2GSIB

Crystal structure of a murine fab in complex with an 11 residue peptide derived from staphylococcal nuclease
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
210
Chain Sequence
VQLQQSGAELVRSGASVKLSCTASGFNIKDYYMYWVKLRPEQGLEWIGWIDPENGDTEYVPTFQGKVTMTADTSSNTAYLQLSSLTSEDTAVYYCNAGVITMAMDYWGQGTTVTTSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Immunoglobulin (kappa) light chain
publication title Crystal Structure of a Murine Fab in Complex with an 11 Residue Peptide Derived from Staphylococcal Nuclease
rcsb
total genus 40
structure length 210
sequence length 221
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2006-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gsiB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gsiB02
5GGRB 5GGSB 1LO4L 4UUJA 1CFNB 2IMMA 4PR5A 4OLXH 2ZUYA 2OL3L 1LQSR 2OTUB 4M3JA 1WBXA 5BW7C 4Z7OE 4KVNL 4XPGL 3MRRA 2A9NL 3S4SA 2DF3A 2GJZA 3BX7C 3C5SA 1X9QA 5ISZE 2EXWC 3NA9H 5I0DA 4M1CD 5JNYB 1NJ9B 1U3HD 4YHMH 5GISH 3MROA 1UM6H 1A8JH 2Y4SA 2BNRE 3CC5B 4K7PL 1T2XA 2DRUA 4EQ3A 2OMBA 1VHPA 4L3AA 4NQTA 4WUUE 1FORH 2DN7A 1HI6B 5MHSD 4NO3B 2AKRA 5IBTL 1TLKA 1AXTH 3RY6A 2WV3A 5T3ZH 4ZQKB 5C6WH 3O41B 3AMKA 2PYEA 4JRXB 1WZ1L 2ZCKH 4NQUA 4PGDB 2P49B 4TUKL 1YEGL 5DLMH 3VU2A 4U1JA 4X7CC 3DUUA 3V7AG 5I18H 5E5UB 1N3NA 2I07B 4J7RA 1ZLVH 4I9WE 2Z92B 4P2OA 2VNCA 1JYNA 2COQA 5JW5A 5KS9A 4WUUB 3BGFB 3BXNB 4ZUWB 3PJSA 7FABH 1OY3B 3LS5L 5HI3C 4CMHC 3TGXA 3QUXC 3LEXB 3RVUC 4GBXC 1NMCC 1FL5B 1S9XA 4FXLA 5B8CC 4Q6IA 2CDFA 3X13A 3ARFB 2L0DA 3QCVH 3L3GA 2DQJH 1DLHB 2RFXB 4AQ1B 4QXGL 3BPOB 3S7GA 3WKMH 2FGZA 2P5WA 4RX4D 4PBWD 3VI3E 4HKJB 4F58L 3QWOA 1B4JL 5CD5D 4R7NB 1IC4L 2BOCB 4HHAA 1QHPA 3WN5B 5LKNA 4LP4A 3B8YA 3RGVC 5JXEC 3F58H 4S10A 1GZQA 4QXUH 1NBYA 2V2WA 2XWTB 1MHPL 1PQZB 2CXKA 3L3HA 4RNRB 3HR6A 1EEYB 4N0UE 5I74C 4HDIB 5HHQB 5HVGB 3TZVD 1KPUB 4LP5A 4U1LB 5GGQH 4GFTB 4NQED 2GJZB 4HSQA 1Z0NA 3E2HB 1N6UA 5FYKD 5ETUB 3BQUC 3BFOA 4Y4HB 3NFPA 1BQHA 2FO4A 2VABA 1G7QA 3TIEB 3BKYL 3QUKB 1PY9A 5FA3A 3KXFD 1KJ2A 4XP4H 5KS9E 3GMOA 4FQCL 2YEZA 5FF6B 1MI5D 2NY0C 4N0UB 1PX3A 1HHJB 4ZOCA 2W9DH 2EIBA 4H0IA 5F1OB 1KC5L 1J1PH 4LLUA 5J89A 4JKWA 4UIKL 1KG0B 2A9ML 1YN6A 2E7HA 1CGTA 2XQBH 1XGYL 4X9FA 2ARJA 1U3HA 1NSNH 4NUGL 4MB3A 5INDB 2R23B 4YHKH 1WFNA 1NAKH 4UV7H 4Y0GA 3VGGA 3MCG1 5KS9B 4OD3H 2FECI 4TVPD 1D7FA 5IEKA 4TSCL 2Q6WB 2BCKA 3MV7A 2BOBA 4XNUL 3HRZA 4N5UA 3RDTD 2R0ZL 1FZKB 5KANI 5ERWB 4M43H 4LMQI 1F5WA 4UU9B 5D71H 3GNMH 4D0CA 3KG5A 2V2TB 1U8OA 2WK2A 1RPQA 1HOCB 5AZ2L 1NLDH 2FGWH 5CBEB 1FNSH 4U7KA 3X3GL 1T22B 1E6JH 2HTLC 2Q7NA 5T5FL 2QQLL 5TDNA 1GZQB 3RWCA 4JFQB 1Q1JH 1BQSA 5EZOH 4M5ZH 4WCYH 4MVBD 1JGUL 1IVLA 3KYNB 3FO2B 3FZUD 4Y8DC 4JFDD 2F5BL 3LSOA 4RX4A 1W72L 5D5MF 1JI1A 1HEZA 4H8WL 5D8JL 5FYLD 3T0AA 3W81A 4LRNH 4M7ZC 5GSVB 4LCCA 1S8DB 3GHEH 1PZ5A 1YJDL 2ENSA 3CZJA 5CWSA 4LLDB 3ABZA 4JG1L 4W4OA 2Y6SD 3LKOB 3NCEB 2FZ3B 3MV7E 3O9WC 1ZA6B 4R3SA 4EI5D 3TZVA 2MNUA 3GSXA 3I3BA 2C3WA 1P7HL 4LLUB 2F58L 4UMGA 3RUGE 1MCOH 1QSFD 4PS4L 3VE0A 1U8HA 3ARQA 2OJZL 5IGXH 5JORB 3NAAL 4KTYA 4CJ1A 3V6FA 3FOMA 3T2OA 4G42A 4OUOA 4JO2H 4JFPB 2A77L 1W0VA 3CVHA 1OARH 3N06B 1TPXC 2F54A 5D1ZD 3UTZA 1AKJD 1MI5A 1KJ3H 4GXUN 4U1GC 2RR3A 4RGNC 1VSCA 1I1YB 3L3IB 1JRHH 3QUMH 1CS6A 4HUWB 1DQLL 5GGUA 3RUGB 3U0PB 1MHCA 5JOFB 4LBEB 1X4ZA 3UAJD 1IGCL 3VMPA 3AREC 3O45B 5IBLD 2KKQA 1FYTB 2LE9A 2NMSA 2VDKL 3CFDA 3MLWH 4P2RD 1OT2A 3ZHKA 3V4UH 3HMXH 3TO4D 4X9GA 5EBMB 3SE3A 2L7JA 4HXBL 5HY9B 5MEPB 1KB5L 4KRPD 4PV9A 5I66A 2IPUK 4K23H 5IROC 3BAEH 4NJAL 1ZGLA 1OTSD 2MCG1 5HI4D 2WP3T 4WFEE 3RDTA 3A6CH 4Y8AA 2XOTA 2ENYA 3G08A 1QFUH 2Q86B 4D0BB 1ES0A 3REVA 4LEOB 1KFAH 4J3VA 4OJFL 2Z35A 3G5VA 4M61A 4JANB 2CQVA 5E2TL 4JFZH 5C0EA 3PDOB 5FYKE 2BFVL 3FN3A 5F6IB 4TRPH 1WK0A 1HEZB 2IPTL 4R26H 3EJJX 5HI5D 5GS1A 1SM3L 4FG6C 1NGYB 1NQBA 4WI3A 2VXQL 2F54E 4Q9RH 2YUVA 5I17B 1SVCP 3GSRA 5DUBA 4LSTH 4J12A 2YXFA 2B20A 3TLRA 2AJUL 1KXQE 1HNGA 2N56A 1A4JB 3OSKA 4WJ5B 4ZUVA 1KCRH 3CDCA 2R4RH 3BP7B 2BDNH 4NBYB 4X4YB 4M48L 4LIQH 2K3TA 4XP6L 2F54B 1GIGH 4IM8A 3TJEH 9CGTA 2I27N 3RY4A 1IGYB 4JAMB 4EI5A 3QQ4A 4FFWD 3X3FH 1DBAL 1J12A 1QSFA 1JK8B 1MHCB 1R3KB 2AAVA 4GMTH 5D2NC 1FGNH 1XF1A 3ZE2F 4GKSA 2DQIL 1G6RA 2J6EH 4HT1L 1ITBB 4ZFGH 3VWKA 1HQRA 1N0XL 3D48R 3WD5L 1U92A 2YZ1A 5L2KE 4OLXL 4JDVA 5I66B 4OCXH 4GRMA 3WL9A 5D1ZA 1J11A 1UXWA 3O3BB 1F3JA 4WI7A 2R0WH 5B39G 1KN2H 2ICES 1KF9B 3P0GB 3HC0A 4XNMB 4QHNA 5E1AA 5D7JC 1XF3A 1E4JA 2JB6A 1UM6L 4MJID 4P2RA 1WGOA 3V4PL 3G5VB 4PJHA 3PV6A 3TO4A 5C0EB 3C09B 5L2KB 2ZOKA 4KY1L 5LAXA 2DQUL 1YMHA 5EORL 2DKSA 1BD2D 4ODVL 3MLZH 2XYCA 3D0LA 3GSNL 5DK2B 1OAXH 5DHYA 4FABH 2DM2A 4WHYG 1JHTA 1EXUB 1SEQL 4NC2B 5GGVL 3LS4H 4MQXC 4K9EH 4JFFD 2YD3A 4LPWA 3WUZA 4K9EC 1BVZA 4XHJC 2FEDC 4HFUH 3IETA 4NO5A 4Q9QL 2P43B 1XGRB 4J23A 3IJHA 3QCVL 3HNSL 4EQ2A 5CGYC 4YBHA 2ADGB 1A6TB 5HHVL 1S7VB 2EDXA 3SHSA 2D4FA 3D2UB 5AD0B 1SJEA 5E8DH 3Q1SH 1P4IL 4PJHE 3VGBA 1I8KA 1KCVH 4ZYKA 5FM5M 1DEEA 4QXUL 4K8RL 4JZNB 2BXYA 2O5ZL 2B7DT 4YUEL 4G6JH 3RHWF 1NGWB 5KVMC 4ALAH 2W0FA 3VGEA 3W82A 3WJJA 1XGQA 3CVIH 1KXTB 1AGEA 1TIUA 5DS8B 3P4LA 4DZ8A 1NBVH 4G6FB 2ZSWB 3P30L 1FL3B 3HZVA 1I85C 3GUTA 1R3IL 4D9LH 1FRGL 1ZANH 4W6WB 1BQUA 2VDOH 1HDMA 1N59A 1OSZA 1MFCL 4WFHD 2XA3A 1C08A 3OZ9L 3BMWA 3PDGA 2EKJA 5ACLA 4R7DA 3W9EA 4PRDA 5AWNL 3JVGC 1OGAD 4OGAC 4MJIA 1FL6B 5TH2B 1TZGL 1NDGA 4Z77A 4PG9A 5HD8C 3PF2A 1D6EA 4JPIB 2YN3A 25C8H 4OD3L 3HAEB 3WNPA 3MRFA 1BD2A 3G04A 1NCDH 4JPWL 4HS8H 5IKCA 5DUML 5C8JA 2A0LD 2XFXA 1NEZB 1ED3A 1KCSH 3V7MA 4GG6A 4M43L 4YE4L 4HFWB 3WCYA 3BDXA 5EZLB 4Y5XA 3U7YL 1JJUA 4JFFA 2ZCLL 1M7IA 2FRGP 4KQ3L 1XIWC 3PWJA 4TOYH 3G5XB 4OZFG 2X4SA 3P9WB 4ZFZA 4QXWA 3OWEA 3V6OE 4LLQB 3R0MA 5JW4N 1XR9B 2Z31D 3VWJC 3K8LA 1UGNA 3BH8A 5LGHH 5EU4B 2M26A 2UZYB 4PGBB 3JV5A 1C1EH 3QJHB 1U8LB 4F37F 3FQXA 1YA5A 4QHKI 4LSVL 1WFOA 1P7KB 5DJCA 5DRZB 3O3UN 4IEFB 4NM8L 1TMCB 1ZA3B 3O4LD 4P3DB 5DURD 3BKMH 1HKLL 3GHEL 4MAYC 1I7UA 2R2CA 3JWOL 2EC9U 5K9KB 1MHEB 1RJLA 3SGJC 2VJXA 4PLJC 4IOFD 3N1PC 4WUKL 4YNYA 2NY3B 4KJQD 1BZ9A 1GZPA 4D8PB 4GG6E 4JO4H 3SDAC 4ZFOA 5F7LB 3L5XH 1MCWM 1FFNB 3FFCE 1V3KA 3ULUL 1Y18B 1NLBL 4NGHH 1CFVH 4M5YH 1U58B 4U6YA 2OYPA 1UACL 1U95B 4NPYB 3RAJL 4XP5H 4I1NB 3QUML 3VH8G 2XN9D 3MRCA 3DRTA 2H8PB 1S7UA 5DJ8A 1OLZA 4Y19D 1XT5A 2YPVL 1Q9KA 5DMJB 1OGAA 1FNHA 4I77L 3HPJA 1UWGL 1R3LB 3FFCB 1FDLL 3IJSB 4P2QE 2C1PB 1BJMA 4ZFFA 1YNLH 3I02B 4Y5VB 1Q0XH 5KBNC 1UC6A 1KSRA 3GSVB 5IHLB 3W11D 5EB9A 3TF7C 3A6CL 2H32B 1A1NB 4N8CL 3U46B 1QFUL 4FRWA 1BIIB 2UVEA 3PG2A 2BNQE 4GRLB 3UBXA 3Q2CA 1MAMH 1NCBH 2CDGB 4JFOA 3LIZH 4P2QB 5MENA 4HWBL 1R6VA 4QXTA 2NY5L 2XNAB 4PRHB 1FZMA 4GW4A 2UUDH 4G7YH 5LXGL 2Z31A 4KQ4H 1YEJL 1I7UB 4NRXB 4JVPA 3ZE0E 5TJWK 1NFIA 3TBTB 3PGDB 1HHIB 1YPZF 4A2MA 1WWBX 5F7NC 1IQWL 4TNWF 4U49A 2DQCH 2BNQB 2XICA 2VXVL 3GMRA 4ZFOB 1CG9A 1KPRB 3WFEL 1HHHB 1G1CA 4CADA 4ZTPL 3BPNB 5IR1A 4Q9CA 1JNLL 1KENL 4I0PB 4XBGA 4LK4A 3J8F7 4GW5B 3GRWA 5CD3B 1UZ6E 1UA6H 2VB5A 1OTUC 2X4NB 3ARTA 2BSSA 4X7TB 1NDMA 3IFLH 5DJXA 5GRXG 1GYAA 1WFUA 5K93A 2WIIB 3BDYH 1N0LA 1N64L 2X1XR 4AIZA 5MENE 3V5DB 4WNQA 4PTUA 1HSBA 4ZFFB 4NKMA 5IMOA 3P40A 3ZYZA 3WV0A 4ZAKA 1KN2L 4FFVC 3VD9A 4LHQB 1JP5A 1KCUL 2XN9A 2B1AL 1TJGH 5IW6B 1J0KA 3OB0H 4X4ME 4Y19A 4HXAH 5EBLA 5GJSH 1BP3B 3HG1E 1LEKB 2FYYA 4P3WA 1G7PA 3ARYA 4X6DF 2X7LA 4HF5H 2OL3A 3P11H 5MENB 5CEYA 1EVTC 4ZSOA 4AYFA 1S5HA 5H94A 1N4XH 5A2LH 1KEGH 4P9MH 2CUHA 4ODTL 3ULSA 5AUMA 1FO0L 1M71B 4Q7DA 4AL8H 1QYGH 2DDQH 3BVNB 5FKAA 2HVJA 1C12A 5J12C 3HUJA 3LS4L 2OM5A 3HG1B 2VIRB 2UZXB 4M4RA 4NN5B 4TQEH 1NGPL 3U1SH 3BUYB 4J3WA 2V7NB 3QJFB 2Z93A 3VG0L 1MFEL 1IGTB 4HZLB 3VFTA 2VXUH 3SQOH 2B2XH 5JUEL 5IB4B 2EIEA 3TJHD 5F7FA 1JNJA 4PY7A 1EMTL 3QRGL 3SDYL 1OPGL 1A14H 4NO2A 3T8XA 4MJ6B 1CIDA 4LPYA 3S5LG 4ZMAT 4I5BA 4GH7B 3OKEA 3NGBB 3NZ8B 4G6AC 5D96B 1Z9SA 1PSKL 1I9IH 2EDQA 5DJXB 1MWAA 1OT1A 4ZODA 1R3JA 2VDML 3FAWA 5K33A 2WANA 6FABH 2FWOB 4NOFA 3V4VH 3KPSD 4L8SC 1F90H 1S9WA 2Y72A 4PTUB 1CE1H 4YDVA 4ZSOE 4MA8H 4NN7C 2YN5A 3T2NH 3SBWC 4LAQH 5K9OA 4QT5A 4ZAKB 4R2GB 4MNQD 1EGJL 2D0HA 1FQ9C 2BSRA 4WDIA 1YN7B 4C57C 2V9TA 5EBLB 3JWDH 5LGJA 3GB7B 3QI9B 4NIKB 3ZDZE 4CNIB 1O7SA 3H9HA 1MJJB 2AXFB 2YK1H 4G43B 5A16A 1B4RA 3GBML 1QNZH 2OL3B 3VFGH 4DUVA 5KSAB 4ZSOB 1PFCA 2I9TA 4XRCA 3BKJH 3Q0HA 3IJYB 5GRJL 3T3MF 3VRIA 2BK8A 3OKYA 2VE6B 3SDXE 2Q8AH 2AK4D 2MCPH 2CUIA 4YBQC 2QLVB 1BBDL 1IAKA 3NCYP 3Q5YA 3TBVA 5TF1H 1ADQA 3QDGD 4RMTA 5FOBB 4KZDL 4I2XE 2A83B 1PVHA 1BFOA 2MQCA 1DFBL 2X5PA 3ILQD 1R5IB 5CZVH 1Z5LB 5EN2A 1FVEB 2RJMA 4WEBL 3SDXB 3FL7A 3UTSE 1VFBA 3RIFK 3IU3A 4J3OC 3NIFF 4L4VE 4NT6B 4S1QL 3GIZL 2UVFA 3LDBC 3PP4L 1CE6A 5F1KC 3HNTH 4KJPD 3CUPA 2NTSP 3OAZH 4I2XB 1F4HA 2QKIB 3MCKB 2F8XC 5E2WL 5DTFA 4KI5D 3TA3D 5E6IC 3U36A 1EEUA 3UTSB 5BOZG 4L4VB 4LCWD 4PJ8A 4LLVB 4OLYL 3ZTNL 3PHOA 5L2JB 1UVQA 4G8EA 3QUZD 1J0ZA 4RGMC 3BYTA 1X44A 3PP3K 1DQQA 1N8ZA 2QADC 4G3YH 4MXWL 2CRMA 1WEJH 1RQ5A 4PLOB 32C2B 1UKTA 3EYFA 3X12B 2CPCA 5JPNA 1U93B 3O6KL 5FYJD 2PR4H 3L5XL 5TFSL 3H6JA 3UJTL 4U05A 5IMKB 1IAKB 1S9VB 1OAYL 1ONQB 3X14B 3WFZA 3RY5A 3AGVA 1CFVL 1U8JB 5IB5B 1CI5A 3JWNC 3EJZD 4UILL 4P5TD 1BFOB 1JYXA 1Y6NR 5SX5H 4NNXB 1R3HB 1XCTB 3DRQA 4TNVK 3KLSA 5H37H 5L6YH 4X8JA 2VC2H 4F15C 1KNOA 4RQQA 4LHUG 2E9IA 2AERT 2AK4A 2ZOLB 2FHFA 4HS3A 4Z6AT 3VRJB 4OFKA 4RRPG 4JQVA 1BEYH 4NNPL 4FXGA 4Z0BL 3MJ9A 3QDGA 3NFSH 2EXWD 2GI7A 2IQAA 4GW1B 2P1YA 3I3DA 5J1SC 5A1AA 1Q9OB 1DQJA 4PG2C 2QJDA 4Q2ZA 3TBWB 5DUPL 2XI9A 4Y4FC 5FUCE 5C0FA 2DQHH 1CL7L 5GGTL 4DK6A 2VLRB 5ACZA 1P5UA 2PTTA 3CSPA 5KG9B 1YECL 3U36B 3FRUA 2IH3B 5ESAA 5I1CH 5A3IC 3ARBB 4XNQA 1RULH 2I9LB 4WTXA 2G2RB 2ICEB 4PJ8B 3BEWA 5J06A 4G8EB 4PJXA 5T3ZD 2IEPA 2FL5A 3S3JA 4M9PA 1SMAA 1I7RA 4G7YL 1S7XA 1H5BC 4G6ML 4CU8A 2BXZA 1EFQA 1UKQA 4KVCL 5E8EB 3SE4A 5ICZA 1H3PL 2FX7H 2BVOA 1QO3A 4OT1L 2VZSA 3TA3A 5F7KC 1T03L 3FO0L 3ROLB 5J3HC 3GKZA 1XF5B 1IGJA 1IM9B 1M05A 2ADIB 1W72B 3I75B 2OZ4L 4JFXA 1VGEL 3QUXD 4LCWA 2D0FA 4B41A 4OLEA 4YHZH 2D9CA 3OKKB 4GOSA 1F6FB 3QUZA 3VG9B 1N6VA 5CJQH 1SJVA 5I1IH 4G5ZH 5I30L 4LDEB 4S0TD 4JKPL 5DJ2B 1K3IA 3FO1B 1RMFH 4MSWB 4NP4H 4WU5B 2NW3A 3SKMA 2DQFB 4OZFA 4MNHA 3RGVD 5JXED 1RJZB 4RQQB 1Z6JT 4M7KL 5DT1H 1XF4A 2NY4D 2XQYG 4G9DA 1NAMA 4IS6B 3RBSA 1X5GA 5I75C 4NQCD 1P4LA 4IBLT 2AXGA 1KCKA 4IIQA 4M6NL 1JPSL 1BJ1J 2GYSA 5IVZA 5F9JA 4GAFB 2JK5B 1B0GA 5GRUH 2AK1H 4P5TA 4N0RA 4XAWL 3UYRL 3BQUD 3LKQB 4A6YA 2MHAA 2JF1A 2V5YA 2V7HA 3SY0B 4R96B 5C2BH 1BWMA 3F65A 3DX9B 1BHGA 4OQTL 1KN4L 1P69B 4FQIH 2NY0D 3G6JF 1E0OB 1KB5B 4AENA 5KANG 1YQVL 2XZAH 2XZCL 4TPRL 3QUYC 1UYWH 1SY6H 2WUBH 3L3DB 1S7XB 2P8LA 1FBIL 3V52H 4HIJB 5ICZB 2VERN 2YD1A 1IAIL 3SE8H 2HWZL 1M05B 4C83A 1AY1H 4KPHL 4JFXB 2YA2A 4UTBH 3SOBH 4AY0A 3VXUA 3C87A 5I1AB 5EU6D 4DGIL 4FQPA 4I18B 4KZEL 2WAHA 1U8IB 5E7FA 2DOCA 3A6BH 3HNVL 2VXTL 2EDFA 1HE7A 3GSNA 4JGUA 1J8HD 5IFHH 5DI8A 4DFIA 3JBG7 1X5LA 1JI2A 4V1DD 5B38B 5IEHB 4FS0A 2HTLD 3KPRE 3T0VA 4MNHB 1QSEE 1Z9MA 3GMMA 2AEIT 1MFAL 1AGFA 3ALPA 5F9WC 3QUXA 2FH8A 4ZUTA 5HVWA 1MELA 1EBPA 2H2PC 4NJ9H 4F7TA 5B8CA 1I9IL 5D70L 2A6IA 2B8OT 4P23C 2DBLL 4ZXBB 3GMLA 1N6QL 3BP5B 3T0WA 4BFEA 4NC1E 3FQRA 2JJSC 3EO9H 3ET9F 1TCRB 1BQLH 2FIRT 2IG2H 4XXCC 4MA8L 4C59B 4NKIH 3KPRB 5TDOB 4NKQB 1QSEB 1VADA 5JXEA 4UQ2A 3GI8L 4X98B 3WDJA 1L0XA 3EBAA 3RX8A 2EE2A 3F5WA 1FFRA 2VDQH 3MREB 3HA0A 4NQCA 5C0BD 4LSQH 5E99H 3PE9A 1BF8A 3VFRA 3MNZB 4AENB 3VXUE 3VFGL 5I1JH 5E8OB 1F2QA 4PJ5E 5D7KD 4YQXH 3BQUA 3BKJL 1DLFL 1IEBA 3W39B 3CLFL 1EHLL 4DW2L 2MCPL 1TZHA 4OF3A 4GAJL 2RB8A 4RGND 3IAPA 4U1NA 1D5XB 4HLZG 5DMYA 1G7MA 5CZVL 4PJ5B 1Z3GL 4Z0XA 3GSNB 3HZMB 3CX2A 1CTNA 1YY8A 4MJ5A 2HFGH 2O5YL 5I8EA 3NBNA 4PJFF 4MA3A 4Z7WB 1U8KB 3OGCB 5CCKH 5LWYH 1RZKL 5JW3H 3BZEB 3HNTL 5EU6A 3RQ3A 2ZNXA 1Y6KR 3FQRB 3FHAA 4PJ9D 5KTEL 3DO7A 1UCBL 5DO2C 2BY2A 1J8HA 2YS4A 4NZDA 3R0NA 1ZT4A 4R8WL 4ISVA 4OCMC 3RWGA 2Q1EA 4K3JH 1LE5A 3RWFB 1AD9B 4FG6D 2CR3A 5DD6B 3MODH 3FB8B 5IB2B 3O6MH 4KKLD 1KGCE 1T1WA 3V5HB 5M95B 5MERB 1A7NL 4LLYA 2QQNL 4YHNA 5IJKA 1QEWA 2W91A 3HLAB 2Q3ZA 3S97C 3VFRB 5CS7A 3IFPA 1I1FB 3DVGA 4I4WA 2C26A 5J9PB 4GAYA 3IDIB 2ZCHH 3OF6D 4R0LC 4HCRH 4AH2B 5IIEB 2H45A 3T1WA 5DFTA 3BIBX 4G80A 2YSSB 3FB6A 4XWGL 5GRVL 5C0BA 1WT5A 4NZRH 3R1GL 3U4EA 1DQML 4RAUA 3RA7H 4U1NB 2W38A 5J1TC 2VXSH 3T09A 4OF7A 3BP6A 1MH5B 2D3VA 2XRAH 3DYMA 3GKWH 1CGYA 3T3PE 5C0DA 3F12B 2VC2L 4WU7A 4MJ5B 3MYJA 2GJ6A 4RAHA 1F6AA 3VFNB 1K8IA 3MBXL 3MCLH 3AXLA 1MCJA 4OD1H 1YMME 4LCIL 3MRHA 2YUZA 5C0NC 1RU9H 4ODXB 4JRWA 1XEDA 2GUOA 4OCRH 4XVJL 1BGXH 2ITDA 2X05A 1ZE3C 4MCZA 4RA3A 5D7JD 3ZTJG 1OW0C 2EDHA 4XPFL 3TCLA 4JE4B 3QUMA 5DJYB 4OFIA 4OCYH 2X4UA 1SEBA 4HJJL 1ZT7A 4LF3A 3THMH 1S9YB 1E6OL 4AEIH 3DV6A 2WMPA 5FUOL 3RI5K 3HMXA 1YMMB 3UTOA 2WZPD 3P4NA 2VDPH 4WTZG 1DBJL 5DD5H 2CIKB 3V6ZB 1QLEL 2PF6A 3GM8A 2AV1B 3LCYA 1NUNB 2HFFA 3KJ4B 4HS6B 3WSQH 4LHUD 1K5NA 4PJ9A 1D5BB 35C8H 2K7QA 4MQXD 2FJHB 1I4FA 4NN6B 5CSZA 5CSGA 2EIDA 5F70A 5JW4R 3BIKB 1F45A 3ZKMC 5F7DB 1OP3H 4XHJD 4P46B 1PZUB 5I73C 2FEDD 2X4RB 1U0QA 2GJ6E 1Y0LB 1RIHL 3Q6GL 4KUZL 1AXSB 1ND0A 4QTHA 3ULUE 2Z8VC 2XWJB 4JZOA 5DQ9B 4RAUB 2QR0A 1JZ5A 2UYLA 5CGYD 3OR7A 5J6HB 4HH9B 5D6CB 1G7HB 1WLHA 4KHXL 2OR7A 5HGBB 1WC7A 3AC0A 4RDQG 4DWHA 4XPBH 3SCMC 1DQDH 3OF6A 1UFUA 2GJ6B 1LEGB 5JO5A 2Z8WC 5INCB 4ZNEE 1INEH 1B0RA 1FZJA 4C4KT 5ILTH 2GUOB 4FQ1L 5K9QI 3KPMA 4U3CA 1JYWA 2E6PA 4APQC 3FMGL 4LL9A 3ZYIA 4Q0XL 3F8UB 2W0KA 2CKNA 2H26A 1T5WA 2X4UB 3N1GC 1XGUB 4MWFB 1SEBB 1TJIL 4XMPH 3DARA 2XKSA 4NSKB 3S36H 1DBBL 1TJHH 2J6EA 1KELL 5AEAA 3IGAA 4LKCA 3IDNA 1T7YA 4OTXH 5D7JA 2AJ3A 3PWNA 3U6RA 2WUBL 3PQYD 4OGAD 3NPSB 3MQIA 3MSPA 5CSZB 5HD8D 1RUQH 4S1SL 1DANT 1BAFH 5GIRA 5KN5A 4Z7VE 5KAQF 4EVNA 5GSRA 4LSSL 1P6AB 4GXUM 2X42A 3H42L 4Z7OF 5F71A 2HKFH 3QDME 4NQEB 2YZ8A 3MRKA 1I3RA 4CAGA 3U9PL 1A6ZB 4GQ9L 3ZT7A 5K9JL 1I1AC 1NBQA 3FOLA 4NUJA 4LSPH 1R0AH 2LQRA 1ND0B 1A6VL 1R5VB 3CMOL 3QFJA 5ENWA 3VFPB 3V8OA 2AJVH 3KXFB 4LHUA 4KDTC 2AJSL 3O2WH 4EJ1C 3NCCB 3Q6FA 2D7TL 3H7BA 4HWEL 2FX9L 2YPLD 4RRPA 3P4OA 4Z7VB 3QDMB 2A2QT 3EYOB 5FHAH 1RZ7H 2OBGA 5CILH 3EOTH 1K4DB 5FGRA 2F74B 2YBRA 5LCVL 4KC3B 3ZDYE 1CFQA 3H8NA 3NZHL 3WXWH 1UEYA 2WINA 1N7MH 5T3XH 2WM0A 4AEEA 3T0BA 1C5CL 1RHHA 1ZLVK 2W0LA 2IFFL 2X4TB 2Z91A 2PO6C 1BZ7B 2Y7QB 4N8PA 1DN0A 4F7EB 3E6FB 1LP9E 3SKOA 1Q72L 4OKDA 5T1LD 1LMKA 2DTMH 4MAYD 4WI5A 2F53D 4KV5E 1MFBL 5HYSB 4P5MB 5TDPB 1N5YH 3BEVB 1YC8A 4PUBL 3VI3F 4IOSD 1J5OH 1CFBA 1B2WH 3IXTB 3QFJE 4J4PC 3SDAD 3PWNB 2HLFC 3VMNA 1A3RH 4OIIL 4ONGL 1LP9B 1C7TA 3QEUB 4J1UB 4GKNA 4U1IA 4PRAA 1YEDA 5DRWA 4XCCH 2EDDA 1F00I 3MV11 4ZUUB 4KDVA 2IADB 2D7MA 3S3PA 4RZCA 4GXVL 4JM2B 4X80L 4BQ8A 2EYTA 5ENWB 3BE1L 2IH1B 5ABDE 3JVGA 3JV6B 3WFBH 3PQYA 1FO0B 5DYOB 5KS9F 5LQBH 5BZDA 2EEAA 2APXA 4RAVB 2WBKA 4PD4J 2DQGH 1LILA 2VL4A 3PWLB 1KIPA 5FECB 5DJ0A 3ZE1F 2AQ3A 3PWPD 1OWRM 5IFJB 1D5MB 4XMLL 5ANME 5DDHA 2APTA 2DI7A 2ED9A 1XF2A 1Q9WA 3BPLB 2NPLX 4JGMA 4DAGL 1II4E 1WAAE 1AKJB 3SDDD 4CJ0A 4F3FA 1YEKL 2YPLA 1KLGA 1UWXH 5D5MA 5JOEA 1T4KB 2MTPA 3DXAB 3NABL 3GHBH 4ZPVB 2CUMA 1A9EA 1XGPA 3KJ6L 4RMVA 1WISA 3S37H 4QHMA 1RZ8A 3QDJD 2LAAA 5C07E 2AABH 3FQTA 5ANMB 5B3JE 4L4TA 3MRJA 4D9RE 3AY4C 4H1LG 5ITBL 2OI9C 3QNYA 3HE6D 3O2DH 4D94A 2OCFD 3I50H 4XNXH 8FABB 4U1MA 2KZ1B 4OCSH 1TVBB 3HCVA 5E2UH 5I8CA 3UJIH 4GKNB 1QRNA 1YEDB 5I1HL 4MAYA 3TVMC 3MNWA 3VFSA 2F53A 5C07B 5EU7E 1ZLSL 4KMTH 4KK5C 1X5ZA 5EA0L 3EGSA 1OTUD 3VDBA 2DQTL 2G60H 1DDHA 4FFYH 1MRFL 3LRGA 3SDAA 4F9PC 2P7TA 2XRAL 3TNMA 4LVHC 5F88A 1WWAX 3C8KA 3WHXA 1QTYT 2LVCA 1OAKH 5FV1L 1JF1A 4PFEA 3VGAC 1CU4H 4O2CB 1NMAH 3RUGF 5I9QC 4F9LA 1FLRL 3P0YH 4R4FL 4DJMA 5SWQA 1IBGH 4FZ8L 2F19H 4L4TE 2L4OA 4FFZH 4PJ7B 4K7FB 3MACL 3JV4B 1XF2B 3BKCL 3BN9C 3FT2A 3TYGH 3ARGC 4ZD3L 1S7QB 3HI5H 4F3FB 1Q0YH 5FO7B 3CPLB 3PL6B 3WJLC 1F97A 3S37X 5F89A 1WJ3A 4Y5YA 3WO3B 4YZFE 3QWQB 1QRNE 5JA9A 1I8MA 1CXLA 1FVDA 3PWPA 4PJDE 1RZ8B 1T1YB 5F7UA 1BFVL 2XKNB 2YWZA 4L4TB 2NX5D 2VH5L 2EEDA 1MFDH 4HX1B 2R56L 1AO7D 3I6GB 3SDDA 2EDWA 3MRBA 3MUZ1 3ZDXE 3MXWH 2DQDL 2CMRH 2G9HB 3ROOB 3RVTC 2IPKA 15C8L 4LKXB 3DGCR 3OTTA 1FAIH 5C09D 3RKDC 3T77A 1QRNB 4CL7A 4XBPB 3EHBC 4TTDC 1GL4B 1GAFH 4PJDB 3QDJA 1PLGH 4HKXA 4E5XA 4JHWL 4OLZL 4K2UH 3M8OL 1S7RB 1SBSL 1GGCL 1DUZA 5EBWB 1JV5A 3QEGL 3HE6A 4E9LA 4G6AD 1RUAH 5L7XL 2P7TB 3L6FB 2MPAH 2OTWB 4N8VA 3B2VL 4CMMB 4MLSA 2FD6L 4G9FD 3A67H 1WIUA 2EKSA 2VR5A 1B6UA 4FP8L 2HKHH 3IF1A 3TCXA 4BKLB 2JB5H 4OLUH 2XG4A 2WWKO 1INEL 4UOW1 4YPJA 5F1IB 5ILTL 4RWYH 1WZKA 2DWEA 1TZIA 1WFTA 2PW1A 4AT6B 3H3PL 1T7XA 1NC2B 5DA0B 5I8KH 4KTDL 1UZ8A 4KKNA 5K59F 4XZUA 2FIKA 5EOQH 4KDWA 4YXKH 3IYLW 1KIQA 3LN4A 2YWYA 3TP4A 4IRZL 4FQ2L 4L8DB 3LPWA 2R29L 3S34L 3AM8A 1RZFL 4Y5YB 1MVUA 5IB1B 3VMOA 2W07A 4M7LT 3D39E 2DICA 4K3DH 1F3DJ 3IDYB 4PREA 4NHUA 5CBAA 2AJZA 1I9JL 5IG7A 5ID0B 1A6PA 3FFDA 4LSRH 3REWB 1J1OL 1L0QA 3BGFC 1JZ8A 2HLAA 2Y06H 2D7QA 2ZWLT 1HN1A 4GLRI 3CX5K 4HV8A 1JTPA 1JFQH 3D39B 2NTFA 1ZGLM 3JTSA 1ZMYA 4PGCB 3ESUF 2G5BA 3CFBB 4B7LA 2AJVL 2NX5A 2DTSA 4AMKH 4JJ5A 4OQ1A 3BMVA 3DX8B 3O3EA 4DN3H 4EN3B 2PN5A 5AZEH 1WSST 4WFGD 3DJ9A 4LHJB 4JRYD 2Y36H 1M6OB 5C09A 4QRUA 3RVXC 4L5FL 1A9BA 3IRZA 3S88H 4E0RB 1PKQA 4PGZA 5F96L 3EO0B 4YPGB 5F9OL 4XH2B 1RIUL 5E6ID 1A7BA 3MRLA 4NBZB 3E2HC 4XC1L 5EU5A 2QSVA 1DSFL 4DKAA 5SWZB 3U0TB 2ESVE 4Y4HC 5TE6H 2GFBA 1A7RL 1KBGL 1NCCL 5E56A 1A1OA 1WZLA 2RBLA 3VI4F 4ODSL 3DURB 4G9FA 3G6AB 2AXJA 2RAMA 4BA8A 1CGSL 2QADD 1U3YA 4JG0H 3OKNB 1XFPA 1MVUB 3EDDA 1SQ2N 3FN9A 1MJ7L 5MEOB 2VAAA 2C1OA 3D25A 4HIXL 3VXMD 5I1KL 2CIIB 1F11B 4DQOL 1QHOA 4JQIH 4YDKH 3W2DL 2ESVB 2NX5E 2AJZB 4P2OC 2Z8RA 3AU1B 3NPZB 1UT9A 5ESVA 4NDMA 3RNKB 3RTQB 4S1DD 3RU8L 1YUHA 3U7WH 4FTVD 1GHFL 2EIZA 5CINH 1JNHB 3EDJA 5FDWA 1TTGA 4FQJH 4HUXB 4OGXH 1E27A 4R97B 4Q6IC 3I2CH 2NTFB 1UB5B 3KPTA 3O4LB 4EOWL 4BH8A 5DR5H 1MCCA 4U6TA 5DURB 4HKBA 3VXTB 4DKEH 1IGFL 4FQXA 4YDJB 2DB8A 1KUMA 1NANI 1T2QH 3TFKC 3OKMA 4F57L 1FLTX 1G7JA 1A7PL 2VSCA 4KK9D 1E4WL 2NY2B 1C5DA 3MRPB 5I15L 2XA8H 5E4EC 5ADPH 1PG7L 2DJUA 2E5EA 3IDJA 5IF0A 3CSGA 1TQCC 4H20L 4G9FE 4K94H 2GSGB 4QRPD 5C0AE 4XBEH 5AAWA 3OKLB 3LY6A 2E27H 5H8DA 3WIFA 3SDCD 4XCFH 3KPQB 4QF1B 2OJEB 3FB5A 4M7JL 1YEHL 3QIUA 5A3ID 3MJ8A 3STLA 1KTLB 5DRXB 5BXFA 3Q3GB 1RUKH 3CLEH 4K71B 4RGOH 5BS0D 3KS0H 1CLZL 2AEPL 4PPTA 4YHPA 1SYVA 2NR6D 3KHQA 4JRYA 4ODWB 5E6ZA 3IFNL 2X9YA 1A1MA 5C0AB 3WFCH 1FN4B 4PRID 2C4FT 2NLJA 1Q94B 2AABL 3KPLB 2BVYA 4YHLL 5C92A 5MEQA 1PYWA 3GO1L 2VAAB 5EO1B 3L5HA 1ORSA 4MD4B 5E6YA 5E70A 4HQQH 5FO9B 1IAOA 2VDNL 3A0OA 3BT2H 5J3HD 3QO1B 1VEPA 1MQ8A 3LB6C 5C0RL 5EOTA 3O2DL 3INUH 3QEHA 3MRMB 3I50L 2AGJL 3MFFB 3QZWA 4L8CA 3PHQB 2HN7B 1MLBB 3PXHA 3BN3B 2ADJB 1J05A 1INQB 4YIQA 2Y1VA 3IVKA 4OSUH 5FDWB 1CR9L 5HDBF 3V5KA 1OD9A 1F4YH 3A6OA 4FQLL 4X5WB 2OSLB 3VXMA 4C56E 1FG2A 2IAMB 4FZEH 3U2SB 1ACYL 2JE8A 3ECBB 1V7ML 3NTCL 5CUSH 3P77B 1WICA 2AEQH 1CVSC 5ESQA 1DL7H 1L7IL 5HVHB 5T33H 4M6ML 1NUFA 5DJ6B 2R2EB 3QB7C 3V0VB 5C9JB 4FTVA 5FM8A 4QHUB 1KEMH 3TBYB 2DKMA 4HBCH 5EPMA 1WBYB 3GZKA 4RMWA 1J86A 4C56B 5SWSE 3DSNA 3OKOA 3FB5B 1G7IA 3CSBA 3QIUB 2B5IB 4LGPB 4WY7H 3VFOB 3TYGL 1RIVL 4PJBB 1ZHNA 5IT2L 1QSVA 3OR6B 1S5IH 4F2MB 1FGVH 3MJ7A 5BJTA 3ARDB 2ZJSH 1CD1B 3QUYD 4QRPA 1A1MB 4PG2A 4ORGA 5I1EH 4RBPH 3MRIB 5DJZB 5D7SH 5SWSB 3TZVC 3SDCA 1B0WA 4NQXA 3RL1B 3MLTB 4JFHD 1YPZA 2GCYA 1MPAH 4PV8B 3AAZA 4JR9H 3TO2B 4IRJD 3KYOB 2YD5A 3VFVB 3H9SD 4XP1H 3W5NA 1HZHH 5JQHC 4ZS7H 3ZL4H 1DBML 3AUVA 1K2DA 4PRIA 1DBKH 2LFGA 5DEGA 4NKOB 5E2VL 1PLGL 3L5IA 4ELKA 3BZFB 2JJUA 3OXRA 2XTJD 5ACMA 2X1OA 4K2UL 5J13B 5KVGL 3S96B 4TNVF 4U4BA 2H2PD 4N5EC 4P23D 2E8ZA 2X4QB 3SE3C 3WNMA 3ZE0F 2UUDK 2VQ1B 1I3UA 3DTXB 2B0SL 5FEBA 2B4CL 1E4XI 5HGAB 4LVNC 4ODHH 3D3VD 4X7DC 2QSQA 4BZ2L 2X4OA 4B53A 3RDTC 3VFUA 3LRHA 1VENA 5B39B 1F13A 4UTAH 3W0WD 2GAZA 3QQ3B 4M6OH 5E5MA 2PXYB 2IQ9L 4HIIA 2XWBA 3CGTA 2BJML 5I71B 3LH2L 2NY7H 4U1KA 4X5LA 1NFKA 4LNRA 3R06B 1FFOA 4X6DA 3QHFH 1UZ6F 1NCNA 4JM4L 1AC0A 5GS1C 4QTIL 12E8H 4Z5RB 1WVZA 3LN9A 5E94B 3LZFL 1PY4A 4PRIE 4UB0L 1OSPL 1AP2B 1IT9L 3IDUA 1MCQA 4H88H 2J4WH 1OGTB 3ARXA 2C7UB 4LSRL 1YNKL 2IALA 3VXNA 4O4YH 5GS0H 2YA1A 1VFUA 4YO0A 2XKUA 1U3JA 5E08L 4WHTA 1U2CA 3RZWA 5CP7B 2EE9A 3QUYA 3UC0L 1OAUL 1L7TL 1K2DB 1A2YA 1VFOA 4EI5C 1G84A 4GLRH 1SY6A 3OB0K 3L95A 3C5JB 2D7NA 1AGDA 4O2EB 1RURH 1JN6A 5FIEA 1YEEH 4IRJA 5AZEL 3VWKC 1JZ7A 3S35H 3H9SA 4BSVB 1HHKA 4MDIA 3LHPL 4X6DE 2JJVA 5D1ZC 4ELME 5D7LD 2PW2B 3L3KB 2HH0L 5TE4L 4Y16B 3B3IA 1GVIA 4XVTH 1AGCB 1YNTB 1EO8L 5IBLC 4JO3H 5HYEA 3RNQB 1IC5H 2LU4A 3L9RB 3VDAA 5IMLB 3L7EA 3O6LH 4E41E 4UBDC 4CVXA 3TO4C 4J3UA 5JOPE 1S7TA 1OAQL 4ELMB 4JLRB 5IESL 1OTSC 1KV3A 1MCEA 1QLRA 3QNXB 4U6VL 1TENA 5C7XH 5KSVA 2CKBL 4HH8A 5E1HB 5F3HB 3CXHJ 1SMOA 1XGTB 5CEZH 1IAIM 3BRFA 1KCLA 1LO5B 5EUOB 5ADOH 1AQKH 4DCQA 4G8IA 4X7EC 3HAEH 4E41B 4OB5L 4D3CH 3ULVL 1QPPA 5J6GA 2YA0A 3HI1B 4WV1B 3VXNB 3N1QC 3MLSH 1IQDA 1O5DT 3RWIA 4DVBA 2AI0H 3S9DB 1B88A 4OBSA 3EZJB 1A2YB 2C4XA 4HWUA 5DRNB 5DR5L 2FATH 3OGOE 5DGQA 4HK0B 2XTJE 4L3ED 3S35X 5F93C 5C0ND 2MQ0A 5KZCD 2I60H 3CAFA 1FPTH 3L7FB 4Y2DA 4HUVB 4XB7A 1CICB 1GGIH 4HIHB 5FCUH 1NANH 3GMQB 1LK3L 2R2HB 1QBLL 1ZTXL 1GOHA 2VYRE 4TUOA 3SDXF 4HW6A 1EPFA 4FQQA 3C60A 3WJJC 2IPUG 3QWRD 4XMKL 3WIIH 1MAJA 3C6SA 5BVPL 2W60A 5GPRA 4XWOC 1NGZB 4PRBA 2BMKB 5IW1A 5CHNA 4UV4H 5JMRA 1KTDA 1ZVSB 2HJFB 1JGEA 2OQJA 1ZSDA 4CVXB 5I1GH 3V95A 1S7TB 3K2UL 1LO2L 1T80A 3QEQD 2CRZA 3OXSB 2P46B 5D7LA 1JPTH 4F37K 3BWAB 3BIAX 1T0NB 2LTQB 3WUWA 4U3HA 3M1BA 5CSBA 5I1DA 5C70A 4Z7UE 2EDJA 3UTQB 3ZKMD 2APBA 1IGIL 1HINL 1F8TL 2FR4B 4PD4K 1C5BL 1NC4D 3INUL 3MUHL 1BM3H 5HYJB 3OAZK 3PGCB 1X7QA 3WS3A 1MLCA 3O3AB 5K9QG 3LEVL 1JWUB 3EDKA 1F4YL 4NYLA 1MRDL 4Z7UB 1QA9A 1XCQB 2BX5A 3MA9L 3SCMD 3VH8B 4HJGA 4EDWH 3GGWA 3QG6B 4LLMA 3T1FA 4R0LA 3RZCD 43CAA 3E6HB 1IFHH 3VD7A 1T3FA 2DIJA 1QOKA 4Q58C 4HCRA 4PBXA 2HT3C 2H32H 3PIQB 3NA4A 2DQEL 1NBZB 1D6VH 4APQD 4HBCL 4G6KL 2HT4C 4X9IA 5ICXB 3WS6C 4NRZA 4GBXB 1NMCB 1IEHA 4EUPG 1CLOH 1TVHB 5AAMA 3C6LD 2P8PB 1HH6A 3EFDL 1FNAA 3EYVB 4L3EA 3QXAB 2FHCA 4WW1A 1JWSB 3MLXH 5IVNA 4XGZB 3VJ6B 1RVFH 1FNEA 2N7AA 3HZKA 1IAMA 1N2RA 2UWEB 5ID1A 3PGFH 1P7QB 5SX5K 2IGFL 5FK9B 5I1EL 1HILB 4EKXA 4WO4A 5I74B 3S4SG 3T65A 3MV9D 3STZA 4OV5B 1S7WB 1CQYA 1S7SA 4BSWB 1A6WH 4U7MA 4Z78A 1A6AB 3VW3H 3ILPB 5JHDA 2WUCH 1I1AD 2PYFB 3N9GH 3UPRA 1N5AB 2G75B 2JELH 1FH5L 2V2XB 1ZLUH 1RK0A 3BPNC 3EOBA 1HZHL 4DGVH 4DGYH 2P5EE 4ZS7L 4EBQH 3QEQA 1BWWA 3EAKA 4KHTH 3DVNB 5DFWH 1JUFB 4MAUL 1FCCA 4JKKA 4TNWK 1JNNL 4JB9H 3G6DL 3NCJH 5I76A 3N85L 1INDH 1F42A 3QH3B 4RWHA 4HJGB 5I19H 1NC4A 2IBZX 5H35B 2FJGA 2GSIA 2H3NB 1V3LA 5E2JA 1GGBH 2X89D 2A6JA 2P5EB 3DUSB 1V5JA 5CKGA 5SV4A 3DROA 4PTTA 1LGVA 2VOTA 2PO6D 1ZEAH 4O51A 5T3XD 2FB4H 5BCAA 1E4XH 3Q48A 3LKSA 3LN5B 4M6OL 1HH6B 4JN1L 2ITCA 4Y2OA 2CLRA 1MQKL 2NYYC 3RZCA 4KRNA 5JHDE 3UZQA 2HFTA 3G6JA 1LNUA 4MCYB 4V1DB 2QHLA 3UPAA 2CR6A 1FNEB 4HUUB 3HZKB 2Z31C 4W4NA 2FBJL 5HPMA 1IEAB 1GC1H 4WO4B 3T65B 3FT3B 1CGVA 3C6LA 1GC1C 2X70B 4NN5C 4P4RB 5JHLH 1UWEL 2BSTA 1TNMA 1BQHG 3EOAA 5DQJA 2DD8H 5HJ3B 4Z76B 4ZUSA 1P4BL 4LRIC 4AG4L 1MIMH 3MRQA 4GKZA 3MR9A 5BZWA 4OZHE 1G6VK 2KUTA 1W8NA 4NCDA 4NQDA 4GT7A 3O9WB 4O02H 3BGMB 2P24B 3MV9A 2CH8A 4QOKE 2V5MA 3NGBC 4ZTOH 3RWEA 4ZO6A 4JJHA 3S5LB 5HGDA 1HYSC 3LMJH 1ORQA 2J5LC 3OPZL 2C3GA 3MRGB 3BP4B 3FRPA 4CVZB 3MGTA 4KDTA 1K8DA 2Q8BH 4WIQA 5F7EH 4OZHB 4U1GB 3WEXA 2F5AL 4ZAKC 1HH9A 3DIFB 5C0CA 4QOKB 1LO4H 2KQNA 5F8QC 3LKSB 2BHZA 3OX8A 3AREB 3LRSB 4BK4A 4MQ7B 2V17L 4CBPA 4KVNH 1A7OL 3CDGB 4PGEB 2A9NH 2X89A 1OD7A 2I25N 2EYSB 3KWWA 5T1DL 3VA2C 4P9HC 4QY8B 4ZDHA 1T21A 2PO6A 3DV4A 4K7PH 3W11C 1CVRA 3KPNA 3QFDB 1UH2A 4HC1L 4JFEE 3E0GA 1RUPL 5IQ7L 1DCLA 2CJUL 5DSCB 4NQDE 1MCNA 1UQSB 4LSUH 5IBTH 2VUOA 3TVMD 1DP0A 3ZHLA 1CN4A 3GBNL 1WZ1H 1FJ1B 4TUKH 1YEGH 1CFTA 4PJAE 5JZ7D 4JPKL 1NGXB 3PWVA 4YHOL 1UH4A 4X9HA 4U7SA 4JFEB 3HE7A 3ESVF 4NQDB 2FATL 5C0CE 3F7YA 1DE4A 4MJ4A 3LS5H 2NXZB 3QG7L 2M1KA 4PJFA 4YX2L 5TPWL 3HZYB 4HK3J 5C0JA 3LEYL 5IFAL 4PJAB 8CGTA 3D69B 1NL0L 3MBED 1KJMA 3KLAB 3O0RL 4QXGH 4TTGA 3BN9D 3EFFA 5EC1B 1FVCA 2CDEB 3ARGD 1TDQA 2GITB 1GRWA 1JWMB 4F58H 1T1ZA 5EDXA 4Z7WF 1BREA 1BJ8A 2JTDA 1MHPH 3QO0B 4BH7B 1CIUA 3FB7A 1IGML 5D2NB 4W6YB 5CMAA 4GUPA 3OV6A 1RZJL 4RMSA 4ZO9A 4RIRB 3O3DB 1F6LL 4K7PX 3S6CA 2QSCL 3EUUA 5D1QD 4OLVL 4PRNA 4XAKE 1JPFB 3CZFA 2C3VA 1VACA 5F8RC 3KPNB 3BKYH 3RVTD 3RKDD 3PNWA 2O5XL 4FQCH 1G7LB 1LO3L 4TTDD 4YDIH 2HFEB 1HHGB 5IOPB 4M9OA 3BOVA 4U6XB 3V9FA 3I6LD 4K07A 1AHWB 1KC5H 3K4AA 1WTLA 4UIKH 2A9MH 3O8XD 3AY4A 4D9QE 3QIWA 4NFDA 1XGYH 2E7LA 4NUGH 5I0ZA 4NNYA 5EC2A 4OZIB 2ICCA 3DGGA 4X99A 4MJ2A 3O2DA 2H9GB 1KB9J 2YXMA 4KKCC 4LLWA 4MX7A 4TSCH 4XNUH 4OI9A 2R0ZH 4LDOB 4QRQA 1ZWIB 3EOYG 4X0KB 5T1KB 1D6VL 1UH3A 4C55A 3HPLA 1J1XH 2DI8A 2Y5TA 5IJVA 1KJMB 2A1WL 5AZ2H 3CFJB 3TJHC 1QLFA 3BZ4B 4GMSL 4J3TA 3CCHB 3X3GH 5T5FH 2QQLH 3E8UL 3ARBC 5CJXC 3L5WA 3MOQA 3MGOA 2DM7A 2AV7B 4PJ8C 3CU1A 4S11A 4GUPB 1CTOA 4F7PA 4M1GL 5C0IB 4X6BA 3F6IA 2NZIA 1JGUH 1KYOJ 4YGVB 3MBEA 3B6SA 1BVKA 2KZWA 5FUCC 2F5BH 1QVOB 1I1RA 1W72H 3N1FC 4WUUD 2YPKA 2AVGA 4H8WH 1ZLWK 5EO9A 1OF2A 1ZS8B 3WJLA 3MMEA 4P57A 1OP5H 3VW3L 2YKLL 1YJDH 2IANA 4H8WC 1I7ZA 4JG1H 1J0JA 2C9AA 1LDPL 3SE9L 3ARFD 1O7VA 1YJDC 4BQBA 3VG9C 3PV7A 3IXAB 5L8KB 4NCC1 2F58H 4PS4H 4I9WD 2OJZH 3GJFB 3RFZC 3NAAH 3MRDA 5D1QA 1JZ2A 1WF5A 2JCCE 1HXMA 4NRYB 2VISA 2PETA 1EIBA 2HJKB 2C3XA 2EC9T 3OG6B 2Q87A 5I19L 3PABA 3EO1B 4P4KA 4MD5B 1QBML 4OAWA 5EULV 1ZT1A 2QQKL 1QD0A 3HAEG 1DQLH 5DC4B 3MUGA 3O8XA 1FNGA 1IGCH 1JL8A 2VDKH 2F8VA 3T4YA 4MA1C 2R4SL 3ILQC 2JCCB 4Y4HD 5GGRA 5IQ9B 5GGSA 1OP3K 5IP4A 3L3JB 1CFNA 4HXBH 1RFDL 1KB5H 4YDLB 3ULUF 4N0FB 4JVUA 2EICA 4NJAH 4HWZB 4NM4L 4QEGA 2IANE 3ARUA 2GKIA 3JUYA 1JGDB 4W68A 3KPPB 1XIWB 5JNYA 4UINL 1NJ9A 1F58H 3CC5A 1S9KC 4OJFH 3VGFA 3VWJB 4HWNA 3HR5A 3SE4C 5E2TH 3LQAL 2BFVH 1X6LA 3S98A 1HI6A 2IPTH 4NO3A 3KYKL 3OB8A 4KGJA 1SM3H 4JN2B 3DLQR 3P4MB 4ZQKA 1GPOL 3O41A 2VXQH 1MREL 4JRXA 3P0VL 1JGLL 4PGDA 3GJEB 3CXDL 3P73B 3HB3C 3QUZC 1P1ZB 2EC8A 4WI4A 4MNGE 1NKRA 2I07A 2WBJB 5T1LB 1MIEL 2Z92A 3BJLA 2AJUH 3TFKD 1T83C 4WUUA 1HXMB 1J88A 4ZUWA 4TSAH 4TUJB 1EHXA 1CWVA 1WWCA 3HTLX 3LEXA 4OIAA 1FL5A 4M48H 2X09A 1MJUL 4XP6H 4GO6B 4ZXBC 4P4KB 3ARFA 2D9QB 4MNGB 5KVDL 3BD5A 1DBAH 1DLHA 4G8GE 1NKOA 1QQDB 2HTKD 4ZOBA 4Z7VF 5F7EL 4P5TC 4HKJA 5FB8B 1FZOB 4R7NA 2BOCA 4HT1H 2DQIH 3WN5A 2CK0H 5I2IB 1QSZA 4M3KB 2I5YL 1N0XH 3WD5H 2XWTA 3F6LA 1PQZA 5D2LB 3ARWA 4NWTL 4RNRA 3WO4C 1EEYA 5HHQA 4HDIA 3D6GA 4NC1C 1KPUA 4U1LA 2LV4A 4JRXE 4G8GB 1F4WH 5C6TL 3LB6D 5ETUA 4QNPE 2W59A 4Y4HA 1EAPA 3V4PH 3HR5B 2YHGA 3TIEA 3QUKA 1KTRL 4YBLC 3MV8E 4XVUC 3ES6A 4LSUL 4KY1H 3ZDYF 5FF6A 2DQUH 4WI2A 5EORH 4N0UA 1U36A 4ODVH 3MV7D 1HHJA 3UMTA 5ICYB 4OZ4B 5JXAL 4GRWB 1MUJB 3GSNH 5AYUL 3DMMB 2EDKA 1KG0A 1G9ML 3ZKNC 2FX8L 3FONB 5IVXE 2ZUSA 1SEQH 5IK3B 2VUYA 1LP9F 5GGVH 1J7VR 4JPVL 4LOUC 4ORZC 5INDA 2R23A 3MV8B 2P8MA 4KV5F 4Q6YA 5DD3L 4LU5L 2AS5M 2Q6WA 5E4IA 2R2BB 4Q9QH 1FZKA 4JM2F 4WHCA 4XPTL 5ERWA 1RZGA 3CXHK 4UU9A 5IVXB 2ZUTA 3HNSH 2V2TA 2RQ8A 3GSWB 4UAOC 1HOCA 5HHVH 5BQ7B 4GG8B 1UB6B 2GTWB 5CBEA 1T22A 1P4IH 4KAQL 4Z7NE 2NY1C 4JFQA 2NW2B 4K8RH 3SJVE 2O5ZH 4WFED 3CIQA 4YUEH 2NY4C 3MV01 3FT4B 4K8RC 1QKZL 3MOAH 4Z95L 5DVLA 1I3VA 1T89C 3KYNA 3FO2A 4LAJH 2PCPB 5C6PB 1ERNA 3LV3B 3P30H 1HIML 1EAPB 1R3IH 5GSVA 1FRGH 1S8DA 1OAZL 3SJVB 4LLDA 3ES6B 3GSQB 3ULVE 2F54D 3BYYA 3LKOA 1MFCH 1FSKB 3UBXG 3VFWB 4YDIL 5EIIB 2FZ3A 3MLVL 1ZA6A 2DIAA 3OZ9H 4JEGB 4NQVB 3P9LB 3LKPB 3TT1L 5TQ2L 1IE5A 4OZGE 3WHE1 4Z8FL 1S78C 1J8KA 4MMZC 1WAAF 3ZE1E 5JORA 1IMHC 1CCZA 4IMLB 4DN4L 5AWNH 3FAXA 5E24E 3FCTB 3UYOD 2CKBB 1TZGH 1UWXK 3G5YB 4N5ED 3QQNA 5IHZB 4KJYB 3KDMB 4JFPA 2P8MB 3WNNA 4NBXB 3DWTA 5BVJB 1ZK9A 5B3JF 4DK3A 5J12B 2ZKHL 3U79A 2J12B 4JPWH 1I1YA 3L3IA 4F8QA 1CFSB 5DUMH 4HUWA 1AO7B 1I7TB 3RUGA 4OZGB 3U0PA 4YXHL 5JOFA 4LBEA 1WCBA 1RZGB 4YE4H 3O45A 3VCLB 1FYTA 5EUKB 2DAVA 1J1XL 2W1NA 4N9GB 1X4YA 3U7YH 5CJOL 3SGDI 4MDJB 2ZCLH 2ZPKL 4KQ3H 5EBMA 5L2KD 1VCAA 5HY9A 5MEPA 1OLLA 4LVOB 2VL5B 3KGRA 1W0YT 1LHZA 3FQUB 3CSYA 1AC6A 2VLKE 3HC4L 4PJ7F 3I9GL 3KJ4C 4K3GA 1FYHB 2Q86A 4D0BA 5IJKC 4LEOA 4LSVH 4L8SB 4NN6C 3D85B 3F7QA 3HHRB 4JANA 3L3OB 4NM8H 2EE6A 3PDOA 4PP2B 1A4KA 5B3NA 5F1NA 4NN7B 3R8BB 4P46C 1MAKA 3IDGB 1UJTA 1HKLH 1EX0A 3B5GA 1NGYA 4JY6B 3SKUD 1R5WB 3JWOH 5GS0D 4PRPE 3BHBB 2YMXL 5I17A 2VLKB 2ADFL 4X4ZA 3TM6A 1WT5C 3K46A 6CGTA 4WUKH 1EJOL 1FYTE 3D2UD 1A4JA 4MQTB 4WJ5A 3KLDA 4YZFF 3VWKD 3ULUH 1NLBH 4MA7L 3BP7A 4X4YA 3QA3B 4PJDF 2RGSA 1UACH 2CLZB 4PRPB 5DVKA 3RAJH 3ULUC 3TBSB 1IGYA 4JAMA 4ERSL 5J0BA 1U91B 4JQXC 4Y4KB 5FGBA 1JK8A 2CSPA 1Z9OA 1WCBB 1LK2B 1R3KA 3U83A 4G6FD 4HGWB 3ZDXF 1MSPA 2YPVH 2DMCA 3H0TB 4X6EB 3LAFA 4UBDD 4I77H 3RKPA 3UTTE 1UWGH 2BY0A 5FM5O 2VLJE 2VAJA 3BPCB 1UM5L 1FDLH 1AIFB 3P2TA 1CL7I 3LVEA 1FFQA 3O3BA 3DBXB 1ZAGA 4YHYB 3CSYB 1P5VA 3QPQC 3RRQA 2N7BA 3LDBB 2ED8A 4XNMA 4N8CH 5A2IH 1U8MB 1F58L 4PJ9C 3WXVL 1UEMA 2KL6A 3GSUB 3UTTB 2VR4A 5GJTL 2VLJB 3K1DA 4BFGA 1LD9B 4NZTL 5L2KA 1A4KB 4WFFE 5F1NB 4HWBH 2NY5H 5E6IB 3LQZA 5LXGH 1YEJH 4RMQA 2NY5C 1P6FA 5DK2A 1MNUL 4KKLC 1BX2A 5E9DE 5TGBB 1A7QH 1EXUA 2ZNWA 2E7BA 4MXVE 4ZPTB 1IQWH 5L88L 2VXVH 1RD6A 2QADB 3WFEH 2X41A 4YC2B 4YWGL 4TSAL 4ZTPH 1MEXL 4M8QB 3VXPB 1JNLH 5K59E 1KENH 4FN0A 4ONHB 1FE8L 3PWUB 5A2JH 2JIXB 1XGRA 2R1XB 4JGJA 5E9DB 3ZMRA 5IV2B 2HG5B 4XWOD 2ADGA 1A6TA 1R24B 1X4XA 4LPVA 3WFDH 1S7VA 2H6PA 2H1PL 4WWKB 3D2UA 2XACC 5AD0A 1AE6H 2OR9L 2CK0L 3EZ8A 1N64H 3DVFA 1U8NB 4JZNA 3CFCL 1TTFA 5JDSB 1BJ1H 1MHHB 1NGWA 4I48B 1MCDA 5E8PB 3JTTB 2NY3D 2VITB 3MO1B 1E4KA 1KCUH 4NZUL 2B1AH 3HN3A 5DQDL 4DZBB 1F4WL 5DS8A 1SJHA 3CDFA 5F7YC 5IMMB 2BVQB 3CFEB 2ZSWA 1FL3A 4QLRA 4HPYL 1NUGA 2C3HA 4PJCB 5C08E 4Y4FB 2RHEA 2QTEA 5EZIL 3UTPE 1W8OA 4DFHA 1D3CA 1IAII 3LQZB 3DX7B 4OM0L 3MZTA 5JQ6L 3E1F1 4ODTH 1U8QB 4K3EL 1FO0H 4JM2C 5DMKB 4S0SD 1BX2B 2WWKT 5BS0B 3SKNB 2HP4A 4X6CA 1FL6A 5TH2A 4FQHB 5HPOA 3FFCD 2VO5A 5C08B 4OUUB 1NGPH 5A43C 5LJYH 4JPIA 4L9LB 3HAEA 2HT3D 1MFEH 3VG0H 4AM0B 3VI4E 5JUEH 2HT4D 2EO1A 1NEZA 1EMTH 3QRGH 3SDYH 1OPGH 4HFWA 5EZLA 4DTGH 4AK1A 5DEFB 4HK3N 4KROC 2H6PB 4M7LL 1FIGL 1PSKH 3HI6L 3G5XA 4P2QD 5IB3A 2NY6B 1KLUB 4Q97A 3C08L 2YD8A 3KVQA 2VDMH 5SX4I 4F7MB 4JZJB 4LLQA 1XR9A 3QCTL 4X8XA 5A40E 3TN0B 1AGBB 2LVEA 4M00A 5EU4A 1D9KB 4PGBA 3Q5OA 5I6XC 3QJHA 1U8LA 3MOAL 5DF0A 3OAYK 1YEFL 2OP4L 4FHBD 1P7KA 1EGJH 2BNQD 4LVEA 5DRZA 4H1LB 4AEHL 1SJHB 4Q74A 1ZA3A 2BC4B 4P3DA 4X6CE 3V6OA 5CEZE 1V8HA 3GBMH 4M62L 4XCEB 4BFIA 3QT2A 1H3XA 1PEZA 1G9NL 2HRLA 5DD1L 4EXKA 1RJYB 3NACL 5KJRL 5K9KA 5BV7L 1MHEA 3C9NB 4L8BB 5HHPB 4KKAD 3G9VA 3LQMA 1IM3B 5GRJH 4LFHD 4D8PA 5JR1L 4GSDL 4WW2B 3U9UB 2OLDA 1FFNA 3LPFA 5D72L 4X6CB 1BBDH 4XP9L 1JGVL 1Y18A 4DUWA 1U58A 2FEEI 4JKLA 4KZDH 4PJEF 1U95A 4NPYA 3ZKXC 1DFBH 1NCAL 3GMPA 2APVA 4DEPC 3ZSSA 1XZ0B 2CLVA 2ORBL 2H8PA 1V7NL 2AJYL 1QZ1A 4JHAL 4WEBH 4U6HB 1Q38A 1KTKE 4IHOB 2NYYD 4S1QH 3GIZH 1R3LA 3FFCA 5B38G 3UJJL 3PP4H 5MP6L 3IJSA 5IB3B 2C1PA 1EERB 1PDKA 4MB5A 5MEND 2DYPB 2L7UA 5HGHB 3I02A 1ZHLB 3SGDH 4Y5VA 2A74B 4XHQA 1AJ7L 3D9AL 3DX6B 1KJ2L 3GSVA 3BW9B 4R4BB 5F9WB 3WS6A 5E2WH 2H32A 1A1NA 4F80A 4P5KB 3U46A 4KI1A 5HDBE 2BHYA 4UNUA 4QRRA 5DJAB 4JY4A 5I1LB 1BIIA 3HG1D 4PJBF 1KB9K 4GRLA 1CF8L 2CDGA 1CDIA 4OLYH 3ZTNH 2BVEA 3D1MC 3D3VB 5EWIL 4P2QA 4QRTA 1X5KA 2XNAA 5DC9B 1HQ4B 4PRHA 3LD8B 4BFIB 1D5IL 5FXCH 4NRXA 4DVRH 3MRNB 3TT3L 2R1WB 4MXWH 5DD0L 3TBTA 1YDPA 3PGDA 1HHIA 3WIHL 3BUTA 2CRIA 4B0MM 4YR6B 3QXDB 3T0EE 2BNQA 3QIBB 1CGWA 4F33B 3O6KH 1HYSD 2FNBA 1KPRA 5TFSH 2DWDB 3UJTH 1PKOA 1HHHA 4FNLL 4QWWD 3VXSE 1PW3A 4F7CB 3OKDB 1OAYH 2ZG1A 4WGWB 2HJLB 5HHXL 1KYOK 1KT2B 4I0PA 4GW5A 1IL1B 4UILH 2EDEA 3ZSTA 5CD3A 4RBPK 1L9NA 2E9BA 4POZC 1BOGB 2W65B 4F9LC 2AQ1A 1P84J 3GMPB 5F6HI 2A6DB 4ZAKD 4R2GD 3C5ZB 2CLVB 2ICWJ 3T0EB 2X4NA 4Q9BA 3PHSA 4QRRE 4X7TA 3D5OF 2WIIA 4U0RC 3VXSB 1VESA 1MCWW 4NNPH 1MRCL 5KSBE 4Z0BH 1WCQA 5KSAD 3V5DA 1E28B 1T5XB 1NFDA 4Y5YC 4PRHE 1L6XA 4XCNB 5TE7L 1UG9A 3WLBB 2YC1B 5DUPH 1QR1B 5GGTH 1CL7H 5GRWA 3MLRH 5F3BB 2WWMC 5IW6A 1CYGA 4QRRB 5J57B 1YECH 4JY4B 1LEKA 4MHHG 3VFMB 3SDDC 4N0YL 1JBJA 5KSBB 2M2DA 1M7DB 4NQSB 5FYKL 3RWJB 4QRTB 5ALCL 3DSFL 4IDJL 1JPST 2VLME 1M4KA 4G6MH 3TIDB 4KVCH 1Y6MR 5BRZE 3CVHL 1M71A 1FNFA 1H3PH 1YDPB 1T20B 1A7QL 4OT1H 1DUYA 3BVNA 5DZLA 4X4MA 1T03H 3FO0H 2YRLA 3HG1A 1A0QL 4S2SB 1WBZB 2VIRA 2GTZB 2OZ4H 1VGEH 5FUZL 1RSFA 3HE6C 2VLLA 1ACZA 3BUYA 1ETZB 2V7NA 2ILLA 3QJFA 2Z9TA 1IGTA 5CIPB 4HZLA 4P3CL 3FO9B 4LRIA 5IB4A 3EYUL 5I30H 4JKPH 5BRZB 1NFDE 2R39A 4TVPL 4MJ6A 4DKFL 3UTSD 1KXVC 4N1HB 3KAAA 1VFAB 4L4VD 3ZYJA 3WFDL 4UZGA 2EEBA 5CLWA 3NZ8A 4RFEB 4M7KH 1W0WB 1AE6L 1ZOXA 5T5NG 1NH6A 5BOPA 1G9EA 2FWOA 3TYFB 1AQDB 4M6NH 3VA6A 1MY7A 4L29B 1JPSH 4U31A 3L1OL 3HS0B 3AM8C 1NFDB 2FO1A 4OKVB 5KSUB 2EZ0C 3SKJL 1CBVL 4XAWH 1XH3B 3UYRH 3KR3L 5JPMB 5DVNA 1DZBA 1RK1B 1Q9LB 1YN7A 3GB7A 3MA7B 3QI9A 4P49A 5HHME 3V0WL 4CNIA 5JLZB 4OQTH 1KN4H 1MJJA 1ZXQA 2AXFA 4G43A 3FQWB 5JIKA 3DYPA 3NN8B 3CDYA 4ELMF 1QBBA 2BRQA 1YQVH 5KSAA 2XZCH 3IFOB 4TPRH 5FYLL 2EH7L 4XC3L 3UP1A 4LQFL 4R97C 3OMZA 3MC0A 3IJYA 1FBIH 5EUOF 1XR8B 2VE6A 2G5RA 5FKPB 1IAIH 1DUYB 5EU3B 4PJGE 2XXCB 5HHMB 3WMSA 2HWZH 4KKCD 4G7VL 4KPHH 5TQ0L 3D18B 2NY2C 2VLLB 5I16B 1NPUA 5FOBA 2X9XA 4DGIH 2HRPL 4KZEH 2A83A 1G6RL 5DHVB 2Y23A 5IBUB 3HNVH 5I73B 1R5IA 1MCSA 2VXTH 1Z5LA 1BMGA 1FVEA 4U1HB 5KW9L 1UM4L 1J0IA 1T1XB 3SDXA 4HMEA 4NO0B 4PJGB 2XT1B 3R4DA 3ARBD 1MFAH 4NT6A 4XXDA 4DTGL 4DUXA 4PJ8D 1EV2E 2A6KB 4H5SB 5D70H 2DBLH 3RPIB 1N6QH 4I2XA 3N50A 4P48A 2X4PB 2QKIA 2MOVA 4L3CB 3MCKA 3SCMB 3CFKB 2D03L 2UZIL 2Y5EA 3I6KB 5SX4H 5H2BB 1IM9D 3UTSA 5HVFB 2E9JA 3GI8H 4HKZB 4L4VA 2J88L 5KVEL 4LLVA 5I8OL 4OGYL 5L2JA 2DJ4A 5ITFB 4UI2A 2HMIC 5L9DL 1KPVB 4P2YA 4O58L 3JWDC 5FCSH 4OFVA 3VXQA 2N1KA 3IDXL 1A02N 1YQ2A 4EIGB 4MS8C 4QRSB 32C2A 4BZ1L 3RWDB 4OM1L 1DLFH 3RIAK 3X12A 1NMBL 3MOBL 4CW1B 4FQXC 3CLFH 1U93A 4DW2H 1EHLH 1JHKL 1HK6A 1EEZB 4JCMA 3VGDA 4CU7A 4GAJH 1FIEA 5FO8B 2GY5A 4M1DL 5IMKA 3HFML 1IKFL 2DL2A 5F7HA 1S9VA 5HVHC 1ONQA 3X14A 1X6NA 4CDGC 1C16B 1U8JA 2DLFL 5IB5A 1QG3A 4Z7UF 2GIYA 1K4CA 1JYVA 4NNXA 2R0KL 1Z3GH 1R3HA 1XCTA 4FXKB 4ZS6C 3FN0L 3TH3T 2O5YH 3B4NA 3G9AB 4UQ3B 3HC3L 3QIUC 2ZOLA 2B5IC 5EO0B 3VRJA 3QCUL 4XXDB 3IS1X 4XVSL 1RZKH 4PBVC 1UXSB 4M03A 1ODAA 3ARDC 4N68A 4GW1A 5E8NB 5KTEH 1Q9OA 2CK2A 1P2CB 1UCBH 4ONFL 3TBWA 2EYRB 1DR9A 3AFLA 3D0VB 1H15B 4ODUB 2VLRA 4R8WH 5KG9A 2PNDA 2R0LL 5J1AB 2IH3A 2BVPB 5CJXA 3ARBA 2I9LA 1QUNA 2G2RA 1A22B 1WTGT 2ICEA 4YHIB 1LO0L 4XPHL 2UWEF 3HB3D 1A7NH 43C9B 2QQNH 3O6FB 4P59L 3VXQB 5HYSG 4JCLA 5E8EA 4KJWD 4DVRL 3KNBB 4I3RL 5J13C 1MCPL 2P45B 3ROLA 2Y07L 1AD0B 1XF5A 4M93B 1IM9A 1WIOA 2ADIA 5HYIA 5EZJB 1W72A 3I75A 3DI3B 4OGZA 4GJTB 4OF6A 5EFIB 4ZXBD 3OKKA 5FGCE 3KPOB 2Q7YA 4XWGH 3ARZA 2V9QA 4S1DC 3R1GH 1DQMH 1UADC 1H0DB 1IC1A 4O9HL 3AS1A 1T04B 3N0PB 5DJ2A 3FO1A 4UT9L 1K4CB 4MSWA 4PB9L 5DFVD 4WU5A 2VQUA 2DQFA 3KPRD 1QSED 1J0HA 4PB0L 2VLRE 2PXYC 1RJZA 2X2YA 1AXIB 3MBXH 4XX1E 5I71C 4IS6A 2WW8A 4LCIH 1VB9A 1QP1A 3OQ3B 5FGCB 3B9AA 2HAZA 4XNZC 4Y1AB 1ZLUK 4EDXB 4KK9C 1YYML 4XVJH 1TVDA 4EI6B 2XPGB 2GJJA 2JK5A 3MLYL 5D1XB 4XPFH 1P9MA 3LKQA 4OD2B 4EEEA 4UDUA 3SDCC 3SY0A 4HJJH 4R96A 3MLRL 4XVUD 4UT7L 3DX9A 1E6OH 2K1MA 2X40A 5FUOH 2O61B 1DBJH 1QLEH 1KB5A 1EHNA 3VXUD 2NCMA 3RGHA 3ZKND 2GK2A 1AFVL 2NR6C 3L3DA 4PJ5D 4LOUD 2B39A 3VXRE 3ZKSD 4HIJA 3V79C 1WV7T 3MNVB 1W2KT 2SEBB 1FHGA 3MXVL 1VGKB 2OI9B 1RIHH 2VMFA 4S1RL 4X7SL 3Q6GH 4KUZH 1EUUA 1MCKA 5I1AA 3M17B 4I18A 4R90L 2Q7YB 1D5ZB 1U8IA 4JFYB 5CEXA 1EFXB 1MCRA 2Z4QB 4OCLC 5D93B 1QFWL 2Q76A 4Y16C 3VXRB 5B38A 1T83A 5IEHA 2VDRL 4KHXH 4OI8A 3U82B 3OBAA 2VDLL 2D31A 4LGRB 1CXKA 2NY1D 4PJIE 3W5MA 1EZVX 4ZXBA 3BP5A 3F7VB 1J87A 1MVFA 4K8RD 3LKRB 3IKCB 1F4XH 1TCRA 1DVFA 4OZHF 1VFMA 4FQ1H 3GMNB 1FV1B 3SQBA 3FMGH 3VGAB 4Q0XH 1CZ8L 2VZ1A 3GFUA 3KPRA 2ICWB 5TDOA 1QSEA 3B9KB 4X98A 4UDUB 1TJIH 3WE6B 4PJIB 4NKDB 5HHOA 1IZKA 1DBBH 1KELH 1KGCD 3ELAT 3MREA 4MD0B 4WV1C 1VPOL 5HSFA 3ARGB 5HYQA 3MNZA 1S78D 5E8OA 1F3DH 3QHZL 4RFOL 4CRPA 3FQNB 1URLA 1NGQL 4R4NC 2GY7B 1LEIB 4S1SH 3KLHD 3MPCA 3IDMB 3W39A 3IKKA 3GRWL 4LSSH 3H42H 1RHFA 1A6UL 1YYLL 1T7WA 3U9PH 4GQ9H 3TPUA 1CXFA 1OB1A 5K9JH 1VKXB 4HMDA 2Q3AA 5CZXD 4IRJC 1CICC 1A6VH 1D5XA 3CMOH 2H2SD 3O4OC 5CEXB 1UJ3B 2AJSH 4PJ5A 3HZMA 1RZIB 2D7TH 4HWEH 2BRRL 2FX9H 2Q76B 4TULL 1NCUA 3VXOB 5HHNB 4H26A 5DWUL 5GZNC 3ARVA 5FA4B 2XIDA 2XTJC 4LCYB 2BP3A 1YMMD 5EIQA 2D31B 4Z7WA 4U1SB 1U8KA 3OGCA 1RUML 5HHOE 4MGXA 2HVKB 4PJAF 3BZEA 5LCVH 4CDHA 3IRPX 1T7ZA 5E0QA 3NZHH 1T7VA 1DVFB 1C5CH 4XNYL 4UOJA 2LTQC 2R69L 2IFFH 4XPAL 1H8OA 1T2JA 5C0GB 4BM7A 4P9HL 2E3VA 1CD9B 1KIRB 4P46D 2W9EL 4OFPA 1Q72H 1CDHA 3RWFA 1AD9A 2MJWA 5T1MB 1CGXA 4K55A 3LKNB 5HHOB 5DD6A 4IRSB 3FB8A 5IB2A 1MFBH 4YAQB 4IOIB 3GIVB 3V5HA 4URTB 5MERA 4QCIB 4YJZL 4KTEL 4JDZB 5HYQB 3HLAA 4PUBH 2ATPB 3ORJA 4J8RB 1T89A 1I1FA 4ESKA 3T04D 1TITA 3GDBA 5J9PA 1REIA 4OIIH 4ONGH 3IDIA 5BMFL 2IWGA 4GS7C 4OCWL 5ISZB 2GJ6D 4JDTL 4QHLB 3V8CA 4AH2A 5IIEA 3B43A 2BNRB 1H3GA 4Z7WE 3ULUD 2N4IA 3NFNB 4PYHA 2YSSA 3TPUB 1LE9B 1G0DA 1OB1B 4Y2DC 5GGRY 5GGSY 4GXVH 4X80H 1MWAL 2NNAB 2FSEB 1BBJB 3BE1H 2APWA 4TSBL 4XCYB 3RWHB 4D0DB 4CN6A 1I9EA 1MH5A 4OZIF 4O2FB 3AB0C 2FEEL 3F12A 2RCSL 3C60C 4EUPB 4H26B 4QYOB 3VFNA 2BNUB 4LQ1A 4ODXA 1SJXA 4N8VG 3QPQD 4XMLH 2DBJA 3EDFA 4UUJB 4PR5B 5DJYA 3D87B 3BDBA 4DAGH 1WBXB 3DUHA 1YEKH 3MRRB 5J56B 4YEFA 2PYEE 4AIXA 1S9YA 3S4SB 3C5SB 1YMMA 3NABH 4JO1L 1I3GL 3KJ6H 3V6ZA 2CIKA 1CDBA 1VERA 3HKFA 3MROB 1OM3L 1PBYA 2AV1A 2EDOA 3K74B 4HS6A 3CJJA 1V05A 1U6AL 3E3QE 1D5BA 5FAAA 5ITBH 2AKRB 2FJHA 1ADQL 4KRLB 3TH2T 3BIKA 4U3XA 5F7DA 1QRKA 2PYEB 3QDMD 3SGKA 4P46A 4KMLB 2ZUWA 2X4RA 4U1JB 3CK0L 5I1HH 2OS7A 3DUUB 4RMRA 1Y0LA 1N3NB 1WQVT 1AXSA 1ZLSH 4P2OB 2XWJA 2P5WE 5EA0H 5JW5B 5DQ9A 2DQTH 5BV7B 5J6HA 4HH9A 5D6CA 3PJSB 2R8SL 1G7HA 1I75A 1MRFH 3WIHA 4P2CG 5HGBA 1S9XB 4C54A 4Q6IB 2CDFB 3X13B 1ZLWH 2ATKA 1OP5K 1LEGA 4J2XA 2B1HL 3MLUL 4AQOA 3EYSL 3L3GB 5MI0B 2ID5A 5INCA 1OP9A 1EVUA 2P5WB 2OK0L 1FLRH 4JQXA 3QWOB 4R4FH 3V0AC 4FZ8H 4HHAB 2JCCF 2KPNA 5E4EB 3MACH 1NBYB 2V2WB 4IJ3C 1TQCB 3BKCH 5GRYA 3L3HB 1I9RL 4ZD3H 4MWFA 1XGUA 4WO4C 1CD0A 4NSKA 3BSZL 1H3VA 4ZNEA 2BSED 4MMXC 3G5ZA 1I8LA 1P84K 1RY7B 1BFVH 3NFPB 1BQHB 2FO4B 1K6QH 2VABB 3QFJD 1G7QB 4JM2D 4XI5C 5KVFL 3NCYS 4EIZC 5FA3B 1KJ2B 2VH5H 3GMOB 5MHSE 2YEZB 2IF7A 3B2UC 2R56H 4BZYA 2D2OA 2VN4A 2DQDH 3NIDE 4NQEA 1QR4A 2IBBA 15C8H 1YN6B 1A6ZA 2ARJB 1U3HB 1AI1L 1CGUA 4HWBA 1R5VA 2JKXA 4JHWH 4OLZH 3U4BL 3VFPA 4NHCL 5F1SA 1JF5A 4LASL 5HDQL 1LWRA 3KXFA 3P9MA 5ELIA 5IHUL 3M8OH 1SBSH 1GGCH 1OQOA 5DMIL 3S3SA 4NWUL 3MJ9L 3O2VL 4KROD 2P47B 1OHQA 5IEKB 3QEGH 2BCKB 5L7XH 4Z7VA 2BERA 3MV7B 2BOBB 3HRZB 3B2VH 3DXAD 3QDMA 2FD6H 3EYOA 2ATKB 1K4DA 4K3HA 5D9SA 2F74A 4FP8H 4D0CB 1U8OB 4AZ8A 3HMWL 3RZCC 1C8PA 3EJYC 2QHRL 5LGKA 5TF0A 1F4XL 2X4TA 3UO1L 5TDNB 5FHBL 3H3PH 1BZ7A 2NXYC 2Y7QA 4KU1A 3RWCB 4F7EA 3BRGC 4KTDH 3E6FA 1JTTA 5GHWL 5D2LF 5LBSH 1J0YA 3TWCL 4IRZH 3C6LC 4FQ2H 4YXLH 4NQEE 2R29H 5C07D 4YFEA 3S34H 5HYSA 4P5MA 1RZFH 5TDPA 3OAUH 3BEVA 4D9RD 3LSOB 5C1MB 3PXJA 2O26U 3G5ZB 4HGKC 3N1MC 4HPOL 1WZMA 3IXTA 4LCCB 3KXFE 1I9JH 1PZ5B 4KUCF 5CWSB 1LP9A 1TCMA 5F97E 5L0QC 1MI5E 1J1OH 3QEUA 4J1UA 5IHBA 4R3SB 2NZ9D 3MX0A 3TZVB 3GSXB 1ULVA 2NXZC 3VE0B 1U8HB 5EOCL 4GRWF 5E7BA 2FJFA 4JFDA 1CLYL 4ZUUA 2IADA 1EO7A 4JREC 3V6FB 1U3ZA 2E6QA 3FOMB 1U2HA 3QZWG 5FYJL 4QNPF 4JM2A 1NAML 4G42B 2IH1A 1PX4A 3P9MB 3JV6A 5DYOA 1FO0A 1W0VB 3CVHB 4KK6C 4TVPE 5D7IA 3UTZB 2X44D 1MI5B 3NH7L 2V5SA 3PL6D 4RAVA 5GGUB 3AS2A 2I24N 4A6YL 5JIPA 3GEWB 5ALBL 3PWLA 5FECA 4L5FH 5D9SB 4L1DA 3CFDB 5IVXF 2FLBT 5IFJA 1D5MA 3ZHDA 4L4TD 5F96H 1IKNA 5F9OH 3PDDA 1RIUH 4POYA 1J10A 4PV9B 4XC1H 1ZGLB 1DSFH 1EH9A 1AKJA 3AROA 4LVNB 4CKVX 4ZG1A 1A7RH 1KBGH 1NCCH 3RDTB 4PGJA 1T4KA 3DXAA 4ODSH 4ZPVA 3G08B 1AR1C 3NA9L 1QRND 3RX7A 2AW2A 2YD7A 1ES0B 4YHML 5GISL 3REVB 1ZGLP 1CGSH 5H37G 5ANMA 2Z35B 5EBGA 4M61B 1AHWC 4JFDE 1MJ7H 4HIXH 1G0YR 4V2BA 5I1KH 1FORL 4G8FA 5FYLE 4DQOH 1AXTL 3BD4A 3W2DH 1WAAA 5GS1B 1A64A 5T3ZL 4Z7NF 8FABA 1EGJA 2JLLA 2ZCKL 5D7IE 5DLML 1TVBA 3GSRB 5DUBB 3RU8H 3HE7C 2CO7B 1GHFH 5I18L 3WBDA 1QSFE 5C07A 1ZKAA 4PYGA 5FM4A 4POZD 2FJFB 4JFDB 4EOWH 4M4PA 4ZUVB 5A2FA 4CN1A 1IGFH 2ZUUA 7FABL 1NC2D 3JV0A 4PY8J 5D7IB 4F57H 3ULVF 1A7PH 1E4WH 1OCWH 4EI5B 3UYPA 5I15H 3QQ4B 4LPCA 1PG7H 2DQJL 4O2CA 3DXAE 1QSFB 4H20H 3WKML 4OZGF 1TQBC 2OMNA 4P2RE 4GKSB 1G6RB 3VWKB 3F58L 4PJ7A 4M7JH 1HQRB 4K7FA 2WWMD 1YEHH 3JV4A 1U92B 3SN6N 5JTWA 2K9UA 4JDVB 4GRMB 1S7QA 5D1ZB 3WL9B 1UXWB 1K85A 1F3JB 5FO7A 1YY9D 2OTPA 3BI9X 3CPLA 3H3BC 3PL6A 5GGQL 1F4AA 1CLZH 2AEPH 3HC0B 4QHNB 5E1AB 5HXMA 1XF3B 3D39D 3IFNH 1P53A 4ENEC 2JB6B 3GJFH 3RX5A 1T1YA 4P2RB 2XKNA 4V2CB 4YHLH 4PJHB 3PV6B 3TO4B 3GO1H 4XP4L 4LPXA 2VDNH 2QEJA 3QIWC 4G8FB 5L8JB 4KRPB 2E7LC 2ZOKB 5LAXB 4TN9A 1YMHB 4HX1A 5C0RH 4EN3D 3I6GA 4KKBD 2W9DL 2G9HA 2AGJH 1J1PL 3D0LB 3ROOA 4LKXA 4JKMA 2XQBL 2PTVA 5DHYB 3B5HA 3QQ9C 1JHTB 1NSNL 4XBPA 1CR9H 4PJDA 2YRZA 5C9KA