5FDYA

Crystal structure of the voltage-gated sodium channel beta 2 subunit extracellular domain, c72a/c75a mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
SNAMEVTVPATLNVLNGSDARLPCTFNSAYTVNHKQFSLNWTYQEANNASEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sodium channel subunit beta-2
publication title Binary architecture of the Nav1.2-beta 2 signaling complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 29
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fdyA00
3ESUF 5DJ8A 4N8VB 2A2QT 2FGWL 4HXBL 2XY2A 4LLDA 3GBMH 3C2SA 1F42A 3P9WB 4LEOB 4NO0B 5B38G 2Q86B 3SDDC 1PX4A 3FAWA 2AEIT 3NACH 4Y2DA 3A6BL 3TO4B 2E8YA 4PGEB 2VL4A 1PX3A 3DMMC 5I8KL 43CAB 4CJ1A 3PWUA 3FQXB 3DX7B 5DO2C 5HHVL 4HPYL 5JUEH 1UXSA 1YNKH 4UDUA 1DN2A 4HKBB 1TCRB 1NEZG 3OSKA 3EHBC 1LO3L 35C8H 3R06A 4OCXL 3D5OF 3QULA 2ZSWB 2PR4H 5E4EC 4N1EA 4PJIF 2W0PA 3QUZD 1YJDL 4M3KB 3MJ7B 3PWPB 4HMEA 2DQJH 2WUCL 4XNYH 5JZ7D 1T5WB 5TDPB 5D93C 2XQYK 4TPRH 1DFBL 5AZEL 2M1KA 1OGAD 4GSDH 3DRQA 5DI8B 5GGTL 4X6BB 1RK1B 2H2PD 1L9MA 1TTFA 3P0VL 4H1LA 2ZKHL 5FGBA 5EBLA 4NQSA 3QQ3A 4OQTH 3K81A 3C6SA 1G1YA 2AEQH 3OXRA 5EBWA 3RWFA 4MMZC 4RQQB 5FIEA 1CXEA 3GUTA 3UC0L 1DVFB 1RIUL 3KPSD 2DYPA 4NO2A 1OL0A 4GLRH 4KGLA 5ALBL 5TF0A 3BP5A 4OZHA 1XH3B 2XN9A 2VDOL 15C8L 3TYFB 3LQAC 2PYEA 2QQLH 5D7IB 2XACC 1AHWB 3LKNA 3V4PL 4F33B 2CH8A 1E6JL 1OPGL 2R15A 5HVFB 4CN4A 2J2ZA 3UBXA 5HGBA 5ICYA 3A67H 3ARBA 3MGOA 5I9QB 1UB5B 2YA1A 3GB7A 5ECJE 4OAWB 3AS3A 3GHEL 5JOPD 3FOMB 2EEBA 5EUOF 1EEUA 5BVJB 3LN9A 3CDGA 4CN1A 3IAGC 4J3SA 4Y19D 5I76A 2LQRA 1LO4L 1MLBA 2ZNXA 4RMWA 2H26A 3NIFE 5MEND 4O2EA 5I1IH 3HMXA 4D9QE 4YUEL 3KPQA 5D7LA 1PG7X 2NTFB 4H20H 5ENWB 4JO2H 4XGZB 4OF6A 1KTRL 2P45B 1ONQA 4J12A 1UC6A 4OZIA 2C26A 2DTMH 3CSPA 5DHVH 2FSEB 2EKJA 4KZDL 4QNPF 4KROB 1FGVH 3SE3A 5JIIA 3FQNA 4K94C 3R8QA 1AXSB 1E4KC 4P99A 1SEQH 1FYHB 4YBHA 3DLQR 1T03L 2E5EA 5GRVK 2JB5L 4GKZA 2R4SL 4QWWD 1URLA 1IQDA 4G9DB 5CJOL 5EBLB 4NQSB 4NP4L 5FK9B 5EBWB 4Z76A 3RWFB 3BVNA 3DETC 2XTJD 1ZA6B 2B39A 4KJPC 3WLBB 1VGEL 1MCHA 3OF6D 4UILH 3VFOB 1GGBH 5JW5A 1MQKL 4Y5XB 1SEBA 3VW3H 4UQ2A 4U1LA 4YBQC 3P0GB 4QHUA 2XZAH 3PP4H 4DTGH 2V2XB 4W70A 5I66A 2DYPB 3OBAA 4NO2B 8CGTA 4JFOB 1I7ZA 2ERJB 1XIWA 3BP5B 5AWNH 3NZHL 2XN9B 1ULVA 4NKOB 4AG4H 3LRHA 4M1CC 3O3DB 4X98B 4I3RL 4NNPH 2C3WA 4I3GA 3M8OL 4OGAD 4MS8C 5EB9A 1YEIL 2D3VA 1UG9A 4ONGH 4OZHE 3O2VL 4ZOCA 2R2HA 3UBXB 2XN9E 1SJXA 1LD9A 5ICYB 2DQDL 4WO4B 2IMMA 1UVQB 3GB7B 5SWSB 1MF2H 4X4YA 2PYEE 4OSUL 1PJ9A 4G42B 3O41A 3I6GB 3CDGB 4O00A 2OI9B 3GSOB 1PG7L 5BXFA 5I76B 3BXNA 3LQAL 3QDMD 2GTWA 4O2EB 2HLFD 3MJ9A 4PJGA 3VH8A 3LIZL 4O5LH 4HWZA 4JPIA 2BOBA 3U7YL 4HG4J 5K59F 4MGXA 1ZLSH 1F8TL 1AGBA 1AHWC 5TH2B 5L8JB 3GZKA 4GS7B 4TTDC 5D7LE 5HDOA 2Q7YA 3RL1B 1NH6A 5TQ0L 1JZ3A 4KVCH 3RWCB 3AAZA 1MUJA 5F7WC 5DJAA 4OZIE 2VXSL 3I9GL 1P5VA 4WEBH 3WJJA 4XMLH 4GKZB 4HWBH 5SX4I 1IQDB 2NZ9D 1JN6A 1I8IB 4PIRF 1J9CT 3HUJA 4Z76B 3VD7A 3BVNB 5KVGH 3V5DB 3VFGH 3W9DB 5ADPH 3IFPA 1S9WA 3OKNA 3I75B 3MCLL 4F7TB 3WL9A 1T2JA 3RWHA 5JW5B 1L7IL 4KRPD 3IDYC 3QYCA 5F9AC 1SEBB 3LKOA 4U1LB 2FJFA 4QHUB 1BWWA 2HMID 4K94L 4G7YH 5B38A 4HK0B 1KENL 3NA9H 1T0NA 2DQCH 3EYQD 4OD3H 2Z31D 3MXVH 3P77A 3WSQL 3S37L 1KCUL 2NY1D 3D18A 4KROC 1YQVH 4XCCH 2FR4A 3U1SL 3L3GB 3D48R 5HYQA 4KDVA 4YNYA 5E1HB 4N5EC 1FIEA 2R2HB 4E42A 3PF2A 1LD9B 3UJJH 4JR9L 4H25B 1PZ5B 1CFTB 5FGBC 4NDMB 2MCG1 4X4YB 5ETUA 3E1F1 2IAMA 2HFGL 3T77B 1G9MC 2BVPA 1EJOL 3HI1A 4LSVH 3G08A 4IOSD 4YX2L 2N7AA 3IU4H 3TNNA 3PHQB 4HGMA 4S1RH 5BXFB 5D7JD 5KJRL 4A6YA 3JV0A 1ZT7A 4NJ9H 3C08L 4JN1H 4UIKL 3EFDH 2A6IB 4L8BB 5FA4A 3QEHA 2ERJC 3O0RH 4W6YB 3V4VL 4PJGB 4E41A 3CFKB 5JR1H 1NC4A 1MCPL 1FG2A 5I1HH 5IMKB 2YPVH 3TZVB 2D9CA 3ZKXB 2V2TA 3RHWF 1AGBB 2CMRH 4HG4K 4RIRB 4PJGE 2Q7YB 2AV1A 5HD8C 2D7QA 1IILE 2ZOLA 4OLYH 2JCCA 1FFNB 1RUML 5DRNA 5FYKL 1CZ8L 1V7ML 3TVMB 4Z78A 1MUJB 5DJAB 1II4E 2EZ0C 3D69B 3DX8B 1QFUL 4LKCA 4DVRH 2DBLH 2OI9C 1S9XA 3VE0A 3P9LB 3CXDH 4NCC2 4YC2C 2V5TA 4Z8FH 1X44A 1CT8B 4P23A 4GBXA 5C0CA 1OAQH 3MLRH 2D03L 3IFPB 1S9WB 3OKNB 3WFCH 3D9AH 5DD3H 2VJXA 3I6LE 3RWHB 3PWJB 2NQCA 1P6FA 3OJMB 3ARUA 2I9TA 3HUJE 2I60L 5EU6A 3JWOC 5B38B 3I6KA 4GMSL 4N8PA 4P48A 1T0NB 4G43B 2HT3C 4BFEA 4X9FA 2ZNWA 3MV9D 4JDVB 1TXKA 1XGQB 5TPWL 3TBSA 3SE3C 2QKIB 3O2WL 3QJFA 4GLRI 2E27H 3S35X 3FCTA 4JQVA 2XFXA 4QLRA 2WINA 4ZQKA 5HSFA 5HYQB 1PQZB 4GW5A 1A3LH 3WKML 4E42B 4WU5B 3TA3A 4AEFA 1NEZB 1NFDA 1LO2L 1W72A 1JYNA 2OR7A 2AXFA 2CRMA 3FFCD 1JPST 4I0PD 1NGZA 5FHBL 3HI1B 4M62L 3MLPA 3ZDYF 3TNNB 4W6XB 4YHKL 1EFXB 1Q9KA 2Q1EA 5SWQB 1ZT7B 3VDAA 4YIQB 5KSBB 4D9RE 3GMOB 4WDIA 5FA4B 2EDQA 5BV7C 1E28B 1XIWC 3FZUD 2JELH 1EK3A 4X9HA 1NC4B 4JY5L 4JFDA 1YZZA 1ZHBA 5IGXL 4J3VA 4QXWA 1NCNA 1S3KH 1YEJH 4S10A 4ZPVB 1SHMA 2HRPH 2OBGA 1IARB 2RR3A 3PQYB 2D7PA 3WCYA 1V7NH 1P4BL 4GXVH 3VA6A 3EOTL 4NFDA 4AQOA 4E41E 3OB0K 1QP1A 1VGKB 4WFFE 5EH1A 2AV1B 4KHXL 1TVDA 4I77L 2JCCB 4JZJA 1EAPA 5DRNB 3VI3F 1R3HA 1AQDB 4PGDB 3MJ6A 4YHNA 3VE0B 2OZ4H 1Q38A 5FA3A 5C0RL 1MCKA 1YN7A 1S9VA 2XZZA 2AXJA 2EDWA 3HC4L 4X83A 5H37G 4P23B 2JCCE 5C0CB 5IOPB 3C8DA 1KEML 4TVPH 4L3CA 1RMFH 4J4PD 4HC1A 4LPXA 3VFWA 1NL0H 1VCAA 3CU1A 1EO8L 2AQ1A 1HN1A 1F97A 3MV8D 4F7MA 2ZCKL 1Q94A 4K7PH 5C0CE 4DEPC 4RFOH 3MV7B 3KXFA 2OS7A 3L3HB 4NZDA 3U9UA 2FIKB 2L0DA 3SKMA 1P4IH 4Q9RH 3TBSB 1G7IB 3GSQA 2XFXB 3EOAB 2WINB 3LPWA 4IOIB 5EU6E 2YKLH 4GW5B 5BVPH 4FA8A 3HMXL 1BQUA 1A4JA 2FLRT 3TA3B 2Y06L 3WJJC 4N0UB 1FL3A 1KJ2A 4V1DE 1F4YL 3FONA 1NGZB 1UWGL 3C6LD 2AQ2A 1MRDH 3JWOL 1AFVL 5I19H 1DBAH 1IAKA 1NFDE 2A83A 2BJMH 2HVKA 4XNMA 4KC3B 1Q9OB 1RIVH 3JTTA 4WHYH 4WDIB 4J2XA 1BD2D 5DHXB 4LU5H 4P2YA 1AO7A 3HE7A 2A73A 2RFXB 1JYWA 2EYRB 1ZHBB 2R0LL 1A7OL 1LK2A 1T7VA 4KQ4H 1CU4H 4LFHG 3EFFA 1OD7A 4XZUB 5KVDL 4M93C 5JMRA 1QLEL 3GGWA 1WBYA 1ZANH 4XCNA 2FD6L 4JFDE 3OZ9L 2UYLB 1U8HA 1UA6L 3LQZA 4QGTA 1UKTA 1EAPB 3N06B 2IAMC 1MWAH 4JRYA 1R3HB 1CE1L 2GQHA 4N0YL 4G8GA 5BV7L 1CGSL 1JGVL 1OF2A 2QQNH 3HZVB 4DUVA 1A4KA 4TSCH 4KHTH 3TIEA 3RVUD 1YN7B 4PJXB 1NFKA 2ZJSL 1U3YA 4JHAH 4NUJA 3MLWH 5FO8A 2I5YL 3VMNA 4HIJA 3ALWA 2ZUSA 2HKHH 3HE6D 4MDJA 2VLJD 5DJXB 4MNGA 4XP9H 3IXAA 3ZE1F 2ADJA 2QQQA 3VFWB 5E94A 4TUJB 3W39A 4LLYA 4PRDB 1HIML 5F6IC 4F7MB 1BM3L 1Q94B 3GJFA 4QTHA 2AJVH 1ZAGA 3O4LD 2FX8L 2PTVA 5KAQG 3KXFB 5I1CL 3BP7B 4EI5A 1QTYT 3MRNB 4DN3L 3MSPA 3PXHA 4E0RA 3U9UB 3UJTL 2NX5A 1BX2A 3V7AG 3TYGH 2FIRT 3GSQB 4Z7OF 2NY0C 4ZTOH 1ZEAL 1JNNL 2PXYA 1HILA 1Q0YH 1A4JB 4MA7L 4HXAL 4XCEB 3MJ9L 2BFVL 3QUXD 3KXFE 5E24E 4XBGA 2WWMD 3OQ3B 4CNIA 3A6OA 1FL3B 1KJ2B 2CDGB 4POZC 1OP3K 3FONB 3JWDC 1DP0A 1DQML 1OGTA 1OTUC 1BFVH 4P23C 2EO1A 4GBXC 5B3JF 3EYSH 2Z0BA 5D5MF 3IDNA 1MPAL 2HTKC 1C12B 5DMJB 4HZLA 2HVKB 4QXUL 4DK6A 1M05B 5IFAL 3MNZA 2A0LC 1XCQA 1MJ7H 5KG9A 2EIZA 1KLGB 4BKLA 2H8PA 5IG7A 1ZVYA 2X4OA 4FXKA 2A73B 4LIQH 4DGIL 3C5ZA 1LK2B 3OMZA 2YZ8A 2HT2C 2EH7L 4KV5E 4NPYA 3ETBF 3EFFB 2UY6A 4JQVC 5HYSG 3IJHA 1AO7E 1LILA 3D0VA 1WBYB 4NZJA 5E7FA 3TA3C 3QNXA 3RDTB 3GDBA 3BT2H 3LQZB 3BMWA 2XTLA 3O9WA 3U30B 3F7PC 2AXGA 2GSIA 4KQ3H 3HCVA 5DD6B 4FTVA 4JRYB 4PRIA 1OF2B 4RAUB 1PW3A 2C9AA 1TVBA 5C0DA 3TIEB 1WVZA 1U95A 4ZTPL 1KEGH 4M00A 1TTGA 1UYWH 4IS6B 5FO8B 5DMIL 4HIJB 3MR9A 4WI7A 2J8HA 4JRYE 4MNGB 4X0KB 5LG1A 4G8GE 3IXAB 2ADJB 3LSOA 4M5YL 5C2UB 5E94B 5BZWA 4Y4FB 3W39B 4LLYB 4HUVA 5KN5B 4JM2D 4L8DA 1X5HA 1CE6A 3OGCB 1GCFA 4IRSD 5HHXL 3BPCA 4NWUH 3UP1A 2UZYB 2C3HA 2NY3B 4MNGE 4EI5B 2YD4A 5EZJA 1DBJH 4XBEH 5B4MD 1JHTB 1BX2B 1BJ1H 4CMMA 4LNVA 2Y25A 2YBRA 4A6YL 2HH0H 4JZJC 1FDLH 1AE6L 4TVPD 3TP4A 3P9MA 1RZ8A 3WDHA 2OJZL 4XBGB 4CNIB 4OLUH 2GKIA 3GI8L 2NX5E 1HWHB 3ZE0E 5DGQA 3IFOA 2B8OT 1OGTB 1WBZA 3WIHA 3PABB 4JE4B 5T5NF 3X11B 4ELMA 4R9HA 1K3IA 1MHPL 2DB8A 4HZLB 4U1MA 3QT2A 4XP1L 4P3DB 4HD9A 4HEME 3RWGA 1IKFL 3HS0B 1KYOJ 3WFBH 3MNZB 1R5WB 3IDXL 4IRJB 1EZVY 2EIZB 3SE8L 1CDBA 5J3HD 4FXKB 2X4OB 1KBGH 2P43B 3T3PF 2APBA 1N6VA 3OL2A 1MJJB 4YHZL 1AC6A 3G6AB 4NPYB 5EC1B 3FRPA 5CD5D 3SJVD 1YYLH 3PHSA 3WIFB 2WANA 2BY0A 3F62A 3D0VB 2HKFH 1G6RL 3BE1H 4LARL 4YAQB 3O9WB 4XWOC 4OZ4A 5FKPA 2AXGB 2GSIB 4ZUVB 5H35A 2VXTL 3HCVB 4FTVB 5I1DA 3EYVA 3TLRA 4D0CA 1ZWIA 1Z9LA 5CILH 1KJ3H 4ZSOA 3BIBX 3P40A 3WFZA 1CGTA 2VB5A 1TVBB 3CK0H 4GW4A 1U95B 4FQJL 4PJ7A 4HPOL 3MR9B 1A2YA 4S0TD 3V8OA 4FTVE 3U2SB 4PRIE 2EO9A 3C9NA 4MNQA 4BSVA 2EC9U 2PO6D 3O8XD 5GHWL 1QLFB 5BZWB 1SYSB 3FMGH 4HUVB 1MCFA 1W72L 4OLXH 4Y5YB 5GISH 4L8DB 5HY9B 4PP1C 3BPCB 1BAFL 5DURB 5HHMD 5EZJB 2C4FT 3GMRB 3M17A 2HRLA 1UKQA 3MRGA 4CMMB 4HWEH 4C83B 3D2UA 1NLDL 3S36H 5FECA 1K6QL 4P59L 2X4SA 1BOYA 2GAZB 1A22B 1Z5LA 1RZ8B 2ITCA 5DRWB 4WHTA 1KIUA 4ZAKA 1JGUL 4TULL 4WCYH 1U8QA 1WBZB 3DURB 3JUZA 2H9GA 4GQ9H 2D7OA 3NABH 2K1MA 4NKQB 3H42L 1WEJH 4Y4FC 3RWGB 1AXIB 5F6HI 5L2KA 2E7BA 4U6XA 1BIIA 3NCYS 3SEPA 3IDIA 3L5IA 3SPVA 5J9PA 4BFBD 1KYOK 2NY3C 3QBTB 2E7MA 4EI5C 4ELME 3U4BL 1QSFA 2A9ML 1MCNA 3FQRA 4I48A 4MSWB 3S88L 1NSNL 3WXWL 4YFEA 1JMXA 4U1SA 3VWKD 4OTXH 2PXYC 4IJ3B 3R8BB 2ICEB 1KT2B 4HC1L 1T6VN 5EFIA 3N1MC 1UCBL 2M26A 4WTZA 5SWZA 1QFWL 4OZ4B 5FKPB 3TJHD 3GK8H 5DJ2A 3BGFB 1FL5A 1ADQL 4NKMA 1ZWIB 4ZSOB 2VDLL 4N9GA 3H9YA 4UT6L 4R90L 3WFEL 3NIFF 3BHBB 3FQUB 1B2WH 3OAYH 5C3LD 4WWKD 4PJ7B 3LRGA 4N0CC 2HP4A 1YMMB 1A2YB 1YY9C 3F6IA 1WFOA 4QOKD 1HINH 4MNQB 5LCVH 5ALCH 1QVOA 4BSVB 3O6KL 4ZSOE 4OZFG 3LN5A 5F88A 3QHZH 3MUJA 2DF3A 3MRPA 2E6PA 4PJ7E 4Y16B 2GY7B 2CDFA 4EI6B 1BEYH 1GHFH 3DGGB 4MNQE 2W38A 3QFJD 4U33A 3GFUA 2HLAB 1OARL 3B2UD 3BH8B 3M17B 5KOMC 2VLRD 2FEEI 1NCAL 4G6ML 2IQ9H 4U6VH 3BQUA 3I2CL 3O9WC 5E6IA 1IGYB 3PDOA 3PGFL 4NQED 1S5HB 2DQIL 5DXWA 4OM1H 4OKDA 4HJGB 1ZOXA 5MI0B 4TSAL 5LGKA 3ULVL 1IM9D 3FT3A 4YHPB 1UZ8B 2ZUXA 4B5EA 3MACH 4NHUB 4R4ND 5FGCE 1HYSD 5DWUH 1TIUA 1KGCD 4NNXB 5HHNA 4HK3J 5L2KB 3JZ7A 1ZGLP 4S2SA 4LDLB 4ODBD 2A77H 4LK4A 3TBVA 4EDXA 1BIIB 4OT1L 3IDIB 5J9PB 3SPVB 3K4ZA 3D87B 3GIZL 4K3JL 1C16A 4RX4D 2F74A 4MJ6B 3FQRB 4BZ2L 4OZHF 4I48B 3AY4A 4TRPH 5GPRA 5L2KE 1DBML 4U1SB 2R56H 2DLFH 3UPAA 3EOYG 2YRLA 5EFIB 4HDIA 5SWZB 3BMVA 3KYKH 3U79A 1QSFE 4LNRA 4TNWK 1FL5B 1OCWL 2QADB 3MRHB 4WNQB 3LCYA 1ZS8A 1I9RL 4N9GB 1U91B 1I8LA 3GMMA 5E2VL 5CEYA 3VGHA 2B7DT 5SWZE 4ZS7L 1KCVH 2FGWH 5D2NB 3RVXD 2E8ZA 1KIRA 2DLIA 5LGHL 1T04A 3LN5B 1I8MA 1MCJA 1EGJL 2FO1A 3A6BH 2EE6A 3MCKA 5JXAL 3Q2CA 2R23A 5I8KH 4FQ1L 3RI5K 2X89D 4HPYH 5D4QA 5C86A 5GSRB 5DJCA 4G8IB 1ZK9A 3BQUB 4OZIF 1LO3H 4OCXH 1EHAA 4H0IA 4MJ5A 5DZLA 3T4YA 3FO2A 1LE9A 2KPNA 4P3CL 1RZIA 5FYLL 1YJDH 4J1UA 2WUCH 5HYSB 2VLLB 3O11A 4LASL 4D0DA 1NUDA 1DFBH 5AZEH 5CJ8A 5GGTH 3NCYP 3P0VH 2A9NH 3T0AA 2ZKHH 2X4RB 5F44A 4YZFE 1IAMA 3TGXA 1HKLL 3ROOA 3FOLA 1XT5A 1JF1B 3TBVB 3UC0H 3PL6A 3MRDA 4PRPD 4EDXB 4R6UA 4RDQF 1KTKE 2HYMA 2QEJA 1YN6A 4RAVA 1G7MA 4BH8A 4HS8L 1C16B 1RIUH 3RGVB 2IPTL 1CICA 5F1SA 5ALBH 5I8CA 3MROA 2VDOH 5MERA 1CDHA 2FX7L 1CTNA 15C8H 5L6YL 3U7AA 4ZAKC 3RWDB 3V4PH 3QXWA 1FJ1A 1T20A 5MI0C 4DZ8A 4W68A 1E6JH 1OPGH 3O6LL 1KC5L 1XGPB 2MSPA 1ZS8B 3O3UN 2VE6A 1HNGA 3GMMB 3GHEH 3JSSA 4ZOBA 3K8KA 1D3CA 1J1PL 4OCSL 3MJ8A 2IFGA 3KPTA 3QUMA 1YQ2A 1X5ZA 4RMSA 1SMAA 3ILQC 4UAOB 3AB0C 1KIRB 3D39B 2HJFA 1LO4H 3V2AR 2DLGA 3LKPA 1KUMA 4FZEH 3MCKB 5BMFL 4PJGF 2B4CL 3DX6A 5ITBL 1RSFA 1RVFL 4XP6L 2AK4A 2AJSL 1VENA 3WIHL 5DJCB 2NY5H 5I8EA 2R29L 1NUNB 5LAXB 2BNUA 3S5LA 4OF3A 4MZ3A 1XZ0A 2BVYA 3VFMB 1LE9B 1MFAL 4BQ9A 4U6YA 3VXSA 2APXA 5EBMB 4KZDH 2BSED 3UROR 4P5TD 4J1UB 2YUXA 3O11B 1ORQB 3GSVA 1JBJA 2NY7L 1WLHA 1QO3A 4RGOL 1DANT 1T03H 2GJ6B 5B8CB 2JB5H 4XXDA 5F71A 5CJOH 3EOBB 5J7CC 3HUJF 4NP4H 4AT6B 1XAUA 4WWID 4I0KA 5FV1L 5HYJA 3ROOB 1VGEH 3FOLB 1TNNA 1WT5A 2VWEE 1YN6B 4U4BA 3MLVH 4JKKA 4BH8B 5I1AB 3X14B 1CICB 3BQUC 5TJWK 4OZFA 4QHKJ 1NC2D 1VFBA 2WWKO 3NZHH 5KSAA 1T0PB 3VXUD 5E6IC 5MERB 1P2CA 3DX9B 4Y1AA 5FF6A 5DK2A 2OK0L 1F00I 1V3KA 4MD0B 3K7UA 4I3RH 1NFIA 2VC2L 1PLGL 1K2DA 1NAMA 3M8OH 1FJ1B 1T20B 4RISL 3VFSB 3PP3K 4DZ8B 1YEIH 1WGOA 3CFIC 3O2VH 3QIUB 4PJCA 2NY4B 3PWVA 5D7SL 2DQDH 4U2YA 2VE6B 5MEOA 1NGPL 2ICWJ 4YQXH 2P7TA 3SO5A 1BP3B 2IBBA 5C9KA 1A6TA 4HH9A 5KS9B 4G6FB 2IALB 1PG7H 3T0EA 3ARXA 2DJ4A 5CP7A 2H41A 2HJFB 3KS0J 3LQAH 5J6HB 3LKPB 3P4NA 1MHCA 3GI9L 2B1AL 2BOCB 4DKFL 3SE4A 5A2JH 3AY4C 4P4KB 1CDIA 3H3BC 3AU1A 3LIZH 1OQXA 4UI2A 2DKMA 5K33A 3DYOA 4PJ5D 5DUMH 2DQUL 1OP5H 1WWWX 5D9SA 1F8TH 2LFGA 5EC2A 5FCSH 1A6ZB 3CFJB 4LSQL 5TQ0H 4U6YB 3H7LA 2AK4E 4NYLA 4LVOB 1K8DB 5HI5D 3RZCB 4X7TB 1I8LC 3HPJA 2BDNH 3QCUL 2VDNL 3AXLA 2VXSH 3I9GH 4NUGL 4FQHB 3QCTL 1EA9C 1B9ZA 4N8CL 4BH7A 2XA3A 4UAOC 3HRPA 3VXSE 1JHKL 3DRTB 4PGCA 4Z7QE 2FZ3B 2VDKL 4KK5D 5GGRY 3SKJL 4LQFL 1N3NA 2O5XL 5C2BL 2DL2A 2D7NA 5FYJE 2X70A 5EOTA 3AC0A 1FNEA 4H26A 3HNVL 4K94H 5JPNB 3LD8B 2YD2A 5IM7A 4OZFB 5HYJE 1VFBB 4XT1C 5IR1A 1P2CB 4Y1AB 1FZJA 2X09A 5FF6B 5DZOA 5DK2B 3WSQH 5ESAB 1KCUH 1IQWL 4U7KA 4KFZC 4KUZL 4U3CA 3U1SH 3ZKMC 2EE9A 1NFDF 1ZSDA 4PJCB 2VWEC 1QR4A 4JR9H 4IIQB 4Y1AE 4YXKL 4UUJA 1JZ5A 4F2MB 4ONOA 5ACMA 2WBKA 1EJOH 3CH8A 2GK0A 4YH6A 3EO0A 4YX2H 3O4OB 3ARVA 3PL6C 4XCFH 3ARSA 4XPTL 4PJCE 2AJXL 5AYQA 1G0XA 1R3JA 3LHPL 3BZDA 5DEZA 5CP7B 2BX5A 2EXWD 5IK3B 5KJRH 5F97E 3MODL 3HAEA 4ONHB 4F37K 3C08H 4RFEA 4PLOB 4J8RA 4UIKH 5B22A 4NFCA 3CIQA 2P5EB 1CICC 4PRHB 5I8OH 3V4VH 4L8SA 4Y4KA 1MCPH 3T0EE 5DMKA 3DI3B 1I1AA 3WHXB 2R69L 3QUYA 4L4TD 3TBTA 2IANA 4X99A 1IC1A 2CGRL 1B6UA 2WAHA 4OV5B 4RMRA 5C08D 3T1WA 4GO6B 3BD5A 5C3TA 1AC0A 1AQKL 2ICWB 5ID1A 1CZ8H 4M7KL 1LQSR 2YUVA 3JXAA 3WBDA 5CEXB 1JI1A 2IQAA 4R2GD 3CFBA 3PWNA 2C3VA 1ZHLA 4ZYKB 4X7EC 3PIQB 4FOMA 1HHHA 4OGYL 3FT2A 2D03H 4B50A 3RTQA 3LAFA 2J5LC 4JPKL 1H3PL 1N3NB 4KUCF 2CIIB 2YEZA 1NBYB 5DJYA 2X70B 5EOTB 2MHAB 3CX2A 5CGYD 4GMSH 4MA1B 5C0IB 1ZT4B 3SDCD 4XP5L 4QRPB 2V7HA 2ZUTA 3UTQB 5LGJA 5DEFA 3O2WH 1J5OH 1CVRA 3PDGA 5FB8B 5C0AB 4DAGL 4YFLF 4NQDA 2X7LB 4P2OD 4PJFA 5EA0L 1OTTC 2C7UB 3OHXB 5CIPA 3REWB 3WKMH 1LO2H 4KAQL 3UX9B 4FQXA 3HMWL 4UUJB 2P8MA 4RA0C 4WV1A 4CU6A 3WHE1 3I50L 1MFNA 3H7BA 3L5JA 1QBLH 5FHBH 4JB9L 4TUOA 1AY1L 3QP3A 2GK0B 2P5WB 1WT5C 4JDZB 4YHKH 3VRJB 2EH8L 3S3JA 3BOVA 4KV5F 4X6DB 4YDIL 4O4YH 3D85D 5TDNA 4MAYA 1J0ZA 3LZFL 4XC3L 1S9YA 3LD8C 1U6AL 2C1PB 2NW2A 5KSAC 4L8SB 1EV2E 4Y4KB 3GMQA 1MCWW 5IGXH 1I1AB 4H1LH 2CK0L 3BKJL 4RZCA 3QUYB 3SY0A 3NFSL 4UIMA 3TBTB 4KRNA 1P4BH 1QA9B 4JFQB 4XWGL 2VTFA 1VEMA 1N2RA 1FLRH 4KHXH 2HJKB 4I77H 3W0WD 3B9EA 4FMFA 3VFVA 1V3JA 3PHOB 1UQSA 5FHAL 5DLML 4F57L 2IANE 1BFOB 3UTTA 1QLRA 3O4OC 2Z92A 3T0EC 5C0RH 1BVZA 3PWNB 5DFWH 3T08A 3HC4H 2GT9A 5C0GA 4U3HA 3SCMD 1KNOA 4MX7A 3DIFB 2R8SL 3TH2T 2YEZB 3SE4C 1WBXB 1DCLA 1ZLWK 1INEL 3G5XA 5DJYB 4PJAB 1HZHL 3OPZL 5GGUB 1A47A 3MOQA 1NCWL 2IH3A 4KPHL 4EUPA 2Z4QB 3L7EB 3HRZA 4LSTL 1K4CA 3S35H 4PBXA 1JGLL 1P69B 3QUML 3WHE0 1FNGA 4NQVA 1SBSL 1XR9A 3ARED 4X9BA 2V7HB 3ZE0F 4OCRL 1HQ4B 4AJ0A 2VDQH 5AUMB 4PJFB 2BNQA 3HMXH 1IGJA 5BS0A 5HHQA 4KH2A 3THML 2NXZB 4HWUA 1U3HD 2P8MB 3FQTB 4WV1B 3RJDA 3ZTJH 1FE8L 1F4YH 1CFQA 1TJGL 1J1XL 1UWGH 5ESQA 3X3FL 4TUOB 3JWOH 3CCHA 1AFVH 3LEYL 3BGAA 4YDVA 4NQDE 4PJFE 1NBVH 3BPLB 2DQHL 2MQ0A 2PW2A 3FB7A 4OF8A 5CHNA 5FUOL 5CZXC 4XMKL 4RBPH 1F3DJ 2A38A 1ZGLA 2W91A 1UJTA 1I3GL 4JFYB 3DETD 4KJPD 1IC5L 2RCSL 3RA7L 3CDYA 4XPFL 1ZLVK 2YPLA 7CGTA 3OJDA 5F3BA 3MRJB 1CFSA 2R0KL 3SY0B 2IPKA 3Q1SL 3REVB 3QO0A 3CDCA 4HCRA 2Z35A 4LVNB 4UIMB 2R1XA 3NTCL 5F7HA 1QLEH 1S78C 2FD6H 3VFVB 1UQSB 1I7TB 4MS8D 4N0YH 4PY7A 5BV7H 1CGSH 1JGVH 4O02L 3WMSA 4JRXA 1VACA 1WUNT 5J11B 5E8EA 1U42A 5DMGC 1Z9MA 3B9KA 2ADIA 5C0GB 3FHQA 5IBLC 1T4KA 5C09B 1DUZA 1KNOB 4MXQC 2IBZX 4MX7B 2ENSA 5F72S 1NAML 3UTTE 1T1XA 4L8SC 4LEXL 3W11C 3G5XB 4Y4KC 2EDXA 1HIMH 1I1AC 1BM3H 3VXRA 5FYKD 1K4CB 3QUYC 2FX8H 3EIFA 2P47B 4S1QL 3SDAD 5I1CH 4NQVB 7FABL 4DN3H 1N64L 1T21B 5E8OA 3UJTH 5IB5A 1HSAB 2XKUA 1UH2A 1CLOL 4EN3B 1ZEAH 1BVLB 2Q8BL 1YEKL 2BNQB 3QB7C 4IDJL 4MA7H 4HXAH 3BRFA 3MJ9H 3VXMA 2BFVH 3G5ZA 5GGRA 4WGVB 4NRYA 1ETZA 4UU9A 1YNLL 5HGGS 5A16B 3OKLA 1UXWA 5ESQB 2VR9A 3LMJH 4YDVB 1BQHG 4QHMB 3RTQC 5ISZA 3C87A 1KIQB 2BNQE 1BECA 1MPAH 4ELMF 5BS0E 1V05A 3FB7B 4JKPL 4QXUH 3BDXA 3D3VA 5IFAH 3QQNA 3DSNA 4Y2DD 4YJZL 1A1MB 3OJDB 4DGIH 4PLKC 2VQUA 3L1OL 2EH7H 1CFSB 5E2JA 2IPKB 3QO0B 2Z35B 5H94A 1SQ2N 2O26U 4OZGA 3GHBL 2YPLE 4YWGL 5FYKU 2AEWA 3ULUE 4FQXC 2NXZC 4P57B 4WV1C 4NHCL 3IU3B 4FNLL 3LPGA 2WZPD 3CPLA 4PY7B 3FQWA 1JCKA 4JRXB 4HWNA 1VACB 4KWUA 5I30L 4ZUUA 5T1KA 3B9KB 3BPLC 1UENA 5C07A 4PJ7F 5DMIH 2H3NA 3HZYB 3RZCD 3T2NL 2IF7A 3ZZ1A 1GL4B 5BW7A 1FNFA 1YEGH 1T7ZA 4LSSH 4JRXE 5EOQL 3ARGB 1LHZA 2J3SA 3GO1H 1F11A 1I8KA 5HHXH 5IBTL 3IKCA 5I71C 4JKMA 3IDGA 5HI3D 4QRRB 2L7JA 5E8OB 5JXEA 1S5IL 3K1KC 4MZ2A 3OR7A 3KPLA 4ZFOL 1YNTA 4A6YH 3NCMA 3VXRE 2PYED 4LLUB 1AE6H 4ISVB 3HC3L 4P2CG 4MHHI 1FORH 5L2JA 4NC2B 4WFED 1R3KB 1AGFB 1YEEL 2OJZH 5GGRB 4NRYB 1ETZB 5J11C 4UU9B 4Q2ZB 3GI8H 5F9WB 3ARBD 4J3WA 1A7RH 4NC0B 1HXYA 1JF5A 5ISZB 2EZ0D 5D1ZA 3CMGA 4OFPA 3VXME 3W81A 1MHPH 4UTBL 2WIIA 5HHOA 3D3VB 4CRPA 3BEWA 3IDXH 1IBGL 3SE8H 1QYGL 5SX5K 5GZNC 5DFVD 3HN3A 5ISZE 5D7LD 1XCTA 4HKZA 2X1QA 3SDXA 5D8JL 3U36B 4PLNC 4F58L 3D3VE 1KPUA 3JWDH 5ANMA 4OIIH 1MCOL 1OLZA 5A3ID 4PRHD 2HT3D 5FYJU 3MUZ1 5HGDA 5KAQF 5IQ9B 4LCWA 4LARH 2LAAA 4Z95H 4YHIB 3V4UL 2VXTH 2F54A 4U1HB 1KB5B 2FX9H 1FNSL 3FQWB 1E27B 3ES6A 4LSRL 2G9HA 4OZGE 3KJ6L 2GUOA 2NPLX 1CF8L 4HPOH 4L3EB 2EDHA 2GHWB 4LGPB 1J8HB 1IGIL 5GGVY 4GG6B 3CFEA 5GHWH 2PR4L 5C0BA 3ULSA 2OTUB 2CRYA 2QHRL 1W72H 3ULUC 1HOCA 4LHUD 2FB4H 5C07E 1F11B 3LVEA 3GIVB 5I6XC 1BAFH 5A2LH 3T8XA 5HI4C 3SOBL 1XIWD 2B2XL 3B43A 4HHAB 2ZG2A 4X80H 3OR7B 3KPLB 1QSZA 5IW6A 1NLDH 3GKWH 4LCIL 4AH2B 5CSZB 4UT7L 4AIZB 2PTTB 4HLJA 1UB6B 4YZFF 4R26L 4U6HB 4OLWL 2DTSA 1JGUH 4TULH 4RRPA 2ZSVA 3F5WA 4H8WC 1YMHA 3B9KC 3BUYA 3MRFB 1BMGA 3VU2A 3OKEB 4G7VL 4HFWB 2X9YA 2O61A 1HXYB 1LEKA 2GSGA 4QCIA 1I3RA 3RI5F 4HIXL 4Z5RB 3C60B 2OQJA 2QQLL 3MPCA 4F7EA 3K8MA 4GAYA 5JHDB 2V17L 1XF2A 3U7WL 3SDXB 1JGEB 2BVTA 1XF5A 3KPNB 3UYPA 4OJFH 3U4BH 2OL3A 3DNKA 2A9MH 2VIRB 1J0JA 5HHOE 1N26A 1KPUB 1NKRA 5ANMB 1F4HA 3TEUA 1NSNH 3WXWH 3MFGB 1RQ5A 5FCUL 1N5AA 2VZ3A 3SDXE 4HC1H 4M7ZB 5DFTA 2F54B 4CVXB 3MBED 1ADQH 5ANME 5I1IL 4Y5VA 1A3RL 4Z7WB 1KIPA 4FFYH 4UT6H 1JZ4A 4R90H 2G9HB 4U1JA 3S7GA 3WFEH 2VKWA 5F93C 2CK2A 5F1OB 2GUOB 1KCLA 4JO2L 4LCWE 5E00B 1FYTA 2X40A 1D6VH 1SVZA 2HG5A 2J8UA 1A9BA 2F54E 1I4FA 3IKKA 5E8PB 1GGTA 3QDGB 3CFEB 3O6KH 1I7UA 2AKRA 1KPVB 2I25N 3IRPX 2BERA 3UAJC 1BQHA 2FHCA 5A2KH 4P2RA 4Q6IA 3FFDA 1UKSA 1B0RA 2BP3A 3RVTC 5FGSA 5EIVA 1IC4L 1BFSA 4NQCA 1T7YA 1WFTA 3KLAA 3B6SA 1OARH 3E6HB 5C0BE 5A40E 4G6MH 5JW4N 1NCAH 2C5DC 1U8JA 3QH3A 2EC8A 1JVKA 4DVBA 1DDHB 3PGFH 5I1EL 3VXTB 4UILL 3QI9D 3DUUA 1W0VB 4KTEL 4OM0L 3GNML 3F5WB 4TSAH 3QXAA 1VDGA 1YMHB 3ULUL 3BUYB 2RJMA 4F7PA 1P7QA 3O3EB 2IAMD 1S7SA 5L0QB 1HSBA 1D6EB 2ADGB 4HCRL 5AWNL 5BW7C 1PD6A 4XBPA 5AYUL 1I3RB 2XZQL 4AG4L 4MD5A 3SKOB 4GXUM 1EHLL 4L9LA 2OQJB 2NXYB 1K8IA 4OT1H 1OQOA 1N8ZA 5CWSA 1OAUH 4K3JH 4ONGL 4YPGB 4QY8A 1QSED 1JTOA 5ILTL 5TE7L 1XF2B 1XF5B 4E41D 5JXEC 3HG1B 2FECL 3VWJA 4H8WL 1CBVL 4KDWA 1WJ3A 4WW2A 1I85A 4AYFA 3E2HB 4NSKB 5C0FA 1QNZL 2F5BL 2IADB 1XFPA 5EDXA 3MGAA 5BOPA 1N5AB 2AVGA 1HH9A 4O9HL 5F9DC 3NBNA 5F1IA 1KELL 3KLHC 2Q8AL 4NN7C 2NY0D 2BHUA 3GJFH 1DL7L 4Y5VB 1KIPB 1I9RH 4DKEL 4U1JB 3MFFA 5HPMA 5E2VH 5CZVL 3VXPB 2HT4C 1FYTB 3OJVC 4ZS7H 3C60C 5LBSH 2V5RA 1GXEA 1CGWA 4GBXD 4PJ8D 3DUSB 5GGSA 1MELA 2AKRB 5LGHH 2EIEA 2QJDA 3OTTA 3WO4B 2FYYA 5KSVB 1IJ9A 2DI7A 4LSUH 4P2RB 4Q6IB 1FYTE 5JXAH 5DUBB 4AM0B 1B0RB 2J8UE 4FQ1H 4X7FC 4KJQC 5EU6D 3TT3L 3BZ4A 5K9KA 3JWNC 2Y07L 3KLAB 3B6SB 5A1AA 4PLJC 5DVMA 4RCAA 1JRHL 1U8JB 4V1DD 3UJIL 2GI7A 4DVBB 4M7ZC 3DV6A 4CADA 2HT2D 4P2RE 1J12A 2FL5A 4P3CH 4FHBD 5F89B 1JPFA 4Z7QF 2ZPKL 3MRRA 4NQCE 3ZE2E 1EX0A 2GFBB 4LASH 1J05A 2AS5M 3VG0H 3EJYC 1N7ML 5H2BA 1P7QB 3FO9A 3LV3A 4MJIA 1S7SB 2AV7A 3FHAA 4OGXL 4XBPB 4OD3L 1FL6B 4MD5B 1GC1L 4L9LB 1HKLH 2YWYA 5KOVC 4M43L 1YQVL 1D5MA 1K8IB 2ESVB 4JAMB 1M71A 5CWSB 3LOWA 2BVEA 2GITA 3QWOB 4HS8H 3OKKB 4I18A 3H9ZA 2IPTH 2JB6A 2XA8L 4Y4HA 3O3AB 4JFDD 1S7WA 1IGTA 4NC1E 4YK4B 3BW9A 2FX7H 1QBBA 4NRXB 5AD0B 1N4XL 3WUWG 5L6YH 3W82A 2ED8A 3MGTB 4NJ9L 4OF0A 5AZ2H 1PBYA 5F1IB 3H0TA 5IB3B 3OKDB 4I9WE 4NKDA 2CD0A 1RAMA 3O6LH 5GJSH 1KC5H 3EFDL 3GSRB 1EEZA 5HPMB 3IJSB 4F9LA 5CBAA 2ZWLT 1J1PH 5EZLA 2VL5A 1D7FA 5I1HL 2D7TL 3WKNA 2W9EL 5T5FL 4KKLC 2QLVB 1JTPA 5H8DA 4ERSL 2QSTA 3L3DB 1X3DA 2CMRL 4UQ3A 2P1YA 5D2LB 4O58L 2FYYB 1Z9SA 1LNUA 3ARFA 3V7MA 5BMFH 5ITBH 3QIWA 1RVFH 3QSKB 1U58A 3LKQB 4XP6H 1RUPL 1YEDB 3VFPB 5K9KB 4WEUD 5GZOD 3WIHH 2R29H 2X4PA 1U8LA 1PZUB 1EEYB 3BZEB 4HKJA 3PNWB 5JLZA 4F9PA 2PCPA 2FL5B 3WS3A 3MLRL 3D9AL 1MFAH 4Y5VC 1JPFB 3ZSSA 5C9JA 5H37H 5IROA 4LPTA 5GJTL 3QIBB 1DQLH 1Q9WB 2BNRD 2NY7H 4ZXBA 1G6VK 4RGOH 3EDKA 1A02N 3OXSA 3FO9B 3LV3B 4MJIB 3RBSA 4F37F 3LB6D 3BAEL 1IAIM 4QTIL 5KSUB 3WO4C 3ZHDA 3RUGA 2NY6C 3RVWD 1D5MB 1RZGA 4LPVA 4Q6IC 1NEUA 4MJIE 1M71B 1JHLH 2X5PA 2VN4A 4WHCA 2R2BA 1I1YA 1AO7D 2GITB 3HE7D 4I18B 4WIQA 5IVOA 4GRWB 3SBWA 1RULH 4JO4L 4W4NA 3ULVD 3F7RA 2W65B 2CSPA 3BW9B 5E6ZA 4RFNB 5T1MB 5IHUL 2OK0H 3ARPA 3OB8A 4Y88A 3T1FA 2YD7A 4OLVL 3KPRA 1JNHA 2VC2H 4NOBA 4RISH 1MNUL 3H0TB 2GJJA 5KTEL 5IP4A 5D7SH 4LSPL 2JELL 1LEGB 1NGPH 4G8GD 3QDJA 4DCQA 1QFOA 5EZLB 1QFWI 2VL5B 3OGOE 4YEFA 1YEJL 4L9LC 5LQBL 2HRPL 1FAIL 4QF1B 2CLRA 3LDBC 1BVKB 1RUKL 2DIJA 3DPBA 2L4OA 4M8VA 3NCCB 4EIGB 2YUWA 1B4RA 3ARFB 5CLWA 5A2FA 2BSTA 3VWJC 4ETQA 3F12B 4Z7NE 3GI9H 3GRWA 2B1AH 2DL9A 3GMPA 1D5ZA 2XKNB 4DKFH 5I16A 4WW2C 1I85C 4YK4C 3DV4A 5HGHA 4K71B 2JIXD 5T3XL 4YFLI 2R1YA 2G5BB 2Y7QB 3BIAX 1LO5A 1GGCL 5T33H 3VRIA 5IMLA 2NX5D 4M3JA 5JLZB 2HN7A 4XRCA 2OM5A 4LSQH 3KJ4C 4OI7A 1LEIA 2PXYD 2CUMA 1BGXL 1JV5B 3B8SA 4XHJC 3ROLA 1MCRA 3QCUH 1ED3B 4PRNA 4HUWA 4X6EA 2OL3L 4I5BA 3LQMA 4NUGH 3QCTH 3UMTA 4I4WB 4N8CH 3IJYA 3V6FA 4L8CA 3TPUB 3WNMA 5CEZE 1UM5L 2VDKH 3T04D 4R4BB 1TPXC 1P4IL 1OGAA 2P4AB 4GRLB 4XAWL 3SKJH 3RUGB 4LQFH 1WFNA 4NN5B 1RZGB 5GRWA 4C56B 4N0CD 3P4OA 3G5VB 2O5XH 3IVKA 3HPLA 5FYLD 5C2BH 1FSKB 1YY9D 2AERT 3EO9L 1XF3A 1I1YB 1WICA 1NCCL 5GS1B 4JFXA 3EYFA 3HNVH 5TF1H 2K7QA 3DHJA 3C5ZD 3F6LA 2NNAA 3F65A 3RUGE 5FUZL 4Z0XB 3S3SA 2RIKA 1FFOB 3F58L 5C92A 5DD0L 3KPRB 1JNHB 1IQWH 2HFFB 2APFA 4KUZH 1Z6JT 1H3VA 3BO8A 1F02I 4PJFF 1FPTL 1RIVL 1SYVA 4X5WA 4ZUWB 4PRID 4CBPA 1T1WA 3KPRE 4YXHL 1Q1JL 4POYA 3JTSB 5C0ND 1WSST 2W59A 2YXFA 5JIPA 4KQ4L 4M4RA 1DSFL 2CLRB 4XPTH 5CAYB 3CUPB 3KYOA 1NGXA 3LHPH 4QKXB 4Z7VA 3J7HA 4UV7L 3MODH 4ZUSB 2UVEA 1ZANL 3QDJE 1MLCA 4I18C 2MCPL 3Q3GA 1VESA 4X7SL 3TBWB 4MVBD 4Y4HC 2BSTB 1WWBX 2ED7A 4ETQB 4XVTL 4Y19A 5E8NA 3L3KA 4GKSB 5HGHB 3TC9A 1YC7A 1KCSL 2QQNL 2R1YB 1LO5B 4TSCL 4PJDB 5IMLB 5D7KE 4WUUA 4XRCB 1ZVSA 2LU4A 3ZHLA 4DGYL 5ACZA 1F6LL 2HKHL 5LWYL 1AH1A 1KLUA 2XWJA 1C5BL 3EYOA 4F9LC 1M4KA 4P46D 3MREA 3RIAF 4HUWB 3WUWA 4M7KH 4I5BB 3QUZB 4LF3B 3K1DA 4B53A 2AJVL 2VSDA 4JFFA 3IJYB 3GMNA 3BWAA 5GS2D 1PG7W 1FBIL 4OGYH 1BBDH 4PP2B 3ARFC 4WW1B 1NANH 4JPKH 3VG9B 1H3PH 4AENA 4I1NB 4ZTOL 3IAPA 2XZCL 3QIWC 3B5GA 1CN4A 4UDTA 1Q0YL 5TGBA 4JFXB 4CW1A 3DROB 3KPPA 4P2QD 4N5UA 5J8OA 3OF6A 1O0VA 3WE6B 3MLXH 1UJ3A 4CKVX 4G6JL 1OGAE 2X9XA 4WGWB 1QOKA 1U8IA 1RZFL 1BFVL 1VFMA 4F9PC 4BK4A 1UGNA 4OBSA 3KPSB 5J1AA 3LS5L 1X5AA 2OTPA 5IROC 3WUZA 1M6OA 4JZNA 4ZFZB 4ZXBC 3Q5OA 2FBJL 4DAGH 1SYVB 3CMOL 4LRIA 5EA0H 4X5WB 3FO0L 3KNBA 4PGBA 4KAQH 2UZIL 2CLZB 3HMWH 4P9HC 3GSNB 4HIEA 3U4EA 4Y89A 3I50H 3T0VA 3STLA 1YPZA 1KXQE 1OHQA 1UWXH 4JB9H 3RWIB 1TETL 2GTZA 1CQYA 2DI9A 1T2QL 3UYOD 4ZFFA 3G5YB 2EH8H 4Z7VB 1FSKC 4OF7A 3H9SD 4YDIH 1MLCB 5GS1C 2ZCHL 4UINL 3S8WA 3LZFH 4U1IA 3BT2L 1U6AH 2Z8VC 4Y19B 1OVZA 3L3KB 5IW3A 3ULUF 3GSWB 1FHGA 4OCYL 3ZKQD 4Z7VE 3BKJH 5MENB 3U0PA 3NFSH 3AMLA 4XWGH 3D2UD 1ZVSB 4OCWL 5ACZB 4Y19E 4QYOA 1KLUB 1H0DA 1ERNA 3EYOB 4ZAKD 5FHAH 5MP6H 4F57H 3QPQC 3WUWB 1HHIA 1FO0B 4WUUE 1FZMA 3HNSH 1FLTX 4NWUL 4CVWA 2RAMA 3GSUB 3BWAB 4NN6C 2YSSA 1DBJL 4KXZH 2BHZA 4QRSA 4G8EA 2R8SH 4NZTL 4AENB 1W2KT 3ILQD 4JFFE 4NNYA 4UDTB 1INEH 4UOW1 5TGBB 4JY4A 1HZHH 3OPZH 2XTJB 4CW1B 3KPPB 1NCWH 2XV6B 3K4DA 4KPHH 4Y8AA 5C7XL 2F15A 1UJ3B 1QSFD 1JGLH 3QUMH 4JEGB 4LP4A 5CMAB 3TESA 5E9DD 1SBSH 4LDEB 1FZKB 1Y0LA 4ODXB 2XTJE 3X12A 4Q9CA 2R1WB 2A6KA 1M6OB 4M7JL 1RJZA 4L4VA 3LS4L 1KXVC 3L3JB 2RBLA 5GQBA 3ALXA 1NDMA 2VAAA 2DOCA 1IEAA 3KNBB 4CU8A 3FB5A 4PGBB 2XWTA 1E0OB 3THMH 3RVVD 3U4EB 4XP4L 3GBLA 1FE8H 1TJGH 2G5RA 2WUBL 5JZ7C 1J1XH 1T0MA 2L7UA 3O2DA 1INQA 4XX1E 1TLKA 3STLB 2W0FB 5EOCJ 5IWLA 4NM8L 2GTZB 4HH8A 4RGND 3VG9C 2BVUA 2H2PC 3NPSC 1U8MB 3QXUA 1AIFA 4ZFFB 2DQHH 5FUOH 2R0ZL 4XMKH 1Y6MR 1EPFA 1I3GH 4U1IB 4ZOEA 2X4QA 1IC5H 1YPZE 2YC1A 4DZBA 3RA7H 2FO4B 5ADOL 4XPFH 5D7JA 4DOHE 3QDMB 4OF5A 4P9HL 3MRCB 2CKBA 2R0KH 3S6CA 3Q1SH 4MA8L 1U41A 1MVUA 3NTCH 1Z2KA 2GK2A 4RNRB 5HPOA 4TYUA 4OZGF 3BJLA 3ISWA 5E6ID 3VXNA 4OCMC 1P5UA 2CLVA 3T09A 3BWUC 1H0DB 3TM6A 4X6CA 2MOVA 1X6NA 4PUBL 4ODWB 3FRUA 1P4LB 3MYJB 5EU5B 3FMGL 1P84K 1QR1B 1HHIB 1MCLA 1FZMB 2Q3ZA 4Z7UB 4O02H 3WNNA 4OKVA 1KXTB 2DD8L 3B5TA 3QZWG 4QRSB 3BGMB 4G8EB 1B3JA 2AJZB 1NAMH 4ONFL 4NRZA 1XF4A 4LEXH 3UPRA 3U6RA 4X5XA 3MX0A 3DTXA 5SV4A 1DUYA 4KRPB 5IUSA 4K7PY 7FABH 5E8DL 1N64H 2V2WB 4LPYA 4U0QB 4GUPB 4JANB 1U8PA 4M02A 4JFEA 3X12B 1FFPA 4OUUA 2A6KB 1CLOH 1U8NB 1RJZB 4DFHA 1B88A 5D6CA 3DBXB 1WEJL 2Q8BH 1YEKH 3S4SG 3ABZA 5ESVA 4IDJH 1NDMB 2Z31B 2VAAB 2XY1A 4KZEH 2XWTB 2Y6SD 5DTFA 5JORB 5I1LA 5M7QA 4XVSH 1G7LB 3QAZC 1T0MB 1INQB 4ZO9A 4L4VE 1VEPA 4QHLB 1AIFB 4QWWC 3FFCA 4JKPH 4PJEA 3PGDA 2XTJC 2IMNA 1DZBA 1QBAA 2X4QB 4X4ZA 2VDRL 1UJ3C 2P49B 1TJIL 5D7JB 5JDSA 4HULB 3SDXF 1Z0NA 4HS3A 5EORL 2WNGA 4GOSA 32C2B 4YDKL 4P5MA 3CLEL 1GIGL 1HI6A 3L1OH 3FO1B 2P24A 3IFNH 4M4PA 2CIKB 3B3IB 5IKCA 1T83A 4OCNC 4GRMA 1JK8B 3EO1A 4JHZA 3IAQA 5FOBB 3DXAD 4LRIC 2DQEL 3VXNB 3QEQD 4N8VA 2CLVB 3ET9F 3GHBH 1QFWM 1HINL 4KI5D 4X6CB 4YWGH 1F3RB 4NO0A 4NHCH 4MLIA 3TO4A 4ENEC 1A64A 3MA7B 4PGEA 5I30H 43CAA 3FQXA 3DX7A 4OKVB 4TNVF 3TO2A 4WI4A 1BEYL 4LPUA 3VXOA 4JVPA 2C4XA 1TCRA 4HBCL 5DSCB 4YR6B 2DDQH 4NRZB 1X5GA 3QHTC 2ZSWA 1DJSA 3PL6D 1AGCA 3U6RB 3TFKC 4X5XB 5F7FA 3PWPA 2R4RL 2VZ1A 5EOQH 3DTXB 4M1GL 1DUYB 1T5WA 5IBTH 5DHVB 1NANI 5KW9H 4J4PA 1W0WB 5DI8A 4LVHC 3QXDB 1A14L 1RK1A 1S5IH 3MV8A 2YD6A 3HR5A 2NR6D 3BPNB 1FFPB 1F4WH 2FHBA 3HAEH 1CXHA 3O6FD 1T22A 3HC3H 2OMBA 1CD8A 5ESVB 2KKQA 5E1AA 4BM7A 2A77L 3P30L 3QG6A 1YEEH 3MV9B 3ZT5A 2V7NB 5DQDH 1DVFA 2N4IA 3LKSB 1OAXL 4JFEE 1EFQA 1Q9LB 2EYTA 4AEEA 3P3YA 2X10A 1NJ9A 5FEBA 1XH3A 3BZFA 2UUDH 2VDML 3DSFH 3FFCB 4I2XA 4I0PB 3C6LA 1J11A 4UTBH 4PJEB 3PGDB 4Y0GA 4NIKB 5D7IA 5CSBA 2FEDC 3NFNA 4PTTA 1IBGH 5CS7A 3L7FB 4F33A 4JQIH 1RK0B 4KRPC 1A1OB 5JDSB 4ODSH 1DN0A 3FN3A 1Q72H 5D8JH 3MRIB 2HMIC 2FGZA 2AK4D 1GVIA 3FFCE 4P5MB 4F58H 4OAWA 4PJEE 5HGAB 2P24B 2ICES 1RU9L 3B4NA 1MCOH 2P48B 5IKCB 5DRZA 3EO1B 4LAQL 5BVJA 3EYQC 5DJ6B 1KCVL 4JGJA 3VRLE 1BQLH 2YOCA 2NY1C 4XPGH 1DEDA 4G6AD 3VXSD 2EE2A 3V4UH 4PJBA 3U46B 5IEHB 1OSZB 1BZ7B 1FNSH 5FGRA 5IWLC 2NTFA 1OTTD 4LSRH 3TO2B 3KJ6H 5ENWA 3VXOB 4HF5L 4XGZA 1CF8H 2J8UF 3I84A 1IGIH 1DBBH 2AGJH 4DQOL 5INCB 3CU7A 5HYJD 1G9NC 5D7JC 1AGCB 2FSEA 2QHRH 5CIPH 5JQ6L 4M48L 3ZLQC 4KXZI 3HE6A 1AXSA 3KR3H 3SOBH 3ZE2F 2AJ3B 2B2XH 5LKNA 4Z77A 1NBZB 5KSAD 4ZG1A 1F3JA 2A9NL 3MV8B 4G9DA 4KJYB 3HR5B 4IBLT 4LCIH 3PWPE 5FK9A 4NCDA 3O4LA 4UT7H 1ZA6A 1T22B 3RIFK 3WLBA 3ZYZA 3E6FA 2JLLA 5E1AB 3VFOA 3QG6B 5IMOA 4GKOA 4R26H 4NGHH 4OLWH 2BMKA 4Y5XA 1AKJD 3WNPA 4IOFD 3MV8E 2V2XA 4APQD 2EYTB 5CJQL 4NM4L 2JJUA 4G7VH 4JFOA 5EBGA 1VKXA 1L0YA 5F1KC 4XXCA 1NJ9B 3BZFB 4U0RB 1FP5A 5HVWA 4NKOA 1D5BA 1R6VA 4HIXH 4I2XB 3T0ED 3C6LB 4ETYA 4MA3B 3O3DA 4X98A 3NFNB 4PTTB 2V17H 2MJWA 2XPGB 1DN0B 5F7YC 3U7WH 3CSYA 4WO4A 4K3DL 2WQ8A 4I2XE 1UVQA 4WW2F 1BD2B 3BFOA 1CXKA 3BPNC 5SWSA 5D7IE 2N1KA 4G42A 5J13B 5DRZB 5J6GB 5ICXA 3I6GA 5HDBE 1ZLVH 1FGNL 4Z18A 1C1EL 3GSOA 5FCUH 4PJBB 5DC9B 5IJVA 4FZEL 2UVFA 4EUPH 1A3RH 1NCBH 5KANI 2ZG1A 3S4SA 1X5YA 1HWGB 4P4RB 2NY5L 3ZTNL 2WIMA 4S0SD 4HUXA 4DFIA 5EO1B 3GMLB 4PJBE 1QFPA 5TH2A 4ALAL 1EVTC 3VFUB 4FXGA 4AK1A 3RL1A 4JJ5A 3LH2L 1ODAA 5CZKA 3HE6B 2VLJB 3RWCA 3BRDA 3FZUC 1IC4H 1T83C 4BUHA 4Z77B 4C4KT 3HLAB 4F15B 4HMCA 4JM2A 1CYGA 1F3JB 2VQTA 3AVEA 1I8IA 3O4LB 3V5DA 1XR8B 5M95B 3W9DA 5I1EH 3E6FB 3TO4C 4U7SA 3I75A 4R7NA 1BREA 4F7TA 1SJHB 5IMOB 12E8L 4KTEH 4OM0H 4NQXB 2BMKB 3NMEA 2YXMA 3GNMH 3MLVL 1FNAA 3ULUH 1VKXB 3O4LE 3RKDC 4BZ1L 4YDLB 2CKBL 5CCKL 4HK0A 3QUXB 3SQOL 4HCRH 5TQ2H 4OD1L 5AYUH 1D5BB 2XZQH 3ECBB 5FKAA 3PGCB 1EHLH 3CSGA 1NLBH 3FTGB 2H2SD 1JZ6A 5IBLD 3L3GA 4MXQD 4J4PC 3QZWB 4ESKA 5ILTH 5TE7H 5EOCL 1I7RB 3W11D 3CSYB 4H25A 1PZ5A 2XQBH 1CFTA 3KYNA 4H8WH 4H88H 1CBVH 4NDMA 5EU4B 4YQXL 1MJUL 3NPZB 1CK0L 2O5YL 4U1GB 3T77A 3Q6FB 4TTGA 5ICXB 1QNZH 2F5BH 2IAND 5FFLA 2YD9A 3PHQA 1FCCA 4O9HH 4ODHL 1HHJA 1ACYL 3OKMA 1DVFC 1KELH 4KDTA 2Q8AH 4CL7A 1G0DA 5SWSE 5IJVB 1DL7H 4M9PA 2A6IA 3CJJA 4L8BA 5FAAA 3STBA 1D5XA 4DKEH 4U0RC 1DANU 3S4SB 2ID5A 3CFKA 4E5XA 2IJ0C 5CZVH 3QRFM 4Z7NF 3C6LC 5DUML 5IMKA 4HUXB 3TZVA 4FFVC 1QKZL 1G7PA 1OY3B 4AMKL 4HUMB 4FXGB 3RTQD 4RIRA 4H0HB 5B21A 1ACZA 4JJ5B 3MMEA 5E70A 5GSVA 3KAAA 5F9JB 5I9QC 1TENA 3MV11 1FFNA 1S7VB 2BDNL 3I85A 3TVMA 2PO6A 4B7LA 3TT3H 5J13C 3D69A 3DX8A 4JFPA 4D8PB 3RWEA 2Y07H 3LEVL 3IF1A 4JM2B 43C9A 1MCCA 1I3UA 1JRHH 3P9LA 4IRSB 4PLKD 3UJIH 3IDUA 1CT8A 4N68A 2UZXB 3VDCA 4M6NL 2K7PA 2KDGA 4HJ0C 4R7NB 2X05A 2ICCA 5J89A 3PWJA 4NQDD 2ZPKH 1FVEB 2GEEA 3TCXA 1JPSH 4FQXD 1N7MH 4TUKH 3CVHL 1LP9A 4PBWD 2VISA 1H8SA 5AG9A 5I73B 2AABL 3OX8A 4P49A 4G43A 4OGXH 1JZ2A 3RVUC 5FKAB 1GC1H 3TNMB 4F8TA 3AS0A 3RUGF 5E2TL 4JDVA 1XGQA 5E5MA 4DKAA 2QKIA 4M43H 5C0EA 4TVPE 4LCUA 3HE6C 4MAYD 4MLSA 1PQZA 1PKQA 1PAMA 1CXFA 1SY6A 1A6UL 4WU5A 3MLTA 1NEZA 5E56A 4F15C 1MVFA 1U36A 2XA8H 3KYNB 1H9VA 4EKXA 5MHSD 1WFUA 2EIDA 1N4XH 2WP3T 4XCFL 1EFXA 4Q74A 4Y5XC 1HHJB 5SWQA 3RX8A 3OKMB 4LLQB 3SJVB 4YIQA 3VWKA 5KSBA 4KTYA 3GMOA 5MEPA 2C3XA 5DJDB 1E28A 5I8OL 1UADC 1D5XB 2ZUYA 2BY3A 3ORJA 4QRQA 4XXCC 2IC2A 4PJIB 3HZKB 3UTTD 2VH5H 4E5XB 2X4NA 2A6DB 2D7TH 1YUHA 4ZPVA 3ZKNC 2W9EH 5T5FH 4ERSH 2IFFL 1G7PB 3PQYA 1FNHA 1G7QB 4ZDHA 4O51A 4O58H 1H3XA 1VGKA 4WWKA 1FVCA 3MMEB 4MB5A 4WO4C 3KDMB 5GSVB 5BRZD 4QOKA 2PO6B 3O8XB 4U1GC 1RUPH 2OSLA 3E3QC 4JFPB 1AQDA 4PGDA 3RWEB 5GZND 5E5RB 3IF1B 1RFDH 43C9B 1QACA 1MWAB 5CGTA 1N0XH 1WTGT 5IOPA 5HHMB 3QG7H 5GJTH 5BS0D 1XGYL 4WJ5A 5AAMA 1OAYH 2F19L 5DJZB 4XI5D 5EZOH 3QQ9D 1LP9B 4NQEA 4QXGL 5IVZB 4R96A 5F7EL 3RJQB 3BEVA 3QWQB 1KTLA 2VISB 1MHEA 5HHME 1KCRL 3BAEH 2A1WL 3MV7A 3OX8B 4QTIH 4GS7C 5J0BA 1Q8MA 5BQ7B 3L3HA 1OWRM 1IM9A 2FIKA 3DWTA 5CGMA 4LKXB 5E5MB 5I17A 1G7IA 4LP5A 5C0EB 1J5OL 1LP9E 4LCUB 3EOAA 4IOIA 2FHFA 4FG6D 1PKQB 1TMCB 3V5KA 3MLTB 4JM2C 4N0UA 2YPLD 4UOJA 4JO4H 3ULUD 4OFDA 2VERN 3D25B 1H8NA 1A21A 1QBLL 5IFHL 5IHUH 5HI4D 2X1OA 1PKQE 1RHHA 3RQ3A 4RX4A 4M61B 4OLVH 5B4MC 1JNJA 1NPUA 5IF0B 1I75A 4MYWB 3T65B 2BY1A 2CR6A 1GZPB 1MNUH 3FB8B 1Q9OA 4O4YL 3B2VL 3VWKB 4JG0L 5KTEH 5MEPB 3RNQB 4LSPH 4QRQB 2V9RA 4KMLB 5F8QC 4GQPH 5I73C 4RAHA 3UZEA 2RFXA 1DTUA 5DC4B 2EYRA 2X4NB 3FT4A 1J0YA 3VFTA 1YUHB 4GT7A 1OB1B 5LQBH 5EO9B 1FAIH 1DEEA 4JREB 5KSBE 1G9ML 4ZDHB 5FDYA 1HK6A 4O51B 1RUKH 5JHLL 1BJ8A 4XZUA 4IHOB 1KPRA 1MHHA 5B39G 1FLRL 4WWKB 2J8OA 1FVCB 2UYLA 1F4AA 4LCYA 4QOKB 1R24B 2VSCA 3VXRD 3PQYE 2OSLB 5T3XH 4J3TA 3TBYB 4K9EC 3HZVA 4LIQE 3UTZA 1AGEA 1GGCH 1GRWA 5DK3A 2V5MA 4PJXA 1RJYB 1EJ6A 1IT9L 4KDTC 5KZCD 4QOKE 3QFJB 5GRVL 4JFHD 5DJXA 3CSBA 3OKYA 2VLRB 4WJ5B 3VXMD 1BGXH 4TUJA 1A7PL 4PRDA 4L4JA 4NQEB 2D9QB 2OL3H 3T2OA 1QUNA 2RGSA 4R96B 1H5BB 3BEVB 4V2BA 3TZVC 3ZKXC 1KTLB 4WENB 3S35L 1MHEB 1BF2A 4YO0A 4EBQH 1UM5H 4HQQL 3BP7A 3MRNA 3JV4A 2EICA 1IM9B 5INDA 2ZOKA 4XAWH 5I17B 3IETB 1EIBA 4NQEE 4ODUB 2VDQL 3K46A 3TVMC 2PO6C 3EO9H 1TQCB 3V5KB 2CUHA 4XCEA 1NCCH 3MV7E 5DJ0B 2HFEA 5BJTA 1JUFA 3UAJD 2CDGA 2IPUG 2C3GA 3CZFB 1MIEL 4LBEA 4RA3A 5FUZH 3RVTD 4QEGA 4XNUL 3F58H 4N9OB 5JDJA 1RHHB 2XG5A 2KBGA 4JQXA 5DD0H 1C12A 4TVSa 2PYFA 1NBVL 3HZMB 2FECI 3NCBB 4N0UE 1NGQL 1S7RB 1M05A 1FPTH 1FAKT 1KLGA 1EBPA 1FVDB 5DK0A 3F7VB 4YXHH 2YA0A 1Q1JH 1M1SA 3L5HA 3FT4B 1YPZF 3VFTB 5T1KD 2GYSA 5C07D 1DEEB 1DSFH 2ZP0T 2A6JA 2LABA 4FQQA 1RJCA 4QXTA 4UV7H 4LGSB 2EDTA 1KPRB 1MHHB 3RKPA 2MCPH 3RDTA 4X7SH 4QGYA 4XVTH 5DD6A 4LCYB 4KKNA 3RY6A 4NT6B 5F9OL 3U4AA 4OIBA 1KCSH 4RAUA 3UTZB 1C5DA 1AGEB 4JM4L 3ZDZE 1OWWA 4G80B 4IS6A 4L9DA 4O2FA 4X9IA 3VWKC 2Z91B 3V0WL 1WWCA 4DGYH 2V5SA 5LWYH 1EDQA 3C8KB 4X0KA 4JZOB 2G75A 2H6PA 1C5BH 1JRHI 1UZ6E 3TJHC 5E08L 4Y4FA 5KN5A 5GRUL 5MEQB 1UEYA 4HGKC 4PJXE 5J12B 2ITDB 2R9HD 2YZ1A 3OGCA 3KLHD 1F90L 4YHYB 4JREC 4YO0B 4K9EL 5D1ZD 3JV4B 1FBIH 5INDB 3SE9L 1JHTA 4XB8A 4WWKC 4BUGA 2ZOKB 3JUYA 3U9PL 4HUKB 4B41A 2EKSA 5HHOD 1VFUA 2XZCH 4HX1B 2DI8A 4EOWH 1SMOA 1P7HL 5JW4R 2HFEB 5BJTB 5KBNC 1JUFB 1FZOB 3ZSTA 1L7TL 4G6JH 4PRPB 1RZFH 4LBEB 3LMJL 4KJQD 2R0WL 2R2EB 3PABA 4I13B 1S7TB 3B2UC 3LS5H 3X11A 2PYFB 1OW0A 1U2HA 1WCBA 1EO5A 1NC2A 4P3DA 2FBJH 3HS0A 3CMOH 3WJLA 1R5WA 4IRJA 4PRBB 3FO0H 3U48A 3CFCL 4HZAA 3QFDA 5DK0B 2UZIH 4GAFB 2VUOA 2EDYA 2HTLD 5DGRA 1IMHC 4ELKB 5C71A 2Z9TA 1MJJA 3EJYD 3G6AA 1TETH 3OAYK 2V9QA 4S1DD 2A6JB 5EC1A 4FQQB 1T2QH 4QXTB 3WIFA 2YUZA 1TQCC 3NZ8B 1HYSC 1CCZA 1J0IA 1TITA 2ZCHH 4UINH 5C0BD 2Q87A 1JGDB 4YAQA 4ZUVA 5DT1H 1P7KB 5E03A 4P5KB 4WI9A 1X5IA 4OCYH 1C5DB 4LHJB 4JPWL 2OTWB 4O2FB 2LVEA 4OCWH 3U2SA 5IV2B 4PJ5A 5HYIA 1YEGL 3K3QA 3MRLB 2G75B 4LSSL 2H6PB 1QLFA 1ZLUK 1SYSA 4LMQE 5F70A 5F8RC 4YDJB 3U83A 4Y5YA 3RZWA 2NYYC 3L5WB 1PKOA 5HY9A 3GO1L 4P5TB 1VPOL 2Q7NA 3MTRA 4U05A 2QR0A 5T3XD 2SEBA 4P9MH 2PTUA 3GMRA 3UTSD 1F6AA 1F58L 3AROA 4C83A 3MLSL 5EPMA 2EKSB 1V8HA 4NZTH 2XWBA 1UM4L 3RVXC 2XNAA 4QRUB 1U0QA 2PNDA 1FORL 2GAZA 4R97B 1IRAY 3C8HA 5DRWA 3A0OA 5DR5H 5C7XH 2A74B 1QSVA 2IWGA 4WTXA 4RMUA 3SN6N 1NKOA 1EMTL 2W9LA 1A7RL 2X9WA 4DW2L 1WIPA 5DD1L 3DURA 1RZ7L 1CTOA 1X9QA 3MRKB 4M7JH 1WCBB 3LS4H 5HDQL 1NC2B 5GGTA 3VXUB 1XMWA 5J12C 5C6WH 1MY7A 3QFDB 1MH5B 1I9EA 5D1XD 4XP4H 2QQKH 1UFUA 2WUBH 3MLYL 3G04A 1INDL 1QBML 4R3SA 4NM8H 1CIUA 4MSWA 3JWDL 5FO7B 4C4KO 1DQTA 3WDJA 4OIIL 5FV2A 5F7MC 3UXFA 5F96L 2VDPH 2R0ZH 4PJEF 3BDBA 2P46B 1JWSB 2E6QA 2ICEA 1KT2A 2DLEA 5F3HA 4Z95L 1K5NA 2NY6D 4D2NA 2QL1A 5ADOH 3VRLF 9CGTA 2FX9L 1B6DA 4R8WL 1W0YT 2E3VA 1U93B 4P9HH 4JQXC 4NQCD 2QHLA 3O81A 5DRXB 5DYOB 4MA8H 3BHBA 5GS0C 4LPCA 3FQUA 2P8PA 3K0WA 4KK9D 1YMMA 1XGTA 4PJ5B 5HDLA 4FXLA 4HKXB 1FC1A 2VO5A 4PUBH 4FFZL 2FRGP 3UTPD 4OLZH 2FB4L 2VOTA 3RX5A 5C08A 2YK1L 4Y16A 3VJ6B 2ZCLL 1PYWB 2QR0B 4MHHG 1VEOA 3H3PL 5DQJA 2SEBB 3DGGA 4PJ5E 4EI6A 1C7TA 4UBDD 2DD8H 5IB2A 2HLAA 3BH8A 1F6AB 2FWOB 2Y23A 1V5JA 4X80L 5JIKA 3RDTC 3PE9A 1CLZL 3GKWL 5EPMB 3U30C 2XWBB 4K07A 4ONFH 5K9QG 1IGYA 1S8DA 2XNAB 3RY6C 1S5HA 5EG6C 4HJGA 2D31B 3N50A 3N0PB 2VXQL 3SKUD 1EAJA 4D0BB 3MRBA 3VGFA 3VWJD 5B39B 1EHNA 4I9WD 4YHPA 6FABH 3MOAL 4X4MA 3P73B 1UZ8A 3Q48A 5E8DH 3TH3T 3RP1A 4LLMA 5DUPH 1HCFX 4NHUA 3H9HB 1I9IL 5I1KH 1CS6A 2DMCA 4QHNA 4BYHA 3W5MA 4NNXA 5BOZG 1TZIB 3SDCA 3GRWH 4XNZB 4R7DB 3TPKA 5DVKA 5CKAA 3KPMB 3G04B 2IPUK 2EDLA 4R3SB 3ARDD 1WAAA 1BWMA 4OJFL 4P2OA 4H1LG 4MJ6A 2AJYL 4FZ8L 1IGML 4EQ3A 1C08B 5D7IF 3MUGB 5F3HB 3HB3D 1WISA 3EW3B 1K5NB 5HDBF 2VDRH 3MNWB 3R1GL 5AAWA 1TJIH 3HTLX 5T1DL 3P4MB 4FN0A 3MRHA 4WNQA 4XCYB 4KK8D 4MJ2A 1T80A 5EORH 4YDKH 1FG9C 4FFYL 3CLEH 1U91A 4TSBH 1GIGH 1OW0C 5KVFL 2P8PB 1WZLA 1D6VL 2XYCA 5IIEA 3WJLC 4IRJC 2DQEH 3R4DA 4C57C 1XGTB 5D2NA 4BSJA 2X2YA 4PJBF 4L4TB 5DS8B 3V8CA 3L95A 5E4IA 5C08B 1KJ2L 3P0YL 2J6EA 4J7RA 3W0WA 1YMME 5DQJB 4MAUL 5GSRA 2CJUL 5IB2B 4CUCA 4OUOA 5E7BA 1YYML 1HNFA 4G8IA 4HBCH 4MJ4A 5GS0L 1FV1B 3FKUS 5C08E 2EECA 3MC0A 4R2GB 2X4UA 3GM8A 1S8DB 3EDDA 1XEDA 4M7LL 3H8NA 3VFNA 5D5MB 1L0QA 2R4RH 5HYSA 5C1MB 4M1GH 3SCMA 2VLLA 4G9FD 3DGCR 3EAKA 3MRBB 4TN9A 4Y4HD 3ZTJG 3RU8L 3T0DA 4BFIB 1FFRA 1MREL 1OAZH 1A14H 3JV6A 4LLMB 1MCIA 2X4RA 3MBXL 1T7XA 1ZHKB 4UNVA 4A2MA 4QHNB 1ZGLM 2X1XR 4UB0L 4Y5YC 2EDKA 2KQNA 1JF1A 3P30H 3AREA 3SDCB 3QR2A 3QEUB 4UNTA 1OAUL 3DJ9A 2DAVA 3RGVA 1OAXH 4Q9QL 4PBVC 4P2OB 5IHLB 1YECL 1U3HA 2VDMH 4ODTL 2R2CA 1MJ8L 5IHBA 1WAAE 3RWDA 1OAKL 4LHUG 3ILPB 1BOGB 1CG9A 1YJDC 2W07A 1XGPA 3QIWD 2KZ1B 3D85B 1H3UA 4KJWD 1OP5K 1GSMA 1RU9H 5IIEB 3B9DA 2Y4SA 4LAQH 1CDGA 3ZHKA 3VFRB 5LBSL 1VHPA 1IL1A 1IC7L 3V7AE 4XNZC 4D9LL 1SJEA 3I3EA 1R5IB 3D39A 4OIAA 4KVNL 3QNZA 3L95B 4LSUL 4ZXBD 2UWEA 3W0WB 3N9GL 4OV6F 4NQUA 5D2NE 1TVHB 5HHPA 4HF5H 4IJ3C 2YD5A 1S7QB 2VNCA 1WZ1L 5LAXA 2D2OA 3VGBA 1YA5A 4FMKA 4DQOH 4G8FA 2X4UB 3VFMA 5CBEB 3GJEA 3BGFC 3VFNB 2EXWC 3W0WE 3IRZA 5FM5M 2VLKD 3G6DL 5JQ6H 4M48H 5EBMA 4JHBA 3SCMB 3VH8G 1ORQA 3VG0L 1EH9A 4YHLL 4YHMH 1D9KD 4JM2F 2GJ6A 5B8CA 3JV6B 2ED9A 4LLVA 3EOBA 1X5FA 5FXCH 2AEPL 3N1FC 4AT6A 3SDAA 1E4WL 2NLJA 4KKBD 3X3GL 4F3FB 1FQ9C 4FQ2L 3V6OA 1XGRB 3AREB 4Y16C 4HFUL 1LDPL 2AI0H 5IHZB 2XXMB 4ZS6C 5I1AA 4HS6B 1RHFA 3IDJB 1FH5L 3X14A 1MCBA 3BP4B 3QDJD 5CJQH 4NM4H 1MCWM 3SGEH 3BN3B 4X4XA 3MUY1 4R2GC 1U3HB 4LCCA 3DX9A 5K9OB 1E4XL 1YC8A 1S7UB 2FJGB 1GH7A 4MD0A 1YY8A 2JK5B 1OTSD 4YPJA 4GKNA 3VFSA 5AZ2L 4M5ZL 1CG9B 5GJSL 3QIUA 4CGTA 4BA8A 4K3DH 5DQ9B 1BZQK 5CGYC 2VQ1A 4NBYB 3HR6A 4JVWA 1MAKA 1FNLA 4FFWC 2VITA 5F7DA 4PY8J 3WS6A 5KS9A 4HIHA 1IL1B 1FGNH 1C1EH 3SDCC 1LMKA 2IALA 3O45B 1SJEB 2AJUL 4K2UL 2LU3A 2APWA 3QNZB 5HVGB 5J6HA 4P2OC 1RY7B 3LN4B 2Y1VA 3O3BB 3SGKA 5F7LB 2BOCA 5FM8A 2UWEB 4P4KA 1ZTXL 3RPIA 5HHPB 2Y5TB 3ZTNH 2VXVL 2Q76B 2QBWA 3D39E 4OD2A 4ALAH 4G8FB 1P53A 3AS2A 4PJ9D 1LE5B 1A3QA 1A6ZA 3GJEB 2QADC 2UWEE 3CFJA 1K8DA 3RZCA 3LH2H 5EN2A 3MJGX 1DQLL 4X7TA 4ZPTA 3O2DH 4K3EL 1BHGA 3V9FA 2MNUA 2M2DA 5IFJB 3BRGC 1IAOB 4S1SH 1BFTA 4FQHA 1RUQL 5D2NC 4LLVB 3DRTA 3JVGA 1J1OH 2F53D 5D72L 3MLUL 2FZ3A 3SDAB 2HVJA 2NLJB 3S97C 3IFLL 12E8H 1CDCA 1G9NH 2DWEB 2GJ6E 1JHLL 1LP9F 5EU3A 5FYKE 5A43C 3T2PA 5JPNA 4HLZH 4PG9A 1RULL 4BZ1H 1AD0A 1J0KA 2CKBH 4GW1B 4X4XB 5TFSL 5CCKH 3SQOH 1AR1D 2WBJD 4AIOA 3HNTH 3V6OE 4HBQA 4OD1H 4LCCB 1RURL 2D0FA 5ESAA 1T66D 1YY8B 3ZDXE 3NGBB 3QJHA 3QPXL 3SCMC 4GKNB 3CLFH 5D6DA 1I1CA 5I75B 4TOYL 2VMFA 5DJ8B 2WMPA 1J7VR 4EIZC 5EOCH 4LLDB 4IIQA 4F2MA 5JO5A 4Y2DB 2VQ1B 1MJUH 4CVZA 1CK0H 1MI5D 1NMCB 2O5YH 1KJMA 2VITB 5F7DB 5IQ7L 3CVIL 3IDYB 4WUUD 3PWUB 3C5SA 4HIHB 3ZL4L 2XIDA 3AREC 1UXSB 4J3OC 5IK3A 4ODHH 1ACYH 4UDUB 2VR4A 4ONHA 3X13A 5KSBF 3RGVC 2P5EA 5CINL 3OG4B 3R06B 1G84A 4LOUD 2CUIA 4PRHA 3QULB 4WFGD 5KS9E 1U3HC 3RPIB 4JFFD 2MPAL 3TN0D 4BQBA 4OD2B 3WHXA 1QKZH 5T33L 3QXTA 4AMKH 3TF7C 1U8KA 3DRQB 5IB1A 4EZMA 4OV5A 4H1LB 1WTLA 3QQ3B 5FDWA 2JTDA 3C6SB 3OXRB 4LVEA 2JCCF 5EN2B 2DQGL 4ZPTB 4YLQT 2ICWA 3CC5A 3GUTB 1MSPA 3AUVA 5CEXA 3LEVH 3JV5A 4LHUA 4PYGA 1CVSC 2MKLC 4ZYKA 1JPGA 3BD3A 3PIQA 2HVJB 2H32H 4M6NH 4OZHB 5TE6L 1UT9A 2CIIA 2W92A 1NBYA 1ZV5A 5D1QD 5L8KB 2Z8SA 1LGVA 3U82B 2RB8A 4ORZC 2NW3A 2MHAA 2PYEB 4GG8A 5EU3B 3BN9D 3CVHH 3BD4A 5TF1L 4PG9B 3LKNB 3K8LA 1AD0B 3WYRA 5C0IA 4ENED 2AABH 3S37X 5HGBB 3ARBB 1ZT4A 4JCLA 1N59A 3MGOB 4QRPA 2XRAH 3UTQA 5E2TH 1ROWA 3QJHB 4RBPK 2F5AH 4Q58C 5FB8A 3WNOA 5C0AA 2MQCA 2WLYA 4WFEE 2VLMD 2X7LA 1UM6L 1A6UH 2C7UA 3OHXA 3REWA 5B8CC 4YC2B 2J6EL 3TFKD 5JO5B 1LWRA 2NY2D 1MLBB 4XPHL 4CVZB 1QRND 2H26B 4JLRA 1KJMB 1CGYA 3KPQB 5D7LB 1P9MA 3RPKA 3SDAC 1GPOL 3C5SB 3NVQA 3V6OC 2P5WA 4JDZA 1ONQB 4X6DA 3X13B 4XB7A 4OZIB 3UYRH 3BUTA 2C1PA 1A6AA 3WFDL 1DLFL 2BHYA 4LCCC 3IYLW 3WD5L 4EVNA 3FQNB 3MBEA 3HI6L 3NGBC 2IFFH 4WUKL 2P5EE 1QA9A 1U8KB 4JFQA 5IB1B 4PRHE 3S9DB 5I75C 3ZDZF 3W5NA 3QIUC 2LV4A 2NY4C 4KK6C 4UV4L 2HJKA 5FDWB 3EZJB 2COQA 3PHOA 4Y2DC 2FEDD 1NMCC 4V2CB 3CC5B 2EEAA 5E2WL 1BFOA 3WS6C 3PV6A 1UZ6F 1N5YL 4XVUD 4J3UA 4LHUB 4UQ2B 1M7DA 2LU7A 4PJXF 5I66B 3BKYH 1JPGB 1I7ZB 4NZRL 5BV7B 1BBDL 1XIWB 1X5JA 5DHYA 4L4VD 4C59B 3DIFA 3SGKC 1KOAA 1WBXA 1XGYH 4P4KC 2F19H 4PJAA 2NW3B 4GG8B 4LRNL 3L5XL 5GGUA 4QXGH 3SDDD 5F7EH 2Z4QA 3L7EA 3QI9A 3MLXL 4BELD 1KCRH 2A1WH 2WBWB 3DMMD 4PB9H 4JHWH 5DO2D 1MCDA 3CFDA 1N59B 1L9NA 1EZVX 1HQ4A 2E7CA 4LVOC 2IBGA 3RZCC 3SGEI 3BKCL 3EDEA 3QEGL 3O41B 3EHBD 5AUMA 3DECA 4X6FA 4WY7L 3BXNB 4RGMB 3FQTA 4QRPE 4QRTA 3JVGC 1A6VL 4PYHA 2GTWB 4JLRB 1IGCL 5IFHH 4MD4A 1VSCA 3L9RA 3QDHA 1QSEA 5C0AE 2KZWA 3VH8B 5HI3C 1A6WH 4HWZB 4JPIB 2BOBB 2Y36L 3B2VH 4JG0H 4DEPB 4PS4L 1MFDL 1HDMA 4JFYA 5JA8B 1LVEA 2DQTH 1A6AB 4MB4A 4XVJL 2LE9A 2P5WE 4KMTL 4EVNB 3WNLA 3ARBC 1MFCL 1NCUA 3MBEB 4X6DE 3MRJA 1NCDH 5IVXA 3AAZB 4M1DL 3REVA 2CRZA 1G9MH 2OR9L 5D6DC 1S7XA 5JHLH 1NUFA 1JN6B 5IMMA 2VUYA 3HUJB 4IIQC 2P8LA 1IAIL 5F7UA 4PJ8A 5E99L 5MP6L 1I7TA 3B83A 3WL9B 1UWEL 5DFVC 3HNSL 1C5CL 1G6RA 1LK3L 3PV6B 3LKOB 1M7DB 2FJFB 3CXHJ 2KQMA 4YXLL 4JFED 4Z9KB 1JPTL 1IT9H 2ATPA 3MLZH 5DHYB 3ZYOA 5C09A 5A3IC 3P77B 4V1DA 4DK3A 1A7PH 3D18B 4RWHA 2FR4B 1OP9A 3QI9B 5T1LD 2ZUWA 1CIDA 4YNYB 4Z6AT 4M93B 3IS1X 4HQQH 4L29A 3FJTA 1T21A 3CFDB 3X17A 4PJAE 1HSAA 4WRLA 5ETUB 1RUAL 2IAMB 4EN3A 2BVPB 5EU7E 1BVLA 4EDWL 3G08B 4OFYD