2GSIB

Crystal structure of a murine fab in complex with an 11 residue peptide derived from staphylococcal nuclease
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
210
Chain Sequence
VQLQQSGAELVRSGASVKLSCTASGFNIKDYYMYWVKLRPEQGLEWIGWIDPENGDTEYVPTFQGKVTMTADTSSNTAYLQLSSLTSEDTAVYYCNAGVITMAMDYWGQGTTVTTSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin (kappa) light chain
publication title Crystal Structure of a Murine Fab in Complex with an 11 Residue Peptide Derived from Staphylococcal Nuclease
rcsb
molecule tags Immune system
total genus 40
structure length 210
sequence length 221
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2006-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gsiB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2gsiB02
5EIVA 3KPPA 5D7IB 3ULVL 3IXTB 3MR9A 4ODHL 1J87A 2L7UA 3VXNB 1QEWB 4BH7B 3HG1E 1QSEA 4IS6A 5MEQA 5FKPA 1K9TA 4NUJB 4ZFGL 1HHIA 3BPCB 4S2SB 4EJ1C 1YPZA 3PQYE 3LV3A 3X11A 3BP7A 4UTBL 3RA7H 1KCVH 1NC2A 4U1LB 3PDOA 4NT6A 3RX7A 3H3PL 3HPLB 2BX5A 5DWUL 1U3HD 4NKDB 4M3KB 3LKPB 1U8QA 1ZHKA 1HE7A 5L9DL 4BJLA 4LMQE 1H15A 2QQLL 4K7PX 2Z91A 3WNOA 1SVZA 3J7HA 2YD6A 1H8SA 2FYYA 3FT3B 3MRJB 4OZFG 1MLCA 4WTXA 5I76A 3QDHA 1A2YB 5C7XH 4YDKH 3U30C 5SWSB 1WJ3A 1MFDH 1UWXK 2BVQB 3DMMC 4DKFH 2NY0B 5C09E 3W0WA 3PWPD 4P2OB 1D5ZB 3BMVA 1KYOK 3BP5A 3HI1B 5H94B 5HYSB 2OJEA 5F9WC 1KEMH 3ISWA 1AKJA 1FRGH 1CGYA 3RJDA 3NTCL 4HH8A 5IHBA 4GAJL 1U95B 1DSFH 1ZA6B 4ZSOA 1CD1B 2GEEA 2V2XB 2EDTA 3OJ2C 2YUZA 3U0WH 2GUOA 3D0VA 2R2BB 4PJ7F 3BIAX 2PETA 2ZG3A 1EVTC 5IB5A 1KACB 2DM2A 3A6CH 1IQDB 4QWWD 1R5VA 4AEIH 4MJ6B 3MLWH 4ESKA 1QSFD 5HYFA 1P5UA 3NPSC 4G3YH 4PLKD 4OCLC 4X99A 1LO4H 4JO4H 3DETD 4LRNL 4HC1H 1MFEL 2CUIA 2DWEA 4HK0A 5INDB 4XMPH 3I2CH 1EHLL 4KJWD 2HVKA 4HDIB 1ETZA 1VFAB 3I6KA 5DRZA 4CVZB 1JPTH 4HWZB 3V5HB 1BBJB 3BD4A 1RJYB 5D71L 2K9UA 3C60B 4Y1AB 1LEIB 4OQ1A 4LAJH 4HHAA 1TPXB 4RISH 1AI1H 4MAYB 3M07A 4GOSA 4G9DB 1OAYL 3UAJC 4MAUL 4XVSL 3WN5B 4NZUL 4NZRH 2EDYA 4NUGH 3UO1H 5I30H 1NFDF 5C0BA 2H3NB 1T5XA 2JCCA 4F7EB 1NCAH 3QIBD 1DN2A 4S11A 3QFJD 5JZ7C 2HT3C 2P47B 4HIIA 5KTEL 3S34H 2DQEL 1FGVH 4I0PD 4I5BB 4OZGA 4WUUA 3RPIA 6CGTA 3VXNA 1IGIH 1QEWA 4A6YB 3SPVB 4CL7A 3PWNB 4OUOA 4QRUB 1KEGH 2EICA 2DDQL 3BPCA 4S2SA 3CVIL 4LEOA 2EDKA 4XCNB 5HVHB 3ZE1E 3RGVD 1UCTA 3EJYD 3RVUC 4KK6D 1IGYB 2AK4E 4ZD3H 1UH2A 5F71A 4OF0A 5I8CB 4OZFB 1S9XA 3TFKC 4PJEB 1AGEB 3DROA 3HPLA 3BP4B 4YBLC 5AWNH 3ARRA 2WWMC 4NKDA 1U8KB 3BWAB 3GB7B 3LKPA 4KK5D 3VXMD 4P9HC 4NQTA 5IFAL 1HI6B 5A16B 1RAMA 3IJHA 1RZFL 2ED8A 4M48L 1N6UA 1WV7T 4M62H 5F9JB 1EV2E 1T21B 3MRJA 3ILPA 4WVRA 3HNVL 4U7SA 3RWIB 2BVQA 2WINB 4HS8H 5IFHL 2ADFH 4MA8L 3KPSE 4P2OA 5ETUB 1JNHA 1P6FA 2LE9A 4WJ5A 5H94A 2OMBA 2MKWA 3O6LH 3VXOB 2M26A 4HUKB 4FQ1L 2RB8A 1U95A 1NPUA 1NSNH 3O6MH 5I1IL 2V2XA 4KI1A 4K3HA 2AQ3A 4XB7A 4PG9B 5BV7L 1N2RB 1P4LB 3CU1A 2R2BA 4FQQB 4Z7UE 2FHCA 2P8MB 1IQDA 2O5YH 5HXMA 5FYJH 1DLFH 2DQFB 1KELH 4DN4H 5BJTB 1YEFL 4LP4A 2DTSA 2BHZA 4NOFA 3C5ZC 2V6HA 4ZS7H 5I1EL 3G6JB 4KH2A 2E8ZA 3DV6A 4JDTH 4BZ1L 2DJ4A 2Z8WC 3DGGA 3CFEA 5CJ5A 4OI9A 2VDMH 4HZAA 2G5RA 4MCZA 3EGSA 5DQDH 3WD5H 4ZFOA 2DQCL 4ZUWA 3H9HB 3L3JA 1QFOA 3NA4A 4HWZA 3V5HA 1RJYA 1ZEAH 2KZWA 1HQRA 2E3VA 3C60A 2YD9A 4XNXL 1LEIA 3MUGB 4G8GE 5FUOL 4NM8L 3UJIL 3EDEA 5F1SA 1A6VL 4TSCL 5L8LB 5D93C 3OSKA 2BCKB 2L0DA 5K9QI 2CJUL 4GXVL 2QHRH 4JZJB 3CLEL 5IF0A 2ZKHL 2G75B 4K8RC 2AEPH 2ZCHL 5J06A 2B4CH 3BGMB 3RVWD 3HG1B 4HMCA 4KDTA 5DMYA 1DQJB 5A40E 3L5HA 4PJ8C 1EGJA 5K9KB 3QPXL 4GBXC 4H1LH 5TE7H 3LVEA 3PF2A 2YD7A 4OLXH 4WWKB 4M5ZH 2DQJH 3VA6A 4UV7H 3SPVA 3PWNA 4PB0L 4GMTL 4NRXB 2CKBB 1OY3B 2MQCA 4I77L 1BREA 4L9LA 2ZCKL 4P3CH 3ZKMC 4XCNA 1J5OL 1FP5A 5E2VH 2ERJC 4QRQA 3QAZB 1RMFL 2W92A 3SGKC 5I8CA 5HYIA 4OZFA 1AR1C 1AGEA 3O6FD 5EZOH 2NY5H 3MV9D 3PGCA 4LPWA 2BVOB 4FFWD 1U8KA 2XN9A 4FQ2H 2VL4A 5A16A 5C09B 2AXFB 3QQ3B 4YDIL 1SJHB 3KLHD 1A7RL 5IB3B 1PLGH 5F9JA 4JVPA 1T21A 3MXWH 1PX3A 5D7LE 3RUGE 3RWIA 3SDCB 5ERWB 1E4XL 4TQEL 1LO0H 1WAAF 1K5NB 4KRMB 1W72L 1TJHL 1YDPB 1FAIL 5D96B 5EN2B 4JPVH 4K3JH 2PYEE 1JE6A 4Z95L 1LDPL 1S7UB 1QRKA 1RZKC 4LPUA 2VLRD 1N2RA 1P4LA 4H25B 4WW2A 3F65A 4O2FB 4LNVA 1YPZF 2EH8L 5I1GH 5CIPB 5E56A 3K4AA 5ITFB 1F8TH 3C08L 2P8MA 4KY1H 3KS0J 1OAKL 3FHAA 4PRHE 1K85A 1J8HE 2W0LA 4EN3D 3LMJL 3MV8A 2OR9H 5SX4I 3HMWH 1Z2KA 1BJ1J 4NWUH 2ZUVA 2E6QA 4FFVD 3F6IA 3G6JA 1T1XB 2A6DB 4AJ0A 2FIRT 4JPWH 1UZ6E 1I8MB 1PKQE 3PP4L 1U8MB 5FHAH 5HHOA 3H9HA 2I24N 3QG6B 1E28B 4HXBL 3LB6D 3TA3D 4G8FB 5GRVK 4KUZH 4P2RE 4WFGD 3UZEA 4PRIE 4K07A 3CSYA 5IB2B 3TYGH 3DHJA 3TPKA 5DVLA 1U6AL 1RIVH 2BCKA 3SCMD 5CZXD 1LNUB 4JPKH 3ARZA 1JK8A 4JZJA 4JRYE 1J1PL 2G75A 4FTVE 4NM4L 1MI5E 1BF2A 1OAUH 3HG1A 5E4EC 3AB0B 1DQJA 1T4KB 1HHHB 5K9KA 1KG0B 3H9SE 4OCWL 2E27H 3PQYA 2FATH 1VKXA 2P4AB 1R5WB 3HUJA 1MFCL 2AK4B 4F7MB 3H42H 4F57H 5DJAA 2EDHA 2D7OA 1RIUL 2CKBA 3SDYL 4UDUA 1J1OL 1QRND 2VC2L 5IP4A 3WIHA 2F53D 1F4XH 3DPBA 2ENYA 5ALCH 5EFIA 4YZFE 1OAXH 2CRMA 1NFIB 5TJWK 3MODH 3VXRE 3MCLL 1T5WB 1IC7L 1E27A 4XBGA 2BVOA 4KTYA 4WY7H 3QUXA 4XPHL 1JZ7A 4DKAA 2WLZA 1FFOB 5C09A 1HCVA 2AXFA 3QQ3A 1SJHA 4Y5YB 3KPSB 5B21A 1MVFA 2IALA 3MGOA 4NNYB 3WMSA 5IB3A 1ZS8B 4U3XA 3NGBB 3T0ED 2F8XC 4X7DC 3SDCA 1IILE 2CK0H 3RHWK 5DK0A 4YR6B 3VGAC 3D69A 3UBXI 3QXDB 4M7ZC 5F7NC 5IG7B 2R4SL 4JO3H 3CSBA 3EO9L 3SOBL 1K5NA 2JCCF 5KSBA 4LSTL 1YDPA 5AG8A 4X6BB 1IM3A 2LAGB 4R90L 5IT2H 1M4KA 4WI8A 3LIZH 2UY6A 4H20L 4Z7UB 1CXFA 2B5IC 4OZGF 5C8JA 5J57B 5GS1C 1S7UA 4U1HA 3M1BB 4WUKH 4GO6B 4KDWA 4OZHA 1QFHA 4H25A 1K8IA 1P7QB 4O2FA 3SDDB 2X4SA 1YNKH 4PTTA 5CIPA 3HZMB 5JHDD 3TBVB 5JQ6H 1FNSL 2DI9A 4S10A 1X5IA 5K9JH 3CK0L 1GRWA 1RUMH 3SGDI 4XP1H 2OLDA 5IHUL 1HSAB 2NY6D 2VSCA 3MRLA 4J3UA 1CU4L 1UWGL 4GKOA 5IHZB 4QRPE 2R9HD 3SDXE 3FOLA 5F7DA 1WWBX 1EZVX 1BOYA 4GQPH 2EZ0C 4CMHC 3QG6A 3AROA 3B2VL 1BFVL 2H2PD 4QXUH 4XCCL 4A6YL 4U0RB 5MP6H 4G8FA 2DQHL 3BT2H 4X4MA 3GKWL 4YHNB 1EAPB 1H3VA 2B39A 5GGVL 3MBEB 5EOQH 5IB2A 2MPAH 1JZ2A 4JHAH 4EIGB 2W9LA 2GT9A 43C9B 4HJ0D 4Y4FB 1HH9B 1T4KA 1GIGL 3V52L 1HHHA 2XXMB 4KZEH 5DEFB 4HMDA 2V9RA 2ICWB 3BUTA 1ZT1B 2AK4A 4F7MA 4NO3B 4KU1A 4OCRL 4HAFA 1JYXA 1K6QL 5E2UH 2NR6C 4QXGH 3LPWA 3VXUD 2HG5B 4D3CL 2IADB 3V4UL 2GFBB 1KJ2B 2BOBB 4YO0B 4OM0H 3AVEA 1IT9L 1NFIA 4WNQA 5JLZB 4OLUH 1PY9A 2FGWH 1SEBA 4W4OC 1ERNA 4K7FB 3O4OC 1OT1A 2GK2A 5D7LB 3RUGB 5T33L 4KVCL 3VWKD 2LTQC 2AJZB 4Y5YA 3KPSA 4NNYA 4WI3A 3EW3B 1YEHH 3Q6FB 2IAMB 2XNAB 4DKEL 1UVQB 1G9MC 5DT1L 4WI2A 2HLAB 4YR6A 2CDFB 3QXDA 4ONGL 2PYEB 1VACB 2IWGA 2Z31B 4QHUA 3HNTH 3JWDC 4PRNA 4MLSA 1WT5A 4HIHB 4X6BA 1H0DA 5GHWL 3VGHA 1CCZA 5SV4A 4Z7UA 1QG3A 3HI6H 4PJHE 2A77H 3CMOH 3O9WB 3MOAL 4S1DD 4I2XA 3M1BA 3TCXA 1E4KC 1EO8H 4PRHB 5J1TC 1J8HB 1P7QA 2WMPA 4XXCA 4FXLA 3SDDA 3PGFL 3UZVB 4EI5C 3FKUS 3HZMA 5I1JH 1K8DB 3L3DB 2BXYA 4X5XB 1MIEH 3KHQA 5IMOB 3R8QA 3N1MC 3UYRL 1LDSA 4FFZL 5T3ZD 1BZ7A 5MHSE 5FK9B 1A9BA 3ARBC 5L2KA 5IV2A 4K9EH 1QSVA 4E42A 4D9QE 5E8DL 4RCAA 1B90A 2BSED 3VFMB 2PR4L 2OXHA 4P2RB 4ZPTB 1MCLA 4J3SA 2H26B 5HPMB 5HYJE 5F1IA 1D7FA 2YPLE 4G8GA 4PRIB 5MI0C 3ZL4L 3D2UD 2DL9A 4AG4H 5IQ7H 2NPLX 1PZUB 3GM8A 3G6AB 4AEEA 4JRYB 1DEDA 4FTVB 4YHNA 1EAPA 4EDXA 3MBEA 3R8BB 3E6HA 1DQLH 3CFBB 3EDDA 1A0QL 2MJWA 1XR9B 2C1PB 4NNXB 5EBWB 4L8DA 3QUZB 3H9SB 4ODHH 2XACC 4IRSC 1VEPA 3BQUC 1R3IL 5TF0A 5E1AB 4U1GB 3C8DA 4PJ9D 4WW2F 5DEFA 4I1NB 1G0XA 5IW1B 4UTBH 4TVPL 4NO3A 1UA6L 5BZWA 2BVEA 3W39B 2KL6A 2VDPL 3JVGC 5L9DH 2IADA 2DLTA 5CBEB 2QQLH 2GFBA 1KJ2A 3G6JF 2BOBA 1BJMA 1LK3L 5F6HJ 5HGHB 5LGJA 5JLZA 3OR6A 3VXSD 4L3AA 1XIWA 4XZUA 3OAZH 2PW1B 5D7LA 3SE8L 3RUGA 1R24B 5TGBB 3T3ME 4LPYA 3WEXB 1L9NA 3QXAB 4S1SH 3S3JA 3Q6FA 2IAMA 4YFEA 2XNAA 1KENL 4NN5C 3C2AL 5DQJB 3NTCH 3D25B 1KPUB 3SE3C 4UBDD 1LMKA 4M4PA 2RBLA 5K33A 4HIHA 1QHOA 4LCUA 4FN0A 5E95B 4X8XA 4JRXD 4ENEC 3D39D 3HUJF 2VZVA 4X7EC 3QDJD 1C16B 1WTLA 4Z76A 1KTDA 4WU7B 1L0XA 4PRHA 1TVDA 1J8HA 4OFIA 3I3BA 2H45A 2YSSA 2K7QA 3EOTL 1K8DA 3L3DA 1HYSD 4G6JH 5KZCB 3LDBC 4QRPB 3SDXB 4FXGA 3PWPE 4HGWA 1VENA 5FK9A 1JGLL 3SO3C 1JGVL 1EHLH 1QFUL 4JCMA 1PKQA 5KVDL 3GSNA 1NGQH 4JJ5B 4GS7C 5IB4A 2X4OB 5EC2A 3QUMB 1M7IB 5D71H 2IPKB 3FN9A 3N06B 4P2RA 2ZUXA 3MRPB 5HPMA 1BQHA 4PRIA 4X83A 4YWGL 1U8LB 3NCYP 4R7DA 5JXEA 3BE1H 1NCTA 1RZIB 2CSPA 1OAYH 5GS0D 4NJ9L 4L9LC 4NZUH 3G6AA 4JRYA 2DICA 4U2ZA 4FTVA 3CZJA 2YN5A 4YXLL 1MI5A 1S7TA 3H0TB 5KSBF 3T1WA 3F7YB 1CTNA 3VXQA 4Z5RB 2MOVA 4ZFFB 1XR9A 1QSFE 3MFGB 4NNXA 5EBWA 5KTEH 2QEJA 3WDIA 4KKBD 3QUZA 3H9SA 5JR1H 2DQEH 5I8EB 2GAZB 4FQXA 1MCCA 1SYVB 1N5YH 4G6ML 3JWNC 4YDLC 2KPNA 4OJFL 4OZHF 4QHLB 3DX6B 3ZKXC 5FA3B 1FNGB 1XGYH 1PY4A 1IAIL 1UT9A 4HKBA 3LRSA 3HE7C 4Z77B 1DBBL 5D6DC 3VXRA 3L95A 5EU6D 5FO7B 3ARDC 3ARXA 3FZUC 2NLJB 3KHOA 3KPMA 5IFAH 5HGHA 3QEGH 4M48H 3ESVF 3QUYC 1JYVA 3PWUB 3HNVH 5IVXE 5BXFA 1R24A 3QFJE 4U7MA 5TGBA 5TH2B 4HEPG 5AYQA 1EDQA 3WNPA 3MREA 2G2RA 4OLWL 4XP9L 1S78D 2EDFA 1G7HA 3D9AH 4DK6A 4R96B 4FQ1H 4M61B 5DQJA 3D25A 1KPUA 2NYYC 4MS8D 1OL0A 2XXCB 4M3JA 4PJHB 3MO1B 5CP3H 5HDQL 3EDFA 4KXZH 2AJUL 4QHMB 2VITB 3MRNB 4E41B 4P5KB 2YEZA 3VXME 3GFUA 2W60B 3BI9X 3ZE1F 1MJ7L 4YGVB 4LDOB 4QKXB 1QYGL 3X12A 3P4MA 1ORQB 4WU7A 2CGRH 4JM2D 4NKQB 1J9CT 5KANG 4PJCE 3RDTB 4Q9RH 4JCLA 5I1CL 1XGTB 1J0IA 4LFHD 3VI4E 5I1EH 2HMID 4QRPA 3SDXA 1QHPA 4IHOA 2K3TA 4P59L 2WUCL 4YDVB 4GMSH 3B8YA 3ES6B 2DQCH 2YPLB 4IOFC 1MNUL 4JJ5A 2AXGB 3QEQD 2X4OA 3D5OF 1KUMA 2VDKL 4U0QB 4H0GA 4OLEA 2Y07H 2IPKA 1UEMA 3SE4C 1IEHA 2R39A 15C8L 4XNXH 2HWZL 2FH6A 1GC1C 1NUGA 1MUJB 4NM8H 2NXYC 5FM5O 3UJIH 1CDYA 1A6VH 4TSCH 1U8LA 3WS6C 4C4KO 5CCKH 1D6EB 2EYSB 1RZIA 2CJUH 1JHKL 4GXVH 2DB8A 3CLEH 2ZKHH 4LCCB 1QR1B 3H0TA 1CL7L 2DI8A 1DZBA 2R69L 3TNMA 1YC7A 3NZ8A 1KJ2L 4Z7UF 3MLRH 1UWEL 3FB5A 5BW7C 2O61B 2BY1A 1XMWA 5JUEL 1PZ5B 1ZGLA 5DHXB 1PYWB 4GMTH 4QHLA 2JK5A 4XBPB 1EPFA 4I77H 4DUXA 3DX6A 2ZCKH 4L3CA 2AABL 4PJXB 5D1XB 5HTSA 3D0LA 1RMFH 5KBNC 2Q87A 4Y16D 1KC5H 2NW3A 4FQIL 3FB7A 5DJ2B 1JNLL 5FO7A 3O2VL 2XKUA 2NLJA 3IDJB 4D9LH 4YDIH 4P23D 3UTSD 3PWUA 1XT5A 5DFTA 3TO4C 3DX7B 3V95A 4Z0XB 3SJVD 1QLFA 4NC1E 3WE6B 2B20A 4TQEH 5F6HI 1AFVL 1UENA 3DX9B 1O7VA 4NO0B 1B0WA 1H3GA 3VWJD 4OM1L 1TJHH 2NQCA 3HMXL 1OVZA 4L8SB 2AJYH 4R96A 3DRTA 3BIBX 2AQ2A 2VDOL 4Y2DC 5JPMB 4HKJB 4YBHA 1FFRA 4PJHA 5ID0B 3MO1A 1LDPH 1YYLL 2B1HL 5HYQA 1ZLUH 3BKCL 1IBGL 2E9JA 4QHMA 1IGTB 3MV9E 3PL6C 4P3DB 4W70A 3CFCH 4YHYC 5D1QD 2B1AL 3MJ9A 4K71B 1FYTD 2Z93B 5F1NB 3LRHA 2PTUA 3SGEH 3OG4B 1UWXH 5I2IA 1OAKH 4D0CB 4XPFL 3PWPB 1EHXA 1VHPA 1R3LB 1T6WA 3LMJH 3RDTA 1XGTA 4ZOCA 1CZ8L 3H7BB 2P24B 3K74B 4N5EC 4UDTA 2Y7QB 2JKXA 4R8WL 3PWLB 2BFVL 1T66C 4X7SL 3PIQB 2QLVB 4YDVA 4XPBL 5HYJA 3HS0A 2OXGA 3PP4H 4K94H 3RUGF 2IBZY 1L6XA 1CGSH 3RNKB 3ULUD 4X80L 4HXBH 1X4XA 5HYEA 4ZAKD 4PJBE 5DR5L 5E99L 5GQBA 3VGFA 1Q9LB 1XGQB 1MUJA 2VLRE 5EZIL 3MRKA 4AIZA 3K4DA 5A2KH 2OI9C 1U6AH 1D6EA 2EYSA 1QSFB 1H3XA 1IAMA 1YEIL 1YQ2A 4NN6C 1J1PH 1BFOB 3ARTA 4NM4H 2FRGP 3TNNA 5C92A 4LCCA 1QR1A 1C5DA 2GYSA 4DW2L 3OKOB 3BYTA 2APWA 1K4DA 4OCWH 3F7VB 2O61A 3CC5B 5IVNA 1MFCH 1NUDA 1U8NA 5FDYA 1U8OB 1HNGA 1EXUB 5DTFA 1PYWA 1RIUH 1AY1H 1J1OH 2VC2H 1UQSB 5EO1B 3B8SA 2ZUSA 3IDXL 3B4NA 1M7XA 1FLTX 4JQXC 3MCLH 1IC7H 4WFGE 5DJ2A 5FAAA 3E6FB 4RGMB 4I18C 2EYRB 5IVXB 3QIBB 3VDAA 3HB3C 3QFJB 5EOTB 3IDJA 3T2QA 1EJOL 4P2CG 35C8L 3RIAK 3TGXA 3O8XC 4I0PB 1UB6A 5EORL 3OZ9L 4FXKB 4KRPC 1PKOA 3SGJA 3FO1A 2JJTA 3O6KL 1TVBA 5LGHH 4Y4KC 4NDMA 5D1ZC 3DMMD 4Z0XA 4L1DA 2VLJD 2R4SH 3DX9A 3EO9H 2AJ3A 2D7QA 1E6OH 3SOBH 3JTTA 2YRPA 1VGKA 5E5RB 3SDAC 4L8SA 1DUYB 1EEYA 3IF1B 4G80B 1U3HA 1QRNE 5HY9A 2F53E 1IEAB 1KIPB 2AJSH 3VXMB 3WFEH 3IGAA 4X0KB 4MNGB 4KVNL 4OCMC 5CGMA 2N7BA 3QUML 4PJCB 2HN7B 4YIQB 3CSPA 1FNSH 2JJVA 2Z93A 3OR7A 5F1NA 1NBYB 2XWTB 4YZFF 4X6DE 5KAQG 3CK0H 3T08A 3PWPA 3P11L 3QWOA 1R3LA 5C0AD 2AXJA 4HKZB 3ME0A 3T0EE 3X14B 3RL2B 4PTUB 3NCCB 3H7BA 3MJ8B 2P24A 1CU4H 4OQTA 1UWGH 4DCQB 3PWLA 3PIQA 4C59B 3BRDA 1EGJH 4NC0B 1TXKA 3R1GL 5CEZL 1T03L 3Q6GL 1T0NB 3RI5K 4XCCH 1OAQL 5EDXA 4A6YH 2JTDA 1M6OA 5EU7C 2I5YH 1MH5B 3GKWH 5HHNA 2PCPA 1JF6A 1XGQA 2X7LA 2HKHL 1JF1B 1D5MA 1HK6A 5E5UB 1WIUA 1LWRA 4DOHE 1QSFA 2EDEA 1AD9A 1CE1L 3UAJD 4LP5A 4OZFH 2DQIL 3CLFL 3DRQA 3EOAB 3U2SA 5JHDE 1C5CH 2V7NB 3GIVB 6FABL 2XQBL 1FO0A 4LVHC 4LQ1A 2F5BL 1CLOL 5EUKB 1FVDB 2Z92A 1GIGH 4NHUA 5JZ7D 2HT3D 2YN3A 2FBOJ 3FT2B 2GTZA 3F7VA 2FO4B 4GKNB 1CFVL 1U8OA 3DXAD 1UYWL 5B8CC 1KIRB 4F2MB 4OCRH 5TDNB 4DEPB 1IKFH 1K6QH 5DMJB 1DQQB 3IDMB 3FQXB 4TNWF 4NBYB 4D3CH 1H3TA 1UQSA 5SWZB 5M7QA 3QQNA 3RVUD 3T2NL 3V4UH 4HJGB 1A5FH 3SDXF 3EYVA 5F7UA 4G5ZH 1PG7X 4NN7B 4EOWL 4LGRB 3ZHLA 3TFKD 1RJCA 1PG7H 5DD6B 1K4CB 2WWMD 3QXVA 3E6FA 2AVGA 5LGKA 5CINL 3QNZB 5IVXA 4KVCH 4OZIE 4RMWA 5EOTA 2QSCH 4WFED 1V7ML 4J3VA 1HZHL 5KVEL 4I0PA 3QRFM 1L7TL 4FXKA 4NWTL 1BF8A 1HXMA 1W8OA 4DKEH 5DT1H 1DVFC 2X41A 3JV6B 3KPQB 4JAMA 4ONGH 5D4QA 3RGVA 4R0LB 1N5AB 2VUOA 2X6MA 5K9QG 1DUYA 2P8LB 3VXUE 3CVHL 3IF1A 3MV9B 4LPVA 4M7LL 1IEAA 1KIPA 3WFZA 1IE5A 3VXMA 1C12B 2CUMA 5DS8B 1NJ9A 2FD6H 5CLWA 1OARL 1NMAH 4X0KA 5D2NE 4FQHB 4G8EB 5IBUG 1WBZA 4PY7B 1MAJA 3PWVB 4GRMB 4PJCA 1DUZB 2HN7A 3MOQA 1N6QL 1VFUA 5F21B 2UVEA 2WIIB 4CMMB 1JL8A 4YHKH 1P9MA 4K9EC 4KROC 2FX7H 1T20B 3S3PA 2J6EA 4F37K 2XICA 3X14A 3RL2A 3C5ZD 2P1YA 4Q74A 4O9HL 3MJ8A 2CRIA 3RP1A 4G6AC 2PXYC 5ANME 1NDGB 2VH5H 3BDYL 1P7HL 2VWEE 3VFTB 3ZL4H 4HWBL 2W59A 1KJ3H 3VD3A 1T0NA 4HF5L 5KSAC 4M02A 2CKBH 3ULVC 1I1FA 3L3HB 3GMNB 4OD3L 4Q7DA 3T0BA 4LKXB 3OAYK 4JFYB 5C2BL 1MCIA 1XH3B 3ROLA 4R4NC 2L7JA 3GJFB 3V6OE 2O5XL 4K8RD 4M1GL 4JY4A 4PJHF 3W2DL 4AMKL 5I19L 1R3IH 2V7NA 1JRHL 1A6UH 5EUKA 3U46B 5C0CD 5T3ZE 4PJ8D 2X09A 3IDNB 4GBXD 1O0VA 2ID5A 4GKNA 4IRZH 1R3JB 3IKKA 5GZOC 1KIRA 1UA6H 5SV3A 4PGEA 3TA3B 3V5KA 3IXAB 1F90L 4QNPE 3IDMA 3FQXA 2VDPH 3ZKMD 1OAZH 5FIEA 2DYPA 2X2YA 3N1FC 2HRLA 5C0EA 2F58L 1G0DA 1LK3H 3SCMB 1NCDL 4Y5XC 1AR1D 5DD6A 5FUZL 4WU5A 1K4CA 1YMMB 3SE8H 3QNZA 2ATKB 3T8XB 1KTLB 5CS7A 1BD2D 1CVSC 3MUHL 1FVEB 2P43B 2NNAB 1RHHB 5FYKD 2UUDK 4C54A 3QNYB 1KENH 5CIPH 3TVMC 3QCVL 2VLMD 2D0GA 5EPMB 3C2AH 1VESA 3K81A 4KZDH 1XAUA 3JV6A 4KXZI 3KPQA 1B4RA 1QRNB 3AY4A 5JO5B 3H7LA 1W0VB 5ICXB 3T65B 1N5AA 4CRPA 2X70B 2HJLB 1WFTA 1CT8A 5IBUB 3DUUB 2X1PA 4IDLA 4OQTL 2P8LA 3O6FA 4OT1L 3RZCB 3MV9A 5JNYA 4ZUUB 1JGEB 2CXGA 1C12A 4YHPB 4MLIA 5DS8A 5I0ZA 3P9MA 4X6DB 3VXSE 4OB5L 4EUPG 1NCWL 4FQHA 4G8EA 3GI8L 4PY7A 3RWCB 3T0EB 5DHVB 4Z7VE 3FMGL 3BRFA 3EOTH 4UU9B 4LCWD 2YD2A 2WIIA 1GVIA 1I1RA 4PP2B 1IM9B 2HT2C 3CJJA 1IGCL 3DSNA 4OV6F 4M7JL 1J8KA 1GPOL 1T20A 1ZLWK 1OWWA 1JGVH 2QL1A 3RQ3A 1YA5A 3P2TA 5KVDH 4PJFB 4U6YB 3T3MF 2EIZB 1EEUA 4F33A 3UTQB 2R2EB 4LIQL 1NDGA 3IU3B 4PJBA 4IJ3B 1OTUC 3D3VB 3VFTA 2DD8L 2VLRA 5I15L 1WVZA 1HOCB 2Y5TB 4YWGH 4KTEL 5A2LH 2XTJC 4XNYL 4DOHB 4NJ9H 4JRXE 3D39E 5FGCE 4YHLL 5JHDB 3FN0H 3QDJE 4YXLH 3L3HA 3GMNA 1FLRL 4DGYL 5DYOB 2B8OT 1T7YA 3UBXG 3TCLB 1U8HB 2F54D 4EN3A 3GJFA 1X5YA 4U4BA 5GRUH 3L7FA 1HILB 2NY6B 3E8UH 1QA9B 4G6MH 1YY8B 1JHTA 2Y72A 3TIEB 5EU3B 2CRZA 2YRLA 4EXPX 5HGAB 3U46A 4CU7A 5JORB 2C3HA 1LGVA 4PLJC 1FAKT 1IAIH 3B9AA 4HG4J 5DJXB 3GMPB 4Q6IB 1D9KC 1R3JA 2XQYK 3MZTA 3TA3A 1DBBH 2ITDB 3IXAA 1OQXA 4WV1C 4O2CB 3VFPB 4YX2L 2A83B 1EBAA 3C6SB 4N0RA 4OZIB 5H8DA 4HPOL 3SCMA 4Y2OA 5MEPA 2KQNA 1D6VL 1G84A 1JZ5A 3FJTA 2OR7A 2G9HB 4JG1H 1RJLA 1JPGB 2ATKA 2ZCLL 1HWHB 1RQ5A 2VN7A 1FVEA 1IRAY 1AR2A 1MRCL 3RWEB 1T0MB 4OLWH 4RDQF 3VXPA 2APFA 1YN6B 4OF7A 5EPMA 1GAFL 3BZDA 4HK3J 3VXUB 3BMWA 4FABL 3L5JA 3DIFA 4HFWA 1QRNA 5BV7C 5JO5A 3AAZB 2F53A 4IMLA 3ORJA 3OB8A 2HJLA 3JUZA 2HJKB 3AGVA 3HRZA 3DUUA 1NANI 5HDQH 2J4WL 2WBJB 5D2NB 2AJUH 4AH2B 4ZTOL 5EU6E 3KXFD 4OUUA 4ONHB 1JGEA 3T0XA 2FECI 2YUVA 5ESQB 4PGDA 4U1JB 1MHEA 1QYGH 3VWKB 4X6DA 3MUY1 4WCYL 2HFFB 1V7NL 3IS1X 5ACMA 1OSZB 3ZDYE 3UC0L 4N0YL 5I1CH 5E6ZA 2HFEB 3T0EA 1OCWL 3PG2A 1BFSA 2ZSVB 5DHVA 1BWWA 5FOJA 4QLRA 4UU9A 1A22B 1IGFL 1KJVA 4PP2A 3IDUA 5EOCJ 2VIRA 3AREB 4R2GC 1UH4A 4G8IA 3E0GA 4P59H 1I7TB 1P84J 5DEGA 2DJSA 3QHZL 5IVXF 5FGBA 4JZOB 3VE0B 2EIZA 2LVCA 1AO7D 2R2EA 2C4FU 1Y6KR 1Y0LA 4PRPD 4DVRL 5FV2A 3UBXB 2UVFA 3CFDA 1VCAA 5DD3L 2Y5TA 3MACH 2EZ0D 2Q3AA 1MQKL 1AH1A 3UYPA 5JHDA 5HD8C 5HJ3A 3DLQR 3MRBA 3IFNL 2DRUA 4OTXL 1CL7H 5DYOA 1IZKA 2YD4A 1NC2D 4XWOC 1KJ2H 1IGML 3HFML 1UWEH 3UTTD 1KCKA 5CMAB 4HBQA 3TIEA 5EU3A 4WW1A 2NXZC 4ZO6A 5HGAA 5JORA 3MCKA 2F74A 5CEYA 3QFDA 4NQVB 4GRWE 4HSQA 4PJCF 3QCUL 1NAMB 3MLSL 5A2IH 2JJTC 3DARA 3QEQE 3VI4F 1G7LB 3GMPA 4Q6IA 2DWDA 4MQTB 2ITDA 5DRXB 1A6TB 1MCEA 1RURH 4O2CA 4WI5A 1JNLH 1U92A 4R97B 1EHAA 1LK2B 1IFHL 3VFPA 2A83A 3O2VH 4GRLC 2APBA 1FIGH 4L5FH 4KTDH 4OZIA 4KJQC 1T1WA 4HIJB 1B0GB 2EC9T 1KN4H 1RK1B 4JDVB 5DRNB 3K2MC 4U05A 4NO5B 1JPGA 3PHOB 4PJ9B 4N5UA 3P0YH 5GJTL 3NFPA 4LVOB 1IAOB 2E5EA 2ZSWB 3S88L 4OD1L 3NZHL 4PJIE 3RWEA 4XP4L 1T0MA 1IC4L 1NAKL 4OM1H 5B4MC 1YN6A 1ZKAA 4MNHB 4RWYL 4I3GA 4PJDB 4JPIB 3VXUA 1RZJH 2VDOH 2IH3B 2VAAA 3AAZA 3U4EA 4EUPA 2B1HH 3WFDL 5I75B 3VXSB 5D2NA 1IBGH 3RKPA 4ONHA 5F6IC 3LRGA 2B1AH 3K7UA 4EQ3A 5ESQA 2D03L 3T0VA 3BISA 1WBYB 3VWKA 4XPFH 3T04D 3UTSE 1U2CA 4LARL 2Q6WB 3LN4B 1U3ZA 2ZNXA 4XNQA 5GSRB 1CZ8H 3QZWG 4EI5D 1XCTB 3SJVE 1PVHA 4M8VA 4J8RA 5ANMA 2WBKA 1UM4H 4ZUVB 1I7TA 3ARBD 4XPBH 1PJ9A 5CJXA 4U1KB 4JZOA 3C5JB 1UACL 5ACZA 1A7PL 3VE0A 4X80H 4W81A 2FBJH 4JRXB 2R1YA 5DR5H 5E99H 3CDGB 2H1PL 2WM0A 3L1OL 3EFDL 3BUYB 1AGBA 3GHBL 4X6EA 4IMKA 3V6OA 1KN2L 4MX7B 1FYTE 2A6KB 1MJJB 4HV8B 4Y19D 1WZ1L 5D9SB 5IJVB 4DW2H 4QGYA 5KN5B 1ZA3B 4JKPL 3TLRA 5EIQA 1ZWIB 1HDMB 3S4SG 1SJEB 4U1SB 4IRSD 4L4JA 3DYOA 1MHPL 3BQUD 5CMAA 4DZ8B 5DFVC 2P46B 1P7KA 2VLLA 4CVXB 4LFHG 1FHGA 5FUCE 4QT5A 4U6XB 2O5ZL 2W91A 5LBSL 3ZYJA 3D2UA 3IDXH 1CFNB 2N56A 3ULUE 3SN6N 1QR4A 5FOBB 1JPFB 5GRYA 1OP9A 1A6TA 4ZMAT 1PQZB 3NVQA 1QOKA 2X9XA 3QEUA 5HVWA 1FVCB 5C08B 1LK2A 4A2MA 5I8OL 2YUXA 2ZOLB 5IUSA 3FRPG 2DLHA 4MCYB 4WGWB 1K3ZA 3RAJL 1WFOA 3DI2B 1EJOH 35C8H 1B0GA 4PJBF 5EORH 4JDVA 1CD0A 2EKJA 4M00A 5F96L 3P4LA 3O6KH 1QBML 4PJ9A 3B9KB 1AD0B 1UZ8A 4OIIH 3C2SA 2HVJB 1P4BL 4HZLA 3D18B 5EG6C 3U9UA 5EB9A 1JV5B 2I9LB 1XGRB 4CVWA 2IAND 3BKYH 4MNHA 3VRLE 1BQUA 4JPIA 5EU6B 3IDIB 1T83C 2IH3A 3QR2A 1NCCL 4X4YA 3LS4L 3VJ6A 3VXSA 1N4XL 4KMQA 3QZWB 4KVNH 4WHCA 4PGCA 3E2HB 3MRQA 4MAYC 3S96A 4ENED 1FFPB 1YEKL 4Z7VA 5ADOL 3WN5C 5DJYA 2J88H 3P11H 2CDEB 5DJ6B 2W65A 1L0QA 1S9WA 3UXFA 3LN4A 5GSRA 2HRPL 5CJOL 4KRLB 3CH1B 3REWA 3VGEA 2BJML 1F5WA 4XMLL 3TO2B 3WNLA 1T1ZA 2VLJE 4XMKL 1U93B 1I9JH 3P4OB 4F8QA 2WBWB 4LBEB 2C7UB 5C6PB 4U1KA 3R1GH 3Q6GH 4KPHL 4UZGA 5DLMH 1OAQH 5HVHC 4HQQL 1CE6A 3CXDL 4JRXA 3P0VL 3EYSH 2EXYC 2VRAA 3D39A 5IB1A 1SJXA 2DI7A 3QDJA 2KZ1B 3S4SB 3WKMH 1JIBA 5CGTA 3BUYA 4JM2B 3IDYB 4GG6E 2X4QA 1WGOA 2VDNL 1CE1H 2DQIH 3CLFH 4MX7A 3MNZB 1UXWB 2A6KA 1MJJA 2BHUA 4HV8A 3T2PA 5A2FA 6FABH 4QOKD 2XQBH 1CLOH 4BFGA 5IJVA 4Z7WA 4FP8L 1ZA3A 4UI2A 1KGCD 5C0AE 2OBGA 3OKNB 3H3BC 2WNGA 1GH7A 3G5YB 5E70A 1SJEA 3NAAH 4GRWB 4U1SA 4DJMA 4DZ8A 3OX8A 1S9YB 1UYWH 4R4BA 3MC0A 1OSPL 4XI5C 4CVXA 4X6DF 2FO1A 2Q76B 1QD0A 4U6XA 2IPTL 1HHGB 4NPYA 3UPAA 3OXSA 4L3ED 3T2NH 1FN4B 3IKCB 2RQ8A 5FOBA 3HE7D 5J13B 4CJ1A 1UCBL 4GG8A 1F2XK 3C09B 2VE6A 5CINH 3ARDD 2ZOLA 1GXEA 2BP3A 3FZUD 4MCYA 3LD8B 1MJUL 3PXHA 3CX5J 1D5XB 3QUYD 1HZHH 5KVEH 4PJIB 1L7TH 4NQDD 4I4WB 4NWTH 4BFIB 2W0PA 3IAGC 3MJ9H 3MA7B 3ZYIA 1AD0A 2VR5A 4Y4HB 3BPLC 1A4KB 4G9FA 4UAOB 1QLEL 3DXAE 4XHQA 3MJ7B 1YMHA 2BSRB 2V5RA 3EJZC 3THMH 3G6DL 4HD9A 2I9LA 1XGRA 4EIZC 2X9WA 1OP5K 5EU6A 2NY1B 4M7LH 3IDIA 5J11B 2NYYD 4AENA 1HWGB 1ADQL 4XC1H 3IAPA 1OB1B 5E2WL 2XA3A 4Y7MA 4WTZG 4P23B 3UTSB 1YJDH 3M45A 4X5WB 3QZWA 1ZANL 4ZOBA 5KS9E 1N6QH 1GZPA 1FFPA 1QFWI 2DIJA 2FIKA 5ENWB 4WFEE 4P9MH 4LRIA 2CDEA 2FJHB 4XH2A 3DURB 5HDLA 1W8NA 1WISA 3ETBF 4O9HH 4OZIF 3VW3L 4JE4B 1ZGLP 4KK9C 2R4RL 2JELL 4WWKC 3WNNA 5BS0D 4HIEB 5T3ZL 3BDYH 3U9PL 1U93A 3CZFA 5DC0A 4IOIB 5ILTL 4LBEA 2R1WB 1BBDL 4IOFD 1IKNC 1OGAD 2DTML 2YXFA 1PD6A 1Y6MR 2YR3A 5F44A 2CR6A 5D1QB 5DUPL 1FYTB 5EO0B 1NAML 2OQJA 2NXYD 2ZUQB 3GBNL 4JM2A 5IKCB 4OGAC 1QNZL 2O5XH 3L3KA 2SEBB 4RNRB 3BPOC 4M1GH 1UXWA 5CHNA 1RU9L 5GGSY 4AMKH 5I19H 1ES0B 1JRHH 4WEMB 5GGRY 2EXWC 2W0KA 5K9OB 3ALWA 4GAGL 1MAML 1ROWA 2NY3C 4TNVF 1S9YA 3QEQA 4W6XB 4ZAKB 2XKNB 4NC2B 2Q76A 3MXVL 2V5MA 4RZCB 2BNQE 1QFPA 1HHGA 5D96C 5BQ7B 2YPVH 2GY7B 2F58H 1OF2A 1NCDH 5H37G 1NMCB 5DF0A 1UJ3C 3RA7L 2JJSA 4XCFL 5EBLB 4BFEA 4EDWH 1IJ9A 4IRJB 1D5XA 4NQED 1GOHA 5CZKA 3W5MA 4PJIA 3S3SA 1T3FB 4X6FB 5F9OH 4BFIA 3TO4D 3MA7A 5C0CE 2E6PA 4K7PL 1LO3L 4YNYB 3H8NA 4TTDD 1FL5B 2IG2L 1E6JL 3WHXB 1A4KA 4BH8A 4DFHA 2OL3A 2C4XA 4YDKL 4HLZG 2EH7L 3MJ7A 1FNLA 1MCWW 4Y16A 4OQTH 2X4NA 4MDIA 4JHBA 4OT1H 3WFHB 4Y2DD 4XPAL 1JNJA 2E7LA 1KEML 4ZS6C 4ZYKB 4GFTB 1FRGL 4OB5H 2H8PB 4N1EA 1NCWH 4P23A 3UTSA 4QNPF 4X5WA 1DSFL 3GI8H 5GZNC 3PL6D 1N64H 3FONA 1C5BH 4MSWB 4HUWA 2J5LB 3FMGH 4Q2ZA 3KPTA 5ENWA 3DMMB 3SJVA 4BZ2H 1BD2E 4KJYB 4JQVC 2FSEA 4M7JH 2BVYA 2FJHA 4YEFA 1UB5A 5HGBA 4P4KC 5FYKE 32C2B 3TBSA 3A6CL 4L1HA 3AB0C 2OZ4A 3VWJA 1OW0C 2VLME 4LKCA 1EFQA 3MRIA 3UPRA 4N5ED 3MLWL 4ZDHA 4YC2B 1T66D 4G3YL 3L5WB 1LO4L 4JO4L 3V8OA 4IOIA 4HC1L 5I15H 3JV5A 2CUHA 1VFOA 4MA7L 5AUMB 4GG6B 3ZTNL 2GJ6D 4KAQH 1FYTA 4YHLH 5DJ0B 2DLEA 1JPTL 1FLRH 4DGYH 5J6GB 5C6WH 4XGZB 2NZ9C 1YYMH 5C0AB 2EE6A 3C8KB 3BP6B 1G7QA 2FL5B 3NPSB 4LCIL 4RNRA 1A6AB 1VFBB 2PKDA 1TTUA 4OFDA 2GSIB 3RWFA 5K9OA 1X4ZA 4NZRL 3NGBC 2VXUL 3UO1L 2YD3A 3NMEA 1NCAL 4Z7VF 4ZAKA 1LE9A 4YDJA 4RZCA 4ZTPH 4PJGE 3RY6A 2B0SH 3BKJL 1CICC 4YX2H 4ETQB 5T1MB 3Q3GA 4HUUB 4HPOH 5GRXG 3PUCA 1D6VH 4KHTH 3INUL 2XG4A 4URTB 2F54E 2ZCLH 3T77A 3HB3D 5I6XC 1JGUH 1MRCH 1KIQB 3MV11 3LKNB 3O8XD 4GW5B 1NBZB 4X6FA 4KRPD 2VXQL 4Y4KD 5D1ZD 1T7VA 1T89C 4YNYA 1GAFH 5IIEB 1GZQB 5AD0B 4FABH 3B6SA 4B41A 1WUNT 3OWEA 4QYOB 2J6EH 4WTZA 3PWJB 3BPNB 5IMMA 3I75B 4Z7WF 3SDAD 4ZTOH 1CK0L 4WI6A 4YBLB 1U36A 1MIML 3WFHA 2V5YA 2D3VA 2D2OA 3PXJA 1EA9C 12E8L 1XF3A 5L2KD 3DTXB 4HS6B 3O6LL 1QQDA 1JPST 4WCYH 2MMXA 3MRMB 4X4XB 1LVEA 4N0YH 3H6JA 1OCWH 3QQ9C 4MSWA 4WI4A 1IGFH 2R0ZH 4CNIB 3DMMA 4NBZB 5FF6B 3GI9L 5JW5A 2VQ1A 2GITB 2VLJA 4Y4FC 32C2A 1QSZA 1ZHBA 2YA0A 2H9GB 2O5YL 3QHZH 1KELL 5J4MA 3ARPA 4PJ5D 3L5WA 4DVRH 3MRRB 3OQ3B 5DD3H 3NFNA 3KXFE 5AUMA 4GG6A 3TBWB 2VDML 1LD9B 3RIFF 5DQDL 5D7JB 3ZTJG 1G9EA 1AC0A 3SEPA 5DJ0A 1VGEL 3IFNH 3LKOB 4PJAA 4OTXH 3U48A 2DBLL 1IAIM 1J0KA 4XGZA 4XCEB 5C0AA 1FNHA 1RZ8B 1TQCC 1CDBA 3C8KA 1IGMH 4UQ3A 3W81A 3MV7B 2GSIA 1LHZA 1KBGH 4ALAH 4YK4B 4LHUD 4JANB 1XIWD 5FB8B 3QA3A 2AEPL 2BNQB 4X9GA 3ZDYF 3FL7A 2B4CL 3WV0A 1AO7E 4EEEA 3BDBA 1ZE3C 3HC4H 5TE7L 4ZQKA 3K0WA 2Z31C 4PRPE 5I1DA 4OLXL 1CXLA 4M5ZL 2DQJL 5DMGC 3CSGA 3BEVB 3WHE1 5T1MA 2AV1B 2C4FT 2G60L 3X3FH 4F9LC 1IEBA 1KPRB 3O9WC 1WWCA 1S7SB 1AHWB 3QCTL 2ESVD 3EOBA 2ICES 2W0FB 4CGTA 5C0CB 1G9NL 4HK3N 5GJTH 4BUHA 5EZOL 1F3DH 3S88H 3UTTE 3DVIA 5JPNB 3IVKA 1KLUA 1KIQA 3LKNA 4XP4H 4GW5A 1NBZA 1RI8A 1IC4H 2P48B 3DXAA 4ZPVB 3QIUB 4JM2F 4LHQB 5IIEA 5AD0A 4I3RL 3DUHA 3MXWL 1Q94A 4XT1C 4GLRI 2ERJB 3PWJA 4DFIA 1SYSB 3CFJB 3I75A 3STLB 4LQFH 1LO0L 5B39G 5KS9A 1B2WL 4GRWF 2BVTA 1A6WL 4HS6A 4DVBB 3CD4A 2E8YA 2YZ1A 4IOSD 3TN0C 3QJHA 3DX8A 1BD2B 3OKEB 5DK3A 3I3DA 2P5EB 4X4XA 4LARH 1IQWL 3O41A 1I7UB 5E6IC 2UUDH 4BM7A 1FL3A 4NJAL 3BGAA 3RFZC 3QO1B 4CNIA 4NQCD 3LQAL 4LF3A 4KROD 5I1GL 5DZOA 4MQ7B 4NQSB 3GJFH 1JCKA 2R2HB 3Q5OA 4KY1L 2H9GA 4U1GC 1UACH 5DURD 4APQB 3V0WL 3DO7B 1A7PH 1ORSA 4M93C 5D70H 4G6AD 2PXYD 3MNWB 2OR9L 2XI9A 3HMWL 4QRTB 4PJIF 1PG7W 4D8PA 2H1PH 3L1OH 3EFDH 3T4AA 2DLFH 3ZT5A 5KSAD 3GHBH 3ULUL 3TBWA 3E3QC 1KN2H 3KPNA 3PV7A 1TZHB 3ULVD 5FHAL 3ZYOA 4XP5L 1JHLL 4ACPA 3BZ4B 5DJDA 4JKPH 3DVNB 4KUZL 4XCEA 4R4ND 1RZ8A 5JOPD 5IFJB 1I85C 3C5ZA 2IF7A 3MGAA 1MHPH 4LLMB 1V8HA 2W38A 4LSSH 4PV8A 1RIVL 4WTWA 1CFTB 1OD7A 1P4IL 3WBDA 5DHYB 3OAZK 4OI8A 2BSTB 4PJGB 5DVKA 4P4RA 3P73A 4LL9A 5IVZB 1OAUL 5FYKU 1TTGA 1S8DA 4G6FD 4RMVA 5GZOD 5DI8B 1MREH 1R3HA 2D4FA 5HI5C 5CUSL 1BIIB 5L6YH 5CFHA 1C8PA 1ZHNA 3GMOA 3N9GL 5I8OH 4P57B 2AV1A 1DN0A 5GIRA 3STZB 3RY4A 5ICYB 4P46B 3ZT6A 3FQNB 5J8OA 5AAWA 3B9EA 2M2DA 3OB0H 5I8KL 2J8OA 4RQQB 5CAYB 1T1YA 1F4XL 4Y19E 1C08B 5ITBL 5ALCL 4HGMA 5F96H 5T3XE 1OAXL 2W0FA 5E4EB 2WUBH 1QBMH 3MLZL 4PJ8A 5LQBL 3MODL 1KT2B 3EDKA 3ARFC 4GBXA 2VQUA 5JPNA 4WY7L 3WIFB 3W9EB 1FNFA 1Q9KB 4ZPVA 1NKRA 5B39B 3TVMD 5DHVH 4XC3L 4OF6A 2CDGA 4NKIH 3ULSA 3LQMA 1BM3H 3M17B 1SYSA 2CK0L 1VADB 3BEWB 3STLA 3G5VB 3RWJA 3SGKA 1N4XH 4R3SB 2RCSL 4XNMA 3TEUA 1ZAGA 1EUUA 2Z8SA 4J2XA 4DVBA 1CXKA 1YEKH 1X6LA 2VLKD 5ADOH 3ULUF 3ZHKA 3QG7L 5IT2L 5EBMB 1BD2A 1GL4B 4QXTB 3OPZL 3KYNB 1QBBA 4QF1B 4LSUL 2BOCA 2RFXB 1ZT7A 2HRPH 3GMMB 5IROC 2BVPB 2BJMH 1ACZA 4XMLH 4QRSB 4M5YL 2HT2D 3VGAB 5I1AA 2DLIA 4M7ZB 1OTTC 2YKLL 3DOSA 4MQ7A 4XMKH 5J12C 3VMOA 5HHXL 1MCBA 1RUAL 3GRWA 1G7JB 4KPHH 2IANE 3KXFB 4HQQH 3U1SL 4G7VL 3CXDH 3MNWA 3CUPB 3P0VH 3HLAA 2B5IB 4NCC2 2Q86B 1OTUD 5EO9A 3SBWA 5C07B 1LEGB 1FG9C 5IBLC 3QEHB 2NTFA 4NRYB 4HGKC 1SJVA 3OKLB 1FNAA 4JFHD 3UCRA 5KVFL 5SX4H 3VRLF 2XTJD 1A21A 3SY0A 2NY7L 1TZHA 3AU1B 4LCWA 5E9DD 2F19L 4QXUL 2CIIA 3DVNA 5JW4R 4OCNC 4RFEA 2Q3ZA 1XF5B 4LLMA 2EDJA 4S1RH 1EZVY 1UC6A 3UYOD 1AO7B 2EE3A 4QRRD 5DHYA 3CDCA 3NIFE 4PRPB 1GGYA 2BSTA 2IPTH 4PJGA 3ZZ1A 4PLJD 2YD5A 5IVZA 1QKZL 5MEQB 3C5SA 1D9KD 1HHIB 2CLVA 4GW1A 1TCMA 5DI8A 4JR9L 4KZEL 1UCBH 3LV3B 1LP9E 1BIIA 3X11B 3BP7B 4NP4H 1CD9B 1I8LC 1FZMB 5EC1B 4TPRL 2A6IB 3TT3L 1NC2B 1MFAL 3MROB 3PDOB 2F54A 3STZA 4EUPH 3FQNA 3WO4B 1X5FA 4RQQA 3UTTB 1Q38A 1U8QB 5TQ0H 4QOKE 2E7LC 2YWZA 4JREC 3L5XL 4OLUL 1A7QL 4GG6F 4JFZH 5I76B 1MLCB 2J8UA 2XWJA 3O11B 3WIFA 4P2YA 4PJAF 3G6DH 2MWCA 1TJGL 2P5WD 5B39A 2PYFB 4OZ4B 3I02B 4PGZA 3W0WB 3CFKB 4ZXBC 3UJTL 1E4WH 3BP5B 4LLYB 5J1AA 4L3EE 4JGMA 3M17A 1ADQH 3A0OA 5E2WH 4MZ3A 1VADA 3BEWA 4JKMA 3BZEB 5F88B 2PNDA 4N9GA 1ZANH 4MGXA 5CJQH 3LEVL 1B0RA 2GUOB 3D0VB 3BXNA 4XWGH 2KQMA 5E24E 2LTQB 5EBMA 2XTLA 2ADIA 2EC8A 3KYNA 4QXTA 5HVGB 1MHHA 3HI6L 3GMMA 2BVPA 1R5VB 5I74C 3VFRB 5DVNA 1EO8L 3VW3H 4QRSA 4FMKA 4R2GD 1BLNA 2WWKT 2JELH 5T3ZH 3U9PH 3WFCH 4X99B 2HTLC 5ILTH 2EDNA 2A9ML 1BBDH 1G7JA 2DTMH 4HK0B 3KXFA 2ARJQ 1QO3B 5D1XC 1ETZB 1U2HA 3AC0A 4F7CA 5GS1A 5CLTA 1NAMH 3QEHA 4U6HA 1KLGA 3GBNH 1ACYL 3SGDH 4FQJL 4NRYA 3OKLA 3IB4A 3MRGB 1QNZH 5JW4M 3RTQC 1CI5A 1S7RB 3RY6C 4JHZA 4LVEA 1F6LL 2UZXB 1RU9H 5KSVB 5HD8D 2VB5A 4AG4L 3OXRA 2E7MA 5T1LD 1FC1A 3S36L 1TNMA 4LLDB 4XWOD 3F8UB 4YPGB 3CNKA 1CN4A 4POUB 5IGXH 3QNXA 5AZEH 1DBML 5KS9F 5C0BB 1C7TA 1T5XB 2JCCB 4HXAH 4JFPB 2XZCL 1DQLL 2IPUG 4YXHL 4HIIB 1FZKB 1AO7A 4ERSL 3MSPA 1F97A 2NXZD 3MXVH 5BS0E 4OGXL 4JO2L 4PRPA 4OZGB 3RPIB 4WUUB 1NLBH 3RU8L 3UTZB 4XXDA 1OGAE 3F12A 4ZG1A 4LEOB 3U36B 3HUJE 3GSUA 5FM5M 5EZJA 1FZMA 5EC1A 4XCFH 2A6IA 3BO8A 4GRLD 3MROA 3O3AB 1S9XB 3DROB 4KJQD 5AYUH 2D4DA 5I1HH 3UTTA 3BQUB 4Q6YA 2ZZUT 2A74B 1FQ9C 2Y25A 3IJHB 4YQXL 3TH3T 1ZLUK 2Z8VC 4K7PH 1LO3H 4DKDC 1OHQA 4GH7B 4X7FC 1NBQA 2IG2H 4OLZL 3ILPB 1E6JH 1DR9A 1GHFH 5C3TA 1NGYA 3IJSA 2X40A 3O11A 2AW2A 2EH7H 5FFLA 3MLXH 2Y36H 5FYKL 5B4MD 5GRZA 4S1SL 3TBYB 2PYFA 3D6GA 3I02A 4OZ4A 1JNHB 3CFKA 3OBAA 1FZJA 4LLYA 4XPAH 4WJ5B 1MVUA 1VSCA 2AAVA 4KI5F 3LKRA 4QY8A 3WS3A 1AXTL 4F9PC 1XF2A 2IBZX 1IC5L 3BZEA 1BJ8A 3MLTA 5F88A 4L4VA 3V4VL 2MQ3A 5EWIH 4W4OA 5KSBE 3HZVB 4OBRA 1BWMA 2EECA 3WLWC 4NQEE 5JQHC 4PLOB 4PY8J 4JGJA 2FJGB 3VFRA 4NN5B 4OZHE 3MBXL 1EBPA 2IANB 2IEPA 2OMNA 2N4IA 1FC2D 1AIFB 2YD8A 4FMFA 3V0AC 4G6JL 4XVTH 2OP4L 3DV6B 1MSPA 3DGGB 1RHFA 3CFEB 4ODWB 4QCIA 4MA7H 3ZTNH 4MCZB 3EGSB 4WIQA 4ZFOB 1QO3A 4Y89A 5DMIL 4ZUWB 5FYLL 1NGQL 3L3JB 4PREB 4AYFA 5DFWH 2ICCA 1E4KA 3I84A 1HQRB 3VGBA 3GMLB 3MRGA 5GS0H 1S7RA 3QIBC 4LCIH 4EI5A 5KSVA 3O0RH 3KS0H 1GOGA 3LDBB 3ZE0E 4TOYH 3BE1L 4UQ2B 4IIQC 4LLDA 4YPGA 4JZNA 2ARJB 5IF0B 4X4ME 2VXUH 3ARBA 5SWSD 4EVNA 1BJ1H 1PDKA 4JFPA 1YN7A 5DFVD 2BRRL 5I9QC 1FZKA 2G5BB 5JR1L 3AS2A 3TWCL 1N5YL 3BKJH 2CMRH 3UTZA 1XEDA 2J1KA 5F93C 2FEDC 1IC1A 5DD5L 2GJ6E 4L9LB 3Q5YA 3U36A 1XGYL 5DD0L 5CD5C 1F13A 3HC0B 4Y19A 1JWMA 4QOKB 3INUH 4QRQB 1Z5LA 2YBRB 3O3AA 4HX1A 2JJUA 3PGCB 1JP5A 1SY6L 4IRSA 5KJRL 3BQUA 1AGCB 2XN9B 2A74A 3QBTB 2VXQH 4YDLB 2VDQL 1BIHA 3QEGL 3ILQC 2KBGA 1F02I 3ZKXB 2MQ0A 4L3EB 1I8KA 3QHFL 3HE7B 4M8QB 4WHDA 3TBYA 1CK0H 3WLBA 5L8KB 3GSWA 3LS5L 1MIMH 2VZ3A 3JVGA 12E8H 3ARDB 4YUEH 1DTUA 1INEH 3D9AL 5H2BB 4FS0A 3C6LC 3WIIL 4NZTH 4ZO7A 4Y1AD 3WDJA 2WK2A 3QUYB 4PJGF 4MAYD 2AERT 3HZVA 5F7KC 4PRDA 2C26A 4WW2B 2MHAA 1DQDH 3GI9H 1S3KH 3MUZ1 5DUBB 5I71B 1J10A 5CD3B 4I2XE 3VG0L 1C7SA 4B5EA 2FJGA 5JW4N 2IBBA 2CGRL 2IANA 1OP5H 4WEUD 3ALXA 4Q9RL 3MV8B 3SE3A 1QTYT 5F89B 1AIFA 4KI5C 3JXAA 4GRWH 4DEPC 3DHMA 4ODWA 1WC7A 3EO1B 3S37L 2XZQL 4KWUA 2CIKB 1F4HA 2EO1A 4GMSL 5L2KE 3HKFA 2J8UF 5ALBL 2EXYD 1AC6A 5HHOB 1VGEH 4NN7C 4PREA 2DBLH 5IEKB 4HWNA 3ARGC 2Y07L 1F6FB 3GMLA 1Q0XL 3EUUA 1V5JA 5IQ9A 3CSYB 2DYPD 2IQAA 5CCKL 1P6AB 1PEZA 4UQ2A 4R6UA 1JK8B 2ARJA 4N68A 2JE8A 1KXQE 7FABH 2PO6C 1IGJA 4MWFA 2R29H 1M71A 1RV6X 5E00A 2VR4A 4XI5D 1EO7A 4R0LC 2EDBA 2G5BA 3PQYB 4PJ5E 3MLRL 1VKXB 1LP9A 2V7HB 1G7IB 3LH2H 1BAFL 3HUJB 3HNSL 1JMXA 4TUJB 4PP1C 5DJAB 2NXYB 2OL3H 4BQCA 2XWBA 2G60H 4UDUB 4CBPA 5EU7E 1JN6A 4NZDA 4UOW1 5C0GA 3QCTH 3HC0A 5EUOE 4QOKA 5EFIB 5JTWA 4OGZA 3TZVA 1Q9WB 2YBRA 1G9NH 1KC5L 4MXWL 5C0NC 5E6YA 1E27B 4KMTL 2ZG2A 4KKNA 4XBGB 4U6VH 1WWAX 3R0NA 1AGCA 5FYJU 4PR5B 3QUXB 1BEYL 1OPGL 4D9LL 3QQ4A 2IALB 3MGOB 1G1YA 1RFDL 4I3RH 4RAVB 1F2QA 4L3EA 1AP2A 2B2XL 3EJZD 3HE7A 5DK0B 2ZOKA 4GSDH 3D69B 4M8QA 5DMKA 4DGIL 2YWYA 5D6DA 3I9GL 1B2WH 5BZDA 5KSBB 1A6WH 3ARDA 4G43A 1RJZA 4C56A 1IM3B 2AJYL 2QKIB 5H2BA 3ZKNC 2OM5A 2GW5A 3QUYA 4NQEB 1IQWH 5C8JB 4NQDA 2ESVE 2EO9A 3SBWC 4R26H 3O4LD 4U1HB 4M4RA 1A3LL 4JKLA 4NJAH 4YHMH 4IBLT 1GYAA 4OZHB 3TIDA 1DQML 1K8IB 2LFGA 3V0VB 3LQAH 5C0IB 3X17A 3CFCL 2X4SB 1BQLL 5DUBA 4PTTB 1CLYL 4R9HA 1MCKA 1TFHA 4KUCD 1JTOA 1DLHB 5CD3A 4TUKH 2MSPA 3LEYH 3V0WH 3MRDA 2X05A 2FECL 4Y2DB 4KK9D 1AGFA 4WWKD 2VO5A 5F89A 3FB8B 3MRLB 1P84K 3ESUF 4PY8I 1J05A 5I17A 2BZDA 3FOLB 1CFQA 5F7DB 4MJID 3ULUH 2CLZA 3EO1A 3K8KA 3PL6B 4TULL 2CIKA 5DJZB 5F7FA 1QUNA 1DE4B 4K94L 4XP5H 5AG9A 2A9NL 1CGSL 3B3IA 1F58L 1JHLH 5IEKA 2EIBA 4OAWA 1UM6L 2YMXL 4OGAD 3V79C 2MCPL 2X89D 5T1DL 1O5DT 2Y9RT 4LPTA 1IARB 1X6NA 1P4IH 2EXWD 2IC2A 5T3XL 4HH9A 2GT9B 4TVPD 5BS0A 4H26B 3DV4A 2NY3D 4MHHG 1OGAA 1ND0A 4WI9A 3OJMB 1X4YA 3BOVA 2AJXH 3OL2A 3L3GA 5CUSH 3SKJL 3SE4A 5F7MC 2V7HA 1G7IA 3N9GH 4TUJA 3DYMA 2UYLB 4CN4A 5DK2B 3ZDXE 5BCAA 4FA8A 3RZCC 3WS6A 2OI9B 4NO2B 1WFUA 4YHOH 1AY1L 5I8KH 1FCCA 1T0PB 2FHBA 3ULVE 2EYTA 4JFDA 5ITBH 3OJDA 2J7LA 3R06B 4LVNC 2I07B 2QQQA 1Q9WA 3MLZH 4WNQB 4AT6A 1VEMA 5LQBH 5JOPE 3T2OA 3MMEB 1CGVA 1SEBB 3ARWA 4E0RA 2V17L 5BW7A 1NGWA 3S97C 1QLRA 4YGAB 3BH9B 4PR5A 4PRBB 2EDQA 4XC3H 1I3UA 3UMTA 1V3KA 4LHUG 1IL1A 1MCRA 4RAVA 5E8OB 3OV6A 4EQ2A 5LGHL 5FM4A 2A1WL 2XA8H 2IGFH 3MA9L 2RCSH 5INCA 1A1NB 1E6OL 1XGPB 4QHUB 1GGUA 1Z3GL 2X44D 4NFBA 4PRNB 5IESL 4AIOA 2EDDA 4ZS6D 2QKIA 1H0DB 1K2DA 3QG7H 1NGXA 4NYLB 3OPZH 4NQEA 3O8XB 4LSUH 2AJSL 5BOZG 5GZND 4KRPB 1U58A 5D6CA 4I2XB 4ZFOL 3WFEL 4F3FA 3TO4A 3EOYG 1HEZB 3B43A 4NQXA 4M5YH 4UT7L 3V0VA 5C0IA 4P49A 1JWUA 2YKLH 4P4KD 3K2UL 3T0DA 1DLHA 5HHXH 1RUAH 1P1ZB 1B6UA 4Z7OE 1S5HB 1MRDH 3TPUB 1BZ7B 1S7WB 3U1SH 4JFOB 1A9BB 4G7VH 4OD2B 4Y2DA 4RMUA 1UKSA 5L2KB 5IV2B 3FB8A 4E42B 1X5AA 2C1OB 3ROOA 5KVFH 4BKLB 2DQDH 2W1NA 3RVTC 5H37H 3PL6A 1EGJL 2NY7H 4N8VG 5F1IB 5FGSA 4G8GB 5DJZA 5FA4A 1CS6A 2EE2A 1DE4A 2VLKE 2F19H 1CYGA 3U0TA 4O02L 2NZ9D 2ITCA 4M1CC 3NFSH 3ZSSA 1TIUA 1SBBA 2I5YL 2IH1A 4EDXB 2D9QB 4JRWA 1EMTL 3E6HB 3H9YA 4JY6A 4CADB 1YZZA 4CKVX 1BQHG 3F5WB 4L8DB 1H5BC 1Y6NR 1H9VA 4PJ5B 1RUQH 4H26A 4HLZH 1C5CL 2VKXA 4LLAA 1WQVT 4JFED 1QKZH 3VFUB 4GQ9L 3OF6D 4WEBL 5GGVY 3Q48A 4N1HB 4B53A 4OSUL 4JR9H 4JQIL 2GJ6A 4AEHL 1KCUL 5EUOB 1CICD 4TPRH 5LAXA 2UYLA 2WBJC 3TT3H 4J3XA 4JFQA 5DK2A 1MFAH 5BZWB 4JFHE 1IKFL 2XTJE 4NO2A 1H3WM 1Q0YH 2OTUA 5E9DE 4LVHB 2Z8RA 1A5FL 3R06A 4UNTA 5DSCA 2I07A 1ZHLB 4LHUB 3VFWB 5LGJB 4G5ZL 3L5XH 4P9HH 3OR6B 3JWOC 5FHBH 1A7QH 1XIWB 1FDLL 4XZUB 2FHFA 3MMEA 1PG7L 3GSOB 4OKVA 5HGDB 3BH9A 1WBXA 2Q1EA 1QVOB 3AREC 4MQXC 2QSCL 4PRBA 5B8CB 4QRRE 1TJGH 5D5ME 3RKDC 4PFEA 2C3VB 2I60L 3UJTH 4AIXA 5E8OA 4P5MA 2DMCA 1N0XL 1B4JL 1OP3K 2W9DL 5E8EB 4QGTA 4JQXA 3KWWA 2A73A 3NIFF 3GSQB 1A1NA 4I48A 1XGPA 1Z0NA 4I18A 5CJ8A 2AKRA 1VB9A 2XYCA 3LEVH 4LCUB 2QQNL 2R8SL 5F97E 4NYLA 4LCYA 1LP9F 1X5LA 3O8XA 2VZSA 5JDJA 2FD6L 3QQ9D 4Z76B 1KTDB 1NMAL 4Y4KA 4YFLF 2I27N 5D1ZA 2GTWB 1HEZA 4OF5A 5ESAA 5F3BA 4BSVB 2YSSB 4Y4FD 2D7TL 1H3PH 1P1ZA 2A9MH 2P5WE 4FXGB 4YHKL 3SDAA 1S5HA 1D5IL 2FX7L 4N8VB 4NIKB 4HGWB 3RY5A 3TPUA 1X5JA 1S7WA 2PF6A 2OYPA 4JFOA 4OD2A 4PBWD 1PKQB 3GSNB 2C1OA 5IB4B 5EC2B 4X6CE 1ACYH 4FQJH 4BKLA 3MLVH 2VH5L 4R97C 4IEFB 2ATPB 1FZOB 3CFIC 1BQHB 2NMSA 3S36X 2C3WA 4R7DB 1KJ3L 3JUYA 1LE5A 4GJTB 3S36H 4KROB 5C86A 4H8WL 2CKBL 1NEZG 1DBMH 1MI5B 1S7TB 2XZCH 1OGTB 2P42B 4K8RH 3WIHL 5DURB 3VXQB 3RWDB 4CADA 4YXHH 1WZLA 3V9FA 2AI0L 3F5WA 5EOCL 4UB0H 3RVVC 2PXYB 4ERSH 3V5DB 4ZNCD 4I3SH 4OGXH 4JO2H 4PJ5A 4FQXB 3RU8H 2XFXA 1A6UL 2AEIT 2ICEA 3VFUA 3KPLA 2FEEI 3ZSTA 5EIIB 1A6PA 4CN1A 1DBJL 2PYED 2VSDA 2Z31D 4HKBB 3QUKB 3GEWB 3LRSB 4IRZL 2KUTA 4D2NA 5EUOA 2ARWA 4XCYB 1EERB 4G42B 3VXRB 3L95B 1JNNL 5F7EL 3I3EA 1P69B 3O9WD 2FB4L 3BN9C 1OAZL 2NY2B 3C87A 3KPMB 1MPAH 2HT4C 4YQXH 1ZHLA 4LHUA 3VFWA 3CX5K 3VD9A 3GSOA 3P77B 4OLZH 5I18L 5F7YC 1ZVHA 5CBAA 5BXFB 1YEEH 5HGDA 5FYKH 1QVOA 4MMXC 3BH8B 3VFNA 5B8CA 3BVNA 4RGND 3RRQA 3MREB 2C3VA 2G2RB 5HGGS 4RMTA 2EEBA 1YEDB 1MWAB 3BIKB 4HEME 1G7HB 3WUWG 1AXTH 1IC5H 4KZDL 3GRWH 5E8EA 4Y5XB 3V4VH 3QSKB 1NDMB 5JMOC 3GSQA 1CF8L 2ESVA 5BMFL 3HA0A 4F7PA 5C0JB 3AXLB 1RZKH 3TN0D 4HLJA 1PEWA 2YEZB 3U0PB 5ICZA 1I3RA 3B5TA 3FO2B 5DJ8A 5E6ID 3X12B 3P4MB 3MBXH 2GTWA 1DVFA 2AJVH 3EJJX 4HJJL 1HXYB 1DCLA 4JN2A 4BSVA 3VD4A 4H5SA 3X3GL 3CGTA 1HQ4A 2OP4H 3WJLC 1INDL 3WSQL 3FRUB 1Q9OA 4IHOB 4N8VA 4RSVA 4H0HB 4ZFZB 4ELKB 5DMIH 1KULA 1QFWL 4PBXA 5FYLH 4I8DA 2VLKB 4LSDA 2JB5L 1NEZB 2LU7A 3UZQA 4LSRL 2ATPA 1FZOA 3QISA 1ZVSA 3L3OA 5DJCA 4K3DL 1NUFA 3MYJA 2JLLA 1Z0MA 3EDJA 4NQCA 5ADPH 1RZ7L 2I26N 5FXCH 3V7MA 5LKNA 3FN0L 3IDGA 3EO0B 1G6RB 1A7OL 1BGXL 4FNLH 5D7IE 3TZVC 1OGTA 1S9VA 3B9KC 3RWDA 2BRRH 3TNMB 3NZ8B 3TH2T 2PXYA 3V5DA 4U33A 4XRCB 5GRUL 3FB5B 3PJSA 3KAAA 1EEZB 3E8UL 3TWCH 2PW2A 1X3DA 4X9IA 5LXGH 1ZGLB 3LQZA 5SX5H 1U8JB 2JK5B 5KSAA 5DD5H 5EIIA 2XTJB 5DUMH 3NACH 3I85A 5HI5D 5J6HB 1SHMA 4L3CB 4G9FD 1KB5B 5DD0H 3WJJC 3QUKA 3PHQB 4TNWK 5E9DB 3D0LB 2WQRA 4ONFH 4BQ9A 3PGDA 4XCYA 2NW3B 5J3HC 4G42A 3FB7B 1SY6H 2FX9L 5KJRH 1MJ8L 4NSKA 3RL1B 3MLYL 1KB9J 2VDQH 3GMQA 1I9IH 4QRRB 5D5MB 4C83A 4TRPH 3P77A 5SWSE 3WUWB 3ARFD 1N7MH 3VA2C 4JG1L 1FJ1A 3KJ6L 3QHFH 3BH8A 3ZE0F 1QLFB 5GGQL 1F3RB 4MD5A 3A6OA 4WV1B 4KV5E 3LS5H 3MLPA 1YEDA 1MWAA 3BIKA 3LKSA 4XPGL 4CUCA 2YXMA 3DRTB 3WIIH 5C6TL 1PSKL 4Y5XA 5T5FL 5M95B 5CSBA 3AS0A 1NDMA 5B22A 1CGWA 3QWRD 5C9KA 2VR9A 5HYQB 3IDYC 3HE6C 1WICA 5C0JA 3AXLA 4UTAH 3VFSB 1X44A 2EDXA 5JXAL 3U0PA 3FO2A 3OKKA 3VG0H 5TE6H 4LGSB 1DDHA 3QRGL 5I2IB 4XX1E 1JGDA 2P5WB 3TVMA 2BDNH 1ZMYA 1ODAA 2XRAL 1XZ0B 4B0MM 2VYRE 1OTTD 1HXYA 4YJZL 5CEZD 5TDPB 1I9RL 4UDTB 3S37X 3FRUA 1L4IA 3S37H 4RIRA 1WK0A 2XZQH 4I13B 4ZFZA 2FGZA 1CR9H 2JJWA 5EH1A 4ELKA 5HYJB 3HS0B 5ALBH 5A2JH 1FFNB 2VLKA 5IBLD 1NEZA 1RSFA 5JIHA 5C0FB 4Y1AE 2EKSB 3FHQA 2FJFB 3CXHK 1DEEA 1Q0XH 4JVWA 4PGBA 3U7AA 3F62A 2UV3A 1TZIB 3MRKB 4AIZB 2BY3A 2EC9U 1BHGA 2HKFL 3MACL 1DBAH 5EU4A 2B4CC 4R2GB 3AM8C 5FCSH 1AXSA 2ZWLT 3HHRB 4L29B 2X9YA 3TNNB 2BHYA 4S0SD 3EO0A 1G6RA 1C5DB 3K1KC 4MB3A 4WHTB 2R23B 5MERB 4RDQG 4Y4HC 4UAOC 1EHNA 1K4DB 4N9OB 5FKAA 4BQ6A 1RVFL 4XRCA 1HNFA 1EEZA 1BAFH 3HNSH 1U8NB 5IW6B 4Y8DC 4P5TA 1RK0A 1F45A 3HAEG 5H35A 5DTFB 5F9DC 1U8JA 2NY1C 5JOFA 3EYFB 1LO5A 1UGNA 5J11C 5J6HA 5LVEA 1KB5A 3PHQA 2NY5C 5E9DA 1BVZA 2EDOA 1UEYA 4PJEE 5T1LB 5E08H 2OCFD 4E41D 4PRAB 4MXWH 3VDCA 2AGJL 1GGTA 1RURL 3DGCR 4KMTH 3MCG1 5D7SL 5E03A 3GBML 1BEYH 1FIGL 3IFLH 4KTDL 1T04A 1OPGH 4L5FL 3RL1A 2MCG1 5B3NA 4QRRA 3T1FA 2NXZB 5D5MA 4NKOA 1KN4L 1AGDB 1MOEA 1UB6B 1RFDH 2NY4C 4MA3B 3WUWA 1M7DB 3FO1B 1TVBB 4M6NH 1D9KA 4NDMB 3H9ZA 2B2XH 3P0YL 3SQBA 4DGIH 4HUVB 4W4NA 3I9GH 4WV1A 4ZXBD 2AJ3B 2YPLD 3JTTB 1HKFA 3U79A 2VDLL 1VGKB 2GSGB 5HYSG 1P5VA 4JLRB 1EEYB 5A3IC 4WHYH 1U3HB 1RZJL 4KKCC 4UT9L 5HY9B 3SE9L 2ZUUA 4YXKL 3U4AA 1A3LH 3IGAB 3U7WL 4XAKD 3GSNL 1DQMH 1CDJA 2RGSA 3VFSA 5JMRA 1BQLH 4B7LA 1CLYH 2AK1L 3I6GB 1NANH 1UKTA 5EUOF 3OR7B 2P5WA 5FCUH 3G5XB 3QWOB 5CP3A 3EYUH 1XZ0A 4XX1G 4JKWA 1P2CB 4UILL 2HTLD 5TDPA 3BSZL 2GK0A 2EIDA 3K80A 4X6CA 3FQWB 5CGYC 4XVUC 1JZ4A 1UM4L 3HCVB 5F6IB 4TULH 3DNKA 1NBVL 5D1XD 2A9NH 2P7TA 1B6DA 1FFNA 1F58H 5C0FA 1EH9A 2FBJL 2EKSA 2FJFA 1N3NA 1M6OB 3CCHA 1UM6H 2YMXH 2M1KA 1DBKL 3RTQD 2MCPH 3O4LE 3QDGD 2PCPB 5HHNB 3FFCD 1QPPA 2X7LB 3L7EB 5T1DH 1TZIA 4LLWA 1D5MB 3QPQC 4OFPA 3GJEB 4CW1A 2XIDA 3HC3L 4IRJC 2YZ8A 4B50A 4N1CA 1AD9B 5T3XH 3SKMA 1FL6A 3HAEB 4L29A 3DRQB 1BX2B 3U2SB 2DF3A 3MTRA 4WO4C 1FO0B 1LO2H 2DM7A 2X4TB 2Z92B 4WHTA 2EE9A 2EDWA 2R0LL 2R23A 5E4IA 5MERA 4NHUB 3LN9A 3STBA 5J56B 2GTZB 3SKJH 25C8L 1XF4A 2WP3T 4NO0D 5FGRA 2BMKA 1FBIL 3TT1L 1KXVC 3X13B 5IW6A 4J4PC 5IWLC 1TCRA 2AV7A 3BRGC 1KJMA 3O2DA 4KHXH 5IJKC 1FE8L 2LU3A 4MJIE 3EYFA 4LU5L 3FTGA 4ZNEE 4O2EA 2V2WB 1UH3A 3UTPD 3WNKA 1MWAL 3EYVB 5T1LA 1M1SA 1MCJA 3NCMA 4PRAA 2GCYB 3U4BL 2HTKC 2J5LC 2V17H 5HDBE 1FYHB 3U7YL 3FQUA 3V6FA 4JO1L 4OI7A 4TVPE 1BVLA 5L88H 5D2LE 1AGDA 4PLNC 4MA3A 4J7RA 1M7DA 2P8PB 4U7KA 3BW9A 1HXMB 4BSJA 4YC2C 1FG2B 3FCTB 1UFUA 4OIIL 2A1WH 4JN1H 4HUVA 3GO1L 4JAMB 4D0BB 3MA9H 1CVRA 3RGVB 3BD3A 1Z3GH 4GRLA 2GSGA 5IESH 1NMBH 4JLRA 3BKYL 2YA1A 5HHPB 2DKUA 4WDIA 4HBCH 3W9DA 1U8IA 5MEND 4LSQL 1NJ9B 3QXTA 5GXBB 1F11A 3ZDXF 3K8LA 2ADJB 3CIQA 4UT7H 5DC4B 1WBZB 3DO3A 3WLWD 1W72A 2GJJA 3ULVF 3VG9B 3K2UH 5BRZD 3I6GA 3K1DA 5KG9A 3QI9C 3WCYA 2J88L 1INQB 3G5XA 5GGUA 2ENSA 1P2CA 3D87B 5E8PA 4TYUA 1G6RL 3RWGA 1YNLL 3FQWA 1FCGA 1SEQH 3HCVA 1I9JL 1U3JA 5GS3A 3LN5A 2R1XB 2IQ9L 3MJ6A 1GGCL 3UX9B 5DLML 4O02H 4S1QL 3EYSL 1I1FB 1EMTH 3L7EA 4WRLA 1KB5L 5D7IA 3WKML 3GJEA 3EYQC 3N0PB 4P99A 3IXTA 4F7TB 2HP4A 3ROLB 1DQTA 1G6VK 1QP1A 5KSUB 3HAEA 1BX2A 4JY4B 3MUJA 4BH7A 1MCFA 2X4TA 4NUJA 4GQ9H 1EJ6A 4WEBH 1HYRC 3BAEL 2HH0H 4OSUH 4JQIH 2P49B 4AEHH 3NAAL 5IMLB 3BPNC 1KCUH 3KNBB 3WL9B 1A6ZB 1S7QB 3X13A 4U1LA 4KJPC 4PGEB 4Z7OF 4MXQC 3G5ZB 1NL0L 2FEDD 4Y5VC 3V5KB 3VD7A 5HI3C 5CD5D 5FO8B 2DYPB 2C3GA 5C0EB 2V2WA 3VD5A 5C70A 2DM3A 3SKOB 1FDLH 2GCYA 3FT3A 1A2YA 4WU5B 1MCPL 4LLQB 1RD6A 5SWSA 5EULV 1OQOA 2R15A 4PG2C 4OF3A 2KKQA 1D5ZA 5L0QB 2I60H 3ILQD 3HI1A 4JFEE 5HYSA 2P8PA 4OCXL 1N0XH 3MJ9L 4CAGA 5BVJB 1B4JH 1FG2A 3FCTA 2W9DH 4QEGA 1U9KA 1ZA6A 1CD1A 4D0BA 1MY7A 4HWUA 2GI7A 1ZV5A 4PS4L 1CIDA 1CT8B 3THML 3RBSA 3V4PL 1MHCB 1FIEA 5ABDE 5D7JC 3O6FB 4MA1C 1YQVL 2QQNH 3C6LD 4PD4J 5JNYB 2R8SH 3I6LD 5HHPA 2V5TA 5B3JE 5TF1H 2QQKL 4XC1L 3BJ91 3P9MB 3B83A 4MJ6A 4D9RD 3MOBH 4RFOL 5F1OB 1UKQA 2ADJA 3B5HA 1YJDL 3BPLB 4XNUL 1VERA 1RIHH 2ZPKL 2D7TH 4YK4C 4P9ML 7CGTA 5INDA 1D5IH 1INQA 4NZJA 1GGBL 5EBGA 3KPRD 3QIWC 1T83A 3UDWC 4HDIA 1VFAA 4QTIL 3RBGA 4CVZA 4KI5D 1BBJA 4HUNB 4F15C 4F33B 1MAKA 1T7ZA 4Y1AA 5D5MF 4RGOL 4PJBB 5TFSL 5SWZD 3ARQA 1WF5A 5DXWA 3O4LB 4MAYA 2VLRB 4G9DA 2R1XA 4NFDA 3OMZA 4RFNC 1GC1H 3WN5A 3MNVB 3ARGD 3O2DL 1AHWC 4H8WH 5D72L 2H3NA 4F7EA 1AE6L 3QJFB 3WIHH 3QWQB 1JZ6A 4HPYL 5E2TL 2AI0H 4F7TA 5EOCH 4EN3B 1L0YA 5KSUA 4I5BA 3L7FB 5KOVC 2QSTA 4A6YA 2VZTA 1MCSA 1JHTB 2PO6D 3QIUC 4QRUA 4M6OL 1FSKB 4M9OA 5I66B 1CLZH 4MJIB 4HWEL 1DBJH 1J0JA 5IMLA 1DL7L 2Q8BL 1IGYA 3KNBA 3WL9A 1A6ZA 3GGWB 1S7QA 5A1AA 5HHQB 4PP1D 4PJEA 5JHLH 4U1NB 3G5ZA 3BP4A 2VJXA 2VTFA 1JNNH 5F7EH 3BWAA 3GB7A 4NHCH 4LLUB 3BPOB 2FB4H 5HSFA 1HI6A 1U91B 3I50L 5FO8A 2YPVL 5F8QC 4I0KA 2IJ0C 5MEPB 4HIXL 4X6CF 2FLBT 3SKOA 5D2LB 5C0ND 5I18H 4LLQA 4ODVL 2NY3B 1NH6A 4JKKA 1RJLB 1YEGL 4K23L 2WINA 2VAJA 5ETUA 5T1KD 4EDWL 4KDVA 2EDLA 2FWOB 3KGRA 3CH8A 3VXOA 5F9OL 4APQC 3VXPB 1YEJL 1JI1A 5BVJA 3E1F1 2R56L 4NKMB 1Q72H 5KOMC 2EIEA 1MF2L 3DIFB 4HFWB 1WSST 2F53B 4IMLB 1HIML 4DGVH 3GJFK 1UJ3B 1CF8H 1T2JA 5BMFH 3HRZB 4PG9A 2FX8L 3ARUA 1MHCA 2OS7A 4FQQA 4OUUB 3ZKND 5FM8A 3W11C 2C5DC 4PGDB 1MHEB 1BVKB 2DQFA 5ISZD 5BJTA 1BMGA 1KV3A 4XHJC 4MB4A 2HLFC 4HJJH 1N64L 1C5BL 3OJVC 5E2JA 1J12A 3X3GH 1KJVB 3WFBL 4RGNE 1INDH 4BZ2L 2VIRB 3WSQH 1KCLA 5M94B 3KDMB 3KYAA 3OKYA 3S9DB 4G8IB 4OBSA 3PP3H 1QFWH 4LASL 5DEGB 1CGUA 2F9BT 2JB5H 1FO0L 4P2QD 2QADC 2WZPD 3MUGA 4JFFD 4I0CC 1Y0LB 1HINL 4LSRH 3O4LA 4P5TC 3CFDB 1WWWX 3D1MC 4P46C 4K3DH 4J23A 4TSBL 2YC1B 1KFAL 3MNVA 1RZ7H 4KAQL 4P4KB 4KGJA 5HJ3B 1YMMD 3BGMA 3MRBB 4Q9QL 1A7OH 1BGXH 1J86A 3QJFA 4MJ2A 2QSVA 2RJMA 3NN8B 3DI3B 1YYML 2C3XA 1G1CA 1FORL 3OB0K 4WWKA 3CMGA 3V2AR 4JGUA 2OK0L 5D8JH 1XGUB 1PAMA 4Z7WE 4NRXA 3BKML 3O2WL 4WW1B 1IKNA 3Q0HA 5I66A 3MCKB 2LQRA 2F74B 4MJIA 1I1AC 3QFDB 5CEYB 2DKMA 4ZNEA 1ZLVH 4UNVA 4ODTH 3GGWA 5HHQA 5DVOA 3M8OL 2XV6B 3ALPA 2DWDB 3TYFB 4U1NA 2JB6B 4YBQC 3RZCD 1X9QA 3E3QE 4ZTPL 2X89A 1U92B 2B0SL 4LLUA 3W82A 2FX9H 1MJ8H 1U91A 1MCOL 3F7QA 1T1WB 3MLYH 1OOAA 2DOCA 1M05B 4M6ML 2MFNA 5D2LA 1A14L 4KHTL 5SWQB 3DUSB 1CBVL