1IKFL

A conformation of cyclosporin a in aqueous environment revealed by the x-ray structure of a cyclosporin-fab complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
b'DIQMTQTTSSLSASLGDRVTISCRASQDISTYLNWYQQKPDGTVKLLIFYTSRLRSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGSRIPPTFGGGTKLEILRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRAAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA R45-45-11 FAB (LIGHT CHAIN)
publication title A Conformation of Cyclosporin a in Aqueous Environment Revealed by the X-Ray Structure of a Cyclosporin-Fab Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/immunosuppressant
total genus 51
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 1993-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ikfL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ikfL01
4W4NA 3DIFB 4MA8H 2QHRL 1NBZA 2BVEA 2IALB 1RMFL 5ADPH 5ITBH 1IILE 4IBLT 5D5ME 1OSZB 1N5YL 3Q5TA 4FZ8L 1AFVH 1Z9OA 3QIUB 4RNRA 1F02I 1AC0A 1AQDB 5AEAA 4G8GB 5I6XC 4HIIB 3QDMD 2VLJA 5HPMB 1RURL 3KNBB 4CUCA 3MNVA 3EW3B 5GQBA 1WV7T 3ULVH 5D70H 2XZAL 3CVHL 2APVA 3F12A 1F90L 1QG3A 3AROA 1WC7A 4HDIA 4WWKC 4L8SA 5DI8A 2R4RH 1DL7L 1EA9C 3O41A 1AXTL 5I1JL 5JHDB 3BP7A 1AO7E 4GAYA 3JWDL 3V6BR 3FO0L 1U8LB 1XR9A 4JY6A 1MHHA 2EE9A 3JXAA 1HCFX 4FFWC 3QIUC 1TJIH 1I75A 4Z7VE 4P2YA 4MZ3A 3PHQA 4JQVA 4APQB 1JNLL 4M03A 4GKZB 3T3MF 5CD5C 1A9EB 1TVBA 4JQIH 4Y4KC 2WWKO 1JGDB 1FNHA 1SVZA 2A6KA 1D5XB 3LDBB 4QHLA 2DQEL 2P45B 4WFFD 5TQ2L 4QNPF 3N1QC 2A77H 1T6WA 1TENA 2NY5C 2H1PH 4ZDHA 3GJFB 2HT2D 3LKSB 5HTSA 5L2KD 3W82A 3RNQA 4HJ0D 3ZE0E 5DUMH 2APWA 3GJEB 2D03H 4IJ3B 1MVFA 3VI4E 3T77A 5HYSB 4NOFA 5AUMA 1FVCA 2VDQL 3FB8B 1KEGH 1U95A 1BM3H 5CGTA 2A6DA 5JLZA 1FNEB 2KBGA 1F3DH 5C09E 3WNLA 4H1LA 2XWBB 4B41A 4YXHL 2FH8A 4LSQH 4OUUA 4ONOA 3BMVA 3VFMA 4NC1C 4L3CB 3WD5L 5EO9A 4IRZH 3BISA 3MPCA 4U2ZA 4DN3H 4KTEL 2AV1B 3LDBC 3QPXL 3RGVA 4M6MH 4WV1B 4U1MB 1UWGH 4C59B 2PETA 1U8KA 1HH9A 5JW3H 5IVNA 4UILH 5E00A 2BK8A 5E8NA 2DF3A 4IJ3C 5T33L 3L1OL 1FAIL 1LEGB 1GCFA 3V0VB 3FB6A 3QO1B 4ZFOB 3HNVL 4Y16B 2Q7YA 5E2TH 1I1RA 3RU8H 2QBWA 1K8IB 2FX8L 2Z0BA 2ICWB 4WUUE 5DQDL 5H35B 4M62L 5GGVH 1OTUC 4LU5L 4BK5A 2IH3B 2R23A 5CZXC 5GJSL 4CVUA 3KYNA 5ICYB 1P4BL 2BC4A 1OAXL 2D7NA 1LEIA 2HG5A 1ZA6A 4HWBA 2DICA 1XGUB 5DHYA 1C5BL 3GSNL 4UQ2B 3KPSB 3WCYA 1CDCA 3RVVD 3UZQA 2AXGB 4XBGA 1IKNC 1GOFA 1P5VA 4HUXB 4G6AC 1VENA 2CIKB 3S3JA 4PJGF 5EBGA 1U8QB 5I1GL 3QUZA 4WU7B 1T89A 4WI8A 3QFJE 4Y16C 1IM9A 4GAJH 5EBLB 4OCSH 1ZHNB 3PQYE 2HYMA 4W6YB 1BWMA 2E7MA 1CG9A 3H9SE 5HHVL 2PN5A 5HHOD 4WEBH 3SCMC 4M6NH 4PRBA 1INQB 4H26A 3MACH 3MOQA 2ZG2A 2GTZB 1DN0A 3SJVE 1JPGB 1EO8L 2DTMH 1U91A 5HBBA 4DAGH 3MRNA 5A40E 2JIXB 4JO2H 1URLA 4JY4A 3LEYH 4XGZA 5EBWB 4D0CA 3MV7D 4NSKB 1BVLB 4MA7L 4YEEA 2Q87A 5TE7H 5J13C 1AGCA 1FQ9C 4XP9L 1KBGL 5C0DB 1TETL 3MRHA 1X9QA 2W9EH 4U7KA 5D72L 3QZWG 4BELD 4YDLB 2AEIT 5I18H 3RWEB 1O5DT 4JFEB 5DXWA 4RDQF 1GOGA 1NSNL 1MUJB 3HRZB 4Q9BA 4DKFL 1BIHA 1OD9A 3MLYH 3SDCA 1YPZB 2BSRB 4M6AA 3CXDH 1BF8A 3S3PA 4M7JL 5D7SH 4JDZA 1CXIA 3VXQB 4PJXB 4GXUN 3QT2A 2EO9A 5CEZL 3IYLW 4XH2A 2DD8L 4ONHB 3HUJB 3OF6D 4DZBA 4UINL 4EUPB 2Q8AH 3K46A 1OB1A 4LNRA 4OCYH 1G7IB 4MWFB 1K4DA 4X6CA 2CLVA 4KPHH 3RWCA 4E42B 3QQNA 4XMLH 4OFDA 3UDWA 3K8MA 3V0WH 1NJ9A 3QXVA 4P4KB 4QHKI 4ODXA 4HHAA 1FYHB 1W0WA 5EOTA 5L7XH 3TT3H 5E7BA 5KN5A 3DPBA 4XWGL 1P4IL 2ADGA 3C6LA 4FABH 5JUEH 1RZ8A 3C9NA 4AMKH 1NGWB 1K6QL 3BVNA 4NQDB 2YZ8A 3GB7B 4GAGL 4F7MA 5DJYA 4NC0B 2F8OA 2QADB 1DUZA 3WV0A 5FHAL 1JWUB 1GJIA 5DEZA 5JIHA 5CGYC 4WI7A 5C9JA 3SQOH 1R3IL 1SJVA 3OZ9L 3VFGL 4NUJB 1IGTA 4K7PY 3HN3A 1EEYB 2O61B 4ZPTA 2FR4B 3P11H 4F57H 3Q6FB 4OZHB 3UMTA 1NFDF 4UU9A 1FPTH 5T3XH 4KC3B 5GRUL 1ZEAL 4CL7A 2MOVA 1FG9C 2R1WB 2PTUA 1B9ZA 2X2YA 1T1YA 1NGXB 1CI5A 2ED8A 2VZSA 4POZD 5DFVC 1C5DA 5HHXL 1KCUL 4NP4H 1JF5A 1S7UA 3GSXA 5E2VH 4CDGC 5SWSB 1DLHA 2CRMA 2JJVA 2WIIB 4U1KB 4UB0L 3REWB 4BQ9A 4LLWA 4LEXL 4WTZG 5DRNA 3TPKA 1N59B 4XWOC 1GGCH 1WCQA 1VDGA 3OGCA 4C57C 3BIAX 4ZUSB 4TPRL 3O2DA 1AO7D 2XOTA 5L2JB 3TZVB 3DLQR 5C3TA 4M48H 3MUHL 4PJ7B 5KS9B 4P2QA 2ZPKH 4P9ML 2AJZA 1OHQA 2AXFA 3D18A 1NGQL 2R4SL 4U1HA 2WUBL 4IRJA 4MMZC 3ESVF 4JZJC 4MSWB 1FGVL 1MQKH 1BJ1H 2DM2A 4JO1H 4MLSA 1JF1A 3NMEA 5AZ2L 5C70A 5C0AE 3TT1L 3EOYG 3RWGB 4NO5A 4JZNB 3AC0A 3MMEB 4UDTB 4ZNCD 5IROA 1BBJB 1NDGB 3O2VL 4HIHB 4HH9A 4HF5H 1CYGA 5HHQB 3ILPA 4U31A 3WJLC 3F7PC 3WYRA 4HPOH 1IGML 2PTTB 4RAUB 3BRFA 4OCWH 1HINH 5DEGA 5LAXB 1EJOL 4PD4J 4CW1B 3PV6B 3QCUH 1XF3B 2BX5A 4LP5A 2V5YA 2VSCA 1NCCL 1YEIH 2DI8A 4QHNB 3ULVE 3FRPG 3O4LE 1CFQA 1MRDH 1RJLA 5C09D 1JRHL 2R2HA 2ITDB 4L4JA 1OSPL 4KJPD 4O5LL 4ZYKA 3RJDA 2OMBA 4PRIE 2E3VA 3MLVL 4IHOB 2E7LC 5EU6E 2G2RB 4OTXL 1WBZB 4DTGH 1MI5E 1GHFH 1DBBL 3QWRA 1CD9B 1WAAE 3IETA 1IEHA 4K9EH 4QCIB 5KJRH 1CFNA 1D9KA 1SJEB 4CMMA 2I27N 5ESVB 1CCZA 4R96B 1BECA 4I3SL 1W0VA 5FGRA 2IC2A 1Q9OB 4WTWA 4N0FB 1J05B 5EOCL 3UJTL 2GIYA 1ACYH 4QOKE 5INDA 2MCG1 1KLFA 3BGFB 2ZCHL 1B90A 3L7FB 3QWQB 4HLJA 4WUUD 3RIAF 1NDMB 3U0PB 1HH6B 4G8FB 1OQXA 3V52L 1J0HA 1MIML 3UP1A 4I0CC 5EC2A 1NEZG 1FZMA 3MNWA 3LAFA 2I07A 4K2UH 2F5AH 1S9VB 1CLYL 3MA7B 3FHAA 4DZ8B 3AU1B 4DW2H 1GL4B 2P47B 4NT6A 4POYA 3OKMA 3TNMB 5EZOL 2VXUL 5EA0L 3OQ3B 1I7RA 1PSKH 5TPWL 3L6FA 4JFQA 4NM8H 2GAZB 2B4CL 3BGFC 3ARDD 3RWJB 4M4PA 3PQYD 5INCB 2VLKE 1NQBA 1XFPA 5K9JH 5C7XL 3GHEL 4MNGB 5EWIL 3H9SD 4UTAH 2VXQH 3V6OC 4LCYA 1FC1A 7FABL 2IANA 4UDUB 4WFHE 3I84A 3IS1X 3TYFB 4DVRL 2X05A 2HT2C 3O3EB 5CSGA 4HJ0C 3GGWA 2IAMA 3VXMB 3HC3H 4NZUH 2VQTA 3DMMD 3OAYH 3MCKB 3JVGC 4LF3A 5JNYB 1A7PL 5DJ8A 1KB5A 2IH1A 4I48A 3ZYIA 1HEZB 3PWLA 5B38B 1UACH 1NEZA 4X0KA 4WI3A 2BVUA 4ETQA 4L1HA 1IGYA 1HHIB 1LK2B 4KDWA 4P57B 5EZJB 4GW4A 5EZLB 5TDNB 1AP2B 2VXVH 2BVQA 5DD3H 3VFRA 1LP9F 3PWNB 3LEVL 2GFBB 4MDJB 4L29B 4PY7B 1PBYA 2Q8BH 3NCYP 2VWEE 2DQUL 3DSFH 4CGTA 3DYMA 3ESUF 1A7BA 2VXSL 4HIXL 3ZMRA 1UJ3A 4U1NB 3IRPX 3O8XD 3ARZA 4O2CB 3G04B 4OFYD 4WO4A 2FYYA 5E0QA 4NZTH 2VLLA 5LKNA 3L5IA 5GGRA 3U1SL 3U48A 4I0PA 4HEME 5E2UH 2CO7B 2VITA 4N1HB 4CN6A 1CF8H 3QBTB 2DL9A 3VXOA 4Z7OE 3UO1L 3B9DA 4Y19A 1MSPA 5DRZB 1GGYA 3TO2B 3FB7B 1MF2L 2CXGA 2EEDA 5HYIA 4HCRH 1YMMA 2ZJSH 2FX9H 1EBPA 5MHSD 1YA5A 2DYPD 1IFHH 4YHKL 4WUKL 3IVKA 3I9GH 1KGCE 4NZJA 4WHTB 1LO2L 2VLJE 3RVVC 5BVPL 4RMTA 4LPUA 4WFEE 2UZIH 3MV7B 5JDSA 4J3WA 5CMAA 2FO1A 1J10A 2EDTA 5F7KC 2XA8L 1LD9B 4JDTL 5BJTB 4H0HB 2DS4A 1KPUA 2EYSA 3CSGA 4G8EA 3VRJB 1MCHA 2DQDH 3E2HC 1F3DJ 4HGWB 3R1GL 1SBBA 1U0QA 3O3AA 3WE6B 4FQQB 1CDBA 1B4JL 3PGDB 5E6ID 3SE8L 2C1PB 1M7XA 2DTSA 3PL6A 5SV4A 5J9PB 1VACA 3UTQB 1K3IA 5JXEA 3WIHL 4OCMC 3THML 1A6TA 3WNOA 3IDNA 1QFWI 3FQTB 4KHXL 4I18A 4ZTPH 5IHZA 3KHQA 5HGBB 3ARGD 4LLUB 4FFZL 3PNWA 1FO0B 3IGAB 2A83A 4Y5VA 3OSKA 3GBNH 4PJFA 3AS1A 1DN2A 2VXTH 1I3GH 1U8PB 1QYGH 1ZGLA 1FG2A 1FYTA 2FATH 5J56B 4L9LA 4HG4K 1VFBB 2BMKA 1CTOA 5IVZB 3U9UB 3B6SB 4GBXB 1HXMB 3QNZA 3MRFA 1UVQA 1TZIA 3FHQA 2VUOA 3H3KA 3I6KA 3F7YA 3Q2CA 3IJSB 5IGXH 1OM3H 1OT1A 4PGCA 3Q3GA 1NBVL 3I3DA 4MHHG 1DQMH 1QSFA 1Y18A 2CRZA 4XMKL 2N1KA 1IAIL 1Z9LA 2EDQA 1FO0H 1NUDA 5DJDA 3WNNA 3C60D 2AK1L 3RKDD 5T3XE 1T0MA 5D5MB 4Z95L 3WNPA 1ERNA 5DLMH 1T0PB 1RUAL 3LKOB 1TXKA 3UBXA 1J1XH 2Y07H 5DQJB 1EVUA 3ULVD 1KSRA 2Z9TA 3O4LD 5BOPA 4YXKL 3UTPE 3H2WA 4JPWH 1JPTL 5TDOA 4UT9H 4OQTH 4XNQB 3RA7L 4OCXH 2C1OA 6CGTA 3EFDH 2VDMH 1MVUB 1RUQH 1UCBL 3VXPB 2EYTB 2CMRL 4M5ZH 4JO3H 1RIVH 4XPAL 1MI5D 5IHUH 4ELMF 1B6UA 5C08B 4L8DB 5GGVY 4PREB 3MZGB 4V2BA 3V4PH 4LL9A 3MYJA 3PWVB 2Y6SD 1XGYH 4ZFZA 1MFAL 1AO7B 3CK0H 4S1SH 4GXVL 5HDLA 3V4UH 3SDXA 4BSVB 1MFBH 3AY4A 5E56A 5I2IB 1RZ7L 3MV01 2AABL 1TJGH 4Z7VB 5F7DA 2O5YH 3QIWA 4QOKD 2J12B 5BXFA 2VDOH 4POZC 3NA9L 4LPXA 3P9MB 5CSZB 4ERSL 3AXLB 1J8HA 5C0FA 1BEYH 1A3RH 3VXRA 1A7QH 1UZ6F 4F7PA 2NW3A 5JW4R 3HC4L 2IQAB 1FL6A 1RK0A 5EUOF 5D6DA 2HFTA 4HFWB 1TJHH 4M1GL 4UMGA 4ZFFB 5DWUH 3RWHA 1H3GA 1OCWL 5I19L 3F7VB 1NMBH 4JR9H 3QEUB 4UUJA 1RULH 5BQ7A 2QR0A 5FGBC 3CFKA 3ARBA 4Q58C 1VFUA 3CX5J 4JG1L 2QHLA 2D7TL 1B4RA 1U3HD 3MR9B 5DYOB 5CD3A 4LMQE 3P9LB 5C09B 1OPGL 3ZE2E 1JFQH 1KN4L 2JCCB 2I9LA 3IXAB 4P59L 2VLKD 2X4OA 1DLFL 2FWOB 3IJYB 4MJ6A 5E95B 1H3UA 4OM1L 4G9DB 2A38A 3BESR 4WFHD 4LCWB 4RGOL 5KVGL 1KPRA 5ESAB 4XAWH 2EDEA 1A7RL 2UWEA 2Y7QA 1PYWB 4GQ9L 1A5FH 3FOLB 4F3FB 5ICXB 4PRPA 1CGUA 2ORBH 5DJCA 5E5RB 1ZLVK 3QG6B 3KPPA 5CILH 1QBLH 2CK0L 4W4OC 4AT6A 3BKCL 3OKEA 1GGIL 2IFFH 4ENED 3QIBD 5ILTH 5IFAH 1JNNL 1S5IH 4KJPC 3DRTA 1A6AA 3B3IA 5IB5B 5EIVA 2K1MA 1Q1JL 3EYUH 3QUKA 4ZQKA 5T5FL 4X7SL 3U4EA 3DXAA 1YN7B 4FXGB 1X7QA 4FOMA 4YZFE 1AXIB 1TTGA 3SKOA 4LRNL 3WS3A 4YHLL 1MWAA 2WBJA 1HHKA 1YY8B 4FHBD 3BDXA 1YEHH 1X5AA 3LZFH 1MEXL 3IFLL 3QDGB 4KK6D 5EC1B 4AJ0A 1U58A 1QRNA 2H41A 3RX5A 3BN3B 5I1DB 4OLUL 5BO1H 3WSQL 3QCVL 1NFIB 4F2MA 3QFJB 3HG1A 4FQ2L 4PJGA 4KZDL 3PQYB 1L9MA 2OTWA 3H9SB 3WN5C 1NL0H 2YKLH 2V17L 3NVQA 4BH7B 3VGBA 4XBEH 5FEBA 4LARL 5I1KH 1ZGLM 3DHMA 4F7TA 1U93A 4U0QB 5KVEH 3KLAA 3MCG1 5LCVL 3QRGL 4J1UB 2AJXH 3SJVB 1X4XA 2EDLA 1L7TH 2QQKL 4TUJB 5IQ9A 4TQEL 3DVGA 3U4AA 3H3PH 1EZVY 3WMSA 1KCVL 4QXWA 2OR9H 1KGCD 2H8PB 3NFSH 4ALAL 2DWDA 4Z78B 4YPGB 1C16A 1EDQA 3VFUA 4NYLA 3QHFH 5EPMB 4OD1L 3HR5B 4AY0A 2XWTA 1K8DB 4CN4A 2YHGA 2CLRA 2W65B 5DZLA 1HSBA 4OGYL 3WNMA 5CJXC 3SBWC 2A9ML 3ARDC 3VFSB 4PGDA 5I8OH 4IRSB 4NN5B 1CU4L 2VDRH 3MBXL 3MODH 4NOBA 4OLZL 2HT3D 4RQQB 1CGSH 2PNDA 4QRSA 2FJHB 1FNGA 4I2XA 4MHHI 1JZ2A 5BVJB 4LGSB 2IQ9H 4RFEA 3HNTH 3SO3B 3X11B 3RL1B 4HS3B 3GKWL 2ATPA 4P2QE 1N0XL 5I1HH 3HI6H 3DMMC 1KENH 3UXFA 2FGZA 5D7IB 4JE4B 5J57B 3FONB 5ALBH 2ZWLT 1YEEH 4X6DA 5C0GB 5FFLA 2YD7A 4M5YH 3NIDE 1XF2B 1DUYB 4H88L 4NM4H 1QQDA 1G9MC 2WQRA 4LSSL 1V05A 1J12A 4TSBH 2ZSWB 3F58H 5I16A 1MQ8A 5KANI 2D31A 3MLZL 4NN5C 4X8JA 5I66B 1EHLL 2EE3A 3BGAA 4HXAL 2H2PD 3KPQB 3U46A 5ID1A 2DYPB 3SO3C 1WJ3A 1UGNA 2L4OA 3MGOA 4AIZB 2F8VA 5DMKB 5IJVA 3PGFL 2IGFL 5T3XD 1F6FB 1RFDL 1ZA3B 1BX2A 4HUNB 3IF1A 5JPNA 2F58H 3STLA 5ICZB 1XCQB 5CIPH 3RGVD 4OZFB 3BT2L 1LO0H 3UTPD 4PJDB 1KB9J 1V3JA 1MREH 4NNXB 3MUGA 2P8MB 4UV7L 3JV6B 1P6AB 1NAML 3ARGB 1M71B 4OF5A 4PS4L 2YS4A 3F8UB 2VRAA 4AH2A 4XX1G 4Q6IA 1IBGH 1WIUA 5D8JH 4F37F 2QSVA 2CUMA 4PJ5A 2YRLA 5FUZL 5DMIL 1R5VA 2FBJL 4X5LA 2VABB 3ZL4L 1UM6H 2ADJA 1AHWB 2D4DA 1SYSA 3L3GA 1JRHI 4YFEA 1UXWA 5E6IC 5ITBL 1U8JB 1LVEA 3TJHD 4D0DB 5DD5L 2VMFA 1LO4L 5JW4N 5C0AB 1AFVL 5H37G 5JDJA 2NX5A 1TZGL 3ROOA 1IE5A 2X7LB 4OIIL 3ARGC 5E03A 4AIOA 4I3GA 3P0GB 4X4XA 2IPTH 1IL1B 2YOCA 4LDLB 2BDNL 5FYJE 3QUZD 1IAMA 1UFUA 1HWHB 1MHPL 2BNUA 3HHRB 1KJ2L 3TLRA 3C60B 5D70L 1G6RB 1IM9D 2CGRH 1AE6H 3R4DA 2DBLH 4KVCH 1E6OH 2B39A 4OD3H 4QTIH 2IBZX 1ZHBA 1MY7A 2OL3H 1AHWC 3F6IA 4YO0A 2M1KA 4YE4H 1T7XA 2WP3T 4XCEA 4OSUH 2HJKB 4PRIB 2VISB 1BD2B 3DTXB 3N1FC 5EU6B 2VH5L 2F54A 3FT2A 3JWOL 2E8YA 1MI5B 4PG2A 3WUZA 4JHAH 1QVOA 2QSTA 1J1PH 2HLAA 1F13A 2J8HA 5HVHB 2GSGB 3J7HA 3C60C 3RKDC 5J6GA 3KYMA 3S5LG 5I1AA 3DX7A 2YMXL 5GS1B 1AY1H 1BZ9A 4KKCD 4RA0C 3C2SA 1DEEA 1H5BA 4JLRA 4FXKA 3P4NA 4B5EA 3PWUB 3SDCD 3MREA 2H1PL 5HGAB 4KQ4H 4QOKB 3ULVC 3PP3H 4N90E 4Y1AE 5DUML 3KYOB 1XR8A 4X4ZA 2D03L 1KLGA 1ZT1B 4U3HA 3ZSSA 2LFGA 5HD8D 4X4YA 1INEH 3VFPB 4H8WC 2XWJA 1DSFH 3LV3A 5I17A 5TGBA 3RVUD 2QJDA 4U6HB 1JUFB 5FK9A 1KEGL 1BM3L 1YEDB 4HK3J 5F9JB 1NCUA 1T3FB 3L5JA 1YJDH 1QLRB 4TVPE 3BI9X 1L0YA 4HUUA 1Q72H 5I8EA 2G60L 3DOSA 4LSQL 5E6YA 4PGEA 2Y6SC 2P24B 5C2BH 4IRZL 4DN3L 5GS1C 4MYWB 4JPVH 4M6ML 2QLVB 1FAKT 1N8ZB 4Y19E 1U3HB 3C6LD 1JNHA 1YMME 5JW3L 3FAXA 5HI3D 4WY7L 4GRWB 3VFTA 1U8OA 3L95B 4J3OC 4X5XB 2A74A 4HV8A 3VJ6A 3BQUA 1HOCA 1FJ1A 3OAZH 1G0YR 5IFJA 3QWOA 3ZKMD 1VADA 3WNKA 5E2TL 1G7JA 5CHNB 2YA0A 3RU8L 4PJAA 4RAVA 2VZ3A 1KT2A 3MRMB 3B9AA 1TFHA 1UH4A 1NBYB 1IGJA 5T3ZL 4ZUUB 4MD5A 2ICEA 4LSTL 1I1CA 3CFJA 4P5TD 4RX4D 3QB7C 1U3HC 5FF6A 5IMMB 2JJSC 1JJUA 3QIBB 4H0GA 3JV5A 4O51A 1IZKA 4TNWK 1N4XH 1FV1A 3BOVA 3CVIH 1CE6B 5D2LA 4OZGA 5IHBA 4A6YA 4WI2A 5IBTL 1KTLB 3HR6A 4HS8H 5DT1H 1YEFH 3B9KB 4ZFOL 2YRPA 5TJWK 1I9JH 1FYTE 3IDYB 2RCSL 4GAJL 3X13B 1D5IH 3D69B 3GMMA 3LQAC 4OCSL 1A0QH 4FQHA 2IWGA 5DUBA 3MNZB 4P2QD 3EYFA 4KXZH 4WEBL 1RVFL 4M6NL 2ADFH 1S5HA 2X41A 1YECL 2EC8A 1SEQH 5K9QG 4C54A 4G42B 1G1YA 2DTML 2KQMA 5ABDE 5F3HA 4DGYL 3D39B 4ENEC 3T4YB 4LIQH 1T66D 4RZCA 3QIBC 5IBUG 2ESVB 1QSFE 2DKSA 4DAGL 1X6NA 4JO2L 3VGHA 2VN4A 3NCFB 1CK0H 1ND0B 3LEYL 3CFEA 2NLJA 3RWIA 2YPLA 4LCUA 5CCKL 1NBZB 2C26A 3E8UL 3LCYA 5F7EH 1VFMA 3QQ9D 5TE7L 4HLZG 1SBSH 5E4EB 3QG7H 5I18L 2X09A 3O9WA 2ADIA 2DI7A 5GHWH 3IDYC 1JYXA 1V3MA 2VWEC 2F5BH 3QUXA 4FMFA 4RNRB 5FA4A 1T21A 1OQOA 2VLJB 3W5MA 3T0ED 1PAMA 2OR7A 1EO5A 4KK6C 1T1XA 3MLYL 3MNVB 5C07A 4J3TA 4U7MA 4QHUB 3CXDL 5D7SL 1WEJH 3F12B 1X5KA 2ZG1A 2RQ8A 1ZXQA 1WC7B 3KPNA 4HDIB 4L8SB 5DI8B 3EYOA 1E0OB 2Q86A 3QWRD 3BSZH 1KXVC 1IKFH 1CL7I 1ZVSA 1DVFA 3O41B 5CUSH 5FYLL 4A2MA 1YNKH 1PX4A 4FP8L 3BPNC 3BP7B 4OCYL 1BLNA 1OW0A 3P4LA 5E1AB 5E4EC 3V5KA 3SDXE 2V7NB 3SDAA 2WUCH 4TTGA 1RHFA 1KF9B 1XR9B 4JY6B 1MHHB 3QUMH 2EIBA 4WGVB 2QKIB 5TE6L 3AAZA 3PHQB 1SMOA 3BO8A 1WFNA 3D3VD 1OD7A 3WUWG 5I1EL 3MXWL 1TVBB 3NCBB 5HYEA 5F9OH 3BHBA 1MNUH 1J8HE 2KZ1B 2A6KB 4IOIA 4ZO7A 4M43H 5DF0A 3T3ME 3VXRE 5D7KE 5CFHA 3SQOL 3MRBA 2RBLA 4L8SC 2D9CA 1H3XA 2VZVA 1QR4A 2X4SA 4XNYH 2UV3A 5FM5M 5GGRY 4ZDHB 2CDGA 3D87B 3RNQB 3P11L 1RZGA 3EBAA 1OP5K 4EI5A 3T77B 1BWWA 2VAJA 5AUMB 1FVCB 3D0VA 5D2NA 3L3HA 1KJ3H 1U95B 3IFOA 5J7CC 2A6DB 5JLZB 5FYJD 1JPFA 5CP7A 3OL2A 4JQVC 4H1LB 4NP4L 2FLRT 1NCAH 4NQUA 4DOHE 5BS0A 3IB4A 4PJ8A 5E2VL 1VFOA 3BWUC 5EO9B 5IW6B 1RUKL 3RGVB 3P30H 4G6MH 5B3NA 4PY8J 5BV7H 2FIRT 4WJ5A 1U8KB 4XPHL 3VXSA 1HH9B 3O6FA 3H6JA 2DLTA 2UWEE 2L7JA 5E00B 5E8NB 3WUWA 4PRPE 3S9DB 2H2PC 3ETBF 2ARJQ 1B88A 4CMHB 3P73A 4JM2F 4AEHL 3FB6B 3QNXA 5AZEH 1XCTA 4O58H 4R8WH 5B22A 2X9WA 3G5YA 1ZT4A 2Q7YB 1MQKL 4JO1L 4MDIA 3D6GA 3GM0A 1A2YA 3MJ9A 4N8VG 3K8KA 2AW2A 3OXRA 3QCTH 5H94A 5K93A 5FA3A 2R23B 3DXAE 1TITA 3QXWA 1OAYH 3RGVC 3KYNB 4HPOL 4N90D 4PJEA 4U1LA 1I8MA 2BC4B 2FJFA 4Y1AD 1LEIB 2HG5B 5A2IH 1I1YA 5DHYB 1HINL 4OF3A 3FQRA 2VB5A 5FB8A 4XBGB 1VFAA 4EI6A 3QCUL 2FLBT 4WU5A 1QRNE 5HJ3A 4PIRF 5GSVA 3TM6A 4C4KT 4YK4B 3FQUA 4CMHC 1OT2A 1YEIL 3IDIA 2WLYA 1MCCA 1MRDL 3QUZB 4CKVX 4Z7UA 2D7PA 4TVPD 4WO4D 5F9WC 4P2OA 4KKNA 3HG1E 4PJGE 4I0PD 2OTPA 5EZIL 3VI3F 3SKNA 1N6QL 4JKMA 1CG9B 4DTGL 1GC1H 1GHFL 4PRBB 1QR1A 4Y19D 3LRHA 4H26B 2E7HA 5IK3A 1S9KC 4RGMB 1FGNH 4K9EL 5KJRL 1DN0B 5HHNA 4MQXD 1YMMD 1F42A 3GO1H 4KDVA 1U91B 1VKXA 3TJHC 4DN4H 3MRNB 1G7MA 1WITA 4OAWA 4JY4B 1CFVH 1FSKB 4XGZB 4D0CB 5T1DH 3TBSA 1Y6MR 1A4KA 4YK4C 1ACYL 4XBPA 1AGCB 4LSRH 3QUZC 2XRAL 1MCIA 3MRHB 2BZDA 5LJYH 4NUGH 3MA9L 2FEEI 5GS0H 5F89A 4HAGA 5K9QI 3SGKA 2AJSH 3ZDYE 3SDCB 5JXED 4HQQH 5D96C 4WNQA 2F53E 1MELA 4JFOA 3OJDA 2P42B 2F5AL 4JDZB 4NCDA 5F71A 3G6JA 1Q0YL 4LSVL 5HGGS 4DW2L 4OCNC 4XH2B 1RZKH 4MXQD 4DZBB 2ZOKA 1PSKL 1OB1B 2ZCLH 4LNRB 4J7RA 2BY3A 4X6DE 1K4DB 4X6CB 2CLVB 4OBRA 3RWCB 4DKEH 3R06A 2X9XA 5J06A 4Q2ZA 5CKAA 1BIIA 1QA9A 2FX7L 4NQCD 3DHJA 2R0WH 5A3ID 3MRQA 3RUGF 2QSCH 4ODXB 5K9JL 2LVCA 4HHAB 1A9BA 2Y1VA 5EOTB 1W0WB 2AXHA 4KKCC 5KN5B 4MA3A 2ADGB 3X3FH 3C6LB 1Z5LA 4PGBA 3MLXH 1RZ8B 3C9NB 4EN3A 3SDCC 2HRPH 3BVNB 1FVDA 5I74C 2FL5A 4F7MB 5DJYB 2PYEA 4NFBA 2WAHA 3HC3L 1C7TA 5ALCH 1EHXA 2X89A 1DUZB 1SMAA 3DWTA 5HD8C 5C9JB 4Y4KA 4U6YA 5HYSG 2VDNH 1FH5L 1NGYA 1J0KA 1IGTB 5DMGD 3RVUC 4KKLD 3F6LA 4S1DD 4ZPTB 1NC2A 5TE4H 2BCKA 1UACL 3AS0A 4PRDA 4UU9B 4YX2L 1TVHA 4R7NB 1P6FA 3CVHA 1DQLH 2VXVL 3CLEH 3FN0L 1T1YB 1WLHA 1ZHLB 5LWYL 2B7DT 1U8MA 4O9HL 3QJFA 3C6LC 1S7UB 3GSXB 1G1CA 4EJ1C 3DSFL 2AKRA 5HI3C 4JFPA 3SKJL 3OX8A 3BEWA 4LLWB 5DRNB 2YD9A 3IDGA 3H7BA 3GMOA 1YDPA 4NN7C 3OGCB 2OYPA 3V79C 4PJ5E 2VAAA 4LHJB 1X5LA 5E9DA 4NZTL 3ZKMC 2DQCH 1K9TA 3ZKQD 4KFZC 1A7OH 4OGZA 2JTDA 3T1FA 1UWXK 3OKLA 3HC0A 2WW8A 1CF8L 3DUSA 3MJ9H 3QQ4A 4P2QB 1AGDA 3PWJA 1A8JH 2AJZB 3D18B 4U1HB 4IRJB 2AI0H 1UA6L 4KMLB 4P5TC 4HCRL 1JF1B 3WEXA 1J8HD 2ZJSL 3CH1A 2IPKA 2FX9L 4LK4A 1A6VL 1MOEA 4NO5B 4WHYH 2NX5E 4YHOH 2WMPA 4B0MM 3VXRD 3I9GL 1V3LA 5D7KD 3QXDA 3V7AG 2UZIL 3KS0H 4HH9B 3ILPB 4ZUVB 5FXCH 1S3KH 4OZIA 5BOZG 3GDBA 5DJ0A 2UY6A 4HWUA 4X9HA 4OGXH 2DQDL 5CJQL 1O0VA 5FGCE 4LHUA 4NO0B 2Z8SA 1AI1L 1CFQB 2X4TA 1RJLB 2Y9RT 4XX1E 2R2HB 4ZYKB 4WI6A 1IKNA 4JGUA 5CKGA 3BJ91 1MPAH 3AVEA 5TDPB 4ZSOA 2H32A 3HAEA 3DETD 1YEJH 4G6JL 1T66C 3GBNL 4R3SA 2DMCA 4NKIH 5I76A 5IROC 3GNMH 3IETB 3WLWD 1PQZA 1CFNB 1D9KB 1W72A 3DX6A 4Z0BL 4CMMB 1I3GL 4DCQA 1QYGL 3QQ9C 2FATL 3SCMA 2B20A 1W0VB 3U7YH 1KIPA 3QAZC 2ZP0T 1Z0NA 1BBDL 1KULA 4D9QE 2P8PA 4Z7NE 3EDKA 3IJHA 4X99A 5INDB 3T0EC 1MCKA 2WBKA 2P49B 3CAFA 2YPKA 4FNLL 1OM3L 1YUHA 4FFVD 3D9AL 4V1DE 4L4TA 1VGKA 2VDKH 4EZMA 1CGXA 3DXAD 1KJVA 1FO0L 2AK4B 5EC2B 1FZMB 3GSNA 3MNWB 1WT5C 4MXWL 3BYTA 3FFDA 3HI1A 2AQ2A 2I07B 3OKYA 1N3NA 4LBEA 4ODTL 3NIGE 3FCTA 3BKML 1QRND 1LHZA 1J1XL 4NFCA 5DK2A 2Y07L 2V5SA 4NT6B 3OKMB 3P77A 1S7VA 4ZPVA 1QFWH 1I7RB 1FDLH 4JPWL 5EH1A 3S96A 4X9BA 3MLSH 4YDJA 1TZHA 3HG1D 1ZHKB 4OQTL 4QY8A 3L6FB 4JFQB 4U2YA 2B8OT 2OK0H 2QHRH 5D1QA 4EOWH 4M5ZL 1N0LA 1RIVL 4OLVH 3NCCB 5DJXA 4FQXA 2VLRA 1N5YH 1BFTA 2IANB 4PJIF 1QSEE 25C8H 3MBEA 3V4PL 1AD0A 4NGHH 4PJAE 1TIUA 2VKXA 3RPIA 3CK0L 4L3EA 2N7BA 3GGWB 2IAMB 3V4UL 4NN6B 5GPRA 1PLGH 1R5WA 4MD4A 1RQ5A 1TJGL 5J8OA 3W5NA 4LF3B 4LLMA 4PTUA 2BERA 5CGMA 2AJUH 5DJ8B 2R8SH 1KB5B 2IH1B 4I48B 5JQ6H 3PWLB 1NEZB 1YEGH 4QLRA 4X0KB 3HCVA 5D1XA 4AEIH 4ETQB 1IGYB 3CGTA 1DL7H 2JJUA 3FZUD 1I9EA 4GW4B 1P7KA 1BEYL 4HIEA 1A3RL 5D2LE 1A7QL 2BVQB 4OZGE 3MUY1 3VFRB 3C5SA 1UM5H 3JWDH 2F53D 4JFFB 5DWUL 4KTDL 3FO0H 3HE6A 2K7QA 2B1HL 5CJOL 1GSMA 1NMBL 4MJ4A 3QQ3A 3SKMA 1RULL 1VERA 4BA8A 4DQOH 3E0GA 1F00I 1UJ3B 5ITFA 1MHCA 3I6GA 2GJZB 2YEZA 3BN9D 2P8LA 4F9LC 2FYYB 2VLLB 1J0ZA 5F7HA 5GGRB 2DMBA 2DQEH 5TQ2H 3ES6A 3ZHKA 2ZUWA 2VZUA 2VITB 5F9DC 4B50A 3PV7A 5DC0A 1H0DA 4JN1L 4HXBH 2I60H 4Y19B 32C2A 5FIEA 4KH2A 5CP3H 4X7FC 4BUHA 4Z8FL 1KTRL 1A5FL 2DLFH 4L4VA 5EFIA 2ORBL 3IVKB 4H5SA 4Z0XA 3QDJE 2Y36L 4JZJA 5F1IA 3T2OA 5I1CL 4K71B 4TNVK 5MI0C 5JDSB 4C58B 2XACC 5CMAB 4JRWA 5C07E 2YUXA 2IFFL 1JTTA 2NNAA 4P23A 3EOBA 4JRXA 5HYJA 2OQJA 5ILTL 5IFAL 2MNUA 1AGEA 1S5IL 1KPUB 3WD5H 2EYSB 4WO4C 3BRDA 1MCFA 1RI8A 4G8EB 4EQ3A 1OGTA 4NNPL 4I0PC 2ICWI 1T4KA 2GJ6A 3O3AB 1G9NH 4LHQB 4HJJH 3PL6B 2JF1A 2XG5A 1VACB 1SY6L 5EU4A 2AJYL 2XQYK 3IDNB 4I18B 1FCGA 5IHZB 4U3XA 4MQXC 1YEHL 3LZFL 5F88A 3MO1A 5C0RH 1OP9A 2A83B 4Y5VB 3HNVH 4M1DH 4NO2A 1CFTA 1RZJH 4PJFB 3OPZH 1JYVA 5C8JA 4K71C 4PJ5D 3EHBD 1EGJA 5DQDH 4P49A 4M62H 4ZODA 1ZGLB 1FG2B 1FYTB 2WINB 3DVNA 4L9LB 4X80L 2R0LH 4Z7WA 3PABA 5HDQL 3A6BH 3QNZB 3MRFB 2YKLL 1CXKA 1OAXH 1UVQB 3GSRA 3I6KB 3RHWK 5JO5A 2GCYA 1T03H 1G7PA 1XF4A 1ZANH 3F7YB 2AJXL 1RJYB 5JXEC 4QEGA 4XP5L 1L7TL 3M8OH 4PGCB 1DBJL 3Q3GB 1IAOA 4I18C 1J18A 2NX5D 4K07A 4PJHA 1QSFB 3QDMA 1Y18B 5D2NE 2OR9L 2AQ1A 3NFSL 5IBLD 3T3PE 5I1GH 4P2RA 5CEYA 3GI8H 4Y5VC 3R0NA 5DJDB 5KOVC 4MXQC 1T0MB 5BS0E 3DYOA 5KVMC 3OKDB 5DRWA 3UBXB 4L9LC 4JRYA 1UG9A 5LGJA 1Q94A 5DA4A 5A3IC 1FNSH 1PZUB 3MODL 5HY9A 1VHPA 1JGEA 3KPOA 5TDOB 3VXSE 5MEOA 2IQ9L 2C1OB 4PLKD 5IMLA 4X6FB 1JV5A 3BW9A 3O11A 2RB8A 3B9VA 4XP9H 3HI6L 2CJUL 1KENL 1MCLA 1CD8A 4NQSA 3MYJB 1YEEL 5DMGC 4ZFZB 3CMOL 1IRAY 4KKLC 4S1DC 4ISVB 4U1SA 1NSNH 3SDXB 4M5YL 4P2CG 3NZ8A 4D9RE 3O45A 3CXHJ 3INUL 4D9QD 2E6JA 2R15A 2JKXA 3ZTNH 5L2KA 1NKRA 3QIWB 4BFGA 4PJEE 4M7JH 5BXFB 3IAPA 1J8HB 4V1DD 5C0FB 4YAQA 3TIDB 5B39A 1R0AH 4UINH 3VXRB 1S78D 5IVXA 4F7PB 2NW3B 1FL6B 1RK0B 1NAKH 4OM0L 4Z7UE 3TVMB 5JXAH 3RWHB 4KGLA 3TWCH 3P0YH 2NY0D 3O81A 5DHVB 2X10A 4HIJA 4QXUH 2QR0B 4YHNA 5IT2H 3AY4C 3CFKB 3ARBB 3EDJA 1P4IH 1LO0L 4N0UE 5CD3B 1RIUH 3V7MA 4NQEA 5IESH 2R56L 2I9LB 3MSPA 5FHAH 3VFWA 4NQVA 1I3RA 3DVIA 2EE6A 3BQUD 1NMCC 1MCRA 1S9YA 4MJ6B 2CKBH 1CDIA 3IS0X 5C0BE 3IKKA 2ZCKH 1IBGL 1QSED 3FT3A 5D8JL 5GRUH 1AXSA 1KPRB 2GT9A 4PRHA 5D6DC 3L3JB 4M8VA 5DMYA 2JLLA 2GQHA 1ODAA 2UWEB 2Y7QB 3C5ZA 2DI9A 2Z31D 4PRPB 5DJCB 1UM6L 2XYCA 1MLCA 5C6TL 5BCAA 1T2XA 4PJBA 5HHXH 3FOMA 4AT6B 3OKEB 2OR8A 4HWNA 3OJVC 4M3KB 1WZMA 1SJHA 4L3AA 3OWEA 4KROD 1OGAD 4JM2A 1BF2A 5DFWH 2I5YL 3DRTB 1A6AB 2UYLA 3RWFA 4YQXH 1WCBA 3G6JE 3B3IB 4K8RH 2ENYA 3KPMB 3QUKB 4U1IA 3U4EB 4ZQKB 3NOIA 4G43B 5AAMA 2IPTL 1LE9B 3DXAB 1JP5A 2DIBA 3DETC 4TVSa 2J4WH 1X7QB 1U8HB 2BRQA 1ZLUH 3SKOB 4Y5YC 3WS3B 1MWAB 3EYSH 3LRSA 2WBJB 1T6VN 5F7MC 3WLWC 2CGRL 1HHKB 1AE6L 2RIKA 3RAJH 4YNYB 3VRLF 1ULVA 4KVCL 4P9MH 1Z3GL 3K4DA 1ZK9A 1U58B 1QRNB 2OL3L 3V8CA 1FGVH 4GFTB 4YE4L 3U2SA 1MJ7H 3TT1H 3LH2L 4Z5RA 4F2MB 2PYEE 5L6YL 3UROR 3L9RA 4X5WA 3C8HA 3SEPA 3D2UA 4FFVC 2OTWB 4LLQB 3NGBB 4JHAL 3CFBA 5IWLA 5DDHB 3BKJL 1BVKA 1J1PL 2OLDA 4F7TB 1U93B 2FZ3A 4P46D 3KLAB 4BZYA 2FECL 3VMOA 5IQ9B 2WBJC 1CDGA 3DVGB 3WIIL 3QUXD 4WIQA 1A6ZA 1AY1L 2DQGH 3MRRB 3QDJD 4XRCA 3SGJA 2DWDB 1JRHH 1OSPH 3RIFK 1HSAA 4LVHB 3VFUB 4WENB 4NYLB 3K7UA 5F3BA 2HFGL 3TBWB 5C07D 4KQ4L 2O93L 2CIIA 1CLOL 2XWTB 4BSWA 4EDWH 3B2UD 2CLRB 5GS0D 1HSBB 2YD4A 1INEL 1UT9A 1DSFL 2FO4A 3WIHA 4PGDB 1OAKL 5GGQH 1G84A 1HHJA 5ESQA 3OF6A 1DVFD 2VN7A 5MEQA 4PYGA 3W9EA 4QRSB 1N64L 4NRYA 5E9DE 1IARB 3DJ9A 4I2XB 1YPZF 2Q1EA 1Q72L 5KAQG 4RMUA 5K9KA 3C8KA 4RFEB 3SDAD 4WDIA 2PF6A 4E0RA 5C2BL 2YRZA 4PJXF 1IM3A 2ATPB 2OMNA 2DQTH 1I7UA 1MCBA 1NMAH 2ZUSA 3TF7C 4P3DA 3HUJF 1S8DA 3QULA 5BZDA 4YR6A 4BJLA 1H8SA 5IKCA 3EO0A 5D6CA 1LQSR 4ZTOH 2GTWB 1FIGL 4ODWA 2P5WA 3FZUC 5I16B 2D31B 5FM4A 4OZIE 4X8JB 1F11A 1B2WL 1CLYH 4EI5D 2IMNA 3VE0A 2ZUQB 3U46B 5ID1B 2VXUH 3RX8A 3MGOB 4JPIA 5JPMA 15C8H 5IJVB 4GUPA 1YJDC 4HEPG 5SV3A 2XV6B 3EFFA 3QH3A 1BX2B 4IMLA 5BS0D 5C7XH 4PJ8D 2D7OA 3IF1B 3BN9C 4OZHF 4ZSOE 1PDKA 1A4JA 4HD9A 3STLB 3EJZD 4GG6A 7FABH 2J3SA 1N4XL 4PP1D 3T0XA 2B1AH 4MB3A 4IM8A 1EEUA 2M8XA 4HPYH 4GOSA 4DGIL 4HS8L 5DT1L 3VXSD 3O6FD 4NQXA 4MAUH 1I9JL 1SQ2N 3B5GA 1D5IL 2IFGA 1A0QL 3OB0H 2ZUQC 3A6OA 1A7PH 4XPTL 3RY6A 1SM3H 4AH2B 3S3SA 4Q6IB 1TNMA 2WANA 4JAMB 3JWNC 2ADFL 4YIQB 3PP4H 5KSUA 4PJ5B 3MZTA 1F2QA 2OM5A 1R5VB 3LRGA 1MCDA 1A1MA 1HILA 1ORSA 4NRZA 4L4TE 1T7VA 4D9RD 2EO1A 2ADJB 2IBBA 1CK0L 1T2QH 1WK0A 4PJ7F 5KS9F 3LEVH 5D9SB 1SYSB 1YQ2A 4WRLA 5F7EL 3L3GB 3RPKA 3VU2A 3QR2A 5CINL 4NCC2 4XPBH 1UXWB 2DQUH 5KSAD 4HBQA 5IIEA 4Q97A 3QG7L 4MNHA 4W4OA 3GSQA 2VXSH 1BQHG 4HIXH 2F5BL 2NX5B 1KG0A 2OI9B 1JZ3A 3EO1A 4QRPB 2CLZA 4X4XB 4CU7A 1F4YH 4ZOAA 2VE6B 4Q6IC 2EIDA 3TV3H 1PD6A 1UZ8A 1SHMA 4CVZA 1VCAA 2Q6WA 4JKKA 1T7YA 3EHBC 3ZDXF 1WEJL 4LOUD 2BVPA 3UO1H 4BZ1H 1ZHBB 1KTDA 4U0RC 5FGCB 3BSZL 4EIZC 2VLRE 1S7TA 1CICD 3ZT6A 5CUSL 1ZLSH 4NNYB 4YO0B 1YNKL 1SVCP 1CDJA 4JREB 4XCEB 4L3EE 4LSPL 1QBAA 1CZ8L 1LO2H 4LEOA 2F54B 5BVPH 1X5GA 5LXGH 2ZUTA 3QUML 2P4AB 5C0BD 3GSWA 2ZNXA 1QVOB 3B43A 5IBLC 4ZOBA 1OL0A 2HLAB 3UTSB 3ZDZE 1I1AA 4HGKC 1ONQB 4NBZB 2CRIA 4HG4J 5J6GB 3R1GH 4M02A 3KYMB 3HRPA 5I1AB 3DX7B 4UZGA 3L7EA 1BZ9B 3SE8H 1DEEB 4GG8A 1HI6A 1H5BB 3IU3A 1BQHA 4JLRB 4FXKB 1I3VA 3P4NB 3MREB 4KHXH 1O7VA 4XNYL 1PY4A 2LQRA 5CEZE 1XR8B 4FFZH 3P4OA 3UZEA 4X4YB 1JWSA 2AEQL 3TEUA 2XWJB 3LV3B 4KVNH 2EE2A 5TGBB 3RBSA 5I17B 4PLKC 4LQ1A 3U9PH 3PGCB 5FK9B 4D3CH 5K9OA 5BZWA 1AR2A 1EUTA 5FO7A 4PG2C 4ZS6D 5CJ8A 5FOBA 3VD9A 3LKQA 3ARDA 2NY2D 4HUUB 5I8EB 4PGEB 2NY0B 1X4YA 5ID0A 4ETYA 2Z8VC 1CL7H 4K23H 4OF8A 2FRGP 1KELL 1ROWA 5SX4I 4NZRL 2VJXA 3P30L 3S6CA 4NC2B 4EN3D 5DMJB 1NBVH 4AK1A 1JNHB 2PYED 3GIZL 3VFTB 1UCTA 1H15A 4L4VE 2A74B 5C0JA 2HVJA 2X89D 4QXTA 3VJ6B 4K94L 2DB8A 1C08A 1HOCB 2E7CA 1FJ1B 5E70A 5IFJB 5AZEL 1Q0XH 3QWOB 4XC3H 4Z95H 1S78C 1VADB 2AEWA 1G7JB 4JRXE 4X9GA 4PJAB 2ID5A 2KH2B 4RAVB 2OP4L 3OR7A 1KT2B 2GJ6E 4UIKH 2NY0C 3DGCR 3GK8H 4JB9H 1LMKA 3QCTL 1IGJB 5GGSA 5D7JA 4MD5B 2ICEB 4TTDD 1UKSA 3ALXA 3KLHD 3CFJB 4WW1A 1IAIM 3RA7H 3S37H 4O02L 5I8CA 4K3GA 1WFOA 4DFIA 5FF6B 4OZFG 2W9DL 2J8UA 5EUKB 4JFDE 4XPAH 3QP3A 4M7LL 1FORL 1FV1B 2BRRL 3KWWA 1KPVB 4HS6A 3BQUC 3O8XA 5D2LB 4A6YB 5BV7C 1XGQA 1MFAH 2XKSA 1T0NA 5E9DD 5MEPA 1TMCB 2HJLA 3GMMB 5FYKH 4FQHB 4Z7WE 5DUBB 2XTLA 5GGTL 2OCFD 3TO4D 1X5HA 1D7FA 3GSUA 1E4WH 2WLZA 3EYFB 1GC1L 3MJ6A 1HHHA 2P1YA 1S5HB 3NA9H 2RJMA 3P3YA 4WCYH 1FGNL 1G7QA 2UY7A 5HHME 1S7RA 4CADA 3CCHA 5A2FA 5F3HB 4OF7A 3GO1L 2BY1A 4KROC 4Y89A 4DN4L 3FMGH 4PJHE 3QDME 3DGGA 4HWBL 4JFHE 3ZHDA 1MFDH 3Q1SH 1BJ8A 4P2RE 3CFEB 2NLJB 3RWIB 2YPLB 4LCUB 2HFEA 4O4YH 1N26A 4M1GH 5J6HA 4Z76A 1OCWH 3NCEB 1AKJD 4MQ7A 4H20L 4LSRL 3CJJA 3AS2A 1Z9MA 1S9XA 1GRWA 4X83A 3S8WA 1DE4B 3O9WB 2ADIB 3MRCA 2NYYD 4XTRD 2HLFD 4JRYE 3QUXB 2D7TH 5FA4B 1U41A 4JFYA 1P2CA 1T21B 4LHUD 5D4QA 3RDTB 1OPGH 1FP5A 1CFSB 1T1XB 1KN4H 4GT7A 5C07B 5BMFL 3FAWA 4P59H 3T8XA 3ECBA 2A9NL 4AQ1B 2C3HA 3KPNB 4OM1H 2Q86B 3TBVB 4XC1H 5HI5D 1RZKL 1VPOL 1ZVSB 1DVFB 1FFPA 1NAMA 4OGAD 1A7RH 5I73B 1GXEA 5LBSL 4GQ9H 1BLNB 3QEHA 4P46C 1CIDA 4XP6H 2R0WL 3V5KB 3SDAB 3OKKB 3DURA 3UYRH 4UBDD 4NZDA 5IBUB 3QUXC 3AAZB 3CH8A 3F5WA 3BO8B 5KSVA 3BD4A 3X3FL 3WL9A 1EHAA 3HS0A 4PLJD 2HRPL 3BHBB 5DK0A 1MFCH 4NKQB 5KSBA 1Q1JH 5T5FH 4IOIB 1T80A 5ISZB 3B2UC 5I30L 1PVHA 5ALCL 5GS0C 1B3JA 4ZO9A 5IVXE 1EZVX 3MRBB 4MB4A 4LRNH 5EIIA 2VDNL 2X4SB 4RWHA 1DVFC 2EICA 1RZGB 5I73C 1MEXH 3IFLH 1OW0C 3JTTA 3BAEH 3D0VB 5E8PA 1M1SA 3SDAC 5D2NB 3O4LA 3IFOB 3WSQH 2Q76A 3TBYA 5JIPA 2QQNH 1JPFB 5CP7B 3NA4A 5DVLA 1GH7A 4NQEE 2V2TA 4HUMB 4E5XA 4N1EA 5D5MF 5BS0B 4PJ8B 1NLBH 5D1QD 3WO4C 3DIFA 1P5UA 4HLZH 2V17H 4J6RH 4G3YH 4LARH 4FQXD 2VLRD 3AMLA 5LCVH 3GMNB 4QT5A 5K59E 4OI9A 4PRHE 4WJ5B 3MV8B 3GI9H 3VXSB 3O6FB 4L3ED 4Y5XA 4HUKB 2DQCL 1KCVH 3WUWB 4OIBA 4HIIA 4G6KH 3RZWA 4EI5C 4X6EA 4PJBE 2BNQE 5D2NC 3DUUA 3QNXB 1XCTB 1QNZH 2H9GA 3G5YB 3H0TA 1G0DA 3VFNB 1ZT4B 4M7ZB 1D6VL 2AI0L 5D1XD 4QRTA 2VUYA 3AGVA 2A2QT 3GBLA 4ONFH 5GRZA 4UOW0 2EDHA 1A2YB 4U1GB 1CU4H 4PJ8C 5H94B 3OXRB 1PKOA 4MA1B 1CGYA 4OLZH 4RAHA 4XPGH 3A6CH 2YN3A 3EJZC 3WIFA 1ADQH 4ODBD 4PP1C 4Z7VF 5FO8A 4PJEB 4U1LB 1I8MB 2FJFB 1TCMA 3HE6D 5CEZD 1JGVH 4PB0H 1I1YB 1HQ4B 3GKWH 3O6FC 3FQRB 1N0XH 3TH2T 3QUYA 1VFAB 4EI6B 1E4XI 4WU5B 1I9IH 5HJ3B 5GSVB 4APQA 3S36H 3I6LD 3FQUB 4S0TD 5E6ZA 4BH8A 3IDIB 2B2XL 4Z7UB 2MPAH 5EOCJ 4P2OB 3QJHA 2DRUA 4M7ZC 1I8IB 2VLKA 4H88H 3T2PA 1MPAL 3ZE0F 4LQFH 1N7MH 3AFLA 4L5FL 5HI4D 3PP3K 3SKNB 3VI4F 1EK3A 3MLZH 4OLXH 2X4QA 4U1GC 1JZ5A 1EHLH 3LKSA 4MA1C 4KGJA 1QR1B 3ARSA 3GNML 4HXAH 4N1CA 5IK3B 1LO3H 2ZOLA 3PDOA 3VI3E 5HHNB 3QI9A 1VEPA 5C0NC 2R9HD 3MLUH 1Q9WB 2VL5A 4L4VD 5KSAC 1VKXB 2JCCF 3MJ8A 3GMRA 1G7MB 4OAWB 3IFNL 3U7YL 4HW6A 5HGHA 2IGFH 2DQJL 4YXLL 1LK3L 3TBSB 1E6JL 1RFDH 2VDPL 1A4KB 1NH6A 4XBPB 3V5HA 4PUBL 4P23D 4JRXD 2K9UA 2R39A 4OFVA 1GOHA 4U4BA 3JTSA 3BT2H 2GJ6D 4TRPL 4U1MA 4LOUC 4RCAA 4KTYA 4UV7H 4GXUM 2MTPA 1CICC 4WNQB 5I6XB 3CX2A 4FN0A 2SEBA 3OJDB 4LCCA 2ATKA 2IG2H 4JFDD 4PS4H 4JHWL 3KJ6H 3C6SA 2YK1H 1OF2B 3G6JB 3NZHH 1P7HL 2ARJB 3ALWA 5FUZH 2ZOKB 4P5KA 4YHYB 1QFWL 5DMIH 1FDLL 1P7QA 4NPYA 5AD0B 4NRXA 2BVYA 3ZL4H 3R06B 4Q2ZB 2NY2B 5GRVK 3T09A 1BIIB 1QA9B 1DANU 2OK0L 3MRQB 2C3XA 3VDBA 4EOWL 2GHWB 1A9BB 1XF5A 2P5WE 3K2UH 3JUYA 4OLVL 4BFBD 2BY0A 3I02A 4MVBD 5ICYA 1FZOB 4MA3B 3BH9B 4QGTA 3PXJA 5DD5H 25C8L 3KAAA 1IC1A 4GLRI 5HHMD 1LO4H 1Z5LB 3SGKC 4EN3B 1AR1D 4NGHL 1FVDB 1TZGH 4JPKL 2PYEB 2CIKA 2BSSB 4OIIH 4R4BA 1S9WA 4JFHD 3TP4A 1PLGL 2BDNH 1U8QA 4P2RD 1MHPH 1U9KA 1UWXH 4D0BA 1KJ2H 4Y4KB 4U6YB 1C1EH 1NGYB 2XQYG 2AJUL 3DO7A 2R8SL 4MXVE 5EBLA 5EBMA 1EBAA 5JQ6L 1NC2B 4YHYC 4DK6A 1YEGL 4AEIL 4LASH 3ME0A 4FQ1H 2NY2C 4JRYD 3D25A 4H1LG 4TN9A 4GG6E 3VRIA 1INQA 3CVHB 4E41B 5DEFA 5ACLA 4X9IA 2WSKA 2DKUA 1UM5L 1U8MB 2A73A 4JKLA 3QJFB 2VH5H 4EN3C 1PKQB 3PUCA 4PJCA 3C09C 2L0DA 3JWOH 2AKRB 4JFPB 3OX8B 3BEWB 3N9GL 4X4MA 4NBXB 4LLYA 4ACPA 4GMSL 4DQOL 1NCDL 3IDGB 3GMOB 1YDPB 5C0DA 1P4LA 2XFXA 2VR9A 5E9DB 1KB5L 2YMXH 1UB5A 2EDKA 5SWZA 4I1NB 4FFYH 3T1FB 3OKLB 3HC0B 3DUSB 3QQ4B 4OB5L 1UB6B 1AGDB 1CE1H 3PWJB 2AS5M 4HXBL 3KDMB 2I60L 1KOAA 4K3EL 1REIA 3BIKA 4TTDC 1D5BA 4YHIA 5D7IF 4D2NA 3KLHC 4JN2A 2CO6B 2BNRD 4FQIL 3CH1B 2IPKB 2X5PA 3IDJA 3O6LL 1JHTA 2DLFL 4YHML 2DIAA 3QEQB 3QXDB 3MOAH 3I3EA 4MWFA 4Q9CA 4A2LA 1QBMH 2CUHA 4OZIB 2G60H 3JWDC 5DJ0B 3ALPA 4Z7QE 2Z4QA 4HFUL 3AREA 1GAFL 3CSPA 2XPGA 4LHUB 1A7NL 1G9NL 3TO4C 5GRYA 2X4TB 4HJJL 4XZUA 2FNBA 3GJFH 4PRAA 3VFOA 4WY7H 2YR3A 4LVOC 5JA8B 4NQED 5J0BA 2GYSA 3HPLA 1LNUA 1JTOA 1XGRA 1S7SA 4ZSOB 4PPTA 2H32B 5ETUA 5GSRA 5C0RL 4NUJA 3RIAK 4M1DL 4R3SB 3PHSA 5I76B 1RZJL 5FYKU 3OPZL 5AAWA 3LHPH 3Q6FA 4PRHD 1PQZB 2Z93A 1W72B 3GSVA 4JKPH 1G0XA 3DX6B 3QSKB 4HBCH 4LRIA 4PJDF 4DCQB 3C5ZD 3SCMB 4JFZL 1ZSDA 5E8EA 8FABB 2R0LL 1S7QB 4URTB 5DA0B 5EU5A 5T3ZH 4MX7A 4DWHA 4LSTH 3A6BL 3OTTA 2NYYC 1KIPB 4XTRC 2BNQD 2HLFC 4FZEH 2P8PB 3ORJA 1KEML 3IJHB 4X99B 5FAAA 1T03L 1ZANL 4JM2D 2WIIA 2YPKB 3HMWH 1YUHB 3M8OL 4J3UA 4N9GA 2R2CA 3RX7A 1XIWA 4L4TB 1VGKB 5GZND 3T4AA 5J13B 5J3HD 5IBTH 2Z35A 4ZFGL 5JOPD 1KJVB 3GI8L 4LGPB 2DJUA 3KHOA 2G5RA 3MLWH 3GSNB 4RWYH 2RCSH 1UWEH 5HI5C 1NLDH 3FFDB 5T1LD 3X3GH 1C8PA 4OGAC 5C71A 2OS7A 1N3NB 1PG7H 3FCTB 1RVFH 4UAOC 3G9VA 5DK2B 1YECH 2ARWA 1FNSL 1OOAA 3P77B 1S7VB 1FVEA 4ZPVB 3HI5H 2BOBA 4JFXA 1NUGA 4ZNEA 2VERN 4P3CL 1YY9D 4DGYH 3S96B 3TGXA 2AJ3B 1TZHB 4YDJB 3BPCA 3MMEA 4PLJC 5E5MA 1BQSA 1FZKB 1UM4L 1BBJA 5CCKH 3E8UH 3D2UD 3GMPB 1JGLL 2CD0A 5DJXB 4FQXB 2VLRB 2D0GA 3MBEB 1AD0B 9CGTA 1PZ5A 1NCNA 4KJWD 3RPIB 4E9LA 4L3EB 2JE8A 5F1KC 4BQCA 3FKUS 3CDYA 1R5WB 4MD4B 4O2FA 3IDUA 2FJGA 4LLMB 1IC4L 2E9WA 1C5CL 4PTUB 3ZTNL 2QTEA 4IIQA 3U30C 4CU8A 3MV11 1WAAF 2J8UE 1M7DA 4WW2A 5D1XB 3SE3A 3HCVB 1RD6A 3VW3L 3WFBH 5E8OA 5IW1A 1P7KB 5FYLH 5D1QC 1R0AL 2P5EA 4FP8H 1NAKL 3MXVH 3UPRA 4FQXC 3C5SB 4RMVA 5J1TC 4AZ8A 5JXAL 3MBEC 3TWCL 3HE6B 4P5MA 3P0YL 1S7WB 5TF1L 1R6VA 5TE6H 3UC0H 1J05A 1GZQA 4QXUL 5IT2L 3CXHK 3B8YA 2PW1A 4XCCH 1BFOA 5I1EH 5ITFB 3MXWH 1MHCB 3I6GB 2YEZB 1QLEH 4F8TA 1RIUL 3L7FA 2Y72A 3VFVA 2P8LB 3P9WB 5TFSH 5MHSE 1K2DA 5IESL 1MFEH 4S0SD 5D1XC 5IG7A 3ES6B 2ERJC 3W2DH 2CKBL 2P5WD 2KKQA 2AEPL 1H0DB 1HKFA 2ZCKL 2PXYA 2R0ZL 4EUPH 32C2B 3ET9F 3BYYA 4HK0A 1J0YA 1OY3B 5EFIB 4L4VB 3HE6C 4CDHA 4GRWF 3WJJA 3SDDD 4H5SB 4Z0XB 2V2WA 4JZJB 5F1IB 2R29L 4P5TA 4RX4A 4B53A 3ULUE 4RA3A 1KN2L 2GAZA 3RWJA 2NNAB 4P23B 3EOBB 2DN7A 5DJZA 2OQJB 5HYJB 1NPUA 1AGEB 1RUKH 3UAJD 2J6EH 4YQXL 1OGTB 3C87A 1G6VK 1UADC 4K8RL 1T4KB 2GJ6B 1U8NA 5IM7A 2I25N 5HI4C 2J4WL 4XPHH 3CLFL 1FC2D 1QZ1A 5EU4B 2HA1A 1I4FA 3EYSL 3W81A 1V7MH 5M7QA 5CS7A 3RAJL 5IB1A 2R9HC 3Q0HA 2FGWH 3MO1B 4AEHH 2DWEA 2A6JA 4NO2B 1CFTB 1WICA 1A3QA 2PW2A 5C8JB 3JBG7 1MJ7L 2UUDH 3B5TA 3BEVA 4UNTA 3LN5B 5IQ7L 5KSBE 4P57A 4P23C 3DVNB 3HZKA 2NY3D 1CR9L 1UH2A 2VOTA 4Z7WB 5JR1L 3PABB 1QSZA 2C7UA 2ZZUT 2Q3AA 4S1RH 4B7IA 4HCRA 1JIBA 4X7DC 3BDYH 4MDJA 4D9LL 3GSRB 5JO5B 2GCYB 2KZWA 1BOGB 1G7PB 1XF4B 2D3VA 5JIKA 5HHMB 2GY5A 4LMQI 2W07A 1MWAL 5TH2A 4M61A 1FL5A 1IAOB 4LLVA 4F33A 4PJHB 3QDMB 2DQGL 3T0EA 2V7HA 4U1NA 4P2RB 5CEYB 2J2ZA 4Z7OF 1OWRM 3LS4H 4RMSA 4EDWL 1OTTD 2YPVH 4U33A 5EZIH 1N6QH 2C3GA 1YYML 3D48R 5DRWB 4JRYB 1WT5A 5D71H 2AGJL 5GGQL 5LGJB 4EBQL 1OARL 1T1ZA 5HY9B 2MQCA 4LSUL 1JGEB 4MVBC 3KPOB 3O3BA 4I0KA 5MEOB 3PHOA 5EG6C 3FB5A 4G8GE 5GGSY 1AR1C 3RI5F 2YUWA 5IMLB 4WHTA 2PO6D 1JV5B 3BW9B 3O11B 4J12A 4NWUL 1A1NA 1AQKH 3QXUA 2DQTL 2YN5A 1XGTA 3D3VA 1NMAL 2XRAH 1F4XH 1I1AD 3BH8A 1NGZA 1H3TA 4AIXA 3MA9H 4K7FA 4P3WA 4U1SB 5DO2D 4BQ8A 3NZ8B 3UEZA 4QF1A 3O45B 4ZTOL 4ELKA 1U3YA 1K85A 2MHAA 5L2KB 2Y23A 2YWYA 3IXTA 1FFOA 5HGBA 4I13B 2VQUA 2IBZY 1FO0A 1Q0YH 4LSVH 5F8QC 4YAQB 2C3VA 2QL1A 3RKPA 4FTVA 3W11D 5IVXB 2EDYA 2NXYD 4L1DA 15C8L 1KCLA 1ZOXA 2FX7H 5B21A 1QP1A 3RL2A 2NZ9D 3K3QA 3L3DA 1RK1A 3OG6B 3RNKA 3U9UA 4GBXA 1MH5A 4HIJB 4YHNB 1HN1A 1T2JA 4OQTA 2B1AL 3O6KH 4BYHA 3IDMA 4HPYL 3HA0A 3GSOA 2OX5A 2L7UA 3VH8G 5SX5H 4NQEB 4MAUL 3VFWB 4NQVB 3P4MA 1I3RB 4JG0L 1TPXB 4RGNE 3GMQA 1ACZA 1FH5H 3GFUA 4LPCA 4F9LA 1SM3L 1A3LH 2AV7A 1H8OA 1HNFA 4UT7L 3O3DB 1Q8MA 3FT3B 1XGPA 3PP4L 1AXSB 2DIJA 2GT9B 2R0KH 4DKDC 4YX2H 2VIRA 3LKOA 3F7QA 5T3ZE 5T1KD 3ZKXC 3FN0H 1JK8B 1MLCB 1NC4A 2RAMA 1UEMA 1OAQH 4IEFB 5LWYH 4PJBB 5D7JD 1HXYA 1T2QL 3FOMB 5FV2A 2UVEA 4O9HH 4Y1AA 4XPBL 5C0EA 2B4CC 1SJHB 1FLRL 5F1NA 5MENA 3SKJH 5I1LA 3S35L 3VXPA 2UYLB 4XVJH 3RWFB 1RZIA 3HB3D 1WCBB 3FN3A 3UYOD 1VB9A 4U1IB 1TPXC 5C08A 4L8DA 5GJTH 1F4YL 2VO5A 4GQPH 4U6TA 3K74B 3TV3L 1I8LA 3E2HB 1M05A 3NBNA 3LRSB 3U0WL 5JZ7D 4ODSH 4HSQA 3VH8A 5C86A 5IR1A 2NQCA 3C5ZC 4J2XA 5HHOB 4BZ1L 1P84K 1EV2E 1MRFL 3MRJA 5GS2H 3OBAA 1ZWIA 5DJ2A 1ZLSL 2E9BA 1UA6H 5F7UA 3U2SB 2LVEA 4Z5RB 1A6VH 4YHPB 3NABH 5DURD 3JSSA 3BXNB 4JM2C 4CAGA 3L9RB 4X5WB 5LXGL 3MTRA 5GZNC 3CFBB 5J3HC 3HNSH 1BVKB 4P0DA 1XF1A 3OAUL 4JVWA 4OUOA 5CJQH 4OT1H 3ZE2F 3TBTA 1RUPH 1V5JA 1A6ZB 1AI1H 4G9FA 1HSAB 3T0AA 2QQLL 2GI7A 1YC8A 1M4KA 2EDNA 3ARTA 3UBXG 4Z6AT 3ULUD 2CIIB 1NCBL 4PRNB 4BSWB 4LVNC 2R1YB 4PJCE 1YY9C 4KJQD 4G6JH 4X4ME 2FO4B 4KVNL 2XZCH 3U9PL 5FV1L 1MY5A 4D3CL 5MEQB 4Z0BH 4TYUA 3W9EB 4HULB 5IWLC 3CNKA 3LIZL 3SN6N 4NRYB 3AUVA 4NQCA 2BHYA 5SWZE 5K9KB 2DLIA 3C8KB 5I8KL 4WDIB 5EULV 3MUZ1 1BBDH 4KJWC 4E0RB 1CL7L 4K23L 4PV9B 1IM3B 3LS5L 1KC5L 2DMKA 3I75A 1YPZE 1I7UB 3SGJC 4P3DB 4FNLH 4Y88A 1S8DB 4P9HL 1JTPA 4YZFF 3D9AH 4PJXE 4NKMA 3QULB 1BZQK 5BZDB 4X6CF 4TOYH 4YR6B 4EDXA 4MS8D 5TF0A 3G08A 3HUJE 5IKCB 5D6CB 5KVFH 1LO5A 4ODWB 2P5WB 4MXWH 1RJZA 3S35X 1Q0XL 4XC3L 4GH7B 1F11B 1F4WL 1L0XA 5FCSH 5KTEL 4ODTH 4S11A 1QPPA 3BKMH 3VE0B 5IF0A 1A22B 2PR4H 4ZAKD 1F5WA 4UIKL 3GK8L 3RWDA 1I7ZA 4JB9L 5FCUL 3QISA 4JPIB 5JPMB 2WBWB 3H42H 4GUPB 3S37L 4DEPB 2NW2A 1HWGB 4P48A 2G5BB 3KPLA 1L6ZA 3EFFB 3QH3B 4IMLB 3EUUA 3EOTH 1C12A 4F37K 3LQMA 3VG9B 1VGEH 2H3NA 4GG6B 1HIMH 3PIQA 4TUOA 5DD1H 5B3JE 4NQXB 1IQWH 4G8GD 4AG4L 5FYKL 1CLZH 1PEWA 1X5ZA 5SX4H 3HMXH 3GRWH 2NTFA 5IHLB 4J3XA 1E4WL 3SDDC 4WCYL 2FHBA 5KSUB 4N8CH 3MLPA 1LILA 2PCPB 4DEPC 1T1WA 1A1MB 2NY3B 1HILB 1ORSB 3FMGL 4NRZB 5JOFA 3IAGC 3VG9C 1MFDL 2V9RA 3Q1SL 5E08L 3UAJC 2OXGA 2RR3A 5FUCE 4O4YL 4YFLI 1LDSA 4KTDH 4ORGA 3STZA 5JW4M 5BVJA 4LCIH 4J23A 2B1HH 1UXSA 5CJOH 4M8QA 5IIEB 5EU3B 2YBRA 3CDGA 4MNHB 3QUYD 4X98A 3S4SG 2Z8RA 3BZEA 4L8CA 2QSQA 3MUJA 4APQD 3EO1B 2A0LD 2CLZB 3LEXB 3RY6C 4YGVA 4ZNEE 2I26N 3HZVB 5C0GA 1UZ8B 4MZ2A 3GBMH 4CVZB 3V5DA 1MAML 2Q6WB 3CMGA 5CIPA 1GZPA 2YZ1A 4UT6H 4JN1H 4RMWA 3ARQA 4GSDL 2BVPB 4Y5YA 2NY3C 1KTDB 4JM4H 4XC1L 1S7TB 4BFIA 2NTSP 4PLNC 3ZDXE 4OF6A 4HC1H 5J12C 3SQBA 3QI9D 4Z8FH 3T0DA 5GRJH 4XP6L 2Y36H 3GHBH 4HT1H 4LEOB 5I1CH 4RGND 3C5JA 3UYRL 5E8DL 3HE7A 1WIOA 3BE1H 1AJ7H 3GSWB 5C0CA 3HFMH 1EAPA 3NH7H 2E6QA 1K5NA 1I1AB 12E8L 4WUUB 3DROB 4NNPH 4Y0GA 5T3ZD 1MFCL 3WN5B 3DNKA 5DS8A 2MCPH 3EAKA 4QHMA 3L7EB 1OTTC 1YNLL 3BGMB 4QYOA 5IMOA 3MLRL 3S37X 4GG8B 3NIFF 2P5EE 1HI6B 1SY6H 3IU3B 4GMTH 4KMTH 1BQHB 2AJYH 2YC1A 3S4SA 4HUWA 3TCLA 4V2CB 2W0FB 4PGJA 2WWKT 2P8MA 3JV6A 4M00A 2VR4A 1NFKA 3P4OB 3OV6A 2CQVA 1DQJA 4PY8I 2FEEL 1CBVH 3RVTD 1QKZH 1JWSB 3BAEL 2C9AA 3TYGL 4H25B 3TPUA 1IEAA 5K9OB 1KCRH 2PO6C 4HUVA 2CSPA 2QQNL 5FO7B 1QPXA 1E27A 1P7QD 4WEMB 1PGRB 3NCYS 5F97E 4W6WB 4X80H 2XXCB 5GISL 3LKQB 3ARDB 1I1AC 2OL3A 5HDQH 1NLBL 1JZ6A 1JVKA 1FZJA 1A14L 5ID0B 1BJ1J 4J6RL 5DO2C 4G3YL 4N0CD 3UBXI 2HFFA 1X3DA 4BM7A 4JANA 4XP5H 1JWMA 3GI9L 1DBJH 4NWTL 3UPAA 3QNYA 1KYOJ 2F74B 1HHGA 1H15B 3DMMB 5C0JB 2HVJB 4QXTB 3BWAA 4G6KL 1ZLUK 3VGDA 2BJMH 3BZ4A 1C08B 2YSSA 2MKWA 4NCC1 1HNGA 1V7NH 2E9JA 1QNZL 3W11C 4YC2B 3VXTA 1KIQA 2NXYC 1YN6A 1E4KA 2B0SH 4ONFL 3OR7B 4XNMA 2NZ9C 5FKAA 3U82B 4MJIA 5CWSA 3ARPA 4XPGL 5GGSB 1AC6A 3A6CL 5DJAA 1ADQL 2F53A 4WW1B 2WQ8A 4XP1H 3S97C 1DQDH 5I8CB 2OZ4H 4PP2A 4KRNA 4R26L 3VXME 1JGVL 2J8UB 4PB0L 4GKNA 5FYLD 3W0WA 2CR3A 3G5VA 4OIAA 4ODVL 2FIKA 2CR6A 3RRQA 2CJUH 1BREA 1I9IL 2DDQL 3KWWB 5HDBE 3TN0A 3S36L 3O8XB 3UZVB 1MCWW 3ZE1E 4X9FA 2J8OA 1XGQB 5AYUH 3CMOH 5A1AA 2MPAL 1T0NB 4UNUA 3BPOC 4YC2C 5MEPB 3A0OA 5SWZD 3Q48A 2HJLB 2R2BA 3UTZA 1YYLH 1G9MH 4LQFL 1N7ML 1NGPL 2KQNA 3INUH 1GIGH 3LPGA 3GSUB 2XI9A 3L5WA 1H8NA 4OLXL 1HHHB 3UTTA 1A21A 3GUTA 1F58L 5M94B 5D7JC 3STBA 1LO3L 1G7QB 5E99H 1S7RB 3U83A 3CCHB 3WFCH 3MLUL 5DURB 1ZTXL 1INDH 2DM3A 5MERB 2YD1A 1YC7A 4C56A 3T0EE 1X5YA 3VWJA 4JDVA 4OM0H 3HB3C 1MHEA 4Y4HA 2HFEB 4JQXA 1LEKB 2ZNWA 4YFLF 4Z76B 5J6HB 3O8XC 4MQ7B 3MCLH 1ORQA 4P4KD 3MRLA 1DTUA 3ARED 3MRCB 5DTFA 4KI5E 5JZ7C 1NFDA 4KHTL 3R0MA 4JFYB 1P2CB 5E6IB 3K0WA 3NTCH 3FRUA 2R56H 1AGFA 2HH0L 2QADD 3ECBB 5T1MA 3T8XB 4HZAA 2IG2L 5AWNL 1ES0A 3KJ6L 1ED3A 2YK1L 1EXUB 3NZHL 3D3VE 5F9AC 1FFPB 1M6OA 2D7QA 1NAMB 3MRGA 3RP1A 1AD9A 4U6VL 4WVRA 5C6TH 4X8XA 3VWKA 3DURB 1A6WL 4IOFD 4OKDA 3G6AA 1T5XA 5C0IA 1MJJA 4OZFH 3K2UL 2F9BT 3P0VL 2JELL 5IEKA 1PW3A 5CJBA 3R8BB 5KSVB 4PJFF 5FO9B 4HJGA 2I5YH 1DBAH 5SWSD 3WL9B 3HS0B 5DK0B 3ULUC 5KSBB 4RFNB 1XIWD 3EIFA 1NCTA 3VD5A 5MP6L 4FTVE 2X1QA 5I1IH 1YMHA 5EIIB 3LKPA 1C1EL 3B9KA 5IB2A 1V8HA 1N2RA 3OB0K 3TZVD 4M93B 1KJMA 1C7SA 3H7LA 3S36X 1Z3GH 4LASL 5BW7A 4FQ1L 3JTTB 3U7WH 5E8PB 1CGVA 3O4LB 2V5TA 1X6LA 1MCNA 4M7LT 3TBYB 3LH2H 5F6HI 1A1OA 1MCJA 3M1BB 3D39A 5L6YH 3T4YA 2PYFA 1G7HA 4MCZA 3VD4A 4E5XB 1U3ZA 5EO0A 4IDJH 1ND0A 4N9OB 4RFNC 1B0GA 3K4AA 3BKJH 4MS8C 1CTNA 3HPJA 4S2SB 1VSCA 5C6PB 3UJIL 4QT5B 1BFVH 3CZJA 1G6RH 1W0YT 3C2AL 3QUMA 3WIIH 4Y5XB 4K3DH 5DRXA 4FFYL 4M93C 4X6EB 2HFGH 4ZAKC 2NY5L 1CLOH 3DUUB 4GLRH 1CE1L 4WHCA 4POUB 2H9GB 3H0TB 4QHUA 1R3LA 4KV5E 4QRTB 5MENE 3LD8B 4V1DA 4PLOB 4H8WH 1OAKH 4MAYA 5E2JA 1CFBA 3R8QA 1MAJA 5C08E 3SDXF 2P5ED 3QRFM 1CT8A 3G5XA 1N64H 3WIFB 3MOAL 5A2LH 1QBML 4AEEA 1HCVA 5FO8B 4LKXA 5E1AA 2V7NA 4XNUH 4M6OL 1IEBA 2EDBA 4U6XA 4Y5XC 3JWOC 2NXZD 2QKIA 3QUYB 4K55A 3QA3A 4NO3A 1ZLWH 5AG8A 2BXZA 3FT4A 1B0RA 4PBXA 2A1WL 2DQIL 2MFNA 3FTGA 3MQIA 4DVBA 4AM0B 4BH8B 4R90H 1MLBA 5J4MA 3QJHB 2VLKB 1PEZA 3MJGX 3LD8C 1FIGH 1OP3H 2P7TA 3WXVH 4CVXB 4JZOA 4BFEA 3N50A 4X6BA 2X4QB 1QSEA 1B2WH 2PXYD 5J1AA 3LHPL 2KUTA 4IOSD 2ZOLB 3PDOB 4JKPL 4HBCL 3QI9B 5FKPB 4CJ0A 2Z31A 2VL5B 3BUYA 1MCSA 2W91A 3MJ8B 5CEXA 3GMRB 35C8H 4RGNB 1WUNT 5HGHB 4G9FE 3QUYC 3S34L 3BJLA 3HLAB 4LPTA 4XVSH 4FZEL 4QXGL 4APQC 5E5UB 1VEMA 4MJ5A 1LDPH 2A0LC 2JCCE 1OGAA 1Q9LA 3M17A 3V5HB 1WISA 4Z18A 4GRWH 3CC5A 3HMWL 5KG9A 3SGDI 4BK4A 5IW6A 1UJTA 3JTSB 2UWEF 5DVMA 2BVOA 2CK2A 4NKOA 2Z8WC 43CAB 4DGIH 4LCWE 4KXZI 3AMKA 1U6AH 2EKSA 1O7SA 5GRXG 4Z77A 3MLWL 4RWYL 1UWEL 1U42A 4NQCE 1NLDL 4TUKL 3LQAH 3VXMD 3X3GL 3V6FA 2SEBB 4R6UA 4LCCB 8CGTA 1W72L 2ATKB 3QI9C 3ZYOA 4XPTH 1LP9A 1PG7L 3C6SB 3MV9A 5ERWA 4ZD3L 4OKVA 2W0PA 1RAMA 4RGNC 1RPQA 2J88L 3HI5L 4P5KB 3WXWL 1P7QB 3ZTJH 4NPYB 5GGTA 3WHXB 3I3BA 4NRXB 3X12A 1CS6A 4KY1L 3T0BA 5GS2D 3BPNB 3L5XL 1XF5B 5CINH 5BRZA 3IDXH 2C4FU 3I02B 3V4VH 4P46A 5I1DA 4WV1C 1WWBX 2Y5EA 1QFOA 2JB5H 4JGJA 4P4RA 2X1PA 3QDGE 4KMQA 4O00A 4R4BB 4KUZH 3QDJA 4LCCC 1S9WB 4IS6A 4LKCA 3RVTC 4HKXA 1PX3A 3A67L 4D0BB 4OI7A 5FM5O 3U4BL 3ISWA 3DO7B 4IMKA 5EBMB 1KFAL 3O4OB 3H9HA 3DX8A 3WFBL 5LG1A 1TTFA 5J11B 3D25B 4KI5D 3VRIB 3GM8A 3DBXA 3BZFA 1E28A 5DEFB 2WK2A 1IGIH 2HWZH 4N0CC 1MCWM 3MXVL 4D8PA 4LSPH 4GAYB 1J1OL 4YWGL 1CZ8H 2A73B 2OTUA 3CU7A 1L6XA 3DSNA 4PJCB 3CFCL 1JF6A 1BQLH 4WHDA 3UC0L 3BIBX 1U2CA 2I9TA 4LLYB 1DCLA 4XCCL 4YHZH 5KVDL 1ETZA 4Y2OA 3S88H 2VC2H 1P4LB 1QLEL 3J8F7 4RIRA 2XFXB 1CGWA 3ZDYF 1N6VA 5TFSL 1IZJA 1UB5B 1MFEL 1EUUA 5SWZB 3O4OC 4QHLB 1EVTC 5DHXB 5I9QB 4AL8L 2FEDD 5EU7E 2X40A 5J11C 1YEKH 3W2DL 1WWWX 4I5BA 2GW5A 2APBA 3NPZB 2HT3C 2F15A 4R0LA 4QNPE 3HTLX 3BIKB 1MIEH 1D5BB 4YHIB 1HQRA 2AEQH 1FFQA 4JN2B 2RFXA 4FRWA 4G5ZL 3IDJB 4X6DF 1JHTB 1RHHA 5LVEA 4KQ3L 4FTVD 4O2EA 2D0FA 5D7IE 4WHYG 1CD0A 2ITCA 1ZE3C 1PG7X 5F7WC 5DUPH 4OUUB 4PB9L 3VFMB 4YDLC 2Z4QB 1X5FA 1KELH 4GBXD 5ELIA 3AREB 1I8KA 2J6EL 2X4UA 2XPGB 4NZRH 2EDDA 5I9QC 2MMXA 1I3UA 3DI3B 2P43B 4XZUB 3VFOB 4PRAB 3GIZH 2XY2A 1V7ML 3HPLB 1LNUB 3PF2A 4M4RA 4K94H 3QZWA 1XGRB 1S7SB 1QTYT 5ETUB 5GSRB 3WFZA 2FGWL 5DJ6A 4KAQH 5F9WB 5C0CE 1EAJA 2DLGA 2WP3O 4H1LH 2OP4H 2Z93B 4YDKH 3GSVB 4ELMA 5L88H 2XKNA 4L8BA 1ZSDB 4R7NA 4P4KC 5E8EB 5EU5B 1R3HA 1NC4D 4MX7B 1L9NA 3AREC 4PJDE 4S1RL 3HZMA 1ZHLA 3I2CH 1EH9A 4O02H 3BDYL 5IFHH 2W9DH 5KSAA 1ZA6B 5B4MD 3SY0A 3AM8A 2VL4A 2JK5A 5MEND 4J4PA 4M7LH 4FQLH 1FORH 3HKFA 2BRRH 4N9GB 2QADC 5CBAA 1DEDA 1XIWB 3T4AB 5C08D 4G7YH 2Z35B 4G8IA 5DSCA 1UQSA 3MGTA 4CJ1A 4XVTL 1IM9B 2H6PA 3WBDA 3LS4L 3WFHA 4ZO6A 5EUOA 5GGTH 2YPVL 4LRIC 3EZJB 1EGJL 4PV8A 3T04D 1H3PH 4RMQA 5D71L 5T5NG 1CICA 4FQJL 5D96B 4N0UA 4IOFC 4M7KL 2YD8A 2AJVH 4X7EC 5IP4A 1FVEB 1A6UL 2BOBB 4JFXB 2E8ZA 3K80A 4PFEA 5FUOL 3EYVA 3BPCB 3GMLA 4HWBH 1ZMYA 4HMEA 2UZYB 3JV0A 1W8NA 5E5MB 5C0BA 4LPYA 1XIWC 1AQKL 4ZUVA 4GW1A 4W68A 2CPCA 4H20H 3SOBH 5IB4A 4Q0XH 1F4XL 5FUCC 2IADA 5DVNA 1X5IA 1PZ5B 3D0LA 3TZVC 2XQBH 4NO0A 3D85A 4MJIE 4G9FD 4R4FH 5FHBH 4WTZA 4O2FB 2FJGB 1KCSH 5I74B 5BMFH 2WNGA 1D6EA 3CFDA 2A9NH 4IIQB 1BD2E 1M7DB 4KWUA 4WW2B 5TDPA 1WZLA 3W0WE 3UYPA 4DK3A 4C83A 4OFPA 2BSTA 5E8OB 5IW1B 1VPOH 3CSYA 2W92A 2P5EB 4LCWD 5C9KA 4K9EC 5LBSH 5A16A 3UPRB 4HZLA 1JPSL 1UENA 5TQ0H 4Z7NF 1NJ9B 1FLTX 4P5MB 1WF5A 3V6ZA 3NFPA 3QDAA 3OB8A 4Q74A 4X7TA 4Y2DA 2NXZB 2M2DA 3QXAA 1GZQB 3K2MC 4LDOB 1FNFA 2PW1B 3O6KL 3KJ4B 3UTTE 1BFOB 1J8KA 3MRDA 1EIBA 1SJXA 3CD4A 4EEEA 3VFVB 4IIQC 5I30H 2HP4A 4QWWD 1K2DB 3MRKA 2XN9A 4WW2C 5IG7B 3SE3C 4C56E 4KU1A 4NN7B 2AK4A 3NIGF 1A3LL 3FRPA 2PXYB 2ZSVA 4Y4FA 4RSVA 1I85A 4AQOA 1EX0A 2R0KL 1WIPA 3QDGD 4HK0B 4BZ2L 5D7LA 4D94A 2EDWA 2ZUXA 2EDJA 1NFDE 3ZO0A