1IE4A

Rat transthyretin complex with thyroxine (t4)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
120
structure length
120
Chain Sequence
SKCPLMVKVLDAVRGSPAVDVAVKVFKKTADGSWEPFASGKTAESGELHGLTTDEKFTEGVYRVELDTKSYWKALGISPFHEYAEVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSTHYRETIN
publication title Structure of rat transthyretin (rTTR) complex with thyroxine at 2.5 A resolution: first non-biased insight into thyroxine binding reveals different hormone orientation in two binding sites.
pubmed doi rcsb
molecule tags Transport protein
total genus 24
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 1ie4A00
3DJRA 5IHHA 1TYRA 5FO2A 3KGSA 5FW8A 4TNEA 4TL5A 3IWVA 5CNHA 1DVYA 3IMUA 4TLSA 5E4OA 3U2IA 2PABA 4Y9FA 2F8IA 1BMZA 4QYAA 4N87A 3CFQA 3OZLA 4ABVA 2GABA 2GPZA 1BZDA 3DK2A 3DK0A 1FH2A 4PWEA 4DERA 1F86A 2ROYA 4PMFA 4ABUA 1QWHA 3ESOA 5L4MA 2WQAA 4YDMA 3NEEA 4TLKA 3FCBA 4L1SA 4TNFA 4IKLA 3TFBA 2QELA 1E3FA 1Y1DA 1SN2A 3CN2A 5CM1A 1TT6A 4FI6A 2H0EA 4HIQA 1SOQA 5BOJA 1ICTA 2G5UA 5AYTA 3P3UA 2QGEA 1TFPA 4TM9A 1TTRA 3DO4A 3IMSA 1U21A 1DVZA 4IK7A 5HJGA 4KY2A 1F41A 4PWGA 5E23A 2H6UA 3DJZA 5CR1A 2FBRA 3GS7A 3IPBA 4MASA 4HISA 4HJTA 1OO2A 1TTBA 3DIDA 4AC2A 4WNJA 2QGDA 1TTCA 3IPEA 3DJTA 2G3ZA 2G9KA 4Y9EA 5K1NA 2F7IA 1IJNA 1G1OA 1RLBA 4I87A 3CN0A 4D7BA 5A6IA 2G2NA 1BZ8A 4N85A 2G4GA 4TL4A 5L4JA 4PWFA 2B9AA 1GKOA 3HJ0A 4IKIA 4PVNA 4QXVA 5CLYA 3KGTA 3GS0A 5CLXA 4TKWA 4FI8A 5AL0A 3GLZA 1SOKA 5JIDA 1FHNA 2B16A 4WNSA 4IIZA 3NG5A 3FC8A 4FI7A 4PWHA 4ABQA 3IMVA 1SN5A 2H0FA 3P3SA 4N86A 2QPFA 2G2PA 2G4EA 5AKSA 4DEUA 3CN4A 3A4DA 2B15A 4MRCA 3ESPA 5TTRA 3SSGA 5L4FA 2NOYA 1ETA1 4I85A 1DVSA 3A4EA 2IGLA 4I89A 4PWIA 1DVQA 3DJSA 1ETB1 3NESA 3D7PA 4HJUA 2ROXA 4HJSA 4TLUA 1E5AA 5AKVA 3BT0A 3GS4A 3B56A 1SN0A 5CN3A 4PWKA 1DVXA 3BSZA 4MRBA 4QRFA 5EZPA 4TLTA 3IWUA 1X7TA 4DESA 4DEWA 1Z7JA 1ZD6A 2G3XA 3CN3A 3KGUA 3DGDA 3CFTA 4PVMA 4PVLA 5EN3A 3CFMA 5L4IA 4AC4A 2B14A 2QGCA 4DETA 3I9IA 1DVTA 3NEOA 3GRBA 4WO0A 4IKKA 5JIMA 4PM1A 1BZEA 3ESNA 5FW7A 3W3BA 1TZ8A 1IIIA 4Y9GA 3TCTA 3P3RA 4L1TA 4TQPA 1BM7A 4YDNA 4ABWA 1KGJA 1QABA 3M1OA 1TTAA 3IMTA 4Y9CA 3I9PA 1TLMA 4Y9BA 3U2JA 3IMWA 4PMEA 4TQIA 4IKJA 5AKTA 5E4AA 1E4HA 2H1XA 1KGIA 3CXFA 3IMRA 4PWJA 2H0JA 3A4FA 1THCA 4Q14A 5AL8A 4ANKA 1X7SA 3CFNA 2TRYA 5DWPA 4TQHA 4ACTA 3Q1EA 1GKEA 3I9AA 3P3TA 4TNGA 5CLZA 2TRHA 4IK6A 5K1JA 3OZKA 1THAA 2B77A 3QVAA 5JIQA 1DVUA 1IIKA 1ZCRA 3GRGA 4TQ8A 3CN1A 1IE4A 2FLMA 1TSHA 3GPSA 3NEXA 3D2TA 2QGBA 5FW6A 3CBRA 2H4EA 5DEJA
chains in the Genus database with same CATH superfamily
1JE6A 3C09C 3L16A 1RFDH 4XNUH 5B7FA 3NCFB 5EDXA 5LGJB 1WAAE 1LDPH 4PAZA 5KS9B 3VXME 2P8LB 2ZPKH 2EDXA 4ZD3L 3OF6A 4MYPA 4RMRA 4Y4FC 5D72L 1Q8MA 4MZIA 4MD4B 3DK0A 1RURH 2NXZB 1S4IA 1RZ8B 2VSDA 3OR6A 3WAJA 5K59F 3FT3A 5A7BA 3CC5B 2LU4A 4HHAA 4PRNA 5G4OA 1I9JL 2NY5L 3GO1H 2H0EA 4FXKA 3ZIMA 1ICTA 2PYEE 1HE7A 3EYOB 1L0YA 3SY0A 1XGYH 3GSRA 5FPIA 5F7NC 3AU1A 3QYMA 3NH7L 2ZCKL 3IE9A 4Z3EA 3SKMA 5KVGL 3UPRA 3LEXB 4AIZB 4HH9B 4L1BA 2FQDA 3QXTA 4PJBE 1AHWB 2O6DA 1AZCA 4WWID 1MIML 4R4FH 1IGIH 1U58B 1A7PH 4I0PB 4PG9B 4QRTB 2IMMA 1BGXL 5TF0A 3ZZ1A 1IAMA 3G6JF 1T22A 4G7VL 5I24A 3O8XD 3MBEA 3JTTB 1ZHLA 4F58H 4Z7OB 3U0WL 4ORGA 3OX8A 3QJXA 4EUPA 2CZNA 3GKWH 1S46A 2FB4H 4PS3A 2RA1A 1WC7A 2C1OA 5EF1A 4KKBD 2VZ1A 3BUBA 1X6LA 4FZEL 1IKFL 1PY4A 5HHME 2F2HA 3F04A 5SWZD 1UYWL 3WXVL 3N1QC 3O4LE 5JXED 1PPIA 4LCUA 1MLBA 2ZQKA 4U7SA 4K0OA 4ELDA 1J1PH 3TPKA 2F1EA 5HDBE 4ZOCA 4ALAH 1ID2A 4OFYD 4YQXL 4MXQD 4YL9A 1ZIAA 1ED3A 2Q9OA 1T20A 4OLVL 1F4AA 4JFDA 3HE6D 2VR4A 3FUNA 3L3KB 5AKRA 5I73B 5DJ6B 4Y4KB 5KSUB 3FQ1A 1E4KC 3ARYA 2Y3AA 3R8QA 5D8JH 1KTLB 1RSFA 5CGTA 4AEEA 2P49B 4C4UA 1OGSA 4Q52A 2W65B 2YBRB 3RX9A 5ABZA 3VE0A 1LLAA 1V7MH 4UT6H 5FCUH 1EXGA 3DA0A 2FQGA 2NY0C 1KC5L 2VW4A 4JZNB 4RISH 4WI3A 4YHPB 1UCBH 3EF7A 5HHOA 4HWEH 2UXTA 4BSJA 4NS0A 3EO9L 5D1QD 4OKDA 4HJIA 3SO5A 1XHHA 4XVUD 2IBGA 4NQCA 1E9PA 1S5IH 4HIXH 5CEZH 1J8HB 3EFFA 4FQLH 2XFXB 3NFSH 1KBKA 4LLUB 5HY9A 3UDWC 4ONGH 3SPHA 3ALXA 3UTPE 1GGIL 2XOTA 3OGCA 4LCYB 5AYUH 3FAXA 4GMSL 3FTWA 1T1WB 1BMZA 3L2MA 1Q9WB 4HU2A 4MXVE 4PGCB 3OZLA 1HHIB 4U0RC 1HHGA 4J12A 5DLLA 1P5VA 4H25B 3WEBA 1ZLEA 2WMPB 4AY0A 2CHZA 3BGFB 4OVUA 5E56A 4BZ2H 1O7DE 4NWTH 5AWNH 3BPCB 1SDDB 3B1UA 3SKOA 5IB2A 1A7NL 3CCHA 4ZX3A 1FLRL 4X9YA 1MRDH 1XT5A 3ES6A 1CDCA 4Z0BL 4KVCL 5ELIA 4LEXL 3I50L 3EGSA 4NJ9H 4IBTA 4OCXH 1UC6A 2DOCA 3BKJL 2WWKO 5K5YA 4FG2A 4YLCA 3KMDA 2YC1B 5AG9A 1CVRA 4QRSA 1JWSB 3RNKA 2HWZH 3FUMA 3B9EA 3OLGA 1P4IH 3QFJD 2PR9A 2YGVA 3OQRA 1YEKL 1A6VH 4G11A 4PJ9B 4N90D 2BERA 4LKXA 2VSMB 1HYSD 1CB4A 2EC8A 3DSNA 3P77B 4LLQA 3M07A 2WXKA 4UIKL 2NY2B 1MW0A 1UEYA 4NKOA 3ZBMA 2BOCA 2Q76A 5AALA 5I16B 3O8XA 5SX5H 5JPMA 1E40A 4OGAD 3VQLA 3X3GL 4GUPB 1U8MA 2X4NA 3MMEA 3I6LE 3QDGB 2J12B 3S8GB 1JK9B 4MQSB 5A1AA 1S78C 4S1SL 4HUVB 4EN3D 4I85A 3LIZL 4FABL 1W15A 4XNDA 2A74C 2DKSA 2X4RA 4LRNL 5EEVA 1L9SA 3CFEB 4A2EA 1DBJH 1O7VA 5SWZA 1D5BB 3QUZB 3QDJE 2UX6A 5JXEA 4Q9BA 3HRPA 5C3TA 1JERA 1P0SE 4NN5C 4TYUA 4XWGH 3LMJL 3KS0J 1LK2B 5KS9F 2HJKB 1G7JB 1EZSA 2VLRB 3GSXB 4XPGH 2OMWA 4E41D 3T6QC 3TFKD 5GGVY 4PGBA 2H3XC 4OFYA 5E2TL 1N12A 4JJHA 4PS8A 5GS1C 2ZOLB 1FSKB 2DBLH 4MB1A 2Q86A 3RFZC 4Y4HB 1QA9B 3HE6A 1AS8A 4ONOA 3TT1H 3ULUE 3MCLH 3CFIC 4NQXB 2H5UA 3CG8A 4BH7B 5HDQL 5CU5A 2VQUA 3N2JA 1NINA 1TJIL 5FGSA 1C16B 5MEQB 4N2CA 5IB4B 1OLLA 3E8UL 3N9GL 4QGTA 1P2CB 5EEZA 2I7SA 3SDDD 3E9UA 3P9LA 3X11A 2XVGA 5D1QA 3BFOA 1GJIA 4YDIL 1MH5A 2V2WA 2JCCA 1QRND 3N1MC 1IM3D 1WBZA 1T0NB 1ES0B 3NDYE 1QBML 5CN1A 3X1NA 4ZX6A 3BP5B 5CUSL 4Z7OF 4KC3B 4NP4H 5DJ2A 4XMTA 1DJZA 3PUCA 3EGXB 3L4WA 4W9JC 5EBWA 1BBJB 2AV7B 4IHOA 3B5HA 5I6XB 4E9LA 1A6PA 3ZKXC 4NT6A 4O4YL 1U9KA 3QQXA 4DIXA 2J8UE 4FI6A 3V5KA 1WBYA 3IU3A 1INQA 1L9OA 1XGTB 1OP9A 5D7JB 1T7XA 1R3KB 1XVSA 1QSFE 1TTRA 2G3MA 5HYJB 1RULH 2JI1A 1N6QH 2CO3A 2E75C 5E23A 2AABH 4P2RE 2Y2WA 1S8DA 4RMTA 2EO1A 1IQDB 1DVFD 3C60C 4U1IB 5KYUA 4DCQB 5BW7A 2NNCA 5JA9A 2Z31C 4LLWA 4WDIB 3UO8B 1XXFC 5ISZE 4YUEL 3KCPA 5L2JB 5J7CC 4F2ME 4LLDA 1JGVH 4ENZA 5IBLD 1OE2A 5CGYD 5MEND 5B1KA 5C0CE 1CXFA 1QR4A 4JMXA 3DV6B 4UQ2B 4PJHA 3BUPA 4JFFD 4BFKA 2C9QA 2D8KA 3L95B 3HHRB 1VFAA 1DLHA 4P5MA 3TYGH 3F85A 2UZYA 4KBPA 1EZVY 1CFTB 3LPOA 4YHMH 4FTVD 4P59L 2L7EA 4KDTC 3GYRA 3JWOC 5TTRA 3VXUD 5L9DH 2Z92A 1ETA1 5DJ0A 3QG6B 1T7VA 4F24A 5IR1B 1OM3H 4P4KC 1N68A 5LBSL 4PJFA 1DFXA 4G83A 5CWSB 3LRLA 4HKXA 5FYLD 1BXUA 3ESMA 1TG8A 5HHNB 3KXFE 2GSIB 5A43C 3DX7B 2X38A 3EJYC 4M61B 5DURB 1OGAE 1FZKB 1G94A 2X1WL 3PYCA 5ESQA 4AC4A 4P2QD 4JM0A 4HS3A 5DHDA 2Q8AL 4E41A 3KW8A 2GC7C 5K9KB 4HP5A 1BOYA 3QUMB 5D4JA 4KHTL 4X8JA 3PGFH 4HGWA 5DRXA 3VWJC 3B6SA 3UTQA 5CHNB 4DP5X 5J6HA 1KF9B 4DAGH 4KQ3H 3O9WB 1F4HA 2VM3A 3ARGD 5FGBC 5KYNA 2Q5BA 1QTYT 4GSQA 1KJVB 3HMXA 4RGMC 4U4BA 43C9A 3OKOB 1NEUA 4L4VE 1HKLL 1JAEA 4Y5VA 3E6FB 1ZVYA 2DICA 1XR8A 2CRYA 2G0KA 1XO8A 4ENED 4G8GE 1A9EB 2X28A 1IE4A 4HV8B 2VLLA 2OZ4L 2HMIC 3QUMH 5ILTL 4IBUA 3CH8A 3QIUB 5I1DA 1HOCA 4JFQB 3QQ4A 4ELKB 1ZXKA 4JFVA 5HP5A 3R7QA 2VUYA 3SDXB 1ZA6B 2WSKA 3EJJX 4GINA 1NLDH 1JN6A 4PTUB 2VE6A 3OAWA 2VQTA 1R3JB 5K9QI 3MLSL 1JV5B 2A0LC 4NC0B 2HFGL 2QQNL 4NQTA 1YC8A 4MJJA 1TYEB 1D7FA 1E6OL 2QMJA 2RFXA 1EHNA 4AENB 4DVBB 4A6YB 1K6QL 4GKSA 4QRUA 3SDAB 4JVPA 3F7PC 3BZ4B 3CDGA 4G8FB 1ZSDA 3IU4L 5AUMB 1JZGA 4LSRH 5DS2A 3S36X 1EANA 5EZIL 1CXHA 1DVFA 4MAYD 1KV7A 1P5UB 4OB5L 4ELMB 2BIPA 5B22A 2WZPD 1X5LA 5BOZG 1KN2L 5GGUB 2QADC 5EU4B 4PWFA 5MENA 3BH8B 1IJ9A 1KLFA 5IJKA 1RHFA 4F80A 3WSQL 1I7UA 3FO2B 4UV4H 5E8EA 1LM8V 2O61A 3AB0B 4E9TA 5IEKB 3CNKA 1BOGB 3FSVA 4XMWA 2XWBB 4WWNA 3EF4A 1YEFH 4YFDB 3U0TA 1X5GA 5D4QA 2XQ0A 2KZKA 4FTVA 4ZMZA 4K23L 3DJSA 4HJSA 3PV6A 1W72L 5C09E 2YMXL 3VFRA 3B56A 3MXWL 3KPMB 5I1IH 1L0PA 2ERJB 4LOVA 4UNIA 2AXGB 5TDNA 5EU6E 2FWOB 4TPRH 3GGWB 2DIAA 1VFMA 1G6RL 1N5AA 3F6LA 5GGVH 4XAKD 3B5TA 4S11A 4E0RA 3C5ZB 3U46B 3KZ8A 1RK0B 4S1DD 5C6TL 3RWFA 3MRDB 3QHFH 3P4NA 4P2QA 2P5EE 1EHAA 2UYLA 3AS0A 3W3BA 4XN9A 3QXUA 4OT1H 2WB7A 4EOWL 1IKNA 2F1BA 2V8LA 1I7TB 2CR6A 5IFAL 3ARFC 4V1DB 1ET8A 3NJKA 4NZUL 4YMPA 1JGDA 2E47A 1E4HA 3BH4A 5D55A 5I66B 4UZUA 1JL8A 3ARGA 1OLZA 5SWSD 5AAWA 3DTXA 4OCYL 5D7EA 2AI0L 1J8KA 2XA8L 3EJZC 4U6YA 5F7DB 2Z0UA 1BZQK 4XX1E 2E4FA 2IANE 3V5DA 3DPDA 5D2LB 5A2JH 1KXQE 4GW1B 1U8HA 1HINL 5FYKH 2FATH 5I0ZA 4Y19E 3H0TA 4LBEA 2YKLH 3GIVB 3OVUB 2V9RA 1B4RA 4QHMA 3DIFB 4GP8B 3WD5L 4TLSA 2WYIA 3KLHD 1NWOA 2XN2A 1F18A 2LVEA 4MZ3A 2XWXA 2VXSL 3K4DA 3KHOA 3LQZA 4WENB 5AOJA 1FO0L 4KROC 3ROLB 4FNLL 5EFIA 3BGAA 3HG1E 2PXYD 4MVBC 3ZPDA 1PCXA 5JPNA 1NANH 2X87A 4OI9A 4PGEA 1KCVH 1RLWA 2PCFA 5ICZB 1I3RA 1SEBA 3D52A 1D9KB 2RHEA 3PFQA 5JR1H 3VB8A 2V2XA 3V0IA 2ZOUA 4PV8B 3MA7A 4NM8H 4I9XA 2XG5A 4HIIB 5CR1A 4OFKA 1VZIA 2ORBL 4X6DB 4MMXB 3AT0A 3RX7A 2A6KB 3L4ZA 4U49A 3GRWL 5I8EB 3PLYA 1XCXA 2NY1B 2CDEB 4GG6B 1RUAL 2WAQA 9PCYA 5FA3B 3UBXI 4W81A 4D0CB 3GM8A 4IEFB 4YHIB 2WZPA 4ZMTA 1IC5H 1UD4A 2FEJA 3HJ0A 5K39A 1P7HL 4P49A 3W9DB 3QAZC 1MCHA 4K55A 4LCCB 2Q7YB 4WUUB 2MEJB 4X6CA 3RLSA 2J2ZA 4HXBL 2VDRL 3STZA 4FD0A 1I31A 2W59A 4DVRL 1F6AA 3LKSB 3CVCA 4OZHB 2Z4QB 1NICA 1D6VL 2X6CA 4GAFB 3UZQB 1CDHA 2D73A 3MLXL 2I7OA 2YPKB 4NKIL 2Y5TA 3D1MC 3FO0H 3ALWA 4QR7A 1NKOA 1DVXA 3GSVB 4KI5F 2V3DA 3KR3L 3EO0A 2XXFA 1DJYA 1JGEB 3QGVA 4AJWA 3MX0B 5LBVA 1MJUH 1QP1A 2VW6A 5HGDA 5CKGA 3SDXF 1CG9A 1KYAA 2FJFB 1DFBH 4ACPA 2XSKA 5JPMC 2DI8A 3WEMA 3O3DB 3AQZA 3AXLA 4Y9GA 3MUJA 3LQAC 5DK3A 3U30B 3DC0A 4KJWD 4B9ZA 3HRZB 2AS5M 1PZ5A 4PB9H 2DD8H 5IEHB 3L9RB 3QULA 1PG7L 5GHWH 1NGZB 4KTGA 4ZUWB 3HE7B 3JYCA 4ZFGL 3T0EC 1XTLA 3BD3A 3D39D 4W4NA 2X4QA 4XE0A 3ARDD 4N0UE 3U7WL 2EP6A 1A9BB 1WRFA 1E3ZA 3D0LA 4ICXA 2QKIC 2Y06H 1MLCB 1AE6L 2NW2B 3B3IA 3TPUB 4PS4H 2EYTB 2Y1AA 4G9FB 2VZUA 4ELMF 3HMWL 2LAAA 3LKNA 2B1HH 2XZAH 4NKDA 1NCOA 5KBPA 1TPXB 3CFBA 4B53A 4PREB 5FF6A 1NKRA 1S7UB 2FHFA 1WIPA 1G9MC 3SKNB 3VXSD 4WI9A 3B43A 1QI4A 3GMPB 3ULVC 2XN9B 1PYWB 1K4CB 2VLME 3KPSE 1U8LB 4M8QB 1B88A 2PO6A 2Z8VC 3GQFA 3LHPH 4RDQG 4E5XG 4E9QA 1NAML 1YQVH 1BVLA 4AGMA 1NWPA 3MV9D 5C08A 3C87A 4P2OD 1AKJB 1SN2A 1HXYB 1LP9E 1FDLL 3U6XA 1JNJA 4JG0L 2G3NA 1RIUH 2PXYA 4Z7UE 3TBVA 1QFWI 1NOLA 5BQDA 4XX1G 1ZHNB 1M7DA 4K8RC 3TGXA 3P4MA 4HZAA 5KSVB 3BAEH 1OTUD 3JBG7 4H40A 4OV5B 3MA9L 4MJ4A 1IQWH 3N41B 3FFDA 5LLIC 3MLRL 3Q6GH 4ODWA 3BDYH 5JW5B 1FZJB 4G72B 4D8OA 3HBPA 1FJ1A 5DK2B 4BRVA 3BSHA 4ATWA 1RLBA 3WFBH 3WTTA 3D3VA 2BP8A 1CFQA 1CR9L 3CHRA 2HT3C 1BBDH 4TSAH 5DD0L 3NP3A 2P8PA 5DWUL 1XIWD 2A6IA 2OL3L 3KDMA 3QZBA 4OD3L 3SYQA 5C1MB 1K4DB 3Q8BA 3IGFA 3G3LA 1H8SA 5G55A 3VRLE 3CN4A 4UQBA 5TK4A 4Z8FH 2UWEB 2JF1A 1MFAL 1VKXA 4HCFA 1DVSA 5MHSE 3MRRB 4JL1A 3SDCB 3ZHKA 3BT0A 5JHDB 5HGBB 1MRCH 4R4BA 2WIIA 4TLTA 2FX7L 2E59A 1BIIA 2VM4A 4AV5A 1TTUA 1KLUB 2DQCH 1RSYA 4KJPD 2NY4D 1MHPL 5F72S 3T8XA 3TOPA 2Z93B 4WFFD 4M7JH 4OJEH 2PWDA 1B90A 2CKBA 4DPAX 4OW6A 3G5YA 3WFEL 5I17A 4JK0D 3ISWA 4GNKB 3SN6N 4NQVA 1TZOA 2P44B 4Z5RA 1DQIA 3RZWA 4D9QD 5I8CA 3BQUB 4H8HA 2C1PB 2CIKB 5I9QC 4KO9A 3TEUA 5DQJA 4HUMB 4JO1H 3EG9A 4LVHC 5EU5A 1MPAH 1R5VA 5JIIA 4FQ2H 4Z7VE 3IDJA 2X6UA 5E9DA 4J5VA 3OV6A 2IJ0C 5C0ND 4G8EA 4NO5B 2AJYH 2AV1A 1BAGA 1KFAL 4X6DF 1R34A 2BP0B 1KCUL 5IBUG 5L88H 2ZAGA 4CDHA 4PYGA 4DTGL 2R0LL 5FO9A 4LNVA 4F8PA 1NH6A 4GG6F 4JFHD 3QEQB 4JFTA 1BLNB 5T1DH 5D5ME 5E4OA 5F1IB 5D96B 3CQQA 2ED8A 5E99L 1UXSA 4PPTA 3VXSA 4MX7B 1IEAA 1VF5C 1F86A 4OKVA 3EBHA 2UZPA 2P5WA 2CBMA 4OZHF 3PREA 1II4E 1OOWA 4LEOB 4V2BA 1BREA 3FTZA 4TF4A 4HS6B 2P26A 3QWNA 1AI1H 2JTYA 1KBGH 3RUGA 2C5DC 1KMGA 3FHEA 5DJDB 3VXMB 3DKHA 1A0QL 2MNJB 3T4YB 4R6UA 1AXTH 2YPVL 1OWWA 3HB3C 2YKKA 4RH4A 4PIBA 1E9OB 1TVBA 2QSVA 2P24B 2VMJA 2Y7SA 4CNIB 1OGTA 1UVQB 4YE4H 1WGOA 4Y0GA 1ROCA 2SEBA 2PYEB 1NFDA 5E8NB 1DQKA 4HUXB 3SGEH 4QGYA 2ADIB 5JDSB 1TZIA 5IFHH 3MRGA 3QI9B 4HZ1A 1PL3A 2NZ9C 4PJBB 4G7RB 1GAFL 3MJ7A 5ENWA 4FFVC 4XCFH 2NXYB 3GMRA 1TJGL 2NX5A 3V8OA 3H42H 2BVPB 3CVBA 4AVIA 5I8KH 1R3IL 3F12A 1F3DJ 4XZ4A 3TA3C 3TBYA 2ZG2A 1D6EB 1PLGL 3IDGB 4NZDA 4G5ZL 3INUH 1ZPLA 1JNLL 3QPXH 4JO5A 1PY0A 4YX2L 3ZRCC 5KG9A 4QJ4B 2ZAHA 4ZTOL 2YLHA 1ADQH 5IJKC 1PGRB 4XXDB 3FT4A 4EMZA 3GUFA 3N44B 5HHMB 3U4KA 4KRPD 2AC0A 5C0BD 3Q05A 4TRPL 3KJ4C 2WLLB 2OMYA 3O4LB 1UGNA 1T89A 3NCJL 1KIQB 1XGZA 5H37H 3KYKH 1H5BB 2ZYHA 3IMTA 4K9EL 2MWCA 2GG1A 5D9SB 1PCSA 5HDBB 2RGSA 1RUML 1SOSA 3IDNB 4WKZB 3MRCA 4HCRL 4HD5A 4QOKA 1WD8A 4N2HA 1SGKA 4JANB 3N41F 2ZICA 5I2IB 4KNQA 4KV5E 2J72A 3NFPB 5KYYA 3T1WA 3IAQA 4K7PY 5DMGD 2IGTA 1OY3B 2MHAB 3GUTA 2UUDH 5L8KB 4PH8A 4G6AD 4NM4L 1OALA 5BUGA 1I4FB 1HX0A 1IKNC 2X70A 4Y9FA 4Q97A 4RRPA 1T5WB 3ILQD 1YEJH 4HYTB 1BMGA 4I1PA 1HDMB 1IBZA 4AT6B 1G87A 1HIMH 1L9PA 2BNQD 3TS8A 5AAWC 2GSGB 3NABH 3QNXA 2UWEF 4M1GH 4XNUL 3NJHA 3SE8H 4FAAB 3LH8A 4U1NB 3S3PA 5J6GB 2VZ3A 3R06A 1LDPL 2ZE0A 3DX8A 2GAZA 4HJ0C 4LEEA 1XBDA 4NX0A 1B9ZA 1MY5A 3W37A 4AGQA 4W93A 5EC1A 2JKLA 3DTDA 5D7KE 4DZBB 1KB9J 2YD1A 3NSYA 3GO1L 2VWEE 3FU5A 4U1MB 4ZFZB 4G80A 4AL8C 5EZLB 2H1LM 5LG1A 1YNKH 4HPOL 4X4YA 1BZ8A 7FABH 4HPYH 4YAQA 2J5LC 1JMXA 2WXHA 2HTKC 5IQ9B 3ZLQC 5JPNC 3ETBJ 4I4WB 2R1WA 4UQ9A 4R4FL 3ENEA 1XB8A 4J2XA 3HPLB 1A7PL 3PWUA 1EO7A 3TZVD 1ZWIA 1E7UA 2BZCA 3OD3A 5KJRH 3U6XS 3UYPA 4MDIA 2X6MA 4P5RA 4F58L 2R9HD 2BC4A 3HC4H 5KAQG 2FGZA 3GKWL 2FB4L 3B2UC 4F9PA 4ONHA 1USZA 1NCAH 1JWMB 2XTJE 4J39A 1CDIA 1SDYA 1XB3A 5BOPA 1EXUA 5DK0A 2JKXA 5EBMA 3EDEA 4ONFH 5BRQA 4C54A 4JJ5B 4YNYA 5J0BA 2G75B 4PB0H 1MHCA 1H3VA 4XTRC 3UZVB 4WFGE 1JVLA 2ODHA 4L8DA 1J1PL 2AGJL 3POCA 4R2GB 4B95C 4ALAL 1XF5A 1DO5A 3RVTD 4ZRGA 2YD3A 1G1KA 1WAAF 4NNYA 3QIWB 5IIEA 3TNMB 4W9FC 5FK9A 3RDTB 1ZT4A 3BP7B 4OIIH 1XH2A 1Z32X 4PRPE 4HALA 3K2IA 4I9WE 4Z3JA 1D5IL 2OK0H 3DSFH 3PQYA 4ZUTA 2HJLB 3BIAX 1KT2A 2DQ6A 4OAWA 4DFHA 2WO4A 4RISL 1J11A 3FB8B 1DQQA 3ECVA 5FW8A 2VQ1B 2YFNA 4HWEL 5MEPA 4H2CA 5IJBC 4UBDC 1F45A 4Y2OA 1NDMA 1JPGA 1GGBH 1YEDA 3HAEA 3UAAA 5KTEH 4Z3HA 1S5IL 4HIXL 4PW9A 4FQLL 2QPDB 3NFSL 1TITA 3BUYB 3KWVA 4NFDA 4U1HB 4LOFA 5FFLA 1QZNA 1SM3H 1ZVSB 5AYUL 4YWGH 3LKOB 2Q7NA 2BNQA 4L05A 4G8IB 5AZ2L 3EXLA 1F97A 1F58H 2P43B 3ULUH 5IKCB 1T0MA 3QORB 1CGUA 1IGMH 4YDJA 1W6WA 1U21A 2YAHA 3S88H 1EEZA 4BZ2L 5IP4A 2V9UA 1C12A 5AWNL 2VQ4A 5EWIH 4KK9D 2CJ3A 4O2CA 3QS2A 3DRTA 1MRDL 1R3LA 3CX2A 3O4OC 5LAXA 2D3NA 2EYSB 2J8UB 4JFED 3N44F 4LLYA 4PY7B 1WWWX 4G1MA 1G6RA 2PO6C 4P23C 3L3OB 1CGWA 2VL4A 1TCMA 3LVTA 1DQJA 3VYOA 1QSFB 5A40E 1U8IB 2CQVA 3IBEA 1JWUA 2CGZA 2PP8A 5L2KA 2WGXA 4RETB 5ESVA 2CJSA 4P2RB 2HWZL 2OW7A 4HHWA 1YEIH 1RKRA 5HDBF 1P4IL 1XTMA 2PXYC 5BVJA 1T5KA 1A6VL 4H8QA 5ISZB 1IM9D 4GB9A 2G2PA 1MHHB 4OZGE 1IAOB 4YR6A 4F2MB 3SSGA 1P6AB 4WGKA 1FNGB 5C0CB 3G5VB 4WI5A 4XOEA 3B9AA 3VWKD 3GS4A 4DQAA 3HJEA 2OJZH 2BMKB 3BN3B 2LU5A 5DTFA 3ERXA 2EEBA 1E9QA 1OSPL 1AG0A 4IHBA 3SODB 4YJZL 3C6SA 1SQMA 3QDME 1LE9A 1FA4A 2ZUQC 1CLYH 1KJ3L 2O5XH 3B37A 5HPMB 3NZUA 3FAWA 5T5FA 3GSOB 1E42A 3CSGA 1TQSA 1DBJL 4AMXA 1A3RH 1PF3A 4H0LC 1E43A 4PJIB 4W6YB 2BS71 1MI5D 4XNQA 4W9EC 1N3NA 2XXCB 1JI1A 3L2LA 3KXFB 4DW2H 2D31B 4XWGL 1TEYA 4ZW8A 4MJIB 5AKTA 1OGAB 3QCTH 4XPGL 3TBTA 4MXVF 3U9PH 1FO0A 1XGUB 4K7PH 1LD9B 1MCCA 3EADA 3KL0A 2DBLL 2OR9H 4XPAL 3MOBH 4OCRH 4X99A 1PSKH 2F8XC 3OHXA 5TQ0L 2FZ3B 2YIHA 3TT1L 3MCLL 3CZFA 3CZSA 5MERA 1WP6A 3BZEB 3V6OE 2X5PA 2PCPA 3VFMB 1ZIBA 3FTUA 1U8NB 3K81A 4AM0A 5I1EH 3HG4A 2AEWA 4RFNC 1CDYA 1X4YA 4N26A 1OT2A 4L4VB 3TEYA 2NDGA 3GRWA 4I5BA 4X2UA 1UZ8B 1T1YA 4G8GB 3AZUA 3RZCC 3IKCB 2VMDA 3K72A 3T3ME 1U2HA 5LGKA 5ABDE 4XBMA 1XF3A 1LEIA 4C56A 1VEMA 2PW1A 1QR1A 5KANI 4QHLB 3ISRA 1KJ2B 4MB5A 4Z3FA 4L8SA 3SHSA 4L0YA 4NP4L 4NOBA 4JO3H 1FHGA 3NCWA 1FYTE 2Y7QA 1IILE 3F05A 4GQZA 3LN5B 2FR4B 3KVDD 3QZOA 3PNWA 2CLRB 3BWAB 2J5WA 4OLUH 2N0KA 4LARH 1TO5A 2BRRH 2OA9A 4PCYA 2Z7YA 5SX5K 3FCTA 2PCYA 3LIUA 1EAPB 1ZA3A 3TURA 4M6MH 3T0XA 4JFEA 4KH2A 4N25A 5TQ2H 3C2SA 1RULL 3NDZE 2X2HA 5DLMH 2VJ8A 1N6QL 2H2SC 1Q38A 2R7EB 1VSCA 2AABL 3ECWA 2MSPA 1KJ2H 1JP5A 3KEDA 4WUKH 5DEZA 2JK5B 5BV7B 2RIKA 12E8H 2IPTH 2WNGA 1JGVL 2E0PA 1GYUA 2DJSA 1J9CT 3KBEA 1W0WA 5BNXD 5DFAA 3ULUF 3TYGL 3WNIA 5B4MC 3UAFA 4FN0A 1ACXA 2MTAA 4HK3N 1ZD6A 4WFED 2YAFA 4YDVB 5ICUA 5IQLA 4HBQA 4B5EA 4YHML 2EH8H 5D4IA 2JJVA 2KMWA 2AJXH 1OM3L 3EHBC 5BV7H 1X6NA 4F3FA 5JLZA 1UACH 5C09B 3T2PA 4AZUA 3Q1SH 1Z5LB 1XWVA 2A73A 2XKNA 4X9HA 3MYZA 5EU6B 1IZJA 3QJHB 1AGFA 4GAJL 4JDVA 4PEEA 5IVXE 1NAMA 3MNVA 2FHCA 2FT6A 1QD0A 2HFEA 4YXKH 3P3TA 1BEYH 2P5EB 3Q2VA 5K1JA 3PGFL 4OCWL 4N8VA 2GTQA 2UXGA 3Q2NA 3OPZH 2J8UF 2OMZB 3BAIA 4KQ3L 4TVPE 5A16B 1U2CA 1WFMA 4RRPM 4E5XB 1W0VA 3RVXD 1T89C 3LNIA 3U6RB 4HEMA 4X7SH 3GZKA 2B08A 3CFQA 1IKOP 2FIRT 5LCVH 3SYOA 1YG9A 3VYPA 1YEHH 4NN6B 4PWEA 1IGYB 4J7RA 3K6FA 2IANB 3D0VA 2MOGA 4R26H 2D3VA 2NYZA 4ODTH 4NBYB 2AW2A 3QIBD 4WZ9A 4U6HB 1QNZH 2Z34A 2OMTA 3PDOA 3D4ZA 4N9GA 4Y19B 3VRIA 1UJ3B 4G9DA 3AABA 3KEHA 3UBFA 3TBWB 5AVQB 3UG3A 2N3JA 4KRLB 4U6VH 5EOCH 3WMQA 3AY4A 2XXMB 3EFOB 3Q48A 1L6ZA 3KBPA 3QUXB 4PWGA 1NLDL 3X14B 1H6EA 3SPJA 5C92A 4GG8B 4BZYA 1JNHA 2G9HB 2C3VA 3HG1B 1IUZA 1XCWA 3VB9A 2VZOA 5FWRA 5ECGA 1MCOH 1NCTA 4ZW7A 1TUPA 2F19H 4ZFOA 3ULSB 3HZKA 4P07A 4CU7A 4HOWA 1KZQA 2XQBH 4KJQD 1ILSA 1I8LA 4PJIF 1IC0A 2EQDA 1HEZB 1IAKA 2IAAC 3FQTB 3Q3GB 4IU3A 4XPHL 2ZTBA 2ZWNA 3SE9L 1JCVA 4LSRL 2QQLH 3OM3B 3UC0H 1TCRA 3NJXA 2VITB 1TETH 1BQHA 1K72A 2YRBA 2KC0A 3QXVA 4TSCL 4RMSA 2C9PA 2F7OA 3TTYA 3HW7A 4X9IA 5GS0L 3WIHH 1WUNT 2X1QA 3TF7C 1AY1H 4JDZB 1G9NL 2Q3XA 4UUJB 3THMH 1E5AA 1IVTA 2C4XA 4N0FB 5AVSB 1TENA 3AQXA 3Q01A 7FABL 5BZWB 3AGWA 2FYVA 4I18B 5J4MA 4P5TD 3ETSA 4G82A 4PLKC 1SQ2N 1YEFL 2X1XR 4Z76B 3N5AA 1I8MA 5E70A 2UY6B 4DKAA 5T8IA 3EYFA 5T1KD 3ATFA 5I1IL 1SBSH 1GGUA 3RY5A 4K7FA 4TPRL 1M53A 5GGVL 5J1TC 3F65A 4BCZA 3QFJE 4FNPA 4JFWA 4PGDA 3QQ9D 5DR5H 1SDAB 4JE0A 5ICYA 5IBUB 3H9SE 4I3GA 1JGUH 3IJYB 5E4AA 1B3JA 1J1XH 4PJ5E 5IM7A 3V0EA 3G6JA 1SZNA 1Z5HA 5IESH 1UOLA 4KUCF 2NY6D 3QEGH 5DC4B 3HIZA 1FZMA 1CBVH 3V0VB 1FFPB 4HS8H 2XY2A 4IRZH 1LYQA 2DJ4A 5BQ7B 1H3UA 2YPVA 5AVUB 3OJ2C 2KT6A 4YHYB 3S97C 3UTTD 1XGPA 5BO1H 1DVYA 2LVCA 4TV3A 2EVHA 4N0UB 1FI8C 4N20A 2CA3A 2X7LB 4CADA 1A8JH 5HD8D 5T33H 3REWA 2KBGA 4L1DA 3OC8A 5BZXA 2AEIT 2FATL 5FYKL 1VIWA 3IJ9A 3MN8A 3V0WH 2YKLL 2NNXA 1FF5A 3NSXA 1MNUH 1Z9LA 4YSRA 5D93B 3QIBA 2NXZD 4A63A 2J71A 2E9WA 3OXSA 4JFZH 5KBKA 3GXIA 5HJGA 1UQSA 2N1KA 4LDLB 3L3HA 3LZFL 4WO4B 2H6PA 3KPSB 5JQIB 2ZWYA 4CW1B 2FYYB 1TTBA 1LP9B 2OPCA 5EO0B 1H9DA 2BX5A 4Z7UB 3X12A 4ODBD 4I87A 3QE5A 5JR1L 3OKKA 4JZJA 3MGTA 4RDBA 3OMZA 3GBNL 2L0DA 4UU9B 3FW6A 5DHVA 2GK0B 4JFPB 5C8JA 5IFJB 3FO1B 3MRBA 5GIRA 1EUUA 2BRQA 1HXMA 4ABQA 2EZ0D 3SYAA 3J27A 2RTTA 2XN1A 1BPVA 1Y6KR 3ECBA 4KK5C 4JY6A 2V5TA 4YIQB 1BXXA 4M93C 2R0KH 1RIVH 1IGJB 2A4EA 3UEZA 4FG6C 5F3HB 1Z0NA 4B27A 5B8CC 4KHXL 1CLCA 1NC4D 4OY9A 4QRFA 1SOXA 3OSKA 3E38A 4HCRA 4RNRB 4RDQF 4MDJB 3HS9A 3IS0X 4LBAA 5D2NE 2J7LA 4I3RH 4P5TA 1AP2A 3WYRA 2XVLA 3OMIB 3FO0L 5GS2H 4JVWA 4JCMA 1JHTA 4G6ML 1WF5A 5T1KA 2YO3A 5ITFB 4DK3A 2WBKA 3FKUS 4M7LH 2QPEB 4Y4KD 1MJUL 1GTNA 3HBZA 3NJLA 5E6ID 4ANKA 1DFBL 2GBVA 4U3SB 4R7LA 4JFFE 4QRPA 2DLEA 5HYSG 1M7IA 2IV9A 3I85A 1KV3A 1N64H 4PB9L 1M05A 2DD8L 3KGRA 1RUKH 4EXPX 2NSQA 1U8QA 3GJFB 2CBQA 2GFBB 3WN5C 4IU2A 1R17A 1VACA 3VXUE 5L6YH 2UZXB 2LU3A 1J8HD 5HYQA 1BA9A 3SOTA 4D0DB 4Z7VB 2DLTA 4NC1E 2AZAA 3UTTA 5JHLL 4ODVH 2Y06L 2VISA 1AYOA 4RIRB 1MCWW 3MNWA 4PS4L 4Q9QH 2DI7A 3OC5A 3V0GA 2B1HL 3IMBA 1RZQA 3I3EA 4HGMA 2QLVB 4FLHA 5BS0E 5CP7A 4DF9A 5LGJA 4J2QA 2R27A 5KS9A 2P8LA 5D5MB 1ILUA 2HX7A 3EGDA 5LVEA 3OHXC 5FHBL 2ENJA 2NPLX 3GJFH 4MD4A 4F91B 4D0BB 5D7HA 1RZ8A 3ML9A 4JRYA 5E0FA 3ZDZE 4KQ0A 3P69A 1KACB 1W0YT 1CK0H 1YQVL 3TO4B 3V0AC 1TTFA 4IS6B 5KUKA 1UXLA 1FFNB 2WWOA 3EYOA 4BHUA 5D1ZC 2IPUG 4NZTL 5DSCB 4DN3H 1KNOB 3MLWH 4Y1AE 1QNIA 3TCLB 3ZSTA 4HOXA 3LEXA 4GO6B 1K3IA 3BAEL 4Q8BA 4PJ9D 1AHWA 1VJSA 3D5OF 1IQWL 1J18A 3DV4B 1U58A 3JWDC 3Q6GL 4JQXA 4O2FB 3D30A 4I0PA 5FEBA 2NY2D 4LCWE 4PG9A 4QRTA 4L8SC 2WW8A 2H0FA 3A4AA 1KLGB 4PD4K 3JTTA 4NFBA 3UIZA 4FLQA 3WFBL 2H1PL 2Q1EA 1MZYA 3F83A 5K1VA 5TH2B 1BBDL 4TSAL 4AGLA 1AANA 3QDGD 2KQMA 3AC0A 3FUIA 1AIFB 1IZKA 4GAGH 3RGHA 1JDCA 1OAKL 2N01B 1R33A 4M5YH 1U33A 5AYQA 4K3JH 5E1AB 1MDTA 3WV0A 1TQBB 1HYRC 1LGVA 3NJIA 4Z8FL 2K1MA 2R29H 5I82A 1FGNH 4N2AA 4PJXF 3F58H 3KVPA 4IBSA 4UT6A 5LGHL 5F0LB 4EIZC 2CCVA 2C9AA 3P3RA 2VLRD 4F7PB 2W94A 1MCSA 4X7FC 2DQCL 2WK2A 3PP4H 3VJ6B 4ZMWA 3FTGB 3V52H 5BUPA 4Y4HD 3DNKA 3L3KA 3OKLB 4M7JL 5DJ6A 2ED6A 4AKOA 4Y4KA 3PDGA 1T03H 4EE2A 5KSUA 3RB7A 1DDHB 1KPRB 1NGQH 4RWYH 4HAGA 1XMWA 1QO3B 1KTLA 4I1RA 4XO4A 4Y88A 5I5JA 2W65A 2YBRA 3APFA 4K94H 3ELQA 1E67A 4JZNA 5DS1A 1SMOA 1LP9F 4YHPA 3BPOB 1X9LA 2H4EA 1UA6L 2DQDL 2Q20A 4Z7UF 5F6HJ 4FA8A 4JO1L 2JKNA 4BZ2A 1MPAL 3KW7A 3P0GB 5ID1B 4FQ2L 4LEBA 3K2MC 3PGDB 2FO4B 1JZIA 3BRDA 3I9GH 4UOW1 1AFVH 2AJYL 2XFXA 1TQUA 5L88L 4LLUA 4BFFA 1OANA 1UA3A 1QOKA 1AOHA 1JTTA 1A4AA 1RPKA 4LCYA 2J6EA 4XAKE 4KKAD 2CWRA 3U2SB 1CF8H 4AYDC 2Y0SA 3D0AA 2E56A 1T1WA 4PGCA 1SFDA 4TTDD 3WTUA 4QWWC 2OXHB 2DJUA 3STLB 1HHIA 4H25A 2WMPA 3LX9A 4MKMA 3WTVA 3HKFA 2WQVA 3NRQA 3WTSA 4NDMA 1AQHA 4XNZB 4MLSA 3BPCA 3O6KH 1AJ7H 3RVWC 2OTWB 5D7JD 4MFHA 4S0HA 3Q9PA 3ZKNC 1SLUA 3VRLF 2I60H 2ZWZA 1HHJB 2J3SA 5HYJD 1AI1L 2NQDA 3IJHB 1KBGL 4M7LT 5SWSE 1BD2E 1UFUA 2XETA 2DKUA 4I3SH 1BFOB 3K3QA 2BPBA 2YC1A 1U3HB 3D51A 1JWSA 1AXTL 3QAQA 2AJ3B 5KVGE 4XNMB 3PJLA 4F7MB 4PJ9A 3N85L 2WLYA 1HILB 2P8MB 5DYFA 3P77A 5K9QG 3EBAA 4L2YA 4YE4L 1N4XH 4DKDC 2WY3B 3IDMA 5HVFB 2QJDA 4AQ1B 1HAWA 3GEFA 5I16A 2WXGA 2WV3A 2RBLA 5GPRA 1HJCA 5B38G 1KDIA 2ZNXA 4GUPA 2P80D 4GRLB 3QDGA 4PBWD 4XCFL 3UP1A 4Z7WA 1JK9A 4HUVA 1QSEB 4KWUA 3H42L 4UM8B 3QXAB 3ARRA 1G7HB 4MMYB 4WJ5B 4Z7VF 2QVKA 3CFEA 1INEH 2FL5B 2GY7B 4W9CC 5I8KL 2L3BA 3SE4A 2ZJSH 1H6FA 1XEDA 1MNNA 3QUZA 3RWDB 5FW7A 1WK0A 3MV8E 1A7QH 5DURD 2OYKA 2EUWA 3PWJB 4YVUA 1OKEA 3QPXL 3P0YH 4F9LA 1LK2A 3CSBA 2HJKA 2VLRA 2XTJB 3ASWA 1GGCH 3GSXA 1ADQL 5D5MF 5F7FA 4JVUA 2DJMA 4Y7MA 5EOQH 4W4OA 2VAJA 4NO2A 2ZOLA 2CRIA 2VR6A 2JKWA 4WEBH 4Y4HA 1QA9A 2KH2B 3Q2LA 3LZLA 4RGNE 4FQCL 2MCG1 1FRGH 3NSJA 4NQXA 1N0XH 3KYKL 3QPQC 2J56A 1N67A 1TSHA 2OSWA 3BUDA 2EDJA 3BUIA 2A9NH 4OQTL 1C16A 5MEQA 4LHQB 2VXVL 5IB4A 1GIGL 1D7BA 3ARSA 3ZYJA 1P2CA 1VCAA 3KH3A 1BV8A 1A4BA 2XPGB 3AG2B 3V5HB 4UOJA 3KL3A 4KI5D 4L23A 2YZ1A 3K6NA 3QIUD 3ZTJG 1KYOK 4C8XA 1H8OA 1EZLA 5KAQF 1T0NA 4FXGC 2ZP0T 3L4CA 2V7NA 4KK8C 4YHZH 3BP5A 3FZUC 3IXAB 4LFHD 4M1DH 3EOTH 4N0CC 3HOGA 4JFYB 3T9WA 3D18B 4GKNB 3W38A 3P3UA 1NMBH 3EGXA 5GS0D 1YEJL 1BBJA 1QLRB 2AV7A 4N6RB 3BAKA 4AEHH 1T0PB 4XVJL 1MQKL 3WFDH 3NABL 4M1GL 1XGTA 5D7JA 1R3KA 3RYMA 1JIBA 1M2VA 5HYJA 4N0YL 3TO2B 5KYWA 3P11H 4Q56A 4WCYL 2W81C 4S1QH 5C0GB 3BWSA 4U1IA 2IAMB 3K6DA 4O00A 5F6IB 3QNZB 5B3JE 1IAIH 1JUFB 3D4GA 1SOKA 2G2RB 4NRYB 4WDIA 3FOLB 1CD1B 5L2JA 2HKAA 3EYUH 1JFHA 4O02B 4NNPH 5AVYB 4BELD 3FQUB 4H8WC 3MTRA 1UFGA 3DV6A 1YNKL 1DP0A 2APFA 4GP5B 4UYPA 4HPYL 3L95A 3VW3H 4ZS7L 1I1AC 4M1CC 3IKKA 4PY8I 5AW3B 1SUJA 4ZFQA 3HC0B 2ZF9A 2MH4A 3CAFA 4IGBA 3WL9A 4LSTH 1CFTA 4FHJA 2OS7A 1IBBA 3ZYZA 2WUCH 4NHCH 4JZJC 3QG6A 5IR1A 5F96H 1U95B 3A67H 2K4WA 4OZGB 3C8KB 5KJRL 4OI7A 3I3BA 3RPBA 5CWSA 2YMOA 4O02H 5CBAA 2NLJB 1IBYA 3UBXG 4MCZB 4KV5F 5KEZA 3IFLH 3HC4L 3IJEB 1E4XL 3C5ZD 1ESOA 1G7PB 3QFDB 4M61A 1FZKA 2XX1A 4LP5A 3U2JA 1J48A 3VD9A 3L7FB 3QDMB 5FYKD 2FT7A 4FCHA 4WV1C 4ONFL 5HVWA 3B2VH 1JG9A 5A2BA 3A4FA 2UUDK 4NERA 5K9KA 2Q6WA 3QUMA 4PB0L 4V1DD 4PJDE 2AK4A 1S7TB 4TNGA 5CINH 4QD2E 5I74B 3T6XA 4G7SB 5CHNA 1QRKA 1SHWA 1DCEA 3O9WA 5FGCE 1A3LH 3IRPX 2NDFA 1V27A 1KJVA 5DHYB 3AT8A 3OKOA 5DHXB 5J3HD 3PWPE 1SXBA 5DUJA 1DN2A 1C5CH 3E6FA 3GT6A 3WKQA 3S8FB 1FNAA 4PV9B 5KN5B 1XB6A 2CDFB 4U7MA 4ZXBB 2L7JA 2OK0L 4HV8A 3DSFL 3Q44A 5L8JB 1QWHA 5K93A 3QIUA 4FE9A 4F8LA 3O3BB 4JFQA 5E8DH 1NBVH 2R2BB 1UCTA 4ZDHB 3SDXA 1CGTA 3ZX1A 1ZA6A 3QJSB 4DSYA 3WDIA 1XCTA 2RH0A 4LO9A 4N1EA 5KTEL 4PTUA 2H7WA 1QSVA 3O0RL 1IX2A 1D9KD 2IO5A 4WFHE 3T3MB 1HL5A 1SM3L 1KB5B 4GT7A 3AMKA 4DVBA 4NXSA 3JZ7A 4A6YA 4BZ1A 3ULUL 1F58L 1S7XB 3SDAA 4NUQA 4AYBA 3BZ4A 1IGML 2G4GA 4TL4A 4G8FA 5AUMA 5HD8C 3S88L 1FYTB 5FUCE 5I0XA 5EWIL 3DJ9A 2XZQH 1P5UA 4LQFL 4RZCB 4ELMA 5AG8A 4NB7A 4ZOAA 2W0LA 1DQDH 2W8CA 2LLNA 1PDKB 4NPYB 1KIUB 1YZZA 4URTB 4DGYH 4IBQA 5GGUA 1T6BX 4X0NA 5EU4A 3BH8A 4G6JL 1BVOA 5FAAA 2F53B 3BI9X 4NQDD 1KB5H 2Z8RA 1DVQA 3FO2A 2GEEA 3LDBB 1A7RH 5GZOA 3GZOA 3WIIH 1YEIL 2IC2A 5IEKA 1BOGA 2XWBA 4WJKB 3LRSB 2WXPA 4FFZH 2AQNA 2G30A 1YMME 1S7RB 2VDNL 2IQ9H 1LO4L 3KPMA 4JQXC 3FN9A 4MJ2A 1DQTA 4I0PC 4U6XB 3E7JA 2AXGA 2AJSH 2FWOA 2OJZL 3GGWA 3F7YB 4OIAA 3DX1A 5EOTA 3KPLB 3GMNB 3LZRA 4NQSB 3C5ZA 3U46A 4BKSC 1LTXA 4JN1H 5HVGB 3JTSB 1J0YA 1RK0A 4CSTA 3MJ9H 4I7ZC 2K6YA 2O5XL 4F7TB 4XI5C 4JLRB 4ZYKB 1N70A 2J4WH 3RG1C 4ZNEE 4XBEH 2Z1KA 4EDWH 5DZ9A 1A3RL 1D2PA 1LHZA 2JH2A 4LPTA 1I7TA 3EFDL 4V1DA 2VC2B 1BEXA 2J25A 3ILDA 2OW6A 2EECA 3FF8A 4AQEB 4YPGA 4DW2L 4OZIB 2HJFB 5I66A 2DMCA 4JM4H 1R5WB 5FW6A 1FL5B 2PF6A 3QCTL 5F3FA 32C2B 5D7LE 3VFGL 4F33B 1MJ8H 5C2UB 4CL7A 5IVXB 3U9PL 2JJSA 5EOCJ 5F7DA 2EDWA 1AR1C 3DVFA 4G9FD 2K7PA 4IMKA 4DKTA 1KGWA 3FTXA 3MOBL 4OCRL 2J8HA 5F88B 2XWRA 2D0FA 4GW1A 1T2XA 4IBZA 4K3GA 3GIVA 4TLKA 3SGKA 3KYMB 5B39G 2HG5B 2VC2H 4FG0A 5L7XH 5I1EL 1B0GB 1PIFA 4FYSA 1TJMA 1PLBA 2X4UA 3C6LA 1NL0L 1MCNA 2PP9A 4QTIL 5K33A 5DMJB 2P1YA 2B1OA 1AKJD 3ZR5A 4JG1H 4UM9B 3RGBA 1XGQB 1KTJA 5ICZA 2CU9A 5IMMB 4OZGF 1D9KA 3BISA 5HTSA 3S2CA 3CU1A 4XOAA 5IT2L 4JO3L 4TVPH 4P2AA 4A1RA 4HIIA 5J13C 4X6DA 4MMXA 4HWUA 3P54A 4AUJA 4LOUC 2A6KA 3FUHA 4PJGE 3E1F1 1VAHA 4YC2C 3O3AB 4LLAA 3WY2A 5I8EA 1K8DB 2GJRA 4OLUL 5F7WC 2CDEA 4LARL 2PYFA 3VH8G 5F3BA 4GG6A 2BRRL 1U0QA 5FA3A 2FH6A 3PWVA 3BGFC 4D0CA 3ZDXE 4KZ0A 4IEFA 4YHIA 2HH0H 3ESPA 4M6ML 3W9DA 4EI5A 1RERA 2F15A 4LCCA 5DLML 5CZXC 2CRMA 4APXB 3QUYB 2P3YA 4WUUA 3K5SA 3NJNA 1KJ2L 4OZFB 4CC4A 3CD4A 1QBLH 3LKSA 3NA4A 4OZHA 4WUKL 2Z4QA 1VGEH 4AKPA 5TJWK 4ZMXA 5BCAA 3UZQA 2AITA 2I27N 3MLUH 2H45A 12E8L 2IPTL 1NUNB 2GY5A 5KVMC 2YPKA 5JHDD 2YD5A 1Z3GH 4M62H 1DYZA 4NENB 3GSVA 3C6EA 1JGEA 3KLLA 2EIBA 4G59C 4G7YH 4FZ8H 3L48A 5HYSB 2EH8L 4OZFH 1I8UA 2FJFA 2X88A 1YECH 3O3DA 4CMHC 1E4WH 1HNFA 3BQUD 3CGTA 1UACL 3HS0B 4PJAE 3DMMD 1M71A 3HRZA 3L45A 3Q1SL 3T3MF 5GSVB 5IEHA 3POHA 1YLBB 1JRHI 3UIYA 3HE7A 3GPSA 3QFJB 3O3EB 4ANXA 1VFUA 4JPWH 1NPJA 3H9SB 3DGGB 3QUZC 5EBLB 5BJTA 1BIHA 3NJMA 4PJ5B 5DU7A 3PE9A 5I0WA 3F84A 4YXKL 1MLCA 1BEYL 2NW2A 2EYTA 1Z3RA 4G9FA 1U8KB 2CCLA 2MRYA 4WHCA 2VOTA 5G5DB 4PVBA 4W4OC 3QWOB 1ND0B 3OPZL 4LVNC 1P84J 1YMHA 2YD0A 4PREA 3WHE1 3VSQA 1S7UA 3HUJE 4PIRF 2WBJD 3EJRA 1SMDA 4XH2A 3SKNA 4B60A 2F7QA 3GMPA 3DYOA 4EN3B 2XN9A 1PYWA 4X7SL 1A6TB 2GUYA 4CGUB 4YXLL 1F56A 1U8LA 2VTFA 4Y89A 1B4JH 1YEHL 3CHOA 1U92B 5JW4M 5J57B 3SO3B 4CAGA 4FG4A 1A4JB 3H3KA 3C5JB 1AKJA 3TH4T 4ODTL 1AO7E 1HXYA 1PU0A 4H2AA 2I25N 3GMQB 3VXMD 2XZZA 3LV3B 5FUOL 5SV3A 4YBQC 3DOIA 1ZHNA 1Q1PA 3KLAA 2YHGA 4PJ8B 1V05A 3WY3A 5K1NA 1BVZA 2ZUWA 2G2NA 4U6VL 3B9DA 5EOCL 4DQOH 4OFQA 1TJXA 4OV5A 1GGYA 4GAYB 4XMLH 4QMEA 5JW5A 1FZJA 1HNGA 2PYED 4EEEA 3DO7B 5DK2A 5J8OA 3D48R 1I75A 1LL1A 1MCOL 1QYGH 2Q7AA 2F19L 3QI9D 2BCKB 1V55B 5I6XC 3F7RA 4YHLH 2Y6SD 4KFMA 3PS6A 3RI5F 2J73A 2XQBL 1SJHB 2ROXA 3IVKB 2NXYD 3VFVB 4XPBH 1K4DA 6PCYA 4OZIF 1EFXB 2QQLL 3UC0L 4XO3A 3FQXB 1QRNB 2IQAB 3DX9B 5EULV 3WGVB 4BGDA 1TETL 1IM3B 3BO8A 5IVXF 3S4SG 3QRGH 2UWEA 3JWNC 4WRLA 5LXVA 2MQ0A 1UT9A 4HEPA 2K6WA 3U79A 3DGDA 4N2OA 3MRRA 2X9ZA 4HUCA 3SDCA 3WIHL 1EDQA 2UX7A 1AY1L 5HGBA 3THML 5ACZB 1F1AA 1Q0EA 5DJCA 4AOFA 1TZ8A 3OAYH 1KLUA 1W91A 2IOIA 3ABMB 5B1JA 3TCTA 3FUDA 4ABWA 1CO1A 1MFDL 1U3NA 5HHMD 2Z91B 4MD0B 2ZONA 3UPCA 1MZZA 3U7YH 3O4LD 1DE4B 2E6PA 1NC2A 3E80A 5D2NB 1N5YH 4IGBC 1CT8B 1B4LA 5I1AB 2YD4A 1UENA 3I74A 1PJ9A 5CMAB 1SBSL 4P9HH 4NHUB 2GQHA 1FIGL 3WUWG 4N28A 1GYCA 1TIUA 2Q8BH 2C1PA 3FTVA 4GSUA 2B9BA 3Q7JA 3NIGE 2CIKA 4JHWH 5DEFB 2PPDA 5DR5L 4QCIB 3FHQA 1CI5A 2BSTB 4MNGE 1J9TA 1NDGB 1JGUL 4MJ6B 5D1XE 1J1XL 3PF2A 3LXCA 3LS4H 4NO5A 2BSSA 3TLRA 1P1ZB 4UTBH 1K8IB 4EKXA 5IESL 2GJ6E 2BP0A 4QYAA 1WISA 3V0DA 5HVHC 4JFFB 2DLGA 2C3GA 5E6SB 1CBVL 4F57L 4HS8L 3QEQA 1BLNA 2C9UA 4OF5A 1OTTC 5F1IA 5AW8B 1U30A 3BW9B 3VXUB 5HI5D 4BE5A 2JJTA 4POYA 1T04B 1B9KA 4IRJB 4P3DB 4MX7A 3WBDA 3O9WC 3LXBA 3MJ8B 5ESAB 3GMMB 2DQUL 3UTPD 4DPCX 5AW1B 3UG5A 5T33L 5DD6B 3V79C 4WSJA 4FQXB 4LEOA 5AD0B 1JTOA 2JKIS 4JCWA 4HS6A 5IB3B 3V0WL 5I71B 1K5WA 1OO2A 1MNUL 2AFNA 5JW4N 1HH6A 3IPEA 5BS0B 1WAAA 5DJDA 1PNDA 2GKIA 4FTDA 4R0LB 3T4YA 3KPQB 4JFZL 3J07A 3QIUC 3V10A 4CNIA 2P24A 5I8OL 4LGSB 3ZDZB 3WMPA 1MFBH 1UVQA 4I0CC 3H6AA 5IHUH 2MCPH 1VZHA 1F4XH 1LE5B 3BLBA 3A0OA 1M1XB 3IMVA 1FZOB 2PYEA 3AAZB 1R75A 4POZC 3RA7H 4AQAB 5B38B 5E8NA 3IGKA 5JHBA 3ZT6A 4HUXA 1FAIH 5FKAA 2ADIA 3HFMH 2OM5A 3L1OL 4Y1AB 2GJZB 4PLJD 5IOPA 4HLZG 4AG4H 5IVZB 3QI9A 4XOBA 4N0RA 1ADQA 3D34A 1ETB1 4QRRE 5ETUB 1IC7H 1H6TA 4KMQA 5LGYA 4OM1H 3E6HB 4ZW5A 5F7KC 3IWUA 5F1NB 3CXDL 3ZMRA 2WP3T 3SDAC 4LCWB 5CU9A 2BVPA 1KYFA 3DWTA 4NUGH 5H37A 2ZCZA 3O45A 1T6VN 4G1EB 2LABA 2ZCHL 1T1XB 1CC3A 3CTTA 2R0KL 1RIVL 3PAUA 1P5UC 5DGRA 2V7HB 3SYPA 4AQOA 4F8QA 2YQ3A 1BF5A 3II3A 2ATAA 3I6LD 1GZHA 2D7PA 4TQPA 1C9SA 3QA3B 4HCGA 2OXGB 2UY7B 4XXDA 1Z0MA 1CIDA 2DWDB 2VRKA 1Y6MR 4I3RL 5GZOC 2D7OA 1PD1A 4EF3A 1JSYA 3VACA 3AB0C 4Y2DC 2WCSA 2WLLA 3QDJD 4CN1A 3TN0B 1JCKA 4LVEA 4R2GD 2WWMD 1KIQA 1XF4B 2CUIA 1H5BA 3WENA 3EYQC 1HQRB 3NCXA 2QLYA 2CHXA 5D1ZI 5D9SA 4DP7X 4ODHH 3IDNA 2DQTH 3JQOB 3RDTD 2JMRA 4M7LL 1ZAGA 4WKZA 5H35B 3U48A 4JANA 3X17A 2H3KA 5I2IA 3ULUD 4P4RB 1RL1A 1UOWA 5C0IA 4PGZA 5KOMC 3WELA 5LJYH 1CD9B 2MHAA 2EIMB 1N64L 1OE1A 2A99A 5L4MA 1RUKL 2FJHB 1L6XA 5GXBB 1E3FA 2ICEB 1I4FA 1T5WA 1I3UA 2EJ1A 5EA0H 3C08H 1XF2B 2HRLA 5F8QC 3QK0A 1HDMA 4AT6A 1BQLL 4Q9QL 4M5SA 2GSGA 3T6ZA 5A2CA 2JJSC 4PYHA 3QORD 4IMKC 4BM7A 4U1NA 2LV4A 5J6GA 1EAJA 4KTYA 4P5KB 5I5RA 5IQ7L 3DOHA 5A2IH 4JN2B 1A1OB 1XL6A 2F08A 3SGKC 4NUJB 2FH8A 2HVKA 2V33A 4DZBA 2YXVA 3HN3A 4N8CH 4Z0XB 1ZHBB 2P47B 1LWJA 1RZPA 5HI3D 4U1MA 4ZFZA 2AEQH 5FB8B 3C6LC 5EZLA 1TSRA 2NY3D 4DN3L 4BK4A 2HVJB 5AKSA 4UI2A 1FN4B 4P2RD 3MLWL 1RPUA 5SWSB 1BD2B 2FLBT 3EH3B 5KANG 4I4WA 3AACA 5FUZH 4YDLC 1E8XA 2B0SH 5ISZD 4HQQL 2AJZB 2WTPA 2ITCB 3CPLB 4CKVX 1ZSHA 1UUSA 3CHSA 3HPLA 1ZANH 4HK0B 3UBXB 4D7PA 1RPQA 4BKTC 1X9UA 5C0CD 4HAFA 2YEZA 4ZD3H 1SY6A 1F5WA 4POUB 4XMKH 4PRBB 3HA0A 1H15B 4MMXC 4TNWF 2MNWA 3FONB 3BSZH 3IFPB 1DO6A 2NY1C 2IH1A 3VXQB 5C07A 4C4KO 1I9JH 5DA0B 1JWMA 3OKYA 5CZRA 4GQQA 4M5YL 4K3JL 3T2LA 4EI5C 2OP4H 2OTPA 3NH7H 2ZCKH 3Q43A 5KVGH 2AK1H 5HHOE 2R29L 4JJ5A 2NCMA 1FGNL 2KS0A 2G75A 3CH1A 4CC4C 3F58L 5IW1A 3UZVA 4HC1L 4KXZH 3KXFD 3I9AA 4N9OB 2OQJB 1YY8B 5DZPA 1OGAD 1THAA 4PTTB 1TLKA 4NI3A 3L4UA 3PP4L 1QASA 4LPCA 2NZIA 3BWZA 3QIWA 1FFQA 2QGBA 4YZFE 3TNMA 2EKJA 3V52L 3RDTA 3BP7A 1REIA 3U9UB 2I9LB 1DBMH 1B2YA 3HZMB 3TJHC 3ZDZF 1NGQL 4CVUA 4RWYL 3B4NA 4RGNB 1I7RB 1FNEB 1UZ6F 4JG5A 4LGPB 4XCEB 5F0JB 3QISA 1YUKB 4HIEB 1FH2A 3N06B 2HJLA 2YOCA 3DGCR 3GJFK 2EC9U 3FB8A 3UO1H 2BW5A 2VQ1A 2MOVA 3WXVH 2EAEA 1DTUA 1G7QB 4R4NC 4G8GD 5D6CB 3I9GL 1AFVL 3K8MA 1U8JB 4WWKB 3HE7C 3BUYA 3PP3H 5C6PB 1FPTH 2Q2EB 4U1HA 5I6KA 4X7TB 1MVUB 1ZVSA 4BH8B 5HHPA 2JLPA 3BH9B 4KNUA 1CF8L 4G8IA 2WANA 3FBKA 5IKCA 2EACA 3WS3B 2D03H 2XY1A 2PPFA 5JQ6H 3QORA 3P73A 1JV2B 3IN2A 5IQNA 4U3CA 3OXRA 2J20A 3CFCH 1TPXC 3BEVB 3O6KL 1AJ7L 5JOPE 4WAFA 1IBFA 3QQDB 3DBSA 1UM6H 2EYSA 2J8UA 1H3XA 1RZJC 2A77H 2I60L 2QEJA 1L9NA 4KU1A 4PY7A 1HQ4B 2ZKHH 4RZKA 3ZY7A 3V9FA 5DHMC 4EO5A 2A3TA 3D39B 1QSFA 1U8IA 3ARDB 4I3SL 1U42A 5FXCH 4A2MA 1KPUB 2XV3A 4P2RA 1FVDB 3T0EE 4UDUB 1PG7W 3DOSA 5ISZA 4HG4J 3WFZA 2N59A 1IAOA 3BHBB 5DC2A 3RL1A 4F2MA 1DSFH 1N4XL 2F5BL 1WHPA 3NRFA 1FNGA 5C0CA 3G5VA 4UAOC 1QFWH 5B1CA 3UYRH 2D9CA 3JXAA 4OJYA 5CIPB 2BMKA 4M03A 4GSRA 4ODSH 3TTSA 3UC2A 1AIZA 4L4JA 4QRQB 4LK4A 3ULVE 1YEWA 1KY6A 4LEXH 2DMBA 3VGEA 1LO3H 3MV9B 3EYSH 4GRWE 4ISVB 2C9SA 3O11B 3QJUB 5C09D 2E7LA 4X6EB 1INEL 3GSOA 1INDH 1OK0A 2ZJSL 3IK2A 5EU6D 4RAVB 4J4PD 5F9AC 1A7QL 4PJIA 3CDCA 1E30A 4MB4A 2D31A 3P0YL 5CIPH 1ZJBA 2AXWA 4MJIA 3SDCC 3BVWA 1OGAA 1GGCL 2CKNA 2JQZA 3N0AA 2B7DT 2P5ED 5EOQL 4QY8B 1XGUA 2PTVA 3L5IA 2HUHA 1LD9A 4X98B 5B39B 5B1JC 4WIQA 2AQRA 2FZ3A 4PJDB 2BY2A 1CF1A 2V2TB 4KZDH 1FRGL 4L1LA 4ZAKA 1N0XL 3D6GA 3BZEA 1ZDSA 4YL4A 5DT1H 4Y8DC 3VFMA 1XIWB 3ESOA 4KUZH 3EH2A 1BLIA 1NA8A 4S1SH 4YDMA 5E5RB 5FGCB 1B3IA 1U8NA 5EDSA 5DRZB 3RE0A 4FABH 2VDKB 1MEXH 3PWPB 2YQ2A 4L4VA 3U1PA 1DDTA 2IAND 1TQWA 3CX5K 1B0RB 4Z77B 3RWIB 1UZ8A 4K5LA 5FKPB 4TSBL 4G8GA 4Y19D 3IKCA 4WTZG 2W5PA 1VHPA 3KPRE 2CO2A 4QHLA 5CN2A 4M1DL 4FDWA 1KJ2A 4KZEH 2UZIH 3QUXD 2WJ7A 5C3LD 5M7QA 4QYOB 3F5WB 4WU5B 3TV3H 1NMBL 3OAZK 3VH8B 3LN5A 2HTLD 2VDKH 2FR4A 1NLBH 2BP5M 4PJHE 3HG1D 4AEHL 3VGGA 1G0DA 1H3PL 2RCSL 5HDQH 5CLYA 2CLRA 4PU2A 3BWAA 4NNXB 3WFDL 4WHYG 4KKPA 2JJTC 3FN0L 3PIQA 3UACA 3N9GH 3U4BH 5I1KH 1EAPA 1EH9A 3LOWA 2VABB 4N2FA 5CILH 2XKSA 3L81A 4WGVB 4S1QL 1HCYA 4M6OH 2HX9A 3N3EA 4PJFE 1G9HA 4DEUA 1CGSL 1XX9C 2V8MA 2OMNA 4WWOA 2L8AA 2XBZA 3K4AA 4I77H 2EYRB 2JK5A 5EU7C 1TQCB 3R7RA 2BSED 4NNPL 2HSIA 3IFOB 1WJ3A 4QXGH 5DD3H 1ZT1B 1WA2X 3SKJH 3D85B 1OT1A 1SHSA 2B4CC 3VW3L 1DBKH 4OGQC 3BVNB 1IVLA 3BLPX 1V8HA 4IBLT 4MQ7A 4O4YH 3DUSB 1OB0A 4LSTL 1WS8A 4YDVA 3INOA 1XGRB 1GOGA 4QJ5B 2QVIA 5E5MB 1X9QA 2WUCL 3ZQWA 5KJ4A 1MW1A 4TQIA 2KLSA 3G04A 3LN9A 3WJMB 1YMMB 3W1ZA 2HT4C 3EJUA 3BQVA 4MA3B 5J5EA 3MKGA 5C09A 4O02L 1FC2D 3ABZA 5GISH 2GIXA 3C09B 1Z5LA 3IFLL 1GKEA 1RK7A 1L7IL 5EU6A 4AVJA 4J4PA 4MZRA 3LSOB 3IDUA 3CIQA 2ZUVA 5LCVA 3WE6B 2V0AA 4OU3A 4D3CH 1QI3A 3DHPA 3QXWA 3B2VL 3VD0A 2P5EA 4EJ1C 4JBSA 4JZOB 2HN7B 3BMWA 3NCBB 5CINL 3W81A 1NGPH 5IROD 1W8NA 3EH4B 3HC3H 2OMZA 2BY3A 1KPVB 5A16A 1A3LL 3BIKB 4PHXA 4E5XA 4L1SA 1JJUA 1NPNA 2A83A 2FEEL 4IKLA 3WJLC 3U6RA 5D7LB 5CM1A 1KGCD 1H5BC 4EI6B 4J23A 1G7MB 3KYNB 3RVUC 4ERSL 4JHBA 5JMRA 5B3JF 1IGYA 1N8OE 3QO0B 3R19A 1KXQA 2R69H 5BRZA 5DDHB 4GKOA 2C9VA 4Y19A 5E8DL 4F7EA 2APWA 3QP3A 1UJ3A 1NBVL 2ZX7A 5CGMA 4F8TA 4AVKA 3B9KD 1G7LA 1GW0A 5FS5A 2QGDA 2VLMD 3TBWA 3UERA 3IDXL 4UTAH 5L0QB 3KPSD 5DQDL 3W9EB 3NSCA 3HKZA 3EFOA 1KBBA 1Z6JT 3QUXA 3FB7B 2RALA 4K07A 3X14A 3PXLA 4NSKB 5LNEA 3VU2A 3ZE0E 4QXVA 1PKOA 3WIHA 4GG8A 1TZGL 25C8H 3EYVB 1JXJA 4ZOBA 2G9HA 3HG1A 4UQIM 1R1CA 3BVVA 5LB1A 1CLVA 4BQBA 4QEGA 3CSPA 3ULSA 1EWHA 1KTBA 2WWKT 4GQPH 2NNAB 1UWYA 4A04A 5DD5L 5F9DC 3S4SB 1HEZA 3Q3GA 3FQTA 2OZ4H 5DYOB 1VERA 1MCFA 1NMCB 5GS2D 2VITA 4PJGB 2QHRL 3KS0H 4JRWA 3T3PE 1DQDL 1EDHA 1Z9NA 4MS8D 3V55A 4DP4X 4LNRB 1JZDC 4JPVH 1IE5A 4DGYL 1DR9A 3CN3A 4MWFB 2BSEA 3ZDXB 4GKZB 4JDZA 4JHUA 2QGCA 3CU7A 1RZGA 3D69B 2WVSA 4PJDF 4UUJA 1KB5L 1GS8A 4HXAL 4N0FA 2NY0B 5DUMH 1A7RL 4P57A 5TE6H 5GS3A 2FE0A 5BZWA 4MMZB 3TASA 4BFIB 3NGBC 2HFGH 4I18A 3WIIL 2QQNH 1FC1A 2FDBP 1KCWA 2C8NA 2DEXX 4FFZL 5MHSD 3WUWB 4Z76A 4LASL 1V5JA 2WZAA 4X6BB 1VGKB 4BQ6A 2IQ9L 2UY6A 3LH9A 2A38A 3M7OA 2EDBA 2FX9H 2YRLA 4IRZA 2DF3A 2AJSL 1LK3L 4ZUSB 1OAQH 4DOHE 2M83A 5BMFL 4H20H 4U0RB 1L4IA 4JN1L 4RAUB 3MJ9L 4MYWB 3MV11 2WINB 2AQQA 1KTCA 3WSQH 4K2UL 3OB0H 2J4WL 5KVEL 4XBEL 4EDWL 1NJ9A 4MD5A 4PJAB 3V0VA 4F27A 1FFPA 3QUKB 5G2NA 5BQ7A 4MA7L 3M6DA 3T1FB 3HR5A 2JIXB 4FQJH 1NGYB 3MREB 3TZVB 1F4YL 1MJ8L 2YMXH 2W0KA 4HZLA 2X7LA 5B1AB 4GI9A 4PJXA 4O2EB 2ZCLH 3LS5H 4NI6A 1KUMA 2KQNA 3QIWC 1OM9A 2F61A 2J44A 4N5EC 3ZIYA 4BQCA 2ATPB 5I6NA 3MCG1 5KSBE 2IWEA 2PPAA 4PP1D 4Z7NE 2WQ8A 1NIBA 2VC2L 3HUJB 5L7XL 5LN8A 1ZMYA 2CHWA 4M3KB 4EOWH 3A22A 3TO4D 4WO4A 1ZLSH 4ADJA 3KPSA 1Z9MA 4FYQA 4CW1A 2FYYA 4KKCD 4B9KC 4JG1L 1RK1A 1PFCA 3ZKSD 2A74B 2DQEL 3WO4C 5IOKA 1FHNA 3LKQB 1GHFL 2NYYD 1AO7B 1LP9A 5EO0A 4OCYH 4QHKI 4Z7UA 2EE3A 2OLDA 1L5GB 1FGVH 1KYUA 2C3WA 4NN5B 4TVPL 5LDSA 2VXQH 4UU9A 4X50A 2J1YA 2GK0A 4I13B 4JFPA 3TJEL 5IFJA 1G6VK 1OPOA 3FO1A 2IALB 3WD5H 1XZ0B 5GS1B 3RTQB 4AGOA 2M1KA 4GEIA 4CVXB 2WKLA 1OARL 3DVNB 5HHQB 1T3FA 2HH0L 2OCCB 4HLZH 4LMQI 4KK6C 4FFYA 4RAHA 4YIQA 4BGLA 1IGJA 3CZEA 3UXFA 3VFPB 1A4KB 1J5HA 1Y0LB 1NCWH 1WIOA 2K8MA 4FNLH 4HJJH 3B8SA 3X1BA 5CJOH 4RNRA 1QBLL 5F8RC 4MDJA 1KJMB 1VGEL 4ETQB 4W68A 1NBZB 3MLUL 5DO2D 2IH3B 3AWFA 5JQHC 4WTWA 2DQFB 2VDRB 5ES4B 3FT1A 4B41A 3TIEB 5LQBH 3O6LH 2F9BT 2ZF8A 2ORBH 3SYCA 5KSAC 1DQVA 5F21B 1QVOA 5ITFA 3E0GA 2QR0B 3Q5TA 5DFWH 4FZ8L 1ACCA 2AQ1A 2OJ1A 3O6FD 3OJDB 4QO1B 5CD5C 4M7KH 4PLOB 1YECL 4MQXD 4U3SA 4KX7A 4D9RD 4KRMB 3LVEA 2EO7A 3H2PA 4X9FA 1E4WL 4IOSA 1N9PA 2F8IA 3RI5K 4NO0B 2VDRH 2YJLA 3DYPA 2KLTA 2DB8A 2IEPA 3ECUA 4GIPD 1LO5B 5DA4A 1MFNA 3GJFA 2GFBA 3V6FB 1WUZA 1AR2A 3NIGB 4GOSA 3H3BC 1KIPB 3Q8EA 2UZXA 2X89A 4JRFA 4MNGB 5JDJA 1IM9B 3M88A 5DZJA 1QWUA 4D0DA 4N2EA 5D1XB 4Z7VA 4H4NA 3OLEA 3UPAA 3FH8A 4Q2ZB 1NSNH 2GJ6B 4RIRA 1CGXA 2OCJA 4WI6A 3VWKB 4EPSA 4PJGF 4XN2A 1FLTX 1KCBA 3D06A 3SBWA 3UCQA 1EV2E 3WLWC 1ZHKB 2E9IA 3B5GA 1E5YA 3FNKA 3ZDXF 5D5MA 4EN2A 3R8BB 3VMOA 3JVGA 4D0BA 1JVOA 4YSOA 4ZAKC 2DTSA 3D3VE 4TUOB 1PVHA 4DGIH 1B4JL 4Z3GA 3E3QC 4IDJH 1PG7H 2JVUA 3GS0A 1CU4L 1FFNA 4RSYA 1HTYA 2GC4C 3BJ91 4P4KB 3Q2WA 5DSCA 2VZVA 3LZOA 4GKLA 4B96A 1YY9C 4DQOL 5D7KD 5J6SA 3LPGA 3DV4A 3TBCA 3C2AH 5T1JA 4O2FA 5ID0A 2R29A 1T7YA 3UGEA 4PRDB 5G4NA 3LB6C 1KLGA 3L13A 4QHUA 1BJMA 3JWOH 4FEIA 1CLOH 5ALBH 3RURA 3RVVC 1I85C 1MJJB 4NFCA 5EORL 2YA2A 3HNTH 4PVMA 3PL6D 3OJVC 4PJAF 5TH2A 1BZ9B 1CICD 1AIFA 4QRRB 1XDTT 4Z7QE 4XPBL 3L5XH 2VLJA 3FRUB 5E1AA 2KKQA 5E2UH 3BUTA 1GTFA 2OL3B 5J89A 2GIYA 4ZMVA 5SX4H 4HWZA 2XIIA 2EDNA 2NTFB 5E9DE 3ZE2E 3TA4D 3UADA 5BV7C 5EF2A 1I82A 1LWRA 4O51B 4TQHA 2XTJD 1T7WA 2Z7WA 3OLIA 2VDLL 1JZ6A 2NR6A 1PFOA 3S35H 3REVA 3ZJAA 5JIQA 1XH3B 3EH1A 3HUJF 3FTGA 2Q3ZA 4ZUVB 3ETTA 3ZO0A 3OKLA 3O3UN 4G7QB 1N5YL 4WFGD 1KPRA 4FXTA 3MNDA 5DD0H 1HHKB 1QO3A 5IZ7A 2VN6A 2OL3H 3WI9A 4OD3H 1KFGA 1XZWA 1QZ1A 3HI1B 2ZSWB 2Q8BL 4YK4C 3QO1B 4ZMOA 1AHMA 2XU9A 1MFAH 5EV7A 2WPGA 3FCBA 1NCJA 5B1BB 2DM2A 2K0RA 4PRPD 5ID1A 1FL3A 3PGDA 3LXAA 2FO4A 4GBXB 4I9WD 3RUGE 3LS4L 2K8QA 1SOQA 4PJEE 3VSTA 4UTBL 1ZT7B 4J4PC 4K3DH 3ISYA 1PKQE 4WY7L 3Q5YA 5E2JA 5H4ZA 5AB9A 2YQBA 2EXYD 3US0A 2QADB 3TXAA 4H0IA 1HESA 3PPEA 4HHAB 2OXHA 1PNCA 1C8QA 4AQ8A 2LW3A 3L08A 3WFEH 5EPMB 3VFWB 3VFSB 2D7QA 4LAQH 1GSKA 3IAPA 4N1CA 4N85A 3S3BB 2OTWA 1QWNA 2NT1A 2GB2A 3RGVA 3IJHA 4QDGA 3GMOA 4W9GC 1EUTA 2NX5E 4NN6C 2IAMD 1BFOA 4OH2A 1U3HA 3ZKMD 4APQA 3VFUA 3UAJD 2WN2A 1T22B 2NTSP 2AJ3A 1ZHLB 4XNMA 4F7MA 1M9WA 3CLFH 1NGXB 2D9QB 4LZKA 5J12C 1MFBL 4ORGB 1BX2B 3R1GH 2P8MA 4N22A 4UQCA 4LSUH 1HHHB 3M1CA 4XXCC 1ITBB 4DEWA 3NA9L 3U36A 3BFQG 1JD9A 3RA7L 4WVRA 3QUXC 4DZ8B 3NIFB 2W95A 5CAYB 2VB5A 3OAYK 5CD3B 1FAIL 2Y9RT 4PVLA 3ARFB 2Q10A 3MLVL 2Y25A 3FHAA 1QPPA 2K9UA 4AG4L 4DO4A 5CFHA 3G5WA 2XFGB 3T6VA 2H32B 4Z78B 3HG0A 1WGVA 3NIGF 4OM1L 4GRLA 3CE1A 5MEOA 4IMLB 1QSEA 4YDNA 4UM8A 2BVEA 1G7HA 2XT1B 3KBHE 4MMYA 2GJJA 2OMVB 1M57B 4NUGL 2FL5A 2E5EA 2GIMA 4Z3TA 2EILB 3PGCB 4XHQA 1T7ZA 3RWDA 3GXMA 4QOKE 4KZCA 5I6MA 1T66C 5F9JA 3QDMD 2PCXA 1IFHL 5AVRB 2GHZA 5FOBA 3Q2CA 3F64A 4OCSL 3WNPA 2H32H 3CFDB 3VUAA 4M9OA 3EOAB 5GJTH 3NUKA 5HHOB 3LZQA 4KROB 1GOHA 5I26A 5K69A 3OSVA 1BQUA 1GAFH 4XNXH 4JL2A 4NQEE 4LU5H 4LSDA 1PAMA 2CGRH 5H2BB 1TJGH 2IH9A 3SGDH 1M7UA 4R7NB 4ODHL 1VENA 2DQTL 3S37H 1R3IH 1AS7A 4LLVB 1YEEH 2OULB 4A7QA 4ZXBD 2IDQA 4LQ1A 3V5HA 2J55A 4G5ZH 4TNWK 4BFNA 1JNLH 1TMQA 1AQDA 3MRIB 3PWNA 4KY1H 3RAJH 1SF3A 1Q9LB 2E46A 3IXTB 4X7EC 1SHXA 3IXAA 1DUYB 4JM2A 4JDEB 4JFYA 5D4HA 3SE3A 3D18A 3ES6B 4XO9A 2HYMA 3IYLW 4NRXB 5EA0L 1DN0A 4G3YL 4Y9EA 4N6RA 1HAUA 3EGSB 3GC3A 4ZNCD 3S98A 4AYSA 3ARBC 2JB6B 1RUMH 3MUZ1 2DM4A 2R1XB 3ABGA 4WGWB 4WNSA 4WJG3 3WTYA 1PZ3A 2R56H 3DTUB 5AAMC 3TO2A 1FYTD 4N86A 1GY1A 1OF2B 1P7QD 2K6ZA 3DSNB 5C0GA 3ZZLA 2IAMA 3QNZA 1JUFA 5E1IA 4NKOB 1Q9OB 2G2RA 3UAJA 4NRYA 3GJEB 1LO2L 4N8CL 3KDPB 2MMXA 1F02I 4JY5H 4RCAA 4WHYH 5JPMB 1HL9A 4K5NA 4O02A 3H53A 4B9CA 3FQUA 1MELA 1CE6B 2AEQL 2EIZB 3DHUA 3SKUD 4WO4C 1WTGT 3A5VA 4KO7A 2D4DA 4O5LH 3UEQA 2RR3A 3T09A 3NACL 3HC0A 3Q9QA 5FUZL 3MBWB 1Z1WA 5I1JL 1IV8A 1FV1B 2CPCA 1JGIA 3T0EB 1ZLDA 2WXFA 4U3XA 1I53A 1ZANL 5IWLA 2AXFB 1VFOA 2QKIB 2YRPA 3KNBB 1DL7H 1U95A 5E6ZA 3SCMA 4OZGA 3C8KA 2ADJB 3GPEA 5CEYA 3BP6B 4XMKL 2OMWB 2QVMA 5I5MA 4MCZA 4AV0A 1OVZA 4PHZA 3BSZL 3LQAH 4TNVF 2CBPA 3IJEA 2CALA 3F00A 4DP0X 5KWYC 1WWBX 2Q86B 1G7PA 3QFDA 3MRLB 1PMYA 1TEFA 3OZKA 1F1DA 3DROB 3PQYE 5I0DA 3QDMA 4LF3A 1AMXA 4B50A 4HPOH 2OP4L 5E51A 4GRWB 2AK1L 3T77B 2ZKMX 1R5IB 3L3JA 2YSSA 1S7TA 2TAAA 5E1GA 2YK1H 1RZKL 3H2WA 4G5AA 2ADFH 1MH5B 2MNUA 1EERB 4JKKA 3DUUB 4P2CG 5DHYA 1NDTA 2IWKA 3II1A 1WD9A 3D07A 3DX3A 4GLRI 3ZRFC 4IKNA 4AJYV 1G9MH 3TVMC 3ULVH 4PV9A 1DBML 2CDFA 1Y7VA 4HIJB 1IGCH 3W11D 4GRWH 3MROB 5DJ2B 2LAGB 3K1KC 4IYKA 2LE9A 4TVPD 2MKWA 3P2BA 3IMSA 4ZQKA 4UNTA 3UMNA 3GHPA 1NC4B 2R2BA 5JMOC 3EDFA 3NIFF 3UO1L 3SIKA 3BCDA 4LPWA 4ZDHA 4RRPG 4Y8AA 2Y22A 4AMWA 1O6TA 4K8RH 3D25B 4NQQA 1INQB 4UM9D 4F7CB 1GC1C 1NKGA 2WZ6A 3ZHDA 2AGJH 3QJTB 5L2KE 5GZNA 2B9AA 1EJOL 1FPTL 1MDAA 3NT0A 4XC3H 1KB5A 2BIMA 3OKMB 5E7BA 3KPRB 2XJLA 5DMYA 2D03L 1S7XA 3KCPB 5JQ6L 1G5GA 3MLTA 4M5ZH 1F3DH 2G4EA