1ILSA

X-ray crystal structure the two site-specific mutants ile7ser and phe110ser of azurin from pseudomonas aeruginosa
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
AECSVDSQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of the two site-specific mutants Ile7Ser and Phe110Ser of azurin from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Metalloprotein
molecule keywords AZURIN
total genus 33
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1995-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ilsA00
5B1BB 3X1NA 2VN3A 3T6XA 1MDAA 1OF0A 4UAHA 5ANHA 1SHWA 2PLTA 4E9RA 4HAKA 4JKNA 4W1TA 1BXAA 3NP4A 2CBPA 1XMEB 4DP0X 5B1JC 1SDDB 5B3SB 1A65A 1AIZA 4N4YB 3EHBB 2VM3A 4HCGA 1WA0X 1WAEA 3KW7A 3EF4A 2UX6A 1GR7A 5PAZA 2OJ1A 3OD3A 4FA7B 3G5WA 5I6LA 2W88A 2PPFA 3T6WA 1N70A 4A67A 1CUOA 4A2FA 5I6NA 2FQDA 3BVDB 1JZGA 1L9SA 2UX7A 4BXSV 3CVCA 3QJQB 4W9ZA 5AZUA 2HXAA 4F7KA 1PNCA 3IBOA 2VW7A 4DP2X 2BZCA 1E5YA 1V10A 3PLYA 1XB8A 1A4AA 4AZUA 2EIJB 3ERXA 2AANA 5B1JA 1ZDSA 3TA4D 1ASPA 4YSOA 3NJHA 1A4CA 1AG6A 1BQRA 3DTUB 1AR1B 2PPAA 1AS8A 3FQ1A 3WG7B 2YQBA 3AG3B 2J5WA 3NJNA 1PZAA 2GI0A 4JHUA 4HCIA 4AKQA 1AZCA 2JFCA 2AZUA 1PLBA 1ZIBA 1NZRA 3S8FB 3ZX1A 9PCYA 3FPYA 2PPCA 4UF7C 3WIAA 1CYWA 2FT8A 1W6LA 1ZPUA 1AS7A 1L9QA 2IDFA 1AG0A 2GB2A 2CJ3A 5A7EA 1IKOP 4HHGA 2DWTA 1JXDA 2UXVA 1KBVA 2IWKA 1PLAA 2UXTA 2IDTA 2BWDA 2J55A 5IY5B 3ABLB 1W8EA 7PAZA 4QKTA 3UAEA 5I6KA 3C75A 5B1KA 1QHQA 1IUZA 5AKRA 4A68A 1NICA 3ABKB 1WS8A 4P5SA 3V9CA 2BW5A 3PPSA 2MTAA 1OV8A 1HAUA 2DV6A 2WO2B 4KNSA 1V55B 4WKXA 5I6PA 3NSFA 2DY2A 1MG3C 1GS7A 5D4IA 5I6MA 1JVOA 2PPEA 3NJIA 2BHFA 2BW4A 3NJFA 1JZEA 5TK2A 1L9PA 3FQ2A 1N68A 4M4RB 3PAUA 3T6ZA 1PAZA 2XVBA 3T6VA 1PLCA 1RKRA 1TKWA 2BWIA 1YLBB 3NJGA 5E9NA 1SF5A 1ASQA 1ILSA 3OMNB 3N55A 2UXGA 1GS6X 3CDZA 2Y1AA 4GYBA 6PCYA 2DYRB 2YXVA 4P5RA 1GY2A 1ILUA 1ID2A 4GP4B 1BXUA 2YAQA 4YSQA 4AI7A 4DP4X 3GXUB 3RYMA 1FFTB 2X88A 2HRGA 2E86A 2XUWA 3WKPA 4G7RB 1NIAA 2PCYA 4E9YA 1A8ZA 3QJRB 3FU8A 2XX0A 1CURA 4YSTA 2PP7A 2FTAA 2N0MA 2VSKB 4CSZA 5D4HA 4KO9A 1PF3A 3X1FA 1JZHA 1B3IA 1J9QA 1L9TA 2QDVA 2YARA 4E9TA 2R7EB 2BP0B 4A2EA 1BYPA 1KYAA 4A66A 1UATA 4HHWA 3ABGA 3UGEA 2XU9A 2XV3A 4DPCX 2XX1A 3L45A 3BQVA 2I85A 2FQFA 2IDQA 2XV2A 1AZUA 1WS7A 3WNIA 4FAAB 1SFDA 1HFUA 4YSCA 1PY0A 1HAWA 1ZV2A 3SBQA 1L9RA 2VM4A 2YAEA 2H3XC 2WSDA 2TSAA 1WA1X 4YVNA 1JZIA 1GS8A 4AKPA 4KNTA 3NYKA 2Q5BA 1ASOA 2A3TA 2CALA 2YXWA 2HX8A 1SJMA 4YSUA 3DIVA 1WA2X 2HZHA 1A4BA 4F2EA 3CVDA 1E5ZA 1L9OA 3OQRA 3QJTB 1RCYA 2DWSA 3ABMB 4G71B 1QNIA 1RZQA 2IDSA 2P80A 3QJSB 5B1AB 1FWXA 1A3ZA 1I53A 4AKOA 5AFAA 3PAVA 3IN2A 2HLEB 3UADA 3S3DB 2EINB 3HB3B 1XB3A 3IE9A 2FWLB 3UABA 2ZWNA 3FSVA 4DP8X 4HALA 1E67A 2ZOOA 1URIA 2IH9A 2IH8A 2YAFA 1JXGA 3FPXA 6PAZA 3FSAA 4GY4A 2EIKB 4G70B 3SBPA 2AFNA 1IBZA 4PAZA 3V9EA 1AANA 1OE1A 3PXLA 4KOBA 2EIMB 5I26A 1PCSA 3FYIB 5EHFA 4DP7X 1OCRB 1JVLA 1IC0A 3NSDA 1CYXA 1ZIAA 1NIEA 3NT0A 4DPBX 2GHZA 1GSKA 2OCCB 4DP1X 2Y69B 2PP8A 2X87A 3NSYA 4UANA 2PPDA 1MG2C 2GC7C 2W8CA 1EHKB 1AACA 2QPEB 4Q8BA 3FSWA 4E9WA 2YAOA 2AVFA 1X9UA 2FQEA 1F56A 1NDTA 2XXGA 1KCWA 2I7OA 3SQRA 4BWUA 1R1CA 1M56B 2FNWA 1SHXA 4BWWA 2DYSB 4RH4A 4ENZA 3N2JA 1J9SA 3FU7A 5TK4A 1AZNA 4EF3A 1MZYA 4JHVA 3ZDWA 3WNJA 4BK5C 3JTBA 3WKQA 2FJSA 1BXVA 2FT7A 4N8UA 2YAMA 4KOCA 1NIBA 2BO0A 2IDUA 3TU6A 2BP8A 1OCOB 2R7EA 2YAPA 5I5MA 2GC4C 1KCBA 2BZ7A 2FQGA 1NPJA 3AW5A 3X2QB 2XV0A 1M9WA 1FA4A 3FYEB 5F7BA 3AG1B 1NIDA 4BWTA 3FQYA 4NB7A 1SNRA 3AG2B 4DP9X 1PMYA 3NJMA 2GSMB 3D12B 2PP9A 1KBWA 4E9QA 3NJKA 2H47C 3AZUA 5I5JA 1JZJA 4QLWA 2EILB 4YL4A 4BDVA 3TBBA 1J9RA 4YSPA 4BXVA 3S8GB 3FU7B 1ZDQA 5I5IA 5I6OA 3CVBA 1AS6A 1ETJA 3CG8A 4GP8B 4E9XA 1J9TA 1ET7A 1ET5A 1NINA 2XXFA 5I28A 2B3IA 1RZPA 3X1BA 3T9WA 1OCZB 1E65A 4AX3A 3ASNB 3GDCA 1GW0A 1JXFA 1AAJA 1NTDA 4TXVB 2HX9A 2QDWA 2QPDB 2JXMA 2B08A 2HRHA 3QJUB 3AG4B 5D4JA 1T5KA 3S3BB 3ZIYA 1GYCA 4L0PB 1BQ5A 1AZRA 1BYOA 4YSRA 1E30A 1GY1A 1OCCB 1KV7A 2FT6A 2VMJA 1JZFA 2IAAC 4YVUA 4HIPA 5LDUA 3KW8A 3ZBMA 1BEXA 4YSSA 4G7QB 2VSMB 2CCWA 3IN0A 1KDIA 2CAKA 5FC9A 2PCFA 4CSPA 1OE3A 4YSEA 1M57B 2MRYA 1J5CA 3UACA 1KDJA 3FSZA 4DP6X 1DZ0A 3MBWB 3H4HA 1NIFA 1X9RA 4DP5X 4KO7A 2IWFA 3NJLA 2OV0A 4YSDA 3QQXA 3AY2A 3S3CB 4A2HA 2LLNA 1SFHA 4KO5A 3H56A 1J5DA 2QT6A 4HCFA 3GYRA 1SF3A 1BAWA 4MFHA 1KGYE 3JT2A 4NAJA 4F2FA 3X1GA 3HEIB 1CC3A 3ASOB 1OE2A 2J56A 5B7MA 1BQKA 1VLXA 2IWEA 1W6WA 3H4FA 4A2DA 2JKWA 4HZ1A 3TASA 2ZXWB 4GXFA 8PAZA 1NWPA 2VW6A 1QLEB 2AZAA 3WI9A 1DYZA 1PZBA 2HX7A 4G7SB 1PNDA 3U25A 4E9VA 1IBYA 1AZBA 3NSCA 2WO3B 4K9JA 4M3HA 3NJJA 3NP3A 4X4KA 2GIMA 3FT0A 3FU9A 1ET8A 3DKHA 1JERA 1TU2A 5PCYA 3OMIB 1TEGA 1TEFA 3EH4B 2P80D 2XLLA 2H5UA 2BP8B 2BP0A 3T71A 4KO6A 3MX0B 4WTQA 5B7EA 4DPAX 3EH5B 1NPNA 3OMAB 1JOIA 3CZUB 2GBAA 2UXFA 3CDZB 1SDDA 2CUAA 2XWZA 2ZONA 1V54B 4KNUA 1AQ8A 1ADWA 4A2GA 1NWOA 3UAAA 2RACA 2J57A 2XYBA 3IEAA 1PZCA 3X1EA 3QPKA 4PCYA 4GP5B 4ZK8A 3TBCA 1XB6A 2YAHA 3OM3B 4E9SA 3FS9A 2TSBA 2Q9OA 1AOZA 3PAZA 3QJVB 4BDVB 1EZLA 4G72B 4NERA 1OOWA 2NRDA 3PCYA 3SBRA 5B7FA 5F7AA 4Q89A 3EH3B 2VW4A 4YSAA 1MZZA 2I7SA 7PCYA
chains in the Genus database with same CATH superfamily
5DGRA 2WN2A 2C4XA 1E2WA 1DBBL 1Q72L 1Q9WA 2DLFH 4BQBA 4R90H 5DFWH 3FC8A 1EAQA 4BE6A 1ODUA 3QS2A 1HIMH 4IS6B 3OAZH 3G04A 4OLXH 1P53A 5CO1A 1E28A 4UV7L 2IQ9H 3K6IA 1BZEA 3GF8A 4MYPA 4YDLB 3HNVL 1K6QL 32C2B 3QZMA 5CMAA 5EU5B 3GMRA 4HWEH 1YC8A 2VDPH 3X11B 2ZCHL 3EGSA 2VDQL 2YUZA 3FTZA 1N3NB 3LMJL 1S2EA 3QDMD 4UT7L 3LEYH 2VDLL 4W9ZA 4F7KA 5IMLA 3TJPA 4N5UA 3GSUB 5CZXD 3SOBL 3CQQA 3QZNA 3WIHA 1V7NH 5KOVC 3W9DA 4PGCA 4YFDB 3Q2LA 4ALAH 5C2BH 2IGTA 4LGPB 1DANU 1PZSA 4Y4KD 1QVOB 4PGEA 5JTWA 3WTSA 2OMTB 3NH7L 1R3LA 2NY7L 1K8IA 1NCDH 1N4XL 2MCAA 3RHWF 4AYDC 3L7EB 3VXRB 5I0VA 1WF5A 4WW1B 3IF1A 5J4MA 4NBYB 4RGOH 1A7PL 3R0MA 5IIEB 1NANH 4HCIA 4U1JA 4XP1L 4G7VL 1Z3GL 3ZX1A 3D69A 4DO4A 3D7PA 3ESNA 1CYWA 3O9WD 1UXSB 4I3RH 3LKQA 5TQ0H 4D94A 5L2JB 1TEYA 1JF1A 2Z65C 4IU3B 4LSDA 5IHUH 1THCA 3CXHK 2CJ3A 1TLMA 4U3SA 3HFMH 2X1QA 2UXVA 1YPZA 2PYEE 4JRYB 4AIZA 4F9PA 2ZE0A 4EVNA 4FP8H 2Y7LA 4L3CA 5IY5B 3ABLB 1EEUA 2Y5TB 3F6IA 4LB8A 1A5FH 3N42B 3BPNC 3S4SA 2COQA 1NCOA 4LF3A 4LU5L 5EORH 1BVZA 3WO4B 3GJFH 5ADPH 15C8H 3MRLA 3V0VB 5KEZA 2DIJA 2AW2A 4JRLA 4AXWB 3VWJB 1E5AA 2YEZA 1TT6A 1UWYA 2WMPB 3MLSH 4WKXA 2ZNXA 3VFRB 4X6FA 1P6AB 3UL4A 2DY2A 5ID1B 3K74B 3MFFA 4KK6D 1RZJC 1S6NA 5F6HJ 1JK8B 3CVHL 5KSBF 1IL1A 4K2UH 4K5NA 1NCBL 3BFOA 2XWBA 1AOZA 4X99A 1J1OL 1DHKA 1YLBB 3RA7H 3SQOL 1N0LA 2LVEA 3WGUB 1IEAA 4JKPL 5E9NA 2EVJA 5JDSA 5T1MA 3FAXA 1TCRB 2XZQL 1KN4H 1I1AC 1ED3B 5FDWB 2P8LA 4GYBA 1WCBA 4XC3H 5E6SB 1LEKB 5E9DB 3JXAA 5D2NC 3TA3C 3VU1A 1HL5A 5H8DA 3SDXA 3VCLA 3B5TA 1UWXH 5F3BA 4NQXB 1T5XB 1BEYL 2V7HB 1T1XA 4KROD 4NKQB 1HHKA 1B9ZA 2DDQH 3DX9A 3PWPB 4RESB 4K8RL 4XNZB 3TJEH 1DQTA 1KY7A 3HBQA 3WHXA 4UQEA 4BE5A 1N5YL 2ZUVA 2XX0A 3MREB 2PP7A 2N0MA 3UTSE 3VTMA 3DK2A 32C2A 4OBSA 5LBVA 1OSEA 4JLRA 5FGCB 1T0MB 2EXYC 3N0PB 4MYWB 3Q5TA 4CKQA 3GRBA 2EZ0C 1B3IA 1L9TA 3DX8B 2QDVA 1N12A 4QF1B 3BI9X 2XV3A 4E41E 4M1DL 4MB4A 1WWAX 2NX5A 3FT4A 3FONB 4I0PA 4A7GA 1OAJA 1FGVL 3TPUA 1C5BH 2BSSA 3O3DA 4G8IA 3HCVB 1A7OL 3CFJA 1R3JB 2Z4TA 3DI3B 4FAAB 1I9JL 2HMIC 1HFUA 3L7FB 3K6FA 1KJ3L 1FGNH 4NGHH 4LBEB 5JQIB 4GG6A 1XR8B 1A6AA 2DIEA 3NZUA 2ZYSA 4HWZA 4AEIH 4CUCA 1AQKH 1B2WL 4B9ZA 3MV01 3O4LB 3B2DC 1DTUA 1IGTB 2BNRB 1RUML 3LHAA 4YDNA 5L4IA 4DGVH 3F04A 4ZAKD 4RZKA 3H9SE 4RLDA 3ZT7A 1GJIA 2BC4B 2IDSA 5CCKH 4F58L 5HI3D 2H4EA 3MODH 3V6FA 3DO7A 1O5DT 4IRZL 4KJPC 2NXYC 1MIMH 1MFCL 4X8JA 3GSRA 3WE6B 5F9JA 1OSZA 3RAJH 3DTXA 4B3EA 3DPBB 5SWSD 4YHZL 1AGFA 2LFGA 2C3HA 5FO7A 2VDKH 4OW6A 3D18B 1D5ZA 1BX2B 4F8PA 4XWGL 3FN0L 1ZLUK 1PY4A 5GGUA 2NCEA 1U58B 3HHSB 3ZJAA 2DB8A 3KYMB 4NFBA 3APFA 4BK5A 3OV6A 4NO3A 3EH1A 2WB1A 4Q4EA 5IGXL 3BPOC 3IRPX 4MJHA 3VXOA 4MZ3A 3KDMA 3C6SA 3LH2L 4WSJA 1PZUB 1EDQA 4NHCL 3GSNA 3UC0H 25C8H 4GUQA 4HKZB 3MRGB 5BZWB 2PN5A 4KFMA 4R97C 1U8OA 4ZW6A 5TE4L 3T0WA 4GG6E 4OJAA 2YAOA 5ITBH 5J3HD 4YHZH 5HYQA 3BLPX 3SJVB 2PR4H 2XN9D 4BWUA 3BQUB 1D6EB 1SHXA 2GJZA 2ZKMX 4NAMA 3ZR5A 3WY3A 4AJVA 5C0AD 4RH4A 2YUVA 1MI5A 2G0LA 5CEXB 1T7YA 3KPRA 4OZIE 1J18A 2NY1D 2P8MA 4JHVA 5D4QA 4QHMB 3WNJA 4LPWA 3HOGA 4U1HB 3RY4A 3ZZSA 3PP3K 1QR4A 2YR3A 5E94A 3QEGH 1AI1H 2I60H 3F6LA 3N41B 2FJSA 4ZOAA 1HHKB 3PWPA 4L4VE 3S3JA 2VDRL 1S78D 5AOIA 3GI9L 3SKOB 2AKRB 1WGVA 2XZAH 2WUBH 2GC4C 3K4ZA 4PJCA 1CXEA 1FLTX 5D2LE 1IBGH 3GMMB 3PFQA 4Y1SA 3VNZA 5KSBB 1M9WA 2RA1A 4KU1A 5CLZA 3AQYA 3C2AH 3W57A 4HPHA 4Z23A 4ABQA 1BGXL 3L4TA 4TUOB 3U4AA 3QUKB 3UPRB 5HYEA 2Y3AA 2X4SB 4JJ5B 3KXFA 1E8WA 1F6FB 4ZX5A 2OZ4H 4JCLA 3L17A 3NSXA 3MYJB 1EZUA 4PJHA 4U2YA 5DR5L 2VGLM 3NCYP 4M1CC 2JLLA 3MNVA 4YL4A 4QF1A 3EAKA 3PABA 2ATPB 4DUVA 4K3HA 4GSRA 4J4PA 1JL8A 2W0PA 1MRCL 4GXVH 5F1IB 4MBOA 3WFEH 4DQAA 4G6ML 5L2KB 1E5BA 2WXNA 3QWRD 4AL8L 4TL5A 4PJXB 2BVEA 3OHXB 4KK9C 1TTGA 2PCPA 4KRLB 2ADIA 2DLFL 3KWTA 3AREA 1E5UI 3BYYA 4JY5L 3O6FC 3N44F 1XHHA 3SODB 3ARVA 4I5BB 4AX3A 3BKCH 1C5CH 1A2YA 2FH8A 4PJDA 3QUXB 3ALXA 2PKDA 4TNVK 1UJTA 1J8HE 1MJ7H 5AALA 2V2TB 1AP2B 1BQLL 4LPYA 1PG7L 3UTZB 2XQ0A 4JRYD 1RHFA 2W9DL 4P4KA 4AWJC 1RJCA 3ZYIA 4Y5XA 4ODUB 3OGOE 5DLLA 1A6ZB 4B9JA 5LDUA 5T5FH 1KZQA 1TO4A 3D9AL 4Z0BL 2HMID 2XTJD 2O5XH 2CAKA 3V10A 4PRAB 3H3BC 1CFVH 5AUMA 4GUPB 1M57B 3PREA 2YSTA 4JG0H 3UACA 1PZ3A 3MRPB 3FUKA 1L0PA 4RRPM 5I1JH 5JW4Q 2VN7A 1CGTA 4W4OA 4O51A 4Z7WF 4MCZB 5DZJA 2NX5E 3T2QA 4DEWA 4FFTA 5E5LA 1TYJA 2Q2EB 1C8QA 2K6ZA 4NO3B 4WHDA 4Z7QF 3DX2A 1EJ6A 4XZUA 4M48H 3S37H 4M1CD 4H1LA 3KVDD 4KV5E 1EUTA 5TDOA 5HI3C 1C5DB 5CWSB 3OKDB 4WWKB 4XE0A 2AV1A 1MIEH 1RUKL 2FGZA 5T5FL 1FNFA 3WJLA 4XCCH 5B7MA 5KYXA 1FHNA 1K2DB 1SYSA 1KBGH 3QRLA 1KGXA 2AZAA 2IEPA 1KXTA 5KSVA 1KJMB 1EO8L 2WWKO 4LKCB 4PJHF 1FDLH 5L2KE 1MAJA 1IBYA 1NPUA 1OY3B 2QJDA 4H4NA 2FX8H 1XVSA 4HV8B 1PYWB 3SGKA 1G1CA 1X5KA 3BP6A 3TJHC 4MNQB 2GY7B 3AMLA 2UWEB 4PRPA 4YGAB 3W9DB 35C8L 4EBQH 1WFUA 2CRMA 4FTVE 2RCSL 1MVYA 4K9EH 4WFHE 4WSKA 5PCYA 4IMLB 1T1XB 1NAMB 3JT0A 3RVTD 4RAUA 4OKDA 2ADJB 3MRGA 4GXUM 5D2NB 2ZUTA 3VXRE 1E4KC 3TNMB 3SPVA 3W3BA 3LNHA 1S7SA 5EG6C 3ML8A 5FUZL 4AL8H 1YEHH 3KL3A 4OCRH 4M3KB 3KR3H 4K23L 4ONHB 4L9LC 5ABDE 1M7IB 3TFBA 2CRZA 5D2LA 1FZKA 4FE9A 5JA9A 2K8QA 2XYBA 2J57A 5E8EA 5A2CA 3L3JA 4PCYA 1KLGB 1ZHBA 4KRPB 2VDNH 1DL7L 5E2JA 5I6XC 5MP6H 4H8WL 2FB4H 4F80A 3C5ZA 5CR8A 3T0EE 2BIOA 3QJVB 1F0LA 5E8DH 4MD5A 1FAKT 4GBXC 4NHUB 4XNXH 3UGXA 1IIKA 1QA9A 2X4RA 5GRVL 2CSPA 4PH8A 4OZIA 2E56A 3HG1B 1NCCH 1TTBA 2FH6A 5I26A 2XZAL 4P48A 2F5AH 4NWTH 3OLEA 5DMGC 5KW9H 1OM3L 3BZ5A 3IGAB 4Q9BA 3BISA 1E8ZA 3LSOA 1UUSA 4LPVA 4LSQL 4FLHA 5JHLA 3EZJB 2J8UE 1JNNL 2XZCH 3EF7A 5I0WA 1LO5B 4AEHH 1GHFL 1XF3A 2OR9H 3EYOA 5CGYC 2KMWA 1CFSA 2OX5A 3KYAA 3V4VA 4H0GA 1AD9A 1D9KA 2H7WA 2XWBB 4GXUN 2J72A 4O2EA 1XGTA 3PQYE 5C71A 3K6SB 1I4FA 1JTOA 3COOA 5C08E 1O6SA 1QHPA 2MOVA 1KCSL 2R0ZH 3QIUD 4OTXL 4G8FA 4YK4B 3BPNB 4OLZL 1SN2A 1IKNA 4N0UA 2R9HC 1DVSA 1EBAA 1FZMA 1ZT1A 3QDGB 1AQHA 3PRZA 4TSBL 2H9GA 5J3HC 1UT1A 1XGPA 4A55A 1U8NA 1YMME 5CJXA 4PJ7F 3UBXA 1JUFA 1CFVL 3CZEA 2EIJB 3VE0A 4B9KC 4FJ6A 1CGVA 4HOWA 1ASPA 5M7QA 3T8XB 1AG6A 2GJJA 3QAZB 4MCZA 1FE8H 3SDAB 2X70B 4MD0B 4WFGE 2J5WA 4OCWL 3SJVD 1F86A 3GKWH 5FFLA 5FECB 2KH2B 3DWTA 5K39B 3MUY1 3J7HA 4TYUA 3HS9A 5DJXB 1S78C 2GITB 4MQ7A 3P2TA 1G7LB 2XPGB 5CIPH 5DLML 4FKEA 1E8XA 4ZXBD 5I1CL 5LKNA 1RD6A 1MHPL 2JQZA 1L9QA 3G6JA 5BQ7B 3TA3B 3UROR 5A7EA 4F3FA 4MKTA 4CRPA 4PW3A 3QHZL 4XP9H 4TQEH 1P9MC 3MBEC 3LIUA 4BEIA 5C0FA 3PIQA 1JIBA 3MOBL 1X5GA 2G3XA 1XTMA 1BDYA 3MUGB 1VIWA 1VJSA 3Q1EA 1AQKL 3HCVA 1BIIA 1QHQA 2NYKA 4G5ZH 1IX2A 2P1YA 43C9A 1J05B 5INDB 3HFFA 5JHBA 5I5RA 2AKRA 1WIOA 2YEQA 2AERT 5EBMA 3QC5X 3E6HA 4U1NB 3B5GA 5FYLL 1SVCP 2DM7A 4FQHA 4YHIB 2XY1A 3EFDH 1QHOA 5ICXB 3N9GH 4HUWA 1NAML 4OT1H 1WP6A 4R7LA 1JVOA 1U2HA 3MLYL 2BW4A 5EPMB 1MW0A 5FYKH 3FQ2A 5IEKA 1N68A 4M4RB 2OLDA 1HZLA 1E40A 3VMOA 1PU0A 5IUCA 1FFPA 3FNKA 5T1LA 2GG1A 1NGQH 3CAFA 1ID5I 1OPOA 2X89A 1JHKH 2GSGB 2XVLA 5DTFB 4LDCA 4OZIB 2ZG2A 1ZSDB 5E9DD 3I9PA 4WO4C 1J10A 2OMXB 2LU7A 3P11H 1PX3A 4Z7UE 2E9WA 4UQIM 4YIQB 3L2NA 2ZSVA 2BFGA 2IV8A 1Z9LA 1CT8A 5IFAH 2R0KL 4JMXA 3WKPA 2XHNA 4HH8A 1KN2L 2XICA 3LOWA 5C07D 2W65A 4DPRA 3H7BB 3PWUA 4Y16B 1BVNT 3VFWA 3WOVA 1DVZA 2YRZA 2B5IC 2FTAA 4DW2H 1B0GB 1Q9OB 4HBCH 1P4LB 4AGOA 1JPGA 1KN4L 5JW5A 1NUFA 1WFTA 2V0AA 1X7QA 4HVBA 3MRMB 2VXSL 3FHEA 2CDFB 3ZMNA 5EOCL 4KX9A 5DJZB 3KYKL 3N1MC 2WXJA 2YPLB 4RMSA 1NC4B 3LZOA 3DMMB 2D3LA 3O6KH 4G7VH 4DTGH 2ED7A 1HX0A 5D1QB 1AGBB 5DUML 3FOMA 3TYFA 1MVUA 4PJXA 3WN6A 3U6RA 4FFVD 3SDCA 1CXIA 2IOIA 2WIIA 1OP5H 4L1HA 4WI2A 4ABWA 2Z35A 3QDHA 2IFFL 5LGYA 3EHBC 1U4FA 2CJUL 4L1BA 3WAJA 1AHKA 1P4IL 4KY1L 2ZKYA 1A5FL 1ZWIB 2JIXD 1NJ9B 2EXTA 2H6UA 4UQ3A 1T5WA 3NQKA 4P3CH 4XC1L 2QVKA 4AQ1A 5MEQB 1T03H 5K39A 4PTTB 5KS9B 3MMEA 5EZJA 1U8IA 3RVXD 1S8DA 2CR0A 3N5AA 3NFNB 3VO0A 3ZL4H 4JKWA 4JCMA 1AO7B 5ALCL 1GVIA 2G3ZA 4NXSA 2OYLA 2WNGA 3BZ4B 4H88L 3IN2A 2IBGA 3AADB 3BKJH 3UADA 3T8XA 2NLJA 5I8EB 1XB3A 2FWLB 5FKPB 1ZANH 2IH1B 2AXHA 4LCUB 5L2KA 3RIFF 2YGOA 2E46A 5JOFB 2BZDA 4QRBA 1THAA 2JKIS 4NXKA 1T21B 3VXUB 5LXGL 1SOKA 2A2QT 2YBGA 2AFNA 3OKMA 2E75C 3IJEB 1AANA 2KLTA 3MLXH 5IR1B 1OANA 2YC1A 1VSCA 1R0AL 2GYSA 4HQQH 1OP3K 3A47A 4PJ5D 1RIHH 4B96A 1CXFA 1RIHL 4LAJH 5DLMH 1ZIAA 3M17B 3G6AA 1RURH 3Q7JA 1TZHA 4Z95L 4ZS6D 3T77B 3TH2T 5LO7A 3LQZB 4NNXB 1L7IL 3HZYB 3SO3B 4M4RA 5AOJA 5AYQA 4OQ1A 1TJHL 1DJSA 3LV3B 3Q8AA 3KJ6L 4K9EC 3C2AL 4ZSOA 2YKLH 2LTQC 3ARBD 1I7TA 4I18A 4X0NA 5KVDH 1C1EH 4ODHH 2GSIA 2VLKB 4RMVA 4WK2B 1M56B 3GS7A 5DGQA 3RWCB 4KK6C 3V8OA 2DYSB 4C56B 4DQOL 1J9SA 3VTTA 1AZNA 1J0JA 3EYQC 3QIWB 3WS3B 4DKAA 4EF3A 1ZS8A 2Q76B 1U9KA 3UBXG 1KEML 1BM7A 1LILA 1U8CB 2MPAH 4TM9A 1XX9C 2PW1A 1D5MB 2YBRB 1KCSH 1RJLB 4KOCA 1DQQB 2DQEH 2IVFC 2JELH 4W9DC 3ZHDA 4RFEB 2AABL 2EAEA 3IU3B 2MMXA 4IJ3B 5DC9B 1J1OH 2PYFA 5FYKU 4HHAB 4U6HB 5F0JB 4DH2A 1J88A 3GMLA 4QTFA 4QHNA 4ONHA 3AG1B 1T04A 3BVNA 4NB7A 2E7CA 3QIBA 4KNQA 4LVEA 4IBTA 1Y1UA 3MXWL 5GS0D 2NW2B 5HDBB 4ZX6A 1ZLVK 1OW0A 3S88H 1KXTB 2P48B 4JPIB 4XE5B 4GKZB 1MCRA 3B7RL 2ZXCA 4X9BA 1INDH 5I2IB 3VGHA 4NQCA 3FFCD 1QWNA 4P4KC 1MFEH 2JLPA 4OGXH 3FU7B 3QVAA 4K3JH 1MHEA 2HLAA 4YHML 1ZDQA 4Q6KA 2NSXA 1KTRL 5ID1A 2FX9H 5L7XL 4I0KA 1KLFB 3GRWH 3KGTA 1X9QA 2VJ8A 4XXWA 5FO8B 2Q3AA 3HMWH 3CTTA 3KPMA 2MKWA 4NM8H 4BSWB 4APQB 1QD0A 2K70A 4R4FH 1CDJA 1D7FA 3LSOB 4G6KL 1YJDH 3K0YA 3L5XH 1JNLH 3F3HA 1IGFH 1NOFA 4DKTA 1T5WB 4N5EC 5D70H 1PJ9A 3AG4B 1P5UB 4D3CL 3ZYJA 1HQ4B 1IM9D 3DPDA 1GYCA 2YFOA 3KVQA 3TYGH 4H5SA 5TGBA 1BYOA 3BAIA 4XN2A 3V4VB 1UWEL 3WSQL 2ZYRA 1C08A 4WI3A 3EXJA 3S3PA 2BOLA 4CDHA 4F15C 3QULA 5D1ZB 4K0OA 5DS2A 3NESA 5AVRB 4Z5RA 5GZOA 2ESVA 4FJYA 3DC0A 1OGAE 2J1WA 4NCC2 1A64A 4B3VA 3IN0A 1R6VA 2IOOA 4MMYA 2AK1L 1GRWA 5KSAD 5E2VL 2Z31D 2MCPL 4AW4A 3MBEB 3IDMA 1KTLB 4H8WC 1FNGA 2L0DA 2F7OA 1OAQH 2ORBL 1KJ2A 4FERA 4HEPG 5IMOA 3UBXB 1G0XA 2VZSA 1A6TA 1U3ZA 5I1IH 2PTTB 3QO0B 3F7VA 5MHSD 4YHIA 4IOSA 3UTSD 2NXZC 4D9RE 1PD0A 2PMZA 4MJ2A 4WJ5A 2NW3B 4K94L 1UWGH 4IIQA 4R3SB 2LABA 5B8CC 4N6RA 4XAWL 5EU6A 1S9YA 2WCSA 2BH0A 4GW4A 4NWUH 3WN5C 2EDXA 3ASOB 1ECZA 4NC2B 2VLRD 3IWUA 2BVPB 1ZHNA 1SZNA 3GLDA 2O5NA 2VW6A 1QLEB 4GPVA 4ODSL 1GAFH 5GS2D 2XACC 4TQ8A 4TLKA 1CDHA 3BQUD 1NA8A 1BQHG 3FB8B 4Z7VB 4TLSA 3RWIA 4QRUA 1I8KB 5D6CA 5IK3B 3VD3A 5T1KA 3D69B 3EYVB 2QBWA 3ARGD 3FZUD 4LLMB 1OARH 5I1KH 3G08B 1AJ7H 1I1FB 1P84K 1JK8A 3EH4B 1KGCE 1UVQB 4OLUL 1E27B 2BVYA 1TNNA 3GINA 4UIMA 4XX1G 2BDNL 1Z5YD 3E6HB 1UCBL 1VGKA 2OL3B 1JPGB 1H6EA 3DPBA 1J8HD 1JV2B 3KWVA 4LLQA 5ICXA 2QTVA 4WI6A 3FTVA 1ADWA 3B43A 3V0AC 1H15A 1LP9F 3QUYA 3ZE1F 1S9XA 1LMIA 3RU8L 1UM5H 3ZZLA 1T0NA 3DI2B 3FSOA 4K7PX 3DV4A 5I1KL 4HC1H 3R06A 1BVNP 5HHMB 3OSKA 4J8QA 3OF6D 1OOWA 2AEOA 4RFEA 1U36A 3DX6A 3PCYA 1E4XH 2A4ZA 4GQPH 4LVNB 5CN2A 5AKSA 3RWJB 1ACZA 3U6RB 4M62H 4PS4L 1WITA 1KB5L 1PFOA 3KCPB 3SDXF 1B4TA 1O75A 2MHAA 5CGYD 1N0LB 1WE5A 4QRPD 4M7LH 5F7LB 4HJ1A 4BSJA 4HS6B 2R27A 3LZLA 4P2CG 1T3FB 4NQDA 1L0QA 3VI4F 5A40E 5B3SB 4N0CD 4LSSL 5GS1C 1N5AB 3EHBB 1GA2A 1U8IB 1JWMA 1VRSA 5DWUH 3VFVB 3EF4A 4PSPA 1GR7A 4MA3A 4K07A 2XBDA 3D3VB 1X44A 3GPSA 3D0VA 5EUOE 3L3GA 1MLBA 4MAYC 1RUPL 4H13C 1MW2A 3RGBA 4W6YB 2CHNA 4ZODA 5CU5A 4Y1AD 4AL8C 4IRJB 3TCXA 1WIUA 1FORH 2EEAA 5E23A 3QDME 3PLYA 3ARBC 1MQ8A 1HH9B 2HJKA 2Q8AL 5C2BL 5EIIA 4XXDB 3FQXB 3O3EA 4FQ2H 4X98A 1MCNA 3MXVL 2C7FA 4IHBA 2PR4L 4R7DB 4ZTEA 1AGCA 2Z35B 5F88A 4IKNA 3VGDA 1VERA 4C4KT 3CPLA 4ZXBC 1Z9MA 3KM1A 1T22B 3P40A 5ICZB 3L1FA 5H37A 5JHAA 4KZDH 1AZCA 1JPST 2UZXB 1CDIA 1TU2B 5HPMA 2JNZA 2FL5A 4PJGE 5HGHA 9PCYA 1Q9LA 2G5UA 3T0EA 3QQ9C 1M2VB 2YRLA 2J4WH 4FNPA 4BIKA 3OLDA 5A2AA 3OKKB 5KJRH 1A6VL 3V6BR 4ZTPL 5EN3A 5FFGA 5CJ8A 1CGYA 3EXLA 4J3OH 3ZE0B 4J3SA 2JB5H 5KJ4A 4PJDE 2YD8A 3DVNB 2IGLA 4PWFA 5HHNA 4H1LH 4QKTA 4N8PA 2NY5H 4OCMC 5EO1A 5GRJH 4AYMC 1HC1A 2WIIB 5ANMB 5IMKB 1PDKB 4A7TA 4LCCB 1DLFL 1WS8A 3VUAA 1SN5A 1FRGH 3U36B 3QPQD 4WO4A 4M48L 4WUUA 1AZVA 3II3A 3NSJA 4YDZA 2DV6A 4BUGA 4AJYV 4L9LB 3SE6A 5C0IB 4XNAA 2PYFB 1UZ8A 4Y0GA 3ZGHA 2AGJL 4JN1H 1JZEA 1OK0A 1FSKB 3V6ZB 1ZAGA 2ILLA 3NGBC 4I1PA 2NY6C 1PJWA 2XA8H 4Z3FA 1A7RL 3WBDA 2A5UA 3REVB 5GRJL 2F9BT 3K1DA 1XZWA 1ZLWK 2B3RA 5L8LB 4P06A 1SF5A 3SBWC 1D2PA 3FQTB 1HOCA 1FFOB 1YYMH 5IJBC 3UDWC 2DYRB 4APQD 1UXLA 1RZIA 5C0RL 4QHKJ 2UYLB 1YY8A 4Y5VB 1L9MA 3EJJX 4MNGA 1OD9A 2W9DH 5T1DL 3P2DA 4Y89A 4AW7A 3UMTA 3HBGA 3GHBH 2ADFL 3EDDA 2IQAA 3ARGA 2EYRB 2NY3D 4PJEF 3UIYA 1S9XB 3VFUB 5LCVL 1SOQA 1TZHB 3I9GL 4KQ4L 1SOXA 4PHXA 3WTVA 5ICUA 5I19H 3TEUA 3I50H 4F7MA 2O6FA 4WAFA 4QYOA 4OGYL 4U6HA 2O61B 4MA3B 2YD0A 5BZWA 1LLAA 3RDTC 4NJAH 4RISL 4XPGL 4XPTH 3PHSA 2ADJA 2YARA 5D2NA 5HSFA 1YEFL 2WXIA 4HUCA 2PNDA 4N8VA 1ADQH 2J6EH 4HHWA 4OIIL 4TNVF 5EB9A 2OSLA 1LM8V 4N87A 3QYMA 4KZ0A 1S7RA 1JP5A 3SPHA 4F15B 2CK0H 2NY4C 4OJYA 5ECJE 3UPRA 2CIIB 3BEVA 4M9PA 5F93C 4EZKA 1U93B 2DTML 3CHQA 3BQUC 3HC0B 4OCYL 1RJLA 1F4HA 1WQVT 3LH8A 3BSZA 3Q01A 5TPWL 2YAEA 3F7VB 3G5XA 3QE5A 4LSVL 4Y5XB 3THMH 4DAGH 5FYJH 1ODAA 4ACTA 4HIXL 4XVSL 3VNYA 2ESVE 3NYKA 4P59L 2Q5BA 1V8HA 4JFPB 5HHOB 2GTWB 2HZHA 1U8MA 1D6VH 3Q48A 5F7EH 4IMKC 2IAMC 2OTPA 4YGVA 1FCGA 4FHKA 4QTIH 4HSCX 4WDIB 3X13B 4JVUA 1FLRH 1G5AA 1BXXA 2XQBL 5FM8A 1SJHA 2V17L 4I0PC 4JDZA 2GK0A 3U4BL 5CF3A 5T3ZE 5F7HA 4OGQC 4WFFE 5E8NB 3K80A 1I85C 2Y25A 4BSVB 3D85A 4GKSB 5T33L 4NKIH 1IFRA 3GB7B 2BVQB 3FFDA 1RJZB 2JXMB 4FQQB 3IDNB 5ITBL 2XVKA 4HALA 5DD5L 1D2OA 2YQ2A 2ZOOA 4KJPD 4GS7B 4NDMB 5J8OA 3HR6A 1JWSB 1G9MC 1JXGA 2IG2H 3K72B 4OD1H 1LEGA 3UERA 1CDCA 4LIQL 4RWYL 3NFSH 4L8SA 3BPCA 2JCCF 3CFMA 1YEGL 3OAYH 4ZS6C 3ETSA 3ECBA 5KYUA 2E8ZA 3RUGE 1H6FA 2X4SA 4C57C 1MFAH 1M3JA 5F0PB 4UU9A 5DRXB 4NQCE 2VN5A 1GGBL 3MRFB 4G6AD 3UBFA 3ZUCA 3GDBA 2B0SH 4W9JC 4QD2E 5GGQL 3RFZB 2KPNA 3N1PC 3CU7A 3QI9B 1BWMA 2FK9A 4LT7A 2Z3FA 5IFAL 4C47A 2BSEA 2PXYD 3FSWA 4X8JB 3VFSB 4V2BA 1X9UA 5J1TC 3EZ8A 4ZMVA 3QIBC 3SQRA 5F9WB 3KLHD 5CNHA 1I1YB 4MSWA 1WBXB 2CG9X 4RCAA 2IADA 3B6SA 5GGSY 1NUDA 3FRUA 4PI2A 3ZL2A 2G30A 3TBWB 2MEJB 1TJXA 4BK5C 1ES0A 1SEQH 1T0OA 1V3JA 1U8KB 5C08D 4HXAL 3U48A 3WAKA 3HMXL 3EFFA 4CU6A 4YQXL 4UUJA 4LVNC 2AITA 3ARFB 4JDTH 4HUVA 3P69A 1XV8A 2GAZA 1CLCA 1JGEA 5GS0C 1I3VA 4OKVA 3UOAB 4Y4FB 3L3HB 3DV6B 4Y19A 4NP4H 4K4KA 3HJ0A 4KQ3H 5F7BA 3MLTA 4KVNH 1J11A 4S1DC 2ZF9A 2NNAA 3SOTA 3IFPB 4NIYE 3B1UA 5DZ9A 1HS6A 2Z1KA 4HUUA 1MJ8L 2R4RH 3DMMC 2PP9A 4XPGH 3LPFA 2VDNB 3EOBA 4YE0A 1JZJA 3DJTA 1U8QB 4P2RD 3QRGL 2EILB 4P5KA 4WEBL 3WNMA 5JXAL 4U1NA 1HSAB 3D1MC 4B9IA 3QR1A 4BXVA 2YJLA 1GIGL 3P54A 4ZMWA 3MOAL 4G59C 1NDMA 4JN1L 3GC3A 3G3LA 1P2CA 3B5HA 1CFSB 2OX5B 4OD2A 4U1MB 2B3IA 3SPCA 3KLLA 3O6MH 3VSVA 3BMVA 4W4NA 3FULA 3KCPA 5CJBA 1JK9B 3LN5B 5TF1L 4D0CB 4RA3A 4W68A 2HFEA 5FGBA 4TXVB 1RMFL 4AITA 4YBLB 3KWUA 4N8VG 2I69A 2A0LC 1G9MH 4XB8A 5KSUA 3OG6B 3U7AA 4V1DE 5C0RH 3SCMD 5KVFH 3VB8A 3DETD 1HTYA 1DJHA 3ZIYA 1AZRA 3ARDA 4FZ8H 2OMVB 1OGTA 4J4PC 1HHIB 3TA3D 2BOBB 2A7BA 2Y36L 4M7ZB 4MDIB 5FK9B 2WSKA 3CZFA 4MRCA 3M1BA 1DP0A 4UNIA 5E6RB 1GYAA 3BSZH 1MLBB 2OPCA 2EIZB 4GW1B 3WTTA 4XCEB 1C9SA 4EN3D 5IG7A 4BFNA 2AGJH 5FHBL 1RZKL 1I9RH 1RPQA 2HVJB 3BOVA 1HE7A 2ADIB 5I1HH 3RZCA 1NFDB 4FQJL 4IRJD 5DQDL 5K9JL 2ICCA 4U1IB 4LHUB 1I4FB 1KDJA 2C3GA 3AITA 3E3QC 5C09A 3FCTA 1JI2A 2R69L 2XPGA 4Q7DA 4EQ3A 3ZK0A 4H20L 3MGTA 3G6JB 2DH3A 4QXUL 1JHTA 3AY2A 4YSDA 3T4YB 4AQEA 4FI8A 4QRQA 2EVIA 3UTSB 1MDTA 3D85B 4GKSA 1LO5A 2QT6A 2NYZA 1M7DB 1YN7A 5ICZA 4QO1B 3X3FL 4RVBA 5FFOA 1F1GA 1U8PB 2XWTB 2ZUQB 3G5ZA 1ZT4A 1TVHA 2WV3A 3BWUF 4KZEL 4A2DA 3T2PA 2JKWA 4MDJA 4PP1D 1XF5B 2W59A 4LLWA 4XPBH 3DIDA 5DD3L 4WI0A 4ZX3A 3NPSC 3ILDA 3L8QA 4HPYH 1J0HA 2HG5B 2NR6C 2EDBA 5DVLA 3UEZA 1EVTC 3MRFA 3ZDYF 1UB6A 2X1WL 4JZJA 3FT0A 2R1YA 4OI9A 5L0QC 4YK4C 3I6SA 3GHEH 1MCJA 3MRRB 2XIBA 4H26B 4YPGB 4KJWD 4X4YB 2R1WA 5DC0A 4LHUG 1MRFH 4U2ZA 4Z95H 1EAOA 3B7UX 1QI5A 2WXPA 3EH5B 3WJLC 2JELL 3IJ7A 4MQXD 4A7VA 5SX4I 2KBGA 4LRIC 4OCRL 1J48A 1HDMB 3DUUB 2P8PA 1JZ5A 3KPQA 4A6YH 2NT0A 1NAKH 1YMMB 3RZCD 5BV7B 2XWCA 4NQDE 4XODA 3ZKMD 2VR8A 3C5JB 4JJOA 1ZTXH 5ACMA 3LXAA 5TPWH 4G9FA 2Z0BA 4HSAC 4ZQKA 2YAHA 1RLBA 3T08A 3MA9H 3M6DA 1MCEA 2QADC 4KFZC 2RCSH 4BDVB 1S7RB 4YDKL 4G6JL 2JE8A 4IDJL 4IDJH 3ZTCC 1VZIA 2J7LA 4YR6A 2ZCHH 3IDGA 1A4JA 3PWNA 4I4WB 4L8BA 4MD0A 4P5MA 4Y7MA 5B7FA 5D1XD 2WGXA 5F7AA 1MCPH 1PTZA 3HJEA 2VW4A 3EIFA 1MCFA 1YSOA 4KAQL 2VN3A 1T1YA 3H3PL 3UGUA 5CMAB 1OF0A 1Z7JA 5IKCA 4J23A 1EFQA 1JJUA 1FL3B 1BZDA 2XI9A 4HAKA 4JG9A 4Z3GA 4OF7A 2X4TA 1JSYA 3NP4A 4HUXA 2X4QA 3ARBA 3OB8A 3KHQA 4OZGB 4RBPK 2QFPA 5DMGD 5JA8B 4KY2A 1JNHB 1XTLA 4W81A 3LPGA 1M7IA 5D7SL 3LPWA 5BMFL 5BOZG 2QSTA 3CH1B 4X6EA 3AS1A 3WCYA 4PW4A 3L4ZA 5D7KD 3WIIH 1N6UA 3KPOB 1EAPA 4K7FA 4M7LT 2PPFA 3ARQA 2X4PB 1KGCD 3QHTC 2A9AA 3T6WA 5JPNC 4AIEA 3M7OA 4LOEA 4N2HA 4P3DA 4N0RA 3O6KL 3QJQB 3T0EC 3PF2A 1E6JL 2Z92B 1A25A 3VRLF 4BFJA 2ZP8A 2VW7A 1GOGA 4IRSC 4NQED 2ICWA 1UYWH 5KSUB 5DC2A 1A4AA 4GOSA 5EU5A 3FU5A 5EF0A 2NZ9C 4YC2B 4EKJA 1G7QB 1HEZB 3BUTA 4I85A 5DS8A 2CD0A 3DSFH 5SWZD 3NFSL 3V7AG 3WHE0 1AR1B 5I73C 2PPAA 2ZICA 1HKLL 2DKUA 1CO1A 3ALPA 3WFDL 1QLRB 2QQLL 5GISL 2WIMA 2AC0A 5F0MB 1F6AA 1PGRB 4GINA 1U6AH 2X09A 4HCRH 4UZGA 3WN5B 3PWLB 1X5LA 1KJ2L 2NLJB 5D55A 4L05A 2HT4D 1AE6L 1SBSL 2DI9A 3HN5A 4PVMA 4WO4D 1QMUA 4WUUD 3V4UL 1ZIBA 4LSRH 2Y72A 3HS0B 2N01B 3L4WA 3QIUA 1YEKL 3BKYH 3QWRA 2XQBH 1HH6B 1ZPUA 5JLZB 1AS7A 2ZXGA 1MEXH 4R2GB 4TSAL 3X3GL 2ED6A 2Z8RA 5DQJA 5DVMA 5A2LH 2VRAA 4WZ9A 1BMZA 5B3NA 3QR2A 2ZCLH 2FYYB 4XMPL 4YWGH 2X9ZA 2DMHA 4UQ3B 4QYAA 5DDHA 1QFWH 1HINH 2FBOJ 4IEFB 2H9GB 4JPKH 2V6HA 2ED9A 2YLKA 5I17B 2YUXA 3SBWA 4WNSA 4DKEH 1DDTA 5E2UH 4KTDH 3SDCB 4FZ8L 3FMGH 4HC1A 4IHOA 3DYMA 1IGJB 5IW1B 4FQPA 4JKMA 5C0CE 4R9HA 3DRQA 1R3KA 1FIEA 5L0QB 4GG6B 5I6PA 4KZEH 1TNMA 2OBGA 2X7LB 4UQ2B 5EBLA 5GIRA 3F65A 1KYDA 3MV9B 1IEBA 3OLGA 2D4DA 4JCWA 3NJFA 2B15A 2HRPH 4LP4A 4DGYH 4EIBA 2OJZL 2WUBL 5IZ7A 1ZK5A 2XJLA 5BW7C 1QG3A 4DZBA 2BWIA 4HEPA 1E6OL 4S2SA 4OGYH 2OW6A 1ILSA 3BP7B 5C7XH 4PJFB 3N55A 4MXVE 4J27A 5I76B 2B4CL 2LU3A 2UV3A 2X05A 3SE4C 3AY4C 3GTVA 4M7JL 2YXVA 3QRGH 4J4PD 3MFFB 5AAMC 1ID2A 4ZTOH 2BOCA 2FWOB 2BERA 2AQ2A 3BLKA 3GXDA 1E5CA 2HT4C 2NXYD 1QFUL 3Q44A 1MCWM 1U3HC 2P5WD 4TUUA 3HBZA 4WEUD 3BVWA 5HVHC 3U7WH 5B39B 3QO1B 1TZIB 1RHHB 5TE4H 2WO3B 5GS1B 3QP3A 1BJ1J 2DQUH 3QNZA 3BQUA 2K3HA 4YDIL 5DJ8A 3D4ZA 3INOA 3NACL 4PP2B 2NZ1A 2BMKA 3EHBD 2X0UA 4PJAF 4J2QA 4L3CB 2WZPA 1MAKA 4DQOH 3EOTH 2F1BA 2PTUA 1DBML 1PF3A 2ED8A 4CC1A 4F5CA 1MFDH 2O1AA 5AAPA 4U4BA 4JFFB 4XBEL 1IC4L 1S7WA 3V52L 5F3HA 3ULSB 4HJ0C 3ETBJ 5DHXB 5GRUL 4RGNC 1XH1A 2BS9A 2YEZB 5F7YC 4WFFD 1RZFL 2HSIA 3IRCA 1D6EA 4JFYB 1I85A 3G6AB 4QIRA 1IAMA 1JDCA 2FWUA 1MI5B 4WGWB 3HI1A 3V6FB 2EDLA 3ARSA 1CLZH 2A9CA 1FSKC 3PQYD 5IT2H 1YQVH 4OKVB 5DQDH 4Y4FA 4AKPA 3U0PB 3BN3B 2ESVD 3P73B 5E6ID 4JFEA 4OM0L 4P23B 1HESA 5CP3A 3BRGC 2I25N 3VD7A 5C0CD 4QHLA 4LF3B 1XCTB 1X4YA 3QHFH 1JG9A 4JFOB 1OCWL 4WI9A 1TJIH 5DYOB 5EO9A 3P9LA 1GGTA 3R19A 2CO6B 2FJHA 1DEDA 1I9JH 3O9WB 3WXWH 1A6UL 2DKSA 1HSAA 2FYYA 2W81C 4CVWA 5HYJA 3L9EA 1CLVA 3CQPA 4NUGL 5FW8A 3L6FB 5K93A 5FOBB 4ORZC 4R7XA 1E67A 1HNYA 2IBZY 4N2CA 2PYED 4YHOL 1G84A 4JFZH 5J06A 1YVLA 2EIKB 4LLYA 3EFOB 5D8JH 4F1ZA 3PPEA 4XPHH 4QJ3B 4XPAH 5C0JB 2D7MA 5F96L 3AB0C 4QTIL 3IPFA 2WD0A 3ARED 1TXKA 5I1LB 2YMOA 2XSKA 2EDRA 4AQ1C 5EIIG 2EE9A 1JPFA 3FKUS 4MB3A 4JHZA 2R4SH 1NLDH 3QCTH 3SKJH 4R0LB 2WNWA 4F8TA 1VB9A 3DJSA 3QRFM 2GHZA 3MMEB 5EZJB 1Z9SA 1I3GL 3V2AR 4NWTL 1GCFA 2DOCA 3TJEL 2JKNA 1IGMH 1TJMA 2BRRH 5D1XB 1SJXA 5E5UB 5FB8A 2FQEA 3AM8A 2WINA 3K2KA 3VXPB 3QG7L 4Z5RB 4U1KB 4L1SA 4X6DF 4I0PD 1YEGH 2O5YL 4Z18A 1J0IA 3NCEB 1P5VA 3LKOA 5L6YL 4BUQA 4XPTL 1HXYA 3DJZA 1P5UA 1SYVB 3LEVH 4OJFH 3ZYZA 2A9NL 1I8AA 2R2CA 1D5BA 4Q74A 4MJ5A 1BXVA 3KLKA 4M62L 4PS4H 4WHTB 3LNFA 1CFTA 5AKTA 5IHLB 1HHGA 1MFMA 3K2MC 4IKIA 1NGWB 3CH1A 3P3RA 4PW9A 3ZE2F 4JFTA 2VAAA 3V0DA 2FR4B 1BECA 3LNEA 4WK4B 3KPQB 3OHXA 4DP9X 5D7JD 1X5JA 4P9MH 5IM7B 1TQBC 4JFFA 15C8L 3TT3L 4OGAD 5EOTA 1UURA 4MMXA 4OIFA 1I1CA 5BUPA 3TBBA 4OM0H 2NXZD 3NIDE 4ZFOA 2MSPA 1J9RA 3S8GB 1J0YA 3KPSE 4YHMH 1RI8A 1PX4A 3CN1A 3FUIA 4FYSA 5JHMA 2PF6A 4NCC1 4NO0B 1A4JB 4P5MB 2DM4A 1O5PA 4GT7A 1EEYB 2G4GA 1BQSA 5CZVL 3KXFD 3ULUH 1P1VA 3BP4B 4GJTB 2P44B 5GRZA 5HYSA 5IVZB 4G7YL 1BHGA 4Y4KB 5TF1H 1RJYB 4RQQA 2B77A 3PABB 2X4TB 1P7KB 2P3YA 2V5TA 4CSSA 3CVHB 2QPDB 5BS0B 4RISH 5AOLA 5D7IE 5JQ6H 1MY7A 2F7PA 3J8F7 4J6RL 1BG9A 1OW0C 5EBWB 3RX8A 3QJUB 1JV2A 4LLQB 3D18A 1ETZB 5FO9B 4NQVB 1BQ5A 1N59A 1E4XL 1IMHC 3KPRB 3RTLA 2X9XA 2P49B 5GSVA 3S37X 2N3JA 3NIGE 4HAGA 1XZ0B 4NO2A 3KYMA 5D2NE 1WBZA 1N2RA 4N5ED 1V27A 4PJDB 1UVQA 3D9AH 3OKNB 3QXTA 3BRFA 1EEZB 4HMCA 4QOKE 5DFVD 3C5ZD 1DVQA 5CBAB 4X6DA 4ZMOA 3KPLB 5AW2B 5CD5C 2JQMA 2MRYA 4ZDHA 1IAKA 1DQML 3TIDA 4DFHA 1OAQL 2ORBH 3P4LA 2CBTA 3MBWB 4O2EB 1DBAH 4TUOA 3BGMB 5IQ9A 3KPPB 4ZUSB 4P2QE 1HILB 3EGXA 4J3BA 5JR1H 1KIQB 1ZT7B 1NOLA 1BVKA 3QDGA 1V7MH 3U46A 3AUWB 3GSOA 4X7SL 1AI1L 3MV8B 5TE7L 4L0YA 3R0NA 2IWEA 1ACCA 3NZHL 4L4VD 4LRIA 5DZLA 3TASA 4PRPE 4ZUUA 4ZW8A 2OJZH 3L3GB 4RIRB 5JLZA 1SHSA 1FYHB 3C09C 3ESVF 3K6SA 3AXLA 5LXGH 2NTFB 5FLVA 1HWGB 2D2CC 1FUNA 4NZTL 4D8OA 2CHDA 3PAYA 3NQIA 1G0YR 2J8UF 3QCVH 5C70A 3VFGH 7CGTA 1ZT1B 5HYSG 5H35B 1ZXQA 2MOGA 4GKOA 4N2MA 1MCBA 2NY1B 2JCCE 2VDRB 1B6UA 2X12A 3BGFB 3U7YH 4G2AA 3ZRFC 4KO6A 3MV9E 4GAYB 4RMBA 4AK2A 3W5MA 3TWCH 3CPUA 1I7RB 1U8JB 4G8EA 2HPTA 5LGJB 3WN5A 1UH4A 4IYKA 4ZTPH 3HA0A 3L3OA 3CPLB 1I3UA 5B21A 1T2QL 1FFOA 4YWGL 4G83A 3SE9L 3IDNA 2P4AB 2FZ3B 5C97A 3GBMH 2FJUB 2XWZA 4N20A 1AY1L 2Q6WA 2BVPA 4M7LL 2UZXA 5HPMB 3QH3B 4KKCC 4A2GA 5FECA 3FN0H 1PZCA 2KI6A 3E8UL 5DJ2B 4E9SA 4EIGB 4CILA 3FS9A 1YQ2A 3CFKA 4A04A 3JV6B 1XR9A 4YOKA 1NKRA 4NQTA 4G72B 4B9YA 1VENA 5EBGA 3VG9C 1NBYB 3L2LA 3VFUA 4FQHB 5I17A 4NERA 3RVVD 1HHGB 4LASL 5HHNB 4EKXA 5JPNA 4PMFA 3V95A 2W94A 4Q89A 3HE6C 3O41A 3HI1B 3L9BA 4KHXH 5GRUH 3NCMA 2ZOLA 5JQHC 2Y06L 1JYNA 1H8OA 5ABZA 1K3ZA 2FEEI 2XG4B 3OAWA 4D7PA 1BZ9B 1AY1H 3ULUL 1K2DA 1EO7A 2IIJA 4JKNA 2OR8A 4HKBA 1RJYA 5EEZA 3LKPA 3AMKA 3UXFA 1MW3A 3II1A 2DTMH 1YEDB 1A65A 1ZHKB 2YO3A 5DEGA 5B4MC 4WTZA 5D9SA 2DH2A 1XAUA 1I8UA 1XCTA 1KG0A 4JFOA 3T5WA 3KW7A 4XWGH 4L1DA 2VR5A 4XCYA 5ICYB 3TT3H 3FUEA 3IJSA 4OGXL 3OG4B 3PUCA 4QT5A 3HG2A 3QPQC 4LKXA 1I75A 3CVIL 3R06B 5JW3L 4WCYH 1E4HA 4KWUA 3Q2CA 4P2OD 3NABL 4I9WD 3UTTE 4Z7OF 5KUKA 3ZMRA 2VMFA 1II4E 3OC5A 2YUWA 4DP2X 3CN3A 1CZ8L 3SPJA 2XN1A 3VSTA 3BUIA 2GTWA 3NZHH 3VB9A 1GYUA 2VZOA 4HKJB 4F9PC 4FFYA 4MNHA 1GGIH 4CDGC 2LU4A 3TA4D 4E0RA 5TDPA 1HNGA 4U1GB 4BHUA 4KHTH 4NBZB 1HKLH 4X8CA 1AIFB 3GUTA 1BZQK 4OFPA 2YQBA 4XOCA 4HZAA 4OFKA 1NLBH 2JCCB 3NJNA 2F8VA 2Y36H 1RIVH 2EUXA 3K4AA 4CJ0A 1GKOA 4ELME 4GFXA 2QHRH 1PLBA 3HC4L 5J9PB 3HBPA 3HZMA 5MHSE 3UTPE 1XCWA 4UF7C 3K72A 3WIAA 2WWOA 4C58B 1R9FA 5FPIA 4QY8A 3NZSA 5JHLH 4KKRA 4E36A 2VR3A 3D06A 5C0AA 3TIDB 2FJFA 3QFDB 2JJVA 4QNPE 3BGMA 1DQVA 5IQ9B 3FB6A 3IPBA 3MRIB 1S7UA 1W0VB 2IWKA 3B9AA 3FRPA 4N90D 3KS0J 4PRID 4JGMA 1UXWB 1HINL 5JNYB 4HUWB 5HVHB 4NJ9L 3FOLB 1TDQA 3UAFA 4HJTA 3KEDA 3SQOH 4XXDA 3QQNA 5D1QA 4Y16D 3MRKB 2HRLA 3H42H 4ZXBA 2WLHA 1K8DA 3LIZA 3M8OH 5AAMA 4DZ8A 2VXVL 1NBVH 1AMXA 1X6LA 3WMSA 5FF6B 5D7JB 3C5XA 3GBDA 2WO2B 3US1A 1A1MA 2OJEB 4KNSA 4KZCA 1UD5A 4NHUA 4XN8A 3RWGB 5KBNC 2DDQL 4LCUA 2ICEC 3EH2A 1X4XA 1BJ1H 1MG3C 1TSHA 5L4MA 1BF5A 4CL7A 2ZPKH 4MA1B 4R5TA 4IOFC 5CEYB 1NC4D 1W16A 1PLGL 2WC7A 4ZZKA 1PLCA 3CX5J 1RKRA 3CDYA 4JLRB 3W37A 1WZ1H 3NCFB 2CCLA 3KYNA 2J12B 2XOTA 4BSVA 3OMNB 5I1IL 2XZQH 4N0UE 1ZLUH 1TITA 1J8SA 1N0XL 3WEMA 1ILUA 4YX2H 1GTNA 2WXRA 1OAZH 2HN7B 2D31A 3QQ4A 4KI5D 4L8SB 4YSQA 4AI7A 5JDJA 1RK1B 4RFOL 2FO4A 1HXYB 3HG1D 2X10A 1FFTB 2FBJH 1UD8A 1YNKL 4JFFE 5DZAA 5IVXF 4TVPD 2FEEL 1JZ8A 2K6YA 4U7SA 3Q9QA 5LBGA 4QXTA 4GIAA 2MOQA 5BOPA 4ZSOE 3K7UA 4J8RA 4AG4L 5HHQA 4KJQD 1JFHA 3PXJA 5CEZD 5D4HA 5ICYA 2UZPA 2NX5D 4ZOEA 5HI4D 2AJVL 3X1FA 1MFDL 2COVD 3KPSB 4L4VA 3TO2B 4XVUC 3UDWA 2QQKH 5E51A 3IWVA 4E9TA 4LSUH 1WDAA 1XL4A 2XWRA 3KYKH 3LV3A 5EEYA 3AAZB 3DVIA 4D0DA 1QSED 1YJDC 1MCPL 3D39E 3RP1A 5JIMA 4UT7H 4QOKD 3A5VA 1MPAH 1FIGH 1Q0XL 4P3WA 5KANG 2XV2A 2Z91B 2WCGA 5BPPA 1P7QA 3HLAB 2UWEE 3IFPA 2KZKA 2Y5QA 1IT9L 1ND0A 1UADC 4M6ML 3W38A 3ZL1A 3LKNB 3BP4A 1ZTXL 4UUJB 5EEUA 3QQ3A 5T1LB 2MCPH 2BFVH 2AJVH 3M07A 5D6DA 2OXHA 4KNTA 5H94B 1Y6NR 5EZOH 3VSQA 5CCJA 4F24A 4OB5L 1NBQA 1NGXA 1PFCA 2HX8A 5I75C 3ULUD 4PD4K 1AYOA 1MCIA 2WP3T 4FNQA 3CVDA 1KNOA 4LLAA 3VXOB 2MJWA 1SBSH 3S5ZA 3VXUE 3VX0A 2AXWA 1KLFA 1ES0B 2H41A 4X99B 4NPJA 4AV5A 5EO0A 1I8MB 2WQAA 3PAVA 4YO0B 1MJJA 2NTFA 1LQSR 2YSSA 3MJ9L 3VH8B 3HB3B 3IE9A 3O8XD 3PE9A 5DO8A 4X6FB 5MEQA 1YJDL 4ZMPA 4OAWB 3FPXA 3U6XS 3FSAA 3BCDA 1FDLL 3HC0A 3HZYA 5CILH 2QSVA 3HNVH 2UUDH 3WDHA 4LLDB 3VWJC 4AEIL 2EH8H 1D5XA 4KTDL 4RQQB 3F58H 4XRCB 3SGJC 3DGGB 4PRBA 5ETUA 1FZOA 4I18B 2XPYA 4OLUH 1OAYL 3CSTA 1WFIA 4AMWA 1UB5A 2JSFA 3KPRE 1PQZA 3QH3A 5BCAA 3ZTJH 3KVPA 2C4FT 3VI3F 2PPDA 2VQ1A 2HH0H 2ICWB 4XAKE 5D1ZC 4GRWB 2DQHL 3CN4A 3QUKA 1T5XA 1DBJL 3BW9B 5LCVH 5HI5D 2P43B 4KRPD 4ANXA 3SE8L 1DQLL 3QQDA 4UV4L 5E1QA 2FD6H 3FT1A 1LK3H 4RX4A 3C60B 1BMGA 3B3IA 3VQLA 1Q9OA 1GJUA 3N2JA 4MVBD 4UM8B 3DJ9A 5HVWA 2C9QA 4XAWH 4XNZC 4NRXB 5C0ND 3WKQA 1G7JB 2XKUA 4PTTA 4X4XA 3L81A 4Z7WE 3ELAT 4ZSOB 5C8JB 3BD5A 4QCIA 1I1AD 2FT7A 2IV9A 1FNGB 1OCOB 2WZPD 4HYTB 1AHWC 2GUYA 4OZFA 4LPXA 1XL6A 3OKLB 3LTVA 1WLHA 3UBXI 3VJ6B 2BZ7A 4NQCB 4HOXA 1NPJA 1QBMH 2F61A 3AW5A 4ZJ9A 3X2QB 3GSNH 4JO8A 4TNGA 3FO1A 3VH8G 3PV7A 4HGMA 5D6CB 3MV8A 4HSQA 2DEXX 3RQ3A 2Y23A 5HBBA 1NIDA 1X5IA 4X6CF 4P57A 1URLA 3CFJB 3MNWB 1C5CL 2WNKA 3TC9A 4JAMB 4ADGA 1VFAA 2ZKHL 4J6RH 3WIIL 4E9QA 3OKMB 3WFCH 4H25A 3A67L 5T3XD 3KYOB 4XH2A 1A6AB 3AAZA 1MRFL 1OTTC 3K4DA 2P7TA 1X9LA 5F1KC 3R7RA 2X4NA 3IFOA 4JB9H 5IF0B 1IZJA 1GIGH 3WFEL 2AK4A 1P6WA 5IJVA 2F19H 4O58H 1BAFL 4YHPA 1IO4C 3CFDB 3P3YA 5I6XB 4R0LC 3SHSA 4YPGA 2G4EA 3JWNC 4H8HA 1BD2B 5CP3H 1CBVL 2J3SA 4ZMLA 1E65A 2QKIB 2RQEA 1KT2B 4S2SB 3SJVE 2OMZB 3NCXA 4WW2C 1T1ZB 2IH1A 2WLMA 4QHUB 2WWKT 5E00B 3DTXB 4V1DD 1XXFC 4TVPL 1L6XA 4P23D 1JGUH 3KCWA 2CA3A 1AGEA 3RWJA 4BFIA 2W95A 1E42A 2DLIA 2R0WL 1MFEL 2MCMA 3HRZC 1G7MB 1W2KT 2YC1B 1BAFH 1QFHA 1U2CA 3BWUC 1HWWA 3KW8A 4AXWA 1BEXA 4YFLI 1MN4A 3QISA 1ZLDA 3K8KA 2WYHA 2JCWA 5MENE 5I1GL 5KBDA 3GXMA 2GW5A 3LN4B 4FQ1H 5F1SA 4MNQA 4PRPB 4FQJH 1R3HA 1ZK9A 1P4IH 3LQMA 4RDBA 1F13A 4JBSA 4X5XA 5EU3A 4Z3IA 2F5BH 3BAXA 3NDZE 3FSZA 1KC5H 12E8L 4G80B 5KN5B 1NFIA 4J3XA 1J8HB 1AR2A 2RMNA 4P59H 4UQ9A 4UAOB 3OJVC 5TDPB 1ZLSH 1KPVB 1TQUA 1TCRA 3SGDI 3DGGA 4PRBB 1FG9C 2CDEB 5GGSA 5DVOA 2GABA 2R2HB 5FWRA 3TF4A 1MREH 5DJAA 1B0WA 5EUOA 1GGBH 3ZT6A 4EI0A 3UTOA 3FCBA 4U0QB 4WFGD 2Z93B 1KTLA 1CC3A 3P0YL 4MAYB 3FUFA 4EDWH 4JO1H 1R34A 4KTEL 3ULUC 4L8DB 1IGCH 1TLKA 3CSYA 2VISA 4GXFA 3RX7A 1A6TB 2D0FA 3O45B 3QXVA 5BRPA 3ZN6A 1LHZA 5E08H 4LIQH 4RWYH 2EEFA 4CNIA 1GOHA 3OPZH 2VDKL 4FG6C 4NOBA 3ARBB 2I26N 2X4QB 3QXUA 4TSCH 4WGVB 3GMLB 5E2WH 5JIIA 3JTSA 2RGSA 2A6IB 1KB5B 4PRIB 1CDYA 1QSFE 4GRMB 1OWWA 2GIMA 2LAAA 5C3TA 1SPDA 1RERA 4AYSA 4B5EA 3I75A 4MA7L 1HQ4A 2MTPA 3U2IA 1C7SA 1JV5A 4EI5D 4HJUA 2VR6A 3TL5A 2XN9A 1JHTB 3FQXA 3TBYA 2ZX7A 2QGEA 3T65A 5D2LF 4YC2C 1N19A 3CDZB 4NENA 1SDDA 1S5HB 2A4CA 2CUAA 4FXKB 4UCFA 4ODSH 4IRSD 4AQZA 2GBUA 5J9PA 1TQBB 2AEQL 1AR1C 3KDPB 1VFMA 1VCAA 5CILL 1Z3RA 1SLWA 1J8KA 2MQCA 4KVPA 4BSWA 5CFHA 1Q9LB 2TSBA 2AJSH 4D0DB 4YUEL 4OZIF 1D9KC 2DQJH 1A9BB 3FTXA 3H0TA 4JM2F 4MVBC 5HDBF 2ZWKA 1EZLA 1ZD6A 4G6JH 4G43B 4G8FB 1IZKA 2PTTA 3O81A 3H1ZA 4K15A 4LO9A 1IGTA 2BNRA 2V2TA 1ITCA 3FFCE 2JI2A 3DVNA 1IE4A 1M4KA 1XGZA 4GB9A 4G6AC 5DHDA 4KKLC 2DQFA 2ROXA 2KZBA 2AJZA 1H0DB 2WBJA 1A7QH 4LL9A 5B4MD 5T3ZD 4E9RA 1NAKL 2VUKA 1JZ7A 2OQJB 4CU7A 2V2XA 3GRGA 4EZMA 4CGTA 5AOKA 1MJUH 2ESVB 1N26A 3PHOA 3L5IA 5DUJA 4A7SA 5FXCH 2Y07H 2X70A 1R46A 1AIZA 4IRJA 4N4YB 4UT9L 5I0YA 1J5OH 3C09B 4N68A 1IEBB 4LPUA 4O02A 3KHOA 3EOTL 3H3KA 5D93B 1YEWA 2BY0A 4JFQB 4PLKD 3N85L 5JIQA 3QEHA 3TBSA 1HH9A 3G5WA 4RSVA 1HKFA 4OSUL 5I24A 3KPSA 2R2EB 3MGOB 5DEFB 1UM6H 2WVUA 2G5BB 2Q10A 1A6ZA 1ZV5A 1OM3H 3PP4H 1MF2H 1PNCA 1YZZA 4Z76B 2W0FB 3CK0H 3HMXA 2XBTA 3BAWA 3HMWL 2WGNB 4NP9A 1CXHA 2HT2D 3ZTNL 1GC1L 4J3OG 1FL3A 3ARUA 2YD7A 4J6IA 1VF5C 2YXMA 1Q94B 2Q86A 4O5LH 3OKKA 3DTUB 1J0ZA 5I71B 2I07B 2RQ8A 3EJUA 4HIHB 4OFVA 2QQNL 1A0QH 4HS3A 2CGRH 5D1QC 1S7SB 3AG3B 1ZPLA 1ORQB 1U3HB 1YO4A 4PCKA 1UWEH 3WSQH 3IRZA 1WYJA 3CSFA 4URKA 3LVEA 3NTCH 2R0ZL 1H5BB 1CL7H 1LO0L 1YEKH 2CWRA 3BKYL 1FORL 1DLHA 5GGVL 1S7VA 2FT8A 4PWJA 4UT6H 2ICEA 1MFUA 1LO2L 3D5OF 4WLCA 4AQOA 1AGCB 1AG0A 4FS0A 2A77L 4IRSA 1P1ZB 4LSVH 4C55A 1TZIA 3HG0A 4DWHA 2NY4B 1ACYH 3VXSA 1VGKB 1CE1H 2OL3A 3CH8A 3CLFH 3FL7A 2VNCA 2F54D 3L3IA 5DZPA 3NIGB 5KSVB 3UAEA 1INEL 3QIBD 5B1KA 4M1GH 4C56D 4D9LH 1WZ1L 1LE5A 3NCBB 35C8H 4EBQL 4NN5C 2CUHA 2QSCL 1Z9NA 3DHPA 3B2VH 1FZKB 4QRPA 4BHUI 2Z93A 3NEXA 4WUUE 3FUJA 3W5NA 5IMMA 2OK0H 1NEPA 4AVHA 2P26A 4U49A 2CK2A 4HIJB 4JM4H 1I7UA 3F64A 3FQTA 3OL2A 1Z3GH 3PWLA 4TSAH 5D5MA 5LQBL 5CZKA 1U41A 2Y2YA 2W5PA 3SB3A 5C86A 3PWVA 4O58L 3M46A 1Q1JH 1JF6A 2DMKA 4PI0A 4HG4K 4DHLA 4DJMA 3ULVL 3O6ML 5DRZA 1QRND 3A6CH 5LGHH 4EN3C 5DURD 3T6VA 3BP5A 1NDGB 3MNZB 3L95B 2X6UA 1ROWA 4KI5C 5B1CA 1U3YA 3NIDB 3I85A 1UM5L 4DN4L 1A14L 4Z78B 4FQXC 1BOGB 2Y1AA 4LQFL 3TBYB 1W0WA 5D1QD 2VH5L 4CMHC 2YAQA 4FG0A 2SODB 3FTUA 2ALWA 4P4KB 5IFHL 2O61A 4QRSA 4Q6YA 4DVBA 5E70A 1X5HA 2CNYA 4CVUA 5ETUB 1U3NA 1MAML 4G7RB 1KCRH 1KCRL 2CK0L 2PCYA 1G6RL 2Y2WA 1F3JB 4FX5A 3SDCC 5BW7A 3L5WA 1A9BA 2M2DA 3L7EA 1J87A 3QG6B 4JO2L 5C07E 1FZMB 2VXUH 1CG9B 3LJ3A 4AQ8A 3P77B 4YBQD 5D6DC 5F72S 4CSZA 3EYSH 4WEMB 1BF8A 5KS9A 1QBLL 2APXA 3HB3C 2IJ0C 1Y18B 1CR9H 2P46B 2VH5H 2ENJA 5GSRA 3QI9A 4XC1H 4URTB 4M02A 3TO4B 3WTWA 3TA3A 1MWAB 2QQQA 1BYPA 2W60A 4FKKA 1OGAB 5D93C 1PIGA 2OM5A 1HI6B 1URZA 4Y4KA 5EU6D 1BJMA 5IB2B 1QFWM 3NEOA 2FECL 3L08A 2IADB 2WO4A 3ARFC 3BWAA 3WNIA 5KN5A 3IYLW 4JFSA 3GTTA 1T7VA 1ZV2A 4MD4B 1L9RA 4OUUA 1QSZA 5B22A 5L8JB 3N04A 3FT2A 4YHKL 1JAEA 3FU0A 3WLBB 1OTSD 4DK6A 2OMZA 3ILQC 4AQAA 1QQDB 1A4BA 4F2EA 1OGSA 3TGXA 2ZZUT 1VPOL 5EOCH 2FWSA 2X5PA 2WWMC 3B2VL 4P57B 4UNVA 1AC6A 1D7DA 2IMNA 2H2SC 3I9AA 4HJIA 4JFDE 3T04D 5ESAA 5B8CB 3ZE1E 2DPKA 3U2JA 4AKOA 3A23A 2XWJB 2H26A 4PLKC 4Y4HD 5C08B 1FN4B 1FYTA 1QSEE 3D39D 3V8CA 4FQ2L 3EGXB 3MJ7A 3HZVA 5SWSE 2Q8AH 3SY0A 4HEME 4XNYH 4B41A 2YIHA 1Z0MA 2X6MA 4TNWK 5EPMA 3IKCB 4JQVC 1ZLVH 5EZOL 4QJ5B 3V9EA 4BQCA 5JHDD 4GLRI 4AGQA 3CZFB 3VTAA 4DGVL 2ICEB 4OGAC 4ZFQA 2BSTB 1CGWA 3MO1A 1Z9PA 1UH2A 4KJYB 1N8ZA 4BM7A 3RVWD 3BSZL 4X7DC 1GSKA 3TBTA 3CQFA 4LOFA 4EE2A 2R23B 2VRKA 3ECUA 3HG1E 3RB7A 1NCWL 3O3UN 1SY6L 4AMKH 1XMWA 5E0FA 1R19A 4LHUA 3DBXB 4KI5E 4WU5A 3LZNA 1EO8H 1U93A 4AE1A 2LFEA 4KXDA 3ZKMC 2ENSA 4PD4J 2GIXA 4OZ4A 3S5YA 4TUJA 3HNSH 4GKZA 1QFPA 2XN2A 2X2JA 3A4FA 5CKGA 2W65B 5EOQH 4UOJA 2C34A 4KK9D 2QFRA 4HFWA 3FU7A 4B60A 2HLAB 2Y7OA 3DHUA 2JTYA 3WGVB 4B9FA 1UOLA 1OLLA 3RRQA 2WBWB 3MPCA 3QEGL 2WHVA 3QORA 2V8MA 1O6SB 3O4LD 3B9VA 1T83C 4FA8A 3X3GH 4F92B 2DQEL 5HD8C 3QPXH 2PETA 2VLRE 4OZGE 2V2WA 4JPVL 4XZ4A 4YXKL 4M8QB 1S9KC 4N25A 5E6YA 3T4YA 1FA4A 3AM8C 1BBDL 4XPFL 3FQYA 5FYKE 1SNRA 1LD9A 1A66A 1NKGA 5E4EC 5BV7L 3UO1L 4BFFA 1RULL 4ZDHB 3NJMA 5MENB 1ZVNA 1BZ9A 1F3RB 2Z4QB 2XRAL 2VDPL 2W9EL 5CD3A 2DBLL 5AB1A 2AQ3A 4OF0A 4Z77B 4K3JL 4N2BA 1ZCRA 5JOFA 1TQVA 4MX7A 2YD6A 3CG8A 3LZFH 1T1WA 2CUMA 1C5BL 5GZOC 1NINA 2VWEC 4JQIL 4K8RC 2FEJA 4DN3L 3NFNA 1MEXL 1RZPA 4NX0A 1C16B 4PV9B 1BF2A 1YNLL 4CC4C 2R39A 5AB0A 1NBZB 1XSKA 2M26A 3L4VA 1VFOA 4MJ6B 3PIQB 1IQWL 4XVJH 3ZHLA 3IS1X 1MJ8H 2R4RL 1DVTA 3VFPA 5HGAB 2NUTA 3AWGA 3UJTL 5I0ZA 2ZYHA 1FNHA 1UHVA 2FZ3A 3O4LE 4RMUA 1UD2A 2NY4D 4LOUC 3VXRD 1K3IA 4FCAA 1ZGLM 1BM3H 2XRAH 3PJNA 4X50A 1U8KA 2EIDA 1XF2A 4HIPA 4WFHD 2H26B 3K6NA 3V4PB 1OQXA 2TRHA 1FZJA 2RBLA 4K8RH 4Q2ZB 2ZXDA 1WAAE 1RZJL 3T0BA 3ZQXA 2IANA 3HB3D 3MLVH 1WBYB 4MCNA 4ZO6A 5G5DB 1VGEL 4JS7A 5FC9A 5HJ3B 4OZGF 1AHWB 1JN6A 3VXSE 5E2VH 4XNMA 4DGUA 2ZOLB 3ESOA 3KBHE 3RVUC 1P0SE 2DM3A 4WI5A 2XQYK 2J88L 3OTTA 3RJOA 2IBBA 3ZE2E 4I77H 4LSTL 1YAIA 2CO1A 5DURB 2WQUA 5K5YA 1BQUA 3MLZH 5DSCB 1U8LB 4HCFA 3VXMA 1RIUL 5I16B 1SF3A 5JPMC 4NQVA 3O4LA 3CU1A 5JHDE 1KBBA 3AUVA 4R83A 5JPNB 1E9QB 1LTXA 2R83A 5I0XA 2A6KA 2OAAA 3L95A 3LQZA 4NNXA 1HEZA 1JPEA 8PAZA 2ZG3A 3LKNA 4QT5B 3WI9A 1YEHL 3MYJA 1DYZA 4EVNB 3KPOA 3ARPA 4XHJD 3RL1B 3ULVH 3NPZB 3LS5H 5H94A 3IU4L 1M7UA 1M7DA 2RIKA 4MWFB 2LR4A 4FXLA 4HHAA 4LLUA 4UM9B 3AGVA 4M5YH 2R8SH 3CHOA 1TEGA 3DURB 4PV8A 2ZJSL 2D7OA 2VAJA 5B38G 4X5QA 4QRPB 5F7NC 3OGCB 4G9FD 1T6WA 1I3GH 5JIDA 2ZX6A 4FZEL 4BUHA 2WMPA 2D7TL 2GBAA 2Y06H 1CXLA 4BFKA 4MJIE 2XBZA 4W93A 1IE5A 3S96B 4XP9L 1CG9A 1EZVX 1E9PA 4ZD3L 2NZ9D 4AOFA 3ENEA 4LDEB 2OTWB 5IJKA 3RA7L 3UAAA 4H2CA 4DNLA 4GW5A 1B88A 1XBDA 1XH3A 4MGXA 2YGVA 3I50L 3UG5A 5F21B 2W1NA 3BX7C 2OTUB 1OK8A 2EADA 1DDHB 3UJTH 3VXSB 2Z4QA 3A67H 1FYTD 1S7UB 1W0VA 4LEBA 2GY5A 4P2RB 4C4KO 3ARDD 4B6ZA 4FTDA 3SBRA 3T3ME 5A2IH 1E4KA 3MACL 4BKSC 1MZZA 3S2AA 5CEXA 3MLUH 4ONOA 1MDAA 1TJIL 4X6EB 2WWNA 5F3BB 2BJMH 5KS9E 4PBWD 3CLWA 2VDPB 3AT0A 3CBKB 2L04A 3L5HA 1G9NC 4HIJA 3C5SB 4YLCA 1QBML 1UWFA 5AB2A 4PWGA 2EZ0D 1FF5A 1NBZA 3ZTNH 1DVFD 1O7DE 2ZAHA 4L3EA 2YPKB 3K71A 1AFVH 1S7QB 1YQVL 3BGFC 3KG5A 4XGZB 3NRPA 4MCMA 4L5FL 1PKOA 4ILDA 3FQNA 2BRQA 4AM0B 5CAYB 1OSYA 5LNGA 1UFGA 1T1YB 1R5VA 4OJEH 3U9WA 1JXJA 2AQTA 1MNUL 2OJ1A 1ZHNB 3WTUA 4FA7B 3JBG7 5I6LA 3MHZA 3JZYA 3QUGA 4ZYKA 4H26A 4ODTL 1N70A 2DWEB 1CUOA 3LEXA 3MQIA 4LAQL 1W72H 4QCIB 5ISZB 3MODL 1X5MA 2YA0A 3GNMH 1RZKC 5DMKB 5HJGA 5D7JA 1F6AB 1DBBH 3WEOA 2F1AA 2VIRA 1I9IH 2BX5A 5T1KB 2OI9B 1A7BA 1E5YA 2HH0L 3VACA 3GSVA 3F00A 1MJUL 5DRWB 1YMMA 4JFXA 4L37A 4PTUA 3PJSB 1A3LL 1AFVL 5K9OB 3V4LA 4ZT1A 5FYLE 3JWNE 1JYVA 5T5NG 3RIAK 4KJYA 5EO0B 4IOIA 1YEDA 1I8MA 3Q3GB 5KVFL 2HJLB 4IOFD 3Q2WA 1PZAA 4M03A 3IS0X 2X40A 5AW1B 3VA6A 3Q13A 3CHRA 4QRUB 4WJ5B 3VGAB 3ZY7A 2VDQH 2MKLC 2AMUA 2JK5A 3TN0C 1JVKA 2L3BA 4JPWH 2EXYD 3QJFB 4W9IC 4WUKH 5E8EB 4KXZH 3TVMC 3TXAA 3B9EA 5HDOA 5AD0A 1L7IH 1QTSA 2IFFH 4U6YB 4ERSH 3WNKA 3GJEA 2GVYA 1D5ZB 2AJXL 3RDJA 1AGFB 2F54B 2VE6B 2ZG1A 4G5AA 5F9AC 3NIGF 4FLRA 3KWXA 1KTJA 2KKQA 5IJDC 2AEPL 3GI8L 4RETB 4KKBC 1NICA 1QASA 4PJGA 4XP4H 4OM1H 3EDJA 2X2YA 3VDBA 1S9WB 4OVUA 1KY6A 2N4IA 4LLMA 2OK0L 4GBXB 1S9VA 1PZ5A 4P4RA 2OXHB 2FAUA 2WQXA 4YR6B 1LEIB 4P3DB 4JDVB 3CDGB 4Q9CA 2Z8SA 1SHMA 2J4WL 1GCYA 4PJHE 1R5IB 3ARGC 3CFBB 3FZUC 2B2XL 4FYQA 4JQIA 3EYOB 1BYNA 3ALWA 5AVSB 4RWHA 3CLFL 3PAUA 4CN4A 4MB1A 5EU3B 3ZZ1A 3EYFA 4AK1A 3IE4A 1YMMD 3NG5A 2APFA 2XTJB 5MEPA 1QEXA 3MRCA 1HZHL 4NRZA 1RHHA 4LRNL 3MVSA 2K7PA 2FB4L 4F7TA 3ZO9A 4OZGA 1GS6X 1PKQA 1SXCA 3RDTA 4KI1A 2VLMD 3SKUD 1W72B 2AXGB 5KTEL 2XG5B 4PJ8A 2P5EE 4N3UA 4Q9QH 3BP6B 5LN4A 3BWZA 3KWWB 3VRIA 1L5GA 3APCA 1YEJH 3CLEL 2VSCA 1CU4L 1W8NA 2X2HA 4O4YH 5FW6A 6FABL 4PPTA 2JI3A 5LNEA 5C0GB 2VR7A 3JYBA 3CFIC 1HSBB 3CSYB 5F9WC 1F18A 1MH5A 4Z8FL 3B1TA 3QWOB 3ZTJG 4Y8DC 1WUZA 2CPCA 4HS6A 2Z31A 2L7JA 4YHLL 4PJEA 1J5HA 4YSTA 4M8QA 3PUUA 2Y7QB 1GXEA 1DJGA 1MKFA 2GJ6E 4MQXC 1XF2B 1JWMB 2VXSH 1CGSH 4NQUA 5AVYB 2R7EB 2IAMA 3U7YL 3VQMA 4LXFA 3D2TA 1PG7H 3I02B 5D1XA 5F88B 3G6JF 4E5XB 5IW1A 2EABA 2ATPA 5E5RB 1YUHB 2Q3ZA 1OGAD 5DVNA 2X4UA 1NGPL 2GBVA 2XX1A 1FZOB 3NCYS 4MCYA 4XP1H 3VX1A 1NM9A 4DPCX 2BVQA 3FFDB 4HS8H 3VVWA 1EMTL 1LQBC 1J1PL 4UIKH 4ATWA 3EO9L 2BP3A 5CSZA 1M1XB 3JUZA 1PDKA 4YSCA 4ELKA 2VDLB 1PS3A 5C8JA 2ARJB 4J1UB 4WV1B 3N50A 3APNA 4XVJL 5E99H 2M8XA 4CBZA 1AP2A 1JZIA 4L8SC 4FQCH 2WLYA 1GS8A 4UTCA 5CLTA 2J8UB 3K46A 3LEXB 3Q6FB 1BSIA 5BS0E 4JQVA 1ASOA 2CALA 4CVXB 1DO5A 1FC1A 1SJMA 4LGSB 5D8JL 5I1JL 5JMOC 1WA2X 3ZMEA 4DESA 5CHNB 3NAAH 3EYQD 3OQRA 3BN9D 3EYVA 3MLXL 3Q8FA 2DWSA 4B9CA 1G9NL 3CCHB 4R26L 3RVVC 3H3PH 4UMGA 1FWXA 2V5RA 1OP3H