1ILSA

X-ray crystal structure the two site-specific mutants ile7ser and phe110ser of azurin from pseudomonas aeruginosa
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
b'AECSVDSQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
molecule tags Metalloprotein
source organism Pseudomonas aeruginosa
publication title X-ray crystal structure of the two site-specific mutants Ile7Ser and Phe110Ser of azurin from Pseudomonas aeruginosa.
pubmed doi rcsb
total genus 33
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1995-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ilsA00
2XXFA 1T5KA 4TXVB 1FFTB 3CDZA 3OD3A 1J9SA 2DYRB 4YSOA 4NB7A 1SHWA 1A8ZA 5I6NA 1BQ5A 2BHFA 2AZAA 2EIMB 3SBQA 5D4IA 5B7EA 4G70B 2CAKA 3NJIA 1B3IA 2CJ3A 2IWKA 3PLYA 2WO2B 4DP4X 1X9UA 3NSDA 5I6KA 3OM3B 3PAZA 5IY5B 1W6WA 3EH3B 3PAVA 2YAHA 2RACA 1NPNA 3CG8A 3D12B 4CSPA 2IH9A 2YARA 3TBCA 3ASOB 1WS8A 2HX7A 1I53A 2ZXWB 6PAZA 2Q9OA 3QJVB 4K9JA 2PLTA 3DKHA 1ZPUA 1MG3C 2XXGA 3NJLA 3UADA 9PCYA 3WKQA 2Q5BA 1EHKB 2R7EB 5AZUA 3NSFA 1OCZB 3V9EA 4YSEA 1L9RA 1IBZA 1AZNA 1OE2A 2EILB 5D4HA 3ZBMA 2B3IA 2XX1A 2H5UA 5AFAA 1ASQA 4AZUA 1E5ZA 1XMEB 2FJSA 7PAZA 2GBAA 1PZCA 1JXDA 3QJSB 4DP0X 2YAOA 1KDJA 1W6LA 3X1BA 1KBVA 4ENZA 3ZX1A 3X2QB 1EZLA 1M9WA 2GHZA 3PXLA 4A67A 4FAAB 3NYKA 2BP0B 1M57B 1SDDA 3QJQB 4YSRA 1M56B 3NJGA 4GYBA 2PPFA 4A68A 1N70A 3S3BB 4M3HA 2FTAA 4AX3A 2TSBA 2J57A 2PP8A 2BZ7A 3MBWB 1SHXA 1BXUA 2PP7A 5I6MA 4YSTA 1ZIAA 2Y69B 1TEFA 1L9OA 1BQKA 1L9TA 1SFHA 1J9RA 1TKWA 4G71B 2DWTA 5PCYA 2VN3A 4L0PB 1AS6A 1PLCA 2MRYA 1BAWA 1JZGA 3RYMA 1CUOA 1IC0A 1RCYA 2XV2A 1GY1A 3FU7B 3FSVA 3JTBA 1OE1A 1ZDSA 3NJKA 2BO0A 3ZDWA 2VM3A 1ILSA 1HAWA 2DYSB 1FA4A 3GYRA 1FWXA 3SBPA 4E9XA 4E9YA 2XV0A 2HRHA 2EIKB 1J5CA 1L9SA 5I28A 2FWLB 1E5YA 3HEIB 4G7SB 1A3ZA 1PZBA 3X1GA 2P80D 5AKRA 5B7MA 3H4HA 1W8EA 5E9NA 1AZBA 2YAMA 4BXVA 2E86A 3EH4B 4BK5C 7PCYA 4QKTA 4DP7X 1L9PA 3DIVA 4KO7A 1GW0A 2IWFA 2JKWA 1XB8A 5ANHA 1KCWA 1SJMA 2VW6A 1IKOP 3FT0A 4KNTA 1AQ8A 1PAZA 4DPAX 4YSUA 2J56A 2BP0A 1GS8A 3AG2B 2IDFA 4P5SA 3MX0B 3UACA 8PAZA 2GI0A 4YL4A 4MFHA 2ZOOA 3IE9A 2CUAA 1NZRA 2BP8A 3TA4D 1XB3A 1WA1X 2CALA 3AG1B 5D4JA 2PCFA 4HCIA 4KO9A 1NTDA 1OCOB 1ET8A 1NICA 2P80A 1KCBA 3WIAA 1AACA 1JVLA 1KBWA 1JZFA 2EINB 3FQ2A 4KNSA 1OOWA 4YVUA 2UXVA 3S3CB 2HRGA 1AZCA 3N55A 4E9VA 1ZV2A 2GIMA 3QQXA 1ET5A 2FNWA 1J9QA 1WAEA 5I6PA 2AANA 2I7OA 2X88A 1ADWA 3KW8A 3NJJA 4Q89A 4DP8X 1OF0A 1GSKA 3T6VA 4AKOA 1SDDB 4W9ZA 2VM4A 2AZUA 4A2GA 2IDSA 1JZJA 1N68A 3GDCA 3S3DB 4G72B 3HB3B 4BWTA 1X9RA 4WTQA 1MZZA 3ABGA 1GS6X 4DP6X 1NIBA 2UX6A 2CCWA 2XX0A 3FU9A 4UAHA 2YQBA 4HIPA 1NWPA 2QPEB 2BW4A 5B7FA 3UGEA 4NERA 2XYBA 1NWOA 4DPCX 3NJMA 3PPSA 3EH5B 3X1EA 4HHGA 2UXGA 2MTAA 3FSWA 1NIFA 4YSAA 5TK4A 2AFNA 1R1CA 2HX8A 2HX9A 3CZUB 2DV6A 4KO6A 3TU6A 2DWSA 2VW4A 3QPKA 4BWUA 4HCFA 4G7QB 4AI7A 2EIJB 3DTUB 3OMNB 2J5WA 2B08A 1JZHA 1NIAA 4E9TA 4UANA 3FYEB 5TK2A 1KYAA 1KGYE 3NJFA 4A66A 5LDUA 3G5WA 3QJRB 1QLEB 2VW7A 2IDUA 3T6ZA 1PLBA 2TSAA 1SFDA 4YSPA 3X1FA 1JXGA 2PP9A 1ETJA 1CC3A 3UABA 4P5RA 1PNDA 2YXVA 1V54B 1PCSA 1NPJA 4YSQA 2JXMA 2NRDA 1WA2X 3WNIA 2H47C 1ILUA 2XV3A 3FU8A 3WKPA 4N8UA 1AS7A 2JFCA 5I6OA 5I5JA 4M4RB 2W8CA 3FPYA 1HAUA 2OJ1A 1NIDA 1E67A 2VSKB 3PCYA 1CYXA 2HLEB 1OV8A 3IN0A 1MZYA 1ID2A 1OE3A 2AVFA 3CVBA 1NINA 2OCCB 1A4CA 3FQ1A 4CSZA 2VSMB 1TEGA 4KOBA 4Q8BA 3X1NA 1MG2C 4KNUA 1KV7A 1A4AA 4ZK8A 2DY2A 1RZQA 4F7KA 5B1KA 1IBYA 2R7EA 1PLAA 2GB2A 2UXTA 2XUWA 4KOCA 3N2JA 1GY2A 3SQRA 2IWEA 2Y1AA 3FSAA 1KDIA 2BWIA 1AG6A 2QDVA 4HHWA 1J5DA 3OMIB 1BEXA 1NIEA 1QNIA 1AIZA 2XU9A 3AG4B 3SBRA 3EF4A 2PPDA 4GP4B 3NP4A 2I7SA 3EHBB 1SF5A 3NJHA 1AG0A 4E9WA 4NAJA 6PCYA 3H56A 2PPAA 2FT8A 4A2HA 1CYWA 2FQDA 3S8GB 4DP1X 1DYZA 1SNRA 2FQEA 2OV0A 3JT2A 4A2EA 5B1JC 1AOZA 3H4FA 2FT6A 2GC4C 3CVDA 2QDWA 1E65A 2W88A 5B3SB 3NP3A 2QPDB 3V9CA 4HALA 3AW5A 2QT6A 3ABMB 1AR1B 4A2DA 4F2EA 1URIA 1CURA 3FSZA 1BYPA 2FT7A 2I85A 5A7EA 2XLLA 3T6XA 1PY0A 1QHQA 2WO3B 1WA0X 1ET7A 4E9SA 4F2FA 5EHFA 2PPEA 3FS9A 1GS7A 3QJTB 1AZRA 1RKRA 3IEAA 4JKNA 5I26A 5PAZA 1WS7A 1BQRA 3FPXA 1GR7A 3OMAB 5FC9A 5I6LA 2YAFA 4BWWA 2IDTA 1JOIA 4EF3A 3WI9A 1PF3A 2BP8B 3ZIYA 4DP5X 3ASNB 1JERA 3NT0A 2UXFA 4HAKA 3WNJA 2WSDA 4YSDA 3CVCA 5B1JA 4E9QA 3AZUA 2IH8A 4HCGA 4PAZA 2BW5A 1DZ0A 1V10A 5B1BB 4YSCA 1UATA 4FA7B 4DP2X 3ABKB 4RH4A 4YVNA 3T71A 3C75A 3IBOA 4JHUA 3WG7B 2ZWNA 4GP8B 2FQGA 4BDVB 1OCRB 1ZIBA 3NJNA 1ASPA 2VMJA 2H3XC 2PCYA 1AS8A 4QLWA 4BXSV 4N4YB 3FQYA 1F56A 3L45A 3QJUB 2LLNA 4GXFA 1A4BA 4AKQA 3UAAA 5I5IA 1OCCB 3BVDB 1E30A 1NDTA 2FQFA 1YLBB 1MDAA 4GY4A 1V55B 3FYIB 3AG3B 2J55A 2N0MA 3FU7A 2A3TA 4UF7C 2ZONA 4JHVA 3NSCA 2XWZA 3AY2A 4KO5A 1HFUA 3TASA 4E9RA 2IDQA 1GYCA 1PNCA 2PPCA 1L9QA 3T9WA 1AAJA 3IN2A 1ASOA 2YXWA 5F7BA 2XVBA 1RZPA 1BXVA 3TBBA 3S8FB 2HZHA 2GC7C 4A2FA 2YAQA 3NSYA 2GSMB 2YAEA 1BYOA 3KW7A 3BQVA 2IAAC 4G7RB 3OQRA 3UAEA 1JXFA 2X87A 2UX7A 5B1AB 1JZEA 2CBPA 5F7AA 1PZAA 4WKXA 3GXUB 1BXAA 1JZIA 3ERXA 1IUZA 3T6WA 4BDVA 4DP9X 1TU2A 5I5MA 2YAPA 3ABLB 3PAUA 1ZDQA 1JVOA 1PMYA 2HXAA 2BWDA 4GP5B 1XB6A 4HZ1A 4YSSA 2BZCA 4X4KA 4DPBX 3CDZB 4PCYA 1AZUA 1A65A 1VLXA 4AKPA 1SF3A 3U25A 4W1TA 1AANA 1J9TA
chains in the Genus database with same CATH superfamily
1U91A 3EJZC 3V4VA 3BW9B 4TRPH 1OGPA 1UADC 1MRDL 4HWUA 4Q6IB 5BXFA 1ZCRA 4F7PA 1VFOA 4X6FB 2AXFB 4MRCA 3T3PE 3HN8A 1MPAH 1SXSA 3LVTA 5B3NA 1OWWA 4XNBA 1LQBC 3V0HA 3RURA 4BQ9A 4JFXB 4KROC 4JM0A 3TBSB 3ZO0A 3PAZA 3TFKC 5IY5B 2DLGA 4M5YH 3S48A 2A0LC 3OLDA 3HAEA 1P4LB 2NNAA 5JUEL 1QR1A 4I9WD 3NEEA 4Y4KB 1XL4A 5DEGB 2F58H 5IHBA 3MRQA 4RFNC 2GW5A 3UGUA 2OKMA 4M5ZL 3IWVA 2MEJB 4BELD 1NGZB 3QJVB 2XQ0A 1S7VA 3L08A 4OQTH 1ZPUA 3NIGE 4LKCB 35C8L 5DJAB 2ETWA 2YO3A 3MRQB 4PS8A 3L9YA 3LIZL 1E9OA 3OJ2C 5D7IB 3FZUD 3FOLA 4WWOA 4FQXB 5GHWH 1LHZA 4LF3A 4LL4A 4YUEL 4ODVH 2ZYHA 4PJAA 5T1MB 2XWBB 3GMMA 2WBJB 3DIFA 5JTWA 3OL2A 4CN4A 1IGFH 2DBLH 3JV6B 1G9NL 5HHVL 5EN2A 4IS6A 3WCYA 1MUJB 4PR5B 2A4ZA 3OAZK 3ZMNA 1GZPA 4ENZA 5TTRA 3ZX1A 2XTJE 5C08E 4BRJA 2O1AA 2DM4A 3UG3A 4XMLL 4PY8I 3ZTCC 1M57B 1QI3A 1X5KA 3TONA 4GYBA 3WIHL 4IRZH 5FW8A 3FFCB 4F8PA 5I1IL 4WY7H 5ECJE 5I75B 4Z76B 3S34L 1SFHA 4PJ5D 1ULVA 5DRZB 3TJEL 3O3BB 3VFTA 5E4EB 5FWRA 3MI6A 1EANA 4HJ0C 2E4FA 1NH6A 1RZFL 3H8NA 1UH4A 3NZ8B 2GSIB 1MWAL 5JA8B 5EEYA 4XZUA 4PJBF 4B96A 2OSWA 2J2ZB 2W65A 2V5RA 4OBSA 2BO0A 3T0ED 4EI5C 5FYKD 1RK0A 3P9LB 5KYUA 5TPWH 4GAJH 2VSDA 1T5XA 2E7LA 1CLYL 1L9SA 3W1ZA 1U8IA 1BA9A 2MKLC 2VO8A 4N2MA 5D1ZI 1GZHC 1A3ZA 4JO3H 3CFBB 1QRND 4GRWE 1XFPA 3SKOB 1DVFC 2ZNXA 3HBGA 3QIWC 5E0QA 1NBYA 4BK5C 1GTFA 4XTRD 4PJ9B 3V8OA 1LEKA 3JTTB 3O6KL 2Q2EB 2WBJA 3WD5L 4Z8FH 4MAUH 3PL6B 3HA0A 3TIEA 3HRZB 1GOGA 1JWUB 4NNXB 3QG7L 2B1HL 4Z7VA 1IE5A 3H54A 5F7HA 2XKNA 3UMTA 4OLZL 1DCEA 1PAZA 4TNVK 1CDHA 3IETB 1SM3L 5F44A 1MCIA 3BO8B 4X6BA 4AW7A 3HHMA 3O45B 1NUDA 4H2CA 2HP4A 2V5MA 2VR4A 4AYEC 2BIIA 4KMLB 3L95A 4P99A 1IGJB 1NZRA 3TA4D 4PWHA 3VG9B 3HI6L 3SDXA 1CICC 1P9MC 1Q38A 2DWYA 4NQXB 3GSUB 3AROA 2EAEA 4N1HB 2CQVA 1ZE3H 4TQIA 1DLHA 2DDQH 1HHIB 3V6BR 4NQSB 2EINB 5HYJB 5E9DE 1EO8L 1MFBH 3UZEC 3S3CB 5CGMA 3VDBA 4G8IB 3MRLA 5JHLL 1I9IH 2AQQA 5DMGD 4ES9A 3DOHA 3A23A 3HPLA 3QDGD 4HS8L 4HG4K 1I8MB 4L3CB 3MTXA 5CZKA 4ELME 4W70A 2WPGA 3HI5H 1Q72H 3KW8A 3NJJA 4J1UA 1DZBA 1XL6A 4HC1H 4AKOA 2GI7A 3C6EA 3MBXL 4EE2A 1KBPA 2XZQL 4HX1B 1PTZA 4X4MA 2EVIA 3FQTB 4S1DC 4X9BA 1DQDH 3I85A 4L4TE 3RPIB 1A7OH 2C9SA 3CSYA 1IX2A 1ITBB 4X5XB 4HK3N 2JIXB 4DN4L 1HINH 4XMKH 4BWTA 3SCMC 1MZZA 4NQVA 1NIBA 2NXYB 5DLMH 4G8GA 1M42A 2IBBA 2PWEA 3O9WB 4HVBA 3FT2B 4NT6B 1NANI 2V3FA 5GGSB 5TE4L 2MQ3A 4JRYE 3QUYD 2BJML 3BAEH 4R3SA 5JZ7C 3W0WB 3QDJA 4IMKC 2CM6A 2G3XA 5GQBA 1FDLL 1TNMA 1NMCC 1PDKA 2FJGA 3NJMA 3ZDZE 1U58A 3QUGA 1WAAA 1RSYA 1MF2H 1OSZB 1PX8A 5DJZA 2VUYA 3RIFF 3QWQB 4I0PB 5ICYB 4C55A 2HX8A 1GHFH 2HX9A 4NYLA 4IIQB 5SV4A 2AJVH 1EZUA 4PJDE 3MCG1 5HGDB 3Q6FB 4UMGA 4G7QB 1NL0L 3OHXC 1QSEB 1A66A 5F3FA 3K6OA 3HG2A 1H8OA 1T7YA 2NNFA 4PJ8B 2OTWA 5I8KL 3SD5A 1U8MB 3W37A 4A66A 3ARDD 5BRQA 5E6UB 4FC3E 4GEJA 4NN5B 5KYWB 1T20B 2WVTA 1CC3A 2VXVH 2NUTA 1HIML 1UZ6F 5DVKA 1VGEH 4OLXL 4FYSA 2EDHA 1GGCH 3W39A 4KHXH 2J6EA 5SX5H 2DM7A 2ZOLA 3NN8B 1BGXL 1CDGA 2YA2A 4HK3J 5AYQA 1JZ4A 3ULVE 5HJ3A 1RUPL 5EZLA 2Q7NA 2V9QA 4BSJA 1DDHA 4OI9A 1VDGA 2AERT 3LD8C 1F42A 3UO1H 2HLEB 2H1PH 4G6KH 3C8HA 4X5XA 2CD0A 1HKLH 1IBGH 1IT9H 2KLSA 3IPBA 3U0WH 4YDIH 5FA4B 5DUPH 3UYRH 2Y1ZA 3LKPA 1D5BB 1E8YA 4PG9A 3VG0L 5A3ID 4OM0L 5KZCB 2X1WL 5FUOH 2N0KA 4JN2A 1Y6MR 2NSQA 4IW4C 4TNEA 2WYIA 4NFBA 5A3IC 2V7HB 5FUCC 4KJQD 1T89C 3SKMA 2EECA 2LOEA 3VFOA 2J8UE 2R56L 5D7JC 4OLUL 3LCYA 4E36A 1FIGL 2EDMA 3GMOB 3N2JA 4M61A 1ECYA 3ZN6A 2HMIC 4NQEA 1HE7A 2X70A 2GTWA 2YKLH 2QDVA 3SDDB 4RA3A 3OMIB 3I6LE 2FBJL 3L2LA 1QNIA 1RLBA 2NZIA 2OBGA 2O5ZL 2B1AL 5F1NB 4L8SC 2WHVA 2EDFA 4OQTL 2DKMA 5F0MB 2D2CC 4R2GB 5FUZL 1HWHB 1AG0A 4N8CH 5EO9B 2IH3A 2NXYD 1IFGA 3K1DA 3E9UA 3GI9H 1WEJL 4BFJA 4DP1X 5C0EB 2OSYA 4XPBH 4BIKA 1W0WA 2VIRA 4JKWA 3GMRA 2MHAB 3T1FB 3S3PA 5FR3A 1UVQA 5T33L 2FR4A 5DJ0B 4JGUA 1W0VA 1YMMA 5I1DA 3QQ3B 2VLJB 3PPEA 4IBLT 3VG0H 5DEZA 3KL5A 3QDGB 3Q2LA 3ARFB 2ADJB 3P0YL 3II3A 4PRHA 2OXGB 2VLLA 1IEAB 4N3TA 1CLVA 5I1AB 4YO0A 1CLZH 4E9SA 3QFGA 4C4UA 4GO6B 2E47A 3QIUB 3DOSB 5D1ZA 4YDZA 4EN3C 1N3NA 1F3JB 2B3RA 3QUXA 4MX7B 1VIWA 4G5ZH 1SOSA 3P9LA 5KYUB 3AQZA 2ZOKA 1E9PB 3O3DB 1RIVH 1K6QL 1JOIA 4XZUB 1UVQB 2FR4B 2EDNA 1T7XA 3TJPA 4LEBA 1FH5H 3LV3A 1MI5B 3VFGL 5L2KE 5IK3A 2EXYD 3MRMA 3I02A 2LW3A 1NCGA 5FS5A 4WV1A 4J6RL 4HCGA 3WL9A 2YQ3A 5IF0B 4X7FC 4EI6A 4UT6L 2O30A 1EZVY 2C7FA 5B1BB 4WWNA 5IWLA 3OR7A 5EO0B 1DJSA 3RDTC 5DS8B 2LLLA 2WW8A 3VFMA 4KJYB 3KPMB 4CC4A 3RHWF 2HSIA 1E3FA 1FBIL 1FPTH 1ZTXH 2IMMA 3QZBA 4H1LB 3NJNA 1ASPA 4ZFGH 2DL9A 1DBBH 3KYOA 5I66B 3LIZH 1XF2B 4MD5B 4AIZA 1CWVA 4D0BA 5DZ9A 5IB4A 4WF7A 4GG8B 1FO0A 1FDLH 1C9SA 5AAMC 2BVPA 3VXSE 1GAFL 5I1HL 3SE4C 1U8MA 1VGKA 1AGDB 4I2XE 4HH8A 1R47A 1G9NH 1ETZA 1KJ3H 3MREA 5IHUL 5KUMA 4S1SL 3VWJA 4FFZA 1MVUB 5F9JA 3CD4A 3FN3A 2IH1B 4GS7B 2DMCA 2Y9RT 1F1DA 3DX8A 1MF2L 3IDIB 2X09A 4PJ5A 3F62A 3ZHNA 5D5MB 2ZOWA 4X5WA 2O6EA 4MDRA 2Y2TA 1B0GA 4WWKB 2CM5A 2XN1A 1INQB 3IJ9A 3WTVA 2NYKA 4JRLA 3HNTL 4HUVA 2H1LM 1H5BC 1QRNB 1KEMH 4MCNA 2AV7B 5DZOA 1BXVA 4WVRA 1A7QH 2OFQA 3QNFA 3P4NB 4BFIB 2HVKA 2NDGA 1XF4B 1X9LA 4AG4L 1SOXA 5JIQA 4L2YA 3DNKA 2ZXGA 3QYCA 3FRPG 3HG1B 2Y4SA 4WCYH 1XIWD 1Q1JL 3VI3A 5DMIH 4DOHE 2C9QA 1DVUA 5B38A 2P24A 3GXUB 3ETSA 4KZ0A 2OMYB 3HI5L 3IDMA 1SMDA 2ZG1A 1J1OH 5JHMA 4S0HA 1HSBB 4FG4A 1HI6B 1JGEB 4GP5B 2WZPD 4QRRA 5GGUA 5IW6A 4QRQB 4UINH 4DPBX 1GAFH 5E8DH 4C83B 4U1SB 2EO9A 1NFKA 4Z7IA 3BUDA 1NCUA 4FCHA 4W1TA 1X5IA 3E38A 5D93B 4UQ3B 2WXOA 2VXUL 1M3IA 2XXFA 2IBZY 5D4QA 4R5VA 3MJ8B 4Y16D 3QDGE 3I3BA 4ZMVA 3V0JA 1QQDA 3LAFA 1H5BA 4HJGA 1AQDA 4PGCB 5DK0B 2FCBA 1JD7A 3LN4A 3UC0L 4GSXA 4P5TC 3VXRA 3QORC 1QLRB 1T1WB 2DTML 2OSXA 3E1F1 3JXAA 5IT2H 3O4OC 3KHQA 4UZUA 2LTQC 3CH8A 2P8LB 4JVWA 3ZDZF 2C1OA 3AM8A 2AJVL 2J21A 4HJTA 4PJGB 5DDHA 1LXMA 2Y3AA 5D2NC 1LWHA 3UBXB 3PQYB 2RFXB 3ZKSD 1HKFA 1SYSB 1CI3M 3F04A 3S37H 1S7WB 3QE5A 3WO4B 1YEHL 3RI5F 4LCUA 5J1TC 2Q9OA 4JUSA 1YHPA 2P5EB 5FX3A 4PY7A 1ZHNB 2BIPA 1SY6L 2J4WL 1RZIA 1M1XA 3EYQD 1KPRB 1B9KA 1T7VA 3B5HA 2UZXB 4KRPD 3HZVB 4R2GC 5C0DA 5SWZB 5LQBH 2E76C 1U3HB 3MRLB 5DVOA 1KLFB 3MROA 5CMAA 2UY6A 5E9DA 1IBZA 1XIWB 2DQJL 5CILL 1L0PA 1WWCA 5HYJA 4HKZA 1RZ8A 4LSVH 3K6FA 3R1GH 3CFDB 5IB4B 5CKAA 3NEXA 1FNEA 5FGCE 1BF5A 4BK4A 4JW3A 2EEDA 3ZTJG 3GIZL 4WUUD 4AZ8B 4PVBA 2XQYK 5F0LB 4C56B 2IANE 4KKLD 4UQ2A 3DX2A 4JHBA 5HHME 2GSIA 1CQKA 3ZQWA 2VMCA 4P9HH 4C83A 3BEWA 3MLTA 1CICD 1NGWB 4HX1A 1GZHA 1LEIB 2PWHA 3MA9H 2B59B 3FB7A 1XQ4A 2VL4A 2H6PB 3GBML 3QFJB 1EXHA 5BNXD 5L2KB 1NFIB 2ADGB 2E7MA 4ZTPH 4MQSB 1D2PA 4QYAA 1DUYA 3RTQD 4J2XA 3HLKA 2OCFD 3QAZB 3QISA 3P4MA 1QNZH 4ONFL 1NFDA 1ZIAA 1T80A 5ABDE 1X9QA 1O6SB 3D9AL 3RTQC 1OB1A 1AZVA 2QHLA 5ERWA 5KVFL 3GB7A 4Q4EA 4YFLI 3IXAA 5EU5A 3V0VA 1B2WH 5DTFB 3SQBB 1CK0L 3QW9A 1NFDE 3V0IA 4J27A 2P5EE 3LS5H 3VFRB 2V6HA 3ZQ9A 2YWYA 4NPJA 2VERA 4PJ9C 4B9ZA 1E28A 2OK0H 2XHNA 3O45A 4KK6C 3SPHA 1IEAA 1OO2A 3KXFB 1XGRA 3PDOB 4PJ5B 5D7KD 3GMMB 4G7YH 4URKA 3X1GA 2AS5M 3HE6B 1O7VA 3BKJL 2WVSA 4FQQB 2IEPA 3MRRA 3VI4E 5KYNA 5D7IA 5FGCB 5TPWL 1GJIA 2YAMA 4GMSH 4ZMWA 3EH4B 3H7LA 4JEGB 4V33A 2YPLA 5G4NA 4DP7X 4QHKI 4PUBH 1CLYH 3KEHA 3HB3D 3HG3A 4K9EL 3IS0X 4KNTA 1J1XH 4Y19E 2O5XL 2CK0H 3N0AA 2FO8A 3B9KC 1U8IB 3BPLB 1S78C 5SWQA 4K3DH 3VFWA 4PP2B 5I23A 5DT1L 3ZZSA 1Z9SB 5A40E 2X1PA 4PREB 4JPVH 2WGNB 3OSKA 1FL3A 2Q7AA 5TD4A 3OR7B 2XG4B 2D31B 1AD9A 1KN2L 3SY0B 5TQ0L 5AZEL 5CFHA 1GC1L 1NDMB 1BLIA 3NIFB 3MC0A 4OW6A 2HRLA 1USZA 5HHXH 4C4KO 1P2CA 3N0PB 3LEVH 3HBQA 3BW9A 4JY5L 3N55A 4LLUA 1JK8B 4PP1C 1QUNB 4RFOH 3C60D 3RNQB 3WYRA 2J12B 4ALAL 4QXUL 1MI5E 1MVYA 1WWBX 4Q89A 1AGEA 2Z92B 4GW5B 4Y19A 2WXLA 3HI1A 1F41A 3HG1D 4P9MH 4HMEA 2VM4A 2L4OA 4ZXBD 4NO3A 3WEMA 2NQDA 4RGMC 5EIIA 4RGOH 3TN0B 3HNVH 5F3HA 1B88A 2LV4A 5J7CC 4DP6X 3EO1A 1T0PB 3WLBB 2DS4A 4GFTB 1ZLVK 3S96B 5I76A 2FLRT 3F84A 4Q0XH 1N19A 5JPMC 3I75B 3JBG7 5I1DB 1P5UC 5AW2B 1FZMB 5T1MA 2KERA 1KLGA 2KPWA 2XYBA 1U33A 4Y16B 2QV4A 2VIRB 3AUVA 4HS3A 3OX8B 3SGEH 3QI9A 1LEGA 2UXGA 1ZPLA 2MTAA 3IB4A 1X7SA 5E4AA 4X99B 3K7UA 3QJZA 4XN1A 4DKFH 4F8LA 3V6OC 2GITA 2FH6A 1XCTB 3SIKA 5ICUA 1QFWM 3FUNA 1A64A 1FH2A 2ZCLL 4JE0A 5I0ZA 1RURH 4PCSA 2AXJA 3C08L 4Y1AE 2WNWA 3QVAA 5D5ME 4G6JH 3ARQA 3GS0A 5CIPH 2FX7L 4UIKH 3T3PF 3TGXA 4HEPG 3R19A 4ETQB 1Y18A 4FJZA 5IVXB 2I9LA 2MIZA 2NY0D 2YD5A 3EZJB 1MOEA 5B21A 4Z78B 3KCPA 2FX8L 4J8RB 2NYZA 2E9IA 3HMXH 4A7VA 1KJ2B 3S0PA 4AYSA 3ZE2F 1LK2B 4M6NL 4LCYA 2NY5C 2YKKA 4FFYA 4X6EA 2VISB 4PLOB 3TF4A 3VB8A 4UT6H 3KLAB 2R1YA 2H47C 1Y6KR 1ILUA 2IADB 2IWGA 2XVKA 4NO0D 3ZKXC 1O6TA 4B27A 2F54E 4JFZH 3Q2NA 2A77H 3KNBA 2F5AL 1OB0A 1G5GA 2EDKA 3S6CA 5ACZB 4P2RD 2JIXA 5DD1L 2OJ1A 4MA8H 1TVDA 3RP1A 2JQAA 4LE8A 1C7TA 4QJ4B 1CFSA 1QLEH 2UWEA 3BUTA 3MODH 2NY4B 4ZSOA 4IHOA 3VDAA 4MAYC 5D7JB 4ZW8A 1I8LA 2AEPH 4FF9A 3NFSL 1KXHA 3F7YA 3TBTB 4IOSD 2HJFA 5H4YA 3F2LA 4U1LA 4I0PD 1JFHA 1KBGL 2NY5L 3TH2T 4ZMXA 3HG4A 3BDXA 3M1BB 3QULA 1NGXA 3RVWC 2ZXDA 2IPKA 3ESMA 3RLSA 4BZ2H 1JWMA 2HJKB 4PV1C 1IL1A 1ZSDB 3TA3D 3UTSB 1ACCA 5DWUL 4P5TA 2A73A 3SKNA 4R0LA 4U0QB 2ITCA 2UXTA 1XH1A 3S35X 4NO5A 4W9GC 4K0OA 1RZFH 3HS8A 4GW1A 1WHPA 1K85A 3VI4F 5CEYA 1KC5H 4EQ2A 5JIKA 3GJEB 4ZMLA 4AEIH 2CGYA 4WEMB 1CPUA 5D1XA 3THMH 1BPVA 3TJHD 5FCUL 5CWSB 4X6BB 1CJYA 2J4WH 4HHAB 1C5CL 4JJ5B 4K94H 2HVBA 1PY9A 4LK4A 4OJAA 4HGMA 1DVFA 3GD1C 2XIBA 4UILH 2FEEL 5TE7H 2BHUA 5BZWA 3WY4A 1C16A 2FQEA 5K59E 3D25A 3P4NA 1EAQA 1BF8A 5DO2D 4KXBA 1DBML 4JKPL 4UMSA 1XR9B 1AQKH 1KG0A 2MCPH 4R96A 3GNML 5C0IA 2BNQE 2CNZA 4HALA 5TDPA 3D05A 1KBGH 2NY5H 1VZIA 2I60H 4JK0D 1W0YT 1WZAA 2R2BB 5CEZD 3LQAH 1QFWI 1E7UA 1YYLL 2WLYA 4FKKA 4PGEA 3RKDC 4LPYA 4YXHH 4YQXL 5IMOB 5DT1H 5AOIA 5TQ0H 5IMMA 1JNNH 1G9HA 2VDOH 3RGVA 1FZKB 3ZZLA 1T1YA 4XNUL 3BIAX 4ODSH 1SLUA 4RX4D 1I85C 5DGQA 1XH3A 2XNAA 3U36A 4F15B 2Y23A 4AGQA 1I1YB 3K4DA 3V4VH 3IMUA 4KMTH 4IQHA 2E27H 4PJHF 4PRAA 3PWJB 5HHQA 5JHAA 5IG7A 4MBRA 4N6RB 1GCYA 3QG6A 5AW9B 3MRDA 4JO5A 5BZDA 4FNQA 5DD5L 3ETBJ 1CBVH 1MREL 5E2VL 4ONHA 4LOUD 4OU3A 1CT8A 1WFNA 1AGFB 3SCMA 2Z4TA 3BMWA 4KUCD 1QA9B 1ZD6A 3FT3A 3VXSA 3REVB 2DW5A 4PJDB 4TQEL 3BQUA 4D8OA 3CFJA 1SJHA 4K8RD 4N86A 4K9EC 5T1JA 2R0LL 2W81C 3FAWA 3M45A 1LO4H 2FK9A 2QQQA 4MJ6A 5AAPA 2DLTA 1OOAA 1DQJB 4GXFA 2XBZA 3AWFA 1E5CA 1MVFA 1VB9A 3NH7L 3RWGB 1YNTF 4Y4FA 1FN4B 5HHVH 1SOQA 2JCCA 1UJ3A 5C6WH 4FQXA 1L7TH 4OI8A 2V2TA 4GQQA 1SQ2N 9CGTA 4CADA 1XSIA 3EH2A 1QBBA 3MX0A 3P3TA 2A6JB 4GFXA 5D6CB 4EBQH 4WI6A 3VWKC 2VDRL 2WB1A 4KXZI 2V2WA 4XHJC 2A3TA 4UF7C 2R29H 2APSA 4FKEA 3RILA 2E6QA 3SCMD 2CWRA 2OJZH 1TUPA 2OP4H 3TASA 2IDQA 4QRPE 4WY7L 1L9QA 5JOEA 3BHBA 2OW7A 1EO5A 3U2SB 3G6JE 3ESVF 4WI3A 1ES0B 4OD3H 4X80L 2DRUA 4PJ7B 3E8UH 4DFIA 4DSYA 4YWGH 4CNIB 3UAEA 3DO7B 2YD3A 5DYOB 4G6AC 4FG0A 3EZ8A 2QVTA 5K93A 4KTEH 5FDYA 1S7XA 2DM3A 2L7JA 3BEVB 3IJSA 1B4RA 3B4NA 2G0LA 1ETB1 2WWOA 4KFZC 5F0JB 1XB6A 5F88B 3GMPA 1FFNA 4MNGB 4PCYA 4QRAA 2A38A 2H26A 1RZJL 4I5BA 4TM9A 4WCYL 5J11B 1SHMA 1TTRA 1Q9KB 5BV7B 4OZIA 4XC3L 4ZOAA 2K7QA 4ZFZA 3MRBB 4FHBD 4PS7A 4X8JB 5I1GL 2GY5A 3UBXG 4QRPA 3L4VA 3CDZA 4MXVE 2VR6A 4A7UA 1JNHB 1C7SA 2Y1YA 4X8XA 2CMRL 2GEEA 1J8RA 2AZAA 4JVPA 2EXSA 2OMWA 5I8EB 1D5BA 4NN7C 2K9FB 1NGQH 2P5WA 3F6IA 2BOBA 4TLSA 1B3IA 5FHAL 3UO8B 4PTUA 2OLDA 1E9OB 1OALA 5IQ7L 5DVLA 3JVGC 4TYUA 3HTLX 4A2MA 3EH3B 2YAHA 3H42H 4IEFB 1MCQA 4PJ9D 3X3FL 5LNDA 4LO9A 4KKQA 2VMFA 4W9LC 5HGHA 2KI6A 1NL0H 4QRTB 5A6MA 5EUOE 2XPZA 4FYQA 4ZMTA 1A9BA 2W60A 4HJIA 4N2KA 4TUJB 2J88L 2Q6WB 5J13B 3NIDE 4RFEB 4CJ0A 2YGOA 1SBBA 4CGUB 5LAXB 1S7UA 2YD8A 1RY7B 1WWAX 4XBMA 5I6XB 4LU5H 1A3QA 4MB4A 4WFHD 1QBML 2ZUQC 4HLZG 2FECI 3SGKC 2WXMA 4XNZC 1D5ZA 1N5AA 1KWGA 4OZFH 1EGJA 1WRFA 2P5WD 2AI0L 2H5UA 2ODIA 1T03L 5LGYA 4PG2A 3BH8B 2Y7SA 3SPGA 1M05A 1NCCL 4PJEF 2FJSA 1FZOB 2BH0A 2I60L 1FL5B 1O5PA 1YYML 4S2SB 3QJSB 4OD1L 3S2AA 2A77L 3HC4L 2UYLB 2C9XA 4ZTOL 5BRPA 3AREC 3R4RA 4OZGA 3ZYOA 1I8IA 5IW6B 1NKOA 3X2QB 4PRBA 4I1RA 4UNTA 1JF1B 4ZS7H 2VLJE 1SXCA 3VX0A 3BI9X 2BVEA 1IBGL 3U6XS 2G3NA 1AGCA 3VD2A 3SJVA 1JZ7A 3Q5OA 4A68A 5SX4I 1I8LC 4LLYA 1EZSA 1M7IB 4K3JL 2GAZA 4PPTA 1GGTA 3HZ3A 1UA6H 4R97B 2B0SH 5GS1A 2HT3C 3ENEA 4OCSH 1FZJA 1QSFA 1F1GA 3V0WL 1UM5L 4XMVA 1P4IL 5GGQL 3FTZA 2BK8A 3QNXA 3V9FA 2IJ0C 1ZAGA 5BO0D 3BCFA 3FW6A 3UDWC 4ZS6C 5DI8A 3C6LB 1C08B 5CUSL 2EVJA 3CFNA 5BRZB 4IU2B 5IFAH 4CC4C 4PYHA 2KH2B 5DHXB 2HG5B 3I9GL 1RJZB 3ME0A 3HZYA 4F24A 4LSQL 4HIJA 3F7VA 2IF7A 1KG0B 3BZ4B 3SJVD 1MCKA 2CDGA 4Y9EA 4FQIL 4P2RA 3PGDB 4U6HB 2DTSA 4L8SA 5H4ZA 3KCWA 4CAGA 3VJ6A 4XWOC 5I24A 4L9LA 3UTQB 4MD0B 3MV7E 3HBPA 5D1QD 2DQDL 4PJHB 2K6YA 5JXEA 3IAQA 3FZUC 3VWJC 5LWYL 1IM3D 2ZAGA 5FDWB 4UNIA 1ZVHA 2BP3A 1NCOA 5E00A 4W9EC 3TT3L 5JO5B 4OF0A 2DQHH 4ANUA 1UH3A 1YYLH 3MV7A 2BP0A 4NIYE 3V0DA 3KYNA 5JHDB 3KLLA 3GLAA 2M1KA 5E94B 3P3SA 4QY8B 3ILPB 4MZRA 2GI0A 2YQGA 1G7LA 2A4CA 4HDIA 3IBEA 2DIBA 1F11A 5HP5A 3GKZA 1E7VA 1FNHA 3RTLA 3UPAA 5B8CB 3CVHA 4IMLA 1FYHB 1HCVA 1A0QH 2XFGB 3K8LA 1U8QA 2X6CA 2OMXA 3QXAB 1TZIB 2JNZA 1QBAA 2Y5TB 1OOWA 1TVHB 1R3LB 1WZKA 4YVUA 4U6YA 1LK3H 3OQ3B 3WIFB 5F89B 3E7JA 3ESOA 4JPVL 5FUCE 5CF3A 1MHPL 4MNQD 2E5EA 1DVSA 2C1PA 2YKLL 3J2PA 1VKXA 3EG9A 2EE9A 5E24E 2Z31C 2R2EA 5DJ2B 5DR5H 1DO5A 1WAEA 2UZIL 4K7PH 4OIAA 3B7UX 3ZHDA 1JV2B 2YD4A 1I8KB 3LY6A 1O9VA 1EEZA 4NLHA 1X4XA 2ZUUA 5BV7H 1XZ0A 1KPUB 4KQ3L 3IF1A 1G7MA 3FQ4A 1TTFA 1MXGA 4XVTL 3SDAB 3BLPX 2X3CA 3ABGA 4CBPA 4GG6A 1OAKL 4J12A 2BDNL 2ZICA 2I07A 5CP3H 1QZNA 1Q9KA 4OZIB 3PHOA 3DX9A 4R9HA 1CGVA 3QQ4B 3SDCB 5B39B 1QOKA 1Y18B 1UXSB 2VR5A 3ZTNH 4MMXC 4IBWA 4LP4A 4HSQA 2X89A 2IDCA 4XPHL 3GZQA 2A6KB 5HGAB 1LD9B 4QKXB 2H0EA 4HF5H 4MZ3A 1S5HA 2LU3A 4ZX6A 2PW1A 3FB6B 3LSOA 4GSRA 2AQRA 3VXNB 1GZPB 3S98A 1X5AA 4MD4A 2AITA 4F3FA 2CKBL 3R0MA 1M71A 3ARYA 1PG7X 5FAAA 4AEFA 1CZ8L 2WLMA 3X11A 5D1XE 4G1EA 1I9JH 1RMFL 3ZE0B 3W11D 4NWUL 4LIQH 4ZUUA 5BVPL 3PJNA 3WLWD 4HKJB 2H0FA 4O02H 4X7SL 2ED7A 4XHQA 5DEFB 3VXSD 4FS0A 3X1FA 1EFXD 5F2FA 4RZKA 4OD2A 2D8KA 4P5RA 1PNDA 3WLWC 5I6XC 1VERA 2ESVE 2X89D 2JXMA 3EUDA 1ZVYA 4FQLH 4Z23A 4MMXA 2H1XA 1TTCA 4LLYB 5JLZB 2GCYA 2ZUSA 1CGUA 1YN7B 4N8UA 5ID1A 2CLZB 1EHXA 4KH9A 1NBVL 4Y19B 5EFIB 2RA1A 5C08B 3SO3C 1ZA3B 5C3TA 3QEQA 4OB5L 4UM8A 3CJJA 4F7EA 3B3IA 4OGZA 3IGAA 4XTRC 1FJ1A 3PREA 3TO4A 4ZSOE 2F5BH 3Q6GH 1KSRA 4TUUA 5GRYA 3FTXA 4DQOL 3DECA 5DVNA 2WOYA 5EZJB 3ZRCC 4YHKH 3WS6C 5KOVC 2ROXA 3K46A 3Q44A 5TFSH 5J1SC 3ZO9A 5GSRA 1WZ1L 1SVCP 1ZHLA 2ZP0T 5D7IE 1BFVH 4ZK8A 4BQCA 2CNYA 5I75C 1HCZA 1DBAL 2Z8WC 1EDQA 4MD4B 3UZVB 5E4EC 3VRLF 4UV4L 3ZW3A 4N2DA 4M6OL 5GSVB 3LB6D 4HOZA 2V3EA 3MLSL 3KVDD 5FUOL 1QZ1A 2O4EA 4YH6A 3O4LB 4HKBA 1AIZA 4FFZH 4JDZB 4YN3A 5DCCA 3CHOA 2R69A 3QB7C 2OULB 3V6FB 3AADB 4XXDA 5GS0C 4YR6B 5DRNA 4ACPA 1YEJH 3ESUF 5EUOF 3WFDL 4OD2B 2BCKA 2V37A 5DJYB 5GHWL 3ZXAC 5I0VA 3BRFA 4GRLA 3QDJB 5E1GA 5C0BD 3MR9B 1DYZA 1AMYA 4QOKE 4R4ND 4NN7B 3FQNB 5MEOB 4AH2A 1K4CB 1CI5A 1ZANH 4Q9QL 5B3SB 2XA8H 4JPSA 3V2AR 1ONQB 1JIBA 2OJEB 2QPDB 3CLWA 4LSDA 4U4IA 2FVNA 4ILDA 4J3OG 5ID0A 1SHSA 4GQPH 1KPVA 2IBGA 3GIZH 4P2QD 4FNSA 4F2EA 1G7JA 4BH7A 2BVOB 1A7RL 4NJAH 1UXMA 2ZF9A 4IDLA 2PW1B 3FB6A 1RK7A 4L29B 4X5LA 1KELL 3L17A 2FSDA 1PZ5B 5C6PB 5CLYA 5CZXC 5G5DA 1UFGA 3FO1B 3HJ0A 3IEAA 3QRGL 5PAZA 1YEFL 5B39G 2EC8A 2HFEA 4CW1B 1HSAB 2O6PA 1R46A 2CMRH 4UZGA 5C0BA 4EF3A 5JZ7D 4TSAL 5MEQA 3NRPA 1HILB 4FQXC 1QEWB 4J4PD 4X0KB 3D3VA 5AOLA 1CYGA 3QHFL 1HHIA 4NZDA 2E7CA 1SYVA 4LHJB 4IIZA 4YSDA 3HBZA 5DJ6B 3EHBD 4BE6A 2GUOA 2FLBT 2F19H 5FYKU 4NO5B 5D2LB 2OZNA 3F01A 4QXGL 1GZQB 2Z0BA 4UIMB 3GC3A 3QA3A 5E00B 1EAJA 1J1PL 3V4VL 4ZD3H 5L8JB 2Y5EA 2HAZA 3OLEA 2X42A 4BDVB 1QRKA 3O2DL 5E8EB 3T65B 4H25B 2CHWA 4NZRL 3N40F 2G9KA 3IDGB 3SGEI 5C0FB 4KK8C 2PNDA 3DUUA 2V2TB 4DTGH 4Z0BL 2F54B 2YC1A 3UAAA 5C0DB 1URZA 3QK0A 4MA3A 4XB7A 2BX5A 5A2KH 1S9VB 3HS0C 4MDJA 1U41A 4GNKB 3PJSB 1YYMH 1CD1B 4URTB 4PGDB 5CGBA 4UDUB 3AUWB 3QA3B 3FYIB 3GMLB 1YY9C 1AHMA 3CFJB 4OLZH 2ATKB 4ZFFB 4QHLA 5G4OA 2LT9A 5HY9A 5D2LF 3BZFB 3Q1SL 1JGVL 1ZSHA 4NM8H 1KYDA 4ODXB 1YUHB 1FFRA 25C8L 3V7MA 1FGVH 2X41A 2GAZB 3OJVC 4HT1H 2P7TA 3A4EA 2VABB 4XO4A 5F7LB 3EO9L 5ADPL 3EXLA 5HHXL 3P9MB 4KRPB 1IU1A 4WSKA 3QIWB 4ZI8A 2OW6A 4U1LB 1EK3A 3O81A 4LMQE 3VM5A 1J5IA 2GHWB 3NRFA 3KPRA 2YJLA 5CXPA 2L0DA 4G8EB 3OHMB 2WXKA 1WIOA 1BZ9A 4DCQB 1OTUD 1ZDQA 3GJFA 4R83A 2CGRH 4X80H 4OV5B 2HXAA 4PTUB 1BBJB 3TPUA 3ZT7A 1D5IH 4N90E 3WTXA 3PHSA 1N8ZB 1TU2B 4AV4A 1UM4H 4XNQB 5HHPA 4EJ1C 4NOBA 1OARL 3LD8B 2NY0C 2W91A 3VI3B 3KPOB 1S3RA 1WFUA 4J3TA 1T5KA 4YLQT 4RBPH 1CDUA 1SHWA 4JFDA 2D7NA 4UM8B 5EUOA 3V5HA 3GKWL 5I0XA 4RFEA 1RPUA 2KZ1B 2ORBL 1YEGH 4PI2A 1LP9A 1Z0NA 4G70B 2BSRA 2AGJH 3RJOA 4LKCA 4E0RB 3IVKA 1C16B 3LH8A 4PRID 1JHKH 3FU5A 1H3TA 3DTXA 4NKDB 4IK6A 2VZUA 3E1ZA 1JXKA 4UV4H 4IU3A 1GHFL 3RY6C 1IILE 4L5FH 4L4VE 4LQ1A 4PQXA 4HKJA 3LRHA 4LQFL 3VSVA 4UIMA 2VE6B 1N2RA 3ULVH 5GJTH 1O9WA 1U93B 2WJ5A 2FO1A 1QFWL 2DJSA 3GHPA 4GKSA 3A47A 3L7FA 2CJTA 4WI2A 4WO4C 3VTTA 5BRZE 2G3MA 1OSEA 1DJHA 4WK4B 2XZAL 2DBJA 4GG8A 2Q5BA 4AY0A 5LGHL 5EOTA 2WOBA 3W9DB 3GXFA 4APQC 1UM4L 2WZAA 3IYLW 4EDXB 3DBXA 1SUJA 2B3IA 1UOLA 5C0BB 1QRNE 2HCZX 5GGTA 1XMEB 2NNRA 3ARRA 5C9JA 4HCRH 3WMSA 3MBED 4DH2A 2WUBH 5ITBH 3V6OE 2HN7A 2CKBA 3CZFB 4NN6C 1VEPA 2YFNA 2C7UB 3DGGA 3MBEC 4IHOB 1BM3L 2E7LC 1T4KB 2B4CL 1TKWB 1EHNA 1T6BX 4U1KB 1WFOA 3QCVL 1BQUA 1M56B 3KPOA 3B9AA 3NFSH 3KL3A 1E8XA 4ZTOH 5H35B 1UWGL 4I77H 2OMTB 1S7SB 2FB4H 4Z7AA 3L1FA 1Z6JT 1BFOB 2OR9H 3MVSA 4UQBA 1MHCA 3HC0A 4LLAA 5IW3A 5HYJD 2BFVL 3KBHE 4QHMB 2ZQKA 5I15L 1P84J 4XPHH 1J9RA 2C3WA 1AD9B 1G1CA 2QKIB 2BCKB 1ODUA 2YBRA 2F1AA 4XCYB 5FHBL 1A47A 1FO0L 4OJFH 3RYMA 1EHLH 2P4AB 1CUOA 2XXCB 2A6JA 3BKYL 2FSEB 4TUKH 2EP6A 1S8DA 2NY2B 2QL1A 4AQEA 2JTDA 5F8RC 2WBXA 3M8OL 1NAKH 3GYRA 1GH7A 1T5WB 1HHJA 3J07A 4X6CA 1Q9WB 1IGMH 2A9NH 4L1BA 1JZ2A 4GBXD 4XNAA 3OKEA 2FX9H 3FQUA 2YGPA 3VFUB 5AKRA 1E4XL 5A2IH 4PJ7A 2V9TA 3EBIA 3KYNB 2WAHA 3KWWA 1AZBA 1CB4A 2VR3A 2EKSB 4QNPE 5CIPA 2B1OA 1S3KL 2LHAA 4KBPA 4PGEB 4KXCA 1CLOL 3A6CH 2O6CA 1A6VH 4HUCA 1HXKA 1IKOP 3FT0A 4XWGL 1WC7B 1H3PH 4N0CC 4JFVA 5CN1A 4DPAX 3BP7A 1KJ2H 1GS8A 1YNLH 4QRSB 2VQ4A 4PRAB 5MEND 2VNCA 3MX0B 4JRFA 3WN5B 8PAZA 1AIFB 1E3ZA 3D18A 4L0ZA 4DO4A 2KDGA 1I1YA 1VKXB 4M9PA 4F58H 1J8SA 4GMTL 5CLXA 2BP8A 3MRGA 3ARGB 4ELMB 4HT1L 4U6YB 2PCFA 4QT5B 1OB1B 2L3BA 4UTAA 4XVOA 2LQRA 2OXHB 4XXWA 2N3JA 2BIMA 1G7IB 3MNWB 3VI4B 3JT0A 3EO9H 3IFOA 4Z7OF 2BS71 4XPTH 3FO2A 2N4IA 1G4RA 2A6IB 4WTZA 3VFGH 4DEPC 3K0WA 4FFVC 1MCEA 3MOAL 2UZPA 1RIUH 2D7PA 1D6EB 2VDLL 1ADWA 3D8MA 4FXKA 5HGGS 4ZNEE 2X0UA 1Y7VA 1SEBB 3N42F 2EEAA 4FXGC 3FO9A 2XG4A 5AW0B 5TQ2L 5EF1A 2WLJA 1NC4B 4PRPA 2QZ5A 4RRPM 2BC4B 4CDGC 3EAKA 1WBXA 4XOCA 4UM9A 4ZUSB 3S3DB 4Q9BA 4U1HB 3UPRB 3FTGA 4P5KA 4WI7A 1MAJA 4UZSA 3ZDYF 4RFOL 4PJHA 2X40A 1LO5B 2D0HA 4HC1L 4Y5XA 4UTBA 1QATA 4JL1A 1KBKA 1A8JH 2HJLA 4KDTA 4DGIH 3QORA 5DUBB 5GISH 3B37A 2QPEB 4JO2H 5IBLD 7FABL 4G42B 3ZYZA 2DLHA 4LL1A 1NWOA 1HI6A 4QRRB 1YMME 3OZ9H 5HY9B 1FZOA 2ATPA 3UZEA 5I1CL 3ECBA 2JB6B 4HHGA 2HTLC 3FFCD 3HS0A 5L2JB 2AMGA 3VXME 3O4OB 4XP4H 1F6LL 5D71L 1R1CA 3DMMB 5CU5A 4ONGH 4ADJA 3MRJA 4KO6A 3TU6A 1E6OL 4TOYH 5IOPA 3SE8L 4MHHI 3PHQB 5EULV 4JMNA 5DJZB 1VADB 2BRQA 1LDPH 3V5DB 4MA3B 3WTWA 1U58B 1X6NA 5J8OA 3D0LA 3QS3A 4NAQA 5DLLA 4LAJH 2QGEA 5AOKA 1NGPH 4HK0A 1T1WA 2G2NA 3PHQA 4PJDF 4U2ZA 3G5WA 2JKNA 2VW7A 1WFMA 3W82A 4IRSC 4OKVA 5D7LB 4ODBD 5LB1A 1IB5A 2E27L 1XSOA 1NAMB 4P49A 4YXKH 1HVXA 5D7JA 1MCCA 1XF5A 2AXHA 4W6WB 3BAKA 1J0KA 1O6SA 2WN3A 3HS0B 4HHAA 1CLCA 2VXQH 2XKSA 2NY1B 4KKRA 3VCLA 3IDIA 4LBEA 4U3SA 2P8PA 4WAFA 3M46A 1H15A 1HL5A 3Q13A 1WD9A 4ELKA 4AMKL 2JF1A 3TV3L 1HQ4B 1BZ8A 2AEIT 2W8CA 3L1EA 4Q52A 4BHUA 5GSRB 2JJTC 3VXTB 4JFEB 4TNWK 4Y4HD 3C6LA 4A55A 1LO5A 2VDML 2FIRT 3T0DA 3HRPA 2E3VA 1LK2A 5C6TL 1GVIA 4KKAD 4U6XB 1LE9A 4J3OF 3JUZA 5AKSA 3RAJL 1OE3A 3DJTA 2VXUH 4QLRA 2FRGP 4M1GL 1A4CA 4JY4B 3VACA 2ICCA 4Z95L 3CXDL 5C0RL 5D7JD 3H2QA 5E08L 3P4OB 3EJSA 4J6IA 3JWNG 4YE0A 4QJ3B 5FECA 1IBYA 1WLHA 4NO0A 1PLAA 1TQWA 1RH8A 4QXVA 4AV5A 3EUUA 1JYVA 1JYNA 2E56A 2WWNA 1KLUA 4H13C 3T6WA 3WJLC 3RUGA 3D87B 4JPIB 2OTUA 2GQHA 3BUYB 1JTOA 1Q94A 2W9DL 3SBRA 1AH1A 1KOAA 1XZWA 3C60C 1NAKL 3X11B 3G5XB 1UXLA 4RZCB 3T3MB 4C58B 4YIQB 1E4XH 2HFTA 4MAZA 1JV5B 5J0BA 1D5ZB 2WVVB 3CX2A 4XH2A 4YPJA 2NZ9D 2EKJA 1CF8L 4QGTA 1Q9WA 4QXTA 1G9NC 5MHSE 2WUCH 1QLRA 4P4KC 1TJHH 5IFHH 2P48B 4AUUA 3TC9A 4RISH 2C4FT 5DJ8B 5F7DB 2CIKB 1P7QA 1ZKAA 2YRLA 3CBJB 1A6VL 5EBWA 3SDXF 2Z92A 1AGEB 1EJFA 1BAFH 1BYPA 2NTSP 1DBBL 4Y88A 1W0VB 1YMMB 1IM9A 1D2OA 5BS0E 4P46B 3SHSA 3T0EE 2JLLA 5L0QB 3GRBA 5L4FA 3A6OA 5GGVY 2PPEA 2X0WA 4QHUA 4ANXA 3WL9B 5L6YH 3U9WA 1K3ZA 2GEQA 1XGYL 2A2QT 4BZ1H 3K2IA 5DRZA 1UKSA 4LP8A 1CE1H 1ADQH 2QMKA 2ZWSA 3VD7A 3LEXB 1CT8B 5C0AB 2ORBH 4IRJB 2JQZA 3NIGB 1PF3A 4LOEA 2VDKL 3VH8A 4U49A 3BWAB 4F7TB 3A22A 3ZVVA 5CEZE 2CHXA 1U2CA 2EIZB 1N3NB 3QUXB 5DTFA 3SQBA 5MERA 4FMVA 2BW5A 3WEXB 5IVXE 3ARBB 5TQ2H 3KYKH 1NQBA 4HEPA 6FABH 5GZNC 3WKMH 5HDRA 4QWWC 2NCEA 2C4FU 4WFGE 1YN6A 5SWZD 2VYRE 3MLXL 1BWWA 2HUHA 3KH4A 3D85D 3APFA 1QFWH 1UJ3B 2WIIA 4RESB 2LFGA 5GS2D 1BX2A 4X98B 4PJCA 2PCPA 4RGMB 4MXQC 2H3XC 3MRRB 1UG9A 1WAAF 1I75A 4FKHA 3QO0A 3Q3GA 1QASA 5MEPB 1BAGA 4O58L 4PCKA 2DQ6A 3CVIH 1XCQA 5LCVA 1CGSH 2P44B 4OI7A 3RGVC 1RERA 1BMWA 1QHPA 3VI3E 2CO3A 2X7LB 4M5SA 4MAUL 3SPJA 4OZHF 2EYTA 2G30A 4OH2A 3T4YA 5ITBL 4MA7L 4PJEE 3A67H 3B2DC 3BFQG 3HVDA 4K3DL 3L9EA 1QTPA 1KJ2L 2D4DA 4BV1A 4W9JC 3RVWD 1OLLA 3D09A 3LXCA 2ZX5A 1WFIA 3AAZB 1B0RB 4LCCB 4OZGE 4UOW0 4RLDA 4BINA 3M1CA 3RX9A 2G60L 1SOKA 3D1MC 1MCNA 5AW1B 1KN2H 4DPRA 1NOFA 5TGBB 3U36B 3KH3A 3T9WA 2DQFA 3ZMEA 5ICZB 4HW6A 5CZRA 2MMXA 1YRKA 1Z2KA 1ROWA 4AYDC 2HZHA 1EVTC 1FVEB 4HLEA 4FQQA 2YAQA 1KTLB 3TA3C 4OT1L 4NQEE 1JTTA 1TO5A 3NQKA 32C2B 1XGUB 4EOWL 1JZEA 4M7LL 4Y4FC 4E41D 2FSEA 3WE1A 2ICEB 3BHBB 1LTXA 1JG9A 1QWUA 1PMYA 1FH5L 4AQZA 4WEUD 5DHMC 1V3LA 1H19A 1J86A 1RUAL 4HPYH 4X4XA 1CDBA 2AKRA 5ESQB 4TNFA 4WO4A 3RA7L 5GGSA 4XVTH 5H8DA 4ODHH 4Q74A 3R06B 1X7TA 3FFCE 1Q94B 1FAIL 1PX3A 2HT4C 4LCWA 4O4YH 4QF1A 4MAYB 2H32H 3RUGB 4K23L 4YSOA 1A6UH 2A4EA 5I6NA 2BNRD 2KL6A 4Y1AD 3OKOA 2YBGA 3QFJD 2AEWA 3UAJD 1C5DA 4MASA 1OAXH 1PG7W 2ZG2A 3GJFB 1EH9A 3G7TA 1F4WL 1FVDB 5HDLA 3K6NA 1ERNA 5FKAA 5B7EA 3T5WA 5L2KA 3VGBA 3G5ZB 4G9DB 2CAKA 3L3GA 3SZKC 1N0LA 3RWJA 5AD0B 5F71A 5M94B 1R6VA 3CZJA 1SMAA 2CK2A 4YAQA 2PYEA 4MJIE 3FU3A 1A2YA 4OZIE 4EZKA 5ALBH 1I82A 1AD0A 2ZXBA 2L7QA 4HBQA 4BFEA 4IM8A 4G7VL 5IHUH 4CVZB 1NGQL 3SDAD 6PAZA 5JW3H 1YNKL 4JZNA 3C2AL 1AD0B 3AY4A 1X3DA 1WG3A 2J44A 4NWUH 5DK0A 4UOZA 1IEBB 4AW4A 4FQJL 3O6FA 4NQEB 1HESA 2DZEA 9PCYA 3ZRFC 5ADOH 4JFPA 4GUOA 2ROYA 5EEUA 3UAJA 2DICA 2K1MA 2IQ9H 1N0LB 1P7HL 3RUGF 5E1HB 3ZYJA 5HDBF 1RZIB 1H9DA 3UJTH 2Z64C 3MNWA 3VI4A 1HXMA 1L0XA 2MPAH 1CF8H 3LB6C 2J1WA 5EU3A 4M6NH 4CU8A 5DZVA 4N9GA 4P4KB 5EOCH 4LASL 2NY4D 5ACMA 3MLUH 5L7XH 2CO6B 3EDEA 3X1BA 1N9PA 3PL6A 3JQOB 5IBUB 5KSAC 3TZVC 2QSQA 1MWAA 3FTGB 4JFTA 4P5KB 5IJBC 3WKYA 5GGTL 4FAAB 2AKRB 1BLNB 3F58H 5IFJA 5L0QC 1ZRUA 2XJLA 2BPBA 3C6LC 3KPTA 4YDIL 5GRJH 3QIUD 2PPFA 2HG5A 2BZDA 2JCCE 3MJ9A 1JWMB 1OAZH 4OSUL 5BRZA 4YDVA 3MBWB 3NIDF 4X8CA 4ZDHB 2Z7ZA 5TFSL 5HYEA 5IJKC 5F97E 4FMKA 3IDNA 4ZAKD 3VRIA 3OF6D 3ECBB 1HHHA 3R18A 1O0VA 4OY9A 2WGXA 1SN5A 4J3OC 5AD0A 1AGBA 3GRGA 1B3JA 1UB6B 2RTTA 1Z9PA 3CBKB 2XV2A 4HULB 4Z18A 3DBSA 1MH5A 4RNRA 5I1EL 2GYSA 2Q7YA 1T83C 2GSGB 4JJHA 5FV1L 1PY4A 4YL9A 3PL6C 3TWCL 3AREA 3HFFA 3O6FB 2EDOA 4ONOA 4ZQKB 2ICES 1I9RL 4B0MM 3SYCA 2VSCA 4LCWE 4WW2C 4TTDD 1NCNA 4JFDE 1RP9A 1WEJH 4Y4HA 3SZ6A 5HHNB 1J0YA 4ODXA 1A6TA 5HYJE 3OLGA 1XV8A 5DC0A 2F1EA 1HQRB 4OUOA 4Y2NA 2E86A 1LP9E 5CBAA 2VXQL 3MRKB 1PBYA 4YDNA 5ID0B 4X6DB 1IGML 4MCYB 2Y5QA 5E6ZA 3VXQA 1J8HD 5DS8A 2XPGA 4FXGA 4PH8A 1SXBA 1XCQB 3V7AG 4WI5A 4WK2B 3EFDH 4DN3L 3JV6A 1TJMA 1THCA 1R3KA 1RI8A 3ARSA 5JQIB 1AQ8A 1ZLUH 4R7XA 2VQ1A 1CD1A 5FO7B 3ARGD 1EV2E 1H8NA 4DW2L 3QWNA 4MS6A 5I17A 4DQOH 3WEOA 4D3CH 2HKFL 2X12A 4MJ6B 3VTAA 4M7JH 1MVUA 1HKLL 5F9JB 1NOLA 2YUVA 3TIDA 3V6FA 1BJMA 1L6ZA 2Y6SC 4LPTA 4GW4B 1ADQL 1Z5LB 3RJQB 2P80A 1B0RA 1ET8A 1JNHA 2JJVA 5JDJA 1KCBA 2AAVA 4NCDA 5MERB 1QEXA 1JZFA 1JF6A 3KPRE 4N2EA 4W6YB 4J8RA 1FLRL 5GGRA 1KIUA 3CFEA 5C0CE 4JO1L 2PCXA 3D07A 3UIZA 1QR1B 4WEBL 3FCTA 1NC4A 2X53A 5C92A 4NQSA 1U8CB 3QWRA 1PSKL 4PJEA 1MHEB 3VFWB 1PD0A 4QXGH 5DD3L 4ZXBC 2OZ4H 4G8GE 3MV8D 3BEVA 4OBRA 4GT0A 2GSGA 3CMGA 3OKEB 2YA0A 5JHDE 4D9LH 3P77B 4R26H 2OQJB 5FGRA 1S7QB 2MNJB 2QGCA 4HXAH 4KJQC 2VXSL 1VENA 3X3GL 2ADGA 3UBXI 1HZLA 3MQIA 1MI5A 4TQEH 4JFSA 3O6LH 1MHHA 4FTVE 3HPJA 4NUPA 2MQCA 3OJDA 3QJOA 4MBOA 4GXVH 3ARBA 4UOJA 3L4TA 5DJAA 1DEDA 3DBXB 4PVNA 1PFCA 1OTUC 3LZOA 3S96A 3S35H 5HDQL 3ZR6A 3PP4H 2XTJC 1KULA 4P2CG 1NCTA 4L1SA 5E2TL 2HFGH 5D8JL 1DN0A 2JJTA 4K5OA 2GTWB 2VMEA 2BDNH 4NO3B 5LAPA 2DV6A 1T66C 3IXAB 2B20A 3TIDB 3FN0L 2ZCHL 4UU9A 5DHEA 3MNMA 5MEPA 3QPKA 1E9QA 3EJZD 4BWUA 3V0EA 4JFXA 5ACLA 2VTFA 3X14B 1UXSA 4DUVA 1EQWA 4FQJH 4QHUB 3JYBA 4WFFE 1NC2B 4JUTA 4XXCA 3AFLA 2CO4A 1J0HA 3T6ZA 4J3XA 5TDNA 1UOKA 2ZWYA 4YSPA 1TZHA 2OMBA 2TRHA 1KZQA 4ZMAT 1KGCE 4WI0A 3SPVA 2C1OB 3BAXA 4DVRH 2FX7H 4CBZA 1R5IA 1HQRA 1MFUA 1XSJA 2NDFA 1A7NL 4FULA 3WKPA 4H0HB 1I4FA 1ZWIA 4RIRB 2JK5A 3C09B 5E8PB 3QARA 4XN2A 3WGUB 1NIDA 3BN9D 1QQDB 1PZ2A 3QUKB 1U3JA 2APVA 2YLHA 1NEZB 3GB7B 4NN5C 3W56A 5HHMB 2GK2A 1JGUH 4NKMB 3FT2A 1MZYA 2F7IA 1ZEAL 2CXKA 3QXAA 3EDJA 3CVIL 2OCCB 5DFAA 1CFSB 1Z5YD 4RMRA 3RWDA 4Z3GA 3AQDA 3EF7A 2X2YA 3KJ4C 4KOBA 5FKPB 1XHHA 4UUJB 2VDPL 4YHZH 3RDTD 2BP5M 4QYOA 3SE9H 3VFPA 4ICWA 2WQVA 4MZ2A 2X6BA 3RUGE 1A4AA 5FA4A 2H1PL 3CIQA 4G6KL 4PTTA 3MV8E 2J8UF 3LOWA 1E4XI 1ETA1 1JPTL 2EICA 4BRVA 5TE4H 3GEWB 4CKQA 4YE4H 4KOCA 2O5YH 5A2FA 4EI5A 4N2CA 1NANH 2IWEA 2Y1AA 4NUMA 5K9KB 3SN6N 3ARUA 3TFKD 4LLQB 3NSXA 4R8WH 4YK4B 1HZHH 3SYOA 1K8DA 2ILLA 5E8NA 4XPGH 3HAEG 4M62L 1WH0A 3G6DH 5CJQL 3L3DB 4HKZB 2X4OB 4N8PA 5IV2B 1J12A 3ZE0E 3L2NA 1J11A 5CFAA 2W5PA 4NQVB 1TVBB 5EWIH 4PY8J 4P2RB 4U6HA 1FIEA 5F9DC 5I74B 5CINH 2WV3A 4ELKB 3ROLB 1KGXA 3O2WH 2CLRA 1H15B 2Q3ZA 2NW2A 1XR8B 2KZWA 1O5DT 4Z77A 5CHNB 1UTDA 5IROC 1WUZA 1KCSL 3NP3A 1BEYL 4BCZA 3WTUA 1UUSA 5A2LH 2OA9A 3MPCA 4PFEA 5SX4H 1JGEA 1LEIA 2FT7A 4BFKA 1HHHB 4HOWA 2XLLA 3L5HA 3PIQB 5C0CB 2WC7A 3SDYL 1QHQA 2MJWA 3D69B 1LEKB 5KVDL 2I27N 1V27A 4XMWA 2MCPL 4YDVB 3NH7H 1WBXB 1T3FA 4UM9B 4ZUSA 4LVNC 1X4ZA 4HIIA 4P06A 4TRPL 5JW5A 2N01B 3CXFA 3L5XL 3ALPA 4KV5F 1KY7A 2VDQL 2YUWA 3E9TA 1HT6A 2AJSH 4TSBL 3VXRB 5FB8A 5E1AB 4NJAL 4G9DA 4OJEH 1WHOA 3EJYC 4G8GB 3QZOA 4Z1PA 2UY7A 2H2PD 4WEEA 5HI3C 1BG1A 4HAKA 2BSTA 2F54D 3TXAA 4E9QA 4NGHL 4MLSA 1CF1A 4HMDA 2RR3A 4R84A 4ERSH 1A6WL 3OGCA 4IKIA 3KDPB 1U30A 3U1SH 1KTDB 5IVXF 2N7BA 2HFEB 2W0FA 2QQNL 1CO1A 4J5VA 4FA7B 1MRCL 2IADA 3O2WL 1DUZB 3KPRB 4OD3L 1FYTE 4PW3A 3WENA 1JDDA 1ZXKA 3V4LA 2WNXA 4Y5XC 4MWFB 3ES6A 4F57L 1IRAY 1DANU 4NBYB 3N44F 4QRSA 2VMJA 3NDZE 1DJIA 4N85A 4N0UE 2E7BA 4JM4H 1SVBA 1WC7A 4N2NA 1F4AA 1K72A 4AKQA 3O0RL 4HXBH 1TETH 3GSUA 4LHUD 1H5BB 4PGCA 4PIRF 3NMEA 3QC5X 3OKKB 4JHWH 3VU1A 1CLOH 1I1CA 3A6CL 3VXMD 4Q9CA 3FHQA 1NDTA 5BRZD 4GY4A 5TDNB 1HX0A 1XBDA 5EO0A 3RGHA 2DOCA 5E6IC 2N7SA 4KRPC 4WWPA 2J55A 2CH8A 4N20A 5D96B 2WN2A 2YXFA 3MJGX 3ARXA 5EPMA 3PP3K 4JKKA 5LBSA 4CW1A 1S7TB 1ED3A 5JOFA 3QEQB 3U4AA 1TTGA 3AY2A 2YC1B 1LDPL 4NC1C 2Q6WA 3KE0A 2DQUL 3KXFE 2ZP9A 1HEHC 1TCRA 1T7WA 2B77A 5K39A 4ZW7A 5HGHB 4S11A 2XVBA 2BC4A 1JPFB 3UG4A 5E5RB 1CGXA 4G5ZL 3KLSA 4XO3A 1FO0H 4OJFL 1JSYA 3OKYA 1S9KC 1FUNA 5EU5B 2CBPA 3QEGL 5CM1A 1G1OA 4ZUUB 1XF1A 4JCMA 4TVUA 5I8EA 3VFMB 3HPJB 1RK0B 2DIAA 4IKNA 5AZ2H 2RMNA 3CWGA 1B0GB 4MMYB 3WSQH 1TTBA 2A99A 3HMWL 3NCMA 4WTZG 2CA3A 2JB5H 1BX2B 4XP1L 1TETL 1ZJAA 4X4KA 2CDEA 1JYXA 3NZ8A 5D55A 1J8HA 1S5IH 2V17L 1AZUA 1UHVA 5BJTA 3L3KA 1RIHL 2FO4A 5IW1A 3KDMA 4EOWH 5KVMC 1DBKL 3KWUA 4AKPA 5DYOA 4AYBA 3NJVA 5C08A 3RHWK 1DANT 4G7YL 1MFEL 4CN6A 2ZYIA 3ARGA 4M4RA 3ZMRA 4ELMF 4WFFD 1J9SA 3MLTB 4ORZC 2Y2WA 1FPTL 3ZL2A 4KTYA 4P3DB 1LM8V 5E2UL 4B0MB 3IPFA 3LDBC 3NACH 4KI5C 1E2WA 2V33A 4J3OD 5T3ZE 1A5FL 4KWUA 4QCIB 1S7XB 3IJSB 3REWA 4NCC1 2VCOA 4FXLA 3NCFB 5HPMA 1U4FA 3QUYC 5ID1B 1QPPA 1UB5A 3TVMC 4H0IA 1UZ8A 4E5XG 3RNKB 1W6WA 5D9SB 2RACA 4HYTB 4B50A 4DAGL 4CSPA 4K3JH 5EZJA 5EN2B 2DWXA 3QDGA 3HZVA 2BSSA 4CJ1A 5F21B 5LKNA 2PLTA 4KK9C 2P45B 1PYWB 3LQAC 1XF5B 4P2OB 1EHKB 2PO6D 1XX9C 2OJZL 1ZTXE 3P3YA 1DBKH 5HYSA 4KQ4H 1L9RA 2EILB 4MMXB 3ZBMA 5T3XE 2BLFA 4JAMB 2IH3B 1IAMA 4HWZB 4UT7L 5KSUB 3D34A 4LCVA 3MGTB 4IBTA 3Q8BA 3ZKND 7PAZA 2JKRM 4JFUA 4AK2A 4UWQB 5AW8B 5CCJA 5CZVH 3UROR 3QUYA 4DP0X 1ZGLA 3HC0B 1ZTMA 1YG9A 4J8QA 1ROCA 3L3JA 4RGOL 4Y7MA 5AENA 2ARJQ 1U8JA 5D2NE 3NYKA 4H1LH 2VWEC 2BP0B 4HV8B 3FT9A 5I1JL 5KN5B 4YSRA 3GO1H 4UQ3A 3RAJH 4HP5A 3KPPB 4OR1A 3U0PB 1BMZA 2AXFA 4U31A 4PGJA 4Y1TA 5I0YA 2PP8A 4JJOA 3C6SB 4M93C 5GRZA 1AI1L 3PYCA 4Q6IA 1MCJA 5T5FH 2C7UA 5FECB 2DH2A 4G8EA 1BM3H 2D7QA 3R8QA 3OPUA 1SXNA 2UVFA 1YEDA 2YPLD 4KAQH 1R0AH 3FT4A 5FYJD 3RWFA 4GAGH 3I74A 4B3VA 1U8QB 3BUIA 3HE6C 1CFNA 1JZGA 4IIQA 2GCYB 2HB0A 4EPSA 4KUZL 4XN8A 1JGLH 5L4JA 3BN3B 1OHQA 3VW3H 3DGCR 2FYVA 2LAGB 1NEZG 2CG9X 1FZKA 2OMVA 3DYOA 1WDAA 1FWXA 4E9YA 5DF0A 3WJLA 5IB1B 3SPCA 1Q8MA 4UIKL 3ZL1A 1U95B 2XICA 4GKLA 3L48A 1RV6X 3BDYL 1E5YA 4KZDL 4IOFD 3VFOB 4HSCX 4N0FB 15C8L 3Q01A 5TE7L 4EUPA 1KPRA 2VM9A 4BFGA 1BBDL 5JA9A 2VZ3A 1CFQB 1GGCL 1TPXC 3TH4T 1H8LA 4EIZC 1FRGL 1L9PA 4XC1H 4N26A 2VRQA 4X6CE 1JPFA 2CLVA 1NAMA 2HTKD 3PF2A 4KQ3H 2MCMA 4KXZH 4JRXE 3C5ZB 1TLMA 5I9QC 3WFEL 2IAMD 2XC8A 3IDUA 5IROA 2FX9L 1G6RA 3FRUB 5E6IB 3QUMH 1PZDA 2JCCB 1YJDL 3K74B 3P2TA 3PUUA 1DVFB 2IDFA 4DGUA 3DI3B 5IM7A 5EC2A 3N44B 4JJ5A 4WJG3 2Q76A 3CSTA 5J9PB 3UTPD 3N50A 1BVOA 2HT2C 3ML8A 1WCBA 3PRZA 2VO5A 3IJYB 1G9MH 5DO8A 1A4JB 3QDMB 1SYSA 1ZJBA 3BZFA 5E08H 3FTSA 4IYKA 1QR4A 5CR8A 4EN3A 3DVNB 1YNTB 4NDMA 4F8OA 3F83A 4NHUB 3S97C 4BZYA 3TX4A 4WK0B 1SM3H 2ATKA 2R0WL 3MUJA 5I74C 3FQ2A 1CFTA 2UXVA 1BIHA 1JMXA 2OM5A 2HRGA 3VGDA 5EIVA 3M17A 1ZV2A 2GIMA 4NGHH 2X4PA 3NSJA 3GS4A 2D3JA 1QNZL 4X8GA 1CL7H 1J9QA 4QD2E 1ZT1A 5DUBA 4JGMA 1CGYA 4GQZA 4UNVA 5CCGE 5I1LB 4ABQA 2WLIB 1OAQH 4E2OA 1P5UB 2WKOA 3VRJA 3LEVL 5IGXH 3M1OA 1IIKA 3CFQA 3PY9A 2XV6B 5KW9H 1F18A 2BHZA 5LG1A 2G0KA 4Z7UB 3I2CL 3U9PL 5IWLC 4C8XA 3OXRA 2D03H 1NBYB 1OSZA 4YJZL 4WTQA 5L4IA 4DEUA 1NGYA 5DD3H 1ZA6A 4QRQA 2ZWLT 1PDKB 2FJGB 1MHCB 2YQBA 1N6UA 2X3AA 1SRDA 4IDJL 3MFFA 1ORQA 1IKNC 5D1ZD 3D48R 4R26L 4HUVB 4HXAL 1MDTA 3S37X 5KSBB 3QNXB 1CXIA 1IC5H 3MJ6A 1SVZA 1N4XL 4PS3A 5B22A 4DKEH 5F1IB 2XWBA 4PUBL 2ADFL 3DHJA 5ICXB 4POYA 1QFUH 2F61A 4GMSL 2GFBA 3S5YA 2X4UB 2D7TL 4G3YL 3MUGB 2QPUA 3B2UD 5JW4Q 2DQUH 5AW4B 2WWMD 2WYZA 1ZS8A 5ESVB 4V2BA 3N85H 5GRXG 4PLJD 3FU6A 1KYAA 3WIIH 4B9IA 3MU3A 5HVGB 3U2IA 1AMXA 2CO2A 2ENQA 3RFRA 1IAOB 5LXVA 3B8YA 1PZ3A 3FN0H 4M6OH 4EXPX 3SE8H 4BZ1A 2SODB 3MRNA 3OAWA 3GXPA 3FO9B 2VR8A 2D03L 4MJ4A 3V95A 1RMFH 4QO1A 4OTXL 1ORSB 3TA3A 3O3EA 4GKSB 3WKML 3BVNB 3Q5TA 3CXHJ 4RCAA 2J1KA 3FQNA 5MEOA 1BJ8A 2JFCA 1MCPL 1AO7B 3MRBA 5HVHC 1GGYA 4JN2B 4F7PB 5JORA 5GIRB 2FZ3B 1R19A 3MBEB 4TF4A 4WHCA 4WNJA 3M1BA 5HI5C 2ARJB 3D4CA 4MDIA 5EOCJ 4WW1A 5G5DB 5BS0B 5JHBA 5F1OB 4KJYA 5EFIA 1DDTA 4I3SL 4MJIB 5F7FA 4UQIM 5I1JH 1DQDL 3EGDA 1RZKH 4L29A 1RUPH 2F68X 4CSZA 2GIXA 4ZSOB 1JZ3A 2YD0A 3FC8A 2ISDA 1MJUH 3BKCH 2DY2A 3RBSA 3FTYA 5B1KA 3GDBA 1GPOL 5IQOA 5KBNC 3SKUD 2CUIA 5A1AA 1NLDH 2FDBP 4CRPA 3VGGA 2XWDA 5EO1B 2I26N 2X3BA 5CNHA 2SEBB 1C8QA 4MS8C 2XN0A 4BZ2L 3L1GA 2K6ZA 3K6IA 3PQYE 4HUWA 1JPEA 3HNTH 1L6XA 4UDTB 1NLBL 4X8JA 2CR3A 3B9DA 4AJWA 3AG4B 1DBAH 2X2JA 3LZQA 3RRQA 1F2XK 3PWVA 1QTYT 2CJSA 2R56H 2P28B 4G8FA 4TPRH 1P4UA 2BNQD 3H2PA 3MRNB 4C4KT 3H56A 2A9DA 5ECGA 3S8GB 1MLCA 3X13B 3A4FA 1B6DA 2EUXA 1SNRA 5C08D 2WBJC 4RX4A 1AOZA 4N0YL 3UJTL 3C08H 5DGRA 3BE1L 5I16B 4IEFA 1F58H 2W88A 1TQCB 2X0VA 3RE0A 1OQOA 1HEZA 5DHYA 3AW5A 3TVMB 3M86A 1ZT7B 3HC4H 1EO7A 1T0MA 3EYUL 3ABMB 3FT1A 1BZ7A 2LU4A 4QHKJ 4FEIA 4U1NB 5DHVH 4PI0A 2Z9TA 3G5XA 5AEAA 3HAEB 2VXTH 1PLGH 1TQTA 1WVZA 4LIQE 3WE6A 4FI7A 1EPFA 2VOTA 5KSAA 2DYPD 4O51A 5T33H 4LNVA 5H35A 1AZRA 2CDEB 2WLLB 1JNJA 1MCHA 4Y5VB 1FHNA 5I30L 3U6XA 2HTLD 4R4BA 3QDJD 2OTPA 1SXZA 3T1WA 4JFZL 5AVWB 3VFRA 1U3HD 2EH8L 3II1A 2EE6A 5ANME 4B9GA 2QHRL 3S8WA 1QLEL 4G43A 2BSDA 4DP5X 4MVBD 1O7DE 1BVKB 1I7UB 1RJYB 1T04A 3ASNB 3L5WB 3GUTB 3NT0A 2UXFA 3S88L 3CVCA 1IVTA 4QXWA 1U9KA 12E8L 1YVLA 5C09D 2OMXB 2XBTA 5B38G 1SJEA 3GSOB 3W9EB 1JI1A 5EUKB 4L1HA 4N2LA 2Y7OA 5EDSA 2DYPA 3J8F7 4KK8D 2VQTA 3TFBA 3BPNC 1BBJA 2QSTA 2PCYA 1IAII 3N43F 4IBZA 4LPVA 1U3HA 4QOKA 1FHGA 4U1JB 4WNQB 5C0GB 3FCSA 1NFAA 3MACH 4F3FB 1I8KA 2A1WH 4OCWH 4AEIL 2EDEA 2DEXX 1GYVA 3TPKA 5JW4M 3EBHA 2NT0A 2MCAA 1NGXB 2NZ9C 3P73B 1FE8L 3D39E 2XKNB 3QYNA 4XO8A 3IJYA 5IHZB 3IDXL 1KN4H 3LKOB 4HWBA 5J9PA 3KZ8A 4J3VA 2VXVL 5E2TH 4KFMA 3ZSTA 2EO7A 2ZUWA 2XWTA 1BVNT 3PHOB 5JYLA 2EDLA 2ITEA 4UOQA 4DESA 1B0IA 4I9WE 2VKXA 4OZGF 3OC8A 2Q8AH 5GZNA 2CO7A 4IHBA 2DB8A 3C5SA 4LDEB 4J28A 3PWNB 3IFNL 5E9AA 2QFRA 3ELAT 1I3UA 2V4LA 1JHLH 1P1ZA 4YLBA 5LBSL 3LQAL 3S8FB 2DWDA 4L37A 3KWTA 4L8BA 5EF0A 5IB3B 2JB6A 5D6DA 3UPCA 2YAEA 5F7EH 2R0KL 5AVUB 3VSQA 5JO5A 4P2RE 1NGYB 3ZKNC 3QO1B 3KPSD 1P1ZB 3GHBH 1MNUH 3OC5A 5IVXA 1UZGA 4Z7QB 1CMOA 3FQWA 3MACL 4HIQA 5JXAH 1E8WA 1JVOA 4XBPA 1DQVA 3Q2WA 3QHFH 2KUTA 3VA6A 4HBCL 4XT1C 3P9MA 2AXWA 5GZND 1A65A 4YOKA 1JP5A 5T8IA 3QSKB 1UH2A 4AIXA 2P7TB 5KAQG 4FLOA 5DJCB 4FCAA 4YX2L 1CBVL 2KYIA 3GHEL 3GLEA 4WHTA 2E59A 3AU1B 2Z7YA 5IEKB 1YMMD 1U8LA 4OCXL 3OX8A 3UEQA 1BQ5A 1HN1A 3FHAA 4I88A 3NOIA 2UWEF 3BUQA 4K9EH 4UINL 1NMCB 4LHUG 4K8RH 4P23B 3SBQA 4HH9A 1XR8A 1IKNA 4XBGA 4OFPA 1Y07A 3ZTEA 2OL3H 3GIVA 4DKEL 2WTRB 5AALA 2P49B 3V4PB 1X9UA 1IBHA 4HEMA 1JCKA 1F4HA 3CNKA 3OM3B 3U46A 2BIOA 3G04B 1FSKC 2MKWA 4PJAB 4XWOD 2E8ZA 4Z7VB 3EW3B 5DJXA 4EVNA 3B8SA 2IH9A 3FRUA 2HX7A 1KJVA 3O41B 3UCQA 5FM5M 4R4FH 3NQIA 1HEJC 2CO6A 4QMEA 2Y06L 4Y19D 3G6DL 5CJQH 1UWYA 3IAGC 4MMZC 5TF1L 5KTEH 3D39D 3H42L 4JDVA 5HSFA 1EHLL 1A02N 1DSYA 3LZFH 2EC9T 1P4LA 1X5YA 5LN8A 2XFXA 1OE2A 3BE1H 1IGYB 4LEOB 2ZKYA 4QXUH 1RL1A 2WQSA 3WO4C 4FP8H 4XVJH 1QSFD 1E5ZA 4MNHB 5HJBA 1FFPB 3JTSB 5LXGL 3QRFM 1ZGLB 3NTCH 4GRLB 1Y0LA 5ISZA 1JXDA 1KNOB 3VD5A 4ECNA 4LNRB 1W6LA 3E6FA 4ODVL 4JCWA 1DVQA 4ETQA 1TSRA 3HZKB 4NQDB 4UB0H 3ZOAA 3CC5B 1AQMA 2YGQA 2HJKA 2A0LD 3O3BA 3OZKA 2H26B 1BZ7B 3IJHA 1ZE3C 4HJGB 2BY1A 5EU4A 3EOYG 2OZ4A 2FD6L 4BHUI 1CD8A 2CIIB 2EDRA 4NQCD 3L5JA 4F93B 1JTPA 4IBQA 3RY5A 4TSBH 2J57A 1OGTA 5FYJE 2H8PA 5I6MA 2QLVB 3O6FC 4HD9A 5EU4B 5DMKA 4JDEB 2Y69B 5DRWB 3QI9B 1EGJH 1KGWA 1L9TA 1TEYA 3SPVB 2X28A 2DWTA 4XX5A 2BOBB 3BP5B 3MN8A 4JM2A 1BFOA 3D52A 4L0PB 2CHNA 4JZJA 3FU7B 1I7TB 2P5WE 3AU0A 1EXUB 1EEZB 4QDGA 2F74B 4L4TB 1TJIH 3QUZA 4KGLA 1YECH 5HBBA 4GBXC 1BECA 2NOYA 2Z1KA 4UU9B 4O00A 5BVPH 2NUPB 5J6GA 4WUUE 1NMBH 3C5ZC 2AV7A 4XP6H 5C0EA 5KVGE 5DSCA 5B7MA 3M8OH 4PRHB 3W0WE 5JNYA 4E68A 1X5LA 4ZAKA 3LS5L 3ZKQD 4NHCL 4OTXH 1RPQA 7PCYA 1IKFH 4XOBA 3ZE2E 2NSMA 4N0CD 4MNQA 4JM2D 1KXQA 3OKLB 4TNVF 4RISL 1PPIA 1MJJB 4U3XA 1QFOA 3ATDA 4AV0A 3RVUC 3FB7B 1OT4A 3CN3A 1ETZB 4PBDA 4UQDA 1XGRB 1K2DA 3VX1A 1NGWA 5DZNA 1A3LH 3HG0A 3N41B 4NXSA 4P5TD 2QQKL 1U93A 3BH9A 3UACA 2Z31B 5EBGA 4GLRI 4QAMB 2AC0A 4NRXB 3QRLA 1TYJA 3DX6B 4HFWB 2EDYA 1XDTT 5F1NA 3C9NB 4BFBD 1GYUA 2CALA 3RFZA 3ULUC 4JNXA 2VDQH 1AO7D 1RJLB 2B7DT 3BPLC 5ERWB 5T3XD 2B4CH 2JLPA 4JRXA 4KNSA 1A6AA 2EACA 3SDAC 1P7KA 3P3RA 3PNWA 2BHYA 2WBJD 4X42A 5IVZB 3P0VL 3HI1B 4KQ0A 2VMDA 3ES6B 2C3HA 3QIWD 4WSGA 5JLZA 1S7RA 5JXAL 1EAPB 3LRSB 4Y4FB 2YFOA 3FO0H 1GA2A 4IOIA 4P05A 1R24B 2ERJB 1OLZA 2WIIB 3TJEH 4WQOA 4EZLA 4NRYA 3FXIC 1SDDB 1FLRH 2YRZA 1KCVH 5T1DH 3UBXA 3ZKMD 4RAVA 3W39B 3GGWB 3QEHA 3DROB 2W9EL 4X6CF