1IKFL

A conformation of cyclosporin a in aqueous environment revealed by the x-ray structure of a cyclosporin-fab complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISTYLNWYQQKPDGTVKLLIFYTSRLRSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGSRIPPTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRAAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/immunosuppressant
molecule keywords IGG1-KAPPA R45-45-11 FAB (LIGHT CHAIN)
publication title A Conformation of Cyclosporin a in Aqueous Environment Revealed by the X-Ray Structure of a Cyclosporin-Fab Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1993-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ikfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ikfL01
2VQ1A 2WW8A 4I48A 1QA9A 4W6WB 1LP9A 5ALBH 3VXUA 3U6RA 2UWEF 4P3CH 4POYA 1S8DA 3GB7B 3Q3GB 4FOMA 2BSSA 5IEKA 3ILQD 4H1LB 4KKLD 3VFPA 1RUKL 3U0TB 2DQGH 4KI5D 1I1YB 4L4TB 5F7NC 5BO1L 3D25A 3A6OA 5HYQB 4XP4H 3TFKC 4EOWL 1XGUA 2KZWA 3WIIH 1J05A 3MRFA 5IHZB 2YN3A 2C1PA 3SDAC 1YYLL 2YKLL 1CU4H 4PJGF 3O9WB 3BH8B 5IK3A 1N3NA 1M6OA 1QBML 3QUZC 4MHHI 4LDEB 1RK0A 1F6AB 2G75A 2O5ZL 2VKWA 3GJEA 5KSUA 4OTXH 2IALA 4XB8A 5DA0B 1ZANH 4TQEH 2VYRE 3BISA 4LSUH 4K2UL 1A5FH 1IRAY 2PYEA 5KW9H 3CUPA 1WAAE 5DRNB 1I9RL 5IB2A 5EZOL 3O3AA 1KOAA 1AI1L 3K80A 3FQRA 1RZ7L 1MJ8H 4PFEA 5BZWA 3QUKB 3VXPB 2ERJC 1B9ZA 3G5VA 3T2PA 3FFCD 2EEDA 2FEEI 5I1AB 3ULVL 4YDIL 3EYVA 4CMHC 3MTRA 4HKBB 1LD9B 3UTQB 1S7TB 5D7LB 1YA5A 3BKYL 3MOAH 5I30L 2ZUVA 5EOTA 5GS0L 4FQCL 5B8CC 5IV2A 5DUPH 4DKDC 4JAMB 1T7ZA 5JTWA 4C4KO 1ND0A 2C26A 1KCKA 3RWFA 5IBUB 4MQTB 3C6LA 1EO8H 8CGTA 1U8LA 1BFVL 2EDXA 3NGBC 3RA7H 2HVJB 1UZ6F 1EXUA 3DYOA 3O2DH 4U31A 4FQPA 1GL4B 1RK1A 2Y25A 4S1QL 2YEZA 3KPMA 1FCGA 1PYWA 3NCMA 1A7PL 5FO9B 3LQAH 1C1EH 2EEBA 2FX8L 1BJ1J 1X5FA 4WW2B 4KUZH 1ACYL 4HEPG 4LCYA 3CXDL 3UBXG 4UDTA 2IMMA 4XAWH 2OX5A 3W11C 4P2OC 4P4KC 2EIZB 1G7QB 5F7WC 1JJUA 1RPQA 3P0YL 5DEFB 4ZUVA 1P4IL 2HT4C 2WBWB 3E6HB 3GK8H 3SE4C 5GGVL 2HWZH 1XGRA 3RL1B 5BJTA 3TN0B 1G9NC 4OV5A 4M61B 3ARDA 2DLTA 4RRPG 4X4YB 4XPBH 3G5ZA 3JWDH 4LPTA 4HS3A 4IDLA 1BGXL 3E6FB 3ZT5A 4YO0B 4JZNA 4MVBD 2P7TB 4JKPL 4RIRA 3QUML 3MA9L 3V4PH 1KJ2H 3BPOB 4Z77B 4PJDB 3QI9A 1JPFB 2ARWA 5DFVD 4DGVH 3HE7B 4QXGH 5J12B 5T3ZD 4OM0H 1MNUH 2ZJSH 4IDJH 2CIKB 3L3JB 3ZE2F 3X11B 3L95A 3V6ZB 1JBJA 5HY9A 4UTAL 4JM2D 4D9RD 4O51A 3HCVA 1YMME 5HHVL 1I8IA 3EFFA 2EECA 3FTGB 1WJ3A 4OLUL 1MWAH 4XH2A 1OCWH 4PG9A 2MCPL 2VDLH 2HJFA 3O4OB 3Q1SH 2QQQA 3DX6A 4LGPB 4PJ9C 4F7PB 3LN5B 5CILL 3QDJB 4DGIL 4NZTL 1NBYA 2ITDB 3H7LA 1K85A 2IG2L 4X6CE 4Z76A 3SDAB 4RGNE 2APXA 2OR9H 5F1IB 1ZTXL 2DQUL 2K7PA 3BUTA 5FYKD 1NCBL 1RZFH 1AQKL 2HKHH 2JELL 4MA7L 5IVNA 5D70H 2FJFA 1NLBL 1MEXH 4HZLA 3SKOA 1JGEA 4R4ND 4AEHL 2OZ4H 4YZFF 3TBSA 2JCCE 4QRTA 3WE6A 2NW3B 1DBBL 4YHYB 4XNMA 2DICA 5AD0B 1LEKA 2ZG1A 5D1XC 2I5YL 3BEVA 4KJPC 1K8DA 3B6SB 3DYMA 1C5BH 3IU4L 4HAGA 4WHTB 5EU7E 1W0WA 3FT4B 1H3WM 1CK0H 5FHAH 2VJXA 3I02B 3U7WL 1UWGH 4QHMB 4JFFB 2EC9U 4GRWB 5E5UB 3WUWA 3ARBB 4X5LA 3G9VA 4JO3H 1EAJA 4MS8C 2ZUTA 3LB6C 3FT3A 4M1GL 3OPZH 2ICWI 1JTPA 5I8EA 3AS3A 2BNRB 3QJFA 2C7UB 3RWGA 4XCCH 5B8CB 1PKQA 3O41A 4GO6B 3HB3D 1K2DA 1UZ8B 2BY3A 4NUJA 2DJUA 2J3SA 3PHOB 3U46A 5EN2B 4ZFGL 2HTLC 5E99L 4AENB 3WJLA 1C5DB 1ZT1A 4HDIA 4R97C 4PJCB 2QL1A 4YXHH 1OP3H 2ZNWA 3RIAK 3ZTJG 2EZ0D 3HPLA 2YPVL 3MFFB 3ZDYE 4L4VE 1I85A 5BRZB 3QDGD 3CPLB 5F6HJ 4KQ3L 4KK5D 2Y23A 4N5EC 3BT2L 4HWBL 3SJVE 5CP7B 4NPYA 4IBLT 3BAEH 3DVGB 3HLAA 1D3CA 3G5XA 2A1WH 5KVDH 4UOW1 4X98A 3MLWL 2D03H 4E5XA 2Y72A 5DHYA 1LEIA 3ZKMC 4JCMA 4O02H 5KZCB 3X3GH 4CW1A 5E9DB 4R90H 3MUGA 1CICD 1OB1A 3BUYB 3RPIB 2H45A 3RUGA 1KNOA 2D9CA 2BDNL 3DVNA 4EZMA 3QDME 5HVHC 4H88H 1N59B 1EGJL 1MFBH 4J3SA 2FD6H 3PF2A 2VZUA 1YEDB 2Z31D 3MXWH 3NABH 4WWKC 1XIWD 1J86A 4WU7B 4GW4A 4QRUA 4H20L 4QHNA 4XCYA 4X6CF 2A73B 2I26N 4LPCA 4YHLH 3T65A 4G7YH 3MSPA 4QTHB 3B9VA 4RZCA 4F57H 2V9QA 1WZKA 3A6BL 2H9GB 3DGGB 4GXUN 2WBJC 4X7DC 4FFZL 3IFOA 4G5ZL 4MA3A 3AFLA 3MRQA 5FUZL 5I1DA 3WFDL 3FB8A 2CLZB 3TBTB 4DVRL 2FGWL 1DBAH 2GK0B 2QBWA 4GKZB 1FZKB 5HI3D 3LVEA 3V5DA 4XXDB 4BSVB 1CFNB 4HULB 2L7UA 5F9AC 4DAGH 3LKPB 2WQRA 1S7XA 1Z9SA 4ONGH 2X4UB 4M5ZL 4DOHB 2I9TA 1MIEH 4OZHE 3FONB 3HMWH 1RIVH 4HUUB 2W65A 4PRIA 3VFNA 2DD8H 3L7FA 1ZKAA 4S0TD 3V4UL 1CDYA 4Y19B 1HIML 4ORGA 3TCLB 5E00B 4PJAF 1F3DJ 2AV7B 1GIGH 2BX5A 5FOBB 1CXIA 3EHBD 3IJYB 4X6BA 1CG9A 1EA9C 2AJ3B 3MRPA 5B21A 2PO6D 3T08A 5HJ3B 5D2LA 1NCDH 1FL3A 3ZSTA 1KCSH 3BD4A 4LVNC 4XHJD 3VD4A 2J5LB 4PLJD 2PTTB 3RWCA 1MFAH 1NGZB 1TFHA 5DVNA 2ESVE 1JCKA 2PTUA 4MJ4A 4AMKL 4G8EB 2DLFL 4Y4KD 1KEMH 5LBSL 2H6PB 4RSVA 5CBAB 3KYKL 2EC8A 1CTNA 2GSIB 4ZOAA 4G8IB 2YBRA 2YMXH 3CIQA 3LEXB 2FO4A 3DIFA 5F9WC 1RZGA 3PJSA 3O2DA 3LKOB 4UIMA 1XAUA 1WGOA 5JPNB 1QBBA 2AV1B 3F5WA 1Z5LB 1OWWA 2Q6WB 1MRCH 4KTEL 4P23D 4XBGA 1MVUA 4ERSL 3M45A 1QBMH 4U3XA 3CFEB 4P2RD 3IVKA 5DHVH 5E70A 5D1ZC 4NQEE 2VIRB 2Q20A 3V4VL 3BE1L 1T04B 2BFVL 1A6ZA 4YR6B 4BZ1L 2IEPA 4MQSB 3CFKB 4LFHG 2VRAA 4GKSA 4M7KL 4JRXE 3WYRA 2BP3A 4MDIB 1I9RH 4X9BA 4WEMB 5EZOH 2J7LA 2VDML 3F7YA 4U1NA 3WXWH 3MRMA 4RFEB 3V9FA 1LGVA 2X4PA 5T1MB 3BH9B 1W8NA 1BHGA 3GI8H 3TBYB 3TESA 3C09C 1ZVSB 2P5WA 2WUCH 1ZGLP 3M17B 4NO5A 1B0GB 2AJYL 5GRYA 1KB9J 3NIGF 4PJHA 4XC3H 4PPTA 4XNZB 1ZLUH 4XMKL 4DKEH 1KJ2A 4OQTH 3VXTB 2F5BL 5IR1B 3K2UL 3WLWC 5HGBA 2X4SB 2I27N 5HGAA 4NIKB 4K7FB 4NO2B 4I0PC 4YLQT 3RHWF 2GEEA 2EKSB 1RZJL 3TYGH 2VZVA 1X5YA 3NFSL 5B39B 1AGDA 5EU4A 4XCFL 1LE5B 4AEIL 1YMHA 1NAKL 4PREA 1K4DB 2NY4C 3OF6D 3TBVB 4OKVB 4JN2B 1FO0B 1EEZB 2X4NB 3DETC 2CR3A 5ACZA 4LGRB 4HKJB 1N26A 4S1QH 4GW1B 4XVUC 1S9KC 1HXMB 1T83A 4FQJL 1A7PH 1MWAA 1T21B 4IIQC 1NUGA 2A77L 1W72L 4HQQH 1KELL 2NY1C 5E6IA 4E42B 2OYPA 1FZJB 2CK0H 3C8DA 3O3EB 2ARJQ 4JGJA 1AQDA 1C16B 4G6ML 1X4ZA 2J4WL 5T33H 1BIHA 4HX1B 5C0CD 4OIIL 3O81A 5ID1A 1GPOL 1ORQA 4M93B 1UM4H 1HH6A 1QHOA 1JPTH 2UZIL 4Y16A 5J3HC 2DMCA 2EH8H 1CTOA 2GK2A 3AREB 2CLRA 2WQ8A 1Q1JL 4Z7NE 4G6KH 1D5MA 4EBQL 3T4YB 4D0CA 1J12A 1A6AB 5GRJH 1TTUA 1BGXH 1QEWA 1KB5B 1MFCL 3KS0J 3S7GA 1ZHLB 4KVNL 1EHLH 3X12B 1WBZA 3D3VA 3OKMB 1AC0A 1RFDL 5BV7L 3MA9H 3VI4F 3H9SA 3O45B 4GH7B 3VXSA 3MCLH 4GRLC 4YFLF 2R2EB 3LN9A 1UVQB 4V1DD 3D2UD 4XXCC 3FQTA 4J4PA 5J11C 2R1XB 2DKUA 3ZKXB 4UILL 5E8DL 3DXAE 2DM3A 3EJYD 3QSKB 4NQVA 5GSVB 2CMRL 4LMQI 1EFXB 4ZOBA 5FYLH 1OP3K 1M05B 2KUTA 3B9AA 4O5LH 3RU8L 4P3DB 4H0GA 3N85L 5HHPA 3BP7B 1INQB 3NBNA 2MCPH 3WHE1 4G7VL 1YPZE 4XMLH 1A1OB 1OSZB 2XTJB 3CFCH 3I3EA 4HKXA 3GM8A 2FIRT 2PKDA 2QSTA 1MLCA 5F9WB 1QVOB 3UO1L 5CJOL 1OTSD 2WP3T 4AIZB 5I18H 5DGRA 3HG1B 4P5MA 4LVOC 1G6VK 4GG6E 1WBYB 4PTTA 3MRKA 3T0VA 1NCBH 3STZA 1IQWH 1UH2A 3TWCL 3RL2A 1BVLB 2NY6D 5IG7B 2JLLA 1UG9A 3C2SA 5LGHH 5IJKC 1JI1A 1N4XL 4LPUA 4JG1L 2MTPA 2YD3A 4X6FB 5C0AB 4AEHH 3VD9A 5EH1A 1WK0A 3VU2A 4U0RC 5JHDE 2VZSA 2Q3AA 4BQ9A 2I9LA 4ONOA 1TETH 4JPVH 3DO7A 2H2SD 5FUCE 1HHGB 5BS0A 3DURB 1OAQL 3DWTA 3IU4H 3BZFA 2GT9A 4NGHL 4MXQC 5HHMB 1R3JB 3QUMB 3C09B 3U7WH 4WO4A 3EGSB 5C8JB 3D0LB 1YMMD 4L9LC 4M1GH 2IC2A 3R1GL 4N9GB 3W39B 1MRDH 1Q9OA 5MERB 1HSAA 2DTML 2FZ3A 1BZ9A 1N5AA 2UVFA 5FYKU 2VLKD 4MCYA 2B7DT 4MAUL 4GAGL 1QZ1A 2JIXB 3ES6A 5C0JB 3ALWA 3R0MA 5SWSA 3BZ4A 1N2RA 5I9QC 4U1JB 3BDYL 4ZFGH 3GSVA 4P5KB 1J5OL 1KIPA 3PWVA 2OR8A 3AS2A 1U91B 5LGKA 4LLVA 2ICEB 4J1UA 1BLNA 1JVKA 3BN9D 3LSOB 5JZ7C 4R6UA 5GS2D 3P30H 1MQKL 3CVHB 1KPRB 1CE6A 1YY8B 1T3FA 1IMHC 4KQ3H 4QRPD 6FABL 4DN3H 1VFAB 3ARWA 4JO4L 4A2MA 4NN5B 2W38A 3R4DA 2NY1B 4ZAKA 1AD0B 1U3HC 4LVHC 4ODUA 3MLWH 4MJIB 5D72L 2CR6A 2IADB 5DDHA 1P9MA 1BVKB 1G7HB 3IRPX 3QEQA 2BRQA 5CEXB 3FOMA 2RQ8A 1F90H 2VTFA 2ZUYA 3FQWA 4E41A 4LF3B 4XPTH 5LQBL 1MJJB 1I9EA 1P1ZA 2W59A 2CKBL 5DMKA 4L1DA 2YRPA 1NKRA 1IM3A 2MHAA 3EJZD 5DD1H 4LGSB 5AAMA 4NQSA 1UWXK 4JZJB 1CGVA 3NPSC 2YOCA 1NBVH 1G6RB 1JGVL 3VH8B 4FQ2L 1NL0L 3RWDB 3ARFD 5F3BB 1UB5A 12E8L 2AJXH 2OL3L 1NFDB 1GZPA 1V3JA 4C56B 1D5XB 1DEEB 5EU6D 1JPSH 4YNYB 3PXJA 2WLZA 5I6XB 1MPAH 2XA3A 3DX8A 4KY1L 4N8PA 4KZDL 4HUKB 3V5HB 5DYOB 4L4VD 5DHVA 4OCYH 2XN9A 4ZPVA 3B9KD 4P59H 4M02A 5GGUA 1T1YA 1CFVL 1BZ7B 3QXWA 3SJVD 5EDXA 3ROLB 4I3RL 4F7TB 4RAHA 5IVZB 4M5ZH 4FABH 3C6LC 4JM4H 4JO1H 4OJFH 1CZ8L 3MLRH 1OWRM 3TNMB 1A6TA 1K3ZA 3VRIA 4OQ1A 3VGEA 3CZFB 1QFPA 4JKMA 3WNOA 5EO1B 3OXSA 1HIMH 2VLMD 4FQHA 1FRGH 2CDEA 4YDJB 5GRWA 1F3DH 3FN9A 4PJEE 4JHWL 3W9DA 3PGDA 2LE9A 4CMMB 1SEQL 3HZMB 3LAFA 3CFIC 4F7EA 4F7MB 2CDFA 3T0WA 5KS9E 2X4QB 4OQTA 3O4LA 4ODSH 1G9MH 5AG9A 1I7ZA 4ZODA 3P9LA 1LO5A 2R8SL 4HK0B 4XRCB 2GJ6A 1FFOB 3KYKH 5IHBA 5DMJB 2JJWA 5ICZB 4EN3D 5T1LD 3B5GA 4GMSL 4D9LL 3MR9A 3DX7B 1TDQA 3MJ9L 4HLZG 3GMQA 5TQ0L 2YHGA 1NLDL 3MGOA 2P5EB 3ARDC 5SWZA 3VXRB 5DZLA 1IAOB 1U8PA 4KRPC 2K1MA 2IFFH 4X6EA 1FAKT 4ERSH 4U6YA 1I9IH 1TJGL 3WHXB 3FN0L 3VXME 3QI9C 4TOYL 1FZMA 3V4VH 3SKMB 2VZOA 3LEYH 1NEZB 3RNKB 2CRMA 3ZDZE 5FYKL 2OTWB 3OKKA 4NJAL 2XWBB 1UADC 1HSBA 4L8DA 2MJWA 4R2GB 1Y6MR 4FN0A 5I9QB 4JHZA 2HT2D 4Z0XA 4HF5H 4LPXA 2VQ1B 4I48B 3S3SA 1QA9B 1R5WA 3K8LA 4PRHE 3ULUH 1QSFE 3FB7B 1D9KD 1RQ5A 2VITB 5EG6C 3W0WE 3ZSSA 1S8DB 2BSSB 3VFPB 2MQ0A 5EU3B 3C2AL 2ESVD 3BGAA 5ICXA 4MWFB 3JWOC 3RGVD 2ORBL 2F5BH 1XGUB 2EIDA 5HYJA 4YFEA 2E9IA 5KVEH 1IKFL 3MRGA 2P8PB 1RZJH 2N7BA 1QFHA 3FT2B 5TDNA 1HEZB 1OTTD 3BW9B 4AEIH 1TZIA 3QXDB 2QLVB 1RU9H 4PGEB 2FEDD 3SGKA 1RK0B 4P2QB 2G75B 5T1DL 3GJEB 3BP6A 4U6XA 2IALB 3TJEH 3NH7H 1SBSL 1SYSA 4PJEF 4BH8B 2PYEB 3G08A 4MYWB 1WTGT 5IB2B 1KELH 2FB4L 3O3AB 3QR2A 3LKSB 3K0WA 1T66C 4YPGA 1EPFA 3O6ML 3ZT6A 3FQRB 3RQ3A 4LHUA 4JRXD 1KT2A 2ZOKB 3B2UC 5BZWB 5KS9F 3HUJA 3SO5A 3WDIA 1DN0A 3O2WL 1XGQB 1T2JA 1MRFL 1BX2B 2DI7A 1KLFA 3W2DL 3ABZA 5E94A 1AGFA 2ED7A 3HE6B 4GRMA 2ZCLH 4LEXH 4LIQL 4NNPL 3R06B 1AXTH 3JV0A 4Q6YA 3F6LA 1GC1L 5E6YA 5JOFA 3T1FA 4YFDB 1Q1JH 3RIFF 2HT3C 4XNUH 3D85A 3IF1B 1KIUA 4EBQH 2EC9T 1ND0B 2BNQE 2BHUA 1CXLA 2IH3A 3BQUD 3RWFB 3KS0H 3C6LB 3L3IA 2FLRT 5BV7H 2VQTA 1U8LB 2AK4A 2N7AA 2J8HA 1EO7A 3GIVA 3D9AL 3AS1A 5I16B 4DGYL 5F1NA 5GS1A 1I85C 4RCAA 5FGRA 2IBBA 5HSFA 4XNXH 5TFSH 5CGYC 5I1CL 4N8VG 2CMRH 3BSZL 5L8KB 2ADJA 2VB5A 5E2TH 4ELME 4N1HB 2YSSA 3RU8H 4QXUH 3C9NA 1CQKA 2V5TA 5ID0B 3NAAH 4JEGB 4FQLL 4AL8L 1LNUA 4K7PL 4ZUVB 1I1AA 3LQMA 4WW1A 4XVTH 5B4MD 4I18C 4XZUA 3TM6A 1D5ZA 1W72B 3LHPL 2N1KA 4K3EH 5L2KA 4OV5B 3KPOA 2MQCA 5FV2A 3WNKA 1HQ4A 1K5NB 4HS3B 2FWOB 1IC1A 1ONQA 3BP5A 2H8PA 2ADFL 4JZNB 4KTDL 3QA3B 4RIRB 5C7XL 1N4XH 1T03L 3MREB 3QCTH 2W9DL 5I17B 1OTUD 5AAWA 2W92A 3CNKA 1QKZH 3DMMD 4LHQB 4DKAA 5E08L 4LSDA 3OHXB 4HXAL 2PCPA 4HWEH 5EUKA 4U0QB 2A6KA 4K94L 3L95B 3HNVL 2OP4L 1UJ3B 4O51B 3DXAD 3HI6L 4ISVB 4NGHH 4H25B 1I8IB 4BJLA 1B0RA 1BAFL 5JIKA 3RTQA 3S5LG 4I2XE 4PG9B 4YEEA 3QXAA 1NGQL 5FA4A 2DMBA 2ZPKH 1R6VA 2HJFB 5GRXG 3KJ6H 4XP6L 5D2NB 1JGLL 3KPSA 4LQ1A 3MRLA 3BJ91 1JF5A 1NBYB 1HHIA 4GAGH 4FFYL 5D7IB 3THMH 4LCWE 1CD8A 2Q8BL 1FE8L 2VMFA 1FGVH 2DIBA 3BPLC 3SE8L 1P7KB 1J5OH 3T3ME 1HKLL 1N6UA 2ZUXA 2ZNXA 3IETA 4KFZC 5HDBF 2J88L 4BQ8A 2FJFB 1MQKH 4X7SL 1OGAE 3SKOB 3TIEA 1JGEB 5D5ME 1U92A 5DRXA 3K81A 3GSUB 4QRTB 3WE6B 5I15H 4QY8A 2X4OB 5DVLA 2IQ9L 3UBXI 4KQ4L 3BKJL 1EHNA 4H8WH 3BEVB 4F9LA 2DQJL 1K8DB 4XI5D 4U1KA 5D72H 2Z9TA 3LQAC 1MUJA 4JRYB 1ZLSH 3UX9B 4OCXH 5HBBA 5L6YH 1MCKA 2ICCA 3RWIA 4YK4C 3S37L 1YC7A 3ARGD 4PGCB 3QEGL 4HKZA 3SDDD 4UIKL 1VKXB 3PP3H 5F21B 5CP3H 1HI6A 2ED9A 3SPVA 4FXGB 4L1HA 3RWGB 4OD3H 2FECL 2QADD 5GZNC 2AJVL 2PXYD 4M7JH 1K2DB 1JGVH 3VJ6B 1LO2L 4YE4L 5HHOE 3U46B 3VWJB 4OZIA 12E8H 3L3HB 2OL3H 4HDIB 1PG7L 5D9SB 4O2FA 4QOKD 3VRJA 3JWDC 1HYRC 2EEAA 2AP2A 3L3DB 3MOQA 3QG6A 4ZUTB 4YDLB 1MI5E 5FGCB 1Y18A 5JQHC 1CXFA 2R9HD 4Y0GA 3G6JF 3TT1H 4L8CB 1Z0MA 4NPYB 2H3NA 2YK1H 3HLAB 2R29L 5E56A 1CFVH 1QRKA 1RUMH 1DE4A 4X98B 4APQD 4HC1L 4E5XB 1LEIB 1MJ7H 4Q7DA 2NY3C 4I3RH 5C3TA 3PIQA 1KBGL 4XPHL 4YHKL 3PGFL 1CZ8H 2IGFL 4CW1B 4Y1AA 5EB9A 1KTRL 1KNOB 2QQNH 4UAOC 2CH8A 4NQCA 1JUFA 4EUPB 1KCRL 1U41A 2HLAA 3GSQB 5E8NA 4ODVL 2B8OT 4J3XA 3A6CL 5I8KH 3RJQB 1ZWIB 1T83C 4GAJH 4KAQL 4J6RH 4JHWH 3MYZA 4GW4B 4NQXA 1CGWA 4FQXD 1UWEL 4HS8H 1OOAA 4QHNB 4XCYB 2EDOA 3CFJB 5E6IC 5IB4A 1DL7H 3T65B 1S9XA 3C6SA 3V6BR 3UPRB 1YJDH 5MP6H 4RZCB 3T3MF 4U1MB 5T3ZH 1J18A 2AJUL 2WINA 2ICES 3IFOB 4D3CH 4MA3B 4AT6B 2IAMD 2CUMA 4Y16C 3FB8B 1DTUA 4CN6A 4TSCH 2X4TA 1HQRB 4WHYG 2V5MA 3DTXB 4RMRA 4JDVA 2EE3A 1S7RA 1S7XB 5IOPA 5E8OA 5C0FA 5HHXH 5FV1L 1BMGA 3U0PA 1S7UA 4RQQA 3FN0H 3P0VL 4ORGB 1E0OB 1EBPA 2MNUA 4LLMA 4JZOB 3MLUL 2QQKL 1SVZA 4J4PC 5DI8A 4UQ3A 4WUUA 4Y4HA 3HNSH 1JZ3A 3MRPB 4K3JH 5GZOD 3KHOA 2Z4QA 1TJIL 3CX5K 2D7TL 4MB3A 4ZDHA 4WENB 4WU5B 4H1LG 4PG2A 1T2QL 2DBLL 1VADB 2CLVA 3VG0L 4QYOB 3NCBB 1BFOA 2IBGA 4GW5A 4OF3A 1PLGL 1WCQA 5FF6B 2A0LC 1GGUA 3QIBA 4ZFOL 2X10A 4NKIH 4Q74A 3FO2A 3L3GA 4M7LL 5DRZB 2ORBH 1IEAB 2FO4B 3DIFB 3KPNA 5EC2B 3QZWA 3PJSB 1JPGA 5DTFA 2JK5B 4W70A 4UIMB 2Z8VC 2XKNA 4YBLB 2KBGA 3MV9A 2CRIA 3VFVA 2EDFA 1FNGA 4Q9QH 1Q9KA 1KXVC 4M8QA 1FAIH 5E8EA 3GSWB 4PS4L 3I6KB 4XBGB 1MVUB 3JV4B 3WKMH 1YY9C 4IMKA 4NO0B 3RZCA 4P46D 1PD6A 4NKMA 2X44D 5EBMA 43C9B 5FB8A 4NQDE 1T22A 3FO1A 3GBNH 2APTA 4YXKL 2D3VA 3SCMD 3VXMD 4NQTA 4P3WA 1GOGA 3K3QA 5IW1A 5TPWL 3OGCB 4U1GB 3WFEL 2BSTA 3N06B 2EDRA 3MRMB 4ENED 3TZVD 1JZ4A 5CZXD 2DM7A 3C5ZD 2EDWA 4U05A 2DQHH 3BWAA 3U1SL 4WO4C 1MCOL 3W9EB 1A6WH 4I5BA 4XP5L 2ZOLA 1QSFD 1JF1A 2DYPA 1CR9H 2NX5E 4PJHB 4PJDE 3QEHA 5IBUG 1S5HB 1S7VA 3H3BC 1JYVA 2E6QA 4M00A 4J2XA 4X80H 5FAAA 5HGAB 5L7XH 1C7SA 1A02N 4N0UE 1Z9OA 2NY3B 1NGYA 43CAB 3H9HA 3UYRL 4GKNB 1J0KA 2ZKHH 1JNHB 2VL5B 3UZEA 2NXYC 2XA8L 4PREB 5CLWA 3MLTA 1JHTA 1XF3A 1UYWH 5DMYA 4IOFD 2ZUWA 2B1HL 4JHBA 8FABB 4PP2A 4OZFH 1QRNB 3KYNB 3D87B 3AM8C 3RVWC 1MWAB 1DQLL 4KUCF 5GJSL 4ZAKC 5IW3A 3IDJA 3Q6FA 3BSZH 3QDJE 3LDBC 3BPCB 2AJSL 3MV7E 2MCG1 1P9MC 5IF0A 3P4NA 3LRSA 1ZVHA 1Q9LB 4AL8H 4FQLH 4HS6A 1ORQB 5A2LH 3TO4D 3O3DB 3GMRA 1HH6B 4JB9H 3KXFD 4AH2A 5IGXL 1OARH 4XP1L 2EO9A 1MCWM 3ILPA 3VDAA 4JFYA 1EH9A 2ATKA 3LKQA 2CLRB 1L9NA 5KTEH 3VFTB 4FFWC 3EOAA 1U42A 5CD5D 5EOQL 2N4IA 3MLSH 4HWZA 1QEWB 2UYLA 4G9FD 3I84A 4RNRA 4WW2F 5F9JB 3FFCA 1NKOA 2BNQD 1UFUA 3PP3K 3SDXB 5C7XH 3VXSB 4GXVL 3U4EA 1T03H 4GAYA 4OCRH 3EYSH 2VDQL 5F3HA 3V7MA 4TTGA 3DVFA 5TDPB 4HG4K 2FHCA 3QP3A 4L8SC 4JFFE 3QIWD 4ODXA 3PG2A 1CYGA 1TVHA 5ADOH 1OT2A 1KN4L 2IFGA 2FATH 2VABA 3MYJA 5TJWK 3LPGA 3PWUA 4IRSC 4EKXA 5CP3A 4MAYD 3SO3C 3DV6A 3VGHA 3HI6H 5DO2D 3WNPA 3OBAA 5IVOA 2G9HA 5HHPB 1ES0A 1P7QD 1N7ML 1NGQH 3MROA 1U95A 4ZUSA 5IHUL 3VFSB 1OPGL 4EI6A 1M1SA 1A9EA 1BP3B 1JN6B 4MA1C 2CDGB 3GSOA 5CUSL 4PJDF 5FDWB 5IESH 2VUYA 3V5KA 4OLZL 3VGAB 4S2SB 1MELA 3TBWA 2R4SH 3QXTA 2Q8BH 1A6PA 2DIAA 3OG4B 4P5MB 5DD0L 2Y6SD 3IDYB 3QUYB 2W1NA 2CPCA 2FHBA 5FA3A 1V7NL 4YUEL 2J88H 2D31A 2GTZB 1FFNA 4YFLI 3HKFA 1W0VB 4PGDA 2RJMA 3QT2A 1CXHA 1ZSDB 1F2QA 2I9LB 3HR6A 4G6FB 4KQ4H 2IPKB 4YQXH 4PB9L 1MIMH 5D93B 4GBXA 4WI2A 5KN5A 2APFA 4HH9B 5GGVY 5BS0B 2R56L 3PL6A 1NGWA 3HC0A 3MBED 2IQAA 3QG7H 5FEBA 4YC2C 4V2CB 5IW6A 4DKFH 4V2BA 2B0SL 1EHXA 4LKXA 3MMEA 2OBGA 1HHKA 5EC1B 1Q9OB 1VESA 1WIOA 5E1AA 3MC0A 1A7BA 1AD9B 5KJRH 2FYYB 1N0XH 3ES6B 2AJVH 5J1TC 1S7WA 4YIQA 5SWSB 1LO2H 1N2RB 3VMOA 1NAMH 2CK2A 5CEYB 2NXYB 4DTGL 3ALXA 2NW2A 3OKDB 4LCWD 4I77L 4J1UB 4LLVB 4MD0B 5H35A 3WFHB 4DOHE 3L5JA 1GZQB 1CE6B 1UM5L 4PRNA 2QQLH 4X4ZA 4GMTH 1AXSA 4JFQB 1JMXA 4MXWL 4GRWF 2E6JA 5EO0B 4P0DA 2F19L 5HDOA 3WUZA 1BZQK 3CMOL 4OFKA 3IFPB 1SMAA 4ZAKB 4FP8L 4YAQA 4Z95L 5IFJB 2FHFA 4XC1L 4HC1H 4TNVK 4HGKC 4LKCB 1YEFL 2DQCL 1JGDA 3HZYA 5DVMA 1A1MB 5DDHB 1KBGH 5C9KA 4KRNA 1HK6A 4EIGB 2OJEB 3F7PC 4NRXA 3AB0C 1MCBA 2R0WH 3SGKC 1I1FA 1JWUB 3FQWB 2WWMC 1KCRH 4PJCF 3RY6A 4CJ1A 3EO1B 1J1XH 4O58L 5I1GH 4PJFA 1VENA 1KG0B 5DMKB 3A6CH 1FG2A 4KAQH 4CVUA 2DJSA 2GJZB 1HYSD 2NY7H 3UTSD 3HI5L 1UQSA 5AZ2L 5C2BL 3QHFH 5CLTA 5HI4D 3QH3B 4KROC 3LH2H 1UB5B 4RWHA 2H1PH 3HN3A 3BEWB 1U8MA 2OLDA 1OD7A 5FIEA 2VSDA 1ZXQA 3HFMH 3O6KH 4B0MM 5AG8A 2HMID 3GGWB 3EUUA 3H3PL 3DX8B 4EEEA 1EUUA 1S5IH 3EYFA 4YHML 3KYMA 4ACPA 1IGCL 2XN9B 3MBXL 3QCVL 4ZPVB 4JLRB 1NC4B 4X5XA 2VR5A 1T1YB 3ZKSD 4WTZA 2B39A 1CN4A 1CGSL 2O5YH 1IGJA 4BQBA 3MNVA 2HKFH 4XNQB 3T77A 2GSGB 2HFEA 5GS1C 4HCRL 1U58A 2ATPA 4NWTL 1I3UA 4NM8L 5TQ2H 4KH2A 5DK3A 3W9DB 5C6TH 2E7CA 1OF2A 5ITBH 4F7EB 2CDFB 2VLJE 4JFEE 4XNYH 3BKMH 4L4TD 1PAMA 1T2QH 2DBLH 3OAZK 1CICA 1NMAL 4PRDA 3AAZB 2VL4A 5F97E 5KVGH 3VG0H 1NCWL 3VMPA 2YPLD 2NY2C 3U9PH 4OLWL 1TPXB 2OXGA 4HJJH 4NO3B 1PLGH 1UKSA 2GJ6B 1AGCA 1UH3A 2FR4B 2Z31A 1I1AC 1ZT7A 5DHXB 1XIWA 4M7LH 4CNIB 3L5HA 3MR9B 3U2SA 3O9WD 4NNYA 4M43H 5ETUB 1KLGA 2E9BA 1EZVY 4KZEL 4UINH 1U8PB 4OZFA 1BM3L 5C09A 4Z7UA 4U7MA 2Y9RT 5GGQL 3QFJA 5BQ7A 5CSZB 1CDCA 4N0CC 3S35X 1FNAA 1X6NA 2F5AH 3JVGA 3WFCH 2UWEA 3KR3H 4PD4K 2V7HA 3HNTL 5DJDB 4IOIA 1UGNA 3Q6GL 1QPPA 3RNQA 1J0ZA 4P49A 2J6EA 3AROA 4MGXA 3TIDB 4ALAH 1WWBX 3ZTJH 3WFEH 1QFOA 1IZJA 4EQ3A 5L8JB 4L8DB 2CRZA 2NTSP 2V9RA 2NY0C 3BGFB 5GS2H 4MB4A 2BVQA 4OZGE 5GRVL 3WIFA 4S1DC 4KUCD 5D7LD 2FL5B 3RTQC 4ZYKA 3C5SA 5E4IA 25C8H 4PJGA 4NKQB 4OGXH 4WI9A 1DLFH 3NFNA 1U8JA 4YGAB 2NCMA 4M6NL 2DF3A 3MNWA 3RX8A 4XP9L 32C2B 3L5WB 1P69B 3ULVE 4WGWB 1OM3L 3VCLA 3H6JA 1CFSB 3QWOB 3O8XA 1R24B 4UUJA 3MRIA 4ZS6D 4QRSA 5J6HA 3MRGB 2XQBL 5I1LA 3LD8C 1Q0XL 2BJML 2VC2L 1TZIB 2XA8H 4ZXBC 5I76A 2H26B 3I6GB 5F7YC 3BVNB 2Y5EA 3PV6A 5JW4M 4JHAL 3ZL4H 1JGUL 2XWTB 3ARPA 4ZFOB 4M4RA 1F8TL 1N64L 2B4CH 2IANA 3AXLA 3EW3B 3PDDA 5ICYA 2AGJH 1A0QL 1CIUA 1YDPA 2X70A 2BCKA 1F4XH 4F9LC 2NTFB 5DK2A 4KPHL 3Q5OA 1X5JA 4LHUB 4KROB 2AJSH 3P0GB 5C6PB 4PLKC 5DJ8B 2GI7A 4N0FB 3RBGA 1WV7T 4P2RA 4MDJB 2RIKA 3HG1E 5JR1H 3TN0D 3LV3B 5E94B 1AGFB 1RJZA 1KPUA 5DJXA 5E2WH 3TVMA 4LQFH 1G9MC 1L6ZA 4JO2L 3T1FB 3GMNB 1LDPL 3D85B 5C3LD 4RGNB 5C0AE 3HC3L 3GJFB 4M4PA 4XPGH 5HPMA 4KJWC 5DJ0A 4G8FA 1HH9B 5GQBA 3MLPA 1QPXA 3HE7D 4FQ1L 3L3IB 4GXVH 4LU5L 4F58L 4TUKL 2JCCB 1FORL 3S98A 1YUHB 4JANA 5GS1B 3VXNB 4OV6F 1F00I 2F53A 5C71A 2BRRH 3VDCA 1OHQA 3LKRA 5DFTA 4J3UA 2AEPH 2ZUQB 2DQIH 4HD9A 2VDKH 5I74C 3MXVL 4A2LA 2AABL 3L5XH 1GGBL 1EERB 2HLFC 2EXWC 2YSSB 1DBKL 1MF2L 3PDOA 3C9NB 3QNYA 2E5EA 4Y2DB 4C59B 2YD4A 3OF6A 3QDJD 2YZ8A 5E5MA 3BXNA 5GSRA 7FABH 1OSPL 1LNUB 1RHFA 3LZFL 1NAMA 2XWJA 3FOLA 2JB6A 5IHUH 3ULVF 1I1AB 1K9TA 3ULUC 3H7BA 1JWSA 2IWGA 1D5ZB 3N1PC 1VDGA 1IQDB 1JRHI 1RZIB 2B5IC 5L2KB 3KPOB 3GSNB 4OLZH 4ESKA 3OKLA 2HH0H 3UBXA 3ZLQC 3RVTD 4MCZA 2DN7A 5DZNA 3BP5B 2H8PB 2JB5L 3MRNA 3IDUA 1YEKL 4FXKA 5C0CA 4H5SB 5KSVA 1A4JB 4KI1A 4YUEH 4DWHA 1F13A 1CLYL 1B4RA 1RZJC 4BQ6A 5CJ5A 4JG0L 3REVB 4I3SL 4QHUB 2PCPB 4RRPA 5ACLA 4PB9H 1UCTA 1IGMH 1I3GH 3KPRD 5ABDE 5FK9A 3ARBD 4O2EA 4DK6A 1YEEH 4Z7VA 1M7XA 3IKKA 3OTTA 4EVNA 2BY1A 2M26A 3HI1B 3CCHA 1B0RB 3QDMB 3QRGH 2BNRD 4RFNB 1J88A 2R2HB 3ECBA 5CSBA 4V1DA 1BQHA 3D2UA 4KGLA 3FRUA 5IVXA 3DHJA 1NFDE 2FX7H 1JRHL 4C56E 4G9DB 1K8IA 5GGTH 3NIDE 3QIUA 5ERWB 2R15A 4PYGA 3FMGL 1YEIL 4M48H 3SOBL 4HT1H 4Y4HC 1E28A 5EZIL 1ACZA 3KG5A 5DD6A 3QO1B 4FQQB 4K3DL 2KQNA 3HZKB 5BRZD 3T3PE 2OS7A 2A6IA 2V9TA 4MQXD 1PQZA 5JHLH 4PG2C 5DRWA 1VGKB 1O0VA 2R4RL 1IGIL 1JPST 1MCPH 1ITCA 1C12A 3C8HA 2LTQC 3KLAB 3TIEB 5FUOH 5DRXB 1R3HA 2IMNA 3BOVA 4MXWH 5BV7C 3QIBC 5HHQB 1FSKB 3JV6A 4PGBA 4QY8B 5KZCD 3CMOH 5E9DD 4NBYB 4HJ0D 4Z95H 5K59E 4YHNA 5A2JH 2HFFA 4OZHB 4UDUA 1NCAH 1TJHL 1MUJB 4QGYA 5L2JA 1YNKL 2BOBA 1XR8B 4IMKC 4LK4A 4UQ2A 1XR9B 3RWIB 3PGCB 3QULB 2WWKO 2Y5TA 3RZCC 4NJ9H 5BXFA 4HKZB 1YN6A 2KL6A 1F4AA 1E4JA 3VH8G 4ZTPL 5IMOA 3QNZB 1IAMA 5DLMH 3SGJC 3JBG7 1OP5H 4OI7A 5CGMA 1KXQE 4NHCH 4LLYB 3FO9B 4KWUA 3UAJD 2P5EE 4OZIB 2WAHA 1CBVL 2BVPA 1CGUA 4O2FB 2DQEL 3JTTA 3ZTNL 1PDKA 3VRJB 1H0DB 4LSVL 4PJXE 3HPJA 3H3PH 1CQYA 5FGBA 4Y8DC 5JW5A 4IHOB 2VLKA 4L3AA 4I9WE 1IGCH 3MBXH 2H3NB 1QD0A 2F58H 4UB0L 3P2TA 4Y19D 3GBML 4PJ8B 4S1SH 3MRDA 5D71H 1FZOA 4PBVC 1T80A 4NQEB 1ZA6A 1R0AL 4RWYL 5FYJH 4Y5XB 3LMJH 5GGRY 1H3TA 5I1EL 1VERA 4NQCB 3ILQC 4KKLC 3UTZB 1NFDF 1V3LA 4QRPA 5E8NB 5ELIA 3VXUE 2RFXA 1QR4A 2HYMA 4M6AA 4KMTL 1Q94B 4NWTH 3TA3B 1V05A 5KAQG 4NRZA 4NBZB 2BSRA 1T7XA 2OQJA 2VWEC 3RVXC 5I75C 1S9XB 2P8MA 1Q8MA 3T3PF 3RVUD 3ZDXE 5IIEA 1F4YH 4L29A 1RMFH 1NMAH 3B4NA 3CLFL 4CADA 1NCWH 4PRBA 4JCLA 3DRTA 4M1DH 2WINB 4OLWH 2P43B 1BOYA 5C0IA 5IJVB 1HOCA 4NYLA 1JTOA 1AIFA 2UUDH 4KJPD 3BIKB 4KMLB 5F96L 3DYPA 5JORA 5D1QB 3OX8A 3N9GL 1Z3GL 3GKWL 1D6EA 3X13B 4PJAA 3OL2A 3WXVL 2CO6B 1KC5H 4OCWL 2BY2A 2PYEE 5ECJE 2HRLA 3LB6D 4KC3B 1YYML 3ARFA 4OFYD 1UENA 3CLEH 4W68A 1DN2A 5JOPE 4H26A 4H8WC 5EU6A 1S7UB 4HH8A 2Z8WC 2VXUL 2BXYA 2WNGA 3T8XA 5KAQF 4JDTL 2G5BA 2LABA 4IMLA 1W2KT 4MA8H 4WUUB 3F6IA 3FQXA 4L4VA 4JDZA 4Y4HB 3UC0H 2ITCB 3K8KA 1M7DA 3B9KA 1EMTH 2Z4QB 5B3JE 5EO9B 1JHLL 2ZCHH 3G6AB 4U6VL 3SJVA 1MHEB 5IB5B 1J1OH 4ZDHB 2C3VB 3GRWH 5A2IH 4OCMC 1WCBA 4LLAA 1BFOB 5DQJB 4RISL 3IGAB 1F4WL 1IKNA 1RIUL 3QIBB 4NKDA 3BDXA 1S7SA 3UCRA 1G7PA 1MH5A 5DTFB 5EFIA 3IXAB 3MV9B 2WANA 5TE7H 2D4FA 2XQBH 4G3YH 5E8EB 1R5VA 1Q0XH 2VLRA 2BJMH 2ZUUA 2Q7YA 1T5XB 1B0WA 3CD4A 3U48A 3F12A 3RZCB 4Z5RB 2AVGA 2R0LH 4HGMA 3VE0A 3ARXA 3IDXH 4W81A 5FDYA 3GEWB 2A38A 1F8TH 1T22B 4QLRA 5T1LA 3RHWK 4HUVB 1KEGL 2HJLA 4HHAB 4LRNL 3I50H 4NC2B 1FPTL 4GBXC 2BSTB 5J89A 3KLDA 5D96C 2HFTA 1ZHBA 1J1PL 3QQNA 4MVBC 1FFPA 1YPZB 3KWWA 4OLXL 3ARED 3BWAB 3T0XA 2GFBA 1KF9B 5HDQH 4I5BB 4F8TA 1YJDC 2UVEA 4LSTL 3STLB 3VW3H 4JO2H 3RX5A 3DUSA 1FJ1A 3QEHB 1S7VB 1UJTA 4FTVA 1KFAL 3L3OA 5K9OA 3ULVD 4GG6B 1DEDA 3HC3H 1A7OH 4ZNCD 3HR5B 2LAGB 2P24A 1TMCB 1D9KA 1RHHB 5GGSB 4P4KA 3BRFA 4LPYA 4WI4A 5LCVH 4F58H 4MNQA 3QUXB 5JHDB 2BOCB 2ESVA 1EFXD 2HFGH 3RGVA 1CF8L 3LEVL 2FSEA 4HZAA 3UJTH 4LAQH 3L3KB 1UA6H 2G2RB 3MXVH 3IDJB 4LSPH 4EI5A 4UMGA 5GGTA 2AABH 3TH4T 2AXHA 4QNPE 2XTJD 5D6DA 1MF2H 2HA1A 5IF0B 5E2VH 2H32B 5JMOC 1F3RB 4ETQB 2AS5M 1NDGA 4HLZH 3MODH 4KKAD 3QQ3A 3U30B 3MUJA 4HPYL 1JZ2A 4R4NC 4KJQC 3RY6C 4CU6A 3HG1D 1L7TH 3JTSA 4JFYB 2ATKB 3LKQB 4XBEL 3KAAA 4NSKB 3EOAB 5FO7B 4F9PC 1PSKL 5HHNB 1XF4B 2VISB 1YEGL 2AEQL 4HWZB 1H3GA 4JRXA 1HHJA 5C0AD 4JY4A 4RNRB 4ZQKA 4U2ZA 2R1WB 3FB5A 5IEHA 1BQUA 4RFOL 2HN7A 4WDIA 2Y7QA 4JRYE 3EDFA 1I8KB 4PY8I 3JUYA 5CINL 1DQDH 4I3SH 4NQUA 1IAII 1TVBA 5HHMD 1QACA 2W9EL 3HB3C 2VDNL 1B4JL 1TCRA 4LCIL 3NCJL 3S4SG 3S88L 3BQUA 4MZ3A 1I3RA 1XF1A 3NFPA 4K07A 3GO1L 1ZOXA 1PKQE 1DJSA 2X4RB 4R0LB 1KACB 2QR0B 3Q2CA 3QCUL 4DN4L 1DVFB 4DUXA 2JIXD 4NHUA 1DDHA 5ITFB 1U95B 3QYCA 4ZUSB 5DK0A 1U3JA 1A9EB 4KK5C 2GKIA 3EZJB 1FNLA 3V0VA 1VPOL 2X9WA 4K9EL 5FGCE 1IGYA 5IBTH 4ZO6A 2EICA 4NNXA 3MRJA 5D4QA 1AKJB 1MCCA 1Q72L 5DQ9A 4HK3N 3UJIH 5FA3B 1CICC 2R4RH 3UJJL 5DD5H 3L5IA 4PB0H 3DRQB 2Z8RA 2EYSA 2D31B 1IAIL 2NY1D 5KOMC 4MJID 3VWKD 2Z31C 3RUGE 4PGDB 3ZHLA 4OCNC 2F74B 1H3PH 5F9DC 1XIWC 3N1FC 1RZ8A 2JJUA 2VERN 1T1WB 2NXZB 2YD5A 3VFUA 1FLRH 2VR9A 2DQDL 4MSWA 5DSCA 4MXVE 4GBXB 3QQ4A 4L3EB 3PL6B 4YHOL 4RGMB 3HC0B 2IQAB 4JFXA 1A1NA 3FJTA 5D7IF 1ED3B 1TJHH 2QEJA 3OJDA 1S7QA 2UUDK 2J2ZA 4N68A 5IW6B 2X1WL 5D7JB 3MMEB 1FGNL 5F1OB 2HG5B 1HHKB 3JVGC 3MCG1 3KPLA 5T5FL 3DMMA 3LN4A 1D6VH 3IFNH 4BA8A 4NKOB 3WCYA 3AGVA 5FHBH 5HI3C 3SY0A 5DC4B 5C07A 3EYQD 3U36B 4OT1H 4C56D 2D0FA 1F02I 4P9HL 5EPMA 1QSEB 5DMIH 5DVOA 1S7WB 4YIQB 3WEXB 2RHEA 1NBQA 5EOCL 2IF7A 5LWYH 1CBVH 3OZ9H 2DQEH 1MCEA 1MLBA 1AH1A 1MSPA 1KCUL 5AYQA 4PRIE 3EHBC 4UT7H 4PP1D 1EV2E 3NN8A 1IC4L 2PO6C 4TUOA 3BGMA 3GMOA 3O8XC 4PJBA 5GRVK 4YAQB 4GXUM 2ZWLT 4FZEL 3ZE1E 4XHJC 3OXRA 3HZYB 5AZEL 4PLJC 2W0FA 2D7MA 2OR7A 1H3XA 3PWLA 4RWYH 4NRXB 3ISWA 1PG7W 4IJ3C 4Y5VB 4F15C 2BHZA 3RKPA 5I1EH 1MHPL 1PFCA 3GRWA 4TSBL 5DJ6A 2YRLA 1FG2B 1UXWA 4CVWA 2Y4SA 1ZS8A 4NFBA 4OF6A 1J0IA 1ETZA 3BDBA 1NDMA 4LSRH 1RJYB 4PRHB 4R9HA 3KPQA 5C0ND 4PRPA 1KTDA 3W0WB 1U8MB 3CLFH 3S6CA 3LRGA 5IWLA 5EBWB 4DEPB 5M7QA 3NZHL 3SDDA 4M3KB 4U1LA 5TDOA 3VXRD 1FDLH 5F96H 4AZ8A 3IJHB 1FYHB 4ZOEA 5BZDA 4ZMAT 3N9GH 3MOBL 4HWNA 5I1IH 1JHKH 4WRLA 4FNLH 2PXYA 3WNMA 1A3LH 2AI0L 5I1JL 5HYSB 4JFOA 1YYMH 4U1SA 1BBDL 4UOJA 4F7CA 2FX9H 2ZCKL 2OK0H 2VLLA 3P9MA 4QOKA 1A9BA 1OQOA 3WIHL 1DANT 4MX7A 1RJLA 4KDTA 2HFEB 5MENA 4R2GD 2P5WE 4JDTH 2CIIA 1E6JL 5E4EC 2KH2B 4WUKH 2Q76A 4PJHE 5CHNA 2CSPA 1QLEL 1OF2B 1XF2A 1AGBA 3P4LA 1QNZH 5GHWL 1CFTB 1RUPL 4KRMB 5DEGA 4CJ0A 2BVTA 1DUZA 4D8PA 4GUPA 5IROA 3TV3L 3X17A 3MLXL 3NTCL 2Z31B 4OLYL 4P57B 1ZT7B 4LEOA 1XIWB 5IQ7H 4NCDA 3DGCR 4FQXA 1SY6L 1BF2A 3VD7A 5E24E 3QRFM 1X44A 4S1RH 1VSCA 4P2QD 1QRNE 3A0OA 5H37H 3ZE1F 3WFBH 1WLHA 4OZFB 4I13B 5C09B 3FZUD 4Z7UB 3SHSA 3FO0L 1MCNA 3QFJB 1LO0H 1U9KA 3HZVA 4HJGA 5ISZA 5KSAB 5D6CA 3VFOA 4JVUA 1KCVL 2PYED 2V5SA 2IAMA 1KJVA 3MRCA 4XBPA 1AR2A 4BM7A 2VXSL 4MD4A 5DWUH 3CC5A 4UTBL 4IOIB 1ZHNA 5HGDA 1V7MH 3RBSA 4JPIB 5KG9A 3BIBX 1BQLL 1FPTH 4LLQA 5DF0A 3HE6D 1KPVB 1J1PH 5E95B 2BVQB 3WIFB 1M7IB 1OAUL 2XY1A 5J1AA 1A21A 3C5SB 4KDWA 4PJGB 5IB3A 4G42B 2AXJA 3VFGL 1G7LA 3D3VE 4B7IA 3O2VL 3H9SE 4KV5E 3VXSE 3RGHA 3C6LD 2VH5H 2XZAL 3O8XB 4JM2F 1X7QA 2WIIB 4QRSB 1MREL 3SE9H 3TO2A 5SX4I 5I8OH 3EDJA 5I1LB 2VAAB 4YEFA 4JJ5A 1TQCC 3VGDA 1SVCP 2XIDA 1XZ0B 3BRDA 3RIFK 4A6YA 3PV6B 1VEOA 1FG9C 2C3GA 2NR6D 2VKXA 3KDMB 5F9OL 1KTLA 4X7FC 1DP0A 1BF8A 2PW2A 2IANB 3AXLB 3MLZH 4JREC 4B7LA 1X5LA 3P4OB 4K71C 5C0EB 1OTSC 2I07A 2X70B 1YDPB 4PJHF 2BCKB 5C86A 5DK2B 4GOSA 3OKNA 4NZRH 4OUUB 2KQMA 1NMBH 2AKRA 4YWGL 5IM7A 2XQYG 3TJHD 4N8CL 3SGEI 1JP5A 4P46A 4XB7A 3U7YL 3H42H 2EYTA 4AM0A 4OKDA 3HAEB 3RWEA 1KPUB 5DJXB 3OR6B 3QPXL 4NZUL 5F7DA 3TVMB 1S3KH 4ELKA 5BW7A 5I66A 4BUHA 4CVZA 3B83A 3VXMA 4Y5YA 4XBEH 3OKEA 4LSQH 2H2SC 2IPTL 1PSKH 4JQVA 1N6QH 1MAML 4JY5H 3TZVA 5HPMB 5DJ0B 1CE1H 1QBLH 5IFHL 3C5ZA 2DLGA 3UTOA 1MOEA 5BS0E 1OGAB 3MRRB 3QPQD 1ADQL 5CBEA 4MLSA 3EFDH 1WC7A 5LGJA 4JANB 5ESVA 4C83A 2F53B 2F54B 5FGBC 4H1LH 3LKRB 4RX4A 3LS5L 1B2WL 4WV1B 5JPMB 1FN4A 2W9EH 1B4JH 2D9QB 4LCIH 3CDGA 4OBRA 3S88H 1CIDA 5F8RC 2CQVA 3W5MA 2XKSA 2BERA 3GO1H 3O11A 3MA7A 3PDOB 3M1BA 1QBAA 4HIEA 4P9MH 5SWSE 4U1IB 3BXNB 3I9GH 4XX1G 3QCUH 1GHFH 5HDLA 4PJIA 5IP4A 3GSRA 2VE6A 2NY5H 4KKBD 3SDXF 5JUEL 2XZCL 2GAZA 1JWSB 5BMFH 4WCYH 5DUBA 3MUZ1 3UTPE 4K9EH 1UCBL 4N8VA 4M9PA 5HHOB 2G60H 4LSSH 3WJJA 3IJSA 1XF5A 5I71C 2HJKA 1BD2B 4GLRH 4MCZB 4NT6B 1FNHA 1X5XA 5C0CB 4ZPTA 1LWRA 1NFKA 3TT3H 1MI5B 5DJAA 5FECA 2DMKA 3TO4A 5EU7C 4CGTA 1Z6JT 2XNAB 4ZNEE 1IAIH 3QEQE 4L9LA 3KXFA 3CFDA 2ZSWA 1DUYA 5K9KB 4PYHA 4E41E 3EJZC 5DZOA 4JRYD 4YHZL 5A43C 1UB6A 1WEJL 2Q8AH 5FK9B 5C1MB 4YHOH 4O2EB 4PY7A 2XRAL 3AU1A 2B4CC 4P48A 4Z7VB 3ARFC 4G9FA 4ONHA 1E4WH 4ZSOA 3NCEB 2BNQA 1FVDB 3V6OA 1RZKH 2HT3D 4R7NB 1VGEH 4FA8A 2LU7A 2K9UA 3FRUB 5IVXB 5C2UB 1FO0L 1R3LA 3QIWA 2E27L 3QIUB 5IFAL 5C9JA 3VWJD 1IFHL 2X7LB 5JO5B 3WLBA 5ADPL 3B9KC 1JNNH 1A7RL 2FH8A 1U3HA 4YHIB 1UXSA 4ZUUB 2XN9E 4TVPE 1I1RA 5EOCH 1TQCB 2A6IB 3S5LA 4R26L 3CK0H 5DUML 2UZXB 3UMTA 2MPAL 4ZO9A 5INDB 1FIEA 1JV5A 4QXTB 4XVSL 1P7QA 1YEJL 1C12B 1CVSC 1S9VB 4LCUA 5D8JH 5E8PB 1KCUH 3EOBA 1IKNC 4I3GA 3WD5L 3C87A 3JV6B 3M8OL 1C5CH 5EU5B 4U6HA 4KU1A 4Q2ZA 2YXMA 1LQSR 3LKNA 5L9DL 1SEBA 2DQFA 4FZEH 4P2CG 3P11H 5AZEH 5HTSA 2F15A 2RCSH 4UDUB 4BZYA 1NANI 3O6FB 2DL2A 2OTPA 1KB5L 4I8DA 4RAVB 4YXLL 3OJ2C 2BOBB 3K4AA 3QXUA 2D7QA 2Y5TB 35C8H 5BXFB 3HRZA 3AC0A 3O4LE 5KSBF 1VACB 4TSBH 3QQ9C 4I4WA 4LLDA 4BFIB 4EN3C 4MMXC 2DWEA 4HMDA 1U8OA 2QKIB 3WO4C 1XCTA 4JVPA 2GJ6E 3C08L 4XCNA 4U33A 3G6JA 2VXTL 5F7EL 2O93L 2VXVL 5GRUL 3MBEA 1YNLL 2DB8A 5IQ9A 3V7AE 5L88L 5SWZE 3GIZH 3JTTB 3GMPA 5C08B 1J10A 3DHMA 1BQSA 1K3IA 4OFIA 3HPJB 3N1GC 5TE4L 4HIHB 1SJXA 3MOBH 2UV3A 5INCA 4HPOL 2X1PA 4P4RB 5HVFB 5ANMA 2AI0H 4JPWH 3OB0K 1OAKL 2HT2C 1BBDH 4MJ5B 1ZHKA 3MRDB 15C8L 1ZEAL 2AQ2A 2ZCKH 4LCWA 3EO0A 1ZA6B 1D9KC 1PGRB 3TCXA 2ARJA 1DBJL 1FLTX 4NQDB 1OW0A 1U8QA 4E9LA 1NUDA 1QO3A 5DR5L 2R0ZH 3RGVC 5DJZA 5MI0B 1E6JH 3ZKND 5EZJB 4CVXA 1KJ3H 1A6VL 2A9NL 5I71B 4Z8FH 5F6IC 2ZUSA 4L3CA 5D7SL 4EI5C 1A2YA 1FYTB 1KIRB 2P8MB 4UV7L 1OTTC 5IIEB 5MEOB 4FZ8H 4R4BB 5HYJE 5D6DC 1CXEA 4L29B 5GHWH 3VFWA 4CADB 4N90E 2FEDC 4PRBB 1HHHA 3DRTB 3ARUA 2I60L 1EFQA 5TE6L 2NX5B 2AXFB 4RGOL 5C0IB 5IMKB 2VDPL 1HOCB 1L0XA 1AIFB 5JW3L 3NTCH 4GRWH 3QHZL 1BVZA 4N0YL 4NC1C 3WMSA 3RP1A 1BQHG 2C4FT 3TYFA 3OX8B 5FYLE 4L8BA 4N0UB 1D6EB 1WAAF 4PJAB 4NO0D 3UTSA 3T0DA 3X14B 3PQYA 2XKUA 5EIVA 5HYEA 1FH5L 3QJHA 2CGRL 1BIIB 2QHRH 3S35H 1KCVH 2X9XA 4LNRA 3MPCA 1Q0YL 5DQDL 3PWNA 4BFBD 1KLUA 2VXSH 1AE6L 3S96A 1EEQA 4UTBH 1TNNA 2DQTH 2QSCH 3CVHL 4G43A 2G5BB 2MQ3A 2NNAB 3NZ8B 2Q1EA 3FQXB 3LPFA 4JDZB 1M7DB 3MV7B 2D0HA 5IT2H 1YEHL 3O6LH 1QSZA 1F3JB 3BQUC 4RAUA 3Q5YA 4JFDA 1EVUA 1TZGH 1IT9L 1WCBB 3ZYZA 2VDOL 3QUZB 3VFGH 4U3CA 1QYGH 3A67L 3OKOB 1BJ8A 3V8OA 2NY3D 1A7NL 4TULH 5JLZB 2PYFB 5JQ6H 2BHYA 4U7SA 5JDSA 2XZAH 2XI9A 2Y07H 5EFIB 1F6LL 1IEHA 1MREH 4LCCA 1A14H 4H1LA 2J8UB 5AYUL 2VLRB 4L4TA 3VXOB 1G6RL 5HYQA 5DT1H 3KLHD 2CRYA 2ERJB 1QRND 4OD1L 4X99B 2YPLA 3F12B 3E8UH 4JPKL 4JR9L 1I9JL 4PGZA 4QRQB 4O9HH 4UT6L 3F58L 1QFUH 5HD8D 1NGXA 4CMHB 3S34L 5B4MC 4AIXA 2DWDB 1IGFH 3BH8A 3WO4B 1F6AA 5MHSE 3UXFA 2F9BT 5L2KE 1Z9LA 3V0WL 1DQML 1TZHA 4N8CH 3EOTH 4M8VA 3U7YH 3NGBB 1OTUC 3I75B 2OCFD 1NUNB 2XYCA 3DMMC 1SJHB 4OLVL 5SX4H 4FTVB 3SKNB 3L3OB 4MNHA 5I1AA 3VXSD 2EYRA 1MAMH 2Z35B 4QHKI 4HKBA 1BJMA 1LD9A 4NP4L 3UTQA 5D7LA 4J4PD 1NGPL 4P2OB 1HZHL 2V17L 4P4KB 3BMVA 1R3IH 1ADQH 1AY1L 2ICWJ 4J3WA 2AXGB 4MNQB 4JAMA 4Y4FA 3Q0HA 4HXBH 5EORH 3H8NA 2E7BA 3B2VL 3B5TA 3GZKA 4EDWH 4IRZL 1NCTA 4I18A 1K4CA 2GY7B 4EDXA 3LS5H 2HVJA 1O5DT 5CGTA 4HIXL 4ZFZA 1JIBA 2XFXA 5F6IB 4R4FL 3KPSE 4EI5B 5ALCL 3TNNB 3SGEH 1VEMA 3F7QA 1KN2L 4WI3A 1RSFA 1WF5A 4F33B 2Y06H 4OFPA 1CI5A 4WW2A 4HEME 1S9WB 1TTFA 4EXPX 2CKNA 2B1AL 1T7WA 5JUEH 3JTSB 4X8JB 5DGQA 4CRPA 2JCCF 1UACH 4O4YH 3QUYD 4TVSa 2EIZA 4LRIC 1UCBH 4QHKJ 3STBA 4ODHL 4M5YL 1HINL 5LAXA 5DEFA 3BZEB 1BWWA 1HHJB 3E6HA 4KHTH 1UM6L 5FUCC 4K55A 4Z7WA 3DLQR 3I6LE 2BVYA 5IWLC 3TN0A 4G6FD 5I1HL 5IEHB 1FL6B 2HN7B 4X4YA 1QQDA 3SDDC 4Z7QE 1XGYH 5T1KB 3MGTA 5BS0D 4PJ9B 1TVBB 4Z0BL 4YHZH 5C0RH 2QADC 5FXCH 3P73A 4TPRL 1WEJH 4Z77A 2PXYC 3HMXL 4KK8D 5HGHB 4NWUH 3TC9A 4OCLC 1IM9B 5BVPL 3EYUH 2D4DA 1IILE 1X3DA 2CIKA 1HN1A 3L3JA 4XHQA 3X11A 4R7DB 1JF6A 4KDTC 3V6ZA 1LO3L 4OZIE 3ZDYF 3BX7C 2R9HC 3EBAA 1FO0H 5DK0B 1RUKH 5SWSD 5C0BA 3V0VB 5BO1H 3FTGA 1CLOL 2NXYD 4EOWH 1IGYB 1A7RH 5JXED 5D1XB 4APQC 1GCFA 1YYLH 2YKLH 3UTPD 4NNXB 3MRJB 1UWXH 5A2FA 3LN5A 3QDJA 2HRPL 1YEJH 2ITDA 4G8GD 2EYSB 2O5ZH 5DS8A 5IROC 4FHBD 3WNNA 1S9YB 1MCIA 4ZS7L 5F1IA 3WD5H 1KENL 1T7VA 2KZ1B 4NQCE 2PNDA 4K2UH 4FQXC 3VFUB 3ULUE 1AP2B 1HXYA 5L9DH 4X9GA 3FKUS 4LDOB 1AI1H 1U36A 1RZ7H 3UPCA 1A1NB 5BVJB 1NFIB 1KB5H 3OJDB 3CSGA 5EIQA 1BECA 1S7QB 3NACL 2NW3A 3NA9L 5CJQL 4R97B 2FBJL 5AD0A 1DLHA 1DQTA 1ORSA 3ULVH 4PUBL 4YDIH 2IAMC 4PLNC 3RI5K 3SKUD 1Y0LB 3B6SA 3LN4B 3BKYH 3MLVL 2L7JA 2FGZA 5I30H 3SY0B 5C07B 2VLJB 3C08H 4JFEB 4YGVB 5GS0H 4FQCH 1ZMYA 3KPRA 5EPMB 3ARBA 2D7PA 4MJ6B 1WZMA 5I73C 5CCKL 5AUMA 3TLRA 3V79C 3BKCL 4NBXB 5L88H 2BNRA 2V7NB 4CN1A 4OZHF 3SEPA 2Z93A 1BFVH 3KPPB 1NPUA 3BYYA 3NIFE 2XN9D 4TVPD 4KK6D 1NC4D 4ZUWB 5HVHB 1DCLA 1UZ8A 1GGIL 2R69L 4U49A 3O3BA 2NZ9D 1OAZL 5EUOB 4WWKB 5EN2A 4AENA 4F8QA 4ONFL 4OIBA 3NN8B 4PJCA 5GZOC 3BGMB 4PJBB 1WBXB 2FX8H 3MRBB 1NANH 4WUUE 4CKVX 5F7LB 3UTTA 5BRZA 3OXRB 1OAKH 3EDDA 1ACYH 2DBJA 2PF6A 5GIRA 3CXDH 5TH2A 1X5GA 3NCCB 2R0KL 1NSNL 2W0FB 3GFUA 5FM5O 4OF0A 5CP7A 4JFZL 4DZ8B 3IDNA 3DVGA 1RULL 3P0YH 2WBJB 3RVVD 4M7ZC 3HS0B 1TTGA 3T04D 1X6LA 1XMWA 4DQOL 1LO4L 1P4IH 4YX2L 1D5BA 4MLIA 5GGVH 1NUFA 1NBZB 1GGCL 2GCYA 5E9DA 3BUYA 3RPIA 3D18B 1IBGL 3CVIL 1A6VH 4HFUL 5H2BA 1T89C 4OZGB 5D7SH 3SQOL 2A9ML 2OZ4A 4UV7H 2GJ6D 1YEDA 3CX5J 3BPNC 4N1CA 4TSAL 2W91A 4PRPB 1KTDB 1RI8A 3MV9E 4FG6D 1ZA3A 4JKPH 3G04B 3QUMH 4YBHA 2I60H 4P46C 2A73A 1RUAL 3SDDB 4U1LB 2EDKA 5JW3H 3QHZH 2YC1A 5L0QC 5BW7C 1KULA 4POUB 4Y5YC 2H9GA 3JWOL 3DGGA 2VZTA 2WMPA 3GHBL 2GUOA 2W0LA 3GMMA 4JQVC 4R96A 3PHSA 4ENEC 3TZVC 5CZXC 1FH5H 4JFOB 4LVNB 2ID5A 4UTAH 2CGRH 2CLZA 3PP4L 4U1SB 3PDGA 4LOUD 3RRQA 3WS3A 1D5IL 4F7CB 3C5ZC 2GK0A 5HHVH 3EO9L 2ADIA 4GKZA 5A16A 4QTIL 1A9BB 3ZT7A 1FZKA 1HILB 4XXDA 1Q0YH 4OLUH 1MCHA 1MY7A 2AERT 5MENB 3LKPA 5B38B 3DOSA 4Q9RL 2B2XL 5DMGD 3CVHH 5J9PB 4FFVD 1Q38A 2X4UA 4GQ9L 3GI9L 5CILH 3ZO0A 3FONA 4M62L 4MB5A 4DGIH 4NZTH 4HIIA 2Q76B 3TPUA 2IG2H 4K23L 4IEFB 4U6TA 2A6JB 3GHEL 4Y19A 1J11A 4NM4L 3TCLA 4X6DB 3D69B 5E00A 5ESAB 1ZTXH 2DQUH 1RIHL 3IJYA 3EIFA 4IOFC 2ZSVB 3JSSA 2R23B 1AQKH 4UNVA 2AJ3A 2ZZUT 5HJ3A 1D7FA 2JELH 4MA7H 1DUZB 3K4ZA 5D1ZB 3A67H 4LMQE 1NLBH 3D0VB 3SKJL 4KXZI 2PTTA 1LE9B 1DBBH 5C6WH 5EA0L 2CO7B 3WJJC 4G8EA 4X7EC 2I5YH 5FYLD 2H6PA 3QDAA 4CL7A 1G6RH 4HJGB 4G8IA 5ISZB 4NDMB 2C3HA 3E1F1 3VFOB 4OM1L 1EAPA 3EDKA 4XVJL 3LKOA 4JR9H 3TO4C 2GQHA 4XBPB 1VFBA 3F58H 2AV1A 3S97C 4XMPL 4MD4B 3CC5B 2Q6WA 3S34H 3TP4A 2Z0BA 4LHUD 4KROD 4XGZA 5HGDB 1OD9A 3ESUF 3DI3B 4Z7NF 1TNMA 1E6OL 5CD5C 3B3IA 4JN1L 4LLQB 1RY7B 4I0PB 4OFYA 5JMRA 1T04A 5DJCB 4YR6A 5F44A 4HV8A 3VI3E 2KPNA 5E99H 5J1AB 4BK4A 3V6OC 3INUL 2NY4B 4MDIA 3D85D 4RGND 1G7LB 3VRLE 3REWB 4JQXA 2YPVH 4DVBA 2L4OA 4L5FL 4RFEA 3FFCE 5T1MA 2FBOJ 3QIWC 5E2UL 3BH9A 3BT2H 3TBYA 2R1YA 4HWBH 2DKSA 3AM8A 5IMMA 4U3HA 4IIQB 4PV9B 1ZVSA 4X7TB 3M17A 4P3CL 1B0GA 4D9QE 2DQGL 5DO2C 3GMLB 1HZHH 4PLOB 5FGSA 4HBQA 1AY1H 3D5OF 5IR1A 3OG6B 2XG4A 4A6YB 2BMKB 1IEBB 1U8NB 3UPAA 2BDNH 1YPZF 4K7FA 4NO2A 1EGJH 2EKSA 1CU4L 2YUXA 3QFDA 4Y2DD 1K4DA 4HG4J 3TBVA 4OKVA 4JN2A 4HIXH 2CUHA 3P40A 4H20H 1FO0A 4KGJA 2X4NA 3JXAA 1ZANL 4HKJA 1TENA 2Y6SC 2AKRB 1I1AD 4GG6F 4TQEL 5F88A 5MHSD 1A5FL 4AK1A 5KW9L 3A6BH 1G7IB 4AM0B 3AY4A 5L2KD 2NPLX 1X4XA 4GRLB 4FFZH 4S0SD 3MV8A 4G5ZH 5FUZH 5J57B 4K8RD 3O3EA 3WFDH 1MJ8L 2A83A 4ELKB 3QEUB 4DVRH 1C16A 4L8SA 4PBWD 5MEQA 5J11B 3BP4A 2FGWH 4Y5YB 1OVZA 1T0MA 3T2QA 1OLZA 4IRSA 5IB1B 3J7HA 3MBEC 3MJ8B 1U8IB 1UM6H 3MOAL 3AREA 4L3EE 5JW4N 1T1XB 5DVKA 3T4YA 1WC7B 5DUPL 1A6AA 3V4UH 5ESVB 1QOKA 4BSJA 1ZHLA 3X12A 1HNGA 3OKMA 4JFHE 1OT1A 2VQUA 3HHRB 4Z0BH 1YNTB 3QDMD 5D7KE 4FS0A 5T3ZE 3HMXH 1Q9WB 3HA0A 2HAZA 3O2DL 4R3SB 5EWIL 4LVOB 1G7MA 1JK8B 3O11B 2R1XA 5ESQA 5F93C 1QSEE 4E0RB 3UYOD 4D9RE 1C1EL 1OW0C 4AMKH 4PJIB 3VRLF 5I1KL 1LO3H 5GSVA 2DLFH 4KUZL 2VE6B 1EFXA 5LBSH 3UROR 4I0CC 1M05A 4XAWL 2GAZB 4U0RB 1U6AL 2XY2A 1CLOH 2HVKA 3UP1A 3IYLW 3GDBA 4N8VB 4QHLB 1INQA 3IJSB 1VHPA 4OZ4B 1FV1B 3SQBA 1X5IA 1IE5A 2X05A 1OSZA 3GK8L 4KTEH 2HWZL 1B6UA 4L4JA 1QVOA 4PJXB 2E7HA 2O61A 1H3UA 4XPBL 4L9LB 3JWDL 3I6LD 1OAYL 3CFDB 3HG1A 3BE1H 1C08B 2BFVH 2YPKB 1WBYA 5C0DA 1NC2B 4BZ1H 3DBXA 4QCIB 1HYSC 5CMAA 1VFOA 5IG7A 3V4PL 4M7KH 4PJFE 1KJ2L 2PETA 2VDMH 4PY7B 4XTRC 4ETYA 4X6FA 5HI4C 5JA8B 5C0AA 4QXGL 4ZSOB 3NACH 4OM0L 3I3BA 1R5IA 5K93A 2ZJSL 4IDJL 1LP9B 3VXUB 1WTLA 3U6RB 3SE3A 3R0NA 3BO8A 1DSFL 1HHGA 2HMIC 5IEKB 3DURA 4KJWD 2AJYH 1R3LB 3E3QC 3D25B 1R3JA 3QUMA 3RDTD 4XMKH 3K2UH 5C8JA 1MWAL 3D0LA 1J05B 1OCWL 3MRFB 1U3HB 4LVHB 2C1PB 3Q1SL 3S5LB 3L9RA 2RGSA 3NFSH 4GFTB 1NCUA 5GXBB 4XCFH 1NAKH 1QLFA 5IK3B 5DFWH 1JV5B 1N3NB 1M6OB 5JOEA 2O5XL 2JIXA 5C0JA 2P46B 4LCUB 5KSUB 4PJ8D 2OR9L 1I8LA 1OAZH 4P5KA 1RZFL 5CJBA 4FQJH 4NQED 3BESR 3CUPB 4Q2ZB 4YHPA 2ICEA 2A77H 4UNTA 1W72H 3LKNB 3LSOA 4LCCC 1SEBB 3NPSB 3CVHA 4NQCD 1YY8A 2YD7A 4KTYA 4G6MH 2J4WH 1VFAA 4B53A 3G5VB 3MFGB 3TA3D 4OIIH 1RULH 1GPOH 1FFRA 2EE2A 3EYVB 5I19L 3DARA 4MJIA 3VWKA 2UZIH 1LO4H 4LLDB 1C5BL 1EHAA 5ACMA 2ZG2A 3LQZA 4TNWF 1I7RA 2IADA 1IC7L 1CK0L 1G84A 2KDGA 5CEXA 2Q3ZA 4IOSD 5EOTB 1UWGL 4XCNB 5IV2B 2ED8A 1LK2A 2NY5C 4LF3A 2A9MH 5BOPA 3QXVA 3V6FA 1MFCH 3QO0A 4KVNH 5GISL 4TSAH 4K9EC 5D1QD 1J8HA 5F7HA 1RFDH 3IDIA 4UOW0 3GMPB 5C09E 4Z7UE 4XCCL 5EIIA 4JZJA 3IXTA 1RUAH 3EKCA 3QFJE 3QBTB 2DAVA 1XH3A 1EXUB 3VH8A 1G1CA 1L9MA 1RK1B 5F3BA 2YEZB 3KPMB 1PYWB 1CT8A 2PTVA 5CIPH 3ZDZF 4OF5A 4C56A 1D5XA 1DEEA 2UWEE 3GHBH 4UILH 4YH6A 5E8DH 5JXAL 3SDCA 4XWOD 1MCQA 4RMSA 4ZTOL 3C5JA 2DKMA 5ANMB 4LCYB 1ZHKB 4WNQA 1D5IH 4UDTB 3EO0B 1MCSA 1PW3A 3V5HA 4WUUD 5DYOA 3N85H 2DLEA 3T1WA 1A3QA 5A1AA 1SM3L 1YQVL 2A1WL 1BZ7A 4G7VH 4Y4FC 3ROLA 2D03L 2B2XH 1QO3B 4F7TA 4C4KT 4PJGE 1AHWA 4O02L 4GQ9H 1RZKC 3X3GL 1XGRB 1FQ9C 3B5HA 3TNMA 4M62H 2IJ0C 4R90L 4WI7A 5BJTB 4PD4J 1IVLA 3UO1H 3CZFA 5CJOH 1QG3A 4S11A 3ARDB 3GHEH 4L3CB 4H88L 3G5ZB 3UZVB 2FD6L 4KRPB 4HWBA 4YDJA 3MXWL 3QIBD 1RIHH 2EIBA 3TWCH 1HHHB 1ZK9A 5JIHA 4CMMA 4WW2C 1HDMA 4QT5A 4YHLL 3QI9B 4JG1H 4TUJA 2PR4L 2W9LA 2X4QA 4G7YL 3AUVA 4F57L 3NCYP 3BIAX 4L8BB 1MAKA 5EA0H 2ICWA 4MQ7A 1WITA 1GOFA 2JJSA 1EGJA 3RZCD 2IANE 4J3VA 3PQYB 2BK8A 3H0TA 4XRCA 2CXKA 5HY9B 1OAQH 2ZG3A 5ICZA 3HCVB 1DBAL 3EFFB 4OM1H 3TN0C 2F8VA 4POZC 2Y1VA 4XH2B 3VXRA 4DAGL 1TIUA 3FRPG 3S96B 3R1GH 1RV6X 4ONGL 2DTMH 3DX6B 1A47A 1VEPA 2P44B 2ZP0T 2P49B 1MIEL 4JKWA 3HMWL 1RIVL 2HTKD 1E6OH 2XACC 1GSMA 4MAUH 4JN1H 1P53A 2EH7L 4Z76B 1NEUA 2Q86A 1QR1A 2FECI 4JFDB 1GIGL 3BDYH 3CFBA 4ZXBA 3MNZA 4Z7UF 1KJMA 1OGTA 2OTWA 4KXZH 1AC6A 3D39A 3T0EA 4L5FH 1KCSL 2DI8A 4HZLB 2A6DA 1TCMA 1KGCE 4RMWA 1EIBA 5E2UH 4EUPH 3TBSB 6FABH 1MFAL 1IAKA 3FB7A 4JO4H 5JDSB 4XNMB 2F53E 2AJZA 2VITA 2F54E 3WDHA 1JL8A 1LEKB 4LCCB 4OGAD 1KEML 2L0DA 3QUXD 1P5VA 4OB5L 3O4OC 5EU3A 5JHDD 4ELMF 4MWFA 3OSKA 1W0WB 1A3RL 3B43A 2YMXL 5CD3A 2YPLB 5DC0A 3HMXA 3ARSA 4BK5A 3WUWB 3RVXD 5H37G 5LQBH 1NGXB 2P8PA 3FT3B 1MRCL 3FT2A 4J8RA 2CKBH 1HEZA 3BW9A 2GTWA 3QXDA 5I8EB 4OGYL 3QJFB 4JKKA 1GGYA 3I3DA 4PGEA 2LVCA 4P2QA 1PKQB 3O41B 4TVPL 4NC0B 4QRRA 3HAEG 3RVTC 5GJTL 2BVOA 4NUJB 4FQ2H 1NL0H 1RURL 1SJVA 1TZHB 4BH8A 4YHYC 3IFLL 1BD2E 1ZT1B 3ZE2E 1GH7A 1WZ1L 3LKSA 3HPLB 5C0CE 3WXWL 1LDSA 1ZT4A 2YD6A 1G9EA 4KK9D 2ZOKA 4DFIA 3EYOA 3GI8L 1XGQA 4KY1H 4KZDH 2X42A 1BX2A 1MHHA 2WUCL 4MNHB 2YA1A 1U2HA 2EYRB 3ARBC 3HE6A 3G5XB 3K2MC 1X5AA 5DHYB 3R06A 4C54A 5F7KC 4XC3L 3FFDA 2E3VA 4DKEL 4OQTL 3IF1A 3MUGB 1OB1B 4Z7VE 4D9QD 3RUGB 3ZKQD 3DVNB 4Y4FB 4ODWA 4WI8A 3TYGL 3N50A 2P48B 4I18B 1MY5A 3MUHL 3P9WB 1K4CB 4EDXB 4V1DE 5IVXE 2YWYA 4QRUB 4ZFZB 2XFXB 5I16A 1DVFD 1SEQH 5EWIH 3U9UA 4YZFE 4MQXC 2XG5A 2YXFA 1MFEL 2EE9A 4JQIL 5KVFL 4HQQL 5I1KH 4QEGA 2R8SH 5I1DB 2M1KA 3MRQB 2CK0L 1O7SA 5D5MF 1U6AH 2FEEL 3RKDC 1AKJD 5T33L 1EUTA 4GMSH 3JWNC 4D9LH 1L0YA 5ID0A 3DX9A 3MJ9H 4HJ0C 4W4OA 1PX4A 5TQ0H 1NLDH 3V5DB 5J6GA 2E9JA 1UM4L 2LAAA 3HRPA 5LAXB 1JPTL 1YZZA 3MACL 2EH8L 3CH1A 1CWVA 4Z7WB 2C3WA 2I9TB 1W72A 5HVWA 2NXZD 4G6KL 2W65B 1TJGH 3W5NA 4PRIB 3VFNB 3L7FB 1QQDB 1HKFA 4GBXD 5GRJL 1K5NA 1OAYH 4L3ED 3MGTB 3JV5A 3PL6D 4NUGL 4TOYH 2FWOA 1EHLL 3C8KA 5J4MA 1M71A 3WHE0 3QA3A 4X6BB 5JA9A 5FYKH 1CG9B 1VA9A 3P73B 4AY0A 5D2LB 3MCLL 1URLA 3MREA 4NJAH 1FL3B 4JFHD 5I17A 5D7JD 3MV01 3TPKA 3UAJC 3OQ3B 4ZFFA 5D7KD 4XCEA 3BPLB 3RWCB 1F58L 3OHXA 4D0BA 4DZBA 1CFQA 1ZE3C 3PWPA 1DSFH 1MFDL 5LJYH 1QSED 3S3JA 3QNXA 3RX7A 1UJ3A 5FYLL 5TGBA 3C2AH 4J7RA 5C0BB 4ISVA 1JNJA 4O5LL 4H25A 5C08E 3T4AA 2YBRB 1CVRA 1CCZA 1P84K 4JKLA 1RZGB 4N0RA 3S4SA 1FVEA 1GRWA 4KDVA 4XMLL 2VLKE 1IKFH 1AR1D 2VZ3A 3F5WB 3CFCL 2XZZA 2LU4A 5CIPA 5D2NA 4X4ME 1MAJA 3T0AA 4Z7VF 2O5XH 3IVKB 5D7IA 4YK4B 5DS8B 5T1DH 5K9QI 1NCCL 5I18L 3V0AC 3E2HC 5F89A 2J5LC 1A6ZB 1P7KA 2EDBA 3WO3B 2E9WA 1SBSH 1IQWL 5FKPA 5IVXF 3SGJA 4QRPE 4GKSB 1HXYB 4AEFA 1NMCC 5LGHL 2SEBA 2FB4H 3F7YB 4IRJA 4U1NB 3O6MH 5FOJA 3RVUC 4KJQD 4OF7A 2X4PB 3GSUA 1AO7A 3O2WH 1FYTE 1MRFH 2X4OA 2V2WA 1TETL 4JPVL 1DLHB 4M6OL 2P5WB 5F6HI 3W2DH 1ORSB 4NO5B 5I19H 2MKLC 1P4LA 4LIQH 4PRHD 1GYAA 4NNPH 1IC7H 4OD2A 1GC1H 5FKAA 3EDEA 2YUZA 4JRYA 3W0WD 1KJ2B 1WQVT 4Z7OE 3CDCA 3KPRB 4PJ5A 5HGBB 4PGCA 4YBQC 1Y6NR 5AUMB 1VKXA 1MRDL 4PJAE 5GISH 4L9DA 1AGDB 5EU4B 5B22A 3ULSA 1YMHB 4FXGA 3NA4A 2Z93B 4TYUA 5DURD 4UAOB 1REIA 3D9AH 4JQXC 3F8UB 4DGYH 3VJ6A 1Z0NA 3OAZH 5ACZB 5EU6E 3O3BB 4MMZC 3O0RL 3VWJA 3L3HA 3BWUC 4W4NA 5D9SA 1VFMA 3MCKA 5JXAH 4I0KA 5I1CH 4ZTOH 4Q58C 3L3DA 3CDYA 3CZJA 3P30L 1EX0A 4M03A 5E6IB 3FAXA 3GSNL 4ZUTA 3UTTB 5GIRB 3DSFL 4K8RL 5TH2B 1FNSL 3RZWA 1AQDB 4L8CA 4XNZC 4DN3L 1UEMA 3IDNB 4Z78A 5ID1B 5GGRA 1SM3H 5I0DA 4K7PH 1YQVH 1EEYA 1JWMA 5I2IA 4Y16B 2EE6A 1D5BB 2VLME 1XGTA 2QSQA 3NPZB 2GCYB 1H5BA 2C1OA 1F90L 3LHPH 5H2BB 1D5MB 4D0CB 4EUPA 4XPTL 3GSQA 3J8F7 4DUVA 3O3UN 2ADFH 1WBZB 1ZWIA 1GOHA 3D3VB 1ZA3B 4KTDH 5DD1L 5AEAA 4WFGE 2J8UE 5E0QA 3H9SB 2VLRE 3AY4C 3C60D 4BZ2L 3CFJA 1H8NA 1A7QL 1NBVL 2W9DH 1GVIA 2PR4H 2YC1B 3FQTB 2YA0A 5C09D 3UPRA 1P7HL 4U1MA 3QFJD 5KSAD 4U4BA 2AJXL 5E08H 4UBDD 1QFWI 4HXAH 3SDYL 2GUOB 1JPSL 3GMMB 4R96B 4M93C 4NQVB 4K94H 2OTUA 2CKBA 4AT6A 2DM2A 3HNVH 1MPAL 1S78D 2OP4H 4Z9KB 3WS3B 3NIGE 2XZQL 1MCWW 1BEYL 3AREC 1BAFH 1PVHA 1MJUL 2ADIB 5A16B 3ETBF 1HQRA 4OCYL 4WHCA 3DTXA 4P59L 4C57C 2BXZA 3RWHA 3D1MC 4XP6H 4HKXB 2OL3A 4FABL 2P1YA 4JM4L 4OJFL 4JO1L 1JGLH 4IS6A 3MLRL 1MLCB 1N6VA 4HIIB 3ULVC 1T0PB 1GGTA 4Z7OF 3TPUB 3LOWA 3IU3A 4FFYH 3VFRA 2EH7H 3DECA 1FRGL 4FTVE 4JZOA 1FE8H 1T6WA 4CU8A 3SE8H 4PTTB 3ZKXC 3MRKB 5H94A 5GS0C 1HKLH 3STZB 3RL2B 3O8XD 3U79A 1X5ZA 4X7SH 1ZV5A 3E2HB 1QFWL 4WU5A 1FNEA 4MNQE 4ODSL 1VADA 1G9ML 4RMUA 4QYOA 2IQ9H 5HI5D 3MV11 3DO7B 1NMCB 3BKJH 2Q7NA 1CLZL 2DQJH 2YD1A 4OB5H 2XTJC 5FF6A 1B88A 3BZFB 1CDUA 2GT9B 1A3RH 5DRZA 2BVUA 2IAND 1IEAA 1WFOA 4KKAC 1EAPB 5EC2A 4TTDD 4WO4B 2JK5A 3FHQA 3OV6A 3S37H 1VFBB 3QEGH 4UIKH 4X5WA 2IFFL 4PIRF 3GSWA 3V8CA 1HSAB 3I6KA 4XGZB 2FZ3B 1BZ9B 1N5AB 5SV3A 3JV4A 1BFSA 1I9IL 4OGYH 4MCYB 3G9AB 4NC1E 4NO0A