1IKFL

A conformation of cyclosporin a in aqueous environment revealed by the x-ray structure of a cyclosporin-fab complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
b'DIQMTQTTSSLSASLGDRVTISCRASQDISTYLNWYQQKPDGTVKLLIFYTSRLRSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGSRIPPTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRAAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA R45-45-11 FAB (LIGHT CHAIN)
molecule tags Immune system/immunosuppressant
source organism Homo sapiens
publication title A Conformation of Cyclosporin a in Aqueous Environment Revealed by the X-Ray Structure of a Cyclosporin-Fab Complex.
pubmed doi rcsb
total genus 51
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1993-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ikfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ikfL01
4EN3B 4ODVH 4JFFA 3RTQB 4M00A 1J1PL 4OV6F 4ZG1A 4MAUH 4WHTA 4UIMA 5GGSY 5GS1B 1AGCA 2NW2B 3QCTH 5CIPH 4NFBA 1XF3B 3V52H 5CP3H 4AJ0A 3PQYD 1RVFL 1KIRA 3MRRB 4XNZC 1EJ6A 3D18A 1K3ZA 3K4DA 2OQJA 3DSNA 3FQUA 5DMGC 5KJRL 1KCUL 2ZOKB 1IAKB 4P2QA 4M6MH 1R3LB 2A1WH 3HE7B 4OZFB 4ZUSA 4YHYC 4NT6B 1ADQL 4FFYL 1A6PA 4WW1A 1IL1B 1HXYA 4NO3B 4X80H 2VL4A 2YPVH 3WUWA 2NLJA 2NY5H 4FABH 4P2RB 4HPYH 4PV8A 4OM0L 5JHLH 1D6VH 1YMMA 3U46A 4AEHH 1HQ4B 4R2GB 1EAPB 4C4KT 2X4OA 4NZRH 5DO2C 2UZXB 5IG7A 4KKAD 3BESR 1H15A 2BNRB 1BVKA 4WCYH 4X7TA 2V2XA 3LEVH 3HUJA 1VFMA 3CDCA 4P2OA 2YN5A 3ARDD 1INEH 3KXFA 5K9KA 4UTAL 4AH2A 4FQQB 5EWIL 1EAJA 1LVEA 5IW3A 4JPVH 3G9AB 3GMQB 1QZ1A 1HIML 3MLYL 4I48B 5E8OB 3ZHKA 2CIIA 2PR4H 2EDTA 5CILL 1U3HD 2IC2A 3W0WE 1IC7H 4IRSB 2BNUB 1XGRB 4AZ8A 1W72L 3H9HA 2J12B 4P46C 4YHLH 1P84J 3ZTNL 3VRIB 1LO2L 3H9HB 1SEQL 4HH8A 1AGEB 5I8KL 1NSNL 2GCYB 2IAND 3SJVE 4O02H 3RWIB 5H37H 4HIJA 1CVRA 4R4BB 4C57C 3Q0HA 2V7HB 3KAAA 4HK3N 3VFUB 3S5LB 3JTTB 4A2LA 4D3CH 4JZNB 3GMNA 4P4RB 1QUNA 2HJLA 3OHXA 2Z35B 1QLFA 4KK9C 2ITDB 4G6FB 4YHZL 1GGTA 5FGBC 3NPSC 3P77B 2FHFA 2ITDA 3RWGA 1ZVSA 1J7VR 3P4MA 4YPGB 2VN7A 4IOSD 4JFEE 5AYUH 4APQB 4ZFGL 1I8IA 2VE6A 3ES6A 1A7OH 2EC8A 1A0QL 1AXTL 2DB8A 4X98B 2MCPL 3TCXA 3STLB 3TNNA 4FXGB 2Q20A 3VGEA 5LWYH 2QQNL 4K94L 3EFDL 1DN0B 5TH2B 3E3QE 4NJ9L 3DMMD 5L88H 2NNAA 2XTJD 3GBMH 4OLYH 4ZFZA 3ARXA 3G6JA 1RJZA 5FYLL 1F5WA 2G60H 4OGYH 5E70A 3AB0C 2P7TA 3PL6D 3WIFB 5I16A 1TVHB 3KPPB 4ODTH 4RMUA 2Y7QB 4OIBA 1EO8L 4FQXC 5IHZB 3MLRL 2FZ3B 4BZ2L 1V05A 2DWEA 2XN9E 4B7IA 4L3EE 2WP3T 2CLZB 5MENE 2C7UB 2IG2H 1CBVH 4CUCA 4X6CB 1JPSL 2WANA 4HUUA 2LU3A 2ADJA 5JHDE 3G5VB 1FL6A 2EC9U 4EVNB 4PLKC 1TQBC 1V8HA 2ZKHL 1DR9A 4RGNE 3G04B 2IF7A 4NKQB 4MXVF 4PUBH 5C0JB 4WGVB 5FGSA 1I1AA 1FNGB 3H9SB 4R6UA 3DX7A 1LMKA 1BFTA 4YXLH 5TE6H 4QTIH 1OAKH 4YHKH 5EO0B 3QDMB 3RWDB 5C6TH 3RX5A 4F7PA 4DKFH 2KBGA 1C12A 1RY7B 4OZHA 5IB3A 3DWTA 4UUJB 3MNVB 1U91A 5JOPE 4LASL 3SKNA 1KYOK 4WV1C 4Z7OE 3OSKA 3PNWB 2ED8A 3RGVC 3CVHL 4ZYKA 1KB5L 1KIQB 2FIRT 3OJDA 2DTML 3C6SB 3NCYP 2DM7A 1QYGL 2UWEB 2VDML 1SJHB 4NC0B 2YUWA 2O5YL 4KK8C 1QSFB 1PYWA 2VIRB 3S9DB 1RUQH 2MPAL 1XF4A 3TPUA 4J3WA 3GSNB 3ZTJH 4DVRL 4O58L 3WLBB 2DLIA 2OM5A 3VFVB 3V6OE 1CLYL 3OJVC 3X12A 3MBXH 1UB5A 1NH6A 1B2WH 2BNQA 5D7IB 5EU3A 5E2UL 1J9CT 4Y8AA 2BNQB 5D7IA 1HINH 1NANI 4Y5VA 2F54A 4PJHF 1KXVC 4JM2B 3DUUB 4KY1L 1E4WH 4W4NA 3MBXL 3T0EB 2APWA 4TSAH 1VEMA 1S8DB 4GBXB 4XB8A 1XCQA 5FM5O 1ZT4B 3DHJA 3VFRA 1OAYH 5KVEL 4KI5D 4K23H 2X5PA 4XCNA 3CLFH 1P69B 2MPAH 2VL5B 5DQ9B 3GJFB 4H8WL 5ECJE 4PG9A 4DOHE 1J1XL 3EJYC 5GS2H 5C0NC 4Y4FA 3GJFA 1UWXK 4ISVA 1OL0A 3AY4C 2HRPL 4K2UL 4Y4FB 3BHBB 4NN5C 3U9UA 5D2NB 1FNFA 4YDJB 4MJIE 4MZ3A 4UNTA 4JFXA 3GMRA 5DK0A 5GRVK 1FZMA 2ATKA 4JB9H 1IC1A 1BM3H 1ZS8A 4JFZH 4JRYD 1F4HA 5LXGL 4P9ML 1BMGA 2UVEA 1ZS8B 3DLQR 2XKUA 1BAFH 2FO1A 3K81A 3AM8A 1UH4A 3OXSB 4DKFL 4MGXA 3RPIA 3LQMA 4MS8C 4Y2OA 1CL7I 2IEPA 1K85A 3FQRB 3HAEH 4URTB 1TLKA 2EZ0D 3IETB 1WGOA 2Q87A 1F3DJ 4HLJA 4XVSL 5A3IC 4U6HA 2HTLD 3VXSE 1UWEH 2ZKHH 5HHOE 2JIXA 25C8H 3E0GA 4BSJA 2X1QA 3VFWB 1T21B 4KTEL 4KK5C 1DANU 3MRHB 4CMMB 3WJJC 2A6JA 1KIRB 4HC1L 2WINA 3SDCA 5EZIL 4NQXB 1PX4A 4RAUB 3L95A 4D8PA 1I1YB 3AAZB 5TDPA 5T5FL 4BZ2H 4TULL 4AQOA 1KCRH 3T1FB 2W07A 1OAZL 4U3HA 5C2UB 3TWCH 4F58H 2XNAA 5CZXD 2PW1B 5IVNA 5HHVL 5FYLH 1LNUA 4QY8A 3LSOA 2QKIA 2FD6H 3PIQA 5TPWH 2Q8AL 3S35H 1IGFH 2XPGB 4WEBL 3GSUA 4OD1H 3QFJB 3OX8B 3ARVA 1MCLA 5GS0H 3HUJB 2VXTL 4PRPE 3QFJA 4KQ4L 4JG1L 3JSSA 1EFQA 1CD8A 2NY4D 2BZDA 3BRGC 3EHBC 4LSUH 3UTZA 1T4KA 2P43B 3EDFA 5BRZA 3H9SE 3QIUC 2LV4A 4JZOB 5EZJA 3T0AA 1RJLB 3UTOA 5CBAA 3L3DA 2YPLA 3MREA 5DD6B 3VGDA 1JNJA 1E28B 1MWAH 4N0FA 4JY5L 4JDTH 2X42A 2AAVA 2J4WH 1MIMH 2HVJB 1A6AB 1NSNH 2E9IA 4ETQA 1JMXA 3MLSL 5F9WC 4OI7A 3IDIB 4Y1AD 4JDVA 2Y5TB 4PLOB 4Z0XA 1CD1B 1OB1B 4Y88A 5DQDH 2PR4L 1ZHNA 3HRPA 5DVNA 1U8PB 2VLKD 1HH9A 1YNKL 3MGAA 3VXSA 4X4XB 2WQ8A 4OT1L 3V5KB 1HK6A 3BW9A 2O5XL 5HY9A 1NANH 2WIIB 1S7UB 4HG4K 1MI5D 1I8IB 2VE6B 3L5WB 3T0ED 1QR4A 1ZMYA 4FP8L 3STLA 2AXGB 5GS2D 1VKXA 3LN9A 4FG6C 5JOFB 2AEWA 4UAOC 4DZ8B 3H6JA 1P6AB 1FVCA 4MD5B 4WUKH 4IJ3C 5D1QD 2BNQD 2J7LA 3QIUD 1HYSC 2GKIA 2F5BL 5DS8B 1NDMA 1UH2A 1NCUA 1UENA 1N6QL 3BGFB 1JZ5A 3WXVL 5ALBH 4TOYH 5TE4L 2YPKA 4WV1B 2D03L 3TO2B 1PEZA 1HCVA 2EE2A 3HC4H 4N68A 4JO3H 5IBUB 1S9YA 4V1DB 3QG7H 2ERJC 1CWVA 5F7DA 5C8JA 4HIIA 4QTHA 5GQBA 3L3HB 2XFXA 4WFFE 4UOW0 1U41A 3I2CH 4Y4KD 4BZ1L 4QTHB 5DA4A 2HA1A 1GAFH 3T4YB 4ZFOA 2ADJB 3BYYA 5J6HA 1OTTC 5EO1B 3WO3B 2QR0A 3NACL 1OSZB 4YDLB 4MAUL 1WUNT 4ODSL 2H3NA 4MJ5A 1AO7A 1KGCE 4MX7A 2CPCA 5E1AA 5KSAD 4D9RE 4G3YH 5JPNB 2FL5B 1JNHA 4F7PB 3MPCA 3C6LA 5IFHH 3ULVL 2ZSVA 5IJVB 1MCCA 4MCYB 4M93B 2R2EB 1AGBB 1JBJA 4KVNH 3IKCA 5C09E 3S36L 5D1ZC 3BP4B 5C0CB 4YK4B 4N0CD 4N8VG 5F1SA 1AC6A 2AK4B 4AL8L 1NEUA 1LEIB 5HD8C 2CXGA 4K3HA 3MOBL 3NA9H 1MPAL 1PD6A 2CK2A 4JJ5A 3HE6C 4LLVA 4NUJB 1NMBL 5INCB 3E6FA 2AJVL 1T7VA 5E2VH 3K3QA 2BSSB 4OF0A 2F19H 1AC0A 4S2SA 5GJTL 3IAPA 3C8KA 1R0AH 1ZTXL 2Q8BH 5A1AA 5ISZD 4OFPA 4CJ0A 4TPRL 1HWGB 4FQXB 4NO3A 4ODUB 1JP5A 4K9EH 2ARWA 3A6CH 3BQUA 1QFPA 1RI8A 4M1DL 1IM9B 2QHLA 5DHYB 2LABA 3DMMB 3KVQA 5F9JB 1CFVH 2E9WA 3CPLA 3B5TA 4MS8D 1IGIH 3H0TA 2AJUL 4GRLD 3WIHL 4WWID 3QIWB 4Y89A 3VFPB 1CFSB 4K71B 3ARBD 5LGJA 2BRRH 3LS5L 1WCBB 1I1FA 4PGBA 2HKHH 4ODBD 1ZKAA 4JANB 4S1DD 2Z91A 4OD2A 4CNIB 5DMKB 4PS4L 4L5FH 4JANA 2NZ9D 4HF5H 4M8QA 4PJDA 4ZPVB 4G7YL 4OLXL 3F58H 3HPLA 1S7XA 8FABB 1IFHH 5E2TH 1JF6A 3H2WA 4WRLA 5F21B 3DV6B 4M7KH 2BOCB 5IGXL 4HWZA 1MUJA 4O2FB 4H26A 3MNWB 2QL1A 4L4TA 1JCKA 3QUMB 4O5LH 1QD0A 1RURH 4CL7A 2IADB 4X4YA 5DQJA 4ONGL 3TO4A 4XNUH 1XIWB 4GS7C 3RY6C 2R56L 5I66B 4QOKA 1I1CA 3MLVL 5C0AA 5BZWA 4FQJH 4HQQL 3CX5K 1FO0L 5E56A 1KB9J 2A73A 2HN7A 4Z7WF 4ZS7L 3AM8C 3IJHB 4CVXA 5AWNH 2A74A 4L8SC 2WWMD 2FGZA 3H3PL 4R90H 3DUHA 5DR5H 4F33A 3DO7B 4ONHB 5B39A 1HWHB 3ECBB 4Y5YB 2YXFA 1C1EH 3U82B 3O45A 1BD2E 3QEHB 4MAYD 4Y4HB 3ARDB 3V5HA 3IT8D 5JW3H 5F9OL 3QUKA 3NCJH 1KENH 2YZ8A 1NDGB 1JMZA 2GTWB 4ZFFA 5B21A 3MV7E 4B53A 5IW6A 3Q1SL 1JWMA 5CJQL 1YEHL 3O3DA 2OZ4L 2J6EL 3MLWL 3QULA 2Y07L 4PRIA 5JXAH 4NM4H 4HWBH 1TVBA 1SMOA 1KT2B 3PXJA 3TYGL 2Z31C 3HFML 5LJYH 2XZZA 5D5ME 3DRTA 4X0KA 4JO1L 3MFFA 1K8DB 3D9AL 4BK5A 5EUOE 2J5LB 3CVHB 1B0GB 3TZVD 4Q0XL 4G80A 4I77H 3AY4A 3H42L 4HS8H 2R1YA 5IIEA 4RWYH 4Q97A 1NCNA 4UV4L 3HLAA 5I19H 3JV5A 1JPFA 5D6DC 4HJJH 1IZJA 3C2AH 3UTSE 2W65A 2YA2A 4JCMA 5F1IB 1RZ8B 4KKAC 2EIZB 2OK0L 1I1AB 4OJFL 1L7IL 2W1NA 4X5XB 1DLHA 5I18H 3LB6D 1T2JA 3TT3L 4RWYL 1KCLA 4NN7B 5E00B 4YXHH 5C08A 4LVNB 4HH9A 5F96H 5DTFA 2Q1EA 5B38G 3BDYL 4K7PY 3SN6N 2Z31B 3C5ZD 3H42H 4ZUWB 2XG5A 4HH9B 4V1DD 2OTUB 4XC1L 3IFOA 4I3RH 4JHAL 2YR3A 4BFEA 2OLDA 1T0NB 5T3XL 3FQTA 1A6TA 3VFMB 5FM5M 1NMAL 4FZ8H 3I6LD 2PTVA 3EO1A 1VPOL 3MJ7B 1IAIH 4HWBL 4YZFF 4G6AD 4P4KA 5ID1B 4UT7H 4OCMC 5I1EH 3Q1SH 2JF1A 4JFOB 3IVKA 3HN3A 3OKMA 3V0AC 1PG7X 2JB5H 3EOTL 2VIRA 1G0DA 4BJLA 5MERB 1M7IB 1KENL 1UM4H 1ZLVH 3AU1A 2BHZA 3EAKA 1MHPL 4JQXC 1S7RA 4F7CB 4Q9QH 3MUJA 2X1OA 2AJZA 4F37F 4N8CL 2K9UA 2BXZA 2FHCA 4F7CA 4XRCA 5D6CA 2RBLA 1A9EB 2OL3H 5FECB 1U8IA 3X3FL 4BELD 4LLMA 3CFKA 2AV1A 1RJCA 5JW4N 4QRPE 4U1IB 1T5WB 1RZFL 4JM2A 1ITCA 3DYPA 2NTSP 1ERNA 4WWKA 5K9JH 3O6FD 2NX5E 3GKZA 3S3SA 3ZKXC 1KC5L 5I15L 2YBRB 1K8IA 5JIKA 2VLRE 4ONGH 3FCTA 4QGYA 5HVHB 2WLYA 3H3KA 5JR1L 1HQRB 5KBNC 2CD0A 2VZTA 3FRUA 3R4DA 3VI3E 2LTQC 1OARH 5A2FA 2AEIT 3VH8B 1GYAA 4OM1H 1MEXL 2I60H 4P46D 5EIVA 3RBSA 3QWOB 2PTTA 4UU9B 5F1OB 4LLYA 1CE6B 3F58L 3W81A 4NQEB 4BSVB 4L5FL 5LGKA 3BDBA 1HNFA 5J1TC 3UJIH 1XCTA 3BWAB 1W8OA 4KJYB 2ZSWB 1A3RL 4JFXB 4JEGB 3O6LH 1UCTA 5D8JL 4GXUN 4DUWA 4HKBB 1SM3H 3HNSH 4RMTA 5IFAL 4NHUB 1EEQA 1YEGH 5BJTB 4PRID 4HK0B 3ZKMD 2LQRA 4XP6L 3WNPA 1C16A 1F6LL 4MA7L 4KHTH 5TJWK 3SDDD 4M48H 4U7MA 1PY4A 1EHLH 2G9HB 2EKJA 2A9NL 3TBVA 1J8HB 1RHHA 4MD4A 5HYQB 4DGVL 4OFYD 3N85H 5KG9A 1MRDH 1DQQB 1Q1JL 3CCHB 3T77A 1ZTXH 3S36X 1WT5A 4OAWB 4PJDF 3IKCB 5GS1A 3QQ9C 3DJ9A 3PHSA 4Y19D 5CEZD 2LTQB 1S5IL 1NMBH 1F42A 4KKCD 3FQWA 4YIQB 3BKJH 3EJZC 1UA6H 1MPAH 1DLFH 3JTSA 3MYJB 1H9VA 3GB7B 4HPOL 5LAXB 3PWNA 4YX2L 1Q9KA 2D4DA 1KTLA 4HEPG 3LKNA 2WUCH 3FKUS 1A3LH 2OQJB 2QQQA 1QSEB 1R3KA 1ZT1B 3GSNH 3PWPA 4G8EA 1XIWC 4GXUM 4M02A 3NN8B 2J8UF 1FVDA 2Z92A 3DIFA 2B4CL 3OGCB 1MI5E 1UKTA 4PV8B 1FH5L 1VGEH 1YY8A 2R23B 5CCKL 5IFHL 2ZG1A 3B5HA 4A6YH 4G3YL 4FQ2L 1ES0A 2C3WA 3SOBL 35C8L 1U8OA 3OKEB 3C5SA 2VUOA 4XWOD 3OKEA 3UC0H 2PYEA 5J6GA 5T3ZE 4PTTA 1NUGA 5D2LE 1TCRB 2P8MB 4N8VB 4HUWA 1BF2A 4HCRL 4XNZB 1SQ2N 4LVOC 4S0TD 5C2BL 4MMXC 3CSPA 3HB3C 4ELME 5F89A 3SQOL 3DHMA 1MUJB 2RJMA 3GSWA 4JFDE 2EYRA 5E9DB 3TESA 1MWAB 4PJGE 1N59B 4Z76B 2X4QB 2DLHA 1QRNA 1OGTA 2V7HA 2R4SL 2GCYA 5FGCB 4E5XA 2XWTB 1ZHKA 1N4XL 4HIJB 4NKIH 1A7RH 1TJHL 1U8QB 1Z9SA 2F74B 1D9KD 4NDMA 1AQKL 4R2GC 1FP5A 1A22B 3B8YA 1NCTA 5HHPA 3ZKQD 2KUTA 3QUZD 2LVEA 1WZ1L 4X6FB 4X4XA 5DDHA 1EZVY 4U6TA 4GBXC 4NZUL 4Y5YA 3ES6B 4J1UA 3CAFA 3KYOA 4DTGL 1AKJA 1G9ML 4HK3J 4YC2C 3MCG1 5DGRA 2NY2D 15C8L 5M7QA 1ND0B 4JM2C 2HFFB 1I8MB 2GK0B 1EVTC 2AGJL 1JF5A 2R0WH 3IS0X 4MVBC 4X98A 4MD0A 4XMKH 3S35X 1IGTA 3SKMA 4AEIL 2PO6A 5A3ID 3KJ6L 3IFPA 5HHOB 2YWYA 4MD0B 1QFOA 1XGUA 2DQDL 2AEQL 4MJ6A 2KZ1B 2XA3A 5HI4D 2QV2A 3QEUA 2R15A 5EORL 5JUEH 1DN2A 3BZFA 3OJ2C 4JDTL 3LKRA 3MLUH 3PUCA 4QYOA 1DQDH 4JQXA 1K8DA 4PJBB 4NWTL 4HS6A 4LVNC 3UZEA 1A4KA 2XRAH 2VDPH 5IIEB 4JZJB 4NQDB 1RUAH 1CFTB 2ICWA 5SWQB 4X99B 5KANG 5I76A 1F97A 3NH7L 4YFEA 1WWBX 3QSKB 1CICC 3U48A 5FGCE 2DBLH 4L8SB 1T5XA 2QR0B 1FNGA 4Q9CA 2KQMA 3HUJE 4PRPB 4PJEF 2EIZA 5IVOA 1DBJL 5BVJB 1XGPA 5IVZB 3JVGC 1OPGH 4PRPA 2EDQA 3HA0A 2FDBP 2XRAL 2UWEF 4JN1L 3O9WC 5IVZA 5BV7C 2R39A 4RA0C 3LH2H 3MA7A 4MNQD 4B0MM 4LSSL 5GSRA 3QDMA 3PWUB 1J0ZA 4MCZB 4U4BA 4OI9A 1XAUA 2D7NA 2V6HA 3MRJA 4P49A 1CDYA 4GMSL 3LCYA 3FQTB 1G9NH 4X8XA 2FECI 4KK9D 4CU8A 1KXQE 3BPOC 3FB8B 3PL6B 1YDPA 4NKOB 1MCPL 3HMWL 3UTTE 4NJAL 5KSUB 3CC5A 2XTJB 5B38A 1PYWB 1NL0L 3ILQD 1WEJL 5GS3A 3U4BH 3OAYK 4EBQH 4KTEH 3OKMB 5I1HL 1NEZG 3SDXB 3DUSA 4L4TD 2OTWA 3AS1A 3QUMH 5T1DH 5C0BA 1ZLSL 3VJ6A 3LN4B 3VFNA 43CAB 3CFCH 1R3HA 4LLDA 1KF9B 4WHYH 5ESVB 1IM9A 4NKIL 4CBPA 3LQAH 4J2XA 2R4SH 1WAAA 2ZNXA 4PJHE 1FFNA 1FE8L 4YHNA 1G7QB 4QXUL 4L8BA 1FFPB 5EOTB 4GBXA 3FCTB 1FFPA 3B83A 3KJ4C 4NFDA 4X7SH 2G75A 4NFCA 2VMFA 4QRPB 1NGYB 4X5WA 5IV2A 4QOKD 3INUL 1JE6A 4NQDE 1MJJB 4ODWB 3QEQD 3ULUC 2HTKD 3A6OA 2X4UB 4H25A 4ELKA 4K23L 4O2FA 5KVEH 2FHBA 3K4AA 3OTTA 1A6WL 1VFBB 4HG4J 2DN7A 2NY1C 3DX8B 1FO0A 2F53A 3EDJA 5C09A 1ZGLB 2VC2L 3DRQB 1BZ7A 4GSDL 4TSAL 1RU9L 3MGTA 4KJYA 4LCUB 1LEGA 3LRGA 5DD0L 3AMKA 4TVPD 2KL6A 3MGTB 1MREH 3TIDB 1AGDB 1KJ3H 5B3JF 1NBYA 5EPMA 1JVKA 3CSGA 2E9JA 5ICXA 3QXTA 1E27B 3CZFA 1OM3L 3OR6B 4ONHA 3I6KA 3I84A 5IB4A 4U1HA 3SDAC 5EFIA 1S7WB 3FQNA 1KPVB 4PG2A 5KG9B 3T2NH 1KPVA 4NM8L 4DVRH 3MZTA 2A2QT 2YD5A 4NNXA 4QNPF 3MBEB 1DLFL 1I4FB 2YA0A 3KYMA 3BKJL 4ZFFB 2A6JB 2EYTA 2O5YH 1JPTH 1JWMB 4PJCA 2WUBH 4NQCB 3L95B 2DDQL 2WV3A 3DV4A 3C5ZA 4UV7H 4PRHE 3L3KB 2WINB 2M26A 4PGEB 1KIUA 1MRDL 1KB5H 3PWVA 1H5BC 1YNTA 4HAFA 3PWPB 4F57H 1HXMA 3WHE1 1B6DA 1EHLL 3D3VA 3CVHA 1IGMH 1UQSB 3T65A 4PP2B 4KHTL 4LCWE 4LDLB 5IEHA 4CADA 2D7TL 3RNQA 3L5XL 4RGMB 5IUSA 4Q7DA 5C6TL 2IAMC 4KRPB 4LMQE 3G5XA 4QRPD 4DWHA 3PIQB 3WNKA 2VQTA 3C9NB 3EYSL 4UBDC 1A3RH 2V2WA 5J9PA 3MACH 4PB9H 4PUBL 2NX5D 3C9NA 2NXZB 3PDDA 3V95A 4MXQC 5D7LA 2XA8L 1EGJA 1SMAA 1F11A 2GK2A 3F7YB 3IF1B 4W6YB 4GAFB 2YSSA 1MEXH 4N8VA 3PHQA 3FO1A 5GGQH 4EQ3A 1RK0B 1SYVA 4U31A 2NZ9C 1VHPA 5DD1L 4IHOB 2UV3A 3QIBA 1ZLUK 3MRCA 2DQCL 4JRYA 3TYFB 4J4PC 4Z76A 2EECA 1KEML 3TBTB 3WDJA 1NPUA 3TNMB 1E4JA 3F5WA 1QBLL 5J1AA 5HHOD 3RWIA 2H1PH 3F7PC 2XWTA 4K3EH 5ILTH 4MA1B 5A40E 4WGWB 3V79C 3B8SA 2ZCKH 5D72L 1X6NA 2FGWH 1C8PA 4I18C 3IVKB 3GMNB 3EFDH 3B9AA 3ULUE 4Z0XB 2DQEL 2NY0B 1EFXB 3QBTB 5KVDL 2FATL 4GOSA 3VGAB 1A0QH 4RFNC 4Q9QL 4LPVA 4ZFGH 5D2NE 1HH9B 5H94B 1IKFH 2OP4L 3HNTH 1DDHB 3KPRA 5C0DB 1PVHA 5D5MB 3FONB 1UZ8B 2YK1L 1HILA 1S7UA 2WZPD 5IQ7H 4FQ1L 2HFFA 3VXUB 5LG1A 4RMWA 2B1AL 2PKDA 3T3MF 1QQDA 3OF6A 3PJSB 5DLML 3MRKB 1MI5B 3O3AA 3QUXB 2VTFA 3FFCB 2BSTA 3ZL4H 2EEBA 2EDBA 2CIKA 2VH5L 4PRPD 3PJSA 4ALAH 2E6PA 1I3RB 4PJ5B 1K8IB 2HLFC 5HI3D 2VLKB 5CZVL 4PJ5A 3AFLA 4XC1H 3T4AB 4JM2F 3UDWA 5I1CL 3DX6B 3HMXL 3R0MA 1I8LA 3X13B 4R3SA 3T08A 4U1SA 5F96L 2UVFA 3VD5A 3LHPH 3QEGH 3D3VD 4X6EA 3P0VL 5CJBA 1L7IH 4S1QH 4X9GA 4NKMA 3C5JB 3DSFH 1HIMH 4PGJA 3D69A 2CGRH 4FQHB 5EO1A 1J0IA 4M6OH 2V5TA 3WKML 2ZSWA 4FQHA 3W82A 1Q8MA 2EDKA 4LKCA 2OJEB 3G6AA 4PJFF 3RNKA 4TUJB 5HGAA 2FIKA 4RFEA 4WW2A 2WBJA 4ZAKA 3LEVL 2DQTH 2A6IB 1NMCC 2VXVL 1XGPB 4HK0A 5E5RB 3O4LE 3FFDA 2PW2B 4I77L 3DYOA 3CSBA 4E41A 4Q0XH 5D7JD 3EZ8A 1OAXL 5J12C 1LK2A 4NN6B 2GUOA 3KYNB 5H35A 4PD4K 3S34L 2R2BA 4LSPH 1PZ5B 1YQVH 4MD4B 1IEBB 3OKKA 1JNHB 4KI5F 1G7JB 2E7BA 4P23A 4FFYH 4YBQC 4OAWA 4MCYA 5DJ2A 3BPCB 3TIEB 2UUDH 5JXAL 4WHYG 3U9PH 5SX5H 1XR8B 1NFKA 1KIQA 3OJDB 1YEHH 5ESAA 2CKBH 3BGMA 4P57A 1RMFL 4LLQA 1XF3A 3TCLB 2AV7B 3D48R 3FQWB 3BGMB 3VGHA 1CZ8L 2VXQL 3HUJF 4LPYA 1T03H 5INCA 3D18B 3I3BA 3DNKA 4HBQA 4QHUA 1HE7A 1U9KA 3H9ZA 2CDEA 1WLHA 4I0PA 1N0XL 5EG6C 4EUPA 3QCVH 1NMCB 5FYKH 3E2HB 1IC5L 1JYVA 4XHJC 1G7MA 3EGSB 5F6IB 4JO2L 5CS7A 1NGZB 4IOIB 5C86A 2IH1B 4LHQB 4OF8A 3LN5B 4G6MH 1ORQA 3MLVH 5FUZL 2F5AL 3T2QA 2RFXA 4OSUH 3QPXL 3WEXA 5E0QA 1BVKB 2VQ1A 3MRLB 1M71B 3MLZL 3ZDXE 1FDLL 1RURL 2UZIH 2YC1B 4O5LL 2H9GA 3T0EA 5HPMB 5L2JA 1P6FA 5DK2B 1S8DA 2P8MA 2AXJA 5DD5L 3QQ9D 5DEGA 2CIIB 5J06A 1CI5A 4LEOB 4JFPB 1MJJA 2VL5A 2J1KA 3CLEH 3SE9L 3D25A 2GFBB 4FXLA 5CD5C 2Y9RT 2KPNA 5I1LB 4WDIB 4Z5RA 2NY7L 3TO4B 3LS4L 1XIWA 1QSED 3QUMA 4IOFC 1KELH 4LCWA 5GSVA 2J88L 3VI4E 1GGCH 5L6YH 1RZKL 4XVUC 1P4LB 2BVQA 2MKLC 5JHDA 4LCWB 1YJDL 2A73B 3CFEB 3Q2CA 5JHDB 2VLJE 5DZOA 2EC9T 4JKMA 1T7YA 5EN2A 2DS4A 1FGVL 2IAMB 1KULA 1JUFA 2Q8BL 3RPIB 4I3SH 5IB4B 3HRZA 5GJTH 1QEWA 5EOCH 5FFLA 2YD6A 1J0YA 4HT1L 1F6AA 4JHWL 1FZKB 2LFGA 4HHAB 5DJ6B 2FR4B 1NUDA 3KG5A 1XGYL 3KS0H 4GW4A 5I73C 1DVFC 4GT7A 1FL5B 4NQCA 1JK8B 3S36H 5CBEA 4F7MA 4ENEC 3KPLB 1XF2A 3V4VL 4KGJA 3RX7A 4RRPA 1WIPA 2X2YA 2IPKB 1VFOA 3D39E 1DUZA 1INDH 5BW7A 3L3IB 1T0MB 3ARBC 4AIZB 5LQBL 2IPTH 1VENA 5CGYC 4Z78B 2F8XC 4X6DA 1LNUB 2KH2B 5F72S 5TQ2H 4K7PX 4GG6E 1UJTA 3MV8B 1UEMA 1XZ0A 4X6CA 2CDGB 5JQHC 1W0VA 5HGHB 4KJWD 5HYJB 1B0WA 1JPFB 1LD9B 4K3DH 3ZE1F 1BD2B 2V2WB 1R3JB 4G5ZH 4Z77A 1J0KA 1T5XB 1F58L 3HZKB 3SJVA 5ICZB 2HFTA 1YEIH 3WNMA 1MFNA 1KN2H 1F11B 3IF1A 2IBZX 4U1KA 4NQVB 2YXMA 3HC3H 5DD3H 3TZVB 3UAJC 4HFUL 3SGDH 3MUZ1 1U3YA 2E27H 3NBNA 4N5ED 5FA3A 5DC4B 1SBSL 1QSZA 1TIUA 1IAMA 1BJ1J 4BSWA 4KK6C 4CVZB 1ORSA 1JPGB 4JFDB 1NCWL 4ZYKB 4XPGL 2HFEB 1FIEA 5J1AB 1ZLVK 1JPGA 2EH7H 1EMTH 4JFDA 3TEUA 2AJYL 3TBWB 5D9SA 2DMKA 3GMPA 2OXHA 2DIAA 2RCSH 4FP8H 4P4KB 5ID1A 1WTGT 1JHLL 3QH3B 4X6CF 3SDXA 3EYQC 5E6ID 4EXKA 1J0HA 1X4XA 3P11H 3GSNA 1M7IA 1CVSC 4OT1H 1E4KC 1OCWH 2X10A 3WYRA 1OD9A 4HKZA 4Z95H 1KJVA 43CAA 2P5WB 2V9TA 4IIQA 1GOGA 5LBSL 4D0BB 3O4LA 2XZAL 2Z31D 4FRWA 5JW4Q 2ATPA 3ZKNC 1BWWA 5JOFA 4LQFL 4MLSA 3SE8H 5TDNA 1XIWD 5DT1L 4KQ3L 1MIML 4OLUH 2YBRA 1G7QA 3MLXL 3LRSB 1YZZA 3VRLF 3QEQA 2NXZC 5EOTA 5DUMH 3VD9A 3CH1A 1AHWA 1CG9B 1QFWH 2XN9D 1S5HA 1NGPL 1QLRB 3QCUL 2XQYK 4W4OC 2DLGA 5D70L 1PW3A 4WENB 3VI3F 4WTWA 3FAWA 4MAYC 4LSUL 1TETL 1GIGL 5K59F 3ULUH 3C5JA 3QG6A 4XWOC 2X1WL 4RWHA 4MA1C 4K8RL 4P2QD 4TSBH 4L9LC 4LVHB 5DK3A 4ZFOB 4KQ4H 5F9AC 1KG0A 5KAQG 5I1IH 1HSBA 2GSIA 1DBBH 3PDGA 1I8KB 3BQUD 3S35L 4FZEL 3VH8G 1OF2B 3MRMB 1E4KA 2QJDA 1OD7A 5KTEL 4F2MA 5BJTA 3WFCH 1CLOL 4FQXD 4J12A 2GUOB 3KYNA 1OAZH 4J3TA 1CF8L 5E7BA 4RFOH 1GZQA 3E8UH 3HC0A 1Z9MA 2VLJB 4YUEL 4EOWL 3HE6D 3IETA 4QEGA 3ZYOA 5E08L 1L4IA 1N6UA 5FYJH 3LEXA 5T3ZH 2MOVA 2YUZA 2VXSH 4HUMB 1OSPL 2P5EA 1DEEB 3GIVB 4YIQA 3KYMB 1BVZA 3P2TA 2H2SC 4JRXA 1A2YB 4AMKL 1W0WB 2ZNWA 3UJTL 2YZ1A 3HAEA 5GS1C 3QDGD 1UWEL 4JHBA 4HIEA 1CXLA 4R0LB 4NO5A 5FUOH 2RGSA 3HE7A 4OZFA 1HHGA 3UEZA 2BHYA 3GSVA 1IL1A 3T1FA 1J18A 1JL8A 2Y06L 1KLGB 3PABB 3KWWB 5MHSD 2C3HA 2PTUA 3B5GA 5EUKA 4PP2A 1KLGA 2C26A 2CLRB 4HMCA 3BSZL 2CLVB 3U46B 2QQLL 3OGCA 5K9OB 3L3GB 3RGVD 4P9MH 1F3JA 1JRHI 5C0EB 3L3GA 2V2XB 2PO6D 4LHUA 5C0EA 3W9EB 32C2B 5IROA 5TFSH 5LGJB 4XGZB 3S97C 1X9QA 1VA9A 2CJUH 3EOAA 2G5RA 4Z8FH 3BIAX 3UYRL 3FT2B 4HUWB 1DBAH 1RIHH 4H0HB 1J05A 5C0IA 2PYFA 3BZEB 1OWWA 4ZPVA 2FBOJ 5EIIB 2VDOL 1TCRA 3QUZA 5FO8A 1WTLA 2XQBL 1RIUL 4RGOL 5EDXA 5FO8B 1BBDL 4UINL 3RZCD 3D87B 1FAIL 2DBJA 5BV7H 5FOJA 3I02B 5F89B 2YPLE 3J8F7 1DL7H 5C70A 4YDKL 2DQHH 4ZD3L 4WW2F 4XCFH 4R97B 1AR1C 3EYVA 3NCEB 1U8QA 5FKAA 4FFVD 4XNQB 1TQCB 2DQHL 3OKLB 2X9XA 4Q74A 4OZIF 4X6CE 4G42A 2IGFH 4ZUVB 1T3FA 4LLUB 2EDHA 5EBGA 1F90H 1BBDH 5C0CD 3ABZA 4LLUA 4Z7WE 4PTUB 1WF5A 1B4JH 3SE4A 3S88H 2EKSB 4NC1C 5LCVL 3KJ4B 5IHBA 1QBBA 3QI9D 1T66C 5F7EL 3O45B 1ZVSB 4GRWB 1AIFB 4PJ9B 4GKSA 4OCWL 5JMRA 3U6RB 1I8MA 4LPUA 3REVA 1OW0A 1H3TA 5IR1A 4TVPL 4G6AC 1AKJB 2VSDA 2VXUL 4AK1A 3PWLB 2CJUL 3K1DA 3UYPA 3P9LA 1FRGH 3EO0B 1ZHBB 3NPSB 2VZSA 5CEXB 4YGAB 2CIKB 3EO0A 1ED3A 1B6UA 4GG6F 1N3NA 3CVHH 4CDHA 3BZFB 3D6GA 3QXVA 3I3EA 5I1JL 4XPFH 4KJQD 4LRNH 5CJ8A 1EH9A 1TQCC 2AJSL 2QADB 4PJHA 5I8OH 4X0KB 4PJ7F 4WFGE 3U36A 2FX9L 1ZSDA 1CD0A 2AXHA 2B5IB 4CN4A 1CL7L 2FZ3A 1YN6A 4N90E 3VXMB 2B20A 2CRYA 3BZDA 1IAOB 2VRAA 5F1NB 5FUOL 1YN6B 5T1LB 5D1XA 3C09B 2NY6D 4OLVL 1IAOA 4J3OC 3T4YA 1GGBL 4GAJH 1QHOA 1BEYH 3O8XB 4MXVE 2HVKB 3HZKA 4RFEB 4UDTB 2DICA 1F4YL 4A2MA 5E08H 4MX7B 3IB4A 3F12A 5E1AB 5GS0C 4M03A 4HWBA 1UACH 5IBLC 4D0DB 3IFLH 1T1YA 3S3JA 2E3VA 4AENA 1PZ5A 1TTUA 2CUMA 1AD9B 3JV6A 3V2AR 2OTUA 4RQQA 1GPOH 4UQ2A 5HGBB 2V9RA 5L2KA 4Z7UB 3PWUA 4FMKA 3PV6A 5KTEH 3SKNB 5B22A 2I9TB 5IM7B 3SKJL 1TJGL 1FVEB 1MCHA 1DBBL 2K3TA 3FB7A 2P24A 3KYKL 1H8NA 1BREA 3FB7B 5KSBF 4JZJC 3V6ZB 3TO4D 1I7RB 2AK4E 2A6KA 2EH8H 4WWKD 5FA4A 1IGYB 3QH3A 5LGHH 1KIPB 4OD3L 3JWDC 2FYYA 3FB6B 4JE4B 3TPUB 3LKOB 4WW2C 4HKZB 3VXRE 5L0QB 5HI4C 4IIQC 4B7LA 1A9EA 3BH8B 3GRWL 3NIFE 3VE0A 4D3CL 2BNQE 3BQUC 5J89A 4BH7B 1JI2A 4YHNB 5C09D 3DUUA 3FAXA 1JN6B 4UB0L 5DT1H 2CSPA 4WWKB 3HCVA 4L1HA 1LO2H 2H6PB 4C83B 3IU3A 4X6DE 3G6JF 3ZTNH 4MQTB 1NGXB 4JY4B 4M7JL 5HPMA 5L2JB 2W9DH 2ZUQC 5DMKA 3K8MA 4NQTA 2HTLC 2VDKL 3VG0H 4U6XB 2H2SD 4N0RA 1IAII 1EHXA 5EUOA 1U8HB 5D7SL 1MOEA 1AO7E 1RFDH 4GRMA 4PJ7E 3P11L 1WT5C 5EWIH 3OB8A 4P3CH 4Z7VB 2F53B 4LLYB 2ORBH 5D2NA 3S6CA 2VITB 2O5ZL 3T0DA 3STBA 1VFBA 1BFSA 2IQAB 3MV7A 4YFDB 3W11C 3FOLA 4KHXH 3RZCA 5GSVB 4U3XA 5HDQL 5D7LD 2Q86B 4GUPA 3QNZB 3RWHA 3WFHA 1RZJH 2ZOLB 3KPSD 5C0AB 1I75A 2EYSB 1D5IL 1NCWH 2GJ6D 1D6VL 2N7BA 3QP3A 5B3JE 4LSVL 2ZJSL 4HPYL 1JZ7A 1UB6B 1HDMA 4U1HB 5CD3A 3CZFB 2K1MA 1KLUB 2R1WB 2NY6B 4I18A 3CFDB 5F3BA 3QDJA 3OB0H 4HXAL 4XC3H 2BC4A 1U8MB 2VLMD 1QFWM 3HC3L 4JY6B 3VXMD 3BPLC 2BC4B 4NNXB 4WHTB 3O3EB 4DCQB 4JY6A 1MNUH 4HHAA 3TA3B 1QO3A 1NDGA 1M1SA 2QSCL 4U6VL 4G5ZL 2H32H 3CFBB 3FMGH 3L3KA 4CMMA 1T0PB 4J4PA 1I9JH 4QXGL 3AAZA 5TDPB 1TVBB 2YEZB 1WC7A 1CLZL 4Y16D 1UKSA 3U83A 3VA2C 3D3VB 4KDWA 1R3KB 3EOBB 2X6MA 1HH6B 2V5SA 1FGNL 1UXWA 4H1LH 3VFOB 2NY3C 2FWOA 1R3IH 3ARYA 1BOYA 3CXHK 3RNQB 3DIFB 4QY8B 3DVGB 4PD4J 1RZGA 3P4OA 3T65B 4Z7QF 2VR4A 4XMPH 1U8KA 4JGUA 3GSUB 5LKNA 1KTDB 2P5ED 2B2XH 5E99L 4L29B 3VFGL 5FYKE 2R0ZH 5HGHA 2JJSA 5HYJA 4DQOH 5E4EB 4BQBA 1Q0YH 2BNRA 4K9EC 2V9QA 3GHBL 1FN4A 4HKXB 4U1JB 5GIRB 4Y4KA 3UCRA 4R4FL 3HZYB 4JM2D 2H8PA 4M6NL 3OAZH 2QHRH 3DECA 2I07A 2P42B 4CVWA 4CMHC 4ETYA 1VEPA 3MJ8B 7CGTA 4XBPA 3P30L 1TZIB 3TBYB 3PE9A 4XVJH 3AROA 3WS3A 1V3KA 1WWWX 1A21A 2RIKA 2X4SA 2C1OA 2ZCLL 1YEFH 1CICD 4HULB 1K9TA 1NBZB 5L9DH 2DLFH 3HI6L 5CINH 4GW1B 1UZ6F 3HPJB 3QXAA 5JOPD 5GRJL 3ARGA 5F7YC 5INDA 2B5IC 3HI6H 5CINL 3WL9B 1EK3A 3TFKC 1HHIA 1A64A 2NY7H 2ZCLH 1X5GA 2WK2A 4XHQA 4YBHA 3CMOL 1T3FB 4APQD 5MERA 4L3EA 1G1CA 3L9RB 4S1DC 3CLEL 3SE9H 5HY9B 2W59A 2VDLH 3ARFB 1EEUA 1LDPH 1T2QL 5F6IC 5IMOB 1RUML 2OBGA 2NY1D 2JCCE 5JORA 4PJ9A 5E94A 5EC1B 3U6RA 4PFEA 5ELIA 5EOCJ 1DDHA 3KPRB 4KUCF 2WBWB 5DFWH 4WFEE 3IGAB 4S11A 2X7LA 1ZANL 2BCKA 2PXYD 3VDAA 1NDMB 2DYPB 4GXVH 4XNYL 1ADQA 3QNYB 4I0KA 1PLGH 1YYLL 3O2VL 3VWKB 2JB6A 4GRWE 2BSTB 5DS8A 4G6JH 2ESVA 4KRPD 1AHWB 3CH1B 1R3IL 3D0VA 2P7TB 5I16B 3KDMA 3RWFA 3ZT6A 1QTYT 2ESVB 3LKPA 3KLAA 5I9QB 3S37X 1NC2A 1CLZH 3SQBA 4R3SB 3VH8A 4NHCL 5J3HD 4NO2B 1N0XH 3PWPD 4NBZB 3TO4C 4JR9L 2FBJL 5DRZB 1MHCA 4R97C 4YE4L 2CMRH 4X9BA 3TH3T 5I75B 1XF5B 2ZUSA 2FSEA 2DJUA 4U6VH 5D1XB 4N5EC 2I5YL 5I76B 5J6HB 3L7EB 2FSEB 1QKZH 1ZE3C 4YDLC 1INQA 3EJZD 3VCLB 2GSIB 4ZQKA 5GRYA 5JLZA 3G04A 4Y2DD 5C6PB 3GJFH 1INQB 1HYRC 5DRXA 1NJ9A 5CFHA 2NYYD 3MUGA 1OTUC 3OAUL 4PB0H 1CGSH 1OSZA 4RCAA 1WWAX 1RZ7L 4JM4L 1G7HA 4U49A 3MOAH 2Z9TA 4BA8A 5HPOA 1D5BA 2R1XA 2D7MA 4U0RB 3X3GL 3SDAA 5HHQA 2BSRB 3S34H 2ZJSH 4KGLA 4XH2B 2DQGL 5IT2L 1BOGB 4KTDL 2FLRT 3V4PL 3WJJA 1UH3A 4W4OA 2DQTL 3SGEH 4KDTC 4G6FD 1UWGL 5DJ2B 1GGIL 3BPCA 2WAHA 3PQYB 5DJAA 2AERT 1KPUB 5E8NA 1RZJC 3ULVD 3KLHC 2ORBL 4YK4C 2OR7A 3HAEB 2IMMA 3ZMRA 1G7IA 1H8OA 5IP4A 1LEIA 1O0VA 5E95B 3KS0J 2W0KA 4FQIL 4KMTL 1YPZB 3CDFA 3DSFL 5K93A 2FEDD 5GGRA 3QUYD 2BFVH 2DF3A 2QTEA 5I30H 4ZDHB 1UJ3C 1FCGA 5K33A 1T1WA 4XMLL 3LQZB 4OZIB 1J5OL 2ZP0T 5HYSA 5CGYD 3M8OH 3MLTB 4K8RD 4XVTH 3TV3H 3PHOA 2B1HH 2NYYC 4N1HB 4WTZA 5J57B 1R3HB 1U3HB 4UOW1 5I1CH 3D3VE 3OPZH 4PR5B 5D7IE 1YMMB 1C5BL 3RU8L 3LN5A 2E6JA 3U2SA 5L8JB 3DX9B 4UZGA 1JZ6A 3EDDA 4FQLH 1FAKT 3CNKA 3VD3A 3MROA 4EKXA 3H0TB 3BPLB 5H8DA 1LO3L 2H6PA 5DK2A 2C4FU 5AZ2L 4AG4H 4BK4A 4C83A 1TFHA 4P5TC 2N7AA 3I6GA 4L3AA 4C58B 4LCIL 4PJDB 4ERSH 4TNWK 1ACYH 3PG2A 3GMQA 3SE3A 1HHKA 1IKFL 4OD3H 4JAMA 1NGYA 4X5WB 4E0RA 1JHKH 3VFRB 4ZNEA 2YN3A 3K4ZA 1MJUH 4L4TB 2NY2C 1TMCB 2MCG1 4QHLA 4MDIA 4HXBH 5IVXE 1DQTA 2P49B 2E8YA 1SJVA 2FGWL 3RKDD 3RAJH 3PWJA 3MCKB 3NOIA 2ZUWA 5ACLA 5C6WH 1JWUB 2CR6A 4PRIE 3VRLE 1TDQA 4KJPD 2Q6WB 1I3VA 4BZYA 1FC1A 2ATKB 4OGAD 1RULH 1IKNC 5D1QC 1JNLH 5EIQA 4XNMB 3QO0B 4JZNA 1FJ1B 5FYLE 1UB6A 5FYJD 1U6AL 3EFFA 2QSTA 2D9CA 5EN2B 3CXDH 1F4YH 4G6KL 2EKSA 1D9KB 3RWGB 1T66D 1CIUA 4Y19E 5CEZE 3EBAA 4TN9A 2FB4H 3H3BC 5I1DB 3RVVD 1AIFA 5DJ6A 4TTDC 2VLKE 3FZUD 1Z6JT 4CDGC 5GHWH 4RISH 1GGBH 4GAJL 4JFYB 3RA7H 3ET9F 2XA8H 5JQ6H 5D7JA 5DI8B 2F8VA 2ICEB 3VFWA 1FL5A 4KMLB 3QZWB 4XX1G 3RGVA 3IKKA 1S9VA 3PGDA 1XGUB 2ED9A 1NAML 1ZLUH 1U8NA 4PRDB 2EDWA 4J4PD 3DV4B 5HSFA 4PJAE 3G6JB 3B2UD 4OQ1A 3T3PE 2AS5M 4P9HL 2HJKB 5MI0C 2XZQH 4R4NC 2Y23A 4X9FA 2HJKA 3A6BL 3MRBA 5IEKA 2JK5A 1HHJA 4NRXA 2M2DA 3VFOA 3W2DL 4OZGE 3TFKD 2XNAB 3FN3A 4WY7H 1EHAA 1TJIH 3SDAD 3U0PA 1I1AC 4F57L 2C3VA 5BQ7B 1D9KC 4M7LT 1NC2D 3AS0A 4G8FB 4X99A 4QRRB 2DDQH 4PP1C 4G8FA 2R29H 2WUBL 1FL6B 4QRQB 4TNVK 2N56A 4R96A 1LILA 4HKXA 4U1JA 4WTZG 2EE9A 1SEBB 4MVBD 5BVJA 5B39G 2VJXA 3S88L 1NLBH 1ZT7B 1FZJB 3T2NL 5FA3B 3VXTA 2V17H 5TGBB 1CR9L 4XVUD 5C3TA 3UPAA 1S3KH 2W9EL 5HJ3B 2GJ6B 4I4WA 4JZOA 5EZJB 4KDTA 5F7LB 1AE6L 4JO4L 5IB5A 5DRNA 4GW1A 4YDIH 1EJOH 4FNLL 3EO1B 5FYJU 1CGYA 4DFIA 1L7TH 4WO4D 5DD0H 4YZFE 4XBGA 2F53D 3MV8E 4U1GB 1G6RL 4TRPH 4GSDH 1KACB 2VC2H 2DL2A 3QAZB 4RGOH 3HNVH 4TUKL 3CFJB 2FX7H 1J88A 4G8GA 3TJEL 2W9LA 4NUGL 1ZXQA 2Y25A 3O6KH 4ZOAA 5I9QC 1JGUH 4QGTA 3INUH 2XY1A 3T8XA 1P4BH 1C08A 1IJ9A 5H94A 3VFNB 5E4EC 2C5DC 4TQEH 1AP2A 4CRPA 1IEHA 1Z9OA 1UB5B 4LL9A 5D6CB 1NCBH 4JFHE 5E2JA 5CJOL 4WHCA 3SCMC 2H45A 1JZ4A 5TDNB 4D9LL 2V2TA 3GUTA 2VWEC 4U05A 5IBLD 2AV1B 1MFAH 4P2OD 5AEAA 3T3ME 3MJ9L 1KGCD 3SPVA 3MXWH 3RDTC 4JY4A 3UTTD 4XAWL 4PJBE 3OR7B 2Y06H 1W0YT 1PFCA 2XN9A 1CGUA 1L9MA 3DX6A 4KROB 3VXPB 2YD1A 2V5MA 2EO1A 1HQRA 5ISZA 1U8HA 2VZ1A 2KQNA 4Y1AA 4TSCL 1S9YB 4V1DA 1CU4H 1FLRH 4GRMB 4YHYB 4PREB 4MHHG 3L3HA 4AMKH 4ISVB 3ZDZF 5I1HH 4S0SD 3B6SA 3BHBA 4UU9A 2ERJB 5GRZA 3ZO0A 2WWKT 3CDYA 2XI9A 4LKCB 2FH6A 1EXUA 4P99A 4YXKL 2FIKB 5IB2A 4RFNB 3DTXA 3G5ZB 5TE7L 3MUGB 4RBPK 4F2MB 4HKBA 2VYRE 3DTXB 3G5ZA 5HHNB 1OF2A 3MRMA 3NA4A 2FL5A 3K1KC 1S7TB 3MRNB 4LSSH 4KZDH 3MRQA 5JDSA 5SWSE 3LH2L 4JPKL 2BY1A 3JWOC 4YFLI 3F62A 1FNSH 3C6LC 3W0WA 4ZTOL 3NIDF 3HC0B 1I9RL 2OR8A 2EXWC 5DRWB 5I1AB 3T0XA 3GSQA 5E6IC 4P59L 3M07A 2ZCHL 5DF0A 1RUKL 4Y0GA 2IBZY 2VWEE 2WP3O 3MSPA 1II4E 3MV9D 1AGCB 2NXYD 4HIEB 1P7KB 4HAGA 1S7SB 1HKFA 3NH7H 1KTLB 3C5ZB 4H1LA 1AJ7L 4S1SH 5TDOB 4ZXBD 4D8PB 4BFIB 5CEZL 3F6LA 5T1KA 5E9DE 1LO4H 3GEWB 1NGPH 3QWRD 3QXUA 3VG9B 4OF5A 3SDXF 3ZYIA 4ODUA 5IROC 3PHOB 2XG4A 3O8XC 5IJKC 1WSST 4OLUL 4PR5A 5EORH 4KQ3H 5JUEL 3DROA 4YBQD 1IBGH 5IOPB 1R24A 3BAEH 1H15B 3DMMA 3P40A 3TM6A 2DQDH 3DX9A 4LQFH 3RVTD 1T7WA 4YXKH 3OXRA 5GGVL 3SBWC 1GC1C 2XZAH 1M05B 3BN9D 3T04D 4KI5C 5IG7B 4DFHA 3FT2A 3KPQA 2EDXA 2EZ0C 2R0WL 4WFHD 1A1MA 1D6EB 3IDXL 3LQAC 5EIIA 1G9MH 5ENWB 4M8QB 3UTSD 2X89D 1TZIA 3FO2B 3TBYA 1P5UA 1QLEL 1JHLH 3X14A 4MNHA 2ZPKL 5B8CC 2HT3C 1MHHB 3QFJE 5MEND 1WIOA 3WO4B 3U79A 2VLLB 1MHHA 3TBTA 4Z5RB 4LSQH 3EYVB 2DJ4A 4XPGH 1I3GL 1ZEAL 4P4KC 1A4JB 1N4XH 3CVIH 1AY1H 3QO1B 4UIKH 5FXCH 4GMTH 5ESQB 1MFCH 4K7PL 2NY3B 4Y4HD 5CAYB 1MFAL 2J8UA 3N50A 2XWJA 4D9LH 3TVMB 1VADB 2NXZD 3ARUA 1N2RB 5DYOA 5BS0D 5F8RC 3IJHA 2FX8H 3ZKMC 4HFUH 4M62H 3SQOH 3QWQB 2HJLB 3OHXB 4TQEL 3WFEH 1IMHC 5C2BH 3MXVL 1BGXH 1G0XA 4L4JA 5D1ZB 1YEIL 2WIIA 3FRPA 3QHFH 3K0WA 3AUVA 1S9KC 1L0XA 4RX4A 4FG6D 3J7HA 5E8DL 4JFYA 5EOQH 2PO6B 5EULV 3P4LA 4X4ZA 1U92A 3UBXA 3REWA 4MMZC 3GKWH 3PGCB 3SOBH 3VWJC 2VDQH 3WO4C 5DA0B 3DO3A 1GOHA 3WIFA 5AUMA 4Z7NE 2OR9L 3Q6GH 4ZO8A 1CDCA 3P9WB 1KCVL 1WBXB 1EJOL 4FNLH 1JIBA 4HS6B 2EDLA 5IHZA 4WI8A 1MF2H 3LKPB 3MRFA 5AG9A 4LVHC 5A2IH 4X9IA 4AIZA 4HUVB 4EIGB 3ARBB 4HIIB 4DEPB 3BMVA 4ZUUB 4WUUE 5CUSH 4HSQA 2XFXB 1BFVL 2G5BB 4MJIA 4QNPE 5IKCB 3NZHH 3W11D 1V3LA 1I7TB 1XGYH 2ZG3A 3WSQH 4XBEL 2EXYD 4Y2DB 4EDXB 4Z77B 3AVEA 1S5IH 2D7PA 1UYWL 4ZXBC 1F6FB 3DX7B 2AK1H 2R29L 1MVUA 3GBLA 1EBPA 5FHBH 5EO0A 4OLWL 1LK2B 4PGZA 3BKYH 5KSAA 2DMCA 4UTBH 4KC3B 4WY7L 2XTJC 2A83A 1LO5A 3O3BB 5HDBE 4AENB 5GRWA 4P46A 3OKYA 3BT2L 2CKBA 2YMXH 2AABH 1FVEA 2IH3A 3K2MC 3BMWA 3PL6A 4LK4A 3O2DL 5F7UA 5IFAH 3PV6B 1Q9WB 1W72A 4DKDC 1MCJA 3O6LL 3D5OF 2JE8A 4XBGB 1Q9WA 1W72B 2XOTA 2J3SA 2VLRD 4XTRC 2BY0A 1Q9LA 2APXA 3IDYC 3GMPB 5JQ6L 1QPPA 1WBYA 3GI8H 3IFNH 4M5ZH 5I75C 3E6FB 8CGTA 1SJHA 2R9HD 3LKOA 1QSFE 2DQIL 4LGRB 1A9BB 4NZDA 3W39A 3CUPA 3LQZA 1AGFB 1OARL 2X4PB 4WTXA 4XRCB 3VJ6B 3VW3H 5FGRA 2Z8WC 4YHML 4Q6IB 1L9NA 1DANT 1U6AH 1KC5H 5FUZH 4G6ML 1YPZE 1Z5LB 3DBXB 1CDJA 5SV3A 1BBJB 1FNHA 4PJIE 3QI9A 1Z5LA 2HJFB 2WLZA 3DBXA 1MCWM 2P5WD 2Y36H 2G75B 3HCVB 2BK8A 5FYKL 2ICWJ 4WUUA 6CGTA 4XP5H 2A77L 4E9LA 1C5DB 2MHAA 1S7XB 1HZHH 5I2IA 5GGSA 2P1YA 4H25B 4LEOA 2DLTA 2IALA 4BQCA 1JHKL 1PJ9A 2XKNA 2VXQH 2X89A 5E1HB 4H26B 1F13A 1ACYL 1HKLH 4ERSL 2IQAA 3V6OC 5KZCD 5I1LA 4LCIH 1YN7A 5I1EL 2VITA 1LO3H 2OTPA 4JFDD 5AZ2H 2Z4QA 1YN7B 3B9KC 4OBSA 1PDKA 1LEGB 1QFHA 3GMRB 2QQKL 2APTA 5E5MB 2DKSA 4RIRA 1NFDA 5KOVC 1KJ2L 1Q94B 2R1WA 4I18B 1GHFH 4I3RL 4JHAH 5GJSH 1OAXH 2B1HL 2HT4D 3GSRB 4GLRH 5B39B 2BVPA 3D85A 5A2KH 4WI9A 4R26L 4YXHL 3ROLB 1YQ2A 1F6AB 1KTKE 3T77B 5EBWA 1OVZA 1QFWI 5DRWA 1JGVL 1I4FA 1Y6KR 4LEXL 2NW2A 5HYJD 4IDLA 4LEXH 2A6DA 1W0WA 4PLKD 1F3RB 2EDRA 1JGVH 3JTSB 3MYJA 1U8NB 4PRDA 3LHPL 5LAXA 1GGIH 3SY0A 2LAGB 1YNTB 5AAWA 5GRUH 3ZTJG 3FQUB 2YS4A 3UPCA 1U36A 1JZ3A 3BI9X 5GJSL 3PWVB 3ZSTA 3WMSA 1WJ3A 5EUKB 4JFFD 1BFOA 3WD5L 5J0BA 4AY0A 1Z0NA 5AAMA 3DVGA 2XPGA 3ARSA 5DLMH 2RR3A 2L0DA 4OF6A 1IAIM 1Z9LA 2Z8SA 2Y07H 2R0LL 1LD9A 4K94C 3MGOA 3EZJB 3QI9C 5D1QB 5IQ7L 5D7LB 1DSFH 4HBCL 3Q3GA 3I9GL 3K8KA 1QFUH 2MNUA 5BO1H 1IM3A 3TA3C 2OS7A 3U7WH 2PYEB 3B9EA 1DTUA 3KXFB 5K9KB 4XBPB 1D6EA 1J05B 2V5YA 5BVPH 2LE9A 2CMRL 1H3UA 4ZTPL 4JR9H 3RL1A 3WHXA 1QBMH 1AFVH 2AEPH 3R06B 1PKQE 4LSTL 5DR5L 1QSEE 3SCMA 4Z7OF 2ZCKL 4NC1E 2VLME 1QA9B 4K3EL 4ZS7H 3CJJA 2DQFA 5ILTL 3SKUD 3HPJA 4YQXL 4BSWB 4JDZA 3IS1X 1UGNA 2AJXH 1H8SA 3D39B 4CAGA 1KEMH 3WN5C 4XNUL 4I0PC 3OMZA 2QLVB 2X4NB 5DWUH 4DUXA 3WL9A 2ED7A 2RQ8A 5DD1H 1DBMH 1U8PA 5HHPB 4NRZB 4M1CD 3F7VA 4M7KL 1ZHNB 2BMKA 2WWMC 1T2QH 2NY0C 4J1UB 4G7YH 4YPGA 4UNVA 3WIIL 3GI8L 5EO9B 5JDJA 3UAJD 4PB9L 1N8ZB 3TNNB 4MNGE 3EYSH 5HI5C 2GK0A 1KB9K 4TTDD 4X4MA 2Y72A 4Y4FD 5DC0A 3DI3B 4WWKC 1CDBA 1IGTB 1T5WA 5I8EA 5F6HJ 3WJLC 1ZLWK 3WDHA 1CFVL 2VLKA 1YUHB 5DMIH 3B3IB 4D0CB 4KH2A 1T7XA 3KLAB 1CT8A 2DLFL 1TCMA 4MNQE 4NBXB 1KUMA 3KPPA 3KDMB 1A1NA 3TO2A 2N4IA 3RIAK 4NO2A 3UPRA 4JGMA 4LF3B 4LIQE 5DSCB 1NC2B 2PYED 5FHBL 2UYLB 4PJFB 1FG9C 3BP7B 4QHNA 2AJVH 2PTTB 1X4ZA 2LU7A 4QOKE 2UYLA 3SGJA 5ADPH 1Q72L 4C56D 1WFOA 4R4FH 3SKOA 3MODL 4ODHH 3L5JA 3SJVD 1NCCL 3MRGB 5HGAB 2CKNA 3UO1L 1EXUB 4PJFE 4AL8H 1OTSC 1Q0YL 3EJYD 5ANME 1NCAL 4ELMB 2R0ZL 2R2HB 1U58A 2B2XL 4M9PA 4N0UA 4TVPE 5HHQB 2R2BB 2N1KA 3O9WD 4GAYA 4EN3A 4FXKB 4NQED 1VDGA 2NR6C 1D5XA 1D5BB 4PY8J 2J8UE 5E2WL 3MNVA 3FB5A 3SDDA 5K9QI 2X4TA 1KJ3L 3CCHA 3OKKB 5A2JH 3GMLA 1MFDH 5DEFA 3V7MA 4F80A 4W70A 3T2OA 4DJMA 5DJAB 3TCLA 3S96B 4LARL 1DEEA 4KROC 5MP6H 3SGEI 4WFED 3C6SA 4QXGH 3D2UD 1KFAL 3VWKC 4Y19A 2Z93B 4V2BA 5EOQL 5J11C 4Y7MA 5GGRB 1YYMH 3BJ91 4BZ1H 2BJMH 4OCYH 3C6LD 2XQYG 3EHBD 2A6KB 4ZDHA 5BOZG 5BS0E 5KSBE 3CZJA 3ETBF 4PJIB 2BDNL 1XGTA 3QG7L 4M62L 4PJIF 4JO3L 3WLBA 5EZOL 4S2SB 3N1GC 3SE4C 2HLFD 5HGGS 5K9OA 1NGZA 4IOIA 1U0QA 1ES0B 3IDGB 4OZGA 1WFUA 1U8LB 4GMTL 3CVIL 4UIKL 4I9WD 32C2A 1WISA 1MLCB 5T5NG 1FFNB 1MELA 3P4NA 2FJHB 3AC0A 4XGZA 3RTQC 3RRQA 4KHXL 5I1KL 2Z91B 2DLEA 4IRJC 4KVCH 3Q6FA 1XCQB 3AS3A 4APQC 1DFBH 2HMIC 1EFXD 3CDGB 5D96C 2X44D 5J11B 1PEWA 2BXYA 4CU7A 5JW4M 1DVFD 1EIBA 3MNWA 1NL0H 4PG9B 4PJEA 2VDKH 5DVLA 5ANMA 4HWZB 1MCFA 3MCKA 3IXAA 1MCPH 3HMWH 4WNQA 3DX8A 2DQJL 3M1BA 1GSMA 4RAVB 4L9LA 4RMQA 2BVQB 2VZOA 3JV4A 4DKAA 3OKLA 1JYXA 5D71H 3T2PA 3EFFB 4JFQB 1I1RA 5ICXB 3HG1D 3OXSA 1GCFA 1LO4L 1PAMA 1E4XI 4XXCC 5EFIB 1TPXB 3CMGA 3CX2A 2J6EA 4WI4A 3VD7A 5LGHL 3QEHA 5B4MC 1OTTD 2NX5A 1NLDL 3MBEA 3VXNA 4UOJA 4JG1H 3IDMB 5ETUA 1RUKH 2VXTH 1Z3GH 5ETUB 5GS0L 5FB8B 1GGYA 4PJCB 1CYGA 4IRSD 5FV2A 3REWB 2MSPA 1IGFL 4RA3A 3G08A 1WC7B 1YEDA 3B9KB 3KPLA 3LKRB 1XF2B 1PKOA 1DE4B 2ICES 1YEDB 3JWDL 5HHVH 4JFEA 4P3DB 5KN5B 5ITFA 4ZNEE 3U0PB 1ZSDB 2P8PB 3VXQA 4TULH 4WJ5B 4OCSL 2AEQH 5IMMA 3G5YB 5ERWB 4Z78A 1Q0XH 2VR5A 3HS0B 2R1YB 4QRQA 4XMKL 3WS6C 2AGJH 4Z6AT 5HI3C 1XZ0B 2ENSA 3OX8A 4HGWB 3GHEH 1UVQA 2CXKA 4QRRA 3DXAA 1VFAA 1I9IL 4DGIL 1BEYL 3L3OA 1WWCA 3O41A 1AD0B 4PRAB 1A5FL 3O41B 4UDTA 4I3GA 4PRHA 4OLVH 5FCUL 1XR9A 3TZVA 1WZ1H 3A67L 5FYLD 3AXLA 1DLHB 1MJ7L 4BH8B 3M17A 2GAZB 5E00A 1HYSD 2IJ0C 5KVGH 4XAWH 5DHVB 5F44A 2AVGA 3RUGB 4WFGD 4PV9B 3AB0B 4CVZA 5JIHA 5F3HB 2AJSH 3L7FB 4LRNL 1A1OA 4HJGA 5JPMA 3NIFF 3F5WB 5B8CA 3LIZL 1EEYA 1BM3L 4JFZL 3C60D 4GS7B 3OJMB 1N5AB 4G8IB 5DJXB 4PJ8D 4KK8D 4XZUA 4K2UH 1WBYB 3NCMA 3AU1B 5D1ZD 3MJGX 5IW1A 3DETD 4MXWL 3VWKD 3P9MB 4H8WH 3NCBB 3V5KA 5KSBA 1BIIB 1U3HC 3VFVA 1ZGLM 4TUKH 2FLBT 4H5SA 3L5WA 4PJ7B 1F90L 2P5WA 4TRPL 1AQDA 5TQ0H 4UI2A 35C8H 4OV5A 1T1XA 4Y4HC 4FQ2H 2PF6A 3BKCH 1X5KA 1FVCB 3CFKB 4MD5A 4A6YL 5J3HC 5GISL 2V2TB 3ARFD 3FFCA 4YC2B 4J8RB 5CCKH 5GISH 3BKCL 3B9DA 1FBIL 3LRSA 4PJXB 2GQHA 4FFVC 1S3KL 2W9EH 1CR9H 3T4AA 4XP1H 3KPMA 3DVNA 4N90D 2AK4D 2V17L 1GVIA 3SGKA 4QRPA 2WUCL 1ZT4A 2OXGA 4ORGA 3UZQA 1RIUH 1JGEA 5KVMC 1UZ6E 2B0SH 3FRUB 4HPOH 4M5YH 5F7DB 3HTLX 1F8TH 4PGCA 2J5LC 3ILQC 1CS6A 1LDSA 3ZE2F 3RI5F 4MXWH 1M6OA 2OL3A 5KSVA 4LCYB 3RI5K 3DRQA 5AD0B 4NOFA 1QYGH 5DK0B 5AD0A 2MFNA 1Q1JH 2CDFA 4OGAC 1U93B 5DRXB 2EYSA 1H3PL 3LIZH 4MNQB 4Y5XB 1V7NH 1CXFA 3UTPD 4N0UB 1T89C 3MRNA 2HT4C 4MA7H 3QXWA 5DEZA 2PO6C 4XP6H 3KPRE 4CN1A 4EN3D 2CRZA 4FQCH 2XZQL 4Z7UE 1G7LA 3E6HB 3FTGA 1FQ9C 3ALXA 5KVGL 4M9OA 3FOMB 1M7DA 1GZQB 3S4SA 2ZUTA 1PZUB 3LZFL 3O3EA 4YWGH 1DQQA 2NY6C 4JFHD 4F9PA 1J87A 4PBVC 2ZUXA 1K4DA 1EV2E 3D2UA 2YUVA 1T21A 1S7SA 1A6VL 1K4DB 4WI2A 5JMOC 4S10A 2H2PD 1LEKA 4OM1L 1KLFA 4NN7C 2YEZA 3RZCC 3S37H 3KPSE 3VXRD 4F9LC 4OFYA 3NN8A 5T3ZL 1Q9KB 4ZMAT 2R0KH 4OZIA 4EOWH 4R0LC 3LKNB 1KXTB 5T1KB 3E8UL 5CZXC 4EI5D 1JGDA 2NLJB 3BDXA 5CSGA 2DQUL 2X1PA 1HXYB 1JNLL 1NCDH 3JWDH 1KTDA 3QZWG 2AJ3B 5DHYA 4OLYL 1RV6X 1HQ4A 3CXHJ 3H9YA 3KPSA 4X8JA 2WM0A 2X4OB 4K94H 4TNWF 1CTOA 2BNRE 3FN0H 4HXBL 1I1FB 5J6GB 5FIEA 2C4FT 3VFSA 4Q9BA 1EEZB 3JXAA 1A7OL 3ULUL 1MHPH 4X6BA 3MJ8A 1HHHB 1YEKH 4H0IA 1X5LA 5J13B 4QF1A 1XGRA 3R06A 1GOFA 1P5VA 4YHZH 5GGVY 4AG4L 3WE6B 1U2HA 3UTTA 3FO0L 1QRNB 2NCMA 4C56E 1PX3A 3RWCB 2VDRL 4KJQC 2O61B 4FZ8L 2IADA 4RAVA 3O11A 5D71L 4PJ8C 1FFOA 5AYQA 3RU8H 4I0PD 5BMFL 2A9MH 1C5BH 1UJ3B 1A4JA 2I24N 4LDOB 2F74A 2VAAB 2DRUA 1GXEA 5I8KH 3OG6B 4JVUA 2Z35A 2D9QB 5E8PA 1FJ1A 4UNUA 3HI5H 3D39D 1CD1A 1OB1A 1UCBH 4L3EB 4XXCA 4H88L 3VXME 1MIEH 1IC7L 5DFTA 4MB3A 4MXQD 4G9FD 2BFVL 4M93C 4OJFH 4PTUA 4XB7A 2EDDA 3HZMB 4HIXL 3C2AL 2JCCA 3UX9B 1KPRA 2AKRB 4ZPTA 1SHMA 3VXUA 3REVB 5FO7A 4BFGA 3IDMA 4EI5B 4YHPA 5T1KD 5DURD 4RBPH 4D94A 3SHSA 5I8EB 2VLRA 2DYPA 1MLBA 2AJYH 2DMBA 1EMTL 1WCQA 3SDCC 3ISWA 5ACZA 5HYIA 4L4VE 3RIAF 1ED3B 4MJ6B 5IT2H 4M7ZB 5JHLL 4FABL 4LSRL 4DOHB 3MOAL 1SBSH 4JM4H 4S1RH 3QUYA 1T0MA 1ADQH 1B0GA 5D4QA 2P8PA 2E27L 1CGSL 4JZJA 1KCKA 2C7UA 3OAUH 4M6ML 4PPTA 5T1LA 1B4RA 1T6VN 2BDNH 4X7DC 1X5ZA 3BH9B 1LO0L 1ULVA 3UROR 4KKCC 2DIBA 2GHWB 2YRPA 1QKZL 1DQJA 1YEEL 5F9OH 4O51A 4QRRD 5JW3L 2XWBA 1DQJB 2X09A 2YD3A 3I50H 5EBMA 4N9GB 2JIXD 2XWBB 4K3DL 3IJYA 4ZAKB 2FBJH 1XF1A 3MNZB 1KFAH 4D0DA 4TTGA 4LARH 3VXRB 5MP6L 2GEEA 3TH2T 1CXHA 5TQ2L 4EI5C 3H3PH 1Q9OA 2BVUA 2GJZB 4IRZH 3VXRA 4E41D 1WFTA 3O8XD 1U91B 1UT9A 5E2WH 1FO0H 1IEBA 3MA7B 1INDL 4CU6A 1GGUA 4P23B 4XPBL 3WIHA 3O2VH 5F3HA 5IM7A 4J3UA 3RL2B 3C08L 4Q58C 4GXVL 2YD2A 4XNYH 4Z7UA 3KPNB 5CEYB 2GSGA 1X44A 1NCAH 1NUNB 2JJVA 4LLQB 2APVA 1NAKL 5DJXA 4LPWA 3O6MH 3SEPA 5ADOH 2OI9B 1NCCH 3MODH 4ODHL 4PYGA 4P2CG 4RRPG 1IFHL 2HG5B 1Q72H 4OLXH 2CUHA 4JHWH 1ONQB 4HF5L 4Y5VC 1X5JA 4DAGL 1BQLH 3H7LA 3UMTA 2VABB 4HJ0C 3BH8A 4UILL 5HDOA 1V3MA 4LLDB 4KMQA 4XP9L 3UXFA 3QQNA 3TT1L 1RAMA 3WIHH 5BRZD 5CSZA 3G9VA 4UBDD 4Y8DC 3U2SB 1UG9A 4KJPC 2ADIA 2K7QA 1J12A 4H20H 4F7EB 1RZKH 4L8BB 1CFSA 4K55A 1RIVL 2F54B 4GO6B 12E8L 4PGBB 1MQ8A 3SGKC 5BZDB 3IXTA 3UBXI 4TPRH 4K07A 1YEFL 4P2YA 5CHNB 1E4XL 3RHWK 4QHKJ 2BOBB 4ORGB 4JPWL 3A0OA 3MLPA 3WIIH 1E6JL 2NY5C 4NQUA 5C0GA 3FO9B 2JCCF 4K3GA 5DQ9A 2H2PC 3FO9A 3O6ML 5ADOL 3P0GB 1BZ7B 4YEFA 1NAKH 2OL3B 4ZOCA 3RZCB 3MR9A 4IDJH 2GYSA 1DBML 3L6FB 3W5MA 4X6DF 1ZGLA 4YDJA 5E99H 4KVNL 3QQ3B 5EPMB 5DUPL 3QISA 2Q7NA 2VKWA 4ZODA 4HGMA 1CCZA 4JKPH 3WHE0 1U3JA 3QPQC 5MHSE 1T04A 3BP5B 1AXIB 3DURB 4ZUTB 4ACPA 1NFIA 4O2EA 3VDBA 4Z7VF 3HRZB 1G7LB 3E6HA 5EBWB 1NFIB 2AEPL 3ZKSD 1QBML 3QCVL 1I9JL 4OIAA 3GMMB 2VISB 5BVPL 3FMGL 5CGMA 5IESH 4FTVD 3I50L 2QSCH 2NZIA 2VISA 1GAFL 3ULVC 3KLHD 1YEEH 1IC4L 4ONFH 1CZ8H 4L3CA 4IRSC 3MCLL 4HBCH 2HT2D 4LBEB 3MRRA 1FYHB 5DZLA 1RMFH 5HHXH 1BQSA 1DBKH 3E1F1 1RZIA 2R0LH 4JLRA 1MFBL 1NKRA 3HC4L 5D2NC 3V6FB 5L8KB 5J1SC 4JLRB 5DUBB 2D03H 3ZDZE 3GDBA 2P4AB 1PG7W 5DUBA 3C87A 4LSPL 3GM8A 3UZVB 1FYTD 1N6QH 1EBAA 4LSVH 4K3JL 4LGSB 1D5IH 3BEVA 4YEEA 1WIUA 5IEHB 1T20A 2HH0H 1QP1A 2D31A 1F3JB 2CRMA 2D3VA 3LPGA 3P4OB 2QBWA 3N1FC 2XACC 5J9PB 1LE5A 4J3VA 1NEZB 4MLIA 3W9EA 3MTRA 4V2CB 3L3OB 2UWEE 3RVUC 3P3YA 2W65B 2ZUUA 4IJ3B 4NQSB 1OT1A 2PXYA 1YNKH 1CQKA 1SYVB 3MX0A 3VG0L 2B7DT 4HWNA 1URLA 3QEGL 2FJGA 3WFZA 1R5VB 4MJ4A 3TC9A 4H88H 3ULUF 4MNHB 1CFNB 1UCBL 3WS3B 4LDEB 2BNUA 5FKPA 3RGHA 1E28A 3WE6A 4M61B 4B50A 3BGFC 1A1OB 4HJGB 2YPLB 2DYPD 1NBZA 1NBQA 2J4WL 5TF1L 2A9ML 5DD6A 5CD5D 2FH8A 1BQHG 5HYFA 1CGXA 3HI1A 5D9SB 3FRPG 2M8XA 1WFNA 3GRWH 2J8UB 2C1PB 3OL2A 1EPFA 3S5LA 2NY1B 2BVOA 4MQXC 3TN0C 4P4RA 1RQ5A 2Y5TA 1OQXA 3LRHA 5DDHB 1KV3A 4OKVA 4J6RH 3ZSSA 2GY5A 3UP1A 2A0LD 3ARFA 5KVDH 4I5BB 1RK1B 5L2KD 1FHGA 3O4LB 1FORL 1RK1A 5SWZB 3FN0L 1N8ZA 4Z0BL 5I8CA 1DN0A 1IM9D 1TJGH 1JPST 3IGAA 4FOMA 3QNXB 2KDGA 2NNAB 1MSPA 3QNXA 1GPOL 4F58L 2GTZB 1MJ8H 3QEUB 1B90A 5MI0B 3DXAD 1WBXA 1S5HB 5HDLA 5T3ZD 4L9DA 1BLNB 5DJ0A 4FFZH 5HYSG 5T5FH 4YHMH 2F58L 3VW3L 1IQDA 3OWEA 3X13A 1JGEB 4PJFA 5DRZA 4P3WA 4XCYB 1A1NB 4U1SB 4MB5A 4J7RA 3EJJX 4KI1A 4U6YA 4LNRB 5FO9A 2R8SL 1GJIA 1P7HL 2P46B 2EIDA 1WICA 2IQ9H 4XVSH 3DYMA 4NO0A 2HFGH 1NJ9B 1JTTA 3MV9B 4LKXA 3R8BB 3LZFH 3G6AB 2VKXA 3T3PF 3MNZA 1CL7H 2WBJB 4FQCL 1UC6A 3C6LB 4MJ5B 2D7TH 4F15C 5KSAB 4MSWA 1BAFL 4E41B 4XPFL 1AGBA 3ZHDA 1EZVX 2ADGB 2ITCA 3ZT5A 4Q9RL 5IJVA 1H3PH 4ZAKD 5EBLA 3VDCA 2F53E 3MV8D 2X9WA 3VWJB 2ADFH 4JQVA 1K3IA 4NSKB 5SX4I 1KBGH 4LAQL 2GSGB 4UV7L 4NKOA 3SDDC 5C0CA 1NQBA 2VXUH 5D7IF 1EUUA 3L5IA 4OQTA 3EDEA 1X5HA 3VG9C 3X17A 5HGDB 4GW5B 3EKCA 3CLFL 4ORZC 3WXWL 4GW5A 1I7ZB 2H41A 3IDNB 4NM8H 5LCVH 3C8KB 1EGJH 1IAKA 1BFVH 1A9BA 2OTWB 4FQXA 1XMWA 2BSSA 4YHOL 1PKQB 5CGTA 4XP1L 2IGFL 5EU6D 1CQYA 3VMNA 2D7QA 3HAEG 4KY1H 5J4MA 2CLVA 4HUXB 3PGFH 4GJTB 1MF2L 4OZGB 3RJDA 2MMXA 3NFPA 1U3HA 4X5LA 1KCVH 4XCFL 2VQ1B 1CDIA 1YPZF 2OR9H 3Q6GL 4LFHD 2OJZH 5SWSB 5E2UH 2XTJE 5FM8A 1BBJA 4P2OB 1CDUA 1MLCA 2EDJA 3NABH 1H0DA 4EDWH 1A3QA 1YMHA 5BXFB 5MEPA 3NFNB 1A1MB 5EC2A 2XQBH 4OLZL 4OZHF 1A6WH 2VDOH 5SX5K 3N9GH 2BOBA 5JXEA 2NPLX 2BOCA 3RVXC 3OBAA 1N7ML 2Q3AA 3KPOB 4E0RB 4XPTL 1BGXL 1ZA3B 3UYRH 2VDMH 5I6XB 3GSWB 3WFEL 2HLAA 4YR6A 1X5AA 4BQ9A 1BIHA 3GBNH 2X4QA 5EA0H 3BRDA 4P5KA 5C09B 3QO1A 1F4AA 4R4BA 4QXUH 1NGQH 1S9WB 3C2SA 3CFEA 4GKZA 4KU1A 2HN7B 1OHQA 3IJSA 4K7PH 1F2QA 3OKNB 4GKZB 5SWSD 4G42B 4FA8A 5FHAL 5BZWB 4N0CC 2H26A 3NGBB 3QO0A 1JZ8A 2PNDA 1FSKB 5ID0A 3T1WA 1KJMB 4KKLC 3UBXG 5CD3B 5JO5A 4LMQI 4X6FA 5K9QG 1MJ7H 4YBLB 1FL3A 1ZLSH 3FQRA 4PJCF 3P4MB 4PJXE 5EU6B 1WBZA 1FNEB 1ZLWH 2V5RA 5FCUH 2XKSA 3GO1L 3OKOA 3EDKA 1FZKA 4NN6C 3N1MC 5FO7B 3IDXH 3U4BL 4EBQL 1CFQA 1WEJH 1JPSH 4ZXBA 3GHEL 1MRFH 4Q6IC 3NVQA 1JK8A 5D7JB 5DI8A 1OGAD 4BUHA 5EU5A 5GGVH 1Q0XL 1RSFA 1MHEB 1R5IA 1EA9C 3NCFB 1JGLL 5IEKB 5ALCH 1IBGL 1CF8H 1EO8H 1TVHA 3Q48A 3QDAA 1P2CA 2BVTA 4UQ3B 5E24E 4HUKB 4OZGF 3MRBB 4ZOEA 2XY2A 2DWEB 1J8HD 3L3IA 4HEME 4JN1H 5HDBF 4G80B 4MAYA 4NJ9H 4KV5F 1GZPB 4NRYA 4GAGL 4DVBA 5I71C 4YNYA 1R3JA 5LWYL 1Z3GL 1JHTA 3MV8A 1A7PL 5DC9B 4LLWA 3O2WL 3ZHLA 1JHTB 2MQ0A 4TSBL 4HGWA 3O8XA 1QR1A 4PRHB 5AYUL 4R96B 3ELAT 3O2WH 2H8PB 2CR3A 2P48B 3IU4L 4RX4D 2W60B 3U30B 1I9RH 1ZT7A 4XPHL 4KI5E 4PV9A 5IHUH 1FNSL 3VXTB 4IHOA 5CP7B 5DUML 5KZCB 5FUCC 4JRYB 3L3DB 4JVPA 1G9MC 2GJ6A 4B5EA 5J8OA 1PQZB 2W0PA 4YAQB 5ALCL 1YY9C 1N5AA 4G8IA 5CJXC 2NY0D 1JFQH 4ZO6A 2FEDC 3KJ6H 1ETZA 3WLWC 5LBSH 4JDVB 2GITB 2E8ZA 1QSVA 1MRFL 2FJFA 3P9MA 3ULVE 4QRTB 1SJXA 5GXBB 5SWZD 3L1OL 4MA8L 1GL4B 4XI5C 2QSVA 2YKLL 4HX1B 4UTAH 5IFJA 2ZG2A 1S7RB 2GIYA 4TSCH 2W38A 3BP6A 2BSED 4HX1A 5IFJB 2YWZA 3WFBL 5IF0B 3FONA 4LLMB 1EUTA 5F9DC 1OP9A 2R2CA 3QAZC 4LCCA 4YJZL 5I1KH 4JREB 4MQ7B 4QRUB 1HOCA 3NZ8A 2EH7L 2X7LB 1AR1D 3OAYH 1ITBB 4J8RA 5I8CB 2W0FA 4DKEH 5ITBL 3F6IA 1MI5A 3O3AB 3MJ9H 1FIGH 2DD8H 4U33A 4X80L 4Z9KB 2DAVA 3GSXA 1O5DT 1VERA 1NCBL 5EZOH 1KCSH 5EA0L 3W9DB 1L0QA 4HZLB 4LF3A 4X9HA 4OZFG 1KN2L 5D7KD 4DEPC 1N7MH 4OCYL 3RDTA 4PJ5E 1BJMA 4PJ8B 2IFGA 5F9WB 5BW7C 2VOTA 3N9GL 2FX7L 3BGAA 3KLSA 1T89A 4N9OB 5DMYA 5FF6B 2CDFB 5IB2B 3SO5A 1CICA 2GT9B 3I3DA 4HWEH 3QRFM 3VXUE 2WNGA 5JLZB 4HS3B 4PJBF 3SDCD 1NBYB 4HS3A 1L7TL 5E5MA 2OJZL 5JA8B 4NQCD 2DTSA 1QRNE 2BX5A 4LIQL 1EX0A 4JO4H 4FTVA 3RFZC 2XXMB 3FTGB 4O2EB 1Y0LB 2B4CH 4PJCE 4PJXF 4NPYA 4EUPG 5FYJE 3TZVC 1JNNH 3MRQB 5JDSB 1J8HA 1RHHB 3QRGH 5HYQA 4JKLA 3QDGB 3RUGF 3BZ4A 3KHOA 5DZNA 4GRWH 4M7ZC 1NLBL 4P57B 1V7MH 4K8RC 3GMOB 4LVOB 1G7IB 4JRXB 1T22A 5T5NF 1HN1A 4QRSA 5C08D 1YPZA 1T22B 2XIDA 3GB7A 5EOCL 5C0BE 4I3SL 1K6QH 3BUTA 1H5BA 3QR2A 3EOBA 3UTQB 4EUPB 3N85L 2ZOKA 2CLRA 1PKQA 4JRXD 1TJIL 4PY7A 4Q9RH 3B9KD 4YGVA 5C71A 4N0YL 3PABA 1LHZA 3DROB 4X7EC 4M48L 1YJDH 1JYNA 3BFOA 3BQUB 3KXFE 1SVZA 3VRJA 3VGAC 2ESVD 1U8OB 4P2RA 1MFEH 1CGVA 5L0QC 4P9HH 2VDNL 3BO8B 3C5SB 3QIWA 2ZZUT 2IFFH 4PRBA 2JJUA 1Y6MR 1R5WB 4OGXH 2BHUA 2PXYB 1HI6A 3R1GL 3Q6FB 4X7FC 4RISL 1A7QL 5CJ5A 5GHWL 2R8SH 1EEZA 3CDGA 5DD5H 3HG1A 2R9HC 4IRSA 1CXKA 2C1OB 2EYRB 5E9DA 3HG1B 1VCAA 3I02A 3CXDL 5ANMB 1QA9A 2VUYA 2F58H 4ZSOB 1KSRA 3ZYZA 1SY6H 3O6FA 4FFZL 2WIMA 2IANB 4MYWB 5I15H 5FKAB 3MMEB 2I25N 1DP0A 1MJ8L 2O61A 1KTRL 4QOKB 4ETQB 3JV4B 5F7FA 4OUUB 3DVFA 4PRNB 3TVMA 4HLZH 1CN4A 3IJSB 3ARGC 4XX1E 4XNMA 1BZ9B 1NC4B 2RHEA 2XWJB 4LSTH 4NYLA 5BS0B 5JXED 1ZA6A 3LKSB 2KZWA 4LHUD 4ESKA 3DO7A 1FORH 3UTSA 5DJ8A 4APQA