY6L 4Q58C 2ZG1A 3JWDL 3RL2B 5JW3L 1Y0LB 4LIQE 3NCJL 1L7TL 3QB7C 3O3AB 4L9LB 3QQ3B 2F58H 2LVCA 1BFSA 5FA4A 1IL1B 3TZVA 5D2LF 1HH6B 1I1YA 3I6LD 2BVOA 5KVMC 4DZBB 2VAAA 3NZHL 1NH6A 2VE6A 3HE6B 4FA8A 5BZWB 4LSUH 3DGGB 3ARED 5HVHB 1L6XA 4I48B 5F6HJ 3CDFA 1MQKH 3GMPB 2KH2B 5HGBA 3T0DA 2VLKE 4LCCC 4O2CB 3ARSA 4TSAL 1CS6A 5DMIH 3LH2L 3WUWA 5L2KB 1IGYA 3MRMB 4U1HB 1YEKL 2ATPA 2IH1B 4DVRL 1LEGB 4YE4L 1KPUA 3VXSE 4NKIH 4X98B 1E4WH 1WZLA 3O4OB 2R39A 4U05A 1JGEB 2R0ZL 4HS8H 3BH8B 4R8WL 3MRGA 5FYJH 5TDOA 1LGVA 4RWHA 3RY6C 3SN6N 4LIQL 3WFEL 2R2HB 1UZ8B 4YWGL 4LLDA 2R4SL 5DUBA 5CJBA 4HJJH 1II4E 4ODBD 3LKOA 5B22A 4YDKH 3QG7H 1FHGA 2BJMH 2OBGA 1I85A 4P2QB 1DQLL 3S36X 3U9PH 2D3VA 3HZVA 1H8OA 4WO4C 1CU4L 4TUJA 5DDHB 4O02L 4QOKA 1U2CA 2AKRA 1XF2B 4UINL 4LNVA 5LGKA 1MQ8A 1RZFL 2X5PA 2X89D 3BPLB 5E99L 2A1WL 3A67L 3UMTA 5B3NA 2EE3A 2L7JA 4TNVK 3HZKA 1CD1B 4Z7UB 4PRAB 3GSNH 3OHXA 4HC1H 1VPOL 4NRYB 3CC5A 4Z95H 1LO3L 4FFVC 2A6IA 4WJ5B 1AD0B 3VWKB 4ZSOB 3T0XA 4JREC 4JAMA 1DUYA 3ME0A 5EZLA 2FZ3A 3MXWH 2PYFA 1J1OL 3U0PB 1J9CT 5T1LD 4Z5RB 5E9DE 3QUML 4HK0A 3I3EA 3CJJA 2WAHA 2UVEA 2XWBB 1D5XB 3BKJH 4X7TB 4NUGH 1RZ8A 4BFGA 3KNBA 2XWJA 1YN7B 4DOHE 3WFZA 3EIFA 5CSZA 4ZOBA 2J8UE 2Q76A 4OGXL 3TV3H 3GGWA 4M6MH 3F5WA 3TH2T 3BXNB 1FAIL 5ACMA 3HAEB 3H7LA 1YEDA 1Q94A 5DQDH 1PG7L 4WI9A 1K5NB 2QL1A 2OJZH 3BGMB 1ERNA 5JZ7D 2ESVE 1EZVX 3MX0A 3PHOB 2V2TB 1P4LB 3B8YA 5IB3A 3L3GA 5KVEL 1XF4A 2O26U 2GK0A 4HIXH 1P4IH 1U8QB 2ORBH 4LDEB 4WO4D 1YPZE 2BMKA 3X14A 4K94L 4H5SB 5HPMB 5HYQB 3LS5H 4KJYA 5CGYC 1V7NH 4EI5C 1L9NA 2FX8L 4MA8H 3DLQR 3S5LG 4JQXC 4RMRA 3P0YH 3QJFA 3JWOC 3MOAH 1FFRA 4KVCL 1KB9J 4FFVD 4OZ4A 1CBVL 4S10A 5ADOL 3PWNB 4YPGB 2AJVL 4IRZH 1KTRL 5MEOB 2A73B 2B39A 4TNWK 4LQFH 2C3HA 3OSKA 5CINH 3MO1B 1YJDL 4LBEA 1IEAA 4J6RH 2AJSH 3Q5OA 4S0TD 3IDGB 3O6MH 5D1QB 3SQOL 2G2RA 4G80A 2IG2H 4UB0L 2NY7H 5C09E 2OR9H 3V4PH 4WDIA 5DVNA 2DQUL 2IBGA 3CXHJ 5SWZD 3RAJL 4ZFZB 2VUOA 5F7NC 1RUQL 4APQA 2B0SH 2VKXA 4LHUD 5K9KA 5TF0A 1D5ZB 2ZSVA 3C5SA 3KDMA 4NRXA 3EHBC 4TOYL 3HI5L 3RVUC 1EEUA 4HIHA 4L3AA 5GPRA 3OKNB 2IH3B 4K2UH 2K1MA 3PGFL 4H88H 5ESAB 1J11A 1F6AA 1I1FA 2DTMH 3GMMA 3PIQB 2P43B 1VACB 2E3VA 5F1KC 1YEIH 1ZKAA 2VNCA 4XP4L 1FFOB 3AGVA 5FDWA 1DN0A 4XNQB 3L5WB 1REIA 1CFQA 1IEBA 4HCRH 4JO4L 1MWAL 2ICWA 3OR7B 2P5EB 2CK0L 5ISZD 1A7BA 4WTZG 4N9GB 1PKQA 4D0BB 3QO0B 5CGYD 4PRNA 4FQCH 1AR2A 4MS8C 4EI5D 1DCLA 4HMEA 4K9EH 2UVFA 4RQQB 1MCFA 3DRQA 3IXTA 3QDJE 4LLWB 1EO5A 4P9HH 4NDMB 5CUSH 3MLUL 4G8IA 5D7SH 1F6FB 1ZHNA 1QPPA 3BZDA 3MV8B 2NPLX 3GSNA 1J12A 3R06A 4I5BA 4JZJC 1LHZA 4DTGL 5D2NE 1P1ZA 3FO1B 2YUWA 3R4DA 3GBLA 1CVRA 1ZT7B 2CRIA 1W72B 2Y5EA 3MNWA 4J4PA 3KAAA 4QHMB 4AQOA 5HDBF 1OOAA 4HFWA 1AIFA 1IQWH 5EBGA 4HG4J 5CFHA 3QR2A 3U0TB 4IOIB 1YDPA 2JIXA 3EHBD 1SJXA 2I07A 4FQQB 1CICB 3K1KC 4KI5C 1HHGB 4M5ZL 3RVUD 1ED3B 1NGZB 3CDCA 2F53D 1TQBC 3EYVB 5E2TH 3SDAC 1L0QA 4P5TC 3ZDZE 3QFJE 4PJHB 5A2KH 2UV3A 1BECA 3EW3B 1EUTA 3MTRA 3SKMB 2P5WE 1KEGL 3MRPA 3KPRB 4WNQA 2LABA 5GSVB 5E6IC 3T3MF 5DEZA 4M5YL 1XR8B 2I9TA 1PFCA 5CJ8A 2ATKA 4L4TA 1X5IA 4BZ1H 2NYYC 2YHGA 5EUKB 2BRRL 2EIBA 4GXVL 4IMKA 4MS8D 4P23C 4TSCH 4ODXB 4ELKA 2A74B 5IM7B 4BZYA 4JFDD 3CXDL 3SGDH 3TBYB 4XCEB 3FQNA 1A3LL 1I3UA 4V2BA 3WFBL 2DWEB 4DW2L 3SPVA 2XPGB 3MRJB 2CUIA 1NC4A 2O5ZL 5FGBC 2FWOA 3WO4C 5D7LD 3DETC 3QCUL 1A4KA 3TVMA 3REWB 2A83A 3KYMB 5E8OA 4WEBL 3QUXC 3BRGC 4M8VA 5FO7B 3K4DA 2PCPA 3P4LA 5F7LB 4D3CL 1QRND 2VLJA 2B20A 1KT2B 5EUOE 1K4DA 2XT1B 1WBXA 3GJFA 4RGNE 3VFVB 3HA0A 4MGXA 1ZGLB 1G9NC 2XFXB 4KZDL 2WP3O 3RBGA 1E6JL 3SE8L 1FYTE 2QADB 4F57L 2DQHH 1JPSH 5K59F 4HGKC 1R5IB 3BFOA 4WI7A 2P8LA 3ARFC 4KDVA 2FIKA 1M7IA 2YBRA 3LQAL 4KI5D 4PJGF 3UTTA 3VXQB 1KN4H 4WUUD 2E7MA 3U30B 2CMRL 4P5TD 3EOBB 1UENA 1EVUA 3EYUH 3S34L 4I2XE 3VXUE 5DJ6A 2ARJQ 4XCFL 1TCMA 3BPCB 3EYQC 3BQUB 1A14L 5IHUH 2IEPA 2PR4L 4OKVB 3T2OA 1PAMA 2A6KB 5JLZA 1NAMH 4HCRA 4I4WA 3PABB 3HUJA 1NEZG 2QQKH 2NYYD 4PJFF 5C08D 4OV5A 1TFHA 4P23D 4JFXB 3IKKA 5DC4B 1X5GA 4KY1L 1NFDB 3STZB 4FOMA 3UPRA 3C8KA 5FA3B 1YEFH 2DMBA 3UZQA 1ETZB 3ARTA 3I9GH 3BYTA 5JORB 2EYRA 3MRDB 4J8RA 4QRRE 4P46A 4M61B 3IAPA 3DETD 4HMCA 2WUCL 1UFUA 4XAWH 2MJWA 5EN2A 4L29B 3NA9L 1AO7E 3GM8A 1DLFH 4JPVH 2WUBH 2W0LA 1C5CH 4P3CH 3HI1B 1NDGB 2YKLL 4NNXB 4QRTB 4E5XA 1D6VL 2P4AB 2NY5C 1S7SA 2Y7QA 4LLYB 1P5VA 4OIAA 5C0CE 1CDCA 3HR6A 2EDOA 2MSPA 2V7HB 3EUUA 1IM9D 4Y88A 2BSTB 3ARFD 3ZE2E 1QLFA 4F80A 2XG4A 2ARJB 2BXZA 1XH3B 1PSKL 3RWDA 4L9LC 3RWEA 2DDQL 3P4OB 4ALAL 4HFUH 5B8CA 3NFNB 5MERA 3BDXA 1I8LC 1NEUA 1OLZA 3EYQD 4UV4L 4GW5A 4NM4H 2D9CA 5BMFH 3PG2A 2IADA 3PGCA 4PV9A 5D1XA 3QDGB 5D7JC 3HE6C 1VFMA 3KLAB 5FYJU 4PGEA 5HVHC 1PYWA 5ESVB 2CUMA 5T3ZD 3NZ8B 4LCWD 4M7JH 4JRYE 3MRFA 1VEPA 5J06A 1BGXL 3R0NA 1YEHH 4HUXA 4NFBA 4YHMH 1B4JL 3O0RL 1NCAL 1SJEA 5I1LA 4ZNCD 4FFZH 1AJ7L 4TULH 1YNLH 5IHZA 4X6EA 1T1WB 3Q1SH 5D1ZD 1DBBL 3O4OC 2VQTA 1U36A 3AROA 2EIZB 5GGTA 4IRSB 5BRZB 1N6QL 1RZ7H 2X4RB 5IBTH 3H9SE 4JRXD 1E0OB 1T1XB 5DGQA 5L7XH 5T33L 3MACL 5C2UB 4N90D 4HX1A 5JDJA 5FV1L 4MJ6A 4HMDA 3BKCH 5CEXB 3D0LA 3V52H 4JANA 2FB4H 4QXTB 3GMOA 1RHHB 1NCNA 3TIDB 1CG9B 4OAWA 3THML 5GSRB 1Q0YH 4ZUVB 4JDTH 1VA9A 4XRCB 4PREB 2AEIT 4JG1H 12E8L 4KK8C 1JFQL 5EZJB 4PJIF 3BESR 1XGRA 3JWOL 5FA4B 4U1SA 5INCA 3TZVB 4E0RA 2G5BA 2Q7NA 1AE6L 1R3LB 3BPLC 4KPHL 3I6GA 2YPKA 1BF2A 5FOJA 2VAAB 4FQLH 3LN4A 2XZQL 1CLOL 2APWA 5C07A 3CX5K 3HE6D 2HAZA 1X5AA 4NQVB 2WBJA 1Q0XH 4AK1A 4DK6A 3PP4L 5IVXA 3VWKC 1CF8H 5CEYA 1UWGH 4OCRH 5A2LH 4AENB 1T2XA 2HRPL 5L2KD 1BZ7A 1UM4L 5DZLA 1MI5A 3RFZC 4XPGH 4R4NC 1U8OB 4MD4A 3OL2A 1NAKL 2Z4QA 1KPUB 4MNGA 3NABH 1F4YL 2BDNH 1NDMA 4LCUA 4WI6A 4G7VL 1MHEA 2BSSB 5TDOB 4NQUA 4ZOAA 4H8WC 1Q8MA 4GAYA 3SDCB 3J8F7 5TE7L 3VFNA 5F1IA 1X4YA 4LLDB 3G9AB 1GGBL 4HKBA 3OZ9L 5C71A 3C08L 3FT3B 3V5KA 1UH4A 5L9DH 5EBLB 1YMME 1I3VA 1MCQA 4P2QD 2OZ4A 5GS0H 1RVFH 4KKBC 4YHLH 5D9SA 4KK8D 4NJ9L 1UYWL 3QO1B 5I1JH 2VXVH 4NZUH 2AJXL 4GQPH 1C7TA 4JO3L 3KYNB 4FQ2L 4PLNC 2AXHA 1AFVH 4HZLA 32C2A 3MZGB 1HKLL 1MFDH 3OHXB 1A22B 4M1CC 4Z76B 4G9DA 4MJ4A 3BIAX 3BT2L 4M9OA 5EORL 3WFDH 5F1NB 3UDWC 3VFOB 3VWKD 2FNBA 4M6AA 3MRIA 4B7IA 5EZLB 4KMQA 3ZKQD 2PYFB 1RU9H 5IR1A 2W1NA 3P4NB 4HK0B 4DUWA 1AXSA 1NCWL 4R4ND 1R5VA 3N1QC 4E42A 5D1QC 1IKNC 3GBML 3KNBB 2XWJB 5F8QC 1RULH 4G8EA 3QXWA 2ERJB 3KYAA 5CSZB 2AVGA 2DAVA 4JDZA 4HUMB 3F7YA 2Q76B 3S4SG 6FABH 1A4JA 2H1PH 3GGWB 4HGWB 3I50L 3SKNA 1S7VA 1YEDB 5F88A 2MOVA 1A6UH 1NUFA 4PTTA 2YA1A 3CDYA 4YX2L 1WLHA 5DK0A 1CGSL 3S35H 1SBSH 5FYKD 3RUGF 3L3GB 3QRGH 3RTQA 5JIKA 4AEHL 1XF4B 2GK0B 3EDKA 1FE8L 4KKBD 1Q38A 2EDEA 2BMKB 3K8LA 1GZPB 3X14B 1I3GH 5F6IB 1TJGL 3FFCE 1ITBB 1BQLH 4ODUA 3OKDB 3T0BA 3S98A 2R2BA 1N7MH 2JJWA 5FIEA 1FH5H 1MCJA 3AB0B 4J3OC 3CMOH 1JGDB 2NY1B 1IC5H 3MQIA 3F7VA 5JOPD 4M1CD 5JQ6L 1S9XA 4OZ4B 4TVPD 5ETUA 5FM8A 4NZJA 5I75B 1QR1A 3WUZA 2GAZB 5ICXA 1AXIB 2BVTA 4QRSA 4GKSB 1FO0L 5D71L 1G9NL 2W9EH 4Y19A 5DS8A 1CDJA 1K4CA 5IB4A 3BIBX 3EO9L 2PYEE 4G80B 4KTYA 5D1QD 2DICA 5IMKA 4I3GA 3WO3B 1I8IA 4U1MB 5IF0A 2DBJA 4DEPB 4KDTA 2ZSVB 5DJCB 3BDYH 5KOMC 3VGBA 3EOTL 3O3EA 4IS6A 4NRXB 1AC0A 4GKOA 3MFFA 5E5RB 1CICC 4R90L 3J7HA 4NWTL 4ZODA 1KENH 3WKMH 1F6AB 3AY4C 5KVFL 3FB6B 1ZANH 3S37H 4NWUL 1IBGH 5FDWB 1DN0B 4AZ8A 2NXZB 1CFQB 1IEBB 1W0VA 5IMMB 1T80A 4PRIE 2QKIB 4OQTL 3ESVF 2EDFA 2P5ED 5I16B 4X6DF 1J8HB 1PEZA 1FFPA 4PGJA 2CKNA 3SKJL 3FTGB 1NCDL 4Z9KB 1O0VA 3CDGB 3W0WA 3ZHKA 3IXTB 5HDOA 3UJIL 3RWCB 4LGSB 3CPLA 5FYLE 1YA5A 1BLNA 3MV8D 3QCVL 3R06B 4I5BB 43C9A 1JBJA 4PJ8A 4JPKL 3VE0B 4LPWA 2GQHA 2NY5L 1QLRA 4PJXB 5J0BA 4HKXA 3QXDB 1HQ4A 1CXKA 3CFJA 4JVUA 1A7OH 3DRTA 2VDMH 1ZLWK 43CAA 4GRWE 4PG2A 1K9TA 1FL5A 4UNTA 4BH7A 3OF6D 5J56B 4I3RH 2QADC 1MRCH 1YEJH 5AG9A 3ESUF 4XXDA 2CDGB 1WVZA 1NFIB 5D72H 3MV7A 4LAQH 3LEYH 4FMFA 3H9HB 4FQJL 5HBBA 3QAZB 2P8MA 4WI3A 1GCFA 3U30C 4NCC2 4XX1E 2B1AL 3X11A 3GHBL 1MJJA 4RGOL 4Z7OE 3BQUC 4P99A 3KPRD 5ICZA 3IDMA 1FNFA 1MVUA 2YWYA 2I9TB 3EYSH 3UTSE 2QQNL 3LEVL 4JM2F 4HK3N 2KPNA 4IIQA 1T5WB 3WS3A 1KBGH 5HVWA 2AEWA 5IQ7H 1UH2A 4F58L 4TSBH 1UXSB 1HN1A 5DRNA 5F7DA 4DAGH 4PJAE 1U93B 2GJ6A 3IXAB 5IKCA 4LNRB 5LVEA 4AEIL 3IDXH 4L4VE 5DRWA 4M03A 4OCYH 4BSJA 3CH1B 5DO2C 4XBPB 3KXFA 3SPVB 4XPBH 2RQ8A 2EH8L 2H41A 1NC4B 1ONQB 2XNAB 5KOVC 4HIIA 1F42A 1JI1A 3TVMB 4QNPE 1B6UA 1ZS8A 4GMTL 1X9QA 1IVLA 2R2CA 5D7IF 2PCPB 5F70A 4GH7B 2VLJB 3HE7A 3OKMB 1G1YA 2AQ1A 3MUJA 3GJFB 4UTBL 1QVOB 2H32B 4MNQB 4LQ1A 3NMEA 5EG6C 3IS0X 1I1AB 3BSZH 3QEHB 3ARDA 1QBLH 1HINL 3KPSA 4HUWA 4OF0A 4OLZH 4U4BA 4U7SA 1KJ3H 5DQJA 2QADD 2XQBL 2EKSA 1IGTB 2P8LB 3EZJB 1EGJH 2FIKB 2YBRB 3FAXA 1CT8A 1L6ZA 3OWEA 1A6WL 4JGJA 1KEMH 4Z0BL 2MNUA 5KSBA 4JKPL 1HCFX 3T3PE 5EZIH 4FP8L 2X44D 1CGTA 5I18H 4PJDF 3BQUD 5EIIA 4GW1A 1H15B 3BAEH 4FZEH 3QQ4B 4PJBE 4OZGF 4OD3H 2DN7A 5J7CC 1E4KA 1J18A 4NPYB 5TPWL 1CXIA 5JOFB 4I4WB 4KRMB 5IW3A 3ZYOA 2FX7L 1XGYH 3VXRB 3S5LA 3IDJB 1YNKL 4OV5B 1MY7A 3NIFF 2R2EB 5LWYL 1I8MA 3DYMA 4X6BA 3V0AC 2OSLA 3FZUC 1NKRA 4YXLL 1UCTA 2UY6A 1EBAA 2DQDL 4C56A 1DFBH 1FCGA 5JR1L 4H25B 5DO2D 4L8BA 4R26L 1LDPH 4MB5A 3EAKA 2EYRB 4GJTB 4UNVA 3BO8A 3PF2A 4P46B 4NZRH 4WFGD 4IRSC 4QHUB 3NIGF 1U41A 1HIMH 4X8JA 1U95A 2GKIA 1A3RH 5B39G 4CBPA 5EC2A 5A40E 2Y7QB 3TCXA 1PEWA 2CRYA 3ES6B 4MD5A 3CMGA 4GS7B 4PPTA 4Y89A 4ZFOA 3B43A 2W91A 2ZPKH 3FB7B 2AK4B 1RIVH 5E5MB 1OD9A 2J7LA 3L5HA 5BS0A 3M8OH 2VWEC 4X6CF 1U3JA 3TZVC 4RGMB 5MERB 1NANH 2GSIA 4LEOA 2RR3A 2OL3L 2R23A 2NY4B 3KPLB 1SYVB 2FO4A 2XTJE 4PTUB 1INEL 1U0QA 4GG8A 4PGEB 3UYPA 1KB5H 1DDHA 2NY6B 1CD0A 1FGVH 2BK8A 3MRFB 4QRPB 3UAJC 1BPVA 4HUXB 4CN6A 1ZA6A 3LMJL 5FYLH 4F37K 1SJEB 1HK6A 3FZUD 4HPOH 4LKXB 1U8MA 4GG6E 2R0LH 4G3YL 4ZDHA 4PV8A 3HUJF 3QG6A 4HF5H 4X6EB 2OP4H 4G7YH 5GRJH 1UQSB 5L88H 3S3JA 2HTKC 2X1OA 2OTPA 3UC0L 3W2DL 4M4PA 4IRSD 5BRZD 2A9NL 1ZLWH 4KV5E 1HDMA 4WVRA 1DVFD 4MHHG 3MLYH 4OJFL 1F5WA 3SDCC 2HRLA 1G84A 2FHBA 2DQJH 1QFWI 3HMWL 4LSTH 1IJ9A 1BAFL 4JANB 4ZFGL 1T04B 5BJTB 4DGVL 5KSUB 3MJGX 4LHJB 3GMOB 5IVNA 3IDIA 5AWNL 2VL5A 1KPVB 1SEQH 5IVZB 1FGNL 1G6RH 1MLCA 1I85C 5ADPH 1PD6A 1TENA 3Q6FA 2P24B 5DHVH 3CLEL 1XGRB 4FQIL 4U1SB 1BVKA 1N26A 3TZVD 1J1PL 4XC1H 4E0RB 1JF5A 3FKUS 3D9AH 1I9RL 5L8KB 2QEJA 4NQXB 4HKJA 4ZMAT 3I6GB 3UJTL 4R2GB 2QQQA 4RX4A 4CVXB 3PWLA 3GO1H 3CUPB 1CFTA 3RRQA 4CVZB 4XMLH 2G9HA 4Y8AA 5BV7H 4FQ1L 5HHNB 3K8MA 4BK5A 1ND0B 4I9WD 4ZPVA 5IVXB 3LD8B 2YUVA 3TESA 3UAJD 1B0RA 1DQDH 4HZAA 1KLGA 1U8KA 4W81A 3B2VH 3CLFH 4HT1H 5LXGH 2FDBP 4Q6IA 5HDLA 1MI5B 3OPZH 4X5LA 2Q8BH 4NSKA 5KN5B 5GGQL 1T22A 4KTEL 5BOZG 2UZIL 4XWGH 1NCCL 3WLBA 4K8RC 2HTKD 1NDMB 2ERJC 3F7PC 4MQTB 4XPTH 4DKFH 1SVZA 3P30H 5F6HI 4HDIA 2AEPH 5I2IB 3WFCH 3VFNB 5HYEA 3A0OA 4NYLA 3SBWA 3SDCD 3MR9A 3AC0A 4K3DL 1F3RB 4F7PA 4U1NA 2BX5A 5AD0B 2ZCLL 4YR6B 4HKBB 3QPXL 2H2PC 3V5KB 1FIGH 1FPTL 4XP5H 5GS1B 5IWLC 4M7KL 1WBYB 3SGEI 4FXGA 5LGHL 3OKEA 4JPIA 2J8UF 5BOPA 1L0YA 1TJHH 2NXYB 1AGFA 5F6IC 3PQYE 4LHUG 3AMKA 1JHKH 2AJYH 5E2VL 3PDOB 5IFHH 2RCSL 1ADQA 1LEKB 2DI9A 1OAUL 1PX3A 3AB0C 5GGSB 4CW1A 2CJUL 2NY1C 3ZSSA 1EJOL 1NEZA 2FYYA 3PWVA 4WY7L 2XN9E 4G9DB 2Y25A 1EERB 3QA3A 2JJTC 1KCRH 3MLZL 5I75C 5AYUL 3MRIB 5FGSA 3WIHL 1YPZF 5C3LD 3BP6B 35C8H 4ELME 4MSWA 4D0DB 1S5IL 5EH1A 5HHVH 1AXSB 1D5IH 2HJKA 2C3WA 4RRPG 2BNQA 1R5VB 2VN7A 4KQ3L 5T5NF 3PHQA 1QQDB 4XBGA 3TLRA 3SJVB 4K8RD 4UZGA 4HWEH 3BPNB 3MBEB 1OAKL 2VJXA 5D5MA 2WV3A 4IOFC 3L9RB 3F7YB 4G8FA 4NCC1 4DEPC 1G7LA 5EPMB 1HYRC 1UM5H 4NQEB 4LLQA 5GRUL 1GC1L 2EEBA 1EK3A 1S7VB 5F88B 3SKNB 4ODTL 3GIVA 1XFPA 5I15L 4LARH 4MNHA 2CGRH 3SEPA 2AQ2A 3D0VA 3TT1L 2H2PD 1G7QA 3RTQB 4J2XA 2RIKA 5KG9B 4BQCA 3N85L 5DVKA 1YZZA 2NXZC 2PTUA 5HHPA 3IU4H 3L6FB 1DBAL 1G6RA 4DGYH 3VGDA 2Y4SA 4U31A 3JV4A 4NKMA 5IB2B 1MRDL 1KIRB 2GITA 4KUCF 5GGRY 1UWEH 4ODUB 5GZNC 5IESL 3MUHL 3WL9A 2VZ1A 1ZHLA 3BVNB 1WWCA 1CDHA 5DXWA 3GSQA 4XCYB 4NJAL 4N8CH 4JHBA 3RKDC 2NY1D 4D9RD 1A6ZB 4DVBB 5ETUB 3DIFB 4CGTA 4HBCL 3CU1A 2O61A 4QHNB 2BNRB 4XNUL 1W0WA 3P0VH 5IBUG 4N8VG 1ZXQA 4UT9H 3FN0H 3S3PA 3K7UA 3CSBA 3HG1E 5TE6L 5HYSB 1GAFL 2CIIA 2WINA 5JW3H 1H3VA 2B8OT 2YEZB 4J4PC 3QWRD 5B38G 4UIKL 2YRZA 3VFGH 5IMKB 1YQVH 4X99A 5IF0B 2ZOKA 3R1GL 4LGRB 3QNYA 3KLHC 5J9PB 4IOFD 4B7LA 1MJ8L 2MPAL 4ODHH 3E3QC 5KANG 5I0ZA 1WBZB 2OXHA 4EJ1C 3K4AA 4ONFL 3STBA 4U1LB 3V95A 3QUKB 4I77H 2IPTL 2QSCL 1ORQB 4HK3J 3QAZC 2EDDA 2DIJA 2LFGA 5EULV 5CD3A 1IEHA 2YD2A 4M43L 2BERA 3LH2H 4MYWB 1JYXA 2NXZD 3ZT7A 5MENB 5EO0A 4PJCE 3CX5J 4ONGL 4ZQKB 3KYOA 1XCTA 1JHTA 1J8HD 1MCPL 1KCSH 5GZND 4IMKC 4R8WH 3WHXB 1FVDA 4N1CA 3GI8L 1TMCB 4DWHA 3WCYA 4OM1H 3RX8A 1T3FB 4D9QD 3QZWG 3ZDZF 4N0YL 3ARPA 4KQ4H 3NFSL 3DXAA 3CPLB 3DURA 5FHAL 3JTTB 3LKPB 1CTNA 1BLNB 43C9B 1MJUL 1KULA 3I6LE 1O7VA 5E8NA 2CDEA 4Z8FL 4YXHH 3LQZB 1OL0A 1K3ZA 4Z7VA 3BWAB 3TVMC 4OGYH 1QSFA 5E00A 2H3NB 2DM3A 4AMKL 3O41A 4J4PD 1HQ4B 1CU4H 1X44A 2PETA 1WCQA 3DRTB 43CAB 2BVPA 4H0GA 5FM5O 4K7PY 4JVWA 1D5MA 1RZFH 3UEZA 3O6LL 3KLHD 3TBWA 2EIDA 1I1AC 2DBLH 3B9DA 3LRSB 4YK4B 2CKBL 4MZ3A 4UQ2A 3MRQB 4EQ3A 2E6QA 1TDQA 1VPOH 4JFEE 3MV9E 3MV7B 3V7AE 2P8MB 3U9UB 2VRAA 5DTFB 3TBVA 1I8KB 1DQTA 1CLYL 3LRHA 3MLRL 3MCKA 5EUOF 5IJKA 3AFLA 1P7QA 3GRWL 3PJSA 1XIWB 2A6DA 4DGIH 3IDMB 5E08L 1MVUB 1FRGL 5GJSH 1J8KA 3S9DB 1Q9OA 1S7XB 4IIQB 3RX7A 4G9FE 1RUAH 2ADGA 1OGAE 3HFML 4RSVA 3RL1A 5DRNB 5F7DB 3BGAA 2IANB 3D3VE 5IKCB 5DRWB 2VSDA 3U6RB 1JIBA 1Q1JL 5L6YH 3NPSB 1B3JA 3LVEA 4M8QB 5DUML 1NC4D 1F3JA 4P46C 2F54A 3OX8A 1Z3GH 1YECH 4OCSL 4GXUN 3TVMD 3FN3A 1X7QB 5SX4H 3PV6A 1SY6A 1BF8A 3WJJA 2NW3A 1F97A 3L5JA 3HE7B 4M6OL 2VLJD 5KAQF 4XP1L 4DQOL 3MYJA 3AMLA 4ZNEA 3O4LA 4UBDC 1FVCA 3S4SA 4GS7C 2QLVB 1I1AD 3ARDB 4HUWB 3VXNA 2AJ3B 2EKSB 1LWRA 2R1WA 4J1UA 3WMSA 4ZO8A 5JUEH 4JO2H 4QLRA 4XB7A 1CT8B 4F9LA 1JWSA 4XBEL 2YUXA 5KBNC 1PBYA 4M6NH 4PS4H 4MA1B 1HHJA 4WTXA 5KSBB 1YY8A 2AQ3A 1RJLA 1HQRB 4RGMC 3FQRA 5J6GB 2QHRL 2BFVL 5E2UL 1G7MB 1HH9B 1QFUH 5EIIB 1QZ1A 4GW1B 2LV4A 4NQCB 2ICEA 3O6KL 3QQ9D 2NY4C 3LPWA 4XVTH 2NY6C 4JZOA 4KVNH 3ZE2F 3VXRD 1LO2L 2VLME 1RUML 3OXRA 1GGUA 4P2OA 4S1QH 4HAFA 3IVKB 1X5FA 2VDKH 4C56B 1FBIL 3VFRA 5C0AB 3U4AA 3LOWA 3TWCH 3VJ6B 5CWSA 3VXMA 4L8BB 4A6YL 4YHKH 2AXFB 5SX5H 4OTXL 2VXSL 3LKRA 4P46D 2GY5A 5F7FA 1JGUL 5F97E 1TJIH 4X8JB 4MJIA 5DJXA 4P59L 5CJOH 1WT5A 2X4UA 2IQAA 3BZEA 5HHME 5F9AC 5EC2B 3TNNA 1OGTB 4HIEA 4YEEA 5C92A 1RIHH 1MCDA 5A3IC 5DLML 2VIRA 4MX7A 2DQIL 1CGXA 5GISL 2IQ9H 2WQ8A 2V2XB 4N0UE 2R29L 2ZSWA 4QRQA 3EYFA 3Q6GL 2AK4D 1MEXL 4ETQA 1MFNA 1OVZA 3ULVC 4FRWA 4BZ2L 5FUZH 5BS0B 3DUHA 4OFPA 4OLWL 5SWZE 2Q8AL 2HJLA 1QUNA 4G6KH 3WXWL 5T3XD 3ISWA 1Q9LB 4R2GC 4LEOB 1Q72L 1GOFA 2R23B 4JVPA 4YGVA 2NY4D 1AHWB 2FO4B 3VFMA 4ZUWB 2DD8H 3QUMA 4YHZH 2DJSA 1DDHB 2JCCE 2RGSA 2NY6D 4Q2ZB 2D03H 3O8XA 3LD8C 4QRPD 1B0GA 4GKZA 1ZA6B 3I2CL 1BIIB 3AS1A 4XX1G 1F58H 5DWUL 1I7RA 3QG6B 4PG9B 5I1HL 4OSUH 4OI9A 2IJ0C 5HI3C 3WNMA 5DRXA 3QJHB 1UCBH 2HFGH 2SEBA 2MFNA 3B3IA 3T08A 1ZV5A 2DYPA 3MLSL 3D85A 2OR7A 4EDXB 4RAHA 2HH0L 5SWSA 2GW5A 5JO5B 1E4XL 4YHPB 4M5YH 3RVTC 5KTEH 3VG0L 1EEYB 4O58L 5CGTA 2FCBA 4Y1AE 1RURL 1BJ1J 4JFZL 5EA0L 1FC1A 2ZKHH 3MJ9H 5E8DL 2VL5B 4OZIB 2V17H 5GS1C 4UDUA 1HCVA 3LN5B 3ULVD 1X6NA 4YBQC 3HR5B 3DMMA 1X4XA 2EH7H 1X5JA 2X4TA 3S96A 2NXYC 3IAGC 2BRQA 3ZKNC 4BFIA 4LCIL 5JDSB 4HKJB 4R2GD 3HI6H 2COQA 4WEBH 4X6FB 1T03L 4P4KB 5HY9B 3HAEG 3V4VH 2G9HB 4KXZI 3RDTB 1Z9LA 4OZHE 2P47B 3K3QA 4MMZC 4ZS6C 4Z18A 1A5FH 4RWYL 2F74A 4ZS7H 3UPAA 4MXQC 1MI5D 3MOBL 1SHMA 4NSKB 2VUYA 2NLJA 4UAOB 1T22B 4K7PH 1AY1H 5HI3D 1FNGB 4S1RL 3BPNC 1E28B 3MBEC 2C3VA 3VRIB 3OKLA 1A7RH 1L4IA 4HDIB 3CVHH 1SVCP 1IAKB 2WBKA 4JFDE 5FM4A 4NYLB 3MRHA 1JNNL 3RVTD 1X3DA 2AEQH 5D7KD 5ANMB 1FJ1B 4F7PB 4U1NB 2FH6A 4PLKD 1AP2A 1GH7A 1VHPA 2FH8A 4PJ7A 3TA3A 1GGCL 2P46B 1BEYH 3CFCL 3CZFA 3VDAA 3BE1H 2GEEA 4DUVA 3RTQC 4J3TA 3D39E 3M17B 3QEQB 4KHTL 1OAQL 1LE9B 4JGUA 1FNEA 2J4WH 1OCWH 4FXGB 4YBQD 2Y36L 4ODWB 4CAGA 5F9OH 1QFPA 5DEFA 3NCCB 5C09A 3F7RA 4HIJA 4ZD3L 3ZKND 1JRHL 4KK9C 4Y5XA 4HHAA 4PRPE 3DX8A 3MLPA 3D5OF 5FK9B 2BHZA 1N6VA 5I76A 2Z93B 1R3KA 4GBXB 3OB0K 4X5WA 4CW1B 3CCHA 3QWOB 2IF7A 5HHXH 5ELIA 3S8WA 1NEZB 4OI7A 3CGTA 3BKYH 1MCEA 5MP6H 2XA8L 5HGDB 1WFOA 2DM4A 3QA3B 3MGAA 2ADJB 4ZS6D 2W65A 4LPXA 1DEDA 1RZKC 5D6DA 1DBKL 4YUEL 4MSWB 5DURB 2XXCB 4MXQD 3FAWA 2BNQB 3SE4A 2DLEA 4X7SL 1T66C 5DA4A 2DDQH 3QHTC 3SJVD 4ZXBA 3RGHA 4BFEA 4FXKB 3MXVH 1YEEH 1QSEB 1A7PH 5D5MB 4S1DC 4OLUL 3KPMA 3MBED 5J6HB 4L4JA 5SV4A 4G8FB 5C6TH 4NO3B 5B39A 2E7HA 1QFHA 4NQED 5ACZA 3IFLL 3C6LB 3HC0B 3EDJA 3GIVB 2HKHH 3KPPB 4Q7DA 5JMOC 1MHPL 2OXGA 5DD6B 3TIEA 1G7PA 1ZT4B 25C8H 2OS7A 3HTLX 5D2NA 1A6VH 3D0VB 1JGVH 2VITA 4QT5B 5AZEH 5AUMB 3RTQD 1DQML 3X3GL 3DV4A 5D4QA 4NQDE 5HHPB 4FQXB 1SEBB 4R6UA 1PG7X 4F15B 1I7ZA 5IQ9A 3ALXA 2XY2A 2IBBA 1MIEL 1QBBA 3IFOA 5D2LE 4KK9D 2WANA 3MA9L 2CD0A 3U1SL 4I3SL 4QHKJ 3C2SA 1UM6L 2C3GA 1RHFA 3MACH 4H20H 5E4EB 3GSOB 3MNVA 4X6DB 5HGAA 3FB5A 4G8GB 4N0CC 4PGDA 2B5IB 2O61B 1HNGA 5EO1B 4RMVA 2BNRD 4CNIA 4LSRH 2VXUL 5CJ5A 1S9KC 3WIFA 1B2WH 3ARWA 2CIIB 2WINB 5CP3A 2UYLA 1ZVSB 3RWFB 1N2RA 4ZUUB 5C0RL 1LO4H 1TVDA 1T66D 5T3ZE 2X89A 4LCWE 4X99B 2VDRL 5KS9A 2ZOKB 1JP5A 3DSFH 5FGCE 3DROB 3QBTB 5GS2D 3QNYB 4S1DD 1MFBH 1JYWA 1FNSL 3QFDB 3UP1A 4ZOEA 1MOEA 4RMUA 1MCKA 4JG0H 4YK4C 3HNTL 3GMNB 3TPUB 5TH2A 2LE9A 1MRFL 5DD5H 4QTIH 4LDLB 5IB5A 3CVHA 1LO0H 4GO6B 4D2NA 4LCCA 4OZFG 3B9VA 5ENWA 3PP4H 3P11L 2FLRT 2DQCH 4P5MA 2BOBA 2IC2A 2WBWB 1BBJA 3FHQA 3U4EA 4CU8A 3RNQA 3P0GB 2QV2A 1NSNH 5DJ8A 2XACC 2VQ1B 4I0CC 1XIWC 4NO0A 5MEND 1NAKH 5C0IB 5IUSA 3KYOB 4QHLB 3HNSH 4IIQC 4MXWL 2EZ0C 3VW3L 1MJ7L 1IAIL 4TQEH 3RY6A 1J88A 1MCWW 5HVGB 1JPST 1B88A 1GPOL 2FD6L 3G6DH 4JM2B 3BD5A 5CP7A 5C7XL 5CBAA 1NUDA 4U1IB 1LK3H 5TE7H 3DXAB 4FS0A 1OAZH 5KW9L 3FQUB 4N0CD 5I1GH 2X70A 3NPSC 2H6PA 5DD1L 1NBVH 1UA6L 1E6OH 5E5UB 3L3IA 3MREB 4Z7VB 4I2XA 2C9AA 4WO4A 3UTZB 5E00B 2R56H 1FIEA 4OLVH 3BD3A 3HE7C 4PJAF 5FKPA 4FG6C 2AJXH 2JELL 1DBJH 3TO2B 2DM2A 3ARDC 4OI8A 1L7IH 1CVSC 2V5YA 3EKCA 1GGTA 3BKMH 4GQ9H 2LAGB 5GIRA 3KG5A 2F19H 4QNPF 3MV7D 3EO0B 4MA3A 4MA1C 4PY7B 4JKLA 3OXSB 1MH5A 1FFNA 1PQZA 1HSAA 2Y06H 3QHZH 3MCKB 4YDIL 5HYIA 3SDXE 1AO7A 2A6DB 1A6TB 1NBZA 1XIWD 1T7VA 1LD9A 4R7DA 2AABL 1Q9OB 4LHUA 3TH4T 4OCXL 4N8PA 3IFPB 1IILE 3OB0H 5TDNB 2EZ0D 5I1IH 1WEJH 2W9DL 3LZFH 1N8ZA 3RL1B 4OZGB 5MEPA 4P2QE 2A9MH 2PXYB 2IAND 3FMGL 1ZEAL 3T3PF 1B90A 4LU5L 1BZ9A 4WUKH 4G6FB 3VCLB 3BRDA 4PJBF 1XGQA 1JI2A 1R6VA 3BW9B 4N1EA 1T2QH 2X41A 4RA0C 1T0MA 1JWMB 1NLBH 1LQSR 4L3CB 4RRPA 4YQXH 2J6EL 5ISZA 1LK2B 2NW3B 2DKSA 1QBML 3HE7D 4JRWA 4TRPL 3SGDI 4FG6D 4MAYB 3O4LB 4JQXA 2P8PA 4ZSOE 2BY3A 1JGLL 1FVCB 3ZL4H 5DR5H 5IFAH 1BHGA 3ARDD 3NN8A 4HWBL 3OV6A 1HYSD 1NFKA 3FQTA 3S6CA 1LO5B 4XZUB 3KJ6L 1ZLVK 4C4KO 3G6JA 1K8DA 5IG7A 4RNRA 1WV7T 2BSRB 2EDBA 1T89A 1KFAH 2NTSP 3IJHB 1MFEL 1NGYA 4YIQB 1YY8B 3Q5YA 5CEZL 3FFDA 4Y4KB 4XAKE 3FQRB 1BBDH 4OBSA 5T1MA 5DHYA 5J3HC 3KHOA 1T7XA 1KNOA 4ZAKB 2ICEB 2QR0B 4M1DH 1IGIH 4NQCD 4XNYH 5C2BH 3BP5A 2NX5A 5EWIH 4NT6A 1AHWC 4BQ8A 2ZUXA 2OQJA 4S1SL 4JZOB 5FYKE 3VU2A 1XZ0B 1WWAX 2FEEI 1H5BB 1R3HA 2GFBA 5C86A 4XP9L 4G5ZL 2HYMA 5IW6A 1GZQB 1F11A 2ITCA 1XAUA 4C56D 3MLVL 1FZMB 2YA0A 5C0AD 3I75A 3MA7A 5CWSB 3RWHB 2V7NB 3GBNL 4N8VA 3WJLA 5KVFH 1BMGA 1SBBA 3P9LA 2FL5A 5T3ZH 3PDDA 1XGPA 1MCWM 1RAMA 4DKEL 5B38A 3F12B 2X4UB 4UOW1 4I0PA 3BZEB 1U3ZA 1BREA 3K2UH 4LRNH 1S7RA 5CZXD 3ZHDA 4DN3L 1QFWL 5JOPE 3D1MC 3TNNB 4F37F 4XCNB 4HIEB 3UJJL 1ZLSL 2J88H 4YDVB 4DN4H 5EO9A 4GG6F 4MX7B 2C1OB 3RY5A 1OAXH 2VLKB 2VO5A 2ZCKL 3EYFB 3FRUB 2APTA 1JNHB 2CUHA 1EO7A 1G0XA 2YD8A 1QRKA 1BP3B 1XGTB 4OF7A 5HVFB 4ODVL 5D7LA 4KV5F 5BS0D 4NO2A 3VXSB 3K2MC 1QYGH 2EDTA 1Q9KA 2PW2B 3L3OA 4F33B 3NPZB 1AGBB 4BH8A 1QRNA 5J3HD 1AGEA 4JQIL 5I8EA 2QQLL 1QEWB 2MWCA 3G5YB 4P4KC 1WZMA 4YGVB 3VFMB 3RDTC 3TEUA 1QNZL 1NGPL 2EDLA 3T3ME 5C9KA 2YC1B 4L3EE 5F9DC 3QZWA 5GHWL 4GKZB 4Y8DC 1AD9A 4Q9CA 5ESQA 5TF1L 1SYSA 4NRZB 4WUUA 4JFHD 4WIQA 3SDAA 4BUHA 1XR9A 3LCYA 4HJ0C 1OP3K 4MVBC 4UAOC 2P5EE 2E9WA 2F5BL 1NMBH 4JPWL 1I1CA 3B3IB 2DYPB 5A2IH 1J10A 5E6IA 4RGOH 3U4BL 3UO1H 1KC5L 5E2WH 2A0LD 1V5JA 1F4XL 5SWSB 2FJGA 5F7WC 3SBWC 5C08A 5TDPA 4YPJA 4KRNA 3L3DA 4WHDA 3MV11 2O5XL 1VGEL 3JV6A 4XGZA 3F58H 1U6AH 5K9QI 5D93B 5E9DB 4IOSD 5FGBA 3VFPA 1V8HA 3DMMB 4GXUM 2X4NB 4TUOA 5I19H 3D2UB 1J0HA 3LPGA 1U8JA 2ZUQB 4DOHB 4NKOB 3BEWA 3QUXA 2CPCA 3D48R 4BFIB 2GT9A 5C0JA 2DQGH 3A6CL 3PNWA 4GBXC 3LHPL 5EZOL 4N5EC 1FO0A 2XG5A 3RDTD 4EN3B 2AV1B 7FABH 5BW7A 1CR9L 1HZHL 2MKWA 1FNLA 3BP7B 4KZEL 4ZPTB 1IM9A 1ZGLM 2IFFL 5CZVL 1HINH 2ESVB 1MLBB 4PJFE 2I5YL 2YD1A 1KTDA 3QNZB 5GGVY 2LU7A 1CE6B 1A6WH 2NLJB 4HJ0D 4MHHI 4MVBD 4AG4H 4Y0GA 3ROLA 1YPZB 3UBXI 2R1XB 3TJHD 3IKCA 4UDTA 5C6WH 1U3HB 1G7IB 4Y16B 4WV1B 1NAMB 3NAAL 1KIQB 4FABL 1MREL 2ZUWA 1A9BB 1DEEA 3DX9A 3X17A 3C6LC 3RVVC 5JPMB 5KSVB 1NGWA 4FNLL 4ELMF 1MWAB 3E2HB 4OQTA 3TA3B 4PJ7B 1TZIA 1ZLVH 1A1NA 3CZFB 1IT9H 1JPFA 1N59A 3S3SA 1ACZA 4IDJL 4JJ5B 4X5XA 1G9ML 1INDH 4FQXC 2VZSA 4H8WH 3T0EE 4G6JL 3L7FA 4F15C 3WHE1 5DEFB 1DE4B 5C09B 5IFJB 3DWTA 4JO1H 3TCLA 3U7WL 4JRXA 4HHAB 1B4RA 5DI8B 5FYKH 5I76B 4GBXD 3HLAB 5E4EC 4X5WB 4N5ED 4Q9RH 1BD2E 1GGIH 4UU9B 1RZJL 2B5IC 5EU5A 1N5YH 2L7UA 5CLWA 3RL2A 4WHCA 1Y0LA 4X4XA 2PW1A 1H9VA 1CZ8H 1FVEB 5KJRL 1DUZB 5DURD 3O3AA 4L9LA 1EFXB 1MCOL 3A6BL 2BNQD 1OM3H 1HH6A 5F9JB 4ZXBB 2Y5TB 5F71A 4POZC 4DZBA 1QSED 1RMFL 3O2DL 4TVPH 3HE6A 5D7JA 2ZCHL 3T0AA 4NHCH 3DGGA 3GI9L 2R4RL 4PB9H 3V6OE 3QDJB 1INEH 2AK1L 5KZCB 3CVIH 3C6LD 3RVVD 1A1OB 3GSVA 4PUBH 3L5IA 1EZVY 4UUJB 5F89A 1FORH 4EDWL 4O2CA 4EVNB 3F6LA 4EIGB 4X0KA 3TIEB 5L2KA 3T2QA 3MRMA 5CIPB 1H3PH 3MC0A 4U1HA 5D2NB 2VITB 2OYPA 3LMJH 1HWGB 1QLEL 3QRFM 5AAWA 5JHLL 2FSEA 3DV4B 3VI3F 4R4FL 1LEGA 4ZYKA 4G6ML 4P2YA 3EGSA 3B9AA 3I3DA 4PJIE 2VR5A 3IFOB 4X9IA 2RJMA 2R2HA 3RI5K 1XF5A 1HWHB 5EOTA 1KLFA 4JM2C 1INQB 1L0XA 1BM3L 4WHTA 3MNVB 5HGAB 5TQ2H 3VFUB 2BCKB 3WSQL 4G8GD 3GIZH 4OIBA 1LILA 1ZTXL 4XPAL 5CCKL 4CNIB 1JZ6A 4PJCF 3GNMH 1OP3H 4E41A 4W6XB 2DB8A 3H6JA 3QFJB 4PB0L 4PJ5E 4XVJL 2P5WB 1U91B 5TQ0H 2UYLB 2E7LC 5E6YA 5MHSD 5I8KL 4U6VH 5KS9B 1FNHA 3MLTB 5HHOE 4POZD 3QDME 2FBJL 4OCWL 4Z7UA 1J0JA 2J12B 2Q3AA 3ROOB 3UBXB 4NRYA 3BMVA 3MRLA 5TH2B 3N0PB 2VLRE 2PF6A 3GUTB 2A38A 3L3KB 1AD0A 5IB5B 4TUKL 1VFOA 1KGCE 2JB6B 4W6WB 4WHYG 1OTUC 1C12B 1W72H 3OG4B 2BOBB 4GSDL 1BBJB 2ZJSL 3U0PA 3U4EB 2J5LB 4Z5RA 4LLMA 4KUZL 2OTWB 3HZYB 5IJKC 1D5XA 4JB9H 3JTSA 2ZWLT 2O5YH 1YN7A 4NO0B 3WD5H 5GGQH 4QF1A 3OQ3B 1MSPA 5BO1H 1HILA 2HLAA 1S7TA 5EUOB 2XWTB 1X5XA 3TYGL 3HC4H 4RGNB 1CK0H 4WFEE 4HUNB 2NR6C 2VDQH 4M1GL 3HAEA 2W92A 5CBAB 1FYTB 4JM2D 2PXYC 3FONB 4JHAH 1AI1L 1DTUA 3DXAD 4KTDL 3SKOB 1OAYL 2VWEE 4XP6L 3GEWB