1ILSA

X-ray crystal structure the two site-specific mutants ile7ser and phe110ser of azurin from pseudomonas aeruginosa
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
AECSVDSQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of the two site-specific mutants Ile7Ser and Phe110Ser of azurin from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Metalloprotein
molecule keywords AZURIN
total genus 33
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1995-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ilsA00
2W88A 4DP7X 1KCBA 5D4HA 1XB8A 2HRHA 2FTAA 2HLEB 5IY5B 1NIFA 2UXVA 2FNWA 3H56A 4M4RB 1X9RA 1KDIA 4BDVA 3TU6A 2BW5A 5B7FA 1CURA 5TK2A 1JZHA 1L9OA 1YLBB 2DWSA 2IWKA 9PCYA 1IUZA 3MX0B 1T5KA 3FU9A 1PCSA 1OCCB 1QNIA 2GB2A 1RKRA 2PP7A 1PLAA 2UXTA 2WO2B 2X87A 4DPBX 4BK5C 1GS6X 2Q5BA 3QJVB 3G5WA 1JZJA 1URIA 4GY4A 3OM3B 4YVUA 2GHZA 2JFCA 3SBQA 3CVCA 2FQFA 4KNTA 4DP6X 5B1JA 2QPDB 3T6WA 1RCYA 4GXFA 2IDQA 2PPDA 2XWZA 4KNUA 5B1KA 1KCWA 3WNIA 2CAKA 3TBBA 3DTUB 2P80A 1EZLA 3ABMB 4YSOA 4AZUA 1IKOP 2GBAA 1ASQA 4DPCX 2PLTA 1JZIA 4X4KA 5PAZA 1OCOB 4GP4B 3CG8A 1SF5A 1PF3A 2VM4A 2PCFA 3OMAB 2XVBA 1OV8A 4DP5X 1NIEA 2UXGA 2I85A 4HCFA 7PCYA 3BQVA 4K9JA 4KOCA 3ZDWA 1A3ZA 1JZEA 3GXUB 2YXVA 2Q9OA 1AACA 5B1BB 1NTDA 2BWDA 3FSVA 1CYWA 3C75A 2PPAA 3AY2A 1B3IA 4L0PB 1ASOA 4YSAA 4YSQA 5I5JA 1HFUA 3WI9A 1AS7A 2E86A 2W8CA 5AFAA 3HEIB 1PZBA 1JERA 1ETJA 3IN2A 4G70B 3NJIA 1RZQA 2GC4C 2P80D 1AZBA 4A67A 1AG6A 3QJSB 4GP8B 1IBYA 2CALA 1AG0A 1J5DA 4P5RA 4QLWA 1OF0A 3ZX1A 3NJJA 3ERXA 3NP3A 1J5CA 2I7OA 2VM3A 3QJQB 1L9RA 3HB3B 4DP8X 1BEXA 2PP9A 2EIKB 1GS7A 8PAZA 1R1CA 1QLEB 4M3HA 4NERA 3U25A 1SJMA 3FSWA 1MZYA 3NJGA 2XV3A 2IH9A 1ILSA 4E9YA 1NIDA 1OE3A 4HHWA 1NIAA 1PMYA 2YARA 4E9XA 1ASPA 1JZGA 1NZRA 2DV6A 2YXWA 2TSAA 4G7RB 3TA4D 2EIMB 3N55A 1AIZA 5TK4A 1GYCA 3BVDB 1NIBA 5B1AB 4DP1X 2FQGA 4YSPA 1GY2A 2ZXWB 4F7KA 1KV7A 1ZV2A 1BQ5A 1ET7A 3FPXA 1NPJA 1JXDA 3IBOA 2IDSA 2BZ7A 2OCCB 1TEGA 3UABA 2VN3A 1ZIAA 2BZCA 5D4JA 3X1GA 1V55B 5ANHA 2GC7C 3PCYA 4GP5B 1SF3A 3IN0A 3AG2B 1RZPA 1SHXA 4EF3A 4ENZA 1SFDA 3QJUB 3T6ZA 2H5UA 2R7EA 2AVFA 4PCYA 5AKRA 1PZCA 1DZ0A 4BWWA 1HAUA 2YAEA 2CCWA 3NJFA 4E9VA 5FC9A 4YL4A 1E67A 3SBPA 1SHWA 2PP8A 3FQ1A 3FYEB 3S8FB 4RH4A 4N8UA 1HAWA 1AOZA 1AR1B 5EHFA 1BQRA 1BQKA 2HRGA 3CDZA 3PAVA 2UX7A 5I5IA 4A66A 1WS7A 4YSUA 2XX0A 1PNCA 1PLCA 4JHUA 2VW4A 2EIJB 4TXVB 2DWTA 4HHGA 3OQRA 2CJ3A 1WS8A 5I5MA 1ZDQA 4YSSA 2R7EB 3NJHA 3FQYA 3N2JA 2BWIA 3GYRA 1QHQA 2DYRB 2XXFA 2AZUA 4YVNA 3T6VA 5I6NA 4E9QA 1NWPA 3JTBA 1NWOA 4KO9A 1AS8A 1AQ8A 2AANA 5F7BA 2XYBA 4A68A 3V9EA 3WNJA 2J56A 4FAAB 1MZZA 1OOWA 4HIPA 5I26A 1FFTB 1BXAA 1V10A 3CZUB 3NJKA 1NINA 5PCYA 2QT6A 3CDZB 1XB3A 2WSDA 4NAJA 4WKXA 2YAOA 3EH3B 4YSTA 1WA2X 1WA1X 2UX6A 1PNDA 3X1EA 2IWEA 1PAZA 6PAZA 2DYSB 1L9TA 2JXMA 1JXGA 1TKWA 4BXSV 1M9WA 4ZK8A 1AS6A 2CUAA 3AW5A 3QJRB 4F2FA 2OV0A 5I28A 3X2QB 4UAHA 2FWLB 4DP9X 4DP2X 2GSMB 4A2HA 2QDWA 1SDDB 4W9ZA 2JKWA 2IWFA 3UACA 4G71B 4E9TA 1W6LA 1ZPUA 1E5ZA 3PAUA 1L9QA 2N0MA 1JVOA 1UATA 1A65A 4KNSA 3UGEA 2H47C 3QPKA 2Y69B 4HCIA 2HZHA 1FWXA 2A3TA 4MFHA 3FSAA 2XV0A 3AZUA 3NSYA 2HX8A 3WKPA 3NYKA 1F56A 4BWUA 1A4BA 2IDFA 2XX1A 3X1FA 1GY1A 5I6OA 2FT6A 2QPEB 2RACA 1N68A 3L45A 1JVLA 2AZAA 3S3BB 4AX3A 3S3CB 3WIAA 2B08A 4DP0X 4AKOA 2Y1AA 4G7QB 1MG2C 4YSEA 4W1TA 2PPEA 4G7SB 3ZBMA 1A8ZA 1JOIA 3S8GB 3KW7A 2NRDA 2HX7A 3FU7A 3UAEA 1J9TA 4KO5A 4A2EA 1W6WA 1TU2A 3D12B 3DKHA 1SDDA 2B3IA 1AANA 3FU8A 3V9CA 1BYOA 2XV2A 2CBPA 2XXGA 1KYAA 1PLBA 3QJTB 1GSKA 1PY0A 2PCYA 1AZCA 4AI7A 3T9WA 2WO3B 3S3DB 1WAEA 1ZDSA 2VMJA 2GIMA 3PAZA 1IBZA 2FT7A 4E9RA 1BAWA 3ABLB 3X1NA 3TBCA 3NSCA 1BXVA 1AZUA 5B7MA 3ZIYA 4DP4X 4AKQA 4Q89A 2FT8A 4CSZA 3SBRA 4CSPA 2TSBA 1E65A 1BXUA 2GI0A 1WA0X 1L9PA 4KO6A 3NP4A 5E9NA 4JKNA 5D4IA 1L9SA 4HZ1A 1J9QA 3FT0A 3ABGA 3NJLA 1XB6A 1XMEB 2VW6A 2IDTA 3CVDA 5B7EA 2I7SA 3FPYA 4F2EA 3FU7B 6PCYA 2VSMB 3MBWB 1KBVA 4G72B 3OMIB 5AZUA 5I6KA 2IAAC 4Q8BA 5A7EA 1SFHA 4NB7A 4BWTA 3X1BA 7PAZA 2XUWA 4QKTA 1FA4A 4WTQA 1DYZA 3PPSA 3JT2A 3ASOB 4AKPA 3PXLA 2UXFA 1N70A 4N4YB 1MG3C 3NJNA 3SQRA 3IEAA 1NPNA 1GR7A 4A2GA 2J55A 3RYMA 3IE9A 1J9SA 1E5YA 1CC3A 1AAJA 3FYIB 1ZIBA 2BO0A 4YSDA 2MRYA 1V54B 2YAQA 2XLLA 3FQ2A 3GDCA 2EILB 1NICA 4FA7B 2FQEA 3AG1B 3WKQA 4E9SA 1PZAA 2MTAA 3FS9A 2YAMA 2YAHA 2FJSA 1E30A 3OMNB 4PAZA 3DIVA 4E9WA 2OJ1A 2YAFA 3H4HA 3QQXA 2X88A 1EHKB 4KOBA 1I53A 1KDJA 1GS8A 2J5WA 1VLXA 1SNRA 1KBWA 3EHBB 3ABKB 3WG7B 2EINB 3AG4B 1ET5A 4BXVA 1A4CA 3EH5B 1IC0A 2PPCA 2VW7A 1GW0A 1NDTA 2PPFA 3FSZA 1ADWA 1J9RA 4DPAX 2J57A 2VSKB 1CYXA 2HXAA 5B3SB 2BP8B 3OD3A 2DY2A 1KGYE 3AG3B 1OCRB 5F7AA 5B1JC 1CUOA 2IDUA 2BP0A 3PLYA 2IH8A 3TASA 1MDAA 1W8EA 4HALA 5LDUA 1BYPA 1ET8A 4YSRA 4A2FA 3T6XA 3NSFA 3UAAA 2LLNA 4P5SA 4HCGA 5I6MA 3EF4A 4BDVB 4KO7A 2HX9A 2YAPA 3NT0A 1JZFA 1OCZB 2ZOOA 2ZONA 4GYBA 4A2DA 2YQBA 3KW8A 2QDVA 4UANA 1A4AA 1ILUA 1AZRA 1X9UA 1M56B 4YSCA 1JXFA 2FQDA 3UADA 1TEFA 3NJMA 4UF7C 2ZWNA 4JHVA 2AFNA 2BP8A 3ASNB 2BW4A 2H3XC 3T71A 3CVBA 3H4FA 2BHFA 4HAKA 2XU9A 1ID2A 1OE2A 3NSDA 5I6PA 2BP0B 1M57B 3EH4B 5I6LA 1OE1A 1AZNA
chains in the Genus database with same CATH superfamily
1UOKA 3ARVA 4GG6F 2CK0L 2H4EA 4FG2A 3WTSA 2AEPL 2VDOB 2HRHA 4OIIL 1ZXQA 4QOKB 5EC1A 1PG7W 1JHTA 4ACTA 3EZJB 4HUMB 4XN1A 4WEBL 1KMGA 2VJ8A 1IGMH 3CFNA 1AR1D 5C0BD 3CGTA 2WJ7A 5K93A 1OZUA 2AXFB 2QJDA 2CXKA 4AIEA 2OQJA 3QIUD 4UI2A 2A1WH 3RWJA 4LLMA 4JKMA 4N0FA 2WLZA 1QLFB 3M1BB 1CD0A 1UKSA 5CSGA 5TFSH 1U3ZA 2WZPA 4YVUA 2YUWA 3CIQA 5DK0B 2FQFA 3WXVH 3EGSA 3MRKB 4PJEF 3U48A 2X1XR 1JTOA 3SQOH 1TJGH 3WGVB 2WXMA 3E8VA 3VXUB 4HUUB 2Y5QA 4X0KA 5IM7B 1FGVH 1HEZB 5KAQG 2OXGA 1YNKL 4CU6A 4N1HB 3BYTA 4HUVB 5CCKL 3HAEH 1D6EB 3B2XA 4GKSB 4M4RA 5T3ZL 4AL8H 5T5FL 2ED9A 3MRJB 1HK6A 1SF5A 4PRID 1KXQA 6TAAA 3APDA 1QUNA 2E9IA 4YDJB 3K72A 2WZ5A 1OV8A 1R5WA 1FFOA 1I8UA 5F6IB 1J1OH 4JB9H 1MLBA 2FECL 4TULH 5M7QA 1BVNP 5C0JB 4PJCA 3MV9E 1SJHB 3GSRA 5D2NC 2E8YA 2EXTA 3AY2A 1HOEA 3Q48A 4JFOB 2Q10A 4J3BA 3MRPA 3VMNA 1IBHA 4Y4HA 3Q2LA 3NIDF 1IBBA 3FQ4A 3HMXL 4JAMB 3SB3A 1GYAA 3EYOA 4Y16D 4ZFQA 1U3HB 3EYQD 1NMAL 2NOYA 5F7WC 1K8DA 4FEMA 3IN2A 1N5YH 2W9EL 2YRLA 1NGQH 4LVNB 4N0YH 1RUPL 5LQBL 4YDNA 1TG8A 4NO0A 4TUOB 4XNMB 1E4HA 1MCRA 5JOPD 4P5RA 2DAVA 4XP5H 5F0PB 3NCBB 3OGCA 3S96B 4CILA 4YZFE 4FQ2L 4GFXA 1HWHB 3JV6B 1XGYH 4XB8A 4R4BB 2Y4SA 1L9RA 1NCJA 3MSPA 1FL5B 3FB8A 2HTLD 3QJFA 4O58H 2FLBT 4UQ9A 3B4NA 4LDLB 3INUL 2QGCA 4XNUH 5MENE 1CYGA 3QDJA 2X89A 1A1OB 5K9QG 3FCGA 1A9EB 1J05B 4KGLA 4FZEL 5B1CA 1A4JA 5JXAH 1OKEA 4G9FE 4OZFH 1YN6B 3UROR 5CEYA 4JM2F 2JJWA 3VNYA 1D5XB 1AQKL 2AGJH 4LNRB 1NIDA 3EFDH 3SDXF 2EDTA 2OMZB 3Q44A 4PJAA 3WHE1 4PB9H 4NO5A 5EZLA 3V4UH 4NYLB 4BD4A 4U6XA 4ZO7A 1BVKB 3LEVH 5TQ2L 3F85A 1AJ7H 1KUMA 2C9RA 4IRJD 4POZD 4AM0B 4ZAKA 1UOVA 1NIBA 1IAKB 5B1AB 4GRWE 1YEWA 4LSUH 3MKGA 1D2PA 3BAEH 2WXLA 3KWUA 3WFHB 2MNWA 1BIHA 1M7XA 1A3LL 2VZUA 4IOSA 5ETUA 3S5ZA 5GHWH 2AKRA 2IANE 4C4KT 1ZLSH 4UUJA 2NY6B 3KM1A 2WVUA 1T7YA 2Z7YA 3X1GA 3JWOC 2APXA 3QZOA 3FQRB 3FH8A 2APFA 5HTSA 1WWWX 4IQHA 2XKNA 3QFGA 5DWPA 4J3WA 3TBYA 3P4MA 5JLZA 3IJ8A 3TH2T 2Y7SA 1Y7VA 3L3OC 2Q3ZA 4KMTH 2E75C 1GHFH 3IDIB 3S35H 4UNVA 5B3JE 1PY4A 3BSZH 3VMPA 1G7MA 2YAEA 1IGYA 2Z8WC 1FVCB 3QFDB 2PP8A 4OZFA 1JE6A 3IETA 5FYLL 4GIPD 4L37A 3BWUF 4OM1H 1AOZA 5FKPA 2XIIA 5I1EL 4NC1E 4OGAD 5BS0D 3CE1A 1UC6A 3K7UA 5I5IA 2FBOJ 4LLYA 3IDGB 3ATBA 1C8QA 4QRRA 4QXVA 1YA5A 4JRXD 1J1XL 4ZMLA 2OMWB 1JNLH 2CG9X 5HY9B 3H9HA 3TO2A 1OCWH 4OCSL 1CF8H 3TF7C 3BDXA 2DS4A 4OD1L 1NFKA 3IJSA 1Z6JT 1PVHA 2NY3C 2D0HA 3CU1A 3L9BA 5DD6B 2GEQA 3ASWA 4Z0BH 2OJZL 4RDQG 3CVIL 2VXSH 3SDDC 1LNUB 2BH0A 3BPOC 4IYKA 1B90A 4PJ7F 2DYRB 3CZEA 1DQLH 3SO3C 3ETSA 3FOLB 5K33A 2IBZX 1G4RA 5CHNB 1OAJA 3KYNB 1JD9A 1AQ8A 5FUZL 5CCHE 1XTLA 2E0PA 5EZPA 2HFEB 3SKNB 4UV4H 1U33A 4L3FA 4OLZH 2YK1H 1NINA 4OH2A 4Z95H 1HINL 5FV2A 4OQTH 2F1BA 2R1XA 4X6BA 2QZ5A 4WTZA 2XWEA 4FQXB 4GT0A 4YSTA 3E2HB 4L4JA 4KXZH 1OF2A 3D1MC 3VVWA 1PNDA 4NBYB 4ENEC 4WWKA 2DQHL 3HNVH 4MNGA 3C6LC 1EVTC 3VG9B 2G9HB 3X13B 3HCVA 4XNYL 2IMNA 3C60B 3DGDA 3T2NL 2VDMB 5C97A 4WNQA 4HDIA 3O2DH 2H8PA 4L8DB 5E2JA 2IG2H 5C0CE 4MS8C 2J88L 4WV1B 1VFUA 2G5RA 4JFDE 4NFCA 5KBDA 3DX0A 3P9WB 5DO2C 1TTFA 1QSVA 1FSKB 4K94C 2ZXGA 3QUMA 1ZPUA 4GB9A 4MCZB 2YD3A 3PAUA 4URKA 5CD3B 5DQJA 3CHQA 3BRDA 1DQQB 3HE7C 3QPKA 4IU3A 5FAAA 5E2TH 3THMH 2VJ0A 5DFVD 2W0FB 4R7DB 4WTXA 4O51A 1YEDB 2JJUA 4H8WC 4Z3HA 2OMTA 1UWGH 2O6EA 1KG0A 2HYMA 3TV3H 3G08A 1NM4A 4RRPM 4KKAD 4ZFFA 1CI5A 2J44A 5H2BA 3S3BB 1C12A 4XXDA 5HDBF 1F4WH 3OPZH 1UXWA 4LQ1A 1Y6NR 2Y1AA 3P4OA 3U0WH 1JPEA 3ISRA 1JOIA 3ZKNC 3HNSL 3STBA 5DJYA 2FR4B 3QDAA 2FH8A 4WJ5A 3VFNB 1BA9A 4TLKA 1UVQB 2P7TA 2QL1A 3PY9A 2XV2A 2CBPA 2FAUA 3MV11 4XR8C 3FZUC 5C08A 1KYAA 1OLLA 4JO4H 2L3BA 1S7WA 4LPTA 2QEJA 3TP4A 2PCYA 1DVFA 4PV1C 4FGMA 3ZDXF 1KOAA 2GIMA 1IBZA 1BAWA 3B56A 3ABLB 4O2FB 5F21B 3OWEA 5ILTL 3RTLA 1N7MH 4L3CA 3GSWB 3ZIYA 3A0OA 5TDPB 2FT8A 3P73A 4PJBF 1ZLVH 2OR9L 2WW8A 2DQEL 2ESVD 4HHAB 5EUKA 3OKNB 3MR9B 3QWQB 1BPVA 1L9PA 3BEVB 4MKMA 2ETWA 1QW9A 3SE4C 4GLRI 2QKIA 4YXLL 3IAGC 3QR1A 3CN4A 1UD5A 4R6UA 2W94A 2VW6A 5DK2B 5GRZA 5AUMA 1N0LA 2ZWZA 4HISA 3OZ9H 1CFBA 1OWRM 2FCBA 4KJWD 4BH7A 1QSED 3GSNL 3F58L 5I0VA 5E08L 3WFEL 2XUWA 3BAEL 4WTQA 3HN5A 1AMXA 1F4AA 5BS0E 4HPOH 3P3SA 5AAMA 4XNBA 3L7EA 1NA8A 3LVEA 3JTSB 5I1KL 1YUHA 2VUOA 1J0IA 2HRPL 3GB7A 4AZ8A 3LHPL 1P4BH 5C0BB 3UCRA 3CVHL 1MREL 3RIAF 2GAZA 4RISH 3AT0A 2DQCH 1OGAB 3L9YA 4WSJA 5CBEB 4OTXL 3EDDA 3FB6A 5CIPH 5HDRA 2YLHA 3GM8A 2OTUA 3T0VA 1J0ZA 4EXKA 1NCIA 2LOEA 3LHAA 4XWGL 3I02B 4IRSC 3SIKA 1ZPLA 2YPKA 1I1YB 3GLAA 3TXAA 4LAQH 5F1SA 3GWJA 1KBGH 3DIVA 3BT0A 3FBQA 1WCBB 3RY5A 3WFCL 4PG9A 2G2RA 3QIWB 2FEEL 5AZEH 4X9BA 4PRDB 4KOBA 2OCFD 1NANH 5EBWB 2VZVA 1R3IL 5IVZB 4H1LH 2V5RA 2BWQA 1A7RH 4K55A 3VCLB 3BP6B 1FGNH 3VSUA 4YS4A 2R2BA 2Z65C 3DURA 3RDTC 3AG4B 1UB6B 2YC1B 3K0WA 1CMOA 1ZJAA 1XSKA 4R83A 3AUVA 2WP3O 1I1AC 2VW7A 4URTB 5ELIA 3SYCA 5ALBL 4Y4KD 1JZ8A 5CUSH 1OCWL 1J9RA 2FJHB 2PKDA 3C6EA 3ARFD 3D25A 3EDEA 3MV7A 3E6HB 3OAUH 1KPRB 5I73B 3BZDA 3D7PA 2DY2A 3L08A 5B39B 5IKCB 4LB8A 5AW1B 1IL1A 1HHGB 2F61A 4EIZC 4YDZA 2IDUA 3O4OB 1AP2B 1FG2A 2HT4C 3EO1B 3PLYA 3RWGA 4N2LA 5FGCE 1J1PH 3BP4A 3VFTB 5D7JA 3BH4A 1MCIA 4MWFB 3BCFA 4XNDA 3KVPA 1ZE3C 5CWSB 4ZFOA 4WSKA 4L5FH 2A9DA 3A67L 4BFFA 4FXGC 4YHPB 1Z5YD 3ATDA 4KO7A 4XPGL 1GAFL 2R0LL 3P4NA 4DSYA 2J8UB 1UEYA 1OL0A 2VR6A 4RRPG 4XN8A 3F01A 4GJTB 2JI2A 2W0PA 4Y4KA 3WHXB 3VW3H 2QDVA 1PD0A 4HFUH 3MNMA 2W59A 4X6CE 5E94A 2AK4E 3P4LA 5CEZD 5KZCD 1RZGA 2BIHA 3DYMA 5E6YA 4H1LA 3S4SA 3MLWH 1HVXA 2WUBH 4PJAF 4WIQA 3TOPA 43C9B 1TEFA 4AT6B 1P5UC 1QLEL 5T1LA 1RJCA 5D2NE 3I9AA 3QH3A 2H3XC 4BFNA 4F37K 3ZE2F 2J25A 2DTMH 4HAKA 1IARB 4LPWA 4P9HL 3EYSH 1WDAA 2J88H 3O2VL 2A2QT 1FYTD 2HG5A 3ESMA 3VTTA 3MBXL 4NUJB 4BFBD 2SEBB 4NO0D 5HYIA 4C54A 2W81C 4TQHA 1IQWH 3HS9A 3MUHL 1ZEAL 3TIDA 2WC7A 1I7TA 3GSNB 4O2CB 5EO0A 2XQYA 1X4YA 1M1XA 4NQQA 4UDTB 5T3XE 2ZWKA 3BMWA 4HQQH 4D0DB 2ZOKA 1CDUA 4ONHA 2IWKA 1FZKA 3DSNA 4RGND 3BDBA 4UT6L 5D7SH 3ZHFA 4XVUC 1MXGA 1DE4A 1D5RA 4W4OC 4LLDA 1A7NH 2VO8A 1BECA 1MLCB 5JOEA 2EP6A 2OA9A 2ZXCA 3GTNA 4K9EL 1AQDB 1Z1WA 4P0DA 3V8OA 4C4KO 5KN5A 4PRPB 3ULVD 2BFVH 3L3GA 1IZKA 4DIXA 2ATPA 1OHZA 2QPUA 1RCYA 4GXFA 2YOCA 3RPIA 3P0GB 4OCYL 5HYJB 4YHNB 2OTWB 3OVUB 3NK3A 3TNMA 4MCYB 3CLEH 3B3IA 1QD0A 3ARTA 4WEEA 2JF1A 1G6RL 2JKLA 2ORBH 1SXAA 4FXTA 5CD5D 1JZIA 1WZMA 1YEJL 5GGUB 4EI6B 1HHJA 4PJXE 4NQCD 1ZHBB 2I24N 4U0QB 2QSCH 1SHSA 3MRGA 4HJJH 4NPYB 2EIBA 3VXMA 2AXGA 1YYMH 1P1ZA 4NWUH 3V0WH 4NX0A 2RR3A 3MLYH 2I07A 4FLRA 2D7TH 5HGDA 3ZDWA 1K8IB 2VDKL 3BI9X 4MLIA 2ZKHH 1YZZA 3FSVA 4M7KL 4RBPH 1U8CA 3WJLC 3MQIA 2DTSA 1CD1A 2VDNH 3GMNA 5GIRB 5SV3A 4ADIA 5C08D 4YIQB 5D6DA 2XPGA 2NQDA 2XWBA 4NZTL 3FTVA 1HFUA 4JHWH 4L4TB 2XPZA 3T2QA 1NFDB 3BRGC 2NY1C 1WD9A 3QZMA 4GKNA 1G6VK 4KXAA 1OAKL 4PBWD 1AZVA 4JMNA 4RMTA 4XHQA 5HHNA 4ZW8A 4WEUD 1RZQA 4R0LA 3U4BH 5D7KE 2NXZB 3IU3A 1BGXL 3M7FB 2ZIDA 3KCPB 2H32H 2F7IA 4HPOL 1A21A 1J5DA 3LKNA 4NLHA 2V8MA 5GISH 1IC5H 2RAMA 4FZ8L 5D7LD 5IBUB 2ICWB 3MJ8A 1HYSC 2A77L 4BA8A 2FB4H 3GSUA 3OMZA 3QORA 4AK2A 3ARDA 4F7PB 1FNSH 2VM3A 5D1ZA 4DTGL 1O5PA 3QDGE 1R3JB 3L2LA 4IRJA 4PTUA 3G5ZB 3ZL4L 4GW4B 2HFTA 3HZYB 4KRMB 3MNVB 4P5MA 4QGYA 1SJMA 1WZ1L 1Z9MA 2APTA 4E9YA 3KLKA 4PJXA 2DQDH 2GPZA 4HHWA 2VDRL 3PNRB 4KK6C 1GGIH 2V4LA 4WI0B 3WFCH 1O6SA 3B9KC 3SGKA 2JQAA 4QI3A 3LIZA 4JBSA 1CU4L 5EOCL 1JZGA 2JKRM 5AZEL 2TSAA 4GAYA 2VQUA 3T3MF 2QSTA 5KSBE 3RI5F 1WLHA 2K9FB 3OXRA 3MLSH 4GINA 1GYCA 5I76A 3NZHH 1SMOA 1T22B 5J11B 2NMSA 1I8LA 4CVZB 4NKOA 4PUBL 3GJFA 3H9SB 1T5WB 1U3JA 1EO7A 3CZLA 3DO3A 3RWEA 1KLFB 3TFBA 25C8L 1OSPL 3HMXA 2H2PD 2J5LC 4JFZL 1MW2A 1ZIAA 1AXSB 2BSDA 5T1LD 1HZKA 4HOZA 4U6HB 4HJ0C 5JZ7D 1G1YA 1P5VA 1UUNA 4PJ9A 3OJDB 1QSFA 1IGTB 4TVPD 4EF3A 4NUMA 3DUUB 3FF8A 4OFQA 1THCA 5DRWB 1ZVSA 4LCWB 1HIML 1WQVT 1OAYH 2J6EA 2DQMA 2WUCH 5K1JA 4PP1C 3D0LA 2D7PA 5DSCA 1QAWA 3NCJH 4ZO9A 4YHKL 2EICA 2D0GA 5DU7A 5SX5H 3WSQL 5H4YA 2MOQA 4MD0A 4WO4B 3O9WB 3FQTB 1JYVA 2H45A 3O6ML 4LHUG 2Z34A 4GW5B 4YFLF 1XXDC 2F7QA 4KTDL 5C0NC 1WISA 3O6KL 4FQLL 4NRZB 4AEIL 1YNTF 2HRGA 3CFKA 3FTUA 2VLJA 4HKBA 4M03A 3MFFB 2JTDA 4JFFD 4JRXA 4GFTB 4NT6B 3EO9L 4QYOB 4PJFE 3QULA 1PNCA 5ECGA 4KJPC 3GO1H 4G1EA 5LHDA 3MLWL 4PJHB 2EIJB 4TXVB 3RL1B 3L4UA 1CG9A 1JZ4A 2DWTA 1IKFH 3QIUC 5D1ZI 2Z8RA 4HD5A 4XB7A 2OZNA 4HOWA 4XMLH 3EJYD 1ZDQA 4L8CB 4FD0A 5EEXA 2BXYA 4DUWA 3G5XA 3L7FA 5EU3A 2HFGH 2BNUA 3JV4A 3MBXH 3AC0A 3UBHA 2BVOB 4KQ3L 1U6AH 3JTBA 4KZEL 1CCZA 3H42H 3T1FA 1PYWB 3ZE2B 4Y5VC 3FBKA 4MJ4A 3WNJA 1TZ8A 3PDOB 5GQBA 1B88A 1FFTB 4MJ2A 5DFTA 5AVQB 3GZKA 3IGAB 4NRYA 3NJKA 1T21A 5ICXA 3DO4A 4XCEA 5HPOA 3L6FB 1LE9B 4R7NA 5AOLA 2Z1PA 4ZFOL 1RURL 3NRPA 4ODTL 3EH3B 2ODHA 1GOFA 4OU3A 3CDGB 1UFUA 4HA1A 4M5SA 2XJLA 3SKMA 3GLDA 1E27B 5B4MC 3UOAB 4PRBA 3BZ5A 3NFNB 3T3PE 1ETB1 1S7XA 4Z76B 1JXGA 4JG5A 2D03H 2Q76A 4KVPA 1H6UA 4APQD 4H7VA 4PH8A 3BPLB 5ID1B 4OCWH 2I25N 2Z31A 1Q9WB 4JM4L 2WKLA 3B7UX 1C7SA 1RI8A 3VI4A 4HZLA 1MCOL 2OMNA 2P49B 4OV5A 1IC4L 4R4ND 2A6IB 2QVIA 1UYWL 2R56L 3O3EA 5F7DB 2CDEA 3FB5A 3RFZB 5HYSB 4UOW1 1BQLL 1F11A 4AIZB 2VWEE 1J87A 3QDJD 4HK3N 5CIPB 5H37A 3VI3B 2W1NA 4OCMC 5D2NA 5CLZA 2CHNA 3QC6X 3SGJC 2A7BA 4M9PA 4XVUD 3ABZA 2H9GB 4WCYH 3BJLA 3U7WH 2IOMA 2NY0C 3QCTL 1DTUA 1RZJC 2X2JA 3AAZB 3GXIA 3T4YB 4B7IA 1U8HA 4P07A 4PB0L 2WNWA 3HHRB 3OPUA 4LCUB 5C0CB 2L4OA 5EO9A 4G42B 3LN9A 2D31A 3HJEA 4OI8A 4QLRA 1RULL 5I18L 3U4BL 1H0DB 3HPJA 3NABH 5IEHA 1DFBL 4TLTA 1KCSL 1BREA 1KC5H 5HI3D 1DANU 1OP3H 1XD1A 2HT2C 4NKIL 4DZ8B 1H3PH 3LXCA 1MRFL 3CXHJ 4APQA 5JIIA 1I1FB 4LLQB 4DCQB 4PG2C 3QUYC 2J7LA 1HH9B 4HK0A 3UO1H 4JX0A 5ISZE 1LD9A 1XH3B 3SE9H 1QWNA 4MX7B 3OTTA 4ZPVB 5E8NA 2NW3A 4JKNA 2LW3A 3ZKSD 1D3CA 4HZ1A 5I30H 1J9QA 3FT0A 4MJID 3Q6FA 2AJZA 3LIUA 2H6OA 3FTXA 1IGIH 1XMEB 4GRWH 1FP5A 4WU7B 1WZKA 1UJTA 4PWGA 1HJBC 5FA4B 1IC1A 1MAML 1RZJL 4UQDA 1G9NL 4BRVA 2FX9L 1ZOXA 5TGBB 5FYKE 3RILA 1RP8A 2IQAB 2EUXA 5TFSL 1ZT7A 2XWTB 5F9WC 3U7YH 4O00A 3HA0A 3OAZH 1GVIA 3JT2A 4KAQH 4PJGB 3EG9A 4JDZA 4DEPC 4Z78A 1IT9H 5MEPA 1I7RA 1XCTA 3AREA 2YPVH 1MG3C 4QTHB 1FLRL 2NY0D 1WVZA 1I9EA 3D39A 3UTSB 3PG2A 1QVOB 1QR1A 3F8UB 3J7HA 1MEXL 5B39G 4XBPB 2IPUG 5D7IF 4RWYL 3LEYL 1MW1A 3P0YH 1ZIBA 4FQQB 4IMLB 1S7QA 4ZMZA 3IWVA 2V9RA 3O0RL 3BKJL 3OB0H 4N2KA 5SWSE 4GRMA 4Z7VF 4TUUA 2YWZA 5KG9A 1J1OL 4PHXA 1UB5B 1FL6B 3KBEA 1R9FA 2EIZA 3PGCB 2K45A 3D3VD 5DYFA 3DA0A 1YAZA 4HF5L 3GBNL 1UM5L 5DEFA 1HH6A 1G0DA 3HMXH 4ZS6C 5JHMA 2X4QA 4PMFA 3CQQA 1N6UA 3GIZL 5HYJD 1J8KA 3N3EA 4XXWC 1MWAB 1S7RA 1Z9OA 3EOBA 2NYZA 1PS3A 4WI5A 5LCVL 2GT9A 2P8LA 1TEYA 1H6TA 4F7EB 1ZVNA 4DPAX 2VDOH 5FGSA 4IGBC 3NVQA 5D1XA 1PG7X 5HVGB 2J2ZA 4ELMA 1PG7L 2PCXA 1ADQA 1WFNA 1OCRB 1WBZB 4FP8L 4BCZA 5JIQA 2ZPKL 1OM3L 3MREB 4KQ3H 4B96A 1GW6A 3MLZH 2VTFA 1JGVL 2DWYA 3EFFB 1QP1A 1FYTA 4M5YH 4XNZC 1BYPA 4I0PA 1XF2B 4OLVH 4BJLA 2ZAIA 1WZLA 2MQ3A 3O41A 3H2WA 3WNKA 3GKWH 4QJ3B 1XF4B 2VLRD 3PYCA 4TQEL 3FO0L 3CFCH 1CFNB 1AQKH 1O7DC 3FU3A 1BZEA 5C70A 3R0MA 2K7PA 1WEJH 3FH5A 3BLPX 5CU5A 5C0RH 2CDFB 5D1QC 4IGBB 1A7QH 2H2SD 3ARGA 2CK0H 3HZVA 2X7LB 4KHTH 4EN3B 2BNRA 3S36X 2BNQE 3VFWA 1ILUA 4YHML 1E2WA 1M56B 3OR6A 2G4GA 1JI2A 2ARJB 2XA8L 4ZMTA 4OGYL 4LSUL 1NL0L 3O3AA 3F3HA 2Q6WA 3D69B 3DJSA 2H3NB 4OD2A 3DV4B 2Y3NA 5CN3A 2HVKB 1UM4L 2ROXA 2X1PA 2DEXX 1C1EH 1I3RB 1IC4H 3POCA 3QUZD 4DPBX 5CJBA 4R4NC 2EVJA 1DVSA 2NNFA 4J8RA 4LCYA 4JFQB 5HYQA 2IADB 2R0ZH 5BVPH 5IY5B 3RZWA 3U36A 5EZIL 5IHLB 4ZMPA 1RVFL 1JGEA 1SOXA 3BRFA 2GIXA 5DGQA 1J18A 2TRYA 4FFZH 5CZKA 1G1OA 1MI5B 4LGPB 1R75A 1SQMA 1TZIB 4G9FD 3B2UD 5H35A 5F3BB 3SDXA 1GHFL 3BZFB 4WUUA 2VLLA 3RGVA 3BD3A 1K3ZA 4N8PA 2B3RA 3FU9A 1IM9D 1ZTMA 4L3AA 3K4AA 1FL3A 4F5CE 5D2LB 4QIRA 1OCCB 3G5VA 1QBMH 2JI3A 1ZVHA 5CCKH 3DJTA 1RLBA 1FIGH 3U2SA 4MD4B 1SXNA 3ZDYB 5T5FH 5KVFL 3VRJB 1CFMA 3U1SL 3FT2B 1KY7A 2NCMA 3HPLA 2ZOLA 3VWJB 2QPDB 5EDSA 4PCSA 3ZTCC 2GHWB 2WHVA 2VXVL 1HL4A 1Z2KA 4LKCA 2B4CH 1U8MB 3LSOA 4JB9L 1RUQH 2ICES 4PR5B 3QR0A 1P1VA 3FUNA 4KK6D 2DL9A 4AZUA 2ZG1A 2VN7A 4OD1H 3LQAC 5EC1B 4K15A 1OCOB 4QTIL 3EYVA 1PX3A 2D8KA 4Z0BL 3CG8A 4F57H 4ENED 2HT2D 5CNHA 2WVVB 1CDHA 2PW2B 1DBKH 1N5YL 1ZANL 3G6JB 5BV7L 1NCCL 4P4KC 1NJ9A 1U8JA 1AACA 1KXTA 4IKKA 1NUFA 2ZCZA 8FABB 1YEHH 4IS6B 5FPIA 5DS1A 3LB6C 4MA7H 1AXTL 3GINA 1BD2D 1U21A 1WG3A 4HIXL 1ASOA 4LLWA 4M7LH 4Z77B 1CZ8H 1E8XA 4YSQA 3VXRA 1KJMB 5BMFH 3EGSB 1DDHA 4WTWA 2G3MA 4UBDC 3QHTC 4DN4L 1DP0A 4I4WB 3B9AA 3SPVB 1H3TA 1HCZA 3FT1A 1ETJA 3GK8L 3MRBB 1F90H 2AEQL 4HUUA 2XTJB 3U7YL 5GRUL 1XIWC 3LD8C 4FZEH 2FGWH 3N1FC 5GS0L 4HUVA 3QDGD 1AG0A 1D6EA 3GD1C 3GXFA 4H13C 4JRWA 1UZ8B 3GPEA 4WFGE 4CVUA 2ZUTA 2IBGA 3A4EA 2R0WH 4RQQB 4AQ1B 1UWFA 3PWPD 4JFYB 2D0FA 1LMIA 2R29H 3CXFA 1K5NA 5D93C 5GSVB 3ZL2A 1Q90A 1L6XA 3IDMB 4X98A 3T0WA 1GS7A 2X3AA 1NCDH 4PJCB 4WW2B 4JE4B 3HE7A 4I8DA 2NY5C 2NY7L 3GQFA 4HYTB 3PE9A 3DX6B 1P4IL 3EJRA 3JT0A 4WFFE 3FCBA 1PMYA 5ESAB 4PHZA 3WDJA 3KS0J 3GJFK 3RWIB 3BP7A 3D2UA 1X5FA 4X5RA 2BMKB 3SGEH 1K8DB 1QX1A 1TR7A 3ETTA 4HKXA 2BJMH 4OFIA 2A6KB 4YDVA 1AIZA 4P2RD 4PJBE 2EH7L 4NO0B 4TUOA 1CK0H 1JYNA 4UOJA 1PD6A 1YC7A 2W60A 2WPGA 4MB5A 1ZSDB 2GABA 3GBDA 1HILB 5DRNA 1ZLUK 1CDYA 4XPBL 2Q7YA 1K2DA 3V6OC 4M7LT 3IBOA 3HNSH 4TVUA 1JYWA 4NENA 1MW0A 1IAII 4AL8C 3IXAB 4MAYB 2EJ1A 3ZW3A 1TFHA 3QDGB 3QNZA 1SQ2N 1ES0A 4YHYC 1JRHI 2WTOA 3V9FA 3WKYA 5IQ7H 2BVPA 3X3FH 4UQEA 4W9IC 4MB1A 1DBBL 4ZW7A 4GP5B 1SF3A 3QDJB 1IGFL 5EMYA 2VLKB 3ARQA 2ED7A 1QHOA 3QJUB 2GITB 1OSEA 1PKQA 1J05A 4N2CA 5I6XB 4WHYG 1CVRA 4Y19D 5FYJH 3ZHLA 1RY7B 1IU1A 1NANI 4HIHB 5HD8C 3VXOA 4WGWB 4AENB 4F3FB 3KPRD 2O93L 4ZOEA 4HC1H 1KBBA 4NO5B 1MCDA 2E9GA 4BFEA 2JKNA 5FC9A 1E67A 1JWSA 1XR8B 4S10A 1OT2A 4AVIA 2VM9A 2X2IA 3KLSA 4ZAKB 3MZTA 4H25A 3KBHE 4KTGA 4AG4H 3UGXA 3K71A 3HAEB 2OJZH 2WLJA 2YA1A 3N44B 1MIEH 2AEIT 3CZFB 3M17B 5L7XH 2XFGB 3F12B 4NBZB 4KDWA 4XVSL 2IH1A 4KHTL 4RMBA 3KLLA 5J4MA 3O8XC 5D1XC 3PUCA 2DYPB 2PYFB 5ADOH 4UV4L 3KEDA 3N85H 4GNKB 3U79A 1ID5I 3QA3A 4LCWE 1F2XK 4NFDA 4F7MA 3BWUC 5I1KH 4OQTL 2QKIC 5BUGA 2DIBA 2XNAB 4HCRA 5E6IB 4CA4A 1RPKA 5JA8B 2CM6A 3LNEA 3RTQC 4P2OC 2O72A 1P4BL 3V5HB 3HS0A 3WY1A 4JEGB 5FO9B 5ISZB 1SY6L 2ZAHA 1G7MB 1E4KC 4YFLI 3UMTA 1MREH 2DQCL 1SY6A 3Q9QA 4K07A 5BW7A 1YEIH 1NCUA 1RZIA 2A4EA 4FTVA 4OZFB 2AS5M 5DEGA 1V10A 1XEDA 3AITA 3BP5B 4KY2A 3VJ6B 3UTQB 1B0RB 4LAJH 1JV2B 2YJLA 3HTLX 4G9FB 2WSDA 1CBJA 3FRUA 1FI8C 5CMAB 3VFPB 4PJ7B 1OWWA 1LILA 4ZX4A 4Q0XL 2F53A 3FQUA 1ACYH 5E8DH 4DESA 4HXBL 3SDDB 2WXNA 2W5PA 3CBJB 5BZDA 1R3IH 2EDMA 4DGYL 1M7IB 3H9HB 4NUQA 4U1SA 3CBKB 4U1JB 3TO2B 2CKBL 4ZZKA 4BXSV 1M9WA 4YDLB 3S88L 3DO7A 2OV0A 5I28A 1KN2H 3DO7B 4ELKB 1SJXA 1W2KT 3VU1A 3KD4A 3I6GA 2QDWA 1SDDB 4OZGE 2JKWA 2KZWA 1UUSA 4E9TA 3U30C 2AQ1A 2VWEC 3L4CA 3IJ7A 3TJEH 1L9QA 5LNGA 32C2A 1PX4A 1MIMH 2F2HA 3NEOA 4KNSA 5C0EA 2YRBA 3FHEA 1JTTA 5DUJA 1R3HB 5IP4A 4UILL 4A6YL 3QXVA 3AZUA 4R5XA 5EN2A 2ITDB 5JIKA 3ARSA 4OKDA 3IVKA 1TQVA 4ICXA 2ZCKL 1ONQB 2APWA 2ENJA 1KTDB 2WQWA 3PFQA 3FN9A 4AMWA 5F7LB 4BYHA 1JF6A 3I3EA 2BK8A 3LZFL 1JZDC 4FE9A 4HIXH 2EDLA 2Y7QA 2G9HA 5J0BA 4UZUA 3X13A 4FTVE 4W1TA 4DN4H 3ZBMA 3ULAB 4N9OB 5AG8A 1VACA 1AD9B 4LCCC 1QPKA 4MNQA 4N2HA 3BPCA 3V9CA 3D12B 4U3SB 1NGPH 2YGPA 4OLXL 3TVMB 4BZ1A 1BYOA 4OF7A 5DWUH 2VMEA 3B6SB 3SYOA 4QRQA 5JDJA 4DW2L 3HFML 1AHWA 3QUXD 1FDLH 3ELAT 1KJVB 4HVBA 2F15A 5LAPA 5SWSB 4P9HH 2MPVA 4F33A 3K2KA 1HL5A 4TNWF 3VDBA 4HOXA 3DNKA 4UTCA 2HG0A 3S3JA 1NC4B 4GKOA 4PWEA 5L2KA 5KYUB 2OMTB 2IGFL 1ETZA 3PHSA 2BZDA 4H26A 5IHBA 4Y19A 5E08H 4ANUA 1QFWM 3ZVVA 3MROA 4MDJA 2J1ZA 3NP4A 1S4IA 3KYKL 4P2CG 4X5XA 3PJSA 4YDIL 1OSZA 4RAUA 1RIUL 4LO9A 3BUIA 1T2JA 4OCXH 2R59A 2UZXA 4PSRA 3CMOH 1KJ2A 1IEAA 1XIWA 1R3KB 2CPUA 4JHAL 2I7SA 3SGDI 4KX9A 1UTDA 2FEDC 2BJML 3MBWB 1F3DH 4G80A 4M8QA 3LN5A 3P9LB 4PJDE 2EXYD 3IF1B 4G72B 2P7TB 1JJUA 1SFHA 1QTYT 5F7HA 1T89C 4A55A 2L04A 2NT0A 3BWAB 3A6BH 5E1HB 2RH0A 3P3YA 1AFVL 3FCTA 4O5LL 4ZUUB 3FT3A 5JYMA 3BXNA 3II1A 4MQ7A 3CXDL 3NMEA 1JGLL 4O2FA 3VAEA 2WWMD 3IEAA 3H54A 3JWDC 1T80A 2J55A 4QRTA 1DBBH 2CWRA 2WLIB 4MNQE 4B53A 3GMMA 1T0MA 4XN5A 3MR9A 1E8WA 3D09A 3FYIB 1BWMA 4MAYD 5LO7A 5JIPA 3N42B 1EEUA 2QSCL 1KBKA 1XGZA 3SKOA 5AD0B 1BZ8A 3QO1B 1YNTB 4K5PA 1SLVA 3FQ2A 2EILB 5D7IE 3BZEB 1S3KH 4YN3A 1OP5K 2A74B 5LBSL 2P5PA 1IM3D 4TPRL 3TJHD 4E9SA 1Z9SB 2D7TL 2ZYSA 3OMNB 2R4SL 3SDCA 3V6OE 4PIRF 2Y72A 1VENA 2BIQA 1ZS2A 3QQXA 1IAIL 2C34A 2R1WB 2D4DA 4NZRL 4D8PA 4EPSA 4XVJH 4BH7B 2A73A 1XGUB 3QFJE 5MEOB 3AU1B 1F6AB 1Y0LA 2MQCA 1LEIB 3FCSB 4I18B 5L7XL 4PLKD 5DVKA 3WG7B 3RVTD 1FO0B 2PYEE 2EINB 1N9PA 1OAKH 5F1NB 3T65A 4N5UA 5EBMB 4DKDC 2KQMA 3CPLA 4N24A 5E6UB 2HPOA 5C0GA 4L5FL 5L88L 3DPBB 5BUAA 3QRFM 3A67H 4H4NA 3T0EC 1BD2A 1WBXB 1P69B 5EOQL 3NJXA 2J5LB 4X4ZA 4B9GA 1IC5L 3TESA 3CDYA 5CBEA 4HU8A 2DEWX 2A77H 1J10A 4LL4A 4NQDA 3S98A 5EC2A 1JUFA 1BQUA 3I02A 1IBFA 2HVJA 2IPKA 2M83A 4X6DF 2Y7OA 4NIYE 4JREB 4MMZC 3MGTB 4YSRA 5DRZB 1CQKA 1FFRA 2G2RB 3T6XA 2LLNA 3EJTA 3JV5A 2YMTA 3KE0A 5MP6L 4PGEA 4FQXC 3O6FA 4QF1A 5GPRA 1EHLL 2WVTA 1XZ0B 1M71B 4G5ZL 5DVPA 2ZSWB 5JIDA 2DQDL 2IAMB 3QQ3A 1LK2B 3BP6A 2F58L 4OCRH 2MHAA 4W6YB 4AITA 1BF8A 1I8IA 5C0AA 5ICZB 2C26A 1H3UA 1UB6A 3FQNA 3QEUA 4PJBB 5GS1A 1BMWA 1U8KA 4MA1C 1DCEA 1DLHA 4LEXL 4YR6A 1U8LB 4YXHL 1HSBA 1NAMB 3FTGB 5IIEA 2VABA 4JRYE 5IHZA 3V0JA 1LK3L 5DDHB 4M93B 3VFUB 1CS6A 3LKQB 1RIVL 2APSA 5TDOB 4ODHH 1LJMA 4WI9A 4OI9A 2XU9A 1ID2A 3BGMB 3NSDA 4FCHA 5BZWA 1IM9A 4LL1A 3VI4F 4I3RH 1B0WA 4PJCE 1ZLWH 1XB8A 2YA2A 2WWNA 2W92A 2FNBA 1AGBA 1CPUA 1XCWA 1X9RA 1LO0H 1KGJA 3OGOE 5TK2A 1EJ6A 1VGEH 1ADQL 1DLFL 2FVNA 1OAZL 3DVNA 1T20A 1OAUL 1T5KA 1T7XA 4OF3A 1W80A 4EDXA 1U8OA 1FO0L 4UAOC 3QAZC 1PCSA 2GB2A 5B8CB 2CO7A 4KTDH 4H1LB 3LV3B 3S4SB 4BK5C 5EEYA 1GGUA 1JZJA 3OM3B 3PV7A 1D5BB 2H32B 4DP6X 1UKTA 5DD5H 4RX4A 1GH7A 5AW7B 5B1KA 4QHMA 4K7FA 2C3VA 4CVXA 4ZXBD 4LHJB 1ZMYA 5D71H 5F70A 4AYDC 4MJ5A 4RFOL 3TIDB 3H3KA 3LTVA 5DMIL 3ULUD 2YN3A 4W9CC 1M1XB 1GYVA 4NZDA 4RSVA 4YGAB 5DF0A 3ZZ1A 4UDTA 5IEKA 2IXQA 3JUZA 5J5EA 2YSSA 4D0DA 2ZOKB 5C07D 3BPOB 2PO6A 3OMAB 3JWOH 4JJ5A 2XVBA 4KZEH 1R47A 4HS6B 4UIKH 5ABDE 3Q8BA 4F8NA 1A3ZA 2NXYB 4LEEA 4WKZB 4PRHA 1TTGA 3C75A 3FO1A 1NOFA 3L17A 4WW2C 2I69A 2YO3A 3SDYH 3FULA 3NCFB 2EQDA 2QHLA 5DTFA 1YEFL 2Y2TA 2A6DB 5DZNA 2RCSL 4FX5A 1FNSL 3MMEB 3H3PH 3RPIB 5EB9A 2F08A 4QXTA 5DLLA 4BKLB 4G70B 4YHNA 5HYJA 3MO1A 3CSTA 4YH6A 2GC4C 2W9DH 4TVPL 4AQ8C 2P80D 5C09E 1AO7D 4AGNA 4LVHC 1MFCH 2OL3B 3MRFB 4ZMXA 2WGNB 4AYEC 5GGUA 2MTPA 4NQSB 5I74B 1OZTG 3HG0A 3P40A 2OS7A 3ZTNL 3VXSD 4NJAL 3SGEI 4R96A 3KM2A 3KPPB 5EOCH 3TWCH 4ZDHA 3X14B 2EC8A 4G8EA 4L8BB 2QVMA 4DP8X 1BFSA 3QAZB 4DF9A 2QQLH 2PWGA 5FGCB 5E5LA 1R1CA 3HC3H 1WCQA 1EK3A 1KIRB 1U8CB 4N2AA 1ZTXH 3TS8A 2AJ3A 3GMNB 3MXVH 1G9MC 1LP9B 3CUPA 4YIQA 4XCNA 4HS3B 4G6ML 1NIAA 4ISVA 1DO5A 2R4SH 3PWVA 4OJFL 1ZRUA 4P46D 1NFDA 4P2OA 2AJYH 2XI9A 4ZJ9A 2M1KA 1DJHA 4GKNB 4LVNC 1KGCE 4XNXL 3WFBH 4TTDC 3K6NA 1JI1A 4Y5VB 4G7RB 1FNEB 4KKRA 4NM4L 4DQOL 3FAWA 1ZT4B 2WQSA 3DXAB 4J1UA 3NACH 1QYGL 3GJEA 3RWCB 5EO1B 1M1SA 4XP4H 3IMBA 4NC2B 1JPTL 4WWPA 3G6JF 3W9EA 3QXDB 5TPWH 4Z3JA 1FNGA 3S36L 2MKLC 1RP9A 4QO1B 2VDKB 2NXYC 3BHBA 4L9LB 3RA7H 4HWNA 4BFGA 3QG6A 1WT5A 3S3SA 1Z9PA 1ZA3A 2NY1D 4H0GA 1RZPA 1FLTX 2VGLM 1TTUA 2FK9A 2IOOA 1MCCA 4RX4D 5D72H 1MRFH 4ELMF 4TUJA 3VX1A 1KB9K 2V33A 4IHOB 1RJLA 4OM0L 3W57A 5J7CC 1A0QH 1SUJA 4PG2A 4WI0A 2B2XH 3QW9A 5F89B 1F3DJ 1BX2A 1QQDB 4HWZB 3V6FB 1H8LA 5BVJB 3UCQA 2VDNB 3FYEB 3F2LA 3VWKB 4RH4A 4HMCA 2NNCA 4OGAC 3QO0A 4P3DA 4JGNA 4IBSA 4KROB 1IGIL 2HFGL 3KXFE 3GJFB 3H9SA 3MRNB 5D5MB 1N26A 2ZXDA 3PAVA 5DJ6A 3ZKXC 2KZ1B 4A66A 1MAMH 1RZJH 4YXHH 1AXSA 4HIJB 3WIFB 1DHKA 2ICWJ 1P5VB 4NQTA 1HSAB 3O3UN 1VJSA 2MJWA 3LAFA 3R8QA 3ECBB 4U1GB 4W9FC 3QGVA 3V6BR 5I5MA 2VERN 1SUHA 1ZVSB 4LCWA 2YPVL 2GIYA 3L4WA 4PB9L 1QI4A 2CO4A 3GYRA 4U1HB 2VITB 5F9JB 3OHXC 4PREB 2WIIB 4XAWL 1NWOA 1ZY9A 5K9KA 4MD0B 4PQXA 4WO4A 2DMKA 2JK5B 1QWHA 1MZZA 4WZ9A 4WTZG 1A6TA 5DS8B 3ZTDC 3QYMA 2VC2L 1KIPB 4TSBH 2ZE0A 2YPLA 4KC3B 5KS9A 4NRZA 1IB5A 1O9VA 4CNIA 1NDGA 3W5NA 2OSLA 2YAOA 5DI8A 1WA1X 3RIAK 4I2XB 3GBNH 1Q0YH 1ZKAA 4FXGA 1CG9B 4GIOA 3N9GL 5HDBE 2A0LC 2PYEB 3ZMNA 4FJYA 4YGVA 3SN6N 1MW3A 1YY9C 4NN6C 1BAFH 3RP1A 4XWGH 3C6LA 2CUAA 4PY8J 1AGCA 3MYJB 4DP2X 1EFXA 3C08L 5EU6E 5MENB 3L7FB 3RTQB 4A2HA 1BXXA 4JZJA 4YE4H 3UJJL 2CHWA 1Q9LB 3GGWA 2AJXH 1B0GB 3S8WA 1H15B 3QQ4B 4RGMB 1PCXA 2GTZB 1PYWA 1AKPA 3D4YA 3X17A 3VXTB 4ETYA 4OFYD 4U3HA 3LH9A 3LPOA 3W82A 1I7UB 1XMWA 2K1MA 2CKNA 3HE7D 4PB0H 1JRHL 1X5HA 4JN2A 2ZOUA 3EADA 1T21B 3N1QC 1BPLB 5EZOL 4YBQD 4OGXL 5CBAB 3A6OA 2XBDA 4R7NB 3L5WA 3EW3B 2VL4A 3QQNA 5FDWA 3SPCA 4N6RB 3NABL 3C2SA 3UZVB 3X1FA 4RVBA 3EBAA 2FT6A 1PZSA 4IIQC 2HT3D 1N68A 3CH8A 4PRBB 2W91A 4XP9L 2OR7A 1DEEB 1JVLA 1QLRA 3ZSSA 2OLDA 3K2UL 1KYUA 5J57B 1NCBH 5BOZG 3JQOB 1WEJL 3BFWA 5DGRA 4YSEA 2V2XB 2ZXQA 4G59C 3A4FA 3FU7A 4JZNA 3HLKA 3WU1A 4GEIA 1SLXA 3WTYA 3KR3L 4WUKH 3ZMRA 4OGQC 1DBAL 2AK4B 1RIHH 3I3DA 2H1PL 4LASH 4LBEA 5FOBB 5MERB 5CIPA 5I16B 3BJ91 5HVHC 5GZOD 1FZOB 5D2NB 3Q05A 2FO1A 4I5BA 4UV7L 3FQWA 1A6UL 1X7SA 2EEDA 1QRNA 5L2KE 1IFGA 2YD9A 3C6SB 5D8JH 2BFGA 3MXVL 1XXFC 1E9OA 5E5MA 4PJ8A 2JJSA 4WI3A 3NJLA 3TBVB 4RIRA 1TITA 2F19L 3ML8A 2V9UA 4HUNB 4FG4A 1BIIB 2D3NA 1FG9C 1W8OA 1TZGH 1Z0MA 2VSMB 3CFDB 3DRQB 4P46B 5GZND 3RDTA 3LEYH 4LHQB 3UAJA 5AOMA 4OJCA 4YHZH 1I1AA 3TVMD 1QYGH 2JB5L 1T03H 1JGUL 1ACZA 4EOWL 4CN6A 4YMPA 3HMWL 3ESNA 4F9LC 3HJ0A 5TPWL 1MJJB 4M6OH 1NPUA 3MLVL 3NJNA 1TTRA 2MSPA 5DR5L 3VB9A 1YJDL 3BQUD 4PS8A 3ESUF 2PTTA 2IV8A 3GPSA 4DCQA 5KVEE 2YGQA 3RGVD 3WN5A 4IM8A 4LIQL 1J8HD 4HK0B 4Y89A 4JFXB 1JZ6A 3X3GL 5IUSA 3RBGA 4UINL 1W9XA 3OPZL 3SDXE 1IAMA 2BO0A 1HU8A 4F57L 2YAQA 3C5SB 3IFNH 2CM5A 2DQGL 4TSCH 1PQZA 4FA7B 2FQEA 4F5CA 3MTRA 5CXPA 5BV7H 4JANA 4YEEA 3VWKC 1U8IB 4F1ZA 4OJYA 4QRUA 3BZ4B 1BZ9B 4AE0A 3IDXH 2XWXA 3CVHA 5KUKA 2NCEA 3MV8E 1AXTH 4FFZA 3VFOA 2C4FU 5CFAA 3U82B 2AJUL 5I0YA 4X9FA 4EIGB 5KVEH 2UVFA 1A47A 4GQRA 5MEPB 1XGQB 3GK8H 3MLTA 2XVLA 4RFEB 1E4JA 4M6ML 3VM5A 4MA1B 4P49A 1ADWA 1N3NB 2K6YA 2ISDA 3GKWL 4GKZA 2RTTA 3DX7B 4YC2C 1RJYA 5EU7C 3L5XL 1WFMA 1YN7B 1R5IB 1SJEA 1KGYE 2OK0L 5J1TC 1SXSA 5D7LB 2Y25A 3NEEA 2WCSA 4U4IA 2BP0A 4OD3L 1PSKH 3BAXA 1RK7A 5KG9B 2P5WA 4KPHH 1G6RB 5CJ5A 4ZW5A 4AEEA 4OF8A 4I9WE 2EIZB 1EUTA 3L3OB 5K39B 4B9CA 3JWNE 1LP9E 1UOLA 4K3JL 1H8SA 2HJLB 3OKEA 5F8RC 2BIIA 5SX4H 2XPYA 5SX5K 3C5XA 4AGPA 5HHOB 4X4YA 1TQBC 4NN6B 2UY7A 1BM3L 1I9RL 2WLKA 3RWFB 4B60A 5I1CH 1DN0B 3TA3C 4X8JA 2VDQH 3AQZA 1U8PB 3RY6A 4UANA 5D7KD 1KIUA 1FAIH 3B1UA 3JWDH 2FL5A 4AUYA 1RVFH 1JXFA 2C9PA 4Z7QE 2EE6A 1UA7A 5L8JB 3L95A 3BX7C 4JHVA 5IOPA 2JIXA 1QZ1A 1ZSHA 1HEHC 1RZ7H 2A4ZA 2J2ZB 3OJVC 4G6JL 4GLRH 3DSFH 2DMCA 5GRYA 1L5GB 4JPWL 3ULSB 4RFNB 5DMKB 1GJIA 3TCLB 4P2RE 5I6PA 1TQSA 1VEPA 2VE6A 1BM7A 2Y7LA 1OE1A 2Q3AA 2OR8A 1EO8H 1GXEA 3NSXA 2NY4C 1HEZA 3CN3A 1L0QA 2O61A 1B4LA 1A1NA 4R3SA 3UZEC 3B8SA 4R90H 2DD8H 1JRHH 5FKAB 2MFNA 1NUGA 5C3TA 1L7IL 5GGVL 2FATH 1LVEA 1L9OA 9PCYA 3MUGB 1EBPA 1IUZA 4HC1L 1O6TA 1CICD 4HIIA 1E9PA 3LKPA 3MRCA 1MLBB 5D6DC 1UXSB 3ARZA 4NM8L 4YDLC 1E4XI 2AVGA 4FQJL 3O9WD 4N0CC 3KXFB 4XTRD 2NUPA 4GAJH 1GS6X 3QJVB 4HPYH 1RZ8B 1WIUA 2HJFB 3IS0X 2X6UA 1CLCA 3WY3A 4ODXB 1HNFA 2VKWA 5C07A 4KNTA 3W0WA 3GKZA 1TSHA 4Z7VB 2N59A 2HVKA 3EYOB 2EEFA 3AXLA 1WK0A 2XWZA 3L3DA 4JQVC 4PJGE 1NCCH 3B2MA 4ALAH 4BZ2H 4K3DH 2VMCA 4MXWH 3US0A 2DBJA 2YEZB 4BQBA 3DTUB 1KCRH 4WUUD 4EI0A 3U36B 1IAOA 2X4PB 2XBTA 4ZO6A 1ASQA 2EH8H 2ZKXA 5AL0A 4B9YA 4KX7A 4WK4B 3UERA 1JHTB 1YQVH 4I9WD 3D4CA 5BMFL 3CK0H 5DFVC 3FO9B 3VW3L 1EEQA 1E4WL 3EZ8A 1IX2A 1X5XA 4AEFA 2C1OA 3QS3A 4AVKA 1NUDA 1J0JA 1OB0A 1MNUH 4HCFA 4IDJL 5IMKA 3X11B 3WNLA 3TYFA 5DUPL 4HJ1A 4ETQB 5BJTB 1E4XL 4NNPH 4Y2OA 1IBDA 2FGWL 1U8QB 1YEIL 2QSVA 3DX2A 5GS0H 1A9EA 4PMEA 4ABVA 3MNZB 1I3GL 2ARJQ 3VRJA 1HN1A 2ADJB 2F19H 3KL0A 3J07A 3WKNA 2OMZA 4PJAB 4HCRL 5BRQA 5F7FA 1T89A 4FFTA 4BZYA 2D3JA 1ACYL 3LN4B 3FMGL 4U6XB 1U8MA 4NN7C 4IOFD 4R5VA 4BCYA 1LL1A 2BSRA 2WTPA 4FJZA 1ZEAH 4BFJA 1G0XA 2WCGA 2NQCA 4Z7AA 3O81A 1AG6A 4GP8B 1KJ3L 4FQCL 4L1LA 5C09A 1ZD6A 1YPZE 4JKKA 1JPST 5HGBB 3ZX1A 4LEOB 4DKEH 3RVUC 3ERXA 4KVNH 2FSDA 3S5LG 2AJSH 1R46A 2JELL 4Y7OC 3MLUH 5JW3L 3FQRA 2PN5A 4NQXB 5EBLB 2X4SB 2FBJL 4YDKL 4CDHA 3TBYB 3QPXL 4ATTA 5KJRL 3TCXA 4IS6A 3D0VB 2W07B 3BUBA 4KTEH 4OBRA 2XV3A 1L0YA 2ZF8A 4Y4HB 2C9SA 2ZX7A 4Z77A 1U95B 2B5IB 4LLVA 3RU8L 4ZUWA 5H94B 1HKLL 2NY3D 3FN3A 4K7PL 5C0BE 3VXRB 1EA9C 4ZTPH 2DLHA 5TF1L 4V1DD 2JB6A 4N90D 3X3FL 1IGYB 3ZGIA 3HI1A 4BFKA 1CBVH 1G6RH 1CTOA 2PR4L 5TK4A 1HOCA 3WELA 5EV7A 4MBRA 5KVEL 4B27A 2EIDA 3QORD 3IFPB 3EJCA 3PL6B 1UT9A 5E9DB 4GSXA 4AQ1A 4LPCA 2EAEA 3E2HC 4XBGA 1Q8MA 2CR3A 2ICEB 1TTCA 3HBPA 5IMMA 3QJFB 5HY9A 3IFLL 1FDLL 2NLJA 4JO5A 1A5FH 1HT6A 4HMEA 4PJ9C 1JVKA 5HPMA 1XEUA 4DJMA 1YN6A 2BS71 5CEYB 3ZDZB 1LNUA 1HYRC 2ZUSA 2VDLH 3Q6GH 3KLAB 3B43A 4LNRA 2MQGA 2WQ8A 3WO3B 35C8L 1MRCL 1OAXL 3LRSA 2QELA 4DUXA 2CCWA 5JMRA 3MACH 5CEZL 5IJVB 3DOHA 5EOCJ 3KYKH 5TE4H 4OB5L 4QMEA 4YDIH 3BKCH 4FZ8H 2P5WD 1TTAA 4PJGF 5DRNB 5BPPA 4J27A 3EJUA 3V0IA 1R4XA 1R0AL 3AB0B 1KZYA 2AKRB 3Q5TA 3D4GA 4MAYA 1WS7A 4DTGH 1KELL 1PLCA 2XZAH 4Y4KC 4ZOAA 5HHXL 4JM2D 2BVPB 4XP1H 3U0TB 2ENSA 2WBWB 4LFHG 2CR6A 2NUTA 2WOYA 1WZ1H 2AW2A 4X4XA 2XKNB 4OW6A 5DHDA 2ZNXA 2R7EB 2DF3A 4HWBL 2VDRH 2XWDA 4JO1H 3VDAA 1P5UA 2ESVB 1WGOA 2F7OA 4L3ED 2XETA 4PIBA 1KJ2L 3KPOA 4YVNA 3UTPD 1NWPA 1YECL 5AVRB 2J1KA 5FOJA 4KO9A 4BV1A 1LO5A 1AS8A 2TAAA 1U8NB 2XYBA 3ZRCC 1X5LA 4Q9RH 3ECVA 5KZCB 2O30A 3LVTA 5IW1B 4GG6E 1L7IH 2BSBA 4QWWC 5I26A 1GYWA 3WY2A 1AR1C 2UWEE 4LVEA 4LDCA 1J12A 1TZHB 5LBSH 2WCPA 5FW6A 1BOYA 3MGOB 3ZKXB 2XN2A 2CH8A 1ZLUH 3F12A 3T1WA 1BJMA 2FX7L 4NAJA 1C5CH 1HQRB 2NY6D 3TZVC 3IDGA 1F97A 3OLEA 4FQJH 5E6ID 4H20H 4XVJL 3G08B 2C9UA 3B5TA 5DYOB 5I24A 5H2BB 4MAUH 5AL8A 2B0SL 4XAKD 1JL8A 4EO5A 4AH2A 1MJUH 1O5DT 3QFJD 3MJ7B 2JCCE 5DJYB 3MV9A 4MXWL 5KSUA 5FO9A 3A24A 4G71B 3BIKA 4G6KH 5C2BH 3CFTA 1C9SA 1BWWA 1FH2A 5E7BA 3KGRA 1K6QL 1RUML 5C08B 2VRKA 2N0MA 3L3IB 5AYUH 4E5XB 1JMZA 2KERA 3OL2A 5E1GA 3MA9H 4F20A 2Y69B 1QBBA 2FZ3A 2H0PA 2IIJA 3VJ6A 1E4WH 5IJBC 2VQ1A 2YN5A 4QRPD 4P5TA 4ZQTA 3EBHA 2Z7WA 3BVWA 1SRDA 1NGPL 2CD0A 2EDXA 3FRUB 3K91A 3IDYC 4OLXH 3NUKA 4XNZB 5CMAA 1M7DA 4B0MM 4J4PC 4E9LA 3OSKA 5ES4B 3SDDA 1G9NC 3L45A 1K4CB 1QRND 4WWKB 4XPAH 5BZDB 4G5ZH 4PY8I 4S0HA 1LTXA 3HG2A 3QE5A 3RDJA 2QKIB 2B08A 2CA4A 1N8ZB 2DEYX 1S5HA 4IBQA 1I9IL 1A8ZA 5IT2L 1U6AL 3RIKA 4NJ9H 4KO5A 3MRQB 3SOTA 3I6GB 1SDDA 2B3IA 3LCYA 4JRXE 2FJGA 3MKKA 3S0PA 1B4JH 4KVCH 4NQDE 4JY6B 5GGSA 1TENA 2EE9A 1NC2B 4BSWB 3BVUA 3PAZA 1YUHB 5ALCL 4DKEL 4F7TB 1RURH 5FLUA 2WO4A 4R7DA 5HVFB 3QWOB 4MYWB 5L9DL 4PS3A 1TCMA 4JHZA 4Q89A 1KTDA 3MLUL 1KEML 1KG0B 3QP3A 1JDDA 4J3XA 3IGLA 3A6BL 1ZGLA 4YDMA 3AABA 5D4IA 2CBMA 4U1IB 3RZCD 3ARXA 4X7CC 1HKLH 2AXWA 5E1IA 1EXHA 2L8AA 2IAND 5TF1H 3BISA 4JRYA 1FO0H 1E5AA 4PGZA 4QWWD 4JQIL 3GBMH 4LSSL 5HGAA 4F2EA 4PG9B 5AQ0A 1GGTA 4N2BA 5IQMA 3ZHDA 3OMIB 1KPVB 4JG9A 2VISA 2OTPA 3B6SA 2ZCHH 2D7MA 1B2WL 3W38A 1ZHKA 2EDDA 2WYZA 1J8HE 1P84J 2G0LA 1DVFB 4GXUM 2Y3AA 2R2BB 4KK9D 2XBZA 4X99B 3ZE2E 3EXLA 1L6ZA 5C0CD 2JJTC 1S8DA 1A7OH 2EKSA 3DX3A 4JVPA 4X83A 3EO0A 4ZW3A 5L2KB 1S9YA 4A7SA 2WAHA 1QBAA 5TDPA 3V0GA 1MCPH 1IO4C 3OKNA 3I6KB 1H3WM 1E5YA 3S37L 2VR5A 2BLFA 3U0PB 2PCPA 4FN0A 1FIEA 2MRYA 1TVDA 1KTRL 3HI6H 4QRRE 3HOGA 1U41A 4LLUB 1CGSL 2LTQB 2RB8A 5AW6B 4CBZA 2BOCB 5D7JB 3CU7A 5ACLA 3VWKD 1JZ5A 1F18A 3UTSE 3F5WB 3LN5B 3P9LA 4MQTB 1EZSA 5GGTL 4V1DB 4W81A 5JHDE 4JZOB 2ZX9A 4NKIH 3VH8A 1GS8A 3QNFA 5GGTA 1N6QL 1YEFH 2R15A 3L7EB 1CXFA 4ZUUA 4NQUA 1M53A 4P9HC 4BXVA 1IGML 1XR9B 4I88A 3CAFA 2YEQA 2WWKT 1OB1A 2EXWD 3GM0A 3WKML 4D9QE 1T1ZB 1UXMA 1EFQA 3QUXA 4JMXA 5CF3A 2WTRB 3K0YA 3QEQA 3FSZA 2F1EA 4X4ME 5MP6H 3HLAA 1XGTA 4XWOD 2CGZA 4NJAH 4M8VA 2CSPA 3QO1A 1NCAL 1CUOA 4EUPB 4MJHA 4QXUL 3HUJA 4WFHD 3ROOA 5HHPB 3GUTA 5DD0L 3SQOL 1LO3H 4LLAA 5DURD 4TOYH 2P5WE 2VIRA 3B2VL 4ZFGH 2R1WA 4D8PB 3QNXB 4Z3EA 5HHQB 4BDVB 5MEOA 1IT9L 4OAWA 7TAAA 2IQ9L 3V4VL 4G6MH 3VCLA 4NO2B 1LP9F 2B8OT 4O02A 2GSIB 3DJZA 1T6VN 2FX7H 5HHMB 3U6RA 4HPHA 2KS0A 4NP9A 4ZXBC 3QRGL 5GGRY 4G7YL 5EZJB 5IVOA 1MLCA 2FJHA 2B0SH 2OMYB 4RNRA 2AFNA 3HE6B 3STZA 4WO0A 2YMXL 2Q3XA 3UTPE 1EJOH 3U46A 1WAAA 3AREC 4KJQC 1E0OB 4N8CH 1M57B 2IPKB 2HVJB 1KYFA 1HL8A 3VFTA 3QQ9D 3VSVA 4D0CA 4J3OG 5BV7C 1GA2A 1AKJB 1DJXA 1EZVX 2BNQB 4ZSOA 2FO4A 3E1ZA 4E0RA 2DN7A 4WVRA 3D33A 3J27A 4UQ2B 3NZ8A 3G7TA 5DEJA 3FUIA 5B7FA 5IV2B 2J8UA 4GIAA 2Q2EB 4BSVA 3QUKA 4XP5L 5HGHA 5C3LD 1THAA 1KGXA 4XXWA 5K9OB 3C5JA 3V4PB 4IBVA 1ZLDA 2A83A 3DTXB 3FUHA 3IJYA 2ENYA 3JTTB 4NDMB 4NKMA 5SWZA 3S37X 1U8KB 2WO2B 4TNWK 3VQMA 3AT9A 2Q5BA 2FEEI 3TO4B 5L4FA 3OC8A 1CD1B 5GIRA 3VI3E 4X9YA 3HVNA 4FP8H 1TPXB 4GMSL 1S7TA 4DEPB 5AB2A 2N56A 5IW6A 5IT2H 4UT9H 3LRLA 1IZJA 3MLZL 5C07E 5BZWB 4FQHA 2HG5B 4NPKA 2JE8A 2UZPA 5AZ2H 2PETA 3MRRA 4JVUA 3V0EA 2P80A 2YD1A 5DUBB 1HI6A 3BWZA 5TQ2H 3KCPA 1SGKA 1U58B 2WNXA 3CFCL 4PRNA 2HKFL 3LD8B 4Q6IB 3VD3A 4MRCA 1U2HA 3ZDYE 2AK1L 2YWYA 3QZBA 1EPFA 5E4IA 1MY5A 2ICWA 3D18B 4EBQH 2FO8A 4PPTA 4UMGA 5J6GA 1J86A 2XWCA 5L9DH 4AQ1C 4JO2H 1JF1A 3DJ9A 1ZLSL 2F5BH 3D39D 4EI5A 1N8OE 4J3OF 1IMHC 1ED3A 1G43A 1JZEA 2QPFA 3DK2A 3TIEA 3QZLA 5GZOC 1LE5A 1AI1H 3ARED 4FXLA 1XCQB 4KJQD 5B1BB 3HZYA 1CYWA 3AJ7A 5B8CA 4APXB 2CCVA 3QUYA 1NM9A 4TSBL 2WSPA 1UZ6E 5DHMC 5KN5B 1D5BA 4OY9A 4Z7VE 2K70A 2EVIA 2GCYA 2HFFA 4MZIA 2ATPB 2ED8A 4TQ8A 4WFFD 2VRAA 4KK5C 3VRIB 4CGUB 3QIBC 4PGJA 2C3VB 3VMOA 4P23A 1OIOA 2YD5A 3A3YB 3N9GH 3OXRB 3NQKA 5DJ8A 4HOMA 2RFXA 2VQTA 3DMMB 2BNRE 1ZTXL 1II4E 2DYPD 1XF3B 1Q0EA 4S1RL 3Q3GB 4CMMB 3VGAB 4DGVL 3C08H 4IBUA 3WN5C 2FHFA 1KLGB 1ZHBA 3CN0A 2F6AA 3BAIA 5F0JB 4NPYA 3EKCA 3U4EA 2ZAGA 3GRWH 4PWFA 4JPVH 4U49A 5D7JD 2C7FA 4MMZA 2XTSA 3OQ3B 3M1OA 1MVUA 2EIKB 3PP4H 4WQOA 4PRHB 1V05A 3LNGA 4MCNA 5DRWA 3TA3D 1TYJA 3RUGF 1N10A 1QEXA 2GY5A 2ZUXA 5T3XD 2N4IA 3AS1A 2B4CL 3D0LB 4EMZA 3CFJA 5EULV 4F8QA 4L4TA 4ZPTA 5FM5O 4E9XA 4Z7NE 3IFOB 3CZNA 4ADGA 4BCXA 4LSTL 3IMRA 2X44D 3FN0H 3DVIA 3VB8A 4MNHB 3MO1B 1IRAY 2WWMC 2EIMB 1CFTB 1KTKE 3MAWA 4I0PD 1RFDH 4LQFL 5HI4C 5EU6A 4TLUA 3FUEA 5SWQA 2CLRA 4Q14A 1A6PA 2FQGA 2UVEA 1QKZH 1UA6L 1KENH 2BIPA 4OLZL 5FM4A 4B9IA 3BUQA 1JXDA 4JRXB 1HINH 1HHIB 3UH8A 1TEGA 4X5PA 3CIAA 1EHXA 4FG6C 2AQTA 3RHWF 2VN3A 2XJKA 3ARDB 3KGSA 4F7PA 2BC4B 1W8NA 2X4TB 3EOAA 4FDWA 4L9DA 1AKJD 5AW9B 1HNYA 2QADB 3CDCA 3G04B 5JHDB 1JHKL 4HC1A 1ANUA 2IH3A 5A16B 1GC1C 4GXVH 4PTUB 3G5ZA 3KCWA 1NLBL 3QZNA 4LPXA 4RRPA 4TQPA 2X09A 5J12B 3KVDD 1L0XA 3BKMH 2ZKYA 4HBCH 3L9RB 4ZUSB 5CINH 5EU3B 2XYCA 4CU8A 5J89A 2VLRE 5KBKA 3BWSA 1E90A 4ISVB 2M26A 4M62H 3FW6A 3VI3F 2MNJB 4UT6A 1I8MA 1TUPA 2J71A 5INCA 4Z0XB 2P42B 3C5ZA 4AXWB 3F7PC 4FG6D 1CXLA 3HRZB 3AM8A 3UBGA 3VQLA 1AR1B 4FERA 3RWCA 4CMHC 2HTKC 2FD6H 4ONGH 3QNYA 1N64L 2E47A 2XFXB 1TZGL 3K1DA 4ABUA 1CLYH 2OSXA 4MA3B 5E9DD 3SKMB 3EJQA 3S97C 1O7DE 1DANT 3ARGC 1P53A 4OZIF 4PJ9B 4ZXBB 5K5YA 3KL5A 3DUUA 2J72A 1VPOL 2VERA 4IDLA 1JN6B 4XO5A 2DDQH 2EVHA 3IKCB 1T1YA 1NUNB 2AABL 4PJ5D 3OXSA 4G8FA 3B9KB 3T6VA 2JKXA 1TJHH 3SJVD 3UG3A 1BVLB 1DVYA 1BHGA 4MDRA 1M6UA 1I8KA 2DPKA 2J56A 3BYYA 4OIAA 4I77L 5HYSA 2F0CA 2YR3A 3WS3A 5ITFB 1NMBH 3PHQB 4DT2A 4AQAB 1BXAA 1EHNA 2OL3H 4U6YB 1S9XB 1V5JA 4C55A 1G87A 2X3BA 3B34A 5F7EL 1O0VA 2VLJB 1KEGH 3ATFA 1RMFL 5I1JH 3S5YA 1WA2X 5FA3B 3QULB 3F7YA 3KGUA 5FYKH 4HIJA 3M45A 3JVFC 4PJHA 4W9HC 2G2PA 5FXCH 1EGJH 1TKWA 3QQDA 2DQJH 2BRRH 1DSYA 1IGCH 2WLNA 3NIDB 1TQCB 4M5TA 2YUVA 3MA7A 2FX8H 3RE0A 4M6MH 4HULB 2Q8BL 3Q2NA 3UPRA 4P46C 1QI3A 3F7KA 1ACXA 1CL7L 5E2VL 2DL2A 3NQIA 4W9JC 1J0YA 5F9WB 2JK5A 1HXYB 3PDOA 2P9RA 4Q58C 5AB1A 3T8MA 3UGEA 3D05A 4DZ8A 3QZWG 1FWXA 4KUZH 5T5NF 4OD3H 2QGEA 5HYEA 3SPIA 2Y06L 4U1NB 3DROA 1LE9A 5I75B 2OZ4L 3JYBA 4TSAH 3I9GH 1RZFH 3Q2VA 1Q1PA 4OR1A 2WMPA 2C1PA 1HH9A 3RTQD 5LXGL 1E27A 1I7ZA 4JDTL 4CC4A 3GHBH 5CKAA 1RIHL 4Z7UE 2E6QA 5D1ZC 1GGBH 3C60C 1UADC 5FO7B 3W39B 4AX3A 1TF4A 2YD4A 1BAGA 5FCUL 5L2KD 1I9RH 4EUPH 2NY2B 2AJZB 2N7AA 1I75A 4XCYA 3G5YA 3Q13A 1U3NA 1X7QA 3KLHD 3T8XA 2YS4A 2WXGA 4ZG1A 4WU7A 4F92B 3ALPA 2E6PA 4KJYB 2D9QB 1FAIL 3SDAB 4EXPX 4LCCA 5FHBL 3OX8A 2GTZA 2Z8VC 4OJEH 5E4EC 1TIUA 4TVSa 3TEUA 2D4FA 4Y5YC 3PFUA 3EG9B 4NC1C 3S3DB 4X7EC 1GTFA 4ZMYA 4ABQA 3VI3A 1KZQA 3N41F 8CGTA 2WQVA 1IEHA 3E0GA 1SPDA 2LFGA 2OPCA 1EIBA 4RAVA 4JFEE 1DJGA 5E56A 4IRZH 4LARL 2NSQA 5EWIH 4R90L 2R69A 5AVYB 4KFZC 3MXWL 4HIEA 4ANWA 3AAZA 1S7SA 2FSEA 1JGUH 3BPNC 4IMLA 5LUMA 5E9NA 2FATL 1BZ7A 3OAUL 3OKMB 2ADFH 1U8HB 1UWXH 5EFIB 4PJ6A 4S11A 5DQ9B 4JM2C 3RZCA 5AKVA 3CV5A 1F42A 2J6EH 4NUPA 3FO2A 3FU7B 4JZNB 2DWDA 3IM1A 1T2QL 1KBVA 5A7EA 2G3ZA 1OPGH 2BS9A 2X4NA 1UWXK 1PFCA 3OKLB 2RMNA 3MUY1 1DYZA 4LBEB 5K1NA 1QNZH 2R0LH 2EVFA 3P69A 4MCMA 2DLTA 1LO2H 3PWJA 4N4YB 4EUPG 2ZCKH 2JWYA 3SQRA 2E7CA 1GIGH 1I1FA 2W80C 3DHMA 4M5ZH 4EKJA 3UDWA 2EDFA 3LZFH 3BO8A 2CLVA 5A43C 2EH8L 1HL9A 1UENA 4LRIC 4KWUA 1MHEB 1E2VA 3C6SA 2HAZA 2EYRA 2YSTA 1UJ3A 2P47B 2AAVA 3D9AH 4HBCL 3W37A 1V54B 3WENA 3QHZL 2X0UA 3P02A 4JFHE 4F9PC 5IQ9B 3RWDA 2YAMA 2R51A 3L4VA 5FR3A 1L3NA 3EFFA 1P7QD 2XWJB 1H8OA 1NBCA 4FKKA 5A2BA 5FA4A 3V4PH 3CFDA 2DH2A 3WCYA 1MHHA 2Z3FA 2IQAA 4M1DH 1IQWL 1OAQL 1SDYA 2PR9A 4NKDB 5DQDL 1SNRA 4W9DC 4PJGA 5DJ0A 1WD8A 2WKOF 3WMSA 1NAML 4NCC1 2JV6A 4B97A 5C0IB 1U3HD 4LSRL 5EIIA 2BPBA 3ARGD 1EEYA 4XBEL 2PTTB 4I48A 5LBVA 4KKLC 3N40P 4H88H 1AIFB 4YHLL 2AMGA 1QFOA 2HLAB 2GJZB 1A7NL 2OMXA 2WXQA 4Y5XC 3O8XA 2EE0A 3D69A 2G3XA 4RESB 1C08B 4ZT1A 5MEND 2UUDH 3ZDXE 4K9EH 1D6VL 3TBSB 3V6ZB 5TE6H 2R8SL 1I3RA 1MJ8H 3CFEB 4DZBA 1EXGA 3QI9D 1PQZB 5GGSY 2IH8A 5AW2B 1FL6A 1FYHB 1JNHA 2OW7A 3EDFA 3W11D 2V17H 4LESA 3QPXH 2RALA 1F4YH 4G3YL 1E6JL 1TZIA 4JPWH 4NHCL 3CXDH 4LDEB 1CR9H 2VUKA 4YHIA 1JZFA 4G7VH 4DFIA 5CGYC 5KYXB 1MSPA 2ZOOA 2C3WA 4U7SA 1EO8L 3VX0A 5I1LB 1DJWA 4HJJL 1RK0A 2BY1A 2FWOB 1YYML 3CX5K 4OUUB 3HZ3A 3VG0L 4M7ZC 3MBEB 5I8CA 3SBWA 2ITCA 4X6EB 2Y7MA 4GBXA 4O9HL 5LBGA 1SJEB 2KDYA 3I75A 4J5VA 3T4AC 3MRKA 3K4DA 4LKCB 5D7LA 2FX8L 2NX5B 2K6ZA 2BP0B 3LSOB 1H6FA 3EF7A 1PD1A 3MREA 3OAYK 4PR5A 3SDCC 4X0KB 3AADB 5IM7A 2P5WB 4I0PC 1FYTB 4OLUH 1NIFA 3VYNA 3L3OA 3AWFA 1CFQA 1V7NL 4DVRH 3KPNB 4HG4K 2HJLA 1IEBA 4GKSA 4M4RB 5IJDC 4UNTA 1KDIA 3ATEA 4QHKJ 4WUUE 4XPTH 5KVDH 4JDVB 2VDLL 4PJ8C 2EDOA 3IDJA 3VGGA 5GISL 4MJJA 5EBGA 4YDJA 1OAXH 5IB3A 5E8OA 4MZ3A 4ALAL 3OHXA 4BZ2L 5KSBA 2CIIA 4HUWB 4X8CA 2ALWA 4WAFA 1U8PA 4JDTH 3NGBC 2WXOA 3C2AL 4UYPA 5TE4L 1L6PA 1RHFA 3BAWA 4MLSA 2KKQA 5A7BA 1URIA 3ESOA 3L95B 2NPLX 2JFCA 4WV1C 4RMRA 3CVCA 3WNMA 3ULSA 3LZPA 3T6WA 5DMKA 1DDHB 4I4WA 1OK0A 1CLVA 3KPSE 1KCWA 2N7BA 1QRKA 3MRBA 4UZGA 3QJHB 4J8RB 2PTUA 1O9ZA 4KRPD 1NLDH 4XNMA 5EA0L 4A38A 1BFOA 4NQEB 2PLTA 4DOHB 4P9MH 5PAZA 5JORA 5FYJE 2EKJA 1IBGL 1PF3A 4JFFA 3R7RA 4JJOA 5F3BA 2HKAA 2DLFH 2PCFA 3FFDB 3BOVA 3NESA 5F1KC 2K4WA 3IDMA 4JFPA 1OSPH 1HHKB 1E9PB 2I85A 3LKPB 4IRZL 4LARH 2HMID 4XX5A 3UYRH 5CR1A 2EDNA 4YZFF 1LHZA 4UTAL 4WNSA 1YNKH 2WQRA 3HE7B 2JSFA 3GS0A 1A4JB 2CJUL 1Q94A 2E46A 3CWGA 4TF4A 1D5XA 3FT2A 2RQ8A 5K69A 3KH4A 3HPLB 3VWJA 3ULUH 5ESAA 3T08A 4BIKA 3ZHNA 4NQCB 5EZLB 2SODB 4FI6A 2MCPH 4GW1B 2EO7A 1NEUA 4MVBC 4AJ0A 5DJ2A 4A67A 4FNUA 4MQXC 1HILA 3ZQXA 4U2YA 3T04D 1PBYA 2HB0A 3B7SA 1OAUH 4NENB 3L54A 5AYTA 5FDYA 1CFSA 3IXAA 3ZYJA 4C83A 1LM8V 3V52L 4R26H 1BV8A 4K5LA 4OFKA 3A22A 2CRMA 5J3HC 1NMAH 2WM0A 1B4RA 3TYFB 2P3YA 2B14A 3CMGA 2GSGA 1TJIH 1BQSA 4Y2OB 4Q9QH 2YQ2A 5A2AA 5KYYA 1JNNH 3P4MB 3IPFA 2F54B 4WK0B 2Q7AA 1KBPA 3L3JA 4GEJA 4LLWB 3VXOB 2W38A 3Q06A 1QW8A 1KJMA 1MWOA 4JFUA 5EORH 4D3CH 1CE6A 5DD1L 4LOEA 4NXSA 5D71L 4L4TE 4K8RC 1T6WA 3V0VB 1EBAA 4I85A 5FYKU 2XG4A 5GSRA 1YMME 5DMIH 4M61B 5GGRA 2NX5E 3N43B 3TN0B 4Y5XB 3HAEA 2VYRE 3ZN6A 4MTMA 3Q6GL 3VXUD