1ILSA

X-ray crystal structure the two site-specific mutants ile7ser and phe110ser of azurin from pseudomonas aeruginosa
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
AECSVDSQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metalloprotein
molecule keywords AZURIN
publication title X-ray crystal structure of the two site-specific mutants Ile7Ser and Phe110Ser of azurin from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 33
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1995-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ilsA00
5D4HA 1TEGA 1CYXA 3S3CB 2MTAA 1ZIBA 3ABLB 1DZ0A 1NICA 1AZRA 4YSSA 4AX3A 2XUWA 1JZJA 3PAVA 4HCFA 1PZAA 4NAJA 1NINA 1NDTA 3FS9A 3ZIYA 2CAKA 1KBWA 3OMAB 4E9QA 1NIEA 4G72B 2ZOOA 3NT0A 2X87A 2GIMA 2VMJA 4YVNA 3DTUB 4KO6A 3S3BB 3X1FA 1W6WA 2XV2A 2UX7A 1NZRA 3EH3B 4QKTA 3GXUB 3H4FA 2HLEB 1KYAA 2GB2A 2FQFA 3D12B 5E9NA 4KOBA 1OV8A 4M3HA 4E9YA 1NWOA 1GS8A 1TKWA 1WS8A 1QNIA 1JZGA 2FQEA 3QJRB 1IBZA 4K9JA 2IDSA 4KNTA 2VM4A 2IDUA 2ZWNA 4JHUA 3SBQA 4A66A 4A67A 5I5MA 1EHKB 2CBPA 2CCWA 2PLTA 3QJSB 4AZUA 1PZCA 2EIKB 1J9QA 2VW7A 2XLLA 2XV0A 1ZIAA 3AG4B 2HZHA 4YSDA 4A2DA 1KCWA 1XB3A 4E9TA 2XXGA 2GI0A 1JVLA 3T6WA 1PF3A 4QLWA 2IWFA 2MRYA 3NSYA 5IY5B 1A4CA 1SHWA 2UXTA 1JXDA 3NJIA 4HZ1A 2FT8A 1AS6A 4MFHA 4G70B 5I28A 3IEAA 5I6PA 2A3TA 3FQ1A 4Q8BA 4YSPA 1BYPA 1KBVA 1ET7A 5B1BB 4JHVA 2XYBA 4HIPA 1SF5A 6PCYA 8PAZA 1E67A 1JOIA 1NWPA 1NIBA 4BXSV 3AZUA 4HHWA 1E5ZA 1OF0A 1X9RA 4A68A 1AACA 1MG2C 5B1JC 1IBYA 1N68A 2H47C 2HRHA 3ABKB 3FSWA 2PCFA 1KDJA 3MX0B 2I85A 1AG6A 2PCYA 1AAJA 2BP8A 4ZK8A 3WKPA 1BXUA 1OE3A 4F2FA 3NJKA 1ASOA 1GW0A 1BQKA 2J57A 2QPEB 4GYBA 4L0PB 4AKPA 1HAWA 3QJUB 2XXFA 1PNCA 3WNIA 4P5SA 3CDZA 2JFCA 3NJMA 1J5DA 1IUZA 2BW4A 2NRDA 1E5YA 4UAHA 1PAZA 2W8CA 3H56A 3RYMA 2XX0A 1ZDSA 1GS6X 1GYCA 4YSTA 3TBBA 5I6LA 3U25A 1DYZA 3FQ2A 3FSAA 4BWUA 3SBRA 3OMNB 1R1CA 3NJGA 3FQYA 2R7EB 1ASPA 1ETJA 4GY4A 6PAZA 4HHGA 4DP8X 4YSCA 4DP7X 1JVOA 1CUOA 1GY2A 2YQBA 3KW7A 4HCIA 3ASNB 1PLCA 1ZPUA 1XMEB 5I5IA 4N4YB 2YAMA 1A65A 1SJMA 2DV6A 2Y69B 4G7SB 1GR7A 1M9WA 2J5WA 2I7OA 1AZCA 3IN2A 2PPEA 1V10A 1NTDA 2LLNA 3ZDWA 4DP5X 4YSQA 3S8FB 1ZV2A 2AZAA 1PY0A 2AANA 3X1GA 4A2EA 4PAZA 5B7MA 3T6XA 1ILSA 1UATA 1M57B 3FSZA 3OQRA 3ERXA 1E65A 1CURA 5TK2A 2BWIA 5B7EA 5PAZA 2H5UA 4YSAA 1SFDA 2BP0B 5B1JA 1V54B 1XB8A 4AKOA 1SDDB 2GC4C 2H3XC 1WA1X 1A4AA 5AFAA 3MBWB 9PCYA 3CZUB 3H4HA 3ZBMA 3AG1B 1OOWA 1JZFA 2DY2A 2P80A 3PCYA 1MZYA 1GSKA 2J55A 1X9UA 3NSFA 3EH5B 2YAEA 5B1KA 1J5CA 1L9QA 1NPNA 3WNJA 1JZHA 1VLXA 3G5WA 3KW8A 1PLBA 1B3IA 3ASOB 4HALA 7PAZA 1WAEA 5I6OA 2PPAA 3PAZA 4BWTA 1J9TA 1L9PA 2YXWA 3QJVB 4KOCA 1KV7A 2IDTA 4E9XA 3PXLA 4BDVB 3N55A 1M56B 2FNWA 2DWTA 2BW5A 1JZEA 3V9EA 5EHFA 1HAUA 1KCBA 2B3IA 2OV0A 2DYSB 1T5KA 2FT6A 3FPYA 2IDFA 3PAUA 1NIAA 3SQRA 1RKRA 3N2JA 5B3SB 5F7AA 3FT0A 5A7EA 2XVBA 1ILUA 1JZIA 2HX9A 4YVUA 2Y1AA 5I5JA 1QHQA 4DP4X 4Q89A 4F7KA 4HAKA 4PCYA 2AVFA 2UXFA 1A4BA 3DKHA 3ABMB 2IWKA 4HCGA 3UADA 1L9TA 1HFUA 2WSDA 3EHBB 4GP8B 5FC9A 3T6VA 1NIDA 3UAEA 4DPAX 1MG3C 1ET8A 4KNUA 3T71A 3DIVA 2I7SA 4DPBX 4UANA 4E9SA 1YLBB 4DP6X 1BQ5A 3C75A 5AKRA 4KNSA 1WA0X 1XB6A 5D4JA 3EH4B 1ADWA 2X88A 5I6NA 2QPDB 2XU9A 3ABGA 2R7EA 4DPCX 3EF4A 1EZLA 1J9SA 2EINB 4NERA 1KDIA 3SBPA 2GSMB 2PP7A 2ZXWB 4A2GA 2VW6A 3WKQA 4A2FA 2HXAA 3CVBA 1TEFA 3BVDB 2VW4A 1L9OA 2YAHA 2PPFA 2QDWA 3FU7B 4YSRA 1A8ZA 4E9VA 2BZ7A 3GDCA 1OCOB 2JKWA 2IH9A 1WA2X 2E86A 1I53A 1OE1A 2UXVA 1A3ZA 3FU8A 3TBCA 2CALA 2GHZA 4KO9A 3CVCA 2BP0A 1AR1B 2OJ1A 1W8EA 2OCCB 2DYRB 1BEXA 1SDDA 4G7RB 4DP0X 1L9SA 3ZX1A 1AZNA 2FQDA 2TSAA 3FPXA 3NSDA 3IBOA 2EIJB 2FJSA 5ANHA 3X1BA 1PZBA 3IN0A 1BQRA 1BYOA 2YAFA 3NJNA 4KO7A 1J9RA 1BAWA 1WS7A 2QDVA 3TU6A 3IE9A 2GBAA 1E30A 4BK5C 1N70A 3AW5A 3NJFA 3QQXA 3OD3A 4JKNA 2XX1A 3UABA 3X1EA 2B08A 5I6MA 5I6KA 2FTAA 3T9WA 1CC3A 4DP9X 1L9RA 3HEIB 3GYRA 1V55B 3NP3A 1PCSA 2AFNA 2PP9A 3JTBA 4AKQA 2IAAC 2QT6A 2Q5BA 1JXGA 4FAAB 3AG2B 1OCZB 1ID2A 1ZDQA 4GP5B 4A2HA 1OCRB 2PP8A 1AZBA 4EF3A 3NJHA 4WTQA 4BDVA 4E9RA 1IC0A 4GXFA 1SF3A 1PLAA 4W1TA 2BWDA 2BZCA 5F7BA 2YARA 2FQGA 3UGEA 3CG8A 2FWLB 5PCYA 1MZZA 3T6ZA 5D4IA 2IH8A 4BXVA 4TXVB 3CVDA 3FYIB 3TASA 2CJ3A 3WIAA 2BO0A 3PPSA 2GC7C 4NB7A 3X1NA 2YAPA 1SFHA 1ET5A 1PNDA 2N0MA 3NJLA 2CUAA 2HRGA 5LDUA 1OE2A 4FA7B 3QJQB 1URIA 1FA4A 1AIZA 1PMYA 2DWSA 1KGYE 3X2QB 4CSPA 3NSCA 5TK4A 1ASQA 1CYWA 1JERA 3S8GB 2RACA 2YAQA 1AANA 2Q9OA 4AI7A 2UX6A 1GY1A 2YAOA 1MDAA 3OMIB 3HB3B 4CSZA 1AG0A 3AG3B 5I26A 2ZONA 1GS7A 4UF7C 2VM3A 4G71B 1AZUA 3FU9A 1F56A 1AQ8A 3NP4A 1NPJA 1RZQA 4P5RA 2EIMB 2IWEA 3BQVA 4ENZA 4YSUA 4BWWA 2WO3B 3FU7A 2PPDA 2VSKB 4F2EA 3PLYA 2BHFA 1RCYA 5B1AB 3NJJA 1OCCB 2EILB 1BXVA 3AY2A 2JXMA 1AS7A 1SHXA 3WG7B 4DP2X 1NIFA 1QLEB 4GP4B 3FYEB 4YL4A 1W6LA 4N8UA 5B7FA 4W9ZA 1IKOP 2P80D 1SNRA 2BP8B 4KO5A 3UACA 2XV3A 4YSOA 3TA4D 2W88A 1JXFA 4DP1X 2AZUA 3NYKA 1FFTB 2TSBA 4E9WA 2IDQA 4RH4A 3FSVA 3QPKA 2HX8A 1BXAA 3CDZB 1AOZA 2WO2B 2HX7A 2FT7A 3UAAA 3S3DB 2VN3A 3V9CA 4M4RB 3QJTB 2J56A 3OM3B 1FWXA 1AS8A 3WI9A 2UXGA 4G7QB 1TU2A 2PPCA 2XWZA 4X4KA 4WKXA 5AZUA 2VSMB 2YXVA 7PCYA 1RZPA 3L45A 3JT2A 4YSEA
chains in the Genus database with same CATH superfamily
3FQNA 3O9WA 1X7QA 1RH8A 3VXMB 1X4YA 2Y22A 3O2VL 4FFWC 5L7XL 1T1YB 1PAMA 2A83A 1EVTC 3HS9A 1Q9LB 1WUNT 1LXMA 4FQJH 4YBLB 5F96L 1S7UA 2FBRA 4BFKA 2FB4H 2K1MA 3G6JB 1WFIA 2NY7H 1UZGA 1INDL 4YN3A 4JFPA 1LO5A 4NQCA 2VN4A 5EO0B 5J6GB 1OANA 2YGPA 5CZVH 5KVFH 1GZPA 3B5HA 4BZ1A 2Y7QA 1XF2A 1ZLWH 4RNRA 4F7MB 1KYDA 3OV6A 3G9VA 4X0KA 1JK8A 1NFDB 1MVYA 1AD0B 3TCTA 3EH3B 4ELKB 2BMKB 3GXUB 3BEVA 3ETSA 3QEQD 1XR8A 2GB2A 2WHVA 5I0XA 2IQ9H 1B3JA 4CKVX 2CDGB 4W9GC 2WLMA 3PY9A 3MUGA 2AEPH 2I26N 1WK0A 2FLBT 1BOYA 4J3VA 4Z7VB 5A43C 4BH8A 3I2CH 5KJRL 1K4CB 1WT5C 4XVSL 3WFCL 3ZL4L 5EF3A 3ARXA 2DM7A 2DJSA 2OSXA 2V3DA 1OD7A 4ODUA 4IIZA 4ABQA 4BK4A 3RZCB 1DVFC 4PJEB 1J87A 4KMTH 3QYCA 5B1CA 5DD6B 2ZWNA 3WS6C 1IFHL 5T3XE 3A21A 1XCWA 1WZKA 2ESVB 2XBDA 1N3NB 4GMTL 4YHOH 1AXSA 4Y2DC 3JV0A 3INOA 1W0VA 1DVZA 2EECA 1KBKA 4Z3EA 2JIXD 1YEIL 4QLWA 4PRAA 3FHEA 2APVA 4J27A 5TDNB 4LK4A 2ZWSA 2P8PB 3CH8A 1QR4A 1BP3B 2WWMD 2X3CA 3P9LA 2Y23A 3CBKB 3VXRE 4HGMA 2AK4B 2FZ3A 2J8UF 4HJTA 3BAWA 2E7MA 1S7WB 1HYSD 2QHRH 4G1MB 3MLZH 3OZLA 4L1SA 3M8OL 5JIQA 1SF5A 4PV9B 4PV8B 4OV6F 4X6BB 1I8KB 2ICWA 2VRKA 4PRHB 1P4LB 2F7OA 1ND0A 1ROWA 4WKZB 3G5YB 3LMJL 4BXSV 5IREA 3EOYG 1TFPA 1QWUA 1G0DA 4FXGC 4AVJA 3JVGC 1CYGA 1NCHA 5EZLB 1QI4A 5HVHC 3SOTA 2PO6B 5LLIC 3QO0A 5FO8A 1G6RB 2FSDA 1ZLSL 4KX9A 2ZCLL 1DQDH 2W65A 5DJ8B 3NFSL 1KJ3L 3B2UD 2E6QA 3CQQA 4LPTA 5D1XE 5D6DA 5AWNL 2AEWA 4HEMA 4LVNC 4TTDC 3RNQA 4YPGA 5F88A 4QRSA 3QQ9C 2YJLA 4L0PB 2YPKB 3ARED 1PNCA 4JDTL 1P84K 1REIA 4S2SB 4XNUH 1PFOA 2ZXDA 5LDSA 4AIZA 3BP4A 3L3KA 5IVXB 1N12A 4S10A 3AM8A 1S7SB 3SKJH 3SE8H 1YEHL 5DQ9B 4D8OA 4Q9QL 1ZDSA 4XPBL 3C8KA 5AOZA 1VA9A 4UIKH 3DDGA 3P11H 5HGGS 3TIDB 1OARL 2XTJB 4H1LH 1ZT1A 2GTWA 4JQXC 1PSKL 2AEQL 3MSPA 1A7BA 4BINA 2VABA 3PP4H 3CLFL 3JV6A 3MRCB 4G6MH 4HV8A 3DHJA 4PJ5D 4F7EA 4WK0B 4N9OB 3FQXA 4JY4B 2HVKB 4LLYB 1G0YR 1CG9A 3WE6A 3Q05A 2QGDA 3KWVA 3OKOB 5BS0A 2CU9A 2N56A 3MUUA 4OFPA 2O5YH 5AG8A 4ZX4A 2QBWA 4K2UH 1JDAA 1LO4H 3LH9A 1NTDA 1U8CA 1RJZB 2V7HA 2Y36L 3EH1A 4X99B 4UTAL 4YK4C 4ICXA 1FLRH 4PJAE 2XPZA 1HXMB 1UM5L 4PAZA 5CZRA 3LX9A 4H44C 4NQEB 3GZOA 5GRZA 3MLRL 3RY6A 1FVDB 1U4FA 2H32H 3WJLC 1SY6H 2H5UA 4XHJD 1UENA 1UHVA 4KVCL 1FFPA 5AW9B 2W0LA 3FF7A 1SDDB 5I9QB 4APQD 3AWEA 4KTGA 3A47A 4XC1L 4FQCL 3VWKC 4G8FB 3AT8A 2PUQT 1JXJA 2EXWD 2OJEA 3KMDA 2EZ0D 3DX7A 4YEFA 2R83A 4G8EA 3I6SA 1A7NH 3IMUA 5KEZA 5KSAC 1M7DA 2X9ZA 2JKTM 1T6WA 3ZDXE 2VIRB 1C7TA 3RUGF 4PJEE 1A7OL 1J7VR 32C2B 5ITBL 4A6YL 4NZFA 2WQVA 4DUWA 2V5MA 3V6ZB 1UACL 4QD2E 3V4VL 1S78D 3GS4A 3WIHL 4S11A 2MKLC 2VLKE 3CC5A 3APCA 2YBGA 1DSYA 1OB1A 4OCRH 2CKBA 3LKQA 4K7PL 4DOHE 5HYJE 2E7BA 4AW7A 4PJDE 4RGNC 1A4JB 2BHZA 4TVPD 3P2DA 1KCBA 2F0CA 5AVZB 1CIDA 3SPJA 3UYPB 4ZUWA 4JG5A 1T0MA 1XF5B 1DL7L 2ZG2A 3QUXB 1TJHH 4KZ0A 1R75A 3MACL 3TBTB 3FUHA 1XCQB 2B16A 3L1FA 4HKXB 3S36X 4E2OA 5F7AA 3FFCA 1U93B 1EVUA 2ZICA 3ATBA 1ILUA 1K4DA 2X10A 3RWCA 4QHLA 2HJKB 1QHQA 1R3KB 4F7KA 4OUUA 4U1KB 4Z0XB 2ZIDA 4QI3A 4I4WB 2DWYA 2HPOA 3U48A 2CR6A 3ZT6A 4CMMA 4UYQA 3MBXL 3VH8B 5FHBL 3PL6A 1LEKA 4DEWA 1KB3A 4B9ZA 3U4EA 1V3KA 4FL4B 4H7VA 4I9WD 4Q58C 4I0PB 4XX1E 4C8XA 4Q2ZB 4UANA 2IH3B 4YMPA 3QIWC 4YL9A 1MIMH 2GQHA 5JHLA 3G7TA 3BX7C 3RP1A 1EEZB 4RGMC 1GIGH 1H8NA 1RUKL 1W0WA 3C08H 4XVUD 4MJIE 4O02B 4Y1AE 4BK8A 2EE9A 4UNIA 1FRGL 2WXHA 4OLWL 3ZTNL 4C83A 2JTDA 12E8L 3RGVA 5IB2A 3MA7A 3JZYA 3RBSA 2DQIL 3NIDF 2I9TA 1Y18A 3CFCL 3BIKA 3U36B 3L2LA 3BVDB 5I1KH 1ZAGA 5EOQL 4EUPG 1T5WA 1UXLA 1GZHC 1WUZA 2WXLA 3PWVA 1XGYH 3O6MH 4QOKE 3DYPA 4HXAL 4NI3A 3OTTA 3QR1A 3ZQWA 3CFUA 4P9HC 5SWQA 1CGVA 2VZSA 4QT5B 1OO2A 3QEHB 4NRXA 3RX9A 3MMEA 5T3ZL 3AWFA 1GJWA 3PHAA 4F9PC 2ZWKA 2VR9A 3NA4A 3O6FB 3TBCA 3X12B 4GUCA 2WQXA 1G6RH 3HG1D 1W8EA 3P77A 1RSFA 3IMRA 1KTJA 2YD2A 1NCDL 1FQ9C 4JFSA 1CD8A 2YEVB 4W4NA 3EHBD 3D4GA 5JMOC 4ZNEE 5LUMA 3WKYA 1NGXB 1ZD6A 3C5ZD 1PYWB 2WLLA 4Y2OA 1XZ0B 5DEGA 2ZUTA 3WKML 3K1DA 1MREH 3O3DA 4NX0A 3BT0A 2AHIA 1ZLVK 3TJHC 3E8UL 4L8BB 1IM9D 4JKPL 3RAJL 3DGCR 4HKJB 4XPHL 5C0AD 2VUOA 3JWNH 1KJ2B 1UZ6F 1CC3A 3PGDB 5HVWA 5L8JB 1KV3A 3ARBC 4PRNB 4KZDH 4JFVA 4YGVB 3GSVA 3FRPB 4DERA 2PP9A 4IOSA 4KI5C 3BSHA 4K5NA 2APWA 4FJYA 4G8GE 3AG2B 3K8KA 4Y7MA 4GBXC 3QWOB 3CFEA 1A7PL 1U58B 1BLNA 4RBPH 2YPVL 1ODUA 1PLAA 3N42B 1F6FB 1TJXA 3G5XA 5AALA 1HKFA 2WC7A 1TF4A 4XTRC 4E42A 5HHOD 2DS4A 4DVRH 1UD6A 4UM9D 1P5UB 1GGBH 1PD0A 2EVJA 1G7QA 1JNHB 2A6IB 1E5UI 1JWUA 5ICXB 5IFHH 1NGWA 1LWRA 5DC9B 4MB1A 2EDBA 4M5ZH 4PCKA 4TS6A 4P2AA 3Q6GH 4FC3E 3NUKA 1CLCA 3BRGC 2W92A 4WI9A 2XA8H 1IBHA 3QUZB 4P0DA 4JB9H 4BHUA 1B0IA 1WQVT 4F58H 1I1AA 2MNWA 4JFYA 1FHNA 1FE8H 2UUDH 2Z0BA 3H3KA 4JPKH 4ZS7L 5AYUH 4B5ZA 3MBEB 4UOZA 4LEOA 1ACYL 5MEQA 1W2KT 3I3DA 4WNQA 2LU4A 2BOLA 3FCSA 1WDAA 3QDMB 3F7YA 3C60D 3FB7B 3DRQA 5F3BB 1U8NA 1KPRA 1KT2A 4DNLA 1AGCB 3NIFB 2N0KA 3EXLA 2YQ3A 2X4OB 2YEQA 2IBGA 3WHXA 1N6QL 4KKAD 1S3RA 4PGJA 4K5LA 2FJUB 5DJ2B 5GJTL 2VM3A 4NS0A 4JDZB 2OR9H 1AZUA 5K59F 1WH0A 4PGEB 3TTYA 3WFHB 5IG7A 3BP6A 3WD5H 4IRSB 2EIMB 5AAPA 2H26B 5CJQH 3GJEB 5BCAA 3O3EA 5DUML 4FTVE 1RCYA 4Z77B 2VDLH 5KSBE 2RAMA 2VMFA 2YRZA 2IH1A 4GKZA 4HWEH 5TTRA 5BV7L 3CCHB 4HX1B 5I75B 1BG1A 4KKLD 4M7ZC 1HHKB 3DV4B 4PD4J 3LVTA 1M05B 2VWEC 4ZMVA 1C12B 3KPRA 4ODHH 4V2BA 5I1LB 2E0PA 5T3XD 1JNJA 4Z3HA 3QIUC 5EU3A 3FUIA 5HHMB 1IARB 1E2WA 3SJVB 2XKUA 1ZV5A 2L7EA 2X1OA 4LCVA 5JIPA 1DUYA 4X6DB 4RMBA 1NAKL 1F97A 2VDQL 1H5BB 1TDQA 4JN1H 3EGSB 2QKSA 5CJOL 3US9A 2CCLA 3C12A 4G8IA 1ORQA 2UWEB 2O4EA 1JYXA 1CICC 5DMIL 4YJZL 1MCCA 5CGBA 5KN5A 3A6OA 1MJ7L 4IMLB 4H8WH 1RZFH 3P0VH 4JQIL 3OM3B 3VXRD 4WAFA 2N01B 4FMFA 4LOEA 3KVQA 4AWJC 3VXOA 3TWCL 4PRID 3MJ9A 2A1WL 2MIZA 2AQNA 2Y2YA 5LXVA 4JO3H 3VUAA 3R19A 2VLJA 1H0DB 1QSFB 2XN0A 1F4WH 3OGCA 2O61A 3FS9A 5I0YA 3VU1A 1A6VH 2UYLA 3CE1A 5E4EB 2CCVA 3OPZL 1DQQA 4K3EH 3CZEA 2OLDA 3D6GA 3HZMB 4G1EB 1HIMH 3ZZSA 2GIMA 1PG7X 3KBPA 3CZGA 3QQ3B 1FVCA 4FFZL 4PB0H 3J27A 5JXAH 1W6WA 5D1XD 3RVWC 2UX7A 4OGAC 3PG2A 2AXGB 3EAKA 1Q0YL 3C6EA 4ELMA 4WU7A 2XFGB 5DVMA 4G59C 5TE4L 1UEMA 1IZKA 1NBZA 5JUEH 2HWZH 1S8DA 1TKWA 3RHWF 4TNWK 3BWUF 1FG2A 3K6DA 3OL2A 3GT6A 2OSWA 3GZPA 1R5WB 1TZ8A 2G75B 3ZKXB 3OGOE 3H85A 1LEGB 1MCKA 3CMGA 1MELA 2FDBP 4JHUA 3O11A 4XHQA 4A66A 3VTTA 1E42A 3G6AA 4WSKA 1HH9B 3DSNB 2EIKB 2VW7A 1EERB 1CT8A 1DQLH 1NBCA 2XV0A 3Q8CA 4KXZI 4AL8C 5I1IH 5D9SB 4KJYA 2DBLL 3RU8L 1SOXA 3ESPA 4J7RA 3RTQD 3RPIA 1LE5B 2GIYA 3HC0B 3QNXB 3VXMD 4WTWA 1I1CA 5IQ7H 2YD1A 3LDBC 1KJ2H 3WNMA 5EU6B 4KUCD 3FULA 1F1AA 2KMWA 4HKZA 2Z31A 3L4XA 5I6PA 3FQ1A 2JCCF 1SJEB 4ATTA 2CXGA 2H3NA 4KZEH 3T2NH 1KBVA 3BGFC 5DI8B 2VDRB 3VGBA 1JTOA 4Z7QE 5BOJA 1P53A 1WSST 1M3JA 1BIIA 1T66C 4LIQE 4OU3A 2XYBA 3GZQA 3P2BA 4JRYE 3HPJB 1NCCL 4ZOCA 4KJPD 1DBBL 3DARA 3H2QA 4XZUB 1RLWA 3RKDC 5KYXB 3IDYC 4TNEA 3BKML 4FNUA 2PCYA 3OWRA 3ZOAA 2WMPB 1C16B 5IHLB 2D4DA 2A99A 4JY6A 2GJ6A 3NJKA 3OX8A 1XH2A 1E7VA 3MQIA 1RSYA 1HN1A 2XPGA 2DTML 3IRCA 4N22A 3VTAA 1WITA 5K5YA 1R3HB 2BERA 1FL6A 4ADJA 4GW4A 3S5YA 1E3FA 1Y0LB 2XV6B 2PYEE 1IUZA 1B6DA 4GJTB 3MRGA 1U33A 5KWYC 2FH8A 1BM3L 2VLKD 1GS6X 3KL3A 4F15B 3QCTH 3FSAA 4BWUA 4JPVH 5HYJD 1TPXC 2W59A 4I2XA 1OAYL 3IGAB 3FQYA 1GW6A 3GLEA 3ALWA 3VXUB 1P4UA 1A6AB 1XGRA 1AKJB 4DP7X 2YUWA 3V10A 5C0DB 4OT1L 3US1A 1F18A 3O2DA 1UYWH 1KN2H 2OMTB 4G43B 2EDNA 3IU3A 4EAEA 3US0A 1MWAA 4P2RE 3U2SB 5KZCD 3KNBA 1GR7A 2XZAL 3MLUL 3ZHDA 3GDBA 2L4OA 4NRZA 3ZGIA 3D0VA 4RGNE 1ZY9A 2BY3A 1AGEA 3DURA 1T2QH 1NMCC 5AW6B 3SGEH 4ZMYA 3QR2A 1Q9KA 4JG1H 1CFVL 2EDQA 3HAEB 4YSAA 1N9PA 3MREB 3HI1A 1UD4A 3TBWB 3GHBH 3ZO0A 4PW4A 2GC4C 3EO0B 2C9RA 2BHYA 4JFOA 1A4AA 4XB7A 1NDGB 5C0EB 1P7KB 4OBSA 1N59A 9PCYA 4MJID 4GSUA 2YS4A 4Y1AD 3CZUB 3H4HA 5IWLA 3V0WL 3FO9A 4GMSL 5E2JA 2H6PB 5AW5B 1GSKA 3FONB 4Y5XA 5FA3A 3R7QA 4QCIA 1COBA 2G3MA 4YDKL 5GGTH 3TNMA 1TSRA 2G30A 2HH0H 1R5IB 4RWYH 1PLBA 1BMWA 1FNEB 5MHSE 4X80L 4PJ8A 1KBBA 4QOKD 4ORGB 4TMPA 5FFLA 4V33A 2VXSL 4ZQKA 2YXWA 4EN3A 5CP3H 2IV8A 3QJVB 3CFJB 1IT9H 1GAFL 4TNFA 2E7LA 2H1PH 4YZFE 3SPHA 4GG8A 5E2WL 4ANWA 1YY9D 4DTGH 3QUYD 4HS6B 2IIJA 5I1CL 3K2KA 5F6IB 1HVXA 5A2IH 1NBYB 4LSVH 1F3RB 3N41F 3NIGF 4PJGB 3B2PA 3UJIH 2X1QA 1IAIM 1LMKA 1Z5LA 4OGXL 3O6KH 1TJGL 3MRNB 1VFUA 2R0ZH 3D33A 2B15A 2AQSA 1JZIA 3ULSA 1GHFL 2WLHA 2Y25A 4Q6IC 5EBLB 4PRPA 5C0CB 2GTZB 2C4XA 4PCYA 1JV2B 3NCCB 1TZIB 4U6XA 2MNJB 1JPTL 4XGZB 4F2MB 1L3NA 3SE9L 4HU8A 3F6IA 3TJEH 1TCMA 4Q56A 2MWCA 4OLUH 2IWKA 4NNYB 4TRPH 3GUFA 4AQZA 1X4ZA 1J0IA 3QXAB 5CF3A 4PV1C 3L4UA 3FZUC 3HR5B 1DJXA 1N6VA 2WKLA 3PIQA 3BVWA 2JH2A 5E95B 3V5DA 4D9LH 4YHZL 2X7LB 5C70A 2I7SA 5GSVB 3RZWA 4BUHA 5ABDE 4DIXA 4E9SA 5KG9A 2EEFA 1FZMB 4LF3A 5C9JA 4OZHB 4B41A 2OXHB 3H9SE 1ADWA 3F62A 4CVZA 4OM0L 2VXQH 1TZOA 3QNZA 3T77A 5IB3A 5EORH 2KPNA 2WVSA 5DUBB 4HF5H 3KWTA 2BSRA 3QISA 2EDLA 3V4PB 3IVKA 3C9NB 2FUTA 3GSWA 4LRNL 1XO8A 2Z8VC 4J3OG 4LARL 4HIJB 1T0PB 4I48B 2FHFA 2QKIC 4NQQA 1T89A 4YSRA 3MXWH 3F3HA 3FCBA 4HC1H 5E24E 4KX8A 2OMYA 5DEFB 3GBNL 4XBPB 3BQUD 1TTGA 3QORA 4PU2A 3ECUA 1LO3H 1T83A 1P7QB 4ONHB 1TIUA 2E7HA 2VMDA 3QDGE 4FFTA 1BG9A 4R7NB 4H0IA 3B9DA 1YN6A 2QHLA 1PEZA 2AQ2A 5D2LB 5DRZA 1I9EA 3U1QA 2QPSA 2Z8RA 2ATAA 3MGTA 3TA3D 1OGPA 4C4KT 5GZOA 2G9KA 4FTDA 1BZ9B 2VDKB 2ZJSL 3TOPA 3HOGA 4HZLB 1I3GL 1XTLA 1D5XA 2QV4A 1YQVH 1S2EA 5ESAB 5JPMA 5AZEL 3MBWA 4HIIB 1RJLA 4G9FE 3S48A 3ZE2F 2NUPA 4LPVA 3P30H 3AU0A 5FYKH 1TU2B 2R2BA 1HSAB 2ICES 4XN2A 2R1WA 2WGXA 4CN4A 5DUPL 1DVYA 4HIXH 1IAOA 3WFEH 4G82A 1OT1A 4FTVD 3VMPA 3JTBA 4EI6A 2PR4L 3H2WA 2FX9H 2BFVH 4WHYH 1OCRB 4BKTC 4YHNA 3IXAA 3QUMB 2Q3ZA 1FNHA 4X4YB 1ZK5A 5CSGA 43CAB 4L8SA 3EZ8A 4QXUL 4B60A 1QO3B 5DVOA 1ZCRA 4CU6A 2EE3A 4YE4H 5IK3A 3ECBA 3SKMB 4V2CB 4DQOL 3D2TA 4TNVK 5IUCA 3DA0A 3WYRA 1QFWM 3ENEA 2BK8A 3NESA 1T1XA 3EYQC 1A1NA 2CA3A 1KGIA 5IMKA 4XZ4A 2GSGB 4FXKB 1SOQA 2VWEE 1DCEA 4Y19B 1DVFD 3CH1A 4W68A 2WVUA 5JOFB 3HAEH 3NJLA 2CUAA 5J6HA 3X11B 3WIHA 4AM0A 1BXXA 3B9KB 3MYJA 1IL1A 4Y2DD 1QG3A 2D0HA 1OHQA 1UD5A 3A3YB 4GQRA 4HS8L 2G5UA 2XG5A 1M9SA 2JTYA 1ZWIA 1MCHA 2WQRA 4IKIA 2PYFB 2VNCA 4LDEB 4R26H 4F8OA 4Z3TA 4OZIB 4OV5B 1DJGA 3QUGA 2YAQA 1MCLA 3B8SA 1WO2A 3WTUA 4AI7A 4RDQF 1A5FL 5CWSA 5F7YC 3SO3C 3WJMB 3HB3B 4GW5B 4WK4B 1SM3H 1ETZB 4U6TA 2ZONA 3GJFK 4WGVB 3VE0B 3VXSE 1NGQH 1S9XA 4B9JA 5HI4C 5KBLA 1LEIB 5IKCB 1DQVA 2XFXB 4PIRF 2HT4D 2QEJA 2HRLA 2VN7A 3QQDA 4M7LT 4PCSA 2B4CL 2WO3B 3FU7A 4CUCA 3IJYB 1OCWL 1PD1A 1FNFA 1Q72L 5HJDA 2VJXA 1OCCB 1XGTA 2CJUH 2YBRB 3ZMNA 1AS7A 4TQHA 5HDOA 1B4LA 4JG0L 5CBAA 4ACPA 4B0MM 3C6SB 1YUHB 2V5YA 3DUSB 3QQ9D 4U3CA 4P3CH 3T09A 3AXLB 2P80D 2HKFH 4G80A 4M93B 3UPRA 1I7UA 1UCTA 3QRBA 1IC5L 3O0RL 2FGWL 3VQ1C 4K8RL 4Q0XH 1G7MB 4XOCA 3MNVB 2V8LA 3FUKA 2BP5M 5DGRA 5DRXA 4GXVL 4RFOH 4N26A 3RWEA 1J0YA 1YEKH 2R56H 2WN3A 3MBED 3FSVA 2OX5A 2QGCA 1KIPA 5C2BH 4GKOA 4JRFA 2NX5E 2J5LB 2JJWA 4M1GH 2ILLA 4IEFA 1SJHA 4X9GA 5LN8A 5F9DC 4CN6A 3FTVA 3O45A 1D5ZA 4PI0A 1QRNB 3BVNA 1HC1A 2J88L 2QSCH 2F15A 2R0LH 1A2YB 3QDAA 1HNGA 1LDSA 4KZCA 4R90H 2IBZY 3MCKA 3A4AA 1AGFA 2ZOKA 5CCKH 3VI3A 2DYPA 1ETA1 3ZXAC 3EGDB 2YPLE 3TBYB 1SXAA 4JRYD 1BZEA 3QXTA 3PUUA 2WJ7A 3T3ME 1C5CH 5FOJA 1JPSH 4ODVL 3V7AG 1PZAA 3KPQA 1NINA 4IRSD 1XF3A 4W4OC 1EXUA 5JHMA 4WI0B 1A9VA 1KBWA 4DEPB 4OLXL 3V4UH 1BBDH 4JFDE 2D7QA 3L54A 3IDNB 5AW2B 3LNFA 3OKDB 2C3XA 2JJVA 2VDML 1XAKA 2OQJA 2X87A 3WO3B 1MVUB 2IG2H 2KLSA 2BSSB 1QLRB 3IS0X 2X2YA 3FSOA 3MJ8A 1NOFA 3GKWH 1MLBB 3BYYA 3GM8A 4XCFL 3T4AB 3GGWB 4QTIL 2Q76B 1KYAA 3TEUA 3BWAB 1E9QB 4M5YL 1GCFA 4M3HA 3L16A 3ZZ1A 4E9YA 3VWKD 1CFMA 2PYED 3GF8A 1UWXK 4X5XA 1HNYA 3VJ6A 5JW4N 4L8DA 5D7JA 4M6AA 1S7QB 1ZE3C 4BZ2L 3KLHC 4KAQH 1JGEA 1XCXA 3MNZB 4MDJA 5JNYB 2WBJC 1HOCA 3BZEA 2AAAA 2DMGA 4M9PA 2OMUB 2VDKH 1PZ5B 4DK3A 3PP3K 1FAIL 5IW1A 5I5MA 5JPNA 1SOKA 4PG2A 4OFVA 4JHWL 4MAUH 5KOMC 5LGYA 4NZDA 3QWRD 4QY8B 2VERA 2VR7A 2XXGA 3VFOB 2ROYA 3P9MA 1T89C 4P2RD 1HEHC 2IWFA 1XSIA 4JFXA 3C5JB 3S96B 1GRWA 1X5IA 1YPZA 4PJIB 2Q8AL 5E8NB 1CVSC 5IVZB 1A1OB 1UEYA 2KBGA 5I28A 1KZYA 3RVXC 1QSFD 2VLRB 3D3VE 4F57L 3QWQB 5J12C 5IVNA 1DN0A 3OVUB 4MNGE 4KK8C 3QAZB 4AV0A 4UZSA 3FO1A 1S7TA 1M7IB 3QUMH 4QRQA 5KAQF 3EGXB 1MHHA 1BD2B 2W5PA 3N1PC 5TGBA 3MJ7B 1KELH 1KXHA 3LZRA 4PSRA 4Y5VC 3ZL2A 3CFNA 1E4XH 3ALXA 4KGJA 3HG0A 2ZSWA 3L13A 4X5WB 5LCVL 5JPMC 1HWGB 2WLJA 3L7EB 4NKOB 1KTLA 3HZVB 4ZAKC 3GFUA 1AVAA 1T4KB 3MDJA 4G3YH 2UZXB 4IBLT 3ARDA 3QIBA 4W9EC 1GW0A 2BVOB 4C56B 4C47A 4X4ME 3QIWD 3KXFA 5I74B 4N0UA 4JFEA 2P42B 2BC4A 4OKVA 3RIFF 4MQTB 3VO0A 1AGDA 4R97C 2SEBA 2L7JA 2XX0A 2NSQA 4OJFL 2AJSH 1FGNH 4P23A 2DQDH 5KVEH 3S9DB 4LU5L 4MD4A 3I9GH 3OF6A 1NCUA 2I27N 3IFPB 3H42L 3C5SB 2DQCH 4JNXA 4XNXH 5ICYA 4F37F 1EGJA 3BJLA 5CUSL 2DMKA 4ETQA 3AS2A 1SGKA 5KUKA 4D0DB 3VD7A 2IGTA 3TONA 2EICA 2L7QA 1N18A 1I8LA 3QK0A 3MRRB 4W9DC 1XMEB 2AJ3A 4NKMB 5CINH 1KXTA 5EOCL 4XMPH 2DD8H 2JI2A 4OJDH 5DLML 3CFDB 5AW0B 4IIQC 4PLNC 4WEMB 3WEOA 4J4PA 2LT9A 3D06A 4J8RB 3L5XH 2GBTA 2OA9A 4H5SB 5D2NA 5LB1A 2HFEA 2F7PA 4JFFE 3CBRA 1CLYL 3F2LA 1IJNA 4M4PA 5J57B 5TK2A 2YN3A 5ALCL 3RWDB 3ROLA 3WNNA 3L3DB 2ENPA 1MCPH 4ZO8A 2Q2EB 3AS1A 1V54B 3U1PA 2FK9A 3BUPA 3SCMA 4NZRH 1FZOB 3HW7A 2DKMA 2BX5A 2A6KA 3INUL 1BJ1H 1YECL 4KXCA 3TV3L 1ETB1 1KCKA 3NFPA 1BQHG 1PX8A 5DK2A 4BRJA 2DY2A 1ZLDA 3FQRB 1CFNA 4CDGC 1X9UA 2XRAH 5CSZA 3BSGA 3STZB 5F21B 5FFGA 2IFGA 3P4NB 1Q9WA 3QO1B 5F7NC 2C9UA 1LK2B 4GEJA 5SX5K 3TM6A 2BY0A 4GBXD 1WGOA 4WTXA 4F9LC 3VXUD 5ACZA 5KBNC 3MV7A 4KUCF 3T2QA 4AYID 2VDPL 1AKJD 2V7NB 3G6JF 4PJAF 1TJIL 1WD8A 1PG7W 2OP4L 3TV8A 4MJHA 4W9IC 4OQTH 5GIRB 2IDTA 4U6YA 3BT2H 4ZZFA 1UVQA 2Y1ZA 1CQKA 2X3BA 4LCYB 4U1MA 2DWTA 3IFLH 3QDGD 2P5WE 3MKGA 2ED9A 1UOVA 1JHKL 4L3FA 4PTUA 5G2NA 5BVJB 1VFMA 4FHJA 4Y88A 1A3LL 2EIZB 3PQYA 4UT7H 1NFDF 4H0HB 2XSKA 3PWLA 4HCRH 3IKCA 1FPTH 3ZYOA 3QH3A 5FIEA 1VEOA 1IGFL 2YD9A 1D7BA 5BRPA 4XC3H 2F74A 5HJ3B 4DK6A 4FOMA 4KK9D 4Y4HD 4LLWA 3O3AB 4IGBA 4CADB 1QNZH 3LS4H 5DFAA 4EQ3A 2DICA 3TZVC 5HSFA 1RMFH 2R9HD 4PJCB 4GUPA 5GGQL 3RDTC 4DN4L 4G9FD 1IM3B 1CK0L 1BVKA 1YQ2A 2XVLA 4NBYB 4ODTH 3V0AC 3V0GA 3RVTD 1DJSA 2F54A 3E8VA 3MRDA 2ZPKH 4PJEF 5DUJA 4Z9KB 5IFJA 5E5MA 4MHHI 4HXBL 1IEAA 3FTWA 1QZNA 3Q2WA 4PJ9B 5I6XC 3FFDA 2GJPA 2A9DA 2HFGH 5I76B 3UAEA 1MFBH 5CEXB 4C57C 3WO4B 1U8IB 3DIVA 2K8QA 3QUHA 2FIKB 5DVNA 5DWUH 3QXVA 4FJZA 4KBPA 6CGTA 3PDGA 4UQ2A 4N2LA 1OIOA 4PJDF 5D4JA 4I1NB 5JHDE 5JZ7C 1AKPA 1HCYA 2IAMA 3S6CA 3MRPA 1SYVB 4WRLA 1MHCA 3JWDC 3LQAH 1EZLA 4KVNL 3GSOB 4HS3B 2BRRH 3BPLB 2HN7B 5J06A 2DQMA 3A6BH 4M7LH 4I77H 2RA1A 4K5MA 3BMWA 2VW6A 5CZXC 2NSXA 3LXCA 3T8XB 3FUNA 4OLZL 2OJZH 4MYPA 4TOYH 3MROB 1EFXA 5JDSA 4KK6D 3ARTA 3UZQA 3TO4B 4FKKA 4MNQB 1OCOB 2FYYA 2HG5B 4JO5A 1CDCA 2JXMB 3TF7C 2LFEA 1G1CA 2OKMA 4K7FA 5FGCB 1U8HA 1JFQH 4M43H 1KEMH 2Y5QA 5JPNC 4UINL 4YS4A 3CUPB 3CBJB 4R2GB 5FYJL 5C0CD 1ACXA 2Z34A 4AUUA 4FQXC 1Z7JA 4I8DA 4BD4A 1D9KC 1DEEB 1M6OB 1OP9A 1G9HA 3BI9X 2FEDD 4Q9BA 1BEXA 4DP0X 4G7RB 3Q1SL 4JY5L 3SDDB 5DK0A 3NSDA 2AVGA 1JGVH 1NCBL 2C4FU 5IVXF 3HCVA 1T1WB 2NNCA 3NCMA 3FU3A 1MIEH 3VGFA 1R19A 1WBXA 4Z95L 3NJNA 4NZUL 4BQ9A 3LXUX 3OBAA 4EUPB 5HJBA 2YD8A 3U1SH 2MQGA 3VXSD 2ADGA 3CN4A 2BNQB 3AW5A 1EO8H 4XMWA 2P48B 4NN6B 4L4TB 3QAQA 4G9DB 4IHBA 1OSPH 2AV7B 4P4KC 1JAEA 1V27A 4QRRA 2O72A 1T0OA 2B39A 2YUZA 3BHBA 2OL3A 1CVRA 3QJHB 3AUVA 3GYRA 3NP3A 4NT6A 4HH9A 4R96A 3ULVC 2IAAC 2NTSP 3BUIA 4XCNA 4IOIB 3EOTH 4MBOA 4GP5B 4YXHH 1VACA 1ZT4B 1X44A 4WHTA 2DLFL 2BOCB 3RVWD 3NCBB 1CGYA 2HKHH 4OGAD 4JFHE 3LPPA 4W1TA 3KYMB 4IU2B 1Y6KR 4JANA 1YNLL 3UZEA 3ZDZE 1YNTB 3K71A 3VFTB 3VRJA 3QIBC 4Z7NB 4ZSOA 5F1NB 2VDNB 1IBDA 3T6QC 4GOSA 2OYPA 3IGLA 1MJUH 1RQ5A 1KXVA 3RBGA 4TXVB 4XCEB 5FYLD 3C8DA 3FQTA 4HK3N 4NB7A 4ODXA 2G3ZA 4WFEE 2E5EA 4PS4L 2R2CA 5T33H 5BV7C 1VCBC 2HSIA 2A74C 2LTQC 4NM4L 4YXLL 3VD4A 1ONQB 4QRAA 4YAQB 4R84A 1KB5H 3EFDL 5E8DL 2BNRE 4H1LA 4DKFH 1WC7A 3BPCA 1LP9E 2YPLD 4I0KA 4MNHB 2FE0A 1F4HA 4JFQA 1I8LC 2C9PA 2B2XL 2OW6A 4H8QA 5FECA 1IX2A 1ZHNA 5FLVA 5D1ZA 2CPCA 3WFDH 2ATPA 4XBEH 3Q8FA 3LEXB 1MFNA 4X9IA 2V17L 3B7YA 5HP5A 3DGGA 1WAAA 1VGKA 3I9AA 5B22A 5IHBA 1ZHKB 1OAQH 5DYOA 2EUWA 1T66D 3VG9B 3UXFA 1YYLL 5HGDB 3SDYL 4JLRA 3BGMB 2TRYA 3FU0A 1ZA6A 2H32A 1B2WL 1SY6A 3FU6A 3QEGH 5CNHA 1RZKL 1MFEH 2BDNL 1EJ6A 2ZWZA 4KXBA 2BWQA 2NYYC 4UUJB 2J8OA 3RKDD 2R4SL 4ZO9A 1BXVA 1NEZA 1FHGA 1BF2A 2W60B 3TPKA 4AITA 4DP2X 1DBKL 1QLEB 5F7MC 1YUKB 4ALAL 5HD8C 4QRPB 1L6PA 4HIEA 1EDYA 1P0SE 4G8AC 4Y19D 2HMIC 4D8PA 1TVBB 1BBJA 2EUZA 1NCWL 1OZUA 5BQ7A 3FB6B 3F7VA 3B9KD 1X9QA 4U1IB 5L2KE 5KS9A 2CXKA 3DO3A 1J8HE 3I50H 4HHAB 4P59L 4UQCA 4A7GA 2ALWA 3X17A 1YY8A 3RRQA 3WN5B 2ZUVA 4PRBB 5T1LA 3UBXA 5J11B 1NLDL 4RMTA 2Z92B 4D9QE 2HRPL 3ZK0A 4K07A 5BO1H 4E0RA 2XQBH 2VR3A 3S2AA 4K7PY 5D93C 1TZHB 2YZ1A 1U91A 4LVOC 3HB3D 1ACCA 1MH5B 4JMNA 1THAA 2C1OA 1I9IH 2IFFL 3GXNA 4B9GA 1NGYA 4OY9A 2YEZA 5B8CC 3MZTA 1LQBC 2NZ1A 1I3RA 3BPNC 1EO5A 2ORBL 3BKJL 4U6HB 5D5MA 1JZJA 1NC4D 4O4YL 2ITFA 4UMGA 2AEIT 3SDXA 1PLGH 3HI5H 3NT0A 3B2XA 3MA9L 4P57B 1CGWA 1E90A 3DRTA 3VFNA 3QT2A 1I4FB 2JKRM 3UROR 3K6SA 1HHIB 5DJDA 2XWJA 3OR6A 2Q6WA 1E5CA 3VG0L 3I84A 1A6TB 4PGBA 2XG4B 5B39A 5F9JB 1JRHH 5GS1C 1M2VA 3MODH 5DJZB 4BGLA 3UAJD 4Y9BA 3ZW3A 1OGTB 2CBMA 4ZFFA 4K9JA 1IBZA 1EEUA 1IIIA 2IDSA 3A4EA 2AXFB 2D4FA 3GSNL 3EJUA 1M1XB 4U1LB 4YUEH 4KY1H 4F8TA 1KLGB 1KENH 5KVDH 2IAMC 3M17A 3HMWL 4K3DH 1DO6A 3QBTB 4Y5YB 1V7NL 5EO1B 2MCG1 2FJHA 2CBPA 2OFQA 1J8RA 2OZNA 3TYGL 43C9B 4N0FB 4N0CC 5EPMA 4S1SH 1SXSA 3LHPH 4EUPH 2ADFH 1QRND 2K9FB 2Y6SD 4MB4A 4UQ9A 5HI3D 2PXYB 2AJVH 4I85A 3NEOA 1Z9SB 4UQEA 4V1DB 2ZKYA 1IU1A 4AQ8A 4AQEA 4Z78B 4AXWB 3DSFL 4AVKA 2VZOA 4ODWB 2ARWA 2HVBA 4X6EA 1CCZA 2WIIB 3O6LL 3OG6B 1FVEA 4PW9A 1QSEE 3HFFA 4UWQB 4AYDC 3LB6D 5C08E 3FQUA 1BV8A 4R7XA 5IIEB 2A38A 4UV4H 2NY5H 3MLSL 4YR6B 4WFFE 4JZOA 3G5VB 3VSUA 3N5AA 1KGJA 4K23L 4K7PX 4O2FB 3SPGA 1ZLVH 3UTPE 4M3JA 1IBGH 1NWPA 2EC9U 4B5EA 2XVGA 5DD5H 2UY6A 5E8PB 2DDQL 1SBSH 5CBEA 1H15A 2WLYA 1OF0A 2VDNH 1IQWH 2IJ0C 4RMRA 1XR9A 1FZJB 1KACB 3AMKA 1WD9A 35C8H 3GZKA 2W0PA 3CN2A 3OXRB 4PW3A 2VUKA 3LZFL 2IQAB 3IJEA 4K71C 3FZUD 1CLZH 4N8VA 5INDA 4DN3H 3PWJA 2J57A 1BQKA 1ZRUA 3DXAB 3NFNB 5E6IB 3JWOL 2H0JA 3BAEH 3TVMD 5SX4H 4OTXH 4P5SA 1J5DA 2BW4A 1SVCP 5DHMC 4L5FL 3TCLB 4CW1A 3FN0L 2DJUA 5FO7B 5IJKA 3TBBA 2G4GA 3S36H 5MENB 3LSOB 3ZE1E 1DYZA 1QKZL 2UZIH 1I7TA 4Z7QF 2GAZA 5E94B 2P5WD 3NJGA 4LASH 3CVIL 2BIHA 2BRQA 2BIQA 1SUHA 6PAZA 5K9OA 2QMJA 5J56B 2OAAA 1XF4B 1A6WL 4JM2A 1OGAB 4PLKC 3MHZA 1N8ZB 1K3IA 1R3JA 4Z7WA 1VADB 2JB6A 2NXYC 2O26U 3QJFB 5EDSA 4PLOB 2K78A 3L95A 2DV6A 4PJXB 3W39B 4WSGA 4QF1A 2AF2A 3ILQC 1BD2D 3U0WH 1G9EA 3RNKB 5E0QA 4EVNB 2VZVA 3U83A 4J2QA 4ZUSB 3ZDWA 3OJDA 5HHPB 4RX4D 2YJQA 2HLAA 2Y7OA 1YNKL 3VMOA 4LEXL 3ERXA 4JPIA 1XXFC 1QLEH 1E65A 4XAWL 2VL5B 2ATKB 2EEDA 5EZJA 2VITB 5IBTL 1NEPA 3FO2A 1WHPA 1WWAX 1Z0NA 2WLZA 4X6DF 3UMTA 5ERWB 3SD5A 1FL3B 2W07A 3OAUL 5IF0A 5IMMB 3DO4A 3GSRB 5C0BE 4Y1TA 1JYWA 1KPUA 4C56D 2UWEF 1AI1L 4FQ2H 3ZT5A 3VB8A 5JHDD 4UIMB 5A2JH 3QZOA 1RZ8B 2X40A 4Y9GA 1W72L 1BVLA 5T3ZE 2IADA 1ADQH 1T5XB 2Z91B 1OOWA 4J2XA 4PJBB 1PKQB 4EI5C 4EIGB 5C8JA 2XOTA 2FHCA 5D7LA 2ED6A 4X6CB 1R4XA 4C59B 3FU5A 1BEYH 3UZVA 1U8MA 3SZKC 3ARGA 1CTNA 3OSKA 4IKJA 1J9CT 2HJLB 3HE6A 1H8OA 1MI5B 3CQFA 3I85A 3QDJA 4Y4FC 3DTXA 3PAZA 1XH3A 4N90D 2V0AA 3VI4E 1X5AA 4RESB 4S1QH 1KV7A 5ADPH 4BDVB 4TLSA 2BW5A 2ARJQ 2MOVA 3V9EA 4NJ9H 5EHFA 2CO6A 3K6IA 1FO0B 1WZ1H 4DQAA 5K9JL 2IANB 4IJTA 1AR1D 1PS3A 4C54A 5I0ZA 2WXIA 1U3HA 2P44B 1NIAA 3DK0A 2GIXA 1X3DA 1RKRA 3EYUL 3ULUH 2CRIA 3FQWB 4G6JH 3HZYA 1HTYA 4JKKA 4RFEA 4PQXA 4ZFOB 1QBMH 3NN8A 4Q89A 1GGIH 1KN4L 4HGWB 1EWHA 1MHEB 3ZYIA 3MLYL 1CL7L 1GSMA 1PJ9A 5FDWB 4F7PB 2NW2A 5CJXA 1ZOXA 3DKHA 4JRXA 5DT1H 1BFTA 2AI0L 5HPMB 1HFUA 4X98B 2OMVA 1V5JA 2BS9A 3LZLA 3E3QC 4XOBA 3T6VA 1E2ZA 4CJ1A 1JPGB 1ORSB 4LCCA 3BSZH 5IHHA 2NUTB 3P9WB 3SY0A 2EEBA 4LCWE 4YZFF 5ICZA 5KTEH 5J3HC 4MZ3A 1F4XL 3DVNA 5HI4D 5IVOA 4JFHD 3QG7L 4TVPL 5CJ5A 5C09E 3UFIA 4DPCX 5CFHA 4IS6A 4UCFA 4DKEL 3HE7A 4PP2A 1I1YA 3W82A 4BH7A 4UDUA 1ROCA 1IAMA 3ULVE 4Q9RL 3DGDA 2SODB 1TEFA 3QDHA 3VVVA 3K6NA 3RUGA 3U46A 1KYFA 4OD3H 4TQ8A 1SHMA 4Y16B 1LQSR 2WSPA 4MVBC 2WANA 5DSCA 4WFED 2CMRH 3HJEA 2EDJA 3F8UB 4P04A 3II2A 3TEZA 4KWUA 5ES4B 2AABH 1CBVL 2ADYA 4NPKA 3H8NA 5DJ0B 2JKSA 3KPSA 4AQ1B 3T1FA 4PG9B 4P9MH 1I9RH 4KK5C 3UO8B 3CZFA 4UZUA 1NQBA 2GHZA 1IM3D 4WNSA 2PCPA 3SYPA 3ZDYE 1HHHB 3PWPB 2DYRB 1HCZA 2OZ4H 4M7JH 2VXVL 1Y1DA 3W57A 3WJJA 4ZW6A 1OF2B 3KHQA 3ZX1A 2EDRA 1EEYA 1OEZW 2ZNXA 1R3IH 1FDLH 1T04B 3EYFA 2CQVA 4AVHA 4OIAA 4UAOC 2Q20A 2EEAA 4H26A 2QLVB 4H8VA 3KJ4B 5F7KC 2ITDB 5EUKA 3SQOL 1KFAL 1BGXH 1FV1B 5C0NC 2I24N 4UM8A 3UTSE 3L6FA 4L9LB 4HUXA 4HA1A 3N04A 4R4BB 3C6LA 2R29L 3FQNB 3O9WB 1X7QB 2A83B 2I69A 4PJBE 1KEGH 4KNQA 1S7UB 2QT6A 4FAAB 3QR0A 2CKNA 1KXQE 2X4UA 3Q2NA 4JFPB 3APDA 3EDEA 3KYOA 1LO5B 5LGJA 3DJRA 5I1HL 4NQCB 5KVMC 3Q8BA 4MAYA 3SGJA 1OLLA 2WIMA 3K0WA 1GZPB 1MI5E 4U05A 2BZCA 2Y7QB 4MNQD 5GS0D 1XF2B 3L81A 4RDBA 1F8TL 4RNRB 2BXZA 3P0YL 4X0KB 1QPKA 1JK8B 1JTTA 2M1KA 1S7XA 3A5VA 2YD3A 3BEVB 1DBML 5L2KD 3K74B 1F00I 1XR8B 1DQML 4P2QE 1QOKA 2B4CC 1UWEH 1RUAH 2HJFA 3S37H 3LD8B 4LAQL 2MMXA 5H37A 3MUGB 3A22A 4HOZA 1NCAH 4BH8B 4F93B 3KJ6L 3F6LA 4D9QD 3UDWA 4A37A 4HAFA 4ONOA 1KTKE 3SDDD 4ODUB 4QKXB 4BM7A 4A38A 4GG6E 2HTLC 4FQJL 1PG7H 3S98A 3KR3H 4YDVA 3U30B 3CVHH 3MOAH 1F4YL 5AB0A 2F19H 1AXSB 3WMPA 1CYWA 3IU4H 4K8RC 2NOYA 4I0CC 1W0VB 3LEYL 3FCGA 4LHUA 4L4TD 1QHPA 4KQ4H 3RVXD 2VRAA 3QG6A 1WFNA 4PRAB 1TTFA 4AGPA 3X3FL 4MBRA 2QVFB 2NZ9D 1KB9K 2CSPA 5GS3A 5A40E 4KK8D 4P46D 3Q6FA 3HTLX 3P9LB 2K3TA 4JM4L 3GRGA 4M7KL 4PBVC 3SOBL 4WFGE 2QADC 1JZ7A 5EOTA 2FZ3B 3L1OL 3C09B 3M6DA 1MKFA 3I6GA 4P5RA 5DQJA 4G6KL 4ENZA 4XCCL 2AEPL 4XP4H 2BVEA 3RL1A 5GGVL 4WJKB 2ICWB 5EWIH 5ISZE 1ND0B 5TFSL 1JWMA 1OTUC 2CM6A 3W2DL 3GBML 3DJSA 4ZAKD 3KLLA 3NTCL 1RFDH 2A4ZA 4E41E 3QO0B 2XN9A 3HG2A 5ECJE 4N0YH 5FO8B 1AJ7L 3LZQA 3ESOA 2W65B 4NUPA 2BP3A 4XN7A 2VR4A 2F18A 2D03L 4TULH 3RNQB 1DQTA 2J3SA 2K45A 4GXUM 4YPGB 4QRSB 5F88B 3EJQA 3U6XS 1ZXKA 4XP1H 5GGTA 1TG8A 4KUZL 5IGXL 1AOZA 3IJ7A 4PJ7E 4AIZB 4HVBA 3BP4B 3L3KB 2RCSL 4XAKD 1VCAA 4QNPE 3T0EA 4GQ9L 4MA3A 1TNNA 4NGHH 3LXAA 4NC1C 1OSZA 1W15A 3C8KB 4MQXD 3LRMA 4HBCH 5C08D 4OZHF 3LQZA 2XWZA 3TTSA 2H7WA 1ZT1B 2GTWB 3GS7A 3L2NA 1JHLH 4GAGH 4S1RH 3KCWA 2VABB 3UTTA 5I8KH 3JV6B 4RMSA 4QRFA 2OCFD 4MJJA 5J1SC 4HV8B 3BDYL 3RI5K 4IRJD 1KY7A 4F7EB 3FQXB 2J20A 3ABLB 4MA1C 4CJ0A 1CG9B 3WE6B 5T1KA 1AY1H 3EFFA 3LIUA 1MFVA 3RWFA 1U8KA 5BS0B 4AIXA 2ZKMX 4NO2A 3KWWA 3ARUA 5FV1L 1G9NL 3SEPA 1UGKA 1U8CB 2V7HB 4HKBA 4Y4KA 3BMVA 3KLAA 1FF5A 1S46A 1FGVL 3CFKA 2PTTA 3STLA 2CG9X 3NA9H 4ZTOH 3D7PA 4UQIM 4H8HA 2EYRA 3B37A 4HWBH 1V05A 2FQFA 4IBZA 5D2LF 5E9NA 1UUSA 1G9ML 1NWOA 4LCCC 1FIGL 3QGVA 1UASA 4H20H 1FFPB 3A67L 3QFGA 3ZRFC 2WQWA 2A9NL 2FQEA 4AMKH 3TF4A 1CFSA 4WUUA 3JV4A 1RPUA 2GYSA 2Y06H 3D50A 3VRLE 2IVFC 2DQHH 4KNTA 3SPIA 1CO1A 4MA8H 3VDCA 3FCTA 2OJEB 5H2BA 4M56A 1IEHA 4LOFA 3DX7B 3CHOA 4L3EE 4G8EB 3T3MF 3TT3H 1JVKA 4HQQL 1DBAL 1M7DB 2NR6C 1OPGL 3FN3A 3AG4B 2X4NA 4QWWC 1MEXL 1P4IL 5HDBB 4PY8J 3QWNA 2IDCA 3DMMC 5FS5A 4PJHE 4ZXBA 2Z65C 2XNAA 1CU4L 5AYQA 1T03H 4J3SA 1LO2H 3PNWA 2EYSA 5F93C 2EUVA 1CFBA 5B3NA 5JIDA 3CC5B 5I0DA 2XWDA 5T5FH 1OB1B 2CKBB 3LKQB 3GPSA 4MXVE 4YSPA 5BNXD 1AP2A 1EHXA 3OR7A 5FW8A 2V37A 4ZUWB 1AXIB 1SMOA 3ESUF 2PWFA 4BZ1H 3U9PL 1T0MB 3W5NA 1MFCH 3L3OC 3CU7A 5C0BD 3SHSA 4A2LA 2VDOB 2FD6L 2OPCA 3RB5A 4Z0BL 4HHWA 1A0QL 5JMRA 1EJOL 3FFCB 5B1JC 3N1MC 3RWCB 1J1OL 1K4DB 1RUMH 1E4KA 3NK4A 4L4JA 4QHLB 5D7IA 5T3ZD 4OUUB 5IW3A 4CMMB 4NM8H 4BKLA 2CH8A 3QXUA 3PL6B 1KIUA 1LEKB 5L0QB 3DECA 3C6LC 4GYBA 2ZCKH 3DI2B 1MF2L 1MCWW 4ZW8A 2JSFA 2CUMA 3U4EB 3EO9H 5JZ7D 4CVWA 3P3SA 3WNOA 4JZJC 3TEYA 3RYMA 4WW2F 2FO1A 1WCBA 3LHAA 1A7QL 4EKXA 1WP6A 4EBQH 4ZFGH 1BJ1J 2PXYD 3NMEA 3Q06A 2A6JA 2WYIA 1W0WB 3T0AA 4NUMA 1ZK9A 1Q1JL 4GLRH 2DQFA 3SDCD 3QS3A 5CIPH 1IFRA 1VKXA 4I18A 4C83B 4MB3A 3U7YH 3OQ3B 5CM1A 3RGVB 3KW7A 5IB2B 2P8MA 3MA7B 2YR3A 4LL9A 2HT3D 6FABL 2I9TB 1Y18B 1YEFL 3BIKB 2E46A 5K9KA 1T7XA 1XHHA 3QSKB 4M3KB 1T5WB 2KUTA 3PWVB 4AG4H 4EXPX 1SJMA 2I7OA 5EF0A 5D1QA 2P5EE 3UDWC 5SWQB 4IW4C 4FQXD 1JYNA 4NRXB 1D9KD 2AJXH 3MMEB 3VFVA 3SY6A 4HWNA 2XWTA 2DH2A 5CGYC 1JSYA 4MHHG 4MKTA 3GJFH 5A2FA 4M62H 4ES8A 4XPFH 1QP1A 3P77B 4YHYC 4M8UA 3GMRA 2CO2A 3PJNA 3CQPA 2C9QA 3IDUA 4LCWD 5E6ID 3DXAD 2VXUL 4QRTA 1S5IL 2VLLA 1IGTA 1RZGA 4FG4A 3FRUA 2WLLB 4Y2OB 4P4KD 5DEGB 3O3DB 3FNKA 4B9PA 3E3QE 4DUVA 2AV1A 1TQCC 2V2WA 3ULVD 3G5WA 1BMGA 3MCLL 4FNLH 4JO8A 5DHYA 5JR1L 1KLUA 1B3IA 1MFAL 2WUCL 4UT9L 3FUFA 4FMKA 3GSVB 3LV3A 4GRWE 4F8PA 2PPAA 4IJ3C 5LXGL 1OGAD 2R1YA 4H1LG 4YLCA 5TF1L 5HDBE 2BSDA 2DWEA 3CFEB 2QZ5A 4E9XA 1BLNB 4PB9H 4FADA 4KKCD 5E5UB 3SKNA 4FF9A 4ZMLA 1IGYA 3G5XB 1V3LA 4E42B 4U1GC 1GTNA 1T5KA 5EV7A 5FKAA 1UJTA 5FUZL 4AM0Q 2NQCA 4KTDL 1G7QB 4KJWD 3B7TA 5CCGE 5C1MB 1JWUB 2R0KH 3MUJA 5G4MA 1NGWB 15C8L 5A7EA 4WY7L 4HUKB 4JL2A 3QCUH 1DFBL 5JTWA 2APBA 2WQUA 5A7BA 1ZGLM 4UNTA 4NXKA 1I1AB 3FK3A 4JFYB 5ILTH 1A4BA 2YXMA 3UTSD 4XMTA 5TH2A 4UZGA 3IAPA 4LEOB 2EP6A 1ZT7A 3U2IA 5MEQB 2F53E 4UOW0 3RFRA 1BA9A 4D2NA 1RIVH 2ZXCA 4ZX6A 1NEZG 4WNQB 4KQ0A 3FCSB 1I85C 1KF9B 3FXIC 3FJTA 1T4WA 3F7YB 4HFUH 3DRQB 2LQRA 1U8NB 3S34L 3BW9A 5MP6L 2DH3A 4E36A 4Z6AT 1KPRB 5AB2A 1KT2B 5IB1A 3ARFC 2X53A 1NOLA 4OGQC 1WA0X 2D9CA 5I15H 1WZLA 1MJ8L 3WHXB 1EAPA 1LK3H 1QAWA 2OI9B 1MI5D 1UWXH 3ARRA 5CD5C 2WAQA 1BFSA 1F58H 1RZJL 2X9YA 3B2VH 1L7IL 3SBPA 4NKIH 1DO5A 5IG7B 3HMXL 1IGCL 3BP6B 4OM1L 3CN3A 3UBXG 2NQDA 3PP3H 4FDWA 1MRFL 1OPOA 2JIXA 4ZMQA 1A8ZA 3ZHLA 3O3EB 4QXGL 4F92B 1Z9PA 1H3PL 5I1GH 1P4BL 4GKZB 2IH1B 4R4ND 5ANME 3CFBA 3LXBA 4AGQA 4LVHC 4N2MA 3PJSA 4Q7DA 5EC1A 3DOIA 3HUJA 2M83A 4XPGL 3KPRB 1HOEA 3IB4A 1P84J 1FC1A 4DGIH 5L6YL 5D96C 5FA4A 4OZGA 4ZD3H 3VFGH 5EU3B 5K69A 3T08A 4XP6H 4YX2L 1DUYB 2BP0A 5HHXL 3HS0A 2D9QB 1U8LA 4MDIA 3SBWC 2BJML 4EZLA 5C0JA 1UTDA 4ZG1A 1OL0A 3NCFB 4LAJH 5T1DL 1W16A 1AQMA 4G8IB 1ORQB 3AT0A 3HHRB 1CL7I 1GZQA 1PZBA 3QZBA 4MSWA 4DGWC 3PDOA 5AVQB 4B96A 4AMXA 5KN5B 1RXLA 1ZKAA 4HIQA 3JT0A 3WDJA 4DKDC 3PHSA 3BVVA 3IDXL 1HQRA 4X8GA 1E30A 5EZOL 2D7PA 2ZX7A 5LJYH 3O8XC 3WXVH 5B39G 1HKLH 2NY4C 4MGXA 3VXOB 4FMVA 3KL5A 5EULV 1E7UA 3NCYP 3COOA 2F8IA 1O0VA 3LRLA 1ZANL 4EXKA 2VLJB 3CHSA 2H6OA 1Z5YD 3OGCB 2O61B 5KYWA 4AYEC 2CUHA 4AL8H 2OCJA 4WTQA 2UYLB 5JLZA 3FH7A 1DQQB 4Y16D 5F7EH 1QWNA 2J8UE 1UM4H 1W72A 1FVCB 4XWOC 3UGEA 2IGFH 1AHWA 2X70A 3M86A 4GW1A 3T6ZA 5JXEC 1SVZA 1VENA 1AH1A 3UAFA 4ELMB 4WU7B 3EYSH 1QTPA 1XX9C 1X7SA 4GT0A 1NBZB 3P0VL 1S8DB 1TKWB 1RZKC 2AXWA 3AY4A 1FH2A 1FG2B 2G5RA 4GI9A 1EJ8A 3BWUC 2QQQA 1RURH 1H3XA 1U2YA 1CXLA 3A6CH 4ALAC 3LKSA 1QBLH 3BKCH 3B3IA 5C3TA 2AJUH 2NPLX 1T1ZA 2ZKHL 4F1ZA 4FA7B 1VB9A 1Q4NX 3O11B 4IQHA 2GABA 1AIZA 4O02L 2NY6C 2ZXQA 1Z9MA 4FNTA 3ETBJ 3G6AB 4FP8H 1KGYE 4J3OD 4LSRL 4AGNA 3MRBA 4R0LC 1RVFH 5C7XH 3N1QC 1CT8B 3MV8E 1QA9A 4APQA 4KJYB 4N2CA 4ZMAT 3TFBA 3U9UA 3K46A 5GZNA 3RPIB 2UX6A 3O9WD 1CB4A 1NANI 1EZVY 3O4LA 2FUQA 4OCYL 4CSZA 1QATA 1X6NA 3VD9A 4N8VG 4TF4A 5F0JB 1G0XA 4HKZB 2Z31B 3DDFA 4YDZA 3O41A 3KHOA 2H3NB 1NUNB 4NP9A 3ROOA 3JWNG 5DZ9A 2VJ0A 1CGSL 1IZJA 1SXZA 1BIIB 1V8HA 3ZGHA 3C2AL 2GUOA 2BHFA 4UB0H 2V5TA 4APXA 1OAKH 4XB3A 4WWKD 5DHVA 1X5KA 3MCYA 1MHPL 2E9BA 5JIMA 5SX5H 3FYEB 1HWHB 5D71H 2A7BA 2J1WA 1QPPA 4WI6A 3SE4C 1INEL 3FN9A 5I19H 3HC2A 4KO5A 5DO2C 4PLJC 2Z7WA 5D7KD 3DLQR 4YSOA 4JY6B 3O2WH 3WUWA 2GJ6B 3OX8B 2XPGB 4NHCL 2O5NA 3NEEA 4KRPC 1UQSA 1FL6B 4NWUH 4GW4B 3V95A 2WXMA 1DBJL 2VMCA 1J86A 4QHUA 3Q2VA 4LESA 2CBOA 2I25N 3MRGB 1ITCA 3S3DB 2VN3A 5AZ2L 1J5IA 1OAXH 4GRLA 5LQBH 3RQ3A 3ESVF 4W6XB 4XO4A 1Y7VA 4I2XB 1PJWA 2J8HA 3D39A 1RZPA 2KC0A 3JT2A 4GUQA 4YBHA 1MNUL 3AQYA 5EFIA 5HJGA 5D4HA 1XGRB 1CI5A 1U3YA 1WIOA 3O81A 4HCRA 1JGDA 1NICA 4JO4L 3ILQD 1V7ML 3CN1A 3IU3B 2YUXA 1ZEAH 1MWAB 4MMZA 5IJCC 1FNSL 1NDTA 2MQ3A 3GMQA 3KNBB 3HPLA 2V2XA 4G72B 4POZD 1TVDA 4NRZB 3D0VB 1GKEA 1I8MA 1AGEB 3DURB 3S3BB 3TN0A 2EO7A 1CD9B 4IMKC 5JDJA 3CXFA 1Q9KB 4ICWA 3R06A 5AB9A 3VWJA 4E5XA 2JELH 2C4FT 4L1TA 5HYFA 5JOPE 2R29A 3HI1B 3IJ8A 4PJFE 4NQUA 4XR8C 3BWZA 2YSSA 1JZGA 2RH0A 2MEJB 4JFOB 5EF2A 4JKLA 3OHMB 3MO1A 3VGAC 2RTTA 3KCPA 4EI5D 1YEJL 3ZL1A 4IDJH 5CLYA 2B1HL 1N59B 4QTHA 4LIQL 1R9FA 1R0AH 2XBZA 1D5IH 3FO9B 2CCWA 1MUJA 3D09A 4XMKL 4Y5XB 5FA3B 1PZCA 3HG1A 3MRIA 1ZIAA 4Y4FD 1OQXA 3MV9A 4QCIB 4WENB 3MRMA 2W38A 3TNMB 3VM5A 4JFZH 2V9UA 4YDNA 1C5BH 3JWOC 2FBOJ 5HHQA 4PJ8B 2VC2L 5FHAL 3QRGL 4YDLC 5SV4A 1JXDA 3WIFA 1FG9C 3C5ZA 2P5ED 3PWNA 2VTFA 4ZQKB 1CGXA 4MFHA 4EN3B 1TLKA 2ZSVA 4G70B 4YFEA 3WTTA 3KPLA 1XGQA 2FATL 3WV0A 2OK0H 4GG8B 2YD6A 2WY3B 3T0BA 5BS0D 1FI8C 1HYSC 1E8ZA 1NAMH 2F8VA 2X89A 4NZTH 3NIDE 5C0AA 3NGBC 4Z7AA 4XVJL 4Z7NF 1L5GA 2VQ1A 1Z5LB 1MRCL 1MRDH 4JCWA 3CK0L 5GHWH 2MQCA 1SDYA 3LIZL 3AB0C 5C6TL 4N1HB 4YH6A 1N68A 5FF6A 2AAVA 3ULSB 5L4FA 2PCXA 1OVZA 4PRPB 4TUKL 5LBGA 5FDYA 4U6XB 3B2UC 2BP8A 3CZJA 3AXHA 3KYKL 5AVYB 1JL8A 5E2UL 4UM9A 3MV01 2IOIA 2JK5A 1PX4A 3AREC 4NPYA 5DQDH 3QJUB 3NVQA 3PIQB 1O7DC 4R8WL 2ZG3A 3V5DB 5CKAA 1J0KA 4NENA 3DBXA 3KPMA 4LLVA 1A4KA 2PW1A 2H1PL 4N25A 3D0AA 4KV5F 2Y7SA 2ZQKA 2GJ6E 2VGLM 3AACA 2MPAH 3ML8A 5TJWK 3TPUA 5KG9B 3HNVL 4LF3B 5FYKU 1YYMH 3OJMB 3F65A 5C9JB 1G4RA 2FJFA 4CVZB 5E7BA 2N3JA 2IGLA 3T77B 3QNZB 4QO1A 3R1GL 1UJ3A 4URKA 5IB3B 1XCTA 4JHAH 3H2PA 2BSRB 1LO0H 2APSA 1UD8A 4AV4A 3C60A 3K2UH 2FX8L 2BY1A 3IVKB 3GSWB 4U0QB 2K6WA 2ISDA 1PX3A 1E28A 4J1UA 4R7VA 3ES6A 1JZ2A 4KK5D 2OMYB 4DFHA 2XTSA 1KCUH 3QORB 4AYSA 4WLCA 4U7KA 5AW4B 1A6UH 3GXFA 4CMHC 1KB5A 1MPAH 2F53D 1YN6B 2LU3A 2O5XH 3I3EA 1U8PA 4XHJC 5DRZB 1IE5A 2XPYA 2D8KA 3U7WH 3MGTB 3LQMA 4APQC 1NGPL 1RZ7L 4GS7B 3PGFL 5DD0H 3QPQD 3VSTA 3ZE1F 1JF1A 2FO8A 3PL6D 2H3XC 3IDGA 4UMSA 3A4FA 4JJ5A 4Y9CA 5DZLA 5GGRA 3TXAA 1D5XB 2DQTH 2ICEA 4G5ZH 3BFOA 2EXWC 1J5OL 4FQIH 5JPMB 3MBWB 1S9YA 2EZ0C 1RJLB 3MLVH 4D0CA 2NUPB 5C7ZA 2GFBA 1GC1L 3AG1B 1GYAA 4J39A 2IC2A 5KVGH 1TZGL 4RRPM 1A64A 2R2BB 1YMME 3P73A 5DMKA 4P9HL 4PM1A 2VDRL 2R1WB 5H37G 1H6EA 4QJ5B 1G7LA 3OHXC 1XSKA 3D52A 1CWVA 3HIZA 5D72H 2EE2A 1IAOB 3NSJA 2OR8A 1Q1PA 1SQ2N 4O00A 3WKNA 2YD5A 5DD3H 4DAGH 4EI6B 3RGVD 2R23A 4ONGH 5E7FA 3F64A 4OD1L 2G4EA 3HRZC 3FT9A 3QFJE 4IKKA 3VXRA 3WN6A 2EH8L 3IXAB 4YHNB 1RU9H 3PXLA 3VX0A 2J73A 3DVFA 4L8SB 4OLYH 3HNTL 1J11A 3FUJA 4ENED 5IESH 4LHUG 5IK3B 2PWDA 3ECBB 4KXZH 4M8VA 2CLRA 5DR5L 1F86A 3KBFA 4Q9CA 1PD6A 3DJZA 1J1XL 3V0JA 3ZU8A 1T1XB 1A1NB 4NUGH 1B2YA 1O9ZA 4NQDA 4XNZC 5IMKB 3P30L 3U4BH 4LPYA 1I31A 3CH1B 5LWYL 4YVUA 5FUOL 4BIKA 5K9QI 2HTLD 3MX0A 3NQIA 5J6HB 5EEWA 3O2VH 5J4MA 2NDFA 4AM0B 5D1XA 3MYJB 5L7XH 4N3TA 1IL1B 4P5TD 5F96H 4X5QA 4TSBL 2D7OA 3CHQA 3V8CA 1INDH 5AEAA 1K8IA 2XC8A 2XG5B 4GP8B 4IRZL 1ZWIB 1EFQA 1Z3GL 3E2HB 3ESMA 3TGXA 3VI4F 3ZVVA 3C87A 3T71A 3OKNA 4DPBX 3GO1L 2D7TL 2P24A 4GAYA 4OQ1A 4Y9FA 2VZ3A 2V2TA 5CWSB 3W9DA 1B90A 4OAWA 3HVDA 5D7EA 1C9SA 2QPDB 5DMJB 3IETA 4BE5A 2R7EA 4IOSD 4OB5L 1IEBA 3CMOL 3EF4A 1N7ML 5GJSL 1S9XB 1KJVA 4I3SL 4NERA 3EZJB 2O5ZL 4FYTA 5JW3L 2EC9T 2PP7A 2E4FA 4JL1A 1XF1A 5AOLA 1NUGA 4FFYL 5DURB 5KJRH 3QQDB 4XVSH 1U9KA 3WFCH 3ZL4H 3RTQA 1MQ8A 2VW4A 2UVEA 4OVVA 3FU7B 2DAVA 1SEQL 1UFGA 3QI9A 5DZJA 1BQLL 1JNLL 1IFHH 1DJHA 1XGTB 4HAGA 3M1BA 4GMTH 4PJAA 5CBAB 2QTVA 4LPWA 3T1WA 2XIDA 4WV1A 2Z4TA 1OE1A 1YEIH 4G80B 3UPRB 1I7UB 2GK0A 2J1YA 3DK2A 1RY7B 5C6WH 3RFZC 2NSMA 5KW9L 5DRXB 4BQ6A 3RWEB 4MS6A 3EHBC 3ILDA 5IB4A 3ARQA 2OX5B 3QZNA 2JJTA 4F24A 1KIPB 3DI3B 2YAFA 1AXTL 1CFTA 4IEFB 1SJHB 1ES0A 4F8NA 4FCAA 3M8OH 1EBPA 3O45B 3ULVF 1D5ZB 2J1ZA 3BVNB 3DPBA 3L9YA 3QQXA 2QELA 1ZE3H 4JJHA 1RIUL 3LMJH 3MCKB 1AGFB 2ZOKB 1JV5A 1MW2A 2YKLL 3VI3B 2DYPB 5CLXA 3T9WA 3ZYJA 3D34A 4M6OL 3VM7A 2W81C 3LOWA 5IBLC 3RL2A 4JDVA 2WUBL 1ZLSH 1HESA 2Q5BA 2ZCLH 1Q8MA 2VLKA 3KPQB 3FAWA 1MWOA 1XF3B 5DU7A 1EXUB 3NFSH 4PJXF 1KJ3H 5HYJA 5AWNH 2JCCE 1FUNA 2JKIS 4PJDA 2ZX5A 3W5MA 2OQJB 3H9YA 3ZDYF 4BFOA 4JDTH 5J0BA 3D85A 3MJ8B 1P9MC 2YWZA 1FNLA 4Q9QH 1YEHH 2ITEA 4XPBH 4ZPTA 2P9RA 3FYIB 5SWSE 2BO0A 1OARH 4I88A 4UT9A 1PSKH 4X5XB 2AEQH 3VJ6B 1G43A 4L8DB 5D7JB 5TE7L 3CIAA 1FC2D 4UI2A 1JGEB 3CLFH 3TT1L 4MDJB 3F5WA 1HOCB 3BZEB 3VYNA 1TTUA 4RWHA 4HSAC 5E9DE 4QWWD 5IW1B 4Z8FL 5JPNB 4BZYA 4RAHA 4PFEA 4PJBF 1INQA 1CTOA 3X2QB 3DMMD 5GS2H 4EE2A 3C60C 2CLZA 3V0HA 3V4PL 5TE6L 4X6CF 5DYFA 1VZIA 4UTAH 3P9MB 4QYAA 5E51A 2Q9OA 3DPDA 1UM5H 4JFXB 4KKAC 3Q13A 4ZTPL 1YPZB 3MJWA 2ENSA 1GGYA 3MLRH 4MJIA 2BSTA 4Y1AA 3V5KA 4X42A 2BVUA 1U4EA 2VLJD 5HYQA 2WVVA 4AY0A 4KVCH 2XZQL 3RA7L 1DN0B 1YO4A 5FYLL 2J4WL 3FO1B 3S3SA 1S7TB 4QRQB 4XC1H 4HUWA 1AO7E 1MHHB 2PPDA 5JOPD 4JVUA 2CUIA 4QOKA 4WHYG 3TH3T 1XIWC 3MLWL 5TGBB 4BQCA 4KKLC 2D31A 5I71C 4HMDA 2OW7A 2X4SA 4TN9A 5EIQA 3BEWA 2H6UA 2ZSWB 2MHAA 3RHWK 2WZPD 1IMHC 5FWRA 4N8UA 5B7FA 4LQFL 3QEQE 3QUYA 3R4DA 1A7OH 2CO4A 2XETA 5LO7A 1KTLB 4A6YH 1ADQA 3D48R 4QRBA 5E8EA 1OD9A 1AZVA 3E1ZA 1UACH 1XBDA 3TA4D 3GM0A 3ARDB 3QIBB 3V4VH 4WO4D 1CDUA 4KDTC 3WIHH 2R2EA 5ELIA 5DJXA 3FUEA 3KXFB 2C9XA 1E5AA 1NMBL 2IDQA 3NJVA 1VFAA 4HSQA 1ZJBA 3BP5A 4JFEB 4N0UB 2BC4B 4K7PH 4OKVB 3HI6L 3Q9QA 4ZNEA 5BO0D 3FT4A 3W1ZA 1AGDB 4JQVC 3L5WA 3OZ9L 2SEBB 3GXMA 2ROXA 4P23B 1JDCA 4MD4B 3WI9A 3NAAL 3QUML 3ZE0E 2F58L 1DL7H 4YHIA 2VSMB 3EJZC 3IF1A 1G5GA 2QV2A 3MACH 3T5WA 4R3SA 5ICYB 4YSEA 3JVFC 3HBPA 4ETQB 3JYBA 3QCVL 3WIIL 3AROA 2DN7A 1KCSL 2Z31D 2NY1B 2F7IA 1D5RA 5EBMA 4G8GA 1OZTG 1DDHA 4NRYA 4HCFA 4L5FE 4AX3A 2AJ3B 1KXTB 1WEJL 5EUOE 4AENA 1YDPA 3MBXH 5FHBH 5E2TL 1MCFA 2ZTBA 1FNGA 5C07A 3HG5A 1LDPL 1XH1A 1HXYA 5H4ZA 2JJSA 5D2NB 2HFEB 1G94A 3IT8D 2AJYL 3CXHK 4PJ7F 4X9YA 4QNPF 2E59A 2CK0L 3ROLB 4U1HA 5CXPA 4YBQC 1RUKH 3SCMB 2ZWLT 2NXZC 3BQUA 4XI5C 2R27A 2GJ6D 2A6KB 2X5PA 1FRGH 2NQ3A 4OLWH 1JXKA 3ZTNH 4CA4A 12E8H 3P3TA 3K5SA 3NFPB 5E1AA 3WBDA 2FECL 4J3OF 5DK2B 2DQIH 1CLVA 3CFCH 2B1AL 5EOQH 5HHNA 1CFNB 4S0SD 1M7UA 5CSZB 1O7DE 4HXAH 1KTRL 2X42A 1N0LA 3TA3A 4A2DA 4B9IA 1Q9WB 3NCJL 1FIEA 4OCXL 2PW2A 2RD0A 3CXDL 4LCUA 5ACZB 3MV7B 5T3ZH 4YBLC 1JFHA 4OLVL 3RWIA 4CSTA 4HOWA 4PJ5E 3EOAA 4U6YB 1UVQB 4WV1C 3ET9F 4U1MB 1BYPA 4LL1A 3TLRA 5DJAA 3VTMA 2BSCA 4PTUB 1G7HA 1NCDH 4RAVA 4YHPA 3L9EA 4ZW3A 3GRBA 3PQYB 4JR9H 1T2XA 3PWLB 2Y1YA 3BUBA 3IKCB 4FTVA 3QH3B 8FABA 2E74C 5KSBA 1OK8A 2F74B 5D7HA 3ZHNA 4KJPC 3WKMH 4LLWB 5BVPL 4IGBB 2P7TA 4AK2A 5FPIA 3VFWA 2H47C 3E8UH 3RAJH 4GUPB 4JKPH 4XPHH 1BZOA 4HZAA 3WMQA 1BVKB 2QZQA 2Y07L 5HHVL 2VAJA 3BCFA 5AD0A 2C3GA 2F54B 3MRDB 4RFNC 3RZCC 2X2HA 4FI8A 2R0WL 5IFJB 3GWJA 5E5MB 1IEAB 4PJHF 3T65A 3UYOD 1WT5A 2NDGA 3FFDB 4EZKA 1A7PH 2OXGA 3B83A 1H6UA 4ZOAA 3CDZA 5JYMA 2YPVH 1DVFA 3QJXA 1EO7A 1PAZA 3WS6A 2W8CA 3G08A 5CD5D 1QQDA 4MXVF 3ZE2E 4NO5A 3QFJD 4UQ2B 2G0LA 4Y2DA 3IPFA 2HTKD 2IAMB 4M00A 3MRPB 3L2MA 5FWQA 1MHCB 4EN3D 5DS1A 3NZ8A 3ZR5A 5DS2A 1R47A 1SUJA 5JQIB 3H6AA 2Q8BL 2FX7L 3KLQA 1EFXB 1I82A 5JDSB 1JN6A 3UZQB 4ZS7H 2XKNA 4I3GA 4W9KC 4XN4A 3BGAA 4D9RE 4N24A 1ZPLA 2FYYB 1ACYH 4NN5B 2YSTA 3MRLA 4JRWA 5IMLA 4UQ3A 1UFUA 2LLNA 3BUDA 3D51A 5HVGB 4MA7L 4K7FB 2B59A 3X1GA 1JPFA 2XWBA 1U8HB 4OIIL 4XP5H 1PY4A 4FXGA 3JVGA 3CVHA 4NC0B 2R51A 1N6QH 2BS71 5TQ2L 1QACA 5CMAA 2BOBA 4QXWA 3UPAA 5GJTH 5DK0B 2APTA 5BW7C 3U0PA 3HCVB 1DVSA 1Z5HA 2WB7A 3O8XD 1WBXB 3PUCA 1F4AA 1S9VA 1QUNA 2DOCA 3LAFA 2OS7A 1VRSA 2P80A 3CHPA 1OT2A 2AS5M 2ADGB 5DUMH 1MCOL 4PHXA 3EH5B 4FQ1L 3MRKA 5G55A 2XTJC 3OAYK 1BZ7A 4XPTL 4ERSL 2QPFA 4UQBA 5BV7H 1YAIA 3KW8A 3NZHL 3RWJA 1ZGLP 4QRRB 4UT6L 3BHBB 2YA0A 2OL3B 3OPUA 3D18A 3IRPX 5GGVY 3DX3A 4OBRA 1E27A 1WAEA 4JQXA 4HH9B 4NT6B 4NAQA 4R96B 4ZW7A 5JIHA 3WXWL 2F2HA 1V3JA 3RE0A 4BWTA 2Z7YA 1L9PA 3KM2A 4XCNB 3Q48A 5DHXB 1VACB 3UYRL 4NNPL 2XZCL 4XWOD 4NN7B 1YY9C 4WHTB 1NAKH 3LRGA 2VDQH 3QUYC 2FNWA 4L3AA 4TLTA 3HG3A 1AQDA 3VFSA 2G3XA 2QVMA 5CJOH 4JANB