1IE4A

Rat transthyretin complex with thyroxine (t4)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
120
structure length
120
Chain Sequence
SKCPLMVKVLDAVRGSPAVDVAVKVFKKTADGSWEPFASGKTAESGELHGLTTDEKFTEGVYRVELDTKSYWKALGISPFHEYAEVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of rat transthyretin (rTTR) complex with thyroxine at 2.5 A resolution: first non-biased insight into thyroxine binding reveals different hormone orientation in two binding sites.
pubmed doi rcsb
molecule tags Transport protein
molecule keywords TRANSTHYRETIN
total genus 24
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 1ie4A00
3D2TA 4ANKA 3NEEA 3BSZA 1F41A 4I89A 3CN1A 4Y9BA 5A6IA 3DK0A 3IMSA 4L1TA 4DERA 3M1OA 1TYRA 3GRBA 2TRHA 5DEJA 5FW7A 5L4IA 5EZPA 1BMZA 2QPFA 2ROXA 3OZLA 3IPEA 1X7SA 3NG5A 3IWUA 2QGEA 1QABA 1TTCA 4HISA 4WNJA 4ABWA 3A4FA 3IWVA 5AL8A 5JIMA 2G5UA 2B16A 5EN3A 3I9IA 2H0EA 2B9AA 1KGJA 5CLZA 2GPZA 2WQAA 1E3FA 1IIKA 4PMFA 4QYAA 1ZCRA 3BT0A 1E4HA 3NESA 2G3ZA 2G4EA 4Y9FA 5CNHA 3U2IA 2QGCA 3DK2A 3FC8A 4I87A 4YDMA 3IMWA 4Y9EA 5IHHA 4TNEA 4TNFA 4HJUA 5K1NA 1KGIA 2H1XA 1SOQA 1BZEA 4ABQA 3CFTA 1OO2A 3IMRA 1SN2A 4YDNA 3A4EA 1THCA 4TM9A 2H0JA 1GKOA 3OZKA 4TQIA 1ICTA 1DVUA 4HIQA 2QGBA 5E23A 1DVQA 5CLYA 4PMEA 5AYTA 4PWHA 5DWPA 3FCBA 4IKLA 3CXFA 1SOKA 5CN3A 3I9PA 1BZDA 1TFPA 3HJ0A 1IIIA 3CN0A 3P3UA 4TKWA 3CFMA 4IK6A 1DVYA 4PVNA 4WO0A 3DJTA 1TT6A 2G9KA 1DVXA 4FI6A 4PVLA 4PWFA 3CFNA 4TLSA 4ACTA 1BZ8A 3CN4A 4DEWA 4FI7A 5FO2A 1DVSA 3D7PA 1Z7JA 5E4AA 5JIDA 3ESOA 1ETB1 1QWHA 1TTBA 3CN3A 3DO4A 5AKTA 5AL0A 3TFBA 3B56A 5CR1A 3GS0A 3ESNA 2GABA 4AC2A 5FW8A 3QVAA 1U21A 4PVMA 4HJTA 1TTAA 3GRGA 1TTRA 3IMUA 4TL4A 4DEUA 4N86A 4TQHA 3A4DA 3KGSA 5E4OA 1X7TA 1Y1DA 1FH2A 2G4GA 1ETA1 3IMVA 4N85A 4FI8A 4QRFA 4AC4A 4TNGA 5BOJA 2FBRA 4N87A 4PM1A 3DGDA 4Y9GA 4DESA 4IKIA 3P3TA 3GS4A 2IGLA 4Q14A 5L4FA 2G3XA 2TRYA 2B77A 3NEOA 5JIQA 3DJRA 5CLXA 3DIDA 3CN2A 3KGTA 4PWGA 2H0FA 5L4MA 4ABVA 2B15A 3CBRA 2H6UA 1G1OA 4IKKA 4TQ8A 3U2JA 3KGUA 4TL5A 1BM7A 4TLUA 1TSHA 3DJZA 5HJGA 2NOYA 2PABA 3NEXA 1E5AA 2H4EA 4PWEA 4MRCA 1THAA 3W3BA 4IKJA 1IJNA 1RLBA 2G2NA 2B14A 5FW6A 5K1JA 3Q1EA 4MASA 2F8IA 4HJSA 4DETA 3P3RA 1ZD6A 3GPSA 1SN0A 5AKVA 2ROYA 1GKEA 4PWKA 4TQPA 4Y9CA 4L1SA 4IK7A 2FLMA 2QELA 3ESPA 3GLZA 4IIZA 5TTRA 4PWIA 3I9AA 5CM1A 3TCTA 4D7BA 3DJSA 5AKSA 4ABUA 3CFQA 3SSGA 1FHNA 1IE4A 2G2PA 3P3SA 4KY2A 4MRBA 1F86A 1SN5A 4QXVA 4TLKA 4TLTA 3IPBA 4PWJA 1TLMA 3IMTA 2QGDA 5L4JA 1DVZA 1TZ8A 3GS7A 2F7IA 4I85A 4WNSA 1DVTA
chains in the Genus database with same CATH superfamily
3BPNB 2M2DA 1B4TA 1U33A 3K6IA 1T5KA 1UEYA 3BMWA 4AG4H 1GAFH 1S7SA 2BDNL 3AG3B 3ZTNL 1KGXA 4QRRA 2IAMB 3HNTH 3WFEH 1HK6A 5F1KC 5IJVA 1LE9B 3U48A 1QP1A 1F0LA 2JI1A 3LX9A 4L37A 3WNNA 1HWHB 3UTZB 4NUGH 3ZE1E 3ASWA 4N2KA 1NSNH 3A3YB 4Y2DB 5C3TA 2EECA 3TP4A 2ITDB 2WQAA 2HSIA 4O2FA 3W37A 1YNTF 2VO8A 4JM2D 1EV2E 1IC7H 1KTLA 3ETBJ 1Z9OA 4HGKC 3O2VH 2BP3A 3ZR5A 3GSUA 4N0FA 1GCFA 2EE3A 5DK2A 1XB6A 4Y88A 2VW4A 2IV8A 2A9AA 3EGXB 1Z66A 3HBQA 1IBFA 3B3BA 4O4YH 1HWWA 1OPGL 3ZQ9A 4JGMA 5I18H 1DVQA 3WEAA 3D0VB 2WLLB 4DP7X 3FQWA 4Z7WA 4KI5F 4Q4EA 3VJ6A 5BO1H 1QLEL 5J7CC 1VHPA 2P1YA 4MMXC 3D39A 2CIIB 3O45B 1U91A 2VR7A 1Y1UA 4AVHA 3UTTD 1FL6B 1U9KA 2X53A 3KH3A 5L9DL 3PREA 2XG5B 3WIHH 2VR4A 4BBWA 1K4CA 2HX8A 1JMXA 2CE6A 2J57A 3V52L 5B8CB 3L5XL 5GS0L 1YC8A 4H26A 4QD2E 1KT2B 5T1KA 2Q10A 4UT9A 1T0MB 2VN6A 3MODL 2IPUK 4JPIB 4RIRB 1IAII 1LDPL 4KTEL 3WXWL 3TGXA 5KYNA 5MEND 1IGCL 4HK3J 3T2PA 1KXQE 3MI6A 3IXTB 3NJHA 1BEYH 1KPVB 3GXPA 5SX5K 3ZL1A 2FD6H 3VI3F 3QUML 1RK1B 2BM3A 2VDPB 3P9MB 4TLUA 3MNZA 2BNUB 5ECJE 3NJMA 3LEYH 1EDHA 1J48A 2YD6A 4OJAA 5TPWH 5C08A 3QEQE 2WGNB 3QI9C 2FSEA 2PPFA 3H9HA 5CGYC 2D3LA 1YZZA 1AZRA 5HD8C 5F0PB 2P7TB 3HHSA 4C4KT 3UJTH 1DEDA 4YHPB 1G6RL 1P4UA 4J6RL 3QDJB 1O0VA 5HVHC 3QDMB 4KKLD 5TTRA 1LO5A 4MNQE 2V3DA 3FUEA 4JRXD 3U0TB 4Z8FH 4MS8D 4ZXBA 1E67A 1NGQH 1SXCA 4P5KA 4PRID 1G84A 3V0IA 3MJ6A 1SN5A 5CKGA 3V4PH 1FZMA 1KV3A 3NIGE 1LEIB 4QO1A 3P4OA 1XT5A 3W1ZA 1JVLA 2VDOB 3SBPA 1NCGA 2WD0A 1XR9A 5J1AB 1JV5A 3JT0A 3JTTB 4UQCA 3TPUA 3AQYA 3OX8B 4KK6C 5T3ZH 2WZPA 2HTLD 2Z7UA 2CJSA 2OPCA 2J8UA 1I53A 1MCRA 1MW3A 2VERA 3HAEA 4OGXL 3SKOA 3WIIL 2UUDK 5F9OL 1S3KL 1XIWC 5IQMA 5FGRA 5SX4H 1XGPB 4F33A 3BYTA 4PRDB 3K0YA 2I07A 1KGJA 4NB7A 4OJCA 1UFGA 3DUSB 4WI0B 1ZTMA 1B90A 2K8QA 3UTSD 2VZSA 3KD4A 3VFMA 3VRIB 5JIMA 1LK2A 1NH6A 1UD3A 4TPRL 1VEOA 1DUYA 5BRPA 3FW6A 2FK9A 4YHOH 4IBYA 4QXUH 4UT7H 5D7IF 5EC1B 2YRZA 2WMPB 3NZ8B 3PJSB 2X6BA 4X4YA 4HXBL 1QFOA 4H0IA 1XCQB 1IZJA 3NGBB 5DWPA 3GZPA 4WFHD 5FO9B 3C5ZD 1SEBB 3QGVA 3T04D 3V4PB 2CK2A 3VMOA 2XNAB 5A2CA 3KCPA 2MCPL 3QEUA 4HIHA 1HCVA 3L81A 5IHBA 3T8MA 1QR1B 3AUVA 3HC4L 3UAEA 4IRZH 4WEUD 1FDLL 2JTDA 1YY8A 3PL6A 4U4BA 3QNYA 2AQQA 4IRJD 4Q2ZA 4XMKL 2JXMA 3NIFE 4P9HH 3BHBA 1I7ZB 3TC9A 2MOGA 1JZFA 2DICA 2J72A 3NCMA 1HTYA 3EYVA 4P2YA 4ZO8A 1U8CA 2OZ4L 1PG7X 1W72B 2F19H 1KBKA 5IK3A 2XTJC 4IRZL 2F1EA 3DIDA 3BKJL 5F93C 4AQ8A 1V7MH 2DQCH 4GW4B 3ARQA 3D85D 3UG3A 1PAZA 1AO7B 2BNRA 4OUUB 4CVWA 4IKKA 1A22B 5ICYB 5JW3H 4CADA 1MCPL 1X5KA 5HJDA 1G7QA 1S7UB 3H6AA 2WGXA 4I5BA 4PJ5E 4W68A 4P5SA 4Z7VE 5EEVA 1KBGH 1TG8A 1Z9LA 3SKMB 1E9PA 3IFOA 4UQ3A 1AHKA 1KB9J 1IGFL 2OR9H 5AKVA 3TTYA 3GMOB 3LEXB 1BQHB 4Y1AD 3ULVL 4IU3B 1CBVL 5CZVL 2VXQL 4C56A 1H6TA 2XKUA 3CX5J 3NAAH 5CINH 3IVKA 2WPGA 3V9CA 3WOVA 2B5IC 2YJLA 5KVGL 4P3DA 3M1CA 5KAQG 1IL1B 3A67H 1WV7T 2EXWC 2E27L 4PRDA 4HS3A 2ENJA 3F7YB 4KAQH 1DBBH 4YDVB 3L1EA 4OZ4B 3C6SB 2P5WA 4FX5A 4UQ3B 4Y4HA 3ME0A 4ENED 3D2UD 4C59B 1HXMA 1S7VB 1UWFA 3DMMB 4K8RD 4EUPA 4KJQC 4G6AC 5E9NA 4YHNA 1YNLL 1QTPA 2ESVD 4HWNA 4ELDA 1N68A 3T3ME 1L7IH 5FYJD 4OCYH 4MMZB 1GHFL 3VWKB 5HYQA 1FZJB 1MPAH 2C7FA 3GLEA 4GMTH 5DGRA 5K59F 2KUTA 1BOYA 1C8PA 2QR0A 4IOIA 1U8CB 3ZE0B 4R5VA 1WD8A 1VFUA 2DWEB 3LIZA 4XAKE 3VMPA 4E5XG 3MRJA 1B2YA 4BIKA 3PL6B 2X89D 1GSMA 3TIDB 4YSCA 3FSWA 4PS8A 2QZQA 1E8ZA 4BUQA 4PGEB 5L7XL 2BNUA 4DW2H 4RQQA 4RVBA 1A14H 2EXTA 3D5OF 3K1DA 1A6ZA 3IJHB 3GJEB 5ADPL 3IN0A 1VPOH 1TIUA 3L6FB 4XPHH 1NUGA 2PKDA 4TV3A 2YAMA 5LCVA 5ABAA 3TO4C 3UACA 4NRXB 3FN0H 1E4XL 1XGTA 3MRNA 4JMXA 4Y5XA 1JNNH 5CGBA 3QDME 4J3XA 5JORA 5C08D 5DRZB 1TZGL 4V1DE 1NOFA 1P84J 5E51A 3CCHB 4K7FA 1G1YA 4CRPA 5HJ3A 5C6PB 1AR1D 1UYWH 4QJ5B 4KHXH 5L9DH 5CLXA 4HPOH 2DYSB 4PLKD 4N4YB 2NTFB 3ABMB 4U3SB 4AIZA 2P43B 1H3WM 4K94L 4WU7A 5LXGH 1J1OL 3FAXA 1T7ZA 1OAKL 3GK8H 4QY8B 4WF7A 3I6GB 1U91B 3SKOB 5BOZG 5HYSB 5F1NA 4DCQB 1BVLB 1IX2A 3C6LC 3IGAA 4XCCH 5HGBB 2RTTA 1KCUH 1JNJA 4AV5A 1GZPA 3S36L 5L0QB 4OU3A 5L0QC 2GB2A 2W9EL 4L1SA 3Q8CA 3DVNB 4KKRA 1FZMB 4OKVB 2FWOB 1CQKA 2OYMA 1IC4H 3HRPA 2W91A 2VZTA 1VKXB 3SQOH 3TO4B 3UTSA 2YD4A 1XSKA 2EIZA 3VSVA 1CB4A 1NCNA 4FQIH 5IEHB 4MXQC 3IDMA 4H25A 4XPAH 3LKOA 1OGSA 1SJHB 5DZPA 5IVXF 1I7UB 4F7PB 4LVHB 2YUWA 1TQBC 1ROWA 4L37B 1PQZA 2YPKA 1E4KC 4QCIB 1BMZA 3ZKXB 4NKMA 2VW7A 1GYWA 1RH8A 4M6ML 3DX2A 4P3CL 4K5PA 3ZT7A 2W88A 1JHTB 3N50A 3KLHD 1JD7A 3BVXA 5HI5C 5KWYC 1UH4A 3QK0A 3UO1H 2LU7A 4IGBB 4KRNA 4PV8A 1AIZA 4GRLC 5E8DH 4N9OB 4M6NH 3UIYA 2Z35A 2ZOOA 3Q05A 5D1XB 1WT5C 5I1DB 4GAGL 3CFTA 3GLDA 3OR6A 5I8CA 4EZLA 4TM9A 1GRWA 2P28B 5ETUA 3WG7B 2APFA 1D6EA 2QADB 4YVNA 1WWAX 3V4UH 1KELH 2OKMA 1M6UA 5FGBA 2EXSA 3M46A 4O00A 3PFQA 1Q94A 2JLPA 3HPJA 3MA7A 2E7LC 2GJJA 5B22A 3S3DB 1AZCA 4Z77B 5FB8A 3TPKA 2W60B 5K5YA 2HX9A 5IB4B 2O4EA 1ZANH 3EDFA 2CKBH 4RAHA 3GMPA 4OGQC 2DLHA 3VGAB 4UTAH 5GJTL 2VMCA 3TYFA 4XN5A 4RAVB 2QFRA 3T08A 4DGIL 5CEZE 5LNGA 1UB6A 4TXVB 4PM1A 2FB4L 2B7DT 2YHGA 2I27N 3TXAA 3DVFA 1OAXH 1AZUA 3VXRB 1AMXA 3T4AC 5LNDA 4CGTA 3F7PC 1HSAA 2E74C 4D0DA 1IMHC 3ZQWA 4MA8H 3G5VB 1QUPA 4P4RA 4M4PA 3CBRA 5F3BB 2QQQA 2WQXA 5ITBH 2H32A 4JFFA 4FL4B 4UM9B 3N0PB 5AVVB 4CU7A 2G2RA 4H7VA 3UXFA 1GZQA 3ILPA 4LXFA 4QTHA 2AXGA 4N22A 2EIEA 1SXNA 5MENA 1F3DJ 1OHZA 3FQRB 4NPKA 3EJJX 1MZZA 1VGEH 1H19A 1N67A 4K3EL 2X4QB 2YGQA 3RHWK 2FEDD 2Z93A 3NK4A 3RIFK 4L4TA 3MJ8B 5E6YA 3CFQA 2ARWA 4OVVA 1IGYA 1CXKA 1TTGA 2BSTB 4H2CA 3FO9A 1FLRL 1HWGB 2AK1L 3WN5C 4RMVA 4F58H 4KQ3H 5DT1L 2G5RA 3EOTH 4G83A 3GSQB 2K7PA 3QNZA 3AXLA 4ILDA 1I85A 4MSWA 2BIQA 3W56A 2V2TA 4GEIA 1OP3H 2NYYD 5E1AA 4PJ8D 3SBWA 1JDDA 4ZX3A 3Q8FA 4HKXB 2L3BA 3QORA 3FDWA 4PIRF 3S35L 1IUZA 1X5FA 2ED7A 3EDDA 4JQXC 1TXKA 3L16A 5C0BA 5EHFA 2ITCA 3CLEL 5KN5A 4KXZI 3NESA 4EN3C 3RGVA 1ASPA 3OHXA 5D7KD 4JLRB 1EUTA 2BVEA 2VLJD 3R8BB 3IJSA 4A67A 1WBYA 5TK4A 4KQ0A 5JHLA 3AU1A 4NAQA 2EDFA 3Q2NA 5A3ID 4LCIL 3CZJA 3N1FC 5IB2A 3Q6GL 2HVBA 4RESB 1CFQB 1D7DA 4ZMPA 5CCKL 3FO1A 1B4JH 2OJEA 1M2VA 1DJIA 3MFFB 4FYQA 4ACTA 3L9YA 3FH7A 4H1LG 3DURA 1MN4A 3FT1A 3QUXD 4G72B 4UOJA 4XMTA 3L45A 2HXAA 4B7LA 4X8XA 1A1NA 1HHHB 1S8DB 3V6FA 4LEXL 4M7ZB 1TJIH 2XVKA 2A2QT 4WO4C 3SE4C 4D9LH 1KXHA 1UT1A 2A1WH 3NJGA 3WNOA 1YEEH 1S5HA 1HILA 2PN5A 4KVNH 5DC9B 1CE6B 1VLXA 5IGXH 4V1DB 3DROA 3RWGB 4GRLA 2YIHA 1YQVH 4RLDA 3RL2A 3GZKA 4PJ8B 2FX8L 3NOIA 3X1NA 4N0RA 1XCTB 4G6JH 1NFDB 3DSNB 3LZNA 4JO3H 4PD4J 5F7MC 3TV3L 4EN3B 1JSYA 3IDGA 4LPCA 2A83B 2VLKA 3RVXC 4OI8A 3V6ZB 4Q9QL 4OZHA 4QHPA 4I0PC 1N7ML 2I9LB 2DH3A 2OSLB 1JJUA 1AD0A 4I9WE 4CVXB 4JRLA 3QWRD 1NCCH 3OSKA 3QH3A 3W3BA 1XL6A 5A2JH 5K1JA 2X6UA 1VGEL 4EAEA 4HT1L 2DMBA 3P02A 4PVBA 1Y7VA 4WY7H 3JV5A 4H8UA 3D0LB 4PJ5B 2VJXA 4TTGA 1MI5D 3LXAA 4LHJB 2K9FB 4OD2A 1Q1JL 2IANB 1C12A 4D3CL 4EUPH 2PXYA 3P3SA 2XQYG 4HCRA 5I1LB 4L8BB 4N8PA 5GHWL 4ZMVA 4NQVB 3MU3A 1OTSD 3LKQA 3M1BA 1FNAA 5T1LD 3UJIL 4BFIB 4M7LL 1HEHC 1IKOP 5FWRA 3MA9H 4DP4X 5B7MA 1MEXL 1NLBH 3T2NL 5LXVA 1ZHNA 3RFZB 1F2QA 4M03A 3HPJB 3FRPA 1AQMA 3IFLL 4QDGA 3H55A 1N8ZA 4K9EC 1WICA 4UQAA 1OTUD 1Q0XL 1E5BA 1NKGA 4KKPA 3TO2A 1A5FL 3ULAB 5JZ7D 4JKPL 3MRLA 4UAOB 2FECL 4AT6A 3JBG7 4AYBA 5TDPB 1B88A 3J8F7 4R7LA 2VL5B 1LXMA 1EZUA 4XWOC 5A2AA 4B9PA 1CGXA 5H4ZA 2F7RA 3KS0J 3Q6FA 3SBQA 5F2FA 3GI9L 4J3SA 3BT0A 3TT3H 1X5YA 1ECYA 2PP9A 2K6WA 3U4BH 4NOBA 2EICA 4TNEA 1Z2KA 4Z5RB 1ZRUA 3D2UA 1OP9A 2O6CA 3EH3B 3RGVB 2BSTA 5FPIA 5AB1A 4EUPG 3V5HA 5I15L 5C0CA 1JERA 1TETH 3V7AE 3TZVB 2JKXA 3HS8A 3P0VH 4G43B 3QHZL 1I1YB 1XZ0A 2E6JA 4YSRA 3GNML 3QXAB 4HKJB 3CWGA 1MRFH 3MMEB 5E1AB 4X8CA 2R83A 4N26A 4LHUA 4JRXB 3UYPA 4F57L 4GNKB 5C09E 1AZZC 1QRND 5LBGA 2PTUA 2ZUTA 3QW9A 4F15B 3HBGA 1CFSB 4JFFD 1OOAA 3QPXH 1HDMA 5T33H 5FYKU 4CA4A 4M9OA 4NC1C 1JNLL 1ETA1 3MXVL 4AVJA 1QBML 1OF2B 2Q2EB 2F1BA 3EO0A 3BZ5A 2JKLA 4UM8B 1UOKA 1V7NL 5TE4L 3L4WA 2X41A 1RZKL 1DQMH 4P9ML 2UY7A 2FL5B 3EXLA 1A4BA 3DLQR 2ENQA 2NX5B 1NCWH 3LIZH 2LTQB 2G2RB 4GY4A 3MPCA 3QIBB 2ZUWA 2X9ZA 1CT8A 4PY8J 1ZVSA 1S78C 1AG0A 2ZOLB 1KZYA 3GIVB 2O5NA 4Q97A 4OF7A 5B38B 1SYVB 3US9A 3TESA 3MRBA 4U31A 5B1KA 1RMFL 1TCMA 1H3VA 3N1MC 3R1GH 4N1HB 3P11L 3JTSA 4LCWA 2MPAH 4H13C 5AW6B 1KCUL 4HGWB 4CAGA 1FL5A 3O9WD 5LCVH 5D71L 5HP5A 3HTLX 3FFOA 1ILSA 2CLVA 3OXRB 3RTQB 1JG9A 3AB0B 3KXFD 1OAKH 1RJCA 4K7PH 1WGVA 4J1UB 2HLFD 4PCSA 5KVFE 2NY1B 2Y1ZA 4K4KA 5EOCH 4CUCA 3V6OC 3MV8B 1P2CA 3MYZA 4PRNB 4XNQA 3ATFA 3MOQA 3THML 2F8OA 4KVPA 3C6LD 4KKBD 4XCNA 1KGCD 5M7QA 5IQNA 2FGZA 4OLYL 5J56B 3KPQB 3D18B 3RDJA 2GCYB 5D8JL 5CZXC 5DVKA 3HHMA 3GXFA 2VM4A 3IDXH 3VFGL 9CGTA 3L2MA 1GS8A 1T21B 3F6LA 3JYBA 2EIZB 2ZXBA 5I1DA 5LN8A 2UWEF 4L4TB 2AI0H 1MELA 3GF8A 4FLOA 3LKPA 4WU5B 3AY4A 3ARUA 4ZI8A 1N5YH 4LCYA 3D08A 5FYKL 3GM8A 4NAJA 3GJFA 3T77A 1U36A 3I6KA 4BK5A 3UZQA 4TNWF 5I1JH 5AG9A 2MCPH 4D0CA 5D2NE 2NMSA 2YSSB 4ZO7A 1HKLH 1OK8A 4U7KA 2AJVL 1U41A 1BQSA 4G8FA 4HKBB 1S7WA 1CD1A 3HR5A 4JFDE 3RU8L 4LKXB 2BOCA 5HYSA 3VD9A 1UJ3C 4X6CA 3ZOAA 3G5VA 2IFFH 4X99A 4NQXA 1JXDA 2WTRA 1P5VB 1GYAA 3FO1B 1U8OA 1PZSA 1ZDSA 2FJFB 4NENA 4MCYA 2CBQA 3OD3A 4K5NA 5IZ7A 5AZ2L 3FPYA 2HFGH 3P0GB 3WY3A 1DE4A 2J44A 3C8KA 4RMSA 4C54A 3C6LB 1KJ2B 5DI8B 1DEEB 3AABA 3LEVH 3FRUA 4MDRA 3AMKA 4DGVL 1A3ZA 3ZDXF 1CLVA 4MVBC 3SDAB 5GSVB 2Q3ZA 4NHUB 3RA7L 4XNMB 3DETD 2R39A 3WY4A 2HLAA 5ANME 2VMFA 2GK2A 4O02H 4N8CH 2Y22A 5H37G 2Y0SA 4MZRA 4IJ3C 4JG0H 5EUOF 5GZNA 3ZYJA 3UPRB 2DQEH 2CO2A 3WIAA 3IS1X 4QHNB 2WBWB 4O9HL 4BK8A 4L4TD 1OB0A 4JN1H 2P8PA 1KZQA 3QQ9D 3KDPB 3KPPA 1KJVA 4AEIL 4IRJB 2ATAA 1J8HA 1ROCA 2QSVA 4X4MA 4CILA 2V2TB 5T5FH 3C2AL 1T83A 1N6QH 2HVJB 3VXOA 1ORQB 3QXWA 1I7ZA 1C08B 1BCIA 1TKWA 4FG4A 4M8RA 3SBRA 3TCTA 2WC7A 1BWMA 2JIXA 2H3NB 5BZZA 1GPOL 2ATKB 3D4CA 2K4WA 7TAAA 1TO4A 1DBAH 4P5MA 2ADFH 4L8DA 4AK2A 2B59A 2KDYA 2Z1PA 2Z92B 4A2FA 2XYBA 5CFHA 2OFQA 3BKJH 3FB7B 3GBMH 4WW1B 2FRGP 4AZ8B 4LE8A 2QQKH 4UV4L 1QD0A 1KJVB 3RNKA 3L2NA 1TUPA 4Y4HC 3L9EA 4UOW0 5CIPH 3KNBA 3KBEA 3P9LB 4JGJA 2WUBH 4WI3A 4NQTA 2HN7A 3RNKB 2IFGA 1L0XA 2X2IA 3WN6A 4YLQT 3ZMEA 1KENH 2ORBH 3IETB 4R3SA 4ATWA 3VRLF 5B4MC 1VADA 3N44B 4P9HC 2VLLA 4EIBA 3QFDA 1EO5A 1RIHH 4AKOA 4YSAA 2B9AA 2LLLA 3FU7B 5D8JH 1NEUA 1NCTA 5EDSA 2ZUQC 4OJFL 4WWID 4XCEB 5GGQL 4NX0A 3R7RA 4JG1H 2ZOWA 4IDJH 4YEFA 4ZMQA 4GP5B 4LFHG 1ZT1B 4F24A 3L3OB 4J6IA 3FTSA 4KVCL 4GO6B 3QUXA 1THCA 2MCMA 4YHMH 2KI6A 3B7YA 5E23A 5HVWA 1JN6B 2O6EA 1JGEB 3T0EA 4XPGL 2D4DA 3SCMD 4XGZA 2EZ0C 1A7BA 1PW3A 3RGVD 4ESKA 3UOAB 4QOKB 4C4UA 5JOPD 1VFBA 4E2OA 5JHLH 3C6SA 3LRGA 4RFOH 2RBLA 1YPZB 3QPXL 1XBRA 5E4AA 2VDLL 5AEAA 1GJUA 1WA1X 2CPUA 3FUMA 1T4KA 4CSPA 4LSSH 4ODVL 4AYFB 1ZT1A 2GUYA 4ZFZA 4DUVA 4JDVA 1MCWW 1HHGA 4XMZA 4PJ7E 5CSZA 4BQ8A 3NQIA 2O1AA 2VXSL 3FL7A 4K55A 3D07A 4LCCC 2EUVA 3ZZ1A 5IWLA 4KKLC 1RV6X 2FEEI 3QEGL 3BN9D 3KVDD 4O5LH 5IROA 3I3DA 4LLYA 5C0IB 5AW9B 2ETWA 2H0FA 5F8QC 4ODUA 3ZK0A 2IV9A 4PJFA 5J9PA 4ZUUA 4PGCA 2H1PL 5BMFH 1YY8B 3CZGA 4IS6B 2YBRA 2P3YA 3HG1A 2BXZA 2NOYA 2VM3A 3KYNB 1E5UI 4OY9A 1DJXA 3HFFA 2ZCKH 4IS6A 2GY7B 5T8IA 1JWUA 3N04A 4L3EE 3VM7A 2L8AA 2DRUA 5I16A 1A5FH 5MP6H 3KWWA 2H2PD 4M8VA 4G9DA 2QEJA 3ZSTA 1NBYB 1PLGH 2NNRA 4L8CB 2JH2A 1CLZL 4M00A 3QNFA 1FJ1B 4H25B 5DUBB 1T21A 2HRPL 1E50A 3VWJA 4KJQD 3LZFH 2O5XH 5KW9L 2G2PA 2AJYH 3B6SA 1S7XB 4M7KL 4BQBA 4GMSH 5DURD 1T6WA 1CE1H 4R0LB 3QIWC 3U0PA 4WHCA 1M9SA 4P2AA 3GS7A 4A2EA 4JL1A 4PJDF 4XXCC 4X6DE 4PJGE 1WBXB 4LSVL 1TETL 1AXTH 3RFZA 1XSJA 2DI7A 1TZHA 3EO1A 5EUOA 43CAB 1CXFA 1WAAE 1JRHH 1OAJA 2NR6D 4MX7A 3ME0B 1HH6A 1CFTB 1E4JA 3INUH 3CHRA 3QO0B 3C5ZB 3DRTB 3CZFA 3HI5L 3K8MA 3PJLA 3GXNA 1WAPA 3HAEB 5FOJA 4F2MB 1UWYA 2CJUL 2QHLA 2NUTA 2HFEA 4K15A 4XI5C 5T1LA 5IM7A 5T3XD 3O4OB 1A7PH 3T0EB 1K5WA 2WNXA 1I31A 1E7UA 4EOWH 4GH7B 1XR9B 2QGCA 1QLFA 1F90H 5GJTH 3QQ4B 4LFHD 1AOHA 2DLEA 4G7YH 1NPNA 1SOQA 3A5VA 5IEKA 5GQBA 3L48A 3IDUA 3O4LA 2ADIB 1U8HA 2YBGA 3NBNA 1QRNA 2WZ5A 1Z3GL 2AMGA 3NRQA 1KIPB 2YA1A 4FZ8L 1X5ZA 3F7LA 2QKIA 4PJBA 3UDWA 3TJHD 3QFDB 2WWKO 4O4YL 5ISZE 2DQDL 4JFYA 4TLSA 1AR2A 1T66D 2FL5A 3BPLC 4WI8A 5HXMA 2YWYA 4HVBA 5DD5H 5K39A 3R8QA 4EQ2A 2IBBA 1TTRA 3ZIYA 2ZKMX 4DP0X 2OXHB 4RISH 1ZHKA 2AQ2A 5JPMA 1RFDH 5IQ9A 2ZG3A 4HCIA 3GDBA 4JZNA 2H3NA 1BQLH 6CGTA 3HN3A 4AQ1A 3VB9A 3VGDA 3MRCA 2R69A 4IQHA 4APQA 4OLZL 2AK4E 2QLVB 1YY9D 5B3SB 3UYPB 5E6RB 2AQPA 3QIUC 1RZGB 4UUJB 1CYGA 3HC3H 5I8EA 2EH8L 5K9OA 1HI6A 2X05A 3D05A 4KBPA 3OR7B 4B0MB 1A25A 3IXAA 4Y4FA 4KH9A 1N4XH 3NEXA 4X7EC 2QVFB 4FQ2L 1X6NA 2IEPA 2PWGA 4OZGE 1UWGL 2JELH 2WVVA 3K80A 3KZ8A 5CILL 3ULSB 4QXTA 2PWHA 1HYRC 4WFFE 2V7NB 5E7BA 3DJSA 2VIRA 3C6LA 5DI8A 3NJJA 4GI8A 2OCJA 1IT9H 1S7TB 2ENPA 3EJZD 3LH2H 4TLTA 4X80L 4HWBH 2BVPA 1LEGA 3TO2B 3Q8AA 4B9IA 2DH2A 4E9TA 1WFNA 4XP9H 2WKGA 2ZOLA 4XOEA 1RFDL 1NCBL 4U1LA 3S97C 3M1OA 3BP5A 4ZODA 1I3GH 2RFXA 2DS4A 3BWUC 3BP6A 4G6AD 3UTZA 5JOFB 2F61A 1LP9B 1WEJL 3JWDL 2CO3A 4Z7WB 1S9YA 4F1SA 4X0KA 3JTTA 4LCWE 5KJ7E 2Y06L 5FYJE 3BZFA 2ZX7A 2VN3A 1ZCRA 1H3UA 3CVIH 1JZGA 5DK2B 2D0FA 4NQDA 4YDMA 2B3IA 2GUOA 4N2OA 1Z3GH 3CMOL 5C0GA 3FUIA 3NCFB 4GRLB 1ZLUK 1JZJA 1YEHL 1JPEA 5GSRB 3UJJL 1KENL 4MYWB 3O3BA 2C7UA 4UINL 3RWEA 5G55A 1LHZA 1LNUA 1RZIB 2PCFB 1KBBA 3G6JE 4G7YL 1EZVX 1O5DT 1NDMA 4DPCX 1L6ZA 5DQDH 3ES6B 4WKZA 2EIJB 2YAFA 3FB8A 3GSOB 3QNYB 1LK3L 4R7XA 5E4EC 1A6UH 1KB5L 1MI5B 3WKYA 4ZMOA 2K9UA 2MHAA 5I73B 2XN1A 2NCMA 3U9WA 4RZCB 4XVUD 3NIGB 1GJIA 3CSTA 4HMCA 5D2NC 4NS0A 1ETB1 4LO9A 3D85A 1DCLA 2GUOB 4FQXC 4ICWA 1MIMH 4E9XA 3MLUL 4PN6A 4NWTL 3RWGA 4J2XA 1MVUA 2OBGA 2QL1A 4JCWA 3C2AH 1GZHA 2ADJB 4K23L 5EUKB 1CZ8L 5GZND 4FI8A 3A0OA 3ZR6A 4CU8A 3HCVA 4BDVB 1I9JH 1MXGA 2AKRA 2WMPA 1MVFA 5DJ2A 3ATDA 3TBBA 1DO6A 1ZV2A 1A2YA 1QSEE 5CILH 1KJ2H 3CZSA 1FO0A 1RURL 4W6XB 4X5LA 3ZUNC 4F7EB 5C0RL 3BAXA 3LQAH 5CP7A 5EV7A 1XAUA 2W9DH 3D52A 3BUPA 4F7MB 4FC3E 2E86A 4UCFA 4KAQL 4LDLB 2CGRL 1RJZA 2ARJB 3G04A 3GYRA 2EVHA 2JIXD 3T1FB 1VRSA 3G5ZA 3R0MA 3WIHA 5I1LA 3S4SA 3WO4C 5CHNA 5HYJA 3N1PC 4R4ND 2VXUL 2VXQH 5I71B 1A4JA 5AUMA 1VFAA 3RZCB 4V33A 2VMJA 4LGSB 4A39A 5IQ9B 1BFSA 4N2CA 2GSIB 1MWAL 4ZTOL 5J8OA 2N0KA 3NCCB 2JK5B 1CG9A 5B1JC 4HC1A 1LLAA 1N70A 2X6AA 2F7IA 2ZCLH 4YHIA 2VXSH 3K81A 3D2TA 1BVKA 3KPRA 3SQOL 4FTVA 1NEZG 4JPWL 1KN4H 4MKTA 4QXGL 4L1TA 5EPMB 4QTHB 4Z23A 3GXUB 1VENA 1UZ8A 3GZOA 4M6NL 2OMZB 4FG6D 5L4IA 3CZEA 5CD5C 2F53B 2JKJA 1BFTA 4XR8C 4K5OA 5IWLC 3HG4A 4NQSA 1U2HA 2H9GB 2X89A 3QUMA 4R90H 4DH2A 3MRDA 5F44A 3QWOA 4TSCH 4B50A 1KDJA 2F53D 3C08L 2CHNA 5BVJB 2FQGA 2XXMB 1OCZB 3QQ4A 3KPRE 4HWBA 4U3CA 2R56H 2EAEA 3IDXL 2R69L 4L3FA 3NFNA 2WQUA 2DOCA 5MERB 5BW7C 5JHDD 1NBVH 5DA0B 5E5MA 4XN1A 2X1QA 4MJ4A 1RLWA 3MBEA 1JV2A 2P5EA 3BP6B 3FN9A 4I3SL 5EDXA 4B7IA 1YNTB 5AFAA 1KYDA 4WLCA 5C7ZA 2K4AA 4APXB 4EQ3A 5IG7A 4N3TA 4U3SA 1UVQB 1CFTA 4AE1A 3X2QB 2E9JA 1CFMA 3AS3A 3SGEH 3VE0A 2UZIL 1GMIA 5EZLA 3UBXA 4RNRA 3HS9A 4DEWA 1LO2H 1MFCH 4UB0H 3CVBA 5C8JA 3RVUC 1RD6A 3T65A 2EKSB 2EE6A 2CIIA 4A7SA 3APFA 4M7ZC 4XCCL 2EDDA 1K72A 1MFUA 2JJTC 3FQYA 3F58L 2WN2A 1RHFA 3HB3C 4M9PA 3WBDA 2VR8A 5EIQA 1QTYT 3KLLA 3TZVD 2Y2YA 4G9FA 1FSKB 1V3KA 4XVTL 3QG6A 4ELKB 3CN2A 3WSQL 3LV3B 2YBRB 1ILUA 3U2SA 1YEDB 3UP6A 1I1FA 4F7KA 3ZHDA 4TL5A 4S0HA 4V2BA 1EBPA 1EVUA 1VAHA 2WW8A 2V3FA 4JO2H 4ZXBC 3VTAA 4HFWA 4LZKA 5F88A 1M53A 4HIEA 2RA1A 3IDGB 3MCG1 1Z3RA 4O5LL 4BFFA 1J8HB 2WIIA 4LEEA 4OFKA 1M56B 4P5TA 2NR6A 3RPBA 1IBGL 3N0AA 4D7BA 1IRAY 4PPTA 2YMXL 3EJTA 4ZQKB 4HD9A 4JW3A 1F86A 4HUCA 1M71A 3NP3A 4FKEA 1ZIBA 2ZCZA 1ETJA 1NKOA 3DUUB 4NQDD 5H35A 3WEMA 4M6OH 1HZLA 3QAQA 3VWJD 3FHAA 4YH6A 2J6EA 5I0VA 3LKRA 4WWKC 1A65A 2IADB 5EBLA 4LL4A 4MQ7B 1ZLUH 3HC0A 2QTEA 3VVWA 4EVNA 4APQC 3BDBA 3WLBB 4WTWA 1DJSA 4PB0L 3QUXB 3FTGA 1FE8L 4L4VB 4ISVA 5I1AB 3L7FA 1P5VA 5IJKC 2BSRB 5H37A 1GA2A 3A21A 1I3RA 1QX1A 4FEMA 1DBBL 3GMMA 1CR9L 1CD1B 1EANA 4S1RH 4ES9A 1Q0XH 4FRWA 1FO0L 1FYTD 4FFYL 3T8XB 2YSSA 4BHUI 4HS8L 4YHKL 3NAAL 4U1MA 4D8PB 1Z1WA 2A6KA 3T0BA 1JTOA 2X4SA 2YOCA 4FJZA 4LDEB 3JVGA 1LQBC 4WI7A 1P4IL 1XGQA 5IROC 4WUUE 5B7FA 3DMMD 5DVLA 5T3ZE 3DO4A 4X7SH 3D06A 4YZWA 3PIQA 5BOPA 1BA9A 4KV5F 3MRJB 2LVCA 4X9BA 3LS5H 3N43F 4QF1A 5D7JA 1F6FB 1FFPA 3N1QC 4HWZB 3O6FC 3IMUA 5D93B 5DRZA 4BFGA 4JZNB 2ODIA 1U8NB 2DL2A 1ORQA 4J3VA 1Y0LA 1SLVA 1Q9KB 3ZGHA 4BCXA 3EH4B 4YDJB 4Y4FD 5T5NG 3L6FA 3TVMC 3MBEC 1AGEA 3T0DA 1J1XL 2LFGA 3KPPB 6FABH 2WANA 5JIQA 4KXCA 2EYTB 3NRFA 3SYQA 4L4VD 4P48A 4KJYB 3UYOD 2P80A 3AREC 4QHNA 4H20L 3L3GA 4P2QB 2DB8A 4JRWA 2XQYK 2P8LB 3FQXB 1OLLA 1W15A 4P9HL 2HLEB 5ALCH 4IU2A 3DHMA 1U8NA 2ERJB 3PGCB 4JG0L 4HS3B 2Q8BH 3RFZC 4D8OA 1EEUA 2Q7AA 4HGWA 5EZOH 3GSNL 4XHJC 5H4YA 1MCOH 3CLWA 2XWBA 3LN9A 3IE9A 2IDQA 4QXWA 2O61B 2VM9A 1X4ZA 4M62L 4B9YA 1L7TH 1QLFB 3APNA 4K2UL 2JB5L 5KVDH 3V9EA 2YPLD 4EUPB 1BQHA 4HIXL 3ARYA 2R1WA 4F5CA 4PB0H 3D9AL 1M6OB 4O02A 4MMYA 4YDIL 4H8QA 4P5TC 4WHDA 3CN1A 4Y9BA 5FUCC 2EYRB 1TJHL 1BZ7B 3D87B 4MJIB 1W91A 3DIVA 3PWVA 1I9EA 3GO1L 2WKLA 3MLUH 4DPRA 5JQ6H 3DYOA 1MJUL 1GMEA 1S5IH 2X0VA 2O61A 5ESVA 2B0SL 5DRWB 4LPWA 3LTVA 4IOSD 1OCRB 3KPSB 4ES8A 4IW4C 1WITA 4Z7WE 3I6LD 5E00B 3G7TA 1KYFA 2Z4TA 3LQAC 3EH1A 3R19A 4LSUL 5E8PB 1IQWL 1VIWA 3MRKA 1UQSA 5T3XH 2D3JA 1PD1A 3ZTDC 1YUHB 1UKSA 1F58L 3LB6C 4KDTC 3D4GA 2VQ1B 2NT0A 4LSDA 2FBJH 2MQ0A 1ODAA 2Q6WB 3RI5F 3ZE1F 1VA9A 1QPKA 3MLTB 4JFPA 4HCRH 5CLYA 5DJ6B 2M83A 4AIXA 1PYWA 5HD8D 4A66A 5E6IB 1NCUA 4AOFA 4Q9RH 3TZVA 1NGQL 1KTDB 5BS0D 4YSQA 2APBA 4TUKH 3KW8A 2FWLB 1MCBA 3D34A 2PYED 4FI7A 1PAMA 3V0AC 4MD0A 3WCYA 1FZKA 3WIHL 1OLZA 1QFUL 3MHZA 3RB7A 5EO0B 5AD0A 3FJTA 1T0NB 3EYVB 1TITA 1UH3A 4WWPA 4IGBD 2WQ8A 5DFTA 3PIQB 2BOBA 5FK9B 1FQ9C 2WIMA 4AENB 5BZDA 2E9IA 4KDWA 5F0MB 3WN5A 1EBAA 4Z7NE 1BAGA 2XKNB 1YDPA 4DNLA 3F58H 3VXQA 1KULA 3UBGA 3LRLA 3K7UA 4YGAB 3W57A 1OPGH 2G3XA 1OW0A 3LV3A 1IM9A 3ULUD 4HAKA 4ZW8A 8PAZA 2H3XC 4FQHB 3RHWF 2FECI 2KH2B 4HMDA 1R17A 2COQA 1ACYH 4XBGB 3VJ6B 1BZ7A 5I1CH 4PJDB 1VFBB 1FNGA 2Y3NA 3SDXF 4YHZL 3EHBB 3MC0A 3W9DA 3CFDA 2JE8A 3R06A 3O41A 4Q0XH 2X4RA 5E6IC 2DQHH 2WO3B 3LPWA 3P4LA 1DE4B 1B0GA 4L1DA 3LNHA 5C0AE 2J5LB 2DEWX 3D0AA 3PV6A 4P05A 1UFUA 2HG5A 2YD8A 3BLKA 3SDXB 4K3DL 4PWKA 5JNYB 2WWMC 3GEFA 3ECWA 3TNMB 5EEXA 1E2VA 2CO7A 3LNFA 4P8QA 2BSEA 2R2EA 4RA0C 4RDBA 3KYMB 4LPXA 1SLUA 1O9WA 4MJHA 5C0AA 4YSEA 1PZDA 1OT4A 3MN8A 3JV6A 3L3GB 4E9SA 3GBLA 1AO7A 2AJUL 2BNRB 2VDNB 1BW8A 4PP1C 3QXAA 4XO3A 4DPBX 5I19H 1WFUA 3KHOA 3GSXB 3P9MA 5LBVA 4BHUA 8FABA 3DI2B 4KRPB 5HHNB 1FG9C 1IGIH 1KIQA 1NWPA 2A73A 4PTUA 4CVZB 1U3ZA 3KPRD 5C0CB 3FSAA 1A9BB 3QUHA 4F8OA 2DWEA 3LNIA 3FQ4A 4UTCA 3VRJB 3FTXA 2IWEA 2VC2L 2NZ9C 5IBUG 5C86A 5GISL 4FQQB 3HZYA 2OK0H 2AVFA 3MNDA 2BZ7A 4OTXL 4PS4L 4M56A 4LHUB 4FERA 4AT6B 4XCFH 1N5AA 3EFFB 3ARSA 4I4WB 4XWGL 2XN2A 4K3DH 4PLOB 1MAMH 3VGAC 5CO1A 2OW7A 2YQ2A 5GGUA 5AW5B 3K8KA 1XSOA 4NO2B 1LEKB 1MHEA 4CDGC 3QJZA 4ACPA 2W9DL 1X5XA 1IKFL 1CICA 1YLBB 3IFLH 5KVEL 3TN0B 4OZHE 1C8QA 3GSRA 2KYIA 2VR9A 3DRQA 1TU2B 2SEBA 3HNVL 1ZVYA 2KBGA 3S34L 2EVIA 4RX4D 4TQEH 2UZYA 4OIIH 3IDIA 3GRGA 5HHMB 3RKDD 1VEMA 3EBHA 4NBZB 3DV4A 3GXIA 2CLZB 3ARDB 3OAUL 3GRWL 2VQUA 5E9DE 4UT6A 2J88H 5DHMC 5FUCE 3D0LA 4PJ5A 1QSZA 4CKQA 3E6FB 1XF4B 4GMSL 1GTNA 3D69B 4QUOA 3U9PL 4FFYA 4YX2H 1HYSC 3MKGA 3QR2A 1YN7A 3IFPB 2I9LA 3N9GH 3OKKB 3VWKD 1SF3A 4PRAB 1NCCL 2H6UA 3AT8A 1NKRA 3G6AA 1NCJA 1AKJD 1AGDA 3SYCA 4PS3A 1J5CA 5J1AA 4Y4KC 2EIMB 2ADJA 3QCUL 1MNNA 3JSSA 2L7EA 3MROA 3FH5A 5EU3B 3I50H 1BX2B 4ATTA 3BCDA 3GSWB 1HQRA 1FV1B 1JNNL 4UANA 5KSAC 5H8DA 1FORL 4BUGA 2J43A 3CVIL 3PWUA 5EO1B 3O2DL 3TM6A 2VC2H 4BQ9A 4NZFA 1K6QL 1XMWA 5FECA 5KSVB 2FTAA 1J9SA 3W2DL 5D7SL 3FT3A 2D7OA 1UKTA 2EE2A 1B3IA 2O72A 4JFDD 2DQMA 4JPKL 1L9SA 4MJIE 2BSSB 4PI0A 4GKSB 2JNZA 1IBZA 3GC3A 3I2CH 2FJHA 3CGTA 1XGUB 4QOKE 4AQAB 5CZRA 4DQOL 1CI3M 4DKAA 4NQDB 1WPCA 1BAFH 1UACH 3VDBA 1A7QL 2VDML 2XTJE 4A04A 2YO3A 1AR1C 3UABA 2YLHA 4ONHB 3SE6A 1D9KC 3GIZH 4KK9D 4PMFA 2K1MA 1HHKA 4GQQA 4OF6A 2H2SD 1JFQH 1FYTE 3QFJA 4LLWB 4I1PA 2IDTA 2FIKA 4J8QA 4Z77A 3ZTCC 1DSWA 1XH3A 4HJ0C 1LWRA 4HPYL 2QMJA 1DVUA 4M62H 4DP9X 2D4FA 5E8DL 1R9FA 3BRDA 3MLSH 1G5AA 4OZIF 2BRQA 4X7DC 5GGVY 1MFDH 2W0LA 4PUBH 3EGDB 5DK3A 1H5BC 2KZWA 3MRPB 4KUCF 3X1EA 2B1AH 4BZ2H 5I1CL 2A99A 5DLMH 4A2GA 4GUOA 1B0RA 3B3IA 3ENEA 5KG9A 5AL0A 2NY2D 2WZ0A 3RUGA 3PWJA 1MCDA 3SDCB 4PVMA 3LQZB 1MREH 2CDGB 4U1HB 2UYLA 3BUQA 5K9KA 1OF2A 4X4XA 1C5BL 4PCYA 1ZOXA 4GBXB 4PREB 1A64A 3TT1L 32C2B 1Z6JT 4ZXBB 3WTWA 1HHJB 1TCRA 3FFCB 4IIQC 4OZGA 1D9KB 1ETZB 5FUZH 2EDWA 4QGTA 4CVXA 4DFIA 4ORGB 1N5AB 2X87A 4I4WA 4UUJA 4XMPL 3IS0X 4KUZH 4IBVA 1MXDA 1PEZA 1HNYA 3UTPE 1PSKL 2W9EH 3NJVA 1YAIA 12E8H 1QWNA 5J6GB 4QRTA 3LXBA 5ID0A 4TUKL 2ZCHL 4MXQD 1DJHA 3EJRA 5JA9A 3LMJL 2H41A 5I6PA 4BKSC 1W2KT 2AQTA 2I5YL 2R29L 4GBXA 4PREA 5FW6A 1CXHA 2Q8AH 3TURA 4FOMA 1CDCA 3H2QA 3WFDH 4O9HH 1S46A 1UXMA 1R3LA 2WQVA 1KLUB 3QDGD 5J11B 4I7ZC 5IW6A 1MY5A 4QTFA 4NPJA 4Y7OC 4JBSA 5GPRA 1CGSH 2Z4QB 2I9TA 4H26B 2EIDA 4HLEA 3OMNB 5IVZA 4JDEA 1QEWB 3LNDA 2Y2TA 3FOMA 1XF4A 3F83A 4TVPL 3C8HA 1N6UA 5DUPH 4WEEA 2GW5A 4X6FB 4JHBA 5ALBH 3II3A 4LOUC 1CL7H 1NIAA 1MCCA 1UZ6F 1NA8A 2PNDA 5G2NA 1D7CA 2DQIH 5FW7A 3B37A 1C1EL 3D39B 2ROXA 3T0WA 3QUYB 5CEZD 1NC4B 5ERWA 2L4OA 1B0GB 1NAMH 1TU2A 3SPGA 2Q86A 3HVNA 5I8KH 1ZA3B 4MB5A 3GMLB 2X2JA 3EYUH 4NUQA 4E9WA 4OCXL 1R5WA 3DO3A 2PPCA 3TA4D 1A6ZB 2VAAA 2EO7A 2C9XA 4WENB 5A43C 2F54D 1EVTC 4OCLC 3FUKA 1CGVA 4IOSA 3ZKQD 1G6VK 1KC5L 2C3GA 1CO1A 3KPSE 3G5XA 3K2UL 3QXVA 1X3DA 1CGSL 1FWXA 2YAOA 4RWYL 1I8MA 3CV5A 1QQDA 3KPMB 2OYLA 5EEWA 3O3DB 4OZHB 5AYUH 3VCLB 3WFDL 2E9GA 4AYEC 3OR6B 4OD1L 5I8CB 3PWNA 4HUXB 5JR1H 4X6EB 5D2LF 2A73B 4PTUB 3SPCA 3VWKA 3RIAF 3UMNA 1V3JA 1X5MA 4HMEA 3KWWB 4N2EA 3FU9A 1HQRB 4JO1H 12E8L 1CVRA 1DQDH 4BH7B 1IBDA 3OTTA 4FQCH 1T1XA 2IVFC 3DPBA 3K4AA 4GSRA 5HYJB 2AK4D 3SJVB 2GSMB 2YN3A 2H47C 3IJ9A 3DX3A 1G9NC 3MV9A 3IK2A 4XPFH 5CBAA 3OKKA 3NYKA 4LSRH 2HT4D 4QRPE 5D96B 4PJ9A 4Q6YA 2BHYA 4UT9H 5JHLL 4I48A 3BZ4B 1DQQA 4FXKA 2O5YH 2YGPA 3U9UB 1VERA 5DQ9B 3GKZA 4KKAD 4H88H 4LCCB 5LXGL 4F8TA 5HI3D 2Y6SD 1IM9D 4XCYA 2NYYC 4PJEE 4MJ5B 4IYKA 3Q5YA 2NUTB 4ZFZB 2VB5A 2PWDA 4LQ1A 4LEOB 1IO4C 2VDOL 3V10A 4Z3FA 1R5VA 2BVOB 3X3FH 1EDQA 3WYRA 1JYVA 2PETA 2VDOH 5GGQH 3AADB 1QSFE 2DYRB 5CU9A 1ONQA 4KJWD 3OJDA 3RY4A 1E4WH 4JY5H 1NCIA 5GGRB 1RIHL 4HIJA 2BIMA 5M95B 1E4XH 2PCXA 1JF6A 3LOWA 4QRSA 3QNXB 4Z78B 2DJUA 1EO8L 1TEYA 1FH5L 3IDYC 3L3JA 2MCG1 3T0EE 1EWHA 3ZT5A 4XZ4A 4P99A 1U93A 2EDMA 2LW3A 3ULUL 2DQGH 2W65A 3CVHA 3RTLA 1Q72L 1EGJL 4NPYB 3WS3A 3MAWA 1VJSA 1JCKA 5AL8A 3NP4A 4YDKH 2ADFL 3FMGH 1BJ8A 3A6BH 3QXTA 1JIBA 2JCCE 3JVFC 4JPWH 4JZJB 1K5NB 1CUOA 2IH3A 4YR6B 6PAZA 1UM5L 2Z93B 5FGCB 5CWSB 1KYAA 3N43B 4AJVA 4HXBH 4JCLA 1GGTA 1RIVL 3T0AA 3WO4B 2C3VA 3PP4L 1OP3K 5D7SH 4DP8X 1EEQA 1J5OL 4RAUB 5CR8A 5JOFA 3V4PA 4M5ZH 4B3VA 3O2DH 1E9OA 3GBNH 1KPRB 5G5DA 1QAWA 1A7OL 3ZTNH 3ESMA 5GGSY 5E8NA 5DJ0A 2EDTA 3HJ0A 4TVSa 3FQTA 3U7YL 2P4AB 1TQUA 4R97C 5EC1A 2BNQB 4K5LA 4ZFOB 4P2CG 1U8HB 1S3KH 4EI6A 4M93B 2YXFA 4AC2A 2ZYRA 4FL4C 1L6PA 4Q52A 2Y9RT 1FAIH 3LPOA 3D51A 4BZ1A 5A6MA 4CNIA 1TQCB 5D70L 5JOEA 2EDQA 4N2DA 1X7TA 4OQTL 3VXRD 4ANVA 3GMOA 3LEXA 3BPNC 1MRDH 4N85A 4EXPX 1ORSA 2F8VA 5AOLA 5TQ2H 3I6GA 4FNTA 3QG7L 4M4RA 2YPVA 4C56E 3T8XA 2J88L 2FX7H 3HRZB 4LLUB 3ARDD 1TVDA 4C4BA 3AFLA 3SE9H 1IC0A 3V4VA 1WP6A 1WTGT 2BHUA 5E6SB 1WAAA 2PO6A 4WK2B 4PJ5D 3RDTA 1SBSH 4Z7QB 1YPZE 4LVNB 3BISA 1ZHLA 4XOAA 5I66A 3RVWC 1KTKE 2WINA 1ERNA 2F19L 4PJ7A 1A9BA 3FCSA 2GHWB 5ICZB 1XGTB 1EHNA 3S35X 3Q2WA 4W9GC 3CZNA 3IETA 4R3SB 2YFOA 3UTQB 3FB5B 4P59L 4KRPC 3NJKA 5DFWH 5HGHA 5ACZA 1R3HA 1BJMA 3ARGD 5D4QA 1JNHB 3AM8C 6PCYA 5H35B 1GS7A 3C08H 3QZWB 2WSPA 4F7TB 5F7UA 2NY1C 5AALA 3QB7C 1ZTXE 1RUPH 3L5XH 1PYWB 2EEFA 3PYCA 1QRNE 1UURA 1CFBA 2WB1A 4KX9A 3IGFA 4EI5B 5L8LB 3OKOA 3N40F 3HG1E 4YQXL 4IOIB 3I75A 1Q0YL 1D5XB 2N59A 3NCJL 4WI2A 4FFTA 3GTNA 4OLXH 3QFJD 3V6OE 4JANA 5FFLA 3F00A 3CHXA 3O6MH 1AFVL 2PP8A 5DUML 2G5UA 1II4E 5CGYD 2DN7A 1BHGA 1CU4H 2UVFA 4HFUH 4EIZC 2ZWNA 4G7VL 4WCYL 4QXUL 2J1ZA 1UXWA 2R1YA 2W92A 4PY8I 4CW1B 2NY0B 3X13A 3S6CA 1SQ2N 5BRZE 4I8DA 3ARFB 1AANA 2G9HA 2XPZA 2XQBL 4UILH 3IU3A 3UC2A 5J1TC 1I3RB 1XH2A 3C5XA 1S2EA 4IK6A 1QYGL 4FI6A 4ZYKB 2ZWZA 3PNWA 5EU6A 4LCCA 1QYGH 1JPSH 3RVVD 4P9MH 1QHQA 4MDIA 4H1LA 1COBA 1INEH 3BKCH 1S78D 4MA7L 1NFIA 1RK7A 3I02B 2GJRA 2IOOA 2XQBH 2LV4A 2ZUVA 3GIVA 3CUPB 1AY1L 4GKOA 4X8JB 4IHOA 5HGGS 2I26N 4LNRA 3BUBA 4FYRA 1S9XA 2VSKB 3OKYA 4N2GA 3IAGC 4PJBE 1YMME 4UQ9A 3TJHC 1KCLA 2V5YA 4HFUL 3MNMA 4JRYE 3A6CL 2FJGB 3UIZA 4HCGA 1SHWA 3ZE2F 3OX8A 3DVIA 4NT6B 4ZMWA 3RGVC 2B15A 3IKCA 2YA0A 1X7QA 2AQ1A 3NIDF 3WEBA 2DIJA 4ZAKA 1U8JB 4J4PC 3C5SA 3NCJH 2WVTA 1KY6A 3QHZH 3TLRA 1QFUH 2HT4C 4LPYA 5ACMA 2CRMA 2FX9H 5GJSL 5KYXA 3H3KA 1E6JL 1CFSA 4BEIA 1UM6H 2J2ZA 3V5DA 4E41B 4ODSL 4G8GA 4XP6L 4IK7A 5HI3C 1R19A 2QT6A 2AEPL 1AQDA 5HHVL 5MI0B 3C9NB 4NC2B 4EO5A 4NM4H 1IGTB 3AREA 2ZT9C 4BFNA 4FMVA 2OL3L 4PJHA 5FF6A 1MHCA 3O6FB 4GS7B 4YDZA 4D0BB 4I0KA 4GOSA 3HRZA 4LLUA 4RGNB 4WNSA 3VYPA 4Y1AB 1G6RA 1ZE3C 1BYNA 1JZ2A 1HOEA 2V5MA 4KPHL 4W9KC 2XIBA 5JHDA 3MLVL 3IMSA 4K71C 4XO8A 5FO9A 1L0QA 3NA9H 2P5WB 4Y4HB 4JX0A 4L48A 3GTTA 1SBSL 1RZPA 2WKOF 3B4NA 3TVMB 3F7YA 1DHKA 1X7SA 4OF3A 1JPFB 2YEZA 1Y07A 2C9PA 2XRAH 3SODB 4FFZH 2EKSA 5FM5O 4JFWA 1GIGL 5E99H 5BUPA 5EBMB 2VGLM 3MOBH 1K4CB 4QYAA 3FTGB 1AXTL 1N9PA 1TJHH 2A5UA 5IHZA 2DKSA 5EBGA 2HAZA 1AY1H 4JK0D 4GSDL 1ZKAA 2XYCA 4MBOA 5F70A 1CE1L 4X99B 3CK0H 2VLLB 3V4UL 1AYOA 2XWDA 4QHLB 2XZCH 1NANH 2E7MA 2V7HA 3EJYC 5HDWA 1JZ3A 5I30L 5KVEH 4ZUWB 4G8FB 3NACL 1QSEA 4KROC 2HKAA 3PAVA 4G6KH 4L8SC 3MJ9A 1QWUA 4JE4B 3HVDA 4N2HA 3BKYL 3TF4A 4WDIB 3GSNH 3RBGA 3X12B 3T4YA 4ZUTA 1OAZH 3AC0A 4HQQH 5GGVL 3SQRA 2W94A 3ESOA 1W9XA 3W0WD 5AKTA 5KBKA 5MEPA 1NGYA 3LN5A 4HDIA 4K71B 4NZDA 1BD2B 3AY4C 1OARH 5J6HB 5AW0B 2RIKA 4YHPA 1R3KB 4H20H 4JFOB 2MCAA 1BQLL 1FH2A 1W8EA 1SDDA 2FBRA 2JXMB 4EF3A 3IFNH 5DCCA 1EFQA 3LXCA 1GGCL 3MLRL 2X4SB 3VFPA 2QSQA 2A9MH 2WXOA 1H8NA 43C9B 3QJFB 3IXTA 2ATPA 3ZRCC 4IMKC 1OAYH 3O2WH 3CK0L 3NABL 3ZE2B 1ONQB 4PR5B 3MTRA 3ZIMA 4Y2OA 5SX5H 4WJKB 1TQCC 1UWXK 3QZLA 1A3LL 1GOGA 1Z9MA 4UQBA 2WLJA 5KEZA 2P9RA 4Q6KA 4B60A 1KLFA 1NGXA 4K5MA 1RPKA 1CD0A 1O5PA 4J12A 3QCTL 4S1SH 3GQFA 2Q7YA 4WTZG 2DAVA 3TOPA 1ZD6A 3VU1A 2IH8A 4W4OA 3QR1A 5CCJA 2LU4A 6TAAA 4DZBA 1S7QB 3EDJA 1R5IB 1U8LB 2DWDB 2Y7NA 2E7HA 3ZGIA 2NY7L 1MCQA 3VI3B 2OL3H 3BOVA 1QBBA 1KLFB 1NGXB 5CZXD 5JXEA 2R23A 2YKKA 5ADOL 3I9GL 2QVKA 4XPBL 4PBWD 3IPEA 3U6XA 4WEBH 5DO2C 5TF1L 3RNQB 4F37K 4Q6IA 1SVZA 1FLRH 2ITCB 3ML8A 5AW4B 4Z3TA 3QZOA 1UTDA 3IF1A 4W9JC 2Z91A 2QQLL 2XTJD 3V4LA 3F7KA 4JDTH 3WMPA 2O5XL 5IMOA 4F8PA 3O3AB 1U8IB 3B7TA 1YJDL 3FB8B 1QRKA 1RUAL 5JA8B 4Y0GA 1CGYA 2YAPA 3IDJB 1DBAL 3TWCH 4QLWA 3LNEA 1MNUL 1R75A 2WBJB 3WD5H 1EEZA 3ARVA 4KNUA 3B2UC 3VD2A 2GC4C 5I6MA 1NFDA 3DSNA 4XO5A 4IKLA 2CIKA 5F0LB 4JHZA 4MVBD 3W9EA 5AG8A 3QQDB 1IIIA 2Z8VC 3R0NA 1CDGA 4ICXA 4UU9B 1DDHA 2C9RA 3FB6B 4Y19B 3PRZA 5D1XE 1OZUA 35C8L 3GMLA 5KBMA 2Q87A 3ARTA 2IH3B 4N90D 1TTBA 2HRHA 1A4AA 3LQZA 4BZ1L 1F58H 5ACLA 2JCCA 3ARFC 2DLGA 4FLHA 4UNTA 3CPLA 2GTWB 1F3JB 2PW2A 2ZP0T 3STLB 1EAPA 3NIGF 4BSVB 1D3CA 3SDAD 4IRJC 3ZN6A 4AIOA 1KCRL 1MFVA 3O8XA 1FVDA 4RDQG 3L4TA 3VXMA 4P2RA 5TFSH 5C8JB 2X3BA 3VFWA 4DAGH 3OKMA 4YC2C 2B1HL 3RWFA 1ZA6A 1AI1L 4HUVB 3BMVA 1SYSA 3NVQA 4LSSL 1J8KA 1JXJA 4PHXA 1RK0A 2J8HA 3OC5A 5DHVA 3ROLB 2E46A 3CZUB 4AKQA 5EF0A 4FLSA 1KCWA 3KGUA 2Q1EA 1KBGL 2PABA 4OSUH 2NY4D 4ZS7L 1NC4A 4R84A 5KANI 4AEHH 5I76B 5FYLL 1WCBA 5DYFA 2AJVH 1UATA 1HKLL 2BY2A 4Z7VF 4KY1L 2YFNA 2BY0A 1Q0YH 4W9HC 3QUMB 1IGTA 1MLCA 3AREB 3HE6B 3LZRA 1FHNA 1QASA 3US0A 1SOSA 3KPLB 5SWZD 3MGTB 5E2JA 1WBXA 4QHUA 5L4JA 3L54A 3C09C 3QNZB 5KUMA 1ND0B 3UZEC 5KYWB 3SIKA 3GT6A 1F41A 3ES6A 1FN4B 5AB0A 3D1MC 4DERA 1XZ0B 2XXGA 4YC2B 5EZJB 3EIFA 5GS0C 2O6FA 5B1CA 1U8JA 4TSCL 4XPAL 5C0GB 2JJVA 1DCEA 3IYLW 3WENA 3A4FA 3NIFF 4PJ7F 8FABB 3TBCA 4WUUA 5EOTA 1JL8A 4KZCA 1C7SA 3S36X 2F74B 3DI3B 3CDFA 4ENZA 4P2QE 2CSPA 1T5WA 3L5WA 4GI6A 4KUZL 5C0FA 1B2WH 3W0WA 1KN4L 2G3ZA 3BPOB 2DQTH 3OBAA 3T3MF 1FGVL 3F64A 1U6AH 3SY0B 1BM3L 4P23C 3N1GC 5E94B 2DMHA 3IMRA 1FUNA 2WLKA 3PQYA 5EU5B 3A4EA 3VXTB 3S5ZA 2OL3A 5FA4B 1J0HA 4FLQA 2NNAA 4Y1TA 4YHOL 1M2VB 2NX5E 3I9PA 5IQ7L 3HLAB 1OV8A 1RMFH 3TEXA 4P46A 4MB4A 5DMGD 3DV4B 3QSKB 4UDTA 4PJXA 5C92A 1HHKB 2EABA 1JOIA 1GL4B 3BDYH 1G9NH 4JPVH 4YE4H 4MNQD 4YMPA 3EF4A 1ET5A 1O75A 3IAPA 2HT2C 5FHBH 2AZAA 4S1RL 5HGAB 2Q86B 4MA3B 1HC1A 2XJKA 4GKZA 4GSQA 3T2LA 3RL1A 3LQAL 1ITCA 2G9HB 4HYTB 5D7HA 1JF1B 1E8WA 4AC4A 1UD5A 2R59A 3L1OH 1PL3A 4ZS7H 2M8XA 1WZAA 4M5ZL 5DJAA 4ONOA 1JK8A 1NFKA 5ADPH 2TRYA 1PKQB 3OMZA 3QJSB 4K73A 5JLZB 1KACB 1ITBB 2B2XL 4XBEH 5IVZB 1OTTC 4YWGL 2AJZB 3FAWA 1CFVH 1CL7L 4GSXA 2NQDA 5AENA 1F3JA 1D5XA 2PW2B 2YAQA 1QSFB 1Q9WB 4JHWL 4DQOH 5KYXB 1GC1H 5CBEB 5DUPL 1IGYB 1F18A 2DM3A 2QMKA 4YHYB 1IBGH 4Z7VB 4C47A 1NM9A 2N01B 5DFVD 1OPOA 4GKNB 5F9JB 2WTOA 4E5XB 2Z9TA 1TTFA 4NXKA 2G60L 4WWOA 3C8DA 3VQ2C 2ZQKA 4F1ZA 5F9WC 3RGHA 3IFPA 3ULUF 3VGEA 2YSTA 4QAMB 3UTQA 5J6GA 1G9EA 1J0YA 2PLTA 3RBSA 3UJJH 3IDMB 1ZWIB 4HUWB 4NI3A 2B4CC 4QT5A 3WIFB 1ZHLB 4P4RB 5TH2B 4DN4H 2AXJA 1OGAD 1ZXKA 3II1A 2CO1A 4TTDC 4KK9C 2V2WA 3QO1B 3WEXA 1PSKH 2QGEA 3G6JA 4LF3B 1D5MA 4MFHA 5E9DB 5JUEH 2CKNA 2UX7A 2YUXA 2WCSA 2E3VA 4YHNB 5KVGH 2NRDA 3N9GL 2SEBB 4GUPA 1ECZA 1YJDH 1CICD 1NLDH 2R2BB 4ODTH 1P4LB 2GPZA 1NJ9A 4JM4H 4JJOA 5KSBA 1NWOA 2R23B 4ZNEE 1QSED 1UA6H 1G7HB 4I2XA 4OCMC 4TSAH 4N0YH 2DQ6A 1ORSB 1B6UA 3VI4A 1X5IA 4FA6A 2Y7MA 4XXDA 3DC0A 2YA2A 3WEOA 4GW1A 1CBJA 1MFBH 1R5IA 1U8LA 5DU7A 1BM3H 2VLJE 3SDAA 4D3CH 3UG4A 1L4IA 3O8XD 4L9LA 4ADJA 2UZIH 1D7FA 1PNCA 1K9TA 1JPTL 2WZ6A 3V0HA 4Y2LA 3VD7A 1DDTA 3HMXH 2E56A 1IC7L 4NRZB 4WO0A 5IMKB 2Y5TB 1AGCB 4L3CA 2VDRH 3MLRH 2X7LB 4F8NA 2PPEA 2COVD 2XA8L 3D7PA 4MDJB 4NQXB 5AOIA 4Y1AE 4RFNC 4Y89A 4ALAL 5IIEA 4NRXA 3WJMA 1U4EA 3VXNA 4AVKA 1SF5A 1IFGA 4BSWB 4N3UA 1MAML 4LKCB 5JR1L 1L5GA 3N55A 2VR5A 3ZTJG 4D9QE 3QJVB 3K6SA 5D7EA 2CUHA 3BD3A 1VB9A 4OLZH 5CD5D 2WUCH 3CH1A 4HQQL 3GIZL 1LM8V 1WRFA 3RKPA 1OAUL 5D2NA 4PGDA 3F12B 4ETYA 2X2YA 3FQ2A 3PGFL 4GAYA 5GZOD 2HJLB 3TASA 2Q3AA 2JIXB 3DX7B 3WXVH 4DP1X 2WQRA 3C5JA 4R9HA 3FCTB 5SWSA 2X70B 1NC2A 1HHIB 1NFIB 3I2CL 1ZPLA 4BRVA 1FBIH 1FZOB 4X9GA 1X5AA 5C7XL 2LVEA 4PW4A 3IFNL 3TBWA 4GAJL 4R4BB 1DVFA 3NTCL 1TQBB 2K78A 3EYOA 1NAML 4I9WD 4N0UA 5ICXB 1OE1A 1KCVL 4JDVB 5IJCC 2VDRB 4J23A 1M7IA 4BWWA 3EJQA 3FULA 2ZKYA 7PCYA 4IIZA 4TMPA 3TBYA 4UMGA 1MF2H 4LPTA 1O7SA 5KS9E 4YN3A 5GRXG 1JDCA 1ZV9A 4M4RB 1TLMA 3ZKNC 2RACA 1DFBH 4LEOA 3KBHE 4X7CC 3HAEG 3VSTA 4PJCB 3V0JA 5A6IA 5DZLA 3O6LH 3HE6D 4OGXH 2O5ZL 2R2BA 2RB8A 4XCYB 5I1AA 2V5SA 2NYKA 1U3HD 2XWEA 1AXIB 4FFWC 2HJFB 3BVNB 2CJUH 2CRIA 5AQ0A 3KDMA 5CS7A 4Z95H 3RJOA 3QJHA 1MFEH 4XNUH 1OZTG 2OQJA 2DEXX 4KZ0A 5EBLB 1T1ZB 1A7NH 2VAJA 1JPFA 3I9IA 3JTBA 4BFJA 1UJTA 4ODSH 5PAZA 2UWEE 5SWQA 3UZVA 4KRMB 5E99L 1KFAL 3DOIA 3CDGB 1SVBA 3UEZA 3VXME 5I0YA 4KK5C 1BVZA 5CJ5A 2NLJB 1GYUA 2JB6A 2ZYHA 3QJQB 1FNEA 2KC0A 4N28A 5GGUB 3WO3B 4K3EH 4O2CB 4LCYB 1AR1B 3OB8A 1WQVT 3FT4A 3LSOB 4U1JB 3VYOA 3SYOA 3VXNB 4YAQA 3RX8A 5FYLE 1G7IB 2GHZA 3SGJC 3TT1H 1DVYA 3HZYB 1NC2B 4HIPA 4ABVA 4NLHA 1W0YT 2P44B 2NY5C 3X11B 5FO2A 4Y2NA 1OP5H 2NXZD 3ELAT 2HP4A 4L3CB 1IVTA 3PXHA 4NI6A 1TVBB 4XCFL 1IAMA 4F15C 3BCFA 3QVAA 5ADOH 3MV7B 5BQ7B 5E6UB 1A7RH 4Y19D 4HCRL 5AVZB 3Q0HA 1S6NA 4UZSA 3P4MA 4L3AA 3HB3D 4JB9H 4O2CA 4NT6A 5DJ6A 1YPZA 4K0OA 5IFHL 3NCWA 1PX4A 3P3TA 3QR0A 5GIRA 1NFDE 3H7LA 4Q14A 4ZMYA 1M6OA 4JAMA 4O02B 2WQWA 3RL1B 1YEWA 1IZKA 2XETA 3U46B 4XNMA 3ALWA 5KOMC 1F8TH 2LR4A 1A0QL 3SKNB 5I19L 3A6CH 4B9FA 4MXWL 4L3ED 1KXVC 1MF2L 2XHNA 4CN6A 5A2KH 2K6YA 4P23A 1P5UB 4LBAA 4XN2A 5JIIA 3APDA 2KZBA 3SD2A 3SHSA 2NDGA 1VGKA 2EYSB 5EOCJ 1TFHA 5J0BA 5HDBB 2IANE 1QSFD 3NTCH 1CGTA 1QVOB 2CCWA 1OAYL 1VADB 2C1PA 4Q8BA 1R3IH 4I2XB 4MNGE 3TH2T 3WHE1 2APSA 4LOEA 2FE0A 3M1BB 1WWCA 1TMCB 2X4UA 3IJ7A 3IJEA 3W0WB 5F7DA 4A2MA 3ZXAC 5F9JA 1NBZA 5I1GL 2ITEA 1I8AA 2Z31A 1M05B 4Z0BH 2R27A 4W81A 2V2WB 3QO1A 3TIDA 4UILL 3WEXB 5C70A 1OARL 1N0LB 2ZAIA 1CLCA 4X98A 4NZUL 2R4RL 5FOBA 3MZGB 5F7AA 5IVNA 1P4BH 2EXYC 2QVIA 4X6EA 1DVFC 1MJ7H 4ZFQA 3OF6A 5EN3A 1EEZB 5CZKA 3MGAA 4V11A 2DM7A 3ML9A 4WCYH 4XX1G 1MY7A 4WJ5B 1A6TA 3B9EA 4FQIL 3C60A 1AC0A 5KYWA 2DTML 4U1KA 4W9CC 4LEBA 4Y9EA 3OWEA 5HVGB 2RHEA 4CC1A 2Z7ZA 2L04A 3G08B 1L9MA 1E28B 1IBYA 5CWSA 4OJEH 3ESVF 3ZE0F 3F7QA 2F58H 5IKCB 1Y0LB 3H9SE 2AK4A 1ZAGA 2QSCL 3EG9B 4WWNA 3TVMD 3OAUH 5HY9B 3VXPA 1NOAA 4L29B 3DJTA 4QNPF 5BQDA 5ITBL 3LS4H 4PJAA 1EFXB 4J3OD 3ZHLA 3C8KB 3HI6H 4U1NB 5DLLA 3OKEB 4RMQA 3AG2B 1TQSA 4G6FD 4OLVL 1U21A 4Y16A 3T65B 1AQKL 4S1QH 2H2SC 5C9JA 1MCWM 1R0AL 5FA4A 1IAIH 3WDIA 1MKFA 2O5ZH 2RR3A 4N2IA 5AB9A 1CFQA 1A4KA 2GJ6E 2J8OA 4FD0A 4DN4L 3E6HA 4GIOA 4QEGA 2F7PA 1FVDB 3GS4A 3VXMB 4PJAE 3S2CA 2IC2A 4Y4FC 1ESOA 2NX5A 4G8EA 2H0PA 2PXYB 1PJ9A 2BP8A 2QQNL 2FT7A 2CLRA 2JCCB 3LHAA 5C71A 3FQUB 4HOWA 2A6DA 2CM5A 5AAMA 5TDNB 2FX9L 2OCFD 5GJSH 3WJLA 2IFFL 3FPXA 1LTXA 4EBQH 5GGSA 1BFVL 4XC3L 1U3HA 3AAZA 2I85A 1FBIL 2E75C 4JO4H 1BP3B 2WY3B 3BEVA 1TENA 1GKEA 2HZHA 4PJHF 4YXKH 1MHPH 4NP9A 2Y6SC 5CM1A 4ZNEA 5K9QG 1REIA 1OHQA 2ZAGA 3CFIC 3GJFK 3CXDH 2CO6A 1BG1A 5EULV 1SZNA 4FKKA 3TJPA 2NY6C 4K3GA 2Q8BL 1HCYA 3HS0C 2RJMA 4I77H 1DVTA 4FXGB 4KITB 4NUJB 4WFGE 1ZT4B 2ARJQ 2Y23A 4M61A 2E8ZA 4KJPC 1XIWD 3WFCH 1P7HL 1ACZA 5DC0A 3E0GA 3C12A 1K5NA 3OAYH 3WUWG 2VDQH 3BKCL 5F6IC 4AITA 1S9YB 4AZUA 3OB0H 5F97E 5FM4A 2MQ3A 1TJGH 4HK0B 4L4VE 4HWEH 1A1NB 3QT2A 5INCA 5CHNB 5LB1A 3MGOB 5J12B 2E6PA 4B5ZA 1PX8A 4JRFA 1XGQB 3GBEA 4NQCE 3QI9A 1PG7W 3FMGL 3KVQA 1UVQA 1FFRA 3KPNA 2AEQL 4BM7A 2XICA 5AW7B 2UXTA 3DIFB 1S7TA 1T1YA 1EGJH 5LDSA 1I8KB 4FNLL 3US1A 4J8RB 4YSDA 3P4NA 3VXRA 1BMGA 3QXUA 5F0JB 4ELME 3L4YA 1L3WA 4OFVA 3EFOA 3FQNB 3MREA 4RFOL 4U6HB 3ROOB 3ZZSA 2R2CA 1LWJA 3B9VA 3NCXA 1P84K 2Y07L 4AQEA 5JW4M 4KXAA 3GFUA 4N5ED 3TYFB 3R1GL 4NQCA 1IEAB 3LN4B 3UO8B 4AYSA 5D1ZA 2OCCB 1Z5LB 3EGXA 4JM2A 3ATEA 4Q74A 4UDTB 3V2AR 4HPOL 5FO7B 1YEGH 4B27A 4BH8A 4Y2OB 1V10A 5K9OB 5IW1A 5AAPA 5F6HI 4TL4A 1IC5L 1JZIA 2DL9A 2MSPA 2ICWJ 2BZDA 4LLAA 1NBVL 2OJ1A 4TVPE 1RZKH 2PPDA 2PR9A 2H6PB 3GXDA 4CN4A 5I8OL 1USQA 3O3EB 2OLDA 2QLYA 3FO9B 1HHJA 1TCRB 3FFCA 4OZGB 2FLRT 5JYLA 2EH7H 2VOTA 4F37F 3ARGA 5D7LD 4RGND 1MCLA 2JK5A 1BD2A 4M1CD 3ZY7A 2QQKL 4UV4H 3MSPA 2NZ9D 4P5TB 1P69B 3QUZA 3QRLA 4YPGA 4DVRH 4U49A 4V1DA 3JV6B 4YXKL 4KKNA 1GC1L 3L9BA 4JHWH 4XP5L 4XO9A 3FU5A 5D4HA 4OM0H 5TDOB 1DQDL 3HW7A 3SE9L 2DQUH 1XF5B 2J8UE 5CLZA 5CJQL 5EOQL 4XBEL 3OF6D 2UWEA 3PL6C 2Y6TE 3HLKA 1QMUA 4YDLC 2P8MA 2GJ6B 3NDYE 3VDCA 1ODUA 3PFUA 3C60D 2ICEC 1N0XL 5HHMD 5TDNA 1YY9C 3FBQA 3SYAA 1VFAB 3RZCA 4M7JL 3BLPX 2BP8B 1OXYA 4WUKL 4Y5YA 4XC1H 3BVVA 1EHKB 4OM1L 4L29A 4LHQB 2NW3B 3P54A 3QJTB 4V2CB 2CA4A 5C07A 2NY1D 4ZMLA 3ULUE 3ZYOA 1PY0A 3QCVH 2Z3FA 3TVMA 1C12B 4Y8DC 4AY0A 2VABA 5ITFB 1X5GA 1G9NL 4JPVL 2XFXB 5AW8B 4G71B 3QUYA 5FCSH 3DTXA 3OKNA 3U7YH 1XGUA 4OCNC 3SOTA 4XOBA 1I7RA 3N42B 5CZVH 4HOMA 5KS9A 35C8H 2BPBA 3SKJH 4X6FA 2AJSL 1V5JA 2DTSA 4I3RL 5DHVH 3V4PL 3ULVE 1BZEA 1LYQA 5IT2H 5FYLD 3QXDA 1U0QA 3MLYL 2OX5B 3VXSE 3BXNB 2QJDA 5I9QB 3IBOA 3O3BB 3AS0A 3JWDC 1CDHA 3VRJA 1LQSR 4YBHA 4P2RE 1B2WL 5CMAB 4YHLH 5MERA 3D4YA 5AAWA 5F8RC 3SDDA 4M5SA 2GKIA 2NX5D 5JPMB 1B0IA 4O51B 5TGBA 5FUZL 2P47B 4ZMAT 3ALXA 3X12A 1QWHA 2DLFL 1OK0A 4WW2B 3GXTA 4JFDB 1PD6A 2CK0L 1T04B 2HT3D 2YZ8A 1N64H 5K39B 1P4IH 4PGBA 3WNJA 2FJGA 1EFXD 1NMBH 5E95B 5FA3A 3BGFC 3QC6X 4TQHA 2Q6WA 2XIIA 5E4OA 1Y1DA 2R69H 4IDLA 3ILPB 1RUML 1NUDA 3OM3B 5T5FA 1WHOA 4ONFL 1E4WL 2Y7OA 4JY5L 4MQTB 1KGCE 4OGYL 2C3WA 3GMRB 2B77A 1FDLH 3QULB 4MA1C 2WCGA 2B4CH 3TNMA 1HHGB 2ZKHH 4WI5A 2PO6B 2BP5M 3RDTB 4JZOA 2EUZA 1CG9B 4OIBA 4OI9A 2NXZC 3MV8D 1YYML 4QHKI 2N0MA 5INDA 5F7DB 4RSVA 4W6YB 5LAXB 3V6OA 4FNRA 1QLEH 3SCMB 1CTNA 2CXKA 3VGFA 1URZA 2VDKB 5F1NB 3L8QA 1NCBH 5EN2A 4IBSA 1S9WB 5FLVA 3BQUB 4BFRA 2J12B 2P5WE 3NSCA 5DEFA 4HKXA 1JXFA 3HBZA 4JKMA 2EQDA 1LO0L 2CHXA 3V0VA 2WLNA 5DUJA 1B4LA 3EF7A 4XNZC 1EZSA 3Q2LA 1S4IA 2AEQH 5E03A 2BNRD 3WMQA 3DARA 3X1GA 2VWEC 2NY2C 5F1IB 5TFSL 4U1GC 3BDXA 4LLWA 2ENSA 2A6JB 1OSYA 4YZFF 4Z7UF 2YMTA 4JFXB 3QARA 3AWEA 3UMTA 4WI9A 4EMZA 1M1SA 4DUWA 1L3NA 1T22A 2R0WL 1MLBB 2CCLA 1KPRA 2IPTL 5G5DB 5I71C 5DZAA 1KJ2L 2EEAA 3K71A 3ERXA 2FDBP 1SVCP 3IJHA 4TUOA 3PHSA 1T2JA 5AOKA 1FNEB 4EI5A 2Z31D 3RZWA 2XBTA 1I9JL 3LRSA 2DWSA 4U1KB 4ZUVB 3DX6B 1JHTA 4YK4B 1PJWA 4R97B 5F6HJ 4EI0A 3P77A 5B3JF 1E28A 4I9XA 4TF4A 3DK2A 4Z8FL 3I50L 3TH3T 2BK8A 2WSDA 3K6DA 4NLAA 1EAOA 1G1KA 3S3BB 2VZUA 4GG8B 4GRMA 4PRPB 4ZMXA 4KDVA 2PW1B 4HX1A 1MFAH 1YUHA 5DWUL 1MW0A 3TWCL 5KYYA 5IV2A 4R8WL 1Q90A 3OXSA 3PAZA 3QP3A 4JRYA 2VJ8A 2FJSA 2XZCL 5J6HA 1AIFB 3FO0L 5B21A 4CVZA 5HYQB 3IT8D 5KVEE 1RP9A 5DD5L 3AG1B 4A37A 3QIWB 3P0VL 1MCSA 3WFBL 3S96A 1UB6B 4KU1A 3VFSA 1KFAH 2FJUB 1JYXA 5DRWA 3O41B 3V4VB 1MG3C 1PDKB 4FQLH 4FZ8H 3I9GH 4UQ2B 1QVOA 4LNRB 2YN5A 4Z6AT 1ZHBA 1MFEL 4GYBA 2X1WL 1OEZW 4XNUL 3TBYB 4B6ZA 1P5UC 1UKQA 5FS5A 2CKBA 1ML0A 4D9QD 1YSOA 3QCUH 2Y06H 25C8L 3WJJA 3ZDYB 4NJAL 4YNYB 2FB4H 4Z7QF 2HJKA 2CA3A 4G80B 2ZE0A 3L3KB 4AXWA 1MFNA 1H15A 3MJWA 4BXSV 1KLGB 2HJKB 4G80A 4ZBJA 3V0WL 1E9QB 4FMKA 2ZIDA 1N12A 2X1XR 3CCHA 2NZ1A 1BM7A 3MBXL 4K7FB 4P57B 5B1AB 5F7EH 3ILQC 1TTUA 1A21A 1RU9L 5JXED 4P06A 4YSPA 5A2BA 2AITA 1IM3B 3QO0A 2VR6A 7FABL 1F2XK 2YJQA 3M7FB 4PJEB 3EJPA 3ULVC 3OHMB 3OSVA 3STZA 3Q44A 1CFNA 3DX4A 3U1PA 3MRQB 3BKMH 1WK0A 4MAYC 1YEIH 3O2VL 4FMFA 1MHCB 2BH0A 2XCMC 3VXQB 3B5HA 5F9WB 2YPKB 4QXGH 1DVFB 2ZWKA 5ACZB 5HGHB 4GAGH 2EUWA 3JV0A 2GK0A 5D1XD 3D12B 1PKOA 1T7VA 3QRBA 1BPLB 5FHAL 3MUZ1 3RILA 1V54B 3PCYA 5F88B 4PBVC 1G7IA 4N6QA 5BVPH 1B9KA 4HUUA 3F05A 5B1JA 3O2DA 4KXDA 1EDYA 3P73A 3KE0A 3KPSA 4JPQA 2OJZH 3II2A 5EU4A 3T6VA 1ZLVK 3QQNA 4EIGB 2J21A 3CDGA 1OSPL 2DDQH 2V4LA 1T4KB 2PR4H 3EOAB 1WUZA 4WJG3 1JGLL 4XNQB 3QEUB 4NGHL 1E0OB 2CGRH 4E42A 3BQUA 5D9SB 4UYPA 2CBMA 4KVNL 4BD4A 3KXFB 2AJ3B 2X6MA 2GT9A 3BE1H 3E9UA 5I1EH 3GSVB 4RISL 2DQHL 3CVDA 1NCOA 3UGEA 3GB7B 5KAQF 3D09A 1YEKH 2R1WB 3F8UB 2QZ5A 3CJJA 3QDGE 3F7VA 2VRAA 4A7TA 1OM3L 3HMXL 2YRPA 1YEIL 4BZYA 1CF8H 1OM9A 1E27B 4HHAA 3VNZA 1DP0A 1RZ7L 4JZOB 3S36H 4KHTL 4HHAB 2RH0A 3DUSA 5D1QC 3SDAC 4N0YL 3MLXL 5EF2A 2J1YA 3ECBB 5CEXA 2A74A 2IG2H 4URKA 5CCGE 3BZ4A 4Y5XB 1Z0MA 2QVTA 2P8LA 3FQXA 4JM4L 5AZEL 2XXCB 1F6AB 1FVEB 1PDKA 2DD8H 4HJJH 3G5YB 4KX7A 3ALPA 3V0WH 3VAEA 4UF7C 2ZXQA