1IE4A

Rat transthyretin complex with thyroxine (t4)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
120
structure length
120
Chain Sequence
SKCPLMVKVLDAVRGSPAVDVAVKVFKKTADGSWEPFASGKTAESGELHGLTTDEKFTEGVYRVELDTKSYWKALGISPFHEYAEVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TRANSTHYRETIN
publication title Structure of rat transthyretin (rTTR) complex with thyroxine at 2.5 A resolution: first non-biased insight into thyroxine binding reveals different hormone orientation in two binding sites.
pubmed doi rcsb
total genus 24
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 1ie4A00
4QXVA 4PVLA 2FLMA 3D7PA 2G5UA 2F7IA 2B9AA 4IK6A 4ANKA 2G4GA 5JIQA 5K1NA 2B77A 2H6UA 1F41A 3ESPA 5EN3A 1E5AA 5FO2A 2H0JA 3DK0A 1IJNA 4IKJA 5CLYA 1GKEA 3IMTA 4IIZA 4D7BA 4Y9GA 4ABUA 2B16A 2QGEA 1TFPA 5CNHA 4TL4A 2H0FA 4TLTA 1ZD6A 1THCA 2B15A 3CFTA 3NEOA 4PWFA 3HJ0A 2G3XA 1TT6A 3IWVA 3TFBA 4ABQA 5FW7A 4IKIA 1KGIA 4L1TA 3IPEA 4N86A 3ESNA 4IKLA 4PWIA 2ROYA 4TNGA 4ABVA 3P3SA 4I89A 4PWHA 3GRGA 4Y9BA 1TYRA 1FH2A 1X7TA 3TCTA 1BZEA 3CN4A 5JIDA 1THAA 5L4FA 1IE4A 4ABWA 2H1XA 4TQ8A 4PWEA 1SN5A 1SOKA 3DO4A 2TRYA 1TLMA 2ROXA 3IMUA 1IIKA 4MRCA 4PM1A 5L4IA 5BOJA 3M1OA 4L1SA 2PABA 5TTRA 1Y1DA 2QGDA 2GABA 2GPZA 1DVQA 3IMSA 5DEJA 3U2JA 4TLKA 1TTRA 2WQAA 3A4FA 3CFNA 3GLZA 5FW6A 4I85A 3CN1A 5K1JA 4YDNA 5IHHA 2QGBA 2G2PA 3I9AA 4PVMA 4TNEA 4TQIA 1BMZA 3CN0A 4TLSA 3IMWA 3GS0A 4TQPA 4N87A 5FW8A 4Y9FA 1TZ8A 5HJGA 3W3BA 3DJZA 4FI7A 5EZPA 5E23A 4IKKA 1SN0A 3P3TA 1X7SA 4TQHA 4ACTA 3I9PA 1DVSA 3I9IA 2IGLA 3IMRA 2H0EA 1TTBA 2G9KA 5E4OA 4DERA 2QPFA 1KGJA 3CFQA 4PMFA 5AL0A 4AC4A 4I87A 3OZLA 1ZCRA 4TNFA 3P3UA 3A4EA 4HJTA 3IWUA 4DEWA 4PMEA 4PWKA 3FCBA 3NG5A 4Y9EA 5A6IA 3CN2A 4TLUA 3DIDA 3DJTA 1ICTA 3GS7A 5AKTA 4N85A 4WNSA 1SOQA 1GKOA 3CN3A 1ETA1 3IMVA 5AKVA 1Z7JA 1U21A 1G1OA 1QABA 2G4EA 3FC8A 1IIIA 3KGTA 1QWHA 2QELA 3SSGA 4IK7A 5CLZA 3DGDA 1BZ8A 1TTCA 3KGUA 4TL5A 5CN3A 2G2NA 2QGCA 4PWJA 3NEEA 3OZKA 1BM7A 3CXFA 1RLBA 3P3RA 4MASA 4TKWA 5CR1A 1DVTA 5CM1A 1OO2A 3NEXA 2B14A 4DESA 4HIQA 5AKSA 2F8IA 4AC2A 4DETA 2NOYA 4FI8A 4PWGA 5L4MA 3DJRA 4HISA 3B56A 4KY2A 5AYTA 3GRBA 4DEUA 3ESOA 4WNJA 1TTAA 1SN2A 1BZDA 1E4HA 1ETB1 3GPSA 4HJUA 4HJSA 5CLXA 2G3ZA 1DVXA 3KGSA 3CFMA 3DK2A 3Q1EA 3BSZA 3GS4A 3U2IA 4PVNA 4TM9A 1FHNA 4WO0A 5E4AA 3DJSA 4QYAA 1TSHA 3CBRA 3BT0A 2FBRA 3IPBA 3A4DA 4MRBA 5L4JA 2TRHA 1F86A 1DVUA 1DVZA 1DVYA 1E3FA 3NESA 3QVAA 4FI6A 4Y9CA 5AL8A 5JIMA 4Q14A 4QRFA 5DWPA 4YDMA 2H4EA 3D2TA
chains in the Genus database with same CATH superfamily
1CICA 5BVPH 3REWB 2XZCL 5G4NA 3OV6A 4Z7WE 3VXPB 2C4FU 5DI8B 3ZUCA 4LLAA 1U3ZA 4DF9A 1JHKL 5LBSH 2ZYSA 4FMFA 3FMGH 3G5ZB 4XOCA 1WUNT 4F57L 4XMKL 4JRYE 3FQNA 4KZDH 1DLFL 1SY6L 3HZVB 1B9KA 4XGZB 1BD2B 2Y5EA 1YY8A 1MG3C 5E9AA 3O9WC 4NBYB 1FNAA 3H9SA 4ODVH 4PP2A 4HZ1A 1X9UA 4JCWA 2R39A 4R9HA 2ATPB 1YEIH 1MRFH 2HTKD 2VDML 2ZWNA 1W6LA 4QTFA 5ERWA 5I1KH 4Q9BA 1CD1B 1PZ5A 2NY1D 3IT8D 1QAWA 5BOJA 2X4RA 2WYZA 4QTHB 1G4MA 1T5KA 1S9WA 2A5UA 1VADB 1CXFA 4I85A 3V0AC 4HUVA 3IDGB 1OZUA 2QR0B 2C1OB 3UTSB 1XTMA 2CHXA 1FZOA 4GSUA 5I1HL 4G9FD 4A63A 4P07A 2X0VA 1U4EA 3L9RA 4Y19B 3GSRB 3JYBA 4R2GB 4Q7DA 4NQCB 3D07A 2Z91B 3DMMC 4MD5A 2DLGA 5FO9B 3OX8A 4AH2B 4YC2B 2AANA 2HAZA 1XV8A 3A6OA 4LPTA 3ULVC 5FYKH 2EINB 1GKOA 5FGCE 15C8L 4BYHA 5JPNC 4MDIA 1I85C 5D7EA 3ZDYE 4K9EC 2PCFA 3EJCA 4I4WB 5E6IB 25C8H 1UYWL 1TCMA 4OCRL 5GGQL 1QRKA 4P59H 3UCQA 4AXWB 1ESOA 2E0PA 4OZFG 3NRFA 3HC3L 4OZGF 5I30H 3WIFA 4NXKA 1I3RA 1DN0B 4MQ7B 4NFCA 3S36H 1C8QA 1IC7H 5E2UL 1J9QA 2WKOF 4V2CB 3FQYA 2OAAA 2G75B 2K7QA 3L95B 2EE6A 5DZPA 2VO5A 2VDNL 4G11A 4HHAA 2VYRE 4ZOEA 3IS1X 1DJYA 5E8EB 3FPXA 3VFWA 5AW4B 1TETL 3QG7H 4EI5D 3ULSB 1U3JA 4X4YA 3FRPA 3QDHA 4H8PA 1JNJA 2SEBB 1AR1D 1TZIB 1M56B 2LE9A 3T1FB 3BPOB 4F27A 1ZOXA 2WTRB 3LTVA 2WUCL 1E6OH 4C55A 2CPUA 2XXCB 3FUMA 2KL6A 4FQJL 1PX8A 2BRQA 2FLMA 3KPOA 1BHGA 3IDNB 3GI9H 4K3JH 3FQXB 2Y5QA 1XQ4A 3DX4A 1L0PA 1QHOA 5J12B 1GZHC 1IBDA 3ECVA 4HXAH 1T1WB 1RUKH 1KDJA 1NLDL 2BVYA 4A1RA 4RSYA 1I8MB 4EZLA 3BEVB 4BFFA 2W07A 3QIWD 2B9BA 1RZIB 3BXNB 4AM0A 5HDBE 2ZOLA 1A9BA 5B38B 1N68A 3VFVA 3PABB 4CN4A 3KXFD 3LKNA 5TJWK 5JQHC 4X9GA 3CH1B 3FUIA 5CIPH 4Z18A 2MQ0A 2JLPA 3B5TA 1FRGL 1DQKA 1GPOH 3QH3B 2AKRA 5HGAB 2IBGA 3NYKA 4IJ3B 4CC4C 4HAFA 2GQHA 4M5TA 4CGTA 2EEXA 4LSVL 4O51A 5L2JB 3NGBB 2GCYA 2NXZD 4UQCA 5I24A 1B2WL 4H44C 5EBMA 2ZCHL 4JPIA 4X9BA 3LN5B 1XD0A 5EWIH 3CSPA 4EUPH 3Q5TA 5AVQB 2W0LA 3Q6FA 4Q6KA 4QCIB 4AENB 4DQOL 3E8UH 1KBVA 4PR5B 3CCHA 4P5SA 2ESVB 2EUVA 4MSWA 1IAKA 5FKPA 3E6HB 3MV8D 2NXYD 5DD6B 3HHSB 1TYEB 3V6ZA 4BH7B 2QPFA 4AMXA 5FM5O 2BFVL 3IRPX 5T1KD 3STZA 3B2VL 3BKYH 1RJLA 3X14A 4CMHB 1I8UA 5M7QA 5D93C 3QBTB 4PRHE 2QPEB 4M1CC 5CEXA 5CKAA 2O5YL 2LAAA 2JXMB 1SY6A 1JN6A 4ICXA 1V3MA 1RXLA 4O2CA 3VXUE 3WIHH 5KG9B 4P5RA 3R06B 3CPLB 2JK5B 1E9OA 3VXRA 3DNKA 1H19A 3TNMA 1TMQA 4JPSA 2DQFB 1NFDF 3OAWA 2BZCA 5E99L 4ZFFA 3CFBA 3ECBA 3TIEB 5CBEB 4EOWL 4N0CD 5IMOB 1HHJB 2E75C 2UZIH 4NQCE 3VFTB 2LW3A 1TZGH 2XV2A 1OF2A 1XO8A 5DHVH 1VEPA 2OR7A 2F8OA 5IOKA 5JLZB 4Z1PA 4MLIA 3QT2A 3TYFA 1T0NA 3OGOE 2V8LA 4MJ6A 3MACH 1E5ZA 3L2MA 3PPSA 5IROD 1JD7A 1AE6H 4E9TA 1SZNA 2A6KA 1JZIA 5DT1H 5E8DL 3NJLA 1A7OH 1KXHA 3ZTNL 3M1CA 5KSAC 1CDHA 5EU7C 3REVA 1T1ZA 3MXVH 4G6MH 3KVPA 3AWGA 3HI6L 1RZJH 5HHOA 3AREC 5IM7A 3LQAH 3C08H 5DWUL 3O2DH 1JF5A 2DY2A 4LIQH 4XX1E 2BSRA 2V2TB 3QEGH 1L7TH 2WQVA 4XBGB 4BQ6A 4R0LC 1OSZA 3HJ0A 1UT2A 4W9FC 2CLZA 5E6RB 2XVKA 5FX3A 1WD8A 4EDWL 4N9GB 1CB4A 1HSBA 4RFNB 2E7HA 2FJGB 4Y5YB 2ENSA 2H1PL 1SVZA 3RL1B 3T0ED 4AEHL 4F8LA 4QHLB 1P1ZB 3WFHB 5EF2A 1LJMA 2XSKA 4ZW8A 2Y2WA 3S35H 4JNXA 5DC4B 1KMGA 1G6VK 1PL3A 1CN4A 4GS7C 3CFDB 1YAZA 3LZNA 3PNWA 8FABA 4XBEH 1ZLWK 2P28B 4GUQA 5DEGB 1IAIH 5K1JA 1OCOB 3D2UD 4IRJA 1YG9A 3H7LA 2VDKH 3K2MC 4JG9A 4F93B 4OV5A 1WYJA 4FCHA 2H26B 1WLHA 2JKTM 3GXNA 3IRCA 3CHPA 4U1KB 5ECJE 3P9MA 4DT2A 1IM3A 4TLSA 4HJGB 3VW3L 1YNLL 4JFEB 4DWHA 4EUPG 3BWUC 5LXGL 3DRQB 1P7KB 4JM2C 3FT0A 4NZUH 2ZUWA 1OGSA 3B7YA 5IEHA 1L6PA 5DJYA 3BOVA 4PRIE 1IARB 3UC0L 4PREB 2QVFB 2BC4B 3Q7JA 1P5VA 4OD3H 3PWVA 1BBJA 3P3UA 2K8QA 4OU3A 4ZAKC 1DP0A 3DIDA 3BQVA 4U6XB 3TFKD 1MOEA 2CUHA 4XMWA 2YPVL 2HFFA 4HULB 1MHHA 1E4KA 3O6KH 4FX5A 5C3IA 3M17A 5F0MB 4XPAH 3FTYA 4JFFD 4UM9D 4EF3A 5IHWA 2DYPA 3ELQA 4MBOA 4X5XA 4X7DC 3CHQA 5LGHL 3SOBH 5IHZB 1Z5HA 4HALA 1OOWA 5H35B 1NAKL 1P7QB 3UGUA 3OGCB 4U6VL 3KEHA 1LD9A 1DQTA 4HIQA 1OF0A 5AZEL 2I60H 3JWNE 1F3DJ 1GC1L 5CGYC 3WEXA 1I1AA 2WXGA 4K94C 1AHWB 4XP5H 3BO8B 4DEUA 1IQWH 4ZFQA 1DFXA 3MCLH 3ROOB 2KQMA 2ZUTA 4BQ9A 2JJUA 2C3WA 5KBNC 3QJSB 1W8NA 4LBEA 3TN0D 2VE6B 4URKA 5A3IC 4XE5B 5DZNA 1LTXA 4Y8AA 4FI6A 1ZLVH 2XXMB 1E27A 2XY1A 3MUGA 4YAQA 5DJZA 3S3SA 4HUXB 5TGBA 3QO0B 4FQ2L 3ILQD 3ARBA 3MNMA 4EIZC 4WW2F 1NDTA 5JZ7C 4FXGA 4XP6H 3BUIA 3PF2A 1R46A 3CXHK 4IRSB 2F74A 3X1EA 1J9CT 3K3QA 1LEKB 4S1DD 5F1OB 3R18A 1KCVL 2EKJA 1YECL 3VWJD 5IR1B 5DJ0A 1T21A 3H85A 3KPNB 1T0MA 5D7JB 4FHKA 5EFIB 1HHKB 3UTZB 5JQIB 3S7GA 3B4NA 3CDYA 2AXGB 3RX8A 1RP8A 1M2VA 4XN8A 5TDNA 1BZEA 4XO9A 3BHBB 3GM0A 4KKZA 3OD3A 4AQ1C 1NEPA 4NJ9L 3RI5K 5ANME 3UL4A 1UM5H 4CKVX 3QXWA 3ZDZF 3Q2VA 1ZIAA 1GZPA 2LR4A 1OOAA 1CF8H 1SBSH 2DM7A 1UWGH 3EYOB 1QQDB 4RAUA 4UIMA 3QWRA 3TYGH 2WVUA 5B7FA 3L5WB 5AW7B 1WHPA 4ZNEE 4ODTL 4OAWA 1U91A 2VLRE 4KUZH 3DPBB 5BZWB 1OGAB 4GRWH 2CA4A 4PD4J 2LLNA 2OSWA 3L3GB 1CU4H 4GT0A 3T9WA 2UY6A 4X6DB 3O6MH 1M9SA 1OL0A 1WEJL 2QKIB 2X2HA 4QHNA 1G1KA 4FZEL 5EU5B 3RTQD 5E00A 2EDKA 2YD6A 4FFTA 1SQMA 4UTBH 4Z95L 4ZI8A 3NZ8A 4YDIL 1G7IA 4DN4L 4P9ML 1OW0C 4HJTA 4TOYH 4M3HA 1DBJH 4LOEA 4MNGA 4AYBA 2VXVH 4JRWA 3H4FA 4NNXA 5AKTA 2GITA 5EH1A 4ALAL 1WBZA 2IH1B 3FQUB 1BMGA 3LS5H 3MLRH 4G6JH 2D4FA 4H0LC 3BVNB 2C4FT 4ZSOB 1O7VA 4HWZA 5CLZA 1BZ9B 3ZDXF 4AKOA 2WCPA 4LNVA 5E9DB 5GS2H 2YC1B 5GHWH 3VSQA 1NCDH 1IX2A 1PD6A 3CXFA 3UJIL 1F0LA 3KLSA 4MCZA 5BVPL 3PL6D 4GBXC 2X05A 4HUKB 2TSAA 2A9NH 1YY9D 4YEFA 5LBSL 2MEJB 2RTTA 4LPXA 5CCKL 3FMGL 4RGND 3KJ4B 3EGSB 2JB6B 4OLVH 3J7HA 1ZSDB 2F08A 2EXYC 3TM6A 4GW4A 4GY4A 4MQTB 5JIIA 2RCSL 4N8VA 4JRXB 4PGCA 1PW3A 4X6CE 3GNMH 4M7ZC 1AXIB 4ODVL 2Z31B 4WWID 1ZDQA 1YEIL 1MRFL 3ETBJ 3QJFB 4HZLB 1UH4A 3VM7A 3ZRSA 5I1KL 5JORA 3WEAA 2D03L 2UYLA 2X6AA 1L9OA 1G9EA 3P4LA 3GIVB 2CUAA 3AQXA 2FT8A 3GXUB 1AMYA 5EN3A 3ESPA 1DQMH 3NDYE 4MA1C 4BH8A 1XR9B 1IZKA 2ITDB 4PAZA 3BRDA 5B3SB 1QA9A 4XXWA 4F5CA 1HC1A 5GISH 4XMUA 2J5WA 1ZT1A 1MFEL 2YXMA 5L7XL 2YPVA 3X3GH 2AEWA 3RPIB 1SLWA 1M1XA 5L0QC 2YUWA 2Z1KA 1NFKA 3A23A 4DOHB 5JOPD 1ROCA 4PJGB 4W9IC 4FNSA 5A2IH 1OGPA 1GSMA 5C09E 1MCCA 5LNEA 4QRSA 1JDCA 1MCPH 1UTDA 1IE4A 1LYQA 2H7WA 1JZDC 5CHNB 2A2QT 3VQ1C 3QUZB 4EZJA 1Q1JL 2PCPB 3IGAA 4L2LA 3TPUA 4LCIL 1CWVA 4BXVA 1P9MC 1AZNA 4PJCB 4NWUH 1LWHA 5F7WC 4P59L 4R84A 3RZCD 4ZBJA 2Y06H 1YZZA 2PWEA 4K8RD 1AQDA 2O6FA 2VO8A 3KL0A 4PRPB 4Y5XA 4QRPB 3FO2B 4ZFZA 1QR1B 1IC7L 3ZZSA 2VL4A 3TL5A 4ZUVA 1COBA 2FX8H 3QPXH 3RPBA 1QEWA 1FFPB 1M7XA 1SUHA 1KTDB 3CAFA 3D3VA 4PLNC 1A6TA 1HWGB 3FCBA 2X4QA 4WSGA 2W88A 3UEZA 3MUHL 3QG7L 3RPKA 2Q9OA 1QASA 5ICZB 4GRLD 4GG6A 2RFXA 4PJFB 1O0VA 4XZ4A 4G8AC 3FTGA 2XBZA 1E6OL 1CGVA 1CFBA 4HIJA 4GKNB 1AS7A 4P9HC 4ZTPH 2OTWA 2Q6WB 3HRZB 1UOWA 1JE6A 3ISRA 4NQDA 3MYJB 3A6CH 3GI9L 4K3JL 5CUSH 5HPOA 4LK4A 1RUAH 3W5NA 2NOYA 5L4MA 5KYXB 1ET7A 3IFLH 4BSWB 1EFQA 4M1DH 4U33A 1G9NC 2WP3O 2F53D 4HXAL 1RUKL 4LPWA 3IJEB 4KKAD 1CICB 1BZDA 3P0GB 3VGEA 4C56A 5B8CB 4CU7A 5BVJA 1QTPA 4FG6C 1ET5A 5ESAA 2NY6C 4K71C 1AR1B 3PP3K 4NXSA 1D9KC 3QFGA 4F2FA 5MEQA 1TENA 3DUUB 2Q1EA 3Q5YA 2MCMA 3GKWH 3NRPA 3R1GL 4OZFA 3S37L 1FNSH 2JTYA 2DW5A 3K46A 3OXRA 2C8NA 1ECYA 4NFDA 1QNIA 3FQNB 4J39A 4NENB 3B3IB 2NLJA 1HQRA 1XH1A 4HCIA 3HS0C 4Y4FC 1TF4A 4R90L 5D1XD 3QYMA 3B2XA 3LKQA 3K74B 1UACH 2H41A 2FWOB 4NM4H 5ERWB 4ZX5A 3B9VA 5D1QA 3R8QA 2E7LC 5CBAB 2OI9B 1PZ5B 3GSWA 1U2YA 1IJ9A 1SVBA 5EWIL 3IBEA 1ZSHA 4WW1A 1NC2A 1FQ9C 3KCPA 1G7QA 1S9WB 3DX6A 3IKKA 1S8DA 3F64A 4JG1H 3WO4C 4Z7OB 4HUVB 5D6DC 1AO7A 1RMFH 4NO2A 3P3SA 1LNUA 4I89A 2A9MH 1I9RL 2APWA 4N6RA 5C0CD 4FS0A 1FZOB 3IETA 3TBYB 3RJDA 1C7TA 2HKFL 2NYKA 2B2XH 2CBOA 3BKYL 3L9RB 4ZMYA 2EECA 4FXTA 4A7GF 5DR5H 1MJ7H 5LBSA 3EO1A 3FB6A 4B7IA 2EEBA 4MD5B 3BN3B 3OX8B 3W82A 1A2YA 1E8YA 5DVLA 1KXVA 1EJFA 3WIHL 3LZLA 2N0MA 4DPRA 3VA6A 3DV6A 1M05A 5KOMC 5CJBA 1KN4H 4Q6YA 1QEXA 2PCFB 2Q20A 4DEWA 3I9PA 5E4OA 2H0EA 4GIOA 1YMHA 5T1KB 2J44A 4NN7C 3U46B 3L3JA 3MJ9H 5F3BA 1A7BA 2UZIL 3JV0A 3ES6A 2VABB 1A7PH 1TZGL 3T77A 1KN2H 2P4AB 1KT2A 4Z7NF 4Z7QB 1PLBA 2JCCA 2VXSH 2IPKB 2MCPH 1F00I 5JHDE 3MACL 1EJOL 2KMWA 1W9XA 1AE6L 2X0UA 4HMDA 1JGUH 3U7WL 3C5ZA 3VFWB 1XAKA 2P5WD 7CGTA 2Y3NA 4PJIE 4YO0A 4MLSA 4OKVA 3FRPB 1BF8A 1HZLA 5BV7H 4PUBL 1MXDA 1RZJL 4K7FA 3LQAL 4POZD 2CJTA 5EU4A 2E7BA 2KBGA 5FO8B 3O4OC 3EYUH 3BH9A 2ZWZA 3GRBA 1OCWH 1BAFH 5C0BD 1DZ0A 3UXFA 5I0VA 3ARSA 3T5WA 4JUSA 5CAYB 4ZXBC 5L2KA 2R0LL 3MNWB 2DPKA 3KWWA 1EUTA 3Q01A 2ARJQ 2HMIC 1G94A 1NL0L 3S35L 5I71C 2ZOLB 3Q05A 1A9BB 1FCGA 4JMNA 4XBEL 3LKNB 4ZX3A 2G4GA 2Y0SA 4HKXA 1UB5A 4P46D 2AAVA 1IAIL 4PJDB 4ZO9A 2VDKL 3Q06A 3G08A 4Q8BA 2VLKA 1K9TA 2AKRB 4KI5E 2D8KA 1YC7A 2BP8B 4BZ1H 3G6JB 3MKKA 4HKZA 3CUPB 2D3NA 4KK9D 1RJCA 3FN0H 2XG4A 3T0EB 4OLYH 2VOTA 1RAMA 1QLEB 1ETJA 2GCYB 2ED7A 5DVMA 4JPIB 4HAGA 2X6VA 4WEUD 1EUUA 4E42A 3H3BC 5KSVA 4OD3L 3Q6FB 4GKZB 3PXLA 3QJZA 5SX4H 4XVSH 5HDWA 3QDJA 3VAEA 1JPSH 5AOIA 2VAAA 1IAKB 5FKPB 3SPHA 1BVNP 1IU1A 1ZRUA 4WKXA 2XA8H 2YGNA 3H9SE 4K3GA 3FQ2A 3I75A 4XPAL 2CO7B 4GMSH 4ORGB 4PBVC 4RIRA 1JMXA 4ZDHA 1EERB 1N6QL 4E0RA 2B1HL 2GIXA 3SBQA 1TJMA 1RVFH 3B5HA 3OKKA 3R19A 4GI9A 5EV7A 1CI3M 3QIUD 5FHBH 3MRCA 3X14B 4ZMPA 1GXEA 3TO2B 4UWQB 1QKZH 3NIGB 1CMOA 3O9WA 1CFVL 4DERA 3LH9A 1YPZA 2FYYA 3IPFA 4LRIC 5CIPA 1JN6B 1KGJA 3RFZB 4XP5L 4O2CB 3CDCA 3TA3D 1IQWL 3L1OL 3GBNL 1GW0A 5DJCA 3D6GA 2GVYA 1JUFB 3QUXD 1E9OB 2N7SA 3VXRB 2DQ6A 4NJAH 5CGBA 3DYOA 3MRGA 1Z3GH 2VDMB 4UM9B 3QCTH 3CFBB 3ECBB 3DUHA 2CNZA 4GUCA 4PQXA 4FCAA 5LG1A 1KFAL 1JYWA 4PJ8C 3HZMA 4EUPA 1OF2B 1RZ7L 4KY1L 1KENH 3IDMA 1A64A 1N12A 4PIBA 3S98A 3QQNA 1JMZA 5E5MA 3RYMA 2YEVB 4P23C 4AYEC 4JN1H 1T0NB 1TXKA 5T33L 1SUJA 1KLUA 2LU4A 4BV1A 2D3VA 1B6DA 3OB0H 4XP6L 2E6QA 4HPYH 4BM7A 2C7UB 4APQD 3ZSSA 2WZ0A 4DPBX 1NMCC 3D12B 4KVNH 1RZKC 2XWRA 4N2NA 3UFIA 4X8JA 5IM7B 5HHOB 5KYUA 2YZ8A 2XKSA 1CTNA 4U7KA 5HI4C 2ZJSH 3D4CA 4WI5A 3WFBL 5JPNA 2EYSA 1E5UI 1BVLA 1I85A 1YJDH 3AW5A 4GG8A 3WIHA 1G5GA 4PY8I 1OTTD 4WHTA 2CLZB 5B4MC 5EEXA 3N42F 3L08A 2AJ3A 1UM5L 1HSBB 2R56L 3FU8A 2IBZY 4QUOA 1OSEA 1ZGLP 1F41A 4HOZA 9CGTA 4BWWA 1C16A 1CF8L 3H2PA 1UWGL 3VWJB 3TYGL 4Y9GA 3ZYIA 4JE0A 1X5AA 5DHVA 4QO1A 3H2QA 3K80A 8FABB 3L3HB 1G9MH 2QTEA 3K8KA 4KUZL 4UOW1 4Q97A 2VMFA 4DVBA 2VDNB 1ZIBA 4OV5B 3ABLB 2ICCA 1IM3B 4UTBL 4LCUB 2BNRD 2DBLH 4P06A 5TFSH 4TOYL 2IADB 1DBJL 1IGCL 4KNUA 2DTSA 5F0PB 4Z7UA 1GAFH 2AVGA 3ENEA 1DBKH 4WUUA 3LV3A 5AUMA 3JV5A 4BSVA 1DANU 3MLRL 1KCLA 3K6DA 3LS5L 4G6JL 4LNRA 4XI5C 5IEHB 2VJ8A 1P5VB 1BBJB 5KS9F 1BMZA 1KIUA 4WI4A 4XCFH 5ANMB 5IB4A 2R59A 5C6TH 1E2ZA 2UZPA 5BZZA 2VDLB 4LGRB 2HFFB 1MHHB 3RTQB 3WTVA 1JZFA 5DZJA 3M17B 5F7KC 4MVBD 4DAGH 2FK9A 2VW6A 3P30H 3U9UA 1FFOA 2DYPB 3H9ZA 4P2AA 4K7PY 2F1BA 1AGEA 2QBWA 1HIML 2LTQC 5EO0B 4GO8A 3P2DA 2FVNA 3AXIA 2ITFA 3GNML 3WEXB 3ZMNA 1A1MA 4HMCA 4W6WB 4IBVA 1B0IA 4JGJA 3TH3T 1AP2A 3PL6B 4HS6B 1TTCA 1P84K 1R47A 2VUYA 3AAZB 1FNGA 1H5BC 2J8UF 3V8OA 3DMMD 4LBEB 4FZ8L 5KBPA 3QJVB 4AVJA 3NA4A 5D4JA 4E9XA 3FCTA 5JW4M 4DESA 32C2A 2NY5H 4RGNB 1OAXH 3VTMA 3OAYK 1DQML 3ULVD 5K9JL 1J1PH 4MNHA 3UBXI 1EMTH 1E27B 3MUGB 4YAQB 4W4NA 3IGUA 1IBGH 1Z9PA 4HA1A 3ARBB 3NSCA 3W9DA 4F37K 2RB8A 3FTXA 5F3HB 1NTDA 1NANI 3CVIH 4FXGB 2YLHA 1MH5A 1FAIH 2EABA 2O6CA 4Z3TA 7PAZA 2IH9A 5CILH 2F74B 4L3EA 5KBDA 1MFBH 1MREH 2D73A 2BVUA 4P5KA 5EIQA 3ULAB 2CU9A 5DJ0B 3ZO0A 1T21B 2FHBA 4FGMA 4P04A 1T0MB 2FSEA 1QPPA 1K6QH 1M2VB 5TDNB 1NGZA 2DIEA 3MLTB 4NWUL 4LFHG 2BNQA 3O45A 3VFRA 1GS6X 2EZ0D 2WXMA 1FFQA 4A66A 1TT6A 2XQYG 1JFQH 4L8SC 5F6IC 1GZPB 4KPHH 4YZFF 3ZHFA 2UY7B 3BAWA 3L4UA 4RAUB 4UIMB 1MNUH 3I6KA 2FX8L 1HZHH 3K72A 5HYJA 2XWTA 4LLVB 5BO0D 1ERNA 3FAXA 1TO5A 1U91B 2N1KA 4PWEA 3MJGX 7PCYA 1P4LA 1PDKA 5ESVA 2UY6B 1E9QA 1PX3A 3KH3A 1SFDA 1UURA 3F12B 1C08A 2M1KA 2AJXH 4PJAE 5KSAA 4QHNB 1K3IA 4CU8A 3AY4A 1Z66A 3IFNL 4NNYA 2I25N 2IDQA 1KWGA 3ABKB 3GLZA 5KSBB 3F7YA 4WW2C 1QSFA 3RKDC 3NZ8B 1G7IB 2P44B 5GZOC 4CN1A 4GAGH 4MNGB 4P4KC 3FQ1A 4NNXB 4ZX4A 2WWMD 1YYML 4ZTPL 5BUGA 4U3CA 4PJXF 1RIHL 5CUSL 5GRXG 3IDUA 1RUAL 3OC5A 4M1DL 1S9XB 1OSPH 4AC4A 1WCBA 1WFIA 3ZKXC 3OJ2C 5E2WH 5F7LB 4GRLB 4LAQL 1HWHB 2K6WA 3CC1A 3VD5A 4OFDA 2W9LA 4CVZB 5HI5C 5LNDA 4IBUA 5AKVA 2ZAIA 2WMPB 3GKWL 4N2OA 4UNTA 1FNSL 4OZIB 1WBXA 1QSEA 4HUNB 3VNYA 2PYEE 1QUNB 1NPUA 2OYLA 1AG0A 4KXAA 5C2BH 2VLRD 4U05A 2G60L 5GRVL 3ARTA 1LQBC 3PY9A 4N8VB 5BRZD 3MO1A 1ZLVK 4PGCB 2NSMA 1OHZA 2ZNWA 2W1NA 3MQIA 1UACL 2XZQL 3ZTJG 1MJJA 1ZE3H 2XV3A 5JTWA 4UTBA 2XTJE 1TEFA 2YUXA 2ZONA 2IV8A 2KZWA 2NYZA 4M1CD 3BP7A 1XZ0A 1CS6A 1ASQA 2WAHA 3MLSH 5DRWA 4ZAKA 4N68A 4NYLB 2H47C 4BH8B 4BFGA 2VAJA 2J1ZA 1RMFL 2NY3B 3HBPA 2UWEA 1QA9B 1B0GB 4PY8J 3SO3C 1TZHA 4XC1H 1B9ZA 1N64H 2AFNA 4TVPE 4EIBA 1M1XB 4JHVA 3QULA 5D1XB 3L5XH 1ZGLA 3E38A 4LQ1A 2ITCA 1DUYA 4IDJH 4MJ2A 3SGDI 1MJ7L 2WBJC 2EUZA 2LFGA 4K73A 5CJ5A 1KYAA 1BIHA 4P2RE 3PREA 1QLFA 2K0RA 4ZO8A 4X99A 5LLIC 4MJHA 3O0RL 3P2BA 4ZS6C 3IGAB 1IAOB 1QFWH 4KKLC 3D0VA 1KN4L 3NJNA 2BH0A 3ERXA 3R4RA 3MRHA 1A7QH 5MP6H 1GW6A 5EN2A 3AG2B 3ZL4H 3GHBL 5AYQA 3I6LE 2BS9A 3ARED 3UAAA 3PWNB 1AQDB 4ZFZB 3U83A 3G5VA 1EV2E 1KN2L 5CS7A 4L1SA 3ULUF 3WNPA 2VXSL 3AB0C 3L1FA 2MCPL 5HI3C 5K39A 3HHRB 1FL5A 2C5DC 1N8OE 3S3PA 3MLPA 4TQEL 4OGYH 5TDPA 1A6TB 1JGUL 2X4QB 4I3RH 2ID5A 2IGFH 4M3KB 1T89C 3W9EA 4TQPA 4PV8A 2X1QA 4LEBA 2JKIS 4H25B 4IBTA 4BD4A 4F7EA 3VFGL 5BV7L 4GG6B 5C09D 4Z7VA 4B9GA 5HGDA 2LVCA 3KWTA 4CU6A 3MRQA 4LPYA 1G9NL 3WTTA 2OTWB 1S7UB 4ZMQA 1A6PA 3V4UL 3T1WA 1WV7T 4ANUA 4BQCA 2I9LB 4Z8FL 3TPKA 2L04A 2P5WB 2VRKA 2XV0A 3K6IA 3O11B 4JM2D 4M1GH 4N2CA 4BK5C 4C56B 5BVJB 3BH4A 1NGPH 2V9UA 3T3ME 2GJZA 5ESAB 2IQAA 4PCYA 5DRZA 2J2ZA 4X5PA 1I75A 5MEQB 3WKML 4KC3B 4OZFB 3ILDA 2XFGB 3BUQA 4FOMA 2BY2A 5DLLA 3LEYH 4FI8A 5C0BB 4D2NA 1BFTA 4XP4L 2NLJB 2VQ1A 2H3XC 1TQBC 1AC6A 3DX7A 1JYNA 3GMPA 3GS4A 1CDBA 3ARGD 2Y3AA 4LCCC 1AIFB 2ISDA 5D1QB 5DD5L 4YDZA 1UENA 1NGYA 3HAEH 3O3UN 3ZTCC 1HEHC 3L3IA 4TNVF 5L4JA 3E3QE 2DMGA 4WW1B 1NC2B 5E5UB 35C8H 4I2XE 3KCPB 4WWOA 2AMGA 4P46B 1DBBH 4FA7B 2ZZUT 1S8DB 5CMAA 4CJ1A 1JPSL 4GSRA 4KXZH 1AO7B 4A7QA 2C9AA 4GBXA 5I17B 1LNUB 1IKNA 3V6OA 4MHHI 1MAJA 5DHYA 4P2QD 4A2DA 3IETB 2LU5A 4OZHB 5I9QC 2WXKA 4GMSL 4NUPA 4GKSA 3COOA 2MKLC 4HHWA 1UQSA 2IJ0C 3MREA 4ZYKB 5A3ID 5KW9L 1RVFL 3CFTA 3HE7D 4O02H 3MGTA 2CKBH 5SX5H 4YDLC 3FB6B 4JGUA 1UA6H 5IUCA 4HG4K 3VM5A 2Z8VC 4ZD3L 3HCVA 2Y5TA 3RHWK 2OBGA 2ILLA 4XHJD 3NCFB 2J1WA 5JR1H 1G87A 2DH2A 1N59A 2XU9A 2XQBH 3VXNA 4L2YA 4JO2H 2P5ED 3V4PL 4G8GA 1GYUA 4YSEA 1YQ2A 4IS6A 5EORH 3JT2A 4XZUB 4YX2L 1Z3GL 3JZYA 5EEUA 1NBCA 1ZT4B 1XEUA 1TJIH 4X7TA 2YGQA 5F3BB 4JQXC 3BUTA 3HVDA 1V3LA 1TQSA 3ES6B 1UG9A 3QIUB 2ZSVA 5KVGH 4WHYG 1MQ8A 5DUMH 1KT2B 2H3NB 3GMQA 5EIVA 2JCCB 3EDEA 5LDSA 3HG3A 1SXCA 3SE8H 3OMAB 3DO7A 2XOTA 4JN1L 4KZEL 2X4TA 1M1SA 1VESA 2UUDK 5KANI 2MSPA 1AGDB 2Q3ZA 4TPRH 3FO0H 2EEAA 3GIZH 3IFPA 3QUXB 3C5ZB 4HPYL 2YBGA 1A4KB 4NRXA 4RMRA 1U9KA 4NP9A 5H2BA 3S88H 4YO0B 3HNSH 4NLHA 5TPWH 2D7QA 3HW7A 1CIDA 1SJEA 3ETTA 1UA3A 4UILL 1F18A 3F7KA 1XGPA 3QSKB 4CADA 3BAYA 2N0KA 4UI2A 4QJ4B 5EU4B 3DURA 3HG0A 1U3HC 3NIDB 4WEBH 3UO1H 1YJDL 1PGRB 4DKDC 4WVRA 3IU3A 2WANA 5K59F 1P9MA 3OKOA 5C97A 3NZUA 3D3VE 3LXBA 4S2SB 2X87A 5FIEA 2E8ZA 4FFZH 1EXUA 5FYLH 3KLQA 3RGBA 5BS0D 1CT8B 2YEZB 4L9LC 4APQB 4XN9A 1KV3A 3VI4B 3GSQA 1U3NA 4XNBA 5KBMA 4E9WA 1YUHB 5PAZA 4HLEA 5EIIA 4B3VA 2BM3A 4A2LA 4I0KA 4N2BA 4WEEA 43C9B 3M7FB 2VC2H 5EO1A 3U2IA 3B7TA 3I50H 4DUVA 1UXSB 4HKXB 1UB5B 4F33A 4NQDE 3GMOA 3B43A 5F97E 5JHDD 5H37H 2VLKB 5TDOA 1DANT 1T4KA 5D9SA 3HAEG 1D2OA 4HIXH 3L13A 5TFSL 4KK6C 1PJ9A 2NUPA 5CP7B 1H3VA 2WN3A 2C9XA 3CX5K 4G70B 4LSUH 3EO0A 1AAJA 1DBKL 3QAZC 1RUQH 2EXYD 1BFOA 2NMSA 1OANA 2OXGA 4OLEA 2MQGA 4E42B 4S0TD 3X17A 4U1IA 5KSVB 4BUQA 4FKHA 3AS1A 3RGVC 1I53A 2QQKL 3QQXA 4KBPA 3SOTA 2ORBH 2EH8H 1C12A 2J73A 2ZD0A 4CKQA 1MW2A 2VAAB 2IWKA 4UMGA 4WI0B 3FQ4A 5B39G 1PZDA 1D9KA 2OMWB 2YAOA 3LSOA 4M9OA 4QPEA 2KPWA 4BKTC 2BNRB 3LZOA 4DAGL 4UQBA 2J4WL 4PB9H 3VJ6A 3KLHC 3OKKB 3LJ3A 3UJJH 5CJXC 3OG4B 3WTXA 2AEQH 3SBRA 5DHDA 3O9WB 4ZODA 3PWLA 1PFOA 5BQ7A 3HS0A 4Y4FA 5CIPB 4TLKA 1FG2B 1EAJA 1V55B 2ZXEB 1TQVA 3H53A 4HUCA 5D55A 3WFZA 4AYID 4JFPB 4X50A 5DJCB 1G7JA 4PVMA 2F68X 5IFJB 3VMPA 1HYRC 1RERA 3N85H 1V10A 2QKSA 1MCWW 3MRGB 5FYJL 2CLRB 4JJOA 1EIBA 1HNFA 1C9SA 4NI6A 1IKFH 3LPFA 5D6DA 1ORQA 1FV1A 1EMTL 5DA4A 2RGSA 4JS7A 2R69H 3V9EA 1J0JA 2F8VA 4NRYA 5E5MB 1UJTA 4JFVA 1EQWA 2O4EA 2OMBA 4K7PL 2DD8H 1KLUB 1PF3A 3QIBD 4PJ5E 3QUHA 3IS0X 5EU6A 1YN7B 1FAIL 1G7MA 4IEFB 3H6AA 3TESA 5CILL 4HJ1A 3DMMB 5LAXB 4DP1X 2GTQA 3DVGA 1MFBL 1HESA 2EDWA 3V0JA 3RA7L 4X8JB 1MW0A 5E70A 3GLAA 1AS6A 4I0PD 1SJMA 5JPNB 2EYSB 3B34A 3MRRA 4KGLA 2HXAA 4GG8B 4UT7L 5DK3A 1H15A 3WAJA 1I1YB 1E4WH 3GTTA 3IVKB 3ETBF 4WHTB 4BCYA 1CZ8L 1HSAA 4PBXA 3SEPA 3MRMB 3V4PA 2AJ3B 3CFEA 1QI4A 4XCEA 4LBAA 2E6JA 1JFQL 4JLRA 4HPHA 4KPHL 4H8WC 5FS5A 1KG0A 2YMOA 1C16B 4JRLA 3CLEL 1MNUL 5FCUH 5LGYA 3VD2A 2VW4A 4UDTB 2NR6D 1WS7A 2WSKA 2NNXA 3MRFA 4JE4B 4N1EA 5H37G 3UZVB 1CLYH 4BDVB 2V2XA 3IB4A 5FYKE 5D2NE 2VM4A 3TU6A 1HL9A 3ARYA 2QJDA 3EOBA 3MV7A 3PRZA 3S3BB 3VYOA 2AJXL 4KHTH 4PY7B 1KCRH 2NY6D 5L2KE 3KLDA 3WE1A 1CDUA 3ATBA 4CN6A 1MQKL 1IAIM 1NGWA 1L3WA 1TNMA 1FDLH 3F65A 3FHQA 5C0JA 4XBPA 3B7SA 2GJ6E 1WWBX 3FF8A 1CD0A 3KLAA 3PGDB 5D5ME 3LV3B 5KSUB 5AUMB 2ZIDA 3GXMA 4BSVB 2RMNA 5IF0A 1A6ZB 1HQ4A 1JZ5A 3F84A 2FEEI 3DIFB 1AJ7H 1WE5A 3PHQB 3J8F7 1OSPL 1G4RA 1E3XA 3C6LA 3VSUA 3CZJA 1A22B 5ENWA 5E2WL 3SJVE 4AGLA 4FABL 4PM1A 3QEQA 3ECUA 4GPVA 4NB7A 4XPBL 1XH2A 2PABA 3WY4A 1DO5A 2X28A 5I6NA 4R3SA 5FC9A 4DZ8A 1U8LB 3ASNB 2WKOA 2V5YA 3FZUD 3RY4A 1AGEB 1E8WA 2I27N 1WS8A 3ESUF 1JWUA 1N8ZA 2QSQA 5AVVB 4ELMF 4LKXA 5HSFA 1BECA 3QDJE 1SLVA 2H9GA 3Q8FA 8CGTA 2KLTA 4Z9KB 4TTGA 3KJ6H 4FQXC 3RVUC 3CD4A 1Z9SA 3LEVL 4BFRA 2UX6A 3OB0K 5EEVA 2AI0H 3MLSL 1ZAGA 4G43B 5E2VH 3PUCA 2ZQKA 1ZVNA 5E2JA 3SDDC 4MNHB 4L3CA 1YPZE 4UV4H 2Q7NA 4KMTL 3A6BH 2E56A 1FH5H 5BRZB 1QZ1A 4PS7A 4XC1L 4XOBA 1OIOA 2JIXD 1T03L 4UZGA 4L3FA 4NEHB 4OD2B 5D93B 2X3CA 4FP8H 4IDJL 4Z3GA 1CQKA 3DDGA 5AWNH 4KROC 1OZTG 3U30C 4LCWE 4LRIA 4R7VA 3TEXA 3VFOB 2PYFA 3IMBA 2FSEB 4HJUA 2FDBP 4YOKA 3MNDA 5GRJH 1QFWL 1BJ1H 2DWEA 1NGZB 1FGNH 3IPBA 4AT6A 5MP6L 1D6VH 1AXTH 2E46A 1PLCA 3VFRB 4I1PA 2B1AH 4PJ8A 4KRNA 3AGWA 1BIIA 4AV5A 4XXDB 1HH6A 2V3FA 3P4OB 3UGEA 2YQ3A 3U25A 2DL9A 1WA1X 5IMKA 2Z34A 1J1OL 3APCA 3K72B 5HYJB 2XWTB 4GAJH 3WE6B 5AAPA 1P4BH 3VG0L 1P6AB 4B53A 2GTWA 4ZXBD 3MBEA 4I3RL 4QIRA 5ESVB 3LS4H 1MCIA 1E9QB 3H3KA 2IGFL 5KSAB 1SQ2N 1C08B 3D05A 3ML9A 1Z1WA 3CX2A 2GTZB 4NNYB 2ARJA 3AREB 2BSCA 2W59A 5CJOH 4WTQA 1LGVA 1LO2H 3IAPA 1X7TA 4HGMA 1MCWM 4PW3A 1BBDL 2F1AA 2V3EA 3WUWG 1OP3H 5DO2C 1EFXA 4PGDB 2YGOA 4FFVC 1HS6A 1R3LA 2VITA 1T04A 2B4CC 2HT4C 3SDAA 4NO0D 4X5RA 4M1GL 1NFDA 1NGPL 4XC3L 4UNVA 4OCWH 4GS7B 4UQEA 3GS0A 5IQ9A 3SCMD 4Z7UE 5CINH 3LRHA 4AX3A 4WUUE 4JO8A 1ZGLM 5DJ6A 1QSEB 2NW2A 3JQOB 3BH8A 4LIQE 3SDCC 2X6MA 3VRIB 2WIIA 1EWHA 4HOMA 5JUEL 2YRBA 1EHLH 2VSCA 1WAAF 4GRWB 5F96H 3V5KB 2H2PD 5DC9B 4DK5A 3SGEI 4FFYL 1WICA 1TQUA 3T0BA 4JM2B 1RHHA 1MJJB 5FWQA 5C92A 4OLZH 4JKPL 2QADC 2YJLA 3EH2A 2QELA 2X40A 4Y0GA 4DP8X 3HUJA 4JFXB 4ZAKB 5GGRB 3L4WA 5DRWB 1BZ8A 1K2DA 2IPUG 3KE0A 4TKWA 2EIKB 1DVTA 2UWEB 3G9AB 3MUY1 4WU5B 4LGSB 5LQBH 3SYPA 1TZHB 2VKXA 3GTVA 1Z3RA 4YHKL 3QULB 1NSNL 1PY0A 1H3WM 4H26A 3MPCA 4KHXL 3SSGA 5C0NC 2ITCB 3EUDA 2W0FA 1KB3A 3CFMA 3HLKA 1R3KA 1A3RH 2DDQH 2CKBL 2P45B 4W68A 3MVSA 3SODB 1UA6L 1Z5YD 4P23D 1W2KT 2VNCA 4QRTB 3QRLA 2PYED 4QT5B 3ZRFC 1N5YL 1KLGA 3MRKA 4U1NA 3NESA 5JR1L 1ZTXH 2J1YA 3I74A 4LSPL 4P48A 4EPSA 1GS7A 2YAPA 3D0VB 4P2QB 3QRFM 4LDLB 5EORL 1QO3B 3GSXA 3QZPA 2BXZA 5LGJA 1BPVA 4OM0L 4HUWB 1PY4A 2XTJD 4J12A 1TJIL 4IBYA 3BQUC 1L9RA 1FZKA 3BCFA 3MLVL 4L3EE 2C4XA 4NQUA 3RY5A 5CZVH 2BIHA 4NAQA 4B9IA 2J57A 2FSDA 1IC4L 3SE8L 3MLWH 1FL5B 2CDEB 3QDGE 1QTYT 1GOFA 4J3SA 3NA9H 3D9AH 3SYOA 5IIEA 4Y4KC 3GIZL 1MWAH 1MFDH 2P5EB 5IBLC 3S88L 2BNQE 4QXUL 1HFUA 2Z3FA 3W9EB 2BCKB 2YN5A 3RY6C 4F7EB 3QDMA 1EEYB 1OARL 2Z7UA 5F93C 5GS0H 2JQZA 5ECGA 4MCYA 2EIZA 3UJTL 1JJUA 5HVFB 4P2RD 2BIQA 3BJLA 3PGFH 4AQ1B 2Y6SC 3RVTC 1KBGL 3TEUA 5FK9A 5SWZE 1VKXA 1RJYA 2DKMA 3CDGB 4FFZL 2AQSA 1IVLA 2APTA 2AQRA 5E23A 1JZEA 1X7SA 3OF6A 4PJGF 2VWEE 3OLIA 1R3JA 4WKZA 2EC9U 3VGDA 1QSFE 4Q4IA 3IE9A 5J56B 2IQAB 5DRZB 4G82A 3B8YA 4ODUB 2ED6A 4U1JB 4R5XA 1U33A 2WUBH 4PTTA 2VC2L 1ZLDA 4KNTA 4NZRL 1YEJH 4WWKC 4Q6IC 4ICWA 4RAVB 5BRPA 1DQDH 3QQDA 4J3OC 1MJUL 4WW2A 2FLRT 4XVJH 5L8KB 2NRDA 5BS0B 3VGGA 5I18L 1C5BH 2VISA 4P4KA 3VGHA 3W39B 4PBWD 1S4IA 3MRNA 5FUZH 4A39A 1NGYB 1HYSC 1RUQL 2OSYA 2Z7YA 4Y1TA 3SGKC 2GEQA 3MOQA 2E4TA 5HGBA 1JD9A 1K4DA 2OMUA 5GGTL 5F72S 2XYBA 2OQJB 1LVEA 4KXDA 4W9EC 4QNPE 5DJ2A 4XPTL 5CMAB 2LT9A 1SN2A 2ORBL 4PJ7F 4M56A 5EEWA 1BZOA 2GW5A 3BE1H 4GBXB 5FO7B 2JJTC 3VFUA 2XG5A 1KEMH 2O26U 1WC7A 4FFWC 4FXKA 4YHPA 1BXUA 4UV7H 2EDOA 5C8JA 1CBVL 3C5SB 4GKSB 4KO7A 5JXAH 1UQSB 2CG9X 4ZNCD 3EZJB 1DVZA 4L1HA 2IXQA 1W80A 3KYNA 5C0EA 3UJJL 1EZSA 3MGTB 5SWSA 2AMUA 1A9EA 5L9DH 3EDDA 4M7ZB 1X6LA 1UD3A 2Y5TB 4P57A 2PWDA 5EUOB 3OPZH 4M8VA 3ZT6A 1HKFA 4XNUH 3FT2B 3VXNB 1IL1B 4FFYA 1LM8V 4PSRA 4G8GB 3N85L 3OLGA 2AJZA 4IS6B 4NM8H 2I32A 3QUML 4RETB 3RX7A 5I76B 2BPBA 2PWFA 4J28A 3QG6A 3HAEA 3WHXB 4RWYH 3L3OC 4MA1B 4X7TB 2TSBA 2NZ9C 2PMZA 3L6FB 4Y9BA 2ZSVB 3GYRA 1UWYA 3TCTA 4LP5A 3GMQB 4B97A 3ZUNC 1I8KA 3LN9A 2X9XA 4JKKA 4RISL 3RDTA 5L0QB 1P7HL 2X4TB 3NCMA 2DD8L 4HF5L 4FXLA 4F7PB 3MJWA 1J5OH 3CN1A 2KZ1B 3QFDA 2WBJA 4NRXB 2WBKA 3V5DA 1A1OA 2AV1A 3CZLA 4TRPL 5B39A 4XNAA 2V37A 3X1GA 4CADB 3OB8A 2CKBA 3K4DA 2Y23A 4X7EC 4WIQA 4X5QA 3KPPB 2Q8AH 4AIOA 1CFSB 2FECI 4B95C 2ZKWA 3BWZA 5E94A 4Z7OF 5DD3H 4TQHA 5JW5A 1NKOA 1RV6X 2OX5B 4PJHE 3JTSA 4HWEH 2A6DA 3IN2A 3OKOB 2XVGA 3VQLA 4OJFH 2WLJA 3HE6D 3L7FB 3OZLA 3D85A 2VN3A 2YPLD 4N3UA 4YHOH 3MOAH 5GZOD 3PWPA 1E28A 1MN4A 2AK1L 1NIAA 4IOSA 1O9ZA 2G3MA 5D2LE 3V0IA 3B8SA 2EP6A 4N8CL 3WDJA 2G4EA 4Z7VE 1XGZA 5FCUL 4WTZG 3ULUH 1WWAX 1GSKA 3T0DA 4L05A 2XXGA 5KYNA 1CLYL 1RHFA 4N0YL 3GMOB 1T89A 4D3CL 2OFQA 1E7UA 4AOFA 4U1HB 4KHTL 1A3QA 5TDOB 1KCRL 2BW5A 2F7RA 1T4KB 2X4NB 2X6CA 3D4YA 4NLAA 4ZMZA 4MJIE 4KTEH 2OTUA 3WUZA 3K1KC 1AD9B 1N6UA 2J72A 1FDLL 2HA1A 1KTLB 2NUPB 5BV7B 1IM9D 2WQSA 3S48A 3FYIB 4FQIH 4LCYB 5DZ9A 3EO0B 4NKDA 5BOZG 4Z7QF 3KYOB 1BFOB 1WCQA 1F4HA 2OXGB 3DO3A 4KOBA 3AU0A 3KYKL 1ACZA 2ATKA 4U1IB 3WD5L 3A4DA 2O6EA 4MJ5A 4XMVA 3HTLX 4OFIA 2R8SH 1DVYA 5T3ZH 1C12B 4Y9CA 1B4JL 3QO1A 4ACPA 4BK5A 4FFZA 4QRFA 5FLUA 2H0PA 4IGBC 4K71B 1D9KB 2W80C 3LSOB 3MCKB 2A73A 3UG5A 1NIBA 4CVXA 5HY9A 4XCYA 4JDZA 1KOAA 5JOFB 4XE0A 1RPUA 3FU3A 4HJ0D 3ALXA 4MWFA 3DVNA 1M53A 3L4XA 4XN4A 3PWLB 4QOKD 3HS0B 4Y4FB 2ZXCA 1FUNA 1T0OA 4YUEH 1WFJA 5H37A 3QUYA 3V6OE 2Y7OA 1G7JB 5JQ6H 2ZKHL 3DBSA 4MFHA 2Z8SA 4RMUA 2EDRA 5JXEC 5HHNA 2D31B 4AEIH 2IANE 4LEOA 3MJ7A 3JV6A 3WO4B 3MR9A 5E2VL 5KEZA 2NQ3A 1J05B 2APXA 5A16B 3AMKA 1FV1B 5GGTA 2MPAH 2M83A 4KKLD 4UV4L 5AW9B 4Z76A 4CMMA 1T1XA 4K2UH 5CLWA 2ODHA 4ESKA 1ES0A 4GXUN 3ZGHA 4YHYC 4G83A 3QJHB 4E68A 3FSVA 4KKBC 2JF1A 5BW7C 3WNMA 4FP8L 3GZOA 1TTBA 2EVFA 4Y16A 5HI3D 2WQ8A 2G2RA 2YD3A 3F6LA 4NKMA 5DMJB 1SGKA 3TVMA 4TLUA 3A24A 2XWXA 4ODHH 1R4XA 2Y7QB 1U41A 1YMMA 4G7QB 4JAMB 4BFBD 1H15B 2V33A 3SPIA 2JIXB 1ADWA 2A38A 4O9HL 4NN7B 4K3DL 4YFDB 3CZGA 3V4PB 4AVIA 3F62A 3NCXA 4NWTL 3CFEB 3QUMA 4PGBA 5FM8A 1T7ZA 3LNIA 4XCEB 3W0WD 2XN9E 3LQMA 5E1AA 4E9VA 1KG0B 2MTPA 1A25A 4KDTC 2DWTA 3TV3L 2HX9A 3ILEA 1UM4H 3T2LA 2ZYIA 2VLJE 1ZXKA 2JELH 4GAJL 3UERA 1L0XA 3ML8A 1GJIA 1P4BL 3MRFB 2ZUUA 2R69A 1DBAH 4MZ2A 3LS4L 3MV7B 5HHME 4PJ5D 1MCLA 1OD9A 3BWAA 1JRHI 1FL6A 5C08D 3DXAE 1J87A 3O4OB 3W2DL 1Y6KR 1U3HA 4A7GA 5CEZH 2WQWA 1JGVH 2TRHA 3CSFA 3TS8A 2VLMD 2EIBA 5HHVH 5IW1A 3KPTA 3KLAB 3BLPX 1F3DH 1NDGA 5IF0B 3AABA 4F9LA 1DVFC 5JW3H 1DHKA 1A8ZA 1QYGH 3O3BA 4L9LA 4ZXBB 5A2BA 3B2MA 5DSCA 4NNPH 3P4NA 3JZ7A 1MCQA 4TUJA 4A6YL 4OCXL 3V5HA 2EKSA 3WJMB 2A9BA 3U0PA 4MB3A 4WI2A 5I71B 2DEYX 1GIGL 4OCWL 4PRDA 2VZOA 3TTYA 2ZG1A 4OZGB 4HT1H 3VI3B 1ZPUA 4R3SB 5FGBC 4DZ8B 4Q52A 4EI6A 2JI2A 1GOGA 3GEWB 3UTQA 2P3YA 1ZY9A 2Q76B 4U2ZA 5TE4L 3B9KC 2PP7A 5JPMA 4HPOH 4D7PA 5IFAH 5DS2A 2XN0A 5FYKD 1DE4A 1UEMA 4JKNA 2KPNA 4OCMC 3T2QA 5CO1A 4BHUA 1H3TA 1O6SA 2DQMA 2ZXQA 4NO0B 1UUNA 4OLZL 1I8LA 3EIFA 2X2UA 3W56A 1E4JA 5EOQH 2GJ6D 4M62H 4KTGA 1ZS2A 3K71A 3RGVA 5IZ7A 3BIKA 1QRNA 1QPKA 3NJHA 1V7NH 1NBYA 5IV2A 2YR3A 3O3EA 5EG6C 4A2GA 1BSIA 5H4ZA 4L3CB 1VFOA 3BW9B 5DMGD 2WINB 3WNOA 4F8TA 5LQBL 3U9PH 3WUWA 1JYVA 2OJ1A 1M6OB 3SKJL 3UZEA 1K8IA 2CJUH 1LQSR 3SJVD 3EZ8A 2VMJA 4ADIA 3QXDA 1LP9A 3FF7A 3CE1A 5BZDA 2DDQL 1I8AA 1K5NB 2G3NA 1Q1PA 3OAZK 4M6MH 3LNDA 5K33A 4AJWA 4MCNA 2ZP9A 2HZHA 5F1KC 3T6QC 4K0OA 4BUHA 4WI3A 1UC6A 4PJEF 1VACA 2DWEB 4F7MA 4H88H 4AT6B 4PB0H 4PW9A 5AKSA 5EU6E 2KT6A 3JWOC 4Q2ZB 3NJKA 1T5WB 4PJ8B 3KPRA 4PG2C 5FA4A 4BCXA 1OGTA 1BIIB 5IEKA 3AACA 1UKQA 1FZMB 2C7FA 5CZVL 4Y4HC 4ZJ9A 1XR8A 2QQNH 1H3XA 2LABA 4GQQA 2BS8A 4P23B 5IMKB 3U6RB 1TG8A 3MFFA 3C60C 3D9AL 5IOPB 2NX5A 3L16A 3ARPA 5EO9A 3ECWA 5GRUH 1MFDL 4LHJB 5DEFA 4DKFL 4C4BA 1MI5E 1C8PA 5DWPA 2IALA 1WFMA 3VUAA 2ZP0T 3VXSA 2ARJB 5LGKA 3AQDA 3SYAA 1T20A 4KJQC 4I88A 1DLHA 4ZUSA 5GS0L 2GI0A 3MODL 4G2AA 4LCWD 4HSCX 3T08A 2IBBA 2O5ZL 1UUSA 3RAJL 4HJJL 2LFEA 1RUPH 4UT9H 1WITA 2EC9T 3VMNA 3SBPA 2B4CL 2XRAH 2YA0A 1N6VA 3O6LH 2W0KA 1ILSA 2WTPA 1R3LB 4KK6D 3H9YA 3MA7A 2VITB 1T04B 4CVWA 4MB1A 3DETC 3LNGA 2GK0A 4N20A 4S10A 1DUZA 3SDAB 2ENPA 3POHA 1NFIA 3QUGA 4QKTA 1NFDB 4DN3L 4L8DA 4YHML 5IWLC 2BO0A 4MB4A 4JCLA 5T5NF 5IQ9B 4I0CC 1VGEH 3S5YA 2BVEA 4H13C 1TU2A 2WUBL 4BGLA 4EQ3A 4LRNL 5DJ6B 2NW2B 1YEJL 2I9TA 4QAWA 1OAYH 1T83C 2G0KA 2WIIB 1N4XH 1D3CA 4HOWA 4YVNA 3EF4A 1MDTA 4TNWK 4XVJL 2GI7A 2ZP8A 2BOLA 3LXCA 4EIUA 3L54A 3KLHD 3QEQE 1IVTA 3S5ZA 1RHHB 2Q0ZX 1EX0A 1GGIL 2ED8A 1B4TA 3OLEA 3V6FA 3GD1C 4IKKA 1KEGH 3EJRA 1JG9A 4F9PC 3TO4A 4D9LH 4AGOA 3T2OA 1OE3A 3V6BR 4G6AD 3ZE0F 3EGXA 3MZGB 3HFML 4WHCA 1VGKA 5I1JH 4ZW3A 2DQGL 1Q9LB 3DJTA 7TAAA 1CL7I 1VEOA 1N5AB 4RMVA 2YFNA 3AROA 4ELKA 5EZJA 4QJ3B 2VDQL 1JWSB 1MVFA 2Z6FA 1Q0XL 2GSMB 4A6YA 5KSBF 4FLSA 4YIQA 3SKOA 4MXVF 4OFPA 3WOVA 4YGAB 2JVUA 2W0FB 4ERSL 2LTQB 5CZXC 3OHXC 5D4QA 3S37X 1KXQE 4DGIH 2WZPD 3VG9C 2F8IA 3B2PA 3MRKB 4U1NB 1KGYE 4JX0A 4Z0XA 3NUKA 1Q9WA 1BQHG 4MNQA 3UP6A 2H2SD 3WMQA 1OT4A 4MAYD 1H5BB 4L4TA 2AF2A 4NM8L 1TVBA 3GSXB 5E6ZA 4LKCA 4DP7X 5KN5A 4W81A 2Z65C 2W9DH 3W38A 2DH3A 4EDXB 2YMTA 2XPZA 5C7XH 4RWYL 3CBRA 1QFWM 3NIFF 3LKPB 5KVFL 3B9EA 3B3BA 4X83A 3ZIMA 1G1YA 3L3DA 3NBNA 3HOGA 1HH9A 2FR4B 5KS9A 4TSCL 3GSUA 4QHMB 3S8FB 1KIQA 4QRUA 1OP3K 4PJBB 5IIEB 3P3YA 1J5OL 1HZKA 2EE0A 2HFEA 2NCEA 3H6JA 1YN6A 1NMBL 1OAUH 1ZWIA 4LVOC 4RMTA 4P5TA 4WFEE 3QDMB 4KDVA 2PWHA 4MXQC 3L5HA 4MCYB 4RX4D 2WYHA 1AR2A 2EIZB 4L37A 4B0MM 3W5MA 2K3TA 1Q72H 4HWEL 1U8HA 1WFOA 2Y69B 3HNVH 2BSTA 3VVVA 4PRAA 1WFNA 4V1DA 3BUYA 1KSRA 2WB1A 2UVFA 5EZOL 1VKXB 1RJYB 1JWMB 4LVHC 3MOAL 4ZFOL 5F6IB 1C1EH 3SE3C 5ITBL 3QYNA 2X6BA 2J8UA 1XBRA 4WI9A 3BWSA 1JGLH 1UVQB 4YDNA 2HPTA 3ULUL 4FTVE 2I5YH 4N2LA 4PTTB 2CDFB 3LPPA 4PJ9C 1IFHH 2PTTA 5JDJA 4DFIA 3QDGD 2H6PA 4C47A 3QQDB 5C9JB 1ZHNA 1UXWA 4AQ8C 1QI3A 2UXFA 4WW2B 1QPXA 2R2EB 4OJCA 3RWFA 4KTEL 2YPLB 5HYSB 2E5EA 4NP4L 4HH9B 4P4KB 4B0MB 1YEEH 2QV4A 3NJXA 4FQIL 1ICTA 2QTVA 1Z6JT 4JO4H 1UCBH 1ETA1 2DIJA 2EE2A 1K4DB 2OMUB 3BD3A 1U8IA 4G72B 2QL1A 2XA3A 1UJ3A 3ZKXB 5D7IE 2R8SL 2D0GA 4FQXD 4TL5A 5C07A 4PJ9D 5SWZD 4JGNA 3VFUB 1HT6A 2XG5B 3WKYA 5KJ4A 4FXKB 1ROWA 5C8JB 1V7ML 3MX0A 1F4XL 4PV9A 4XWGH 3F7QA 3ZDZB 4FA6A 2ADJA 5HHQA 1AZCA 2HTKC 1IM9B 2VXUH 4PHZA 3SDDD 4P3CH 1FGVH 3HUJE 5A6LA 2NY1C 5C0IB 4G59C 3DSFH 5SWSB 4ZW6A 1E2VA 1I7RA 3S35X 3G04B 3KG5A 1A9EB 1LO4L 3STLB 2H1LM 4LOFA 2OJZL 4WTZA 4P57B 2V5MA 4AQAA 1TTFA 2GJPA 5DFAA 2VDPH 5IVOA 3E8VA 1JK8A 5JQ6L 5MENA 5ITFB 4QRRA 1NOFA 3S8WA 1NC4D 4PW4A 2H4EA 5IHUH 1JNLH 4AGMA 3QG6B 4F2MA 3ARFA 4HU8A 2JV6A 4G8EA 1F3JA 3O4LA 2FBJL 4PJXA 2MPAL 4GH7B 4JVUA 1GYCA 3LZQA 4FTDA 1J0KA 4QOKB 4K2UL 3U4EA 1I8KB 3UPRA 5HVHC 4NO3B 4HMEA 3ZDXB 5AW6B 4JHBA 3ZDYF 4MTMA 2QFRA 2IH3A 3EH5B 3K6OA 4L5FH 1TPXC 2EXWC 3IJ7A 3S5LA 2BWQA 1KXTA 2WBJB 3QFDB 2X44D 4LXFA 3V5DB 5DEZA 3GKZA 1RSFA 3F6IA 2AV1B 5B39B 4JVWA 2R23A 1PG7H 2F15A 4AL8C 2OYKA 2VH5H 4QYOA 3DO4A 3T3PB 3LDBC 4HUUA 3QWOA 5E94B 4ODHL 2YUZA 4B9PA 1HILB 2EIEA 4V2BA 2CZNA 3WJLC 5JW5B 1OTUD 4MAZA 2A6DB 2ZXDA 4F2EA 3ZTDC 1H3GA 3BGFC 2XZAH 3ISYA 4O4YH 2FIRT 4OZHF 3BQUA 3D85B 3CXHJ 3GT6A 1A4CA 4WY7H 3NCBB 5DMIH 4NO5A 3CFKA 4YH6A 3AB0B 2P80A 1HAUA 4U6YA 4ZMXA 2VW7A 2A74C 4N2AA 3JWDL 5DO2D 3JSSA 3QA3B 4YGVB 3FFOA 1INQA 4FFVD 2GY5A 4Y4KA 2J55A 1Q94A 1KIRB 1NAML 3PWUA 3QB7C 4J4PD 1K4CB 2BLFA 3U2SA 2HT4D 4OJAA 5DZOA 3RY6A 3ZLQC 1UXMA 2AK4A 4ZMTA 5IG7A 1AC0A 2CQVA 4RVBA 3QFJA 4NIKB 4E9YA 1JZJA 1U21A 2Y7MA 3QYCA 2L7QA 4XXCC 2C9SA 4N6QA 4Q74A 3W0WB 5I6KA 3DX1A 1IC1A 1UATA 3CFCH 4JBSA 3DGGA 4UQ2A 4V11A 4NAMA 3SDCD 1FYHB 3BIAX 3QIWC 2XIIA 1F4WL 1RLBA 2XN1A 3P4MB 5FHAH 1P5UC 2CBMA 5I1EH 1RIVH 2ATKB 3BP4A 3BSGA 4AC2A 2DQDH 4ANWA 3ZO9A 1HEZA 4NNPL 1K85A 3QO1B 2AERT 4G5ZH 1JGEA 2QADD 5I1DA 4GUPB 4ZFOA 1DDHB 5C08B 2NYYC 2A73B 2C9QA 2B20A 3K0WA 1HVXA 4CVXB 1FLTX 4D94A 2D9QB 5D72H 4JDTH 4XCYB 5D70H 4JDZB 2NXZC 4Q6IA 1X4ZA 3GUTA 4YXHH 1J8KA 1TQBB 2J25A 4P8QA 3ZE1E 1BMWA 2CHNA 1OALA 3D39A 2D9CA 3NT0A 4JPVH 3PS6A 2IPTH 4LCCB 3GMRB 4Y1AE 5C0ND 1FZJB 5CN1A 5J6GA 2NXYC 4MJID 4Y2DC 3VI4F 1T6VN 1J88A 3ZDZE 1I31A 2MOQA 3OL2A 5ALCH 5HHNB 1PIFA 4S11A 4ABUA 4IQHA 3HC0A 4J3TA 2RHEA 4BXSV 3A67L 1XF3A 4PCKA 2Z93A 1QFUL 2JJTA 4U4IA 4G80B 3MDJA 4Z76B 5I9QB 4MD4A 4AMKH 4JKWA 1DQLH 2Y36L 2CJUL 3SDXE 1BYNA 5I2IB 2IDTA 1IIKA 1UZ8A 2QHLA 3F85A 2EYTA 3QP3A 3THMH 5KVEH 3MRDA 1PTZA 4JDVA 2EO1A 1EO5A 4YDLB 1PY9A 4QGYA 4M6ML 2PW2B 2CR6A 2BWDA 5IVXE 4Y16B 2G2RB 2JKRM 4OFQA 4YL9A 1ZLSH 4HBCH 2DQCL 4NKMB 5CKGA 1CLOH 4YHNB 3PFQA 2YSSA 1YMMB 4Q56A 1BV8A 4GI6A 4H88L 5E8OA 5B1JA 5IROC 4X4XA 4S1QL 5AAWC 4IBLT 2XHNA 4H1LB 3QUMB 4MMXA 4PGBB 2ERJB 1CDYA 2IAND 4PCSA 5E1AB 2VZVA 3LEXA 2QQNL 1JPEA 1S3RA 2BIOA 2Y6SD 2WLZA 2A3TA 3VWKA 4XCCH 1SYSA 5FFLA 5J89A 2IWGA 3NCCB 3ZZ1A 2QDVA 1A3ZA 1ACYL 2EDTA 2BFGA 1PKQA 1T3FB 2GC4C 3MV9D 4TSAH 3G5WA 3U79A 2JKSA 4M43H 4ONGH 3BWAB 4ZTEA 4NRZA 3PWPE 3U4AA 1CFNA 3D0LB 4MDRA 5CM1A 4CILA 1U3HB 2QVIA 4RRPG 4CJ0A 1F02I 1NCJA 4EQ2A 4WWKD 1WZ1H 3IXTA 5D1ZC 5GZND 5IW1B 4PRBA 2H5UA 3ESOA 5KVGE 1UGKA 4J3OD 1NDGB 1YQVH 4UTCA 3RWDB 3EBIA 4WTXA 1BZQK 3O6LL 3S96A 3O3BB 4L9LB 1VA9A 3DJSA 4XVOA 1TQWA 3P4NB 1TSHA 3REWA 1XGTA 3V5HB 1HYSD 1YC8A 4LLDB 4FN0A 3VCLA 3VXPA 5L8LB 2P8LA 2XN9D 3E9TA 4PRDB 1AKPA 1II4E 3ULVF 1B3IA 3FW6A 1JZ7A 1BOYA 1E8ZA 4EI6B 1CC3A 2XETA 3IDXL 3HZVA 5TE7L 2VLJD 2JKWA 1OAYL 4Z7NB 4L0PB 4XGZA 1D5BA 1NAMA 3N04A 4FFWD 4HS8L 3RL2A 1LE9B 3FUJA 1L7IL 1DE4B 4M5ZH 4P2OD 1BEYH 5TQ0H 4ES8A 5HHMD 2ATPA 5FYLE 3TFKC 3GGWA 3FT9A 2ZX8A 3T0XA 3TFBA 3QAZB 3DXAD 4AMWA 3Q2NA 4AUJA 4M7KL 1KEGL 3ESNA 2MNJB 4D9LL 4QLRA 1OQXA 5MERA 1X5GA 2OCJA 3RGVB 3LKRB 5JIDA 1QRNB 3HBQA 2IAMC 2B3IA 3O3EB 3KHOA 3NTCH 4HLJA 5H8DA 3UTSA 5ID0A 3OR7B 4YHLH 2XDHA 3L1EA 2JLLA 4CSTA 4Z7IA 1Q0YH 5T3XD 2DQJH 1IBHA 1ZPLA 1K8IB 4Y19A 3GSRA 4DKAA 3QXDB 3HLAA 5CJ8A 3VH8G 3HZKB 1E50A 3EYSH 3KL5A 1G7LA 2Z91A 3TN0C 5AVXB 2W5PA 3KWVA 5FO9A 5KAQF 4AH2A 2YAEA 4LPUA 4EN3D 2GAZB 2J7LA 2WNKA 5FYKU 5I0WA 4H0HB 2BDNL 5GS1C 1PZCA 4EKJA 3FTZA 4WV1C 4WCYH 4QY8A 3VXME 5JXEA 1RULH 4AXWA 2N7BA 2ZNXA 4N0UA 5H4YA 4OGXH 2GJRA 1HJCA 3T65A 4OQTL 3FB5B 5T1DL 4JN2A 5IEKB 4UINL 4MBRA 2EUWA 3EJSA 5CGTA 2PPAA 3OKMB 1XL6A 5EOCJ 2BRRH 1BF2A 2G75A 1V3JA 1XR8B 1A47A 3L95A 4UDUB 4UT6H 1E0OB 4WK0B 4A67A 2CNYA 3MJ6A 3T4AC 3MFFB 3FK3A 5BW7A 5E8EA 2NX5B 4LLUA 4YBLC 4XTRD 2L0DA 5EO9B 4J7RA 3ULSA 4M4RB 4XNQA 3VU2A 1JVOA 5FV2A 2IALB 4BZYA 3PFUA 1QLEH 2SEBA 1TZIA 3VXSB 5AAMC 5F9JA 3T1FA 2HX8A 1T20B 4ZUSB 1DLHB 1IMHC 3D51A 2A83A 4JY5H 4XNMA 5BMFL 1O9WA 3B6SA 3HNVL 3C12A 2EH7L 3FQXA 4PU2A 2F9BT 5LHDA 3N40F 2A9CA 4FERA 2HVKB 2N7AA 3OXSA 1BG1A 5IGXH 2JJVA 1C1EL 1IEHA 4X2UA 2VZ1A 4KDTA 1BQHA 3GSOA 2GK0B 1DUZB 1WFTA 2XZCH 1QFHA 3IYLW 3K1DA 4L8DB 3BXNA 2DB8A 2K1MA 5GJSH 2GG1A 4XMPL 2B16A 3PABA 4NZFA 4JK0D 1MCRA 2O5NA 1TU2B 1EK3A 4F57H 4LOUC 4XMKH 4AQEB 1NLBL 2EDDA 3CH1A 1NUFA 3QZWG 1SY6H 2I9TB 1WVZA 3QH3A 4F7KA 4IGBD 5HGAA 4JPKH 1DEEB 2QSTA 2EQDA 3UX9B 3DLQR 3O3AB 4ZOBA 1MI5D 5L2JA 2VDMH 3ARDD 1YEEL 1D5IH 1EDQA 2ZICA 3V6FB 3V7AG 5ES4B 3N1QC 5DHXB 1X4YA 4F92B 4Z7NE 5IHHA 1L9TA 2ADIB 3MTRA 1TKWA 3EGXB 2Z7ZA 2ESVA 1VGKB 4NPYA 5HDRA 1SF5A 4BH7A 4NQED 3S0PA 3WFDL 4R5VA 5I1HH 3N42B 5GJTL 4ELKB 3QZLA 4FL4C 4K5MA 2BIIA 4A6YB 1IAMA 2PLTA 3JV4A 5FGBA 4YIQB 1FJ1B 5I8KH 4B9KC 3P54A 4JO3L 1OT1A 4DVRH 3CFQA 4P3CL 1VPOL 3C09C 2R7EA 2ADGA 2WOYA 1SLUA 3FO9A 5CF3A 4Z0XB 4KKBD 2VDPL 5T1LA 4FQXB 1MCKA 2JK5A 4LMQE 3O41A 3FUFA 2ZAHA 3D0AA 5GGQH 3IJHB 2VIRB 3DGDA 3BCDA 2DQFA 5KVMC 3T4YA 4LKCB 3TIEA 1LP9E 5KN5B 5CBEA 4TVUA 3HC3H 3V8CA 4D0CB 2WXJA 1JNLL 1A0QL 1HHJA 2R9HC 2ZAGA 4AK1A 2L3BA 5EC2A 3K6SB 2B0SL 3R7QA 5K9KA 1UM6L 5E2UH 3L9EA 2NNCA 2EO7A 3E6FA 4M6AA 5JLZA 4DP0X 3L3DB 2XQ0A 3D5OF 1F8TH 1HH9B 2VDNH 3WDIA 1JI2A 5KS9B 1OAKL 1KGWA 3GSUB 5KOVC 2NNAA 2E8YA 3GUFA 1USQA 2HFEB 4KROB 4JM2F 2YK1L 3US0A 3U30B 3AUVA 2ZG3A 1YN6B 1ZWIB 1UASA 3KPRE 1DVUA 1JS4A 5D7LE 3RZCC 1PG7L 3POCA 2WZ6A 4K8RC 1A6UL 2WUCH 1K72A 1H0DA 1X5XA 3KPQB 4XRCA 1GS8A 3AQZA 5DUJA 4LHUD 2G5UA 4FQJH 4ELMA 1KJVA 5JIQA 4XN2A 1DCLA 3AJ7A 5JIHA 4CBPA 2BSTB 4J6IA 2VDLH 4O4YL 4PRAB 3IMTA 4N9GA 4V1DB 1NANH 2W95A 2XWJA 4NHUB 4PPTA 1ZA6B 1FPTL 4JKLA 4Y5YA 2R2BA 1NLDH 4DO5A 4QHLA 3EFOA 1P1ZA 3CNKA 5AZ2H 4OIAA 2J8UB 4QMEA 5DMIL 3FTSA 4OQTA 2F5AL 1CLZL 4QXTA 1DVFD 3T8XB 5IJKC 1NA8A 1A21A 2VR4A 4L8BA 5DEGA 3VRJB 1YAIA 1O7SA 2PTTB 1VFBA 2MWCA 4KKPA 4I5BA 2H6PB 2H26A 5GGSB 1UXWB 2A7BA 5LBGA 2V5TA 4RBPH 2PPCA 5DEJA 1HCVA 2ZKMX 3RWFB 4DUWA 4JFEA 4LSVH 3UDWA 1QX1A 4KKAC 3CFCL 1N0LB 4WFED 1P7KA 2G5RA 1B2WH 3BAJA 2ZCHH 1G7PA 4R4FH 4IMKA 3B9KD 1ZHLB 4PREA 5FHAL 5I1EL 2XWEA 1F97A 4XVTL 1RIVL 2Y7LA 2O5XH 4LLWA 1U8IB 4EIGB 2NW3A 4U6XA 2DQDL 1TJHL 2CGYA 1U95A 1HOCA 3KBEA 2BFVH 4TNFA 1DL7L 4JFYB 2Y24A 1A5FL 3UGXA 1OP4A 3MX0B 1N7ML 1PNDA 5G55A 1AACA 2J20A 3F05A 2ADJB 5D72L 5IB1A 3PDDA 1V54B 3SDCB 2EVHA 3QUKA 3TWYA 3WKQA 3OGCA 4L4VA 3DOIA 4FTVD 1I7RB 1U8QB 4JHUA 1HHHA 3EJTA 4DUXA 1JCKA 1KNOB 1ZJAA 4LE8A 4IU3A 4WQOA 2EDLA 2JKJA 2ZOKA 2D3LA 2BP5M 3HPLB 4AQAB 3ROOA 1BGXL 1AANA 3KM2A 5MENB 4FNTA 4QRRB 4KTYA 1I3VA 3B56A 3G6AA 2HFTA 4KFZC 5FXCH 3DROB 5CJQH 5IY5B 4FNLL 1PD0A 4EOWH 1BWMA 1X5FA 2ZUSA 1CDCA 1V8HA 4G8EB 2OTPA 3QNXA 3MC0A 3O4LB 2M26A 2PO6C 4OCYL 3OHMB 1XCQA 3IJYB 1N26A 4HUXA 2CA3A 4XNXH 1BF5A 1Z5LB 3U4EB 4AMKL 4ZS7H 5JHLL 2BVQA 5D96C 1DQLL 4MNQE 3KL3A 1P84J 1QW9A 4L4TE 1R5VA 4IJTA 3D2TA 5KVEL 2VDQB 3THML 5EF0A 3ZXAC 5I8OL 1KXTB 3UBXG 4Y4HD 2X2IA 3BIBX 4NCC2 5IR1A 1WGVA 3HI6H 3KPNA 4YN3A 2FWUA 2R23B 3C60D 4HW6A 5ICYB 5EFIA 1D7CA 3UTZA 1LHZA 1NBQA 4ONHB 2E76C 2AXGA 2X0WA 1MFUA 4HUUB 1ZD6A 1YEHH 4TUKH 5DQ9B 1WAAA 3P9LA 5KS9E 1AKJD 3VGBA 2WNXA 4EDWH 1XBDA 3UO8B 1J8HD 1TJXA 4MD0A 1J1XL 3CQPA 1ND0A 3BQUB 4PJIF 4YDVA 4RH4A 2H1PH 4AEHH 5E1GA 4X6EA 3O6FC 5LO7A 4MRCA 1HX0A 3CFKB 4IYKA 4J6RL 4P3WA 1FE8H 1MFAL 3IMSA 3NCWA 2UXVA 4POZC 2YA1A 1INQB 3GQFA 2R27A 3KLKA 4Y4KB 1OGAA 2H32B 5EUOF 5DUPL 4ZO6A 3L3GA 5EF1A 1ZTXE 2XPYA 5I6OA 1EEQA 2QKIA 3N55A 4HEMA 4TSAL 3NOIA 1XHHA 4XB7A 3RUGF 5EU5A 4K7PX 5ISZA 3VX1A 2BK8A 3J27A 4ONGL 3HG1A 3AVEA 4DP4X 5IG7B 3VW3H 4DHLA 3QFJB 3SQBB 3IDJA 4UUJA 1U8NB 2E59A 2IWFA 1YNLH 4G3YH 4PTUB 4ACTA 5CWSB 3T6VA 1D5XB 2VXQH 2XX0A 1LK2B 2F54E 2MH4A 3DGGB 4BK4A 3AG1B 4UQ9A 2CIKA 1T5XB 3FQUA 4FNUA 3UC0H 1YQVL 3FFCE 4ZSOA 4J3WA 3VX0A 1U58B 5F89A 1XT5A 1BZ9A 2PXYC 3BP4B 3UTTA 3KPSA 3TJHD 4A7TA 2YC1A 3UAFA 4N85A 2B3RA 4KJWD 4OLXL 1D6EB 3MV9B 1NCWL 2WLIA 3QORC 2JKNA 5T5NG 5I1DB 4HJEA 4ZFOB 2PN5A 5GRZA 3LRMA 3V55A 5DTFA 1CXIA 3OAUL 5IKCA 3EGSA 4WWKB 1I7TB 1NAKH 4Q6IB 3OKDA 1U8CA 4NDMB 2J88H 4DK3A 1JIBA 3GUTB 2ADYA 4AQ8A 4JRXA 3HKFA 1GC1H 2Y2YA 3D39B 1FIGL 2YAHA 5TQ0L 5C07E 3NSDA 3JVGA 2ALWA 5I5MA 3VACA 3FUEA 4MA8H 4OD1L 5J6GB 5CZXD 2XWZA 4Y1SA 2X4SA 4KKRA 3GIVA 3N5AA 5B1CA 5EZIL 3VFSB 3OTTA 4NQXA 1ZJBA 3HC0B 1XR9A 3T71A 2ITDA 2XN2A 4YDMA 3ZY7A 5CR1A 1JXKA 5D7KE 4UU9A 1IFGA 3NTCL 3DHUA 5I5IA 1ZHKB 4YHLL 2LU7A 3S3JA 4FQ2H 4NZJA 5LN4A 4MD4B 4XB8A 3BMVA 3RPIA 4PLJD 4AYSA 3TA3C 5AVZB 4PJGA 3SPGA 3D48R 1YEFL 4HXBL 4OCSH 1UZ8B 4KVCH 4TL4A 2EYTB 4GP4B 2Q7YA 3EYSL 3MRDB 2B15A 4JDVB 4WO4C 4BZ2H 4PGEA 3L8QA 2HKHH 4F2ME 1YECH 4HSAC 5CHNA 4YSPA 3N9GH 2JMRA 3HBGA 2WGNB 4PWIA 4Z6AT 3DBXB 3FAWA 4PJXE 2DS4A 2PCPA 4I48A 1O9VA 2YSSB 2YWZA 4N8PA 4CAGA 1I8IB 1MFMA 2H1XA 2BHZA 4G9FA 3D08A 1U8OB 4PJCA 1WQVT 1RULL 2PTVA 3HFFA 4Y1AD 1TVHA 2VXTL 2QGDA 3SN6N 4XMXA 4WFGE 4OGXL 1HK6A 4MXQD 2FD6L 3TWCL 3FO2A 4AEEA 3LNFA 4TUUA 4UYPA 1LE5A 4OZFH 2VMEA 2BRRL 1KIPA 4UT6L 2QQLH 4HETA 2K6YA 4ODTH 2OJEB 1FF5A 3QEHA 1ZV9A 2WNWA 2WVVA 4PJ7A 4KXBA 2DQEL 3LZPA 3V10A 2Q7AA 2OSXA 1Q8MA 5JHLA 1MHPL 1JHTB 1PKQB 2A6IA 4HKBA 1N9PA 1S3KH 2XICA 2YFOA 3DDFA 5ICZA 5FB8A 1QLEL 4HFWA 5FR3A 3N43F 3L3KA 4DN4H 2AV7B 3ARWA 4P9MH 4WU7B 2HG5A 1W15A 4BKLB 4Z77B 4GKNA 3IXTB 4KX7A 4KMLB 4RMSA 1EO8L 4ALAH 3VH8A 3HRZA 4PRBB 3MYJA 2HX7A 1W72B 2A1WH 1Z9NA 5FFOA 3NJIA 3S96B 3KR3L 4N24A 4DEPC 5IGXL 5AW2B 1HINH 3QC6X 4MASA 3UJIH 4EI5A 2AK4E 1VZHA 2XKNA 5F1SA 5B8CA 3CHSA 1XGTB 4W4OC 2A74A 4M03A 4PH8A 5E6IC 3VCLB 5GJSL 1L9PA 3DUUA 4NUJB 3UAJD 2P8LB 5B7EA 4ODWA 1ANUA 4WK4B 4LASH 5CCKH 3H55A 1QSVA 7FABH 4FQPA 5C0GA 1XGUA 4NENA 3B3IA 2YJQA 1MCNA 4RLDA 2YD4A 1BXVA 1D5BB 3ZHNA 1NAMB 2RCSH 1WF5A 5FM4A 1VENA 4FJYA 3RL2B 1B6UA 4JPKL 4M7JL 2CO6B 3UG3A 2DICA 3IFOA 2FWOA 1DTUA 3GGWB 1D5IL 4OF5A 5CBAA 4WJG3 2F18A 2D03H 3QIWA 5MEPB 4ENEC 5INDB 2IAAC 1FO0L 4N90E 2IOMA 2IOIA 5C86A 2L8AA 2OZ4H 3BUPA 4MVBC 3KXFA 4RZKA 5MERB 3DV4A 4NSKB 2VUOA 2LV4A 2I7OA 1D7FA 2CBPA 5C0AD 2DLFL 4UQIM 4DO6A 1AZRA 1KGUA 4MAUL 3K4AA 4IGBB 1QHPA 5F7EH 5ID0B 3IWVA 1MFEH 3TBYA 3NJJA 1IBBA 1G0DA 5L7XH 4WHDA 3FONA 3C2AH 2Y07H 1KZYA 4HVBA 5E0FA 5I8KL 2XI9A 3F7PC 4DVRL 2QDWA 1ZT7A 5DMKB 1TITA 3QARA 3HLAB 4Y89A 1NCIA 3MRBB 3BP6A 4GW1B 5K5YA 2Y2TA 5ACMA 1G7LB 2EJ1A 4MHHG 3GMLB 3EBAA 4ONFH 2EDNA 1EPFA 3NDZE 1E43A 4NUGL 4O5LL 2WHVA 3TJPA 3UTPE 1Q1JH 2FE0A 3MV8A 4MA3B 4N3TA 5SX4I 1FWXA 4RGOH 4KJPD 3R0NA 2EXWD 4NQEB 1F4AA 4LCIH 3QZWA 4AG4L 5T3ZE 4QY8B 3WDHA 3SD5A 4RGMB 5T1KA 2N4IA 1CPUA 1JTPA 2Y4SA 4N0UB 3U46A 1FSKC 3HB3C 2QSVA 4X7FC 3FH7A 2KDYA 3VI3F 2VABA 1B3JA 1SEBB 4PFEA 3T65B 1NCGA 4JN2B</