4DVRH

Crystal structure of yu2 gp120 core in complex with fab 48d and nbd-557
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
b'EVQLVQSGAEVKKPGATVKISCKASGYTFSDFYMYWVRQAPGKGLEWMGLIDPEDADTMYAEKFRGRVTITADTSTDTGYLELSSLRSEDTAVYYCAADPWELNAFNVWGQGTLVSVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp120
publication title Crystal Structures of HIV-1 gp120 Envelope Glycoprotein in Complex with NBD Analogues That Target the CD4-Binding Site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate yu-2)
molecule tags Immune system/transcription inhibitor
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2012-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dvrH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dvrH01
2D2OA 1V7MH 3CLEH 3E6FA 4C56A 1BZ7A 2GSIA 5GZOD 3T1FA 3DRTA 4NHUA 4R6UA 2R4SL 4U0QB 3VRIB 2WIMA 4RZCB 1XGYH 1HHIA 2V17L 3QIWB 5FGCB 4JZJA 3HNVH 3LSOA 1JGEB 1NAKL 1NDMB 1LNUB 1VFAA 1ACYH 4FXGA 3ZDZF 1F97A 1Z5LA 2G2RA 5C08B 4JY4A 4NZTL 1LDSA 3UBXA 1GZPA 1M7IA 5EDXA 3RVWD 4WUUE 1BBJB 4P4KB 4JKPH 1ZGLB 2BNUB 4POUB 4DN3H 5AYUH 1KEML 3SE9H 1K4DB 4NDMA 4PV8A 4HIIA 4ETQA 5KTEL 2H32B 2DL2A 5DUML 2DS4A 2ZCLH 4Q58C 3PL6D 4W6YB 4JFDA 2LV4A 3I2CL 5I19L 3MRMB 1KXTB 2HTLD 2Y25A 1YMME 5C09B 5C0RH 4ZAKA 3ET9F 1XCQB 2ESVE 2JF1A 3PGFH 3RY6A 1S9VA 3BP7B 4QRPD 2PKDA 5DD6B 1EGJL 1FNGB 4ELME 1CQKA 1AJ7L 4XP5L 3B2VL 3G9AB 4WI5A 5I1AB 2Q3ZA 3MQIA 1C12A 3LS4H 1SM3L 1DLFL 3DXAB 4GXUN 4MA1B 2RGSA 5EZIH 1JBJA 1FL5A 3G5VA 1BMGA 3DMMB 4UQ3A 4UIMB 5HI3C 4JO4H 3BJLA 3G6DH 2XWTA 1JHLH 4J4PA 1W72B 3JV4B 3DX9A 1MCOH 2PYED 4OQTH 3BSZL 2I5YH 5IB1B 3P73A 1L9NA 1DANT 3O3EB 3VGAB 4XVUD 3NIGF 4ONHA 5MEOA 3O6FC 4OD3L 4NQEB 3B4NA 4EVNA 1S3KL 3MFFA 4XCFL 5GGVY 1IM3B 1T04B 1KC5L 5FO8B 2F54E 2HFFB 1A3RH 3PL6A 4PJBA 2V2TB 1AGDB 3WFDL 2HJFB 4RNRB 1KB5A 1X7QB 4NC2B 5F1IB 5D2LF 3LKQA 3NIFF 1UB5A 3BQUD 1B4JH 4M8QA 2WWMC 2XTJB 3AMKA 4Z9KB 4P23B 4YC2C 5D6DA 4TTDC 5D7KE 5A40E 3DGGB 1NSNL 3HLAB 5CP3A 3NCJH 4KAQL 3UPCA 4KZEL 4QXTB 3P9MA 5FA4B 4GW5A 1Z9OA 4KGJA 1KYOJ 4P46B 5DC0A 1D6EB 5FYKH 4HK3N 2CR3A 5KSUB 5HPOA 4QOKD 4PRBA 5DQ9A 1RJYA 1LEGB 3FT3B 4X4ZA 4YLQT 1WAAA 4NBYB 1N59A 2MQ0A 5L7XL 3L6FA 5H2BA 4NO0A 1A6AA 3HNVL 3UAJC 3UTSA 3ARBA 5FO9A 1NGWA 4BZ1H 1J0JA 4JPVL 2NYYD 2A6IA 2H9GA 1J88A 4S2SA 3RVUC 3VFWB 1ORQB 3BH8A 3BKJH 1NLBH 2XOTA 2ED9A 2W60A 3HG1D 3N1MC 1WVZA 4DFHA 3TT1L 5IR1B 3V7MA 1TQCC 4DN3L 4WHYH 1J0KA 3CXHK 3BP6B 1DE4A 5BS0B 3IU3A 4NO2A 2IQAB 1T3FB 4X6CB 3T1WA 4U4BA 5GGVH 3QSKB 3FB8B 1DZBA 3WN5B 2X4UA 5C0RL 5FUOH 5E2VH 5CJXA 4ODXA 5C0AD 5FA3B 1L6XA 4G8EB 4U0RB 1XIWB 5C0AE 4NJAL 1S9WB 3RWFB 3DGCR 5SWSE 1DDHB 2KDGA 2YUXA 3GMRB 3LS4L 5IESH 5EN2A 2I9LA 1OGTB 4QTIL 4TULL 1CZ8L 3OAYH 3V7AE 3G6DL 3KLAB 5A2JH 1UYWL 4HUVA 5TF0A 2ATPB 4OQTL 3TN0B 2I5YL 3OF6A 4M5ZH 3HG1A 2E9BA 4YHNB 4P4RA 2ZNWA 2HTKC 2P44B 3QQ4B 1OP9A 1PEZA 5EU5B 3DX8A 2BVOA 4Y4KD 2DLIA 5I9QB 5KS9A 3THMH 5EBGA 3MMEA 3P4LA 4FN0A 1DBAH 5D1ZB 5ANMA 5GZND 1FFPB 4ZFFA 1J1XL 2XTLA 2HAZA 5EOCH 2DBLH 5EU3A 4JGUA 5B3JE 4JKLA 4R26H 2P4AB 4GW1B 2FECL 1OCWH 1JN6A 2WSKA 2DYPD 5J56B 4JKWA 3WJJA 3LQAH 5J6HB 4HCRH 4NKIL 4F7MB 4X99A 4IRSB 5J0BA 2BNRD 1MWAA 1KN2H 3ULVH 1ZHBA 3BIKA 3QXVA 4I13B 4TUKH 3Q6GL 3NCEB 1AGBB 1V3KA 4WW2C 5D70L 3S35X 3GI8H 1B9ZA 1GGCL 2WLZA 4O2CA 4BZ2H 4NUGH 4WWID 3MBXH 2ZOKB 3P2TA 1YEJL 5AG8A 4GG8A 3GMOA 3QO0B 3GHEL 3KS0H 4F33A 2IBZX 2IBGA 5TQ0L 1QFUL 4K8RL 3CX2A 1I1YB 5C0CE 4Y4KA 3GBMH 1GGYA 2EDYA 4KRPD 1P4LB 2Y5TB 3L3GA 4ZYKB 3OL2A 3CFBB 1FNAA 3IDJB 5EULV 2D0FA 3BGMB 3WNLA 3C6LA 4B53A 5LAXA 2GFBA 3IS1X 4JN2A 1HIMH 4PGBA 4A2LA 2I60L 3BO8A 2DYPA 5E2VL 4M93C 2XQYG 4GS7B 3SKJH 3H9SB 2RAMA 1UM4L 4JQXC 3V4UH 2W59A 3OKOB 1F2XK 1OSZA 3HE6B 4LLUA 3NTCL 3ARWA 3D3VB 5FCSH 1FNHA 1Q1JH 2BSRB 1IGML 2HT2D 2R23B 5IQ7H 5CEZL 4LSQH 1U58A 1JPGB 4PUBH 2FD6H 3TBSA 1NC2B 4RMUA 5AWNL 2BCKA 1G0YR 3VG9C 1G9MH 4X5WB 5DMIL 3TZVB 3OHXB 3D0VA 4NFDA 1UM5L 3K74B 3ULVC 4PB0L 1WLHA 3EOYG 1G9EA 2E7HA 5E8EA 4ZFZB 2V2XB 1LP9E 5HHOE 2IAMC 3MRNA 1U3HB 5F7FA 1VADA 1RMFH 2H8PB 1U2CA 25C8H 4XNQB 1LD9A 2BERA 4FQCH 5EOCL 2A6JA 1WIPA 3QIUD 1JNJA 1PLGH 4V2CB 5ID0B 3P77B 3W2DH 4TRPL 4MNGA 1DQMH 5ID1A 3O11A 5DYOB 2GAZB 4CKVX 5I1HL 5JO5B 4TSBH 3PGCA 3AVEA 4PRPE 3VXME 2FEEI 4ZUTB 1QLEL 4NQSB 1VPOL 3ULVL 2OZ4A 3AY4A 1U95A 4O51A 4TUJB 3BPNB 2V7NB 3QI9C 1I1AD 5EIVA 2DQFB 2BVQB 3DURB 4PLJC 4Z76A 3MBXL 5DQJB 5BRZA 2JCCB 4L5FH 5EU4B 5HYSA 2FGWL 5IFAH 4GRLD 3SE4A 1HILB 2WZPD 4BH8A 3ARZA 2VH5L 5L8LB 1JRHI 5TF1H 3QIBB 2O5YL 4ZQKA 4OAWB 5A16A 3FRPA 3GBML 2VDNH 1JGVH 1HQ4B 1C16B 4P5TD 4MNHA 4M61B 4FQXB 1W0YT 1X4XA 3MRLA 4OIIH 4J8RA 4NO5A 4U6HA 2X44D 2P8MA 3QIUA 5T3ZD 2DIJA 1E0OB 1U8PB 1HIML 3ESVF 1A4KB 5T3ZE 1X6LA 1DQDL 2F58H 2XA3A 5DFWH 3EOBA 4PP1C 5IHBA 3I84A 3HFMH 1G9MC 1GRWA 2AJUH 2M26A 5E8PA 3ARED 2RQ8A 4S1RH 4TVPH 3X3GH 3MJGX 2V9RA 2CMRH 3V4UL 1RV6X 4LLQA 2NQCA 5C2BH 3E3QC 3KPRA 2EO9A 2J4WH 4LF3A 3JWOL 3ECBA 4M43H 5EOCJ 3U6RB 2X41A 4PJ7F 3B2UD 1F2QA 2ICWI 5INCB 4OZGA 1DQTA 3NN8B 4CN6A 3DSFL 1P7KB 1PSKH 2E5EA 2CLVB 5JDSB 5LCVL 1D3CA 4Z7VF 2J2ZA 5FOBA 1YN6B 5DI8A 5E2WH 1FFOB 3VFOB 3VFMB 5FXCH 4OLYL 1NBZA 1GH7A 3O8XC 1U8OA 3VD9A 2Y06H 3L3JA 1KJ2A 5D7LD 3OG4B 2EC9T 4L3CB 4V2BA 1S7QA 3KPPA 4LEOA 3O6LH 1BQUA 1JV5B 2XQBH 3MLXH 4EZMA 4MXVF 5ADPL 4LP4A 1QBML 3VI3E 4FZ8H 1FYTB 4FQCL 1NAMA 1IVLA 4PD4K 3CLFH 4WFGE 3KS0J 1ZLWK 3AREA 2UYLB 5DJ6A 1DQML 4G6JH 3GK8L 3ZTJG 1JMZA 3QIWD 1FPTL 2F53B 4L4VE 4OV5A 5SWZE 1F8TH 3SBWC 1F5WA 1KENH 1VFMA 1DQQA 2YPKA 3OGCA 5AZEL 1U6AH 5FCUH 5C08D 1CLOH 4V1DE 2CDFA 3I75B 4HEPG 2FBJH 3G5XA 2DM2A 5EZJB 1ZWIA 3VXOA 1X9QA 4M9PA 4P4KD 2HJLA 3VRLE 3WBDA 3TGXA 3H3PH 2H2SD 4Z95H 1UKTA 3RWCB 3VGEA 4IIQC 2X9WA 4K7PY 3FTGB 5D7LA 5TF1L 3TA3B 4GAFB 1JGVL 1T4KB 2XI9A 3QXAB 5C09D 5IG7A 4Y1AA 4H5SB 3NZHL 3I9GH 4HUUA 2Q86A 3F62A 3VXPA 4JFXB 1MFAH 1MCWM 5D71L 4S10A 3BP4B 3NA4A 3VRIA 2Z35A 4OJFH 4RZCA 2HFGH 3DXAD 3VA6A 3HFML 3QIWA 4XNZB 3FMGL 3DMMD 2D9QB 5C9JB 2DM4A 4NP4H 4FQQB 5HGHB 5JMOC 3EJYD 2DAVA 4HAFA 5GXBB 3FO2B 1H3UA 3T0WA 1XH3B 4XMKL 3RIAK 5FGBA 4KDVA 1AQKH 3QUMB 4R7NA 3EO1B 3FN0L 4KUZH 5D2LB 5FECA 3B9EA 4WI7A 4X98B 4XHJD 1Q0XL 1XR8A 1BBJA 2X1XR 2VXSH 3MV9B 2BNUA 5K9KA 3MJ6A 3FQRA 4NQED 4R7DA 1PSKL 5CGMA 4XXCA 2RFXB 4U1LB 5IMOB 4XPTH 3TLRA 2VSCA 4FQHB 3V0VA 4O58L 2H32A 2UZXB 2C26A 4IOIB 1FLRH 2X10A 2Q8AL 2I07B 4MJ2A 4M03A 5I75B 5KW9L 4ELKB 3TV3L 1TTGA 4UAOC 3VJ6B 3TESA 2JB5H 4CAGA 1S9YB 2XTJD 4P23D 1XCQA 5FF6B 4K7PH 1O5DT 3F58L 2IWGA 3B5GA 3BT2L 4Y88A 3RAJL 4P46D 2XQBL 1NCAH 5I1AA 1JF6A 1Q94B 4KK8C 1UG9A 3DXAA 3RVVD 5JUEH 1T5XA 1HN1A 2B1HH 1LEIB 4MS8C 4L3EA 5EO1B 4UIMA 1JE6A 1SJEB 3X14B 2YD9A 3OAUH 1T5WA 2VDRH 1FV1A 3JV4A 3WSQL 5D7IE 4XNXH 4OM1L 4UU9B 4D0CA 4FFZH 2H2PC 5IB1A 1KENL 2G9HA 3LQZB 2Y07L 4JY5L 3PWJA 4NOFA 5L2KB 1U6AL 5FCUL 3RIAF 5FB8A 5J11B 4Y89A 2FBJL 5DRNB 5F3HA 1T04A 2AJSL 1M71B 1RVFH 5DHYB 2HFFA 3QEGH 2V2TA 1AGDA 1QBLL 1A8JH 4MJ5B 4RNRA 5C6PB 1X7QA 4MA7L 5BS0D 4Z95L 4HUMB 3BEWA 2QKIB 4TN9A 4ODUB 3NAAL 1JP5A 4JY6B 4OF0A 3OMZA 3ALWA 1Q8MA 4NNXA 5F70A 2HVKB 2GTZA 3QHZH 3DGGA 3VXUB 4O9HL 1YUHA 4J12A 3O2VH 4M6OL 3TO4B 4P46A 1D6EA 4WFHE 5BV7H 4H1LB 4JREC 1AHWB 1KB9J 1XIWD 4BK5A 3ZL4L 4X0KB 5C07E 1X5ZA 2FB4H 3EDFA 4NZRH 4K3JH 5BXFA 2CK2A 4BKLB 2D4DA 4HMDA 3VXTA 4OJFL 2HFGL 1QFWH 3QXTA 2MKLC 3SO3B 3WIHH 4F9LC 2J5LB 3FQWB 1PG7H 3CVHA 2Z91A 1KXQE 2DQJL 1SJHA 2X40A 1AXSB 1RUPH 3GBNL 3RDTC 1ORQA 3VFWA 4F3FB 3TN0D 3BYTA 3Q48A 1HE7A 1VERA 5I73B 1VDGA 4GBXC 3ZYZA 2NY4B 3S98A 3BP6A 2V7HB 5FUCE 1UACH 4FNLH 1ZVSA 4X6CA 1FLRL 5D1ZD 1HHHB 1X5LA 2HFTA 4XP9L 5DD0H 4JAMA 2X70A 4LCUA 1OWWA 2XIDA 5TDPB 5FA3A 3O45B 3FKUS 5TFSH 4HH9A 3SQOL 2OR7A 1XIWA 3L7FA 4CVUA 1I3RB 1S9WA 1BJMA 3RWFA 3L5HA 3JUYA 2HWZL 4BZYA 3LMJL 1NCAL 3O4OB 4IRSD 4WEMB 1XF1A 3CCHB 3T3PE 4KKCC 5FAAA 1QTYT 2GUOB 5JUEL 1QBBA 4HXAL 1OGTA 1MFBH 3GHBL 1YQ2A 4PJAA 2J7LA 5KSAA 3KLAA 2F5BH 3GJFK 1FZKA 4MDJB 3WUWG 1Q9WA 1YNLL 3SCMB 4HX1B 4NZDA 3TPKA 1EFQA 4PJ5B 5ALBH 3TN0A 1KLUA 2FWOB 5L88H 3MROB 4MJIB 4YHNA 2QADC 5BV7C 4HK0B 1R5IB 3KLHD 3QQ4A 2YN5A 1I9EA 4DKEL 1S8DB 3T08A 1Q9OB 2WV3A 3MUJA 1D5IH 1RVFL 4JN1L 4MQTB 5D1ZA 3QEGL 4M8VA 3MO1B 1FFPA 5FM5M 3BUYB 3V6FA 4G8GB 4H1LG 5BVPH 2O5ZL 3CFKA 3TYGH 4LEXH 3T3ME 3FO1A 3QHZL 3DETC 1CFSA 3DYOA 4GW1A 1LK2A 1FVDB 3QHTC 3PF2A 1JZ5A 3C5JB 1VGEH 5GSVB 1DBMH 4XRCB 4EIZC 5HHVL 3RGVB 5LGHL 4F7MA 1T66C 3H9SD 1DL7H 1MLBB 3OAZH 4XB7A 4Y5VC 2WBWB 4DGVH 3BAEH 1DQLH 2UVEA 2B39A 4Y5YA 3SY0B 2MOVA 2VXQH 5D7SL 3HE6D 1AGBA 5IF0B 3WHXB 3D3VD 4NYLA 1QFWL 1HZHL 1LHZA 1J11A 3DI2B 2R0LH 4FQLL 4PLNC 2N4IA 1F3DH 1F00I 3M17B 1E4XH 4JM2B 1INEL 3QULA 4UOW1 4D3CL 2KL6A 1IKNC 2VLLB 1NC2D 2E6JA 1MFNA 1A0QH 4GUPB 1WSST 4P2OC 3TZVD 4EEEA 1TJHL 2P8PB 1D5MB 1W0VB 3ORJA 5J06A 2Y5TA 3C08H 4FNLL 1YEEH 1NL0L 4QHNB 4CGTA 2BVUA 1JL8A 1U3HD 3VFNB 3H3BC 3HZKB 5GS1A 3MCKA 3S96B 3DLQR 1WK0A 2D7TL 5KJRH 1WQVT 1MHHA 3FHAA 5TFSL 1MCSA 4LGRB 4RFOL 3RVXD 3HE6A 5KVDL 1BFSA 2FJGA 3D3VA 1DLHA 4CMMB 1D9KA 1TVBB 2OTWB 1B88A 4U6XA 4Q9QH 2BSRA 3WXVH 2AK4A 5HY9A 2R23A 1YPZE 3U0PA 2VKXA 4DKDC 2X42A 1JPGA 2OXGA 4YX2H 2CIIA 2FDBP 3GMLB 4Y2DB 3UEZA 4KMTL 2R69L 1UJ3B 4EUPA 2ZUQB 4GAJH 3SJVA 3CFJB 1MF2H 3QIBD 5IVZB 1PZ5B 5JHDE 3LKPA 3FT2A 1U3HA 4FQXD 3VRJB 2VDQL 2B4CL 3EFFA 4XNQA 3QFJE 4LASH 3D18B 1BZ9A 5DVLA 5ID0A 1CXLA 2X4OA 5GRYA 1ITBB 3K81A 3QQ9C 2NTFB 2FEDC 4PJ7B 1FSKB 1VGEL 1DBML 4ZNEA 5JO5A 4X6DF 1MY7A 3U4EA 2MMXA 3FFDA 4XWGL 1DL7L 3BAEL 1DQLL 4NIKB 5D1QB 5CKGA 1NMCC 3MRGB 3X11B 4Z78B 5I1LA 2V7NA 3H6JA 2BVEA 2DQFA 4B41A 2OR9H 4LNRB 5LKNA 2GJ6E 2R0LL 5DQJA 4N8CH 3QDGB 1KELL 2Q6WB 4KKLD 2PTTB 3MCG1 1ZK9A 4ZOBA 5I1EL 3D0LB 1UZ6F 4X6BA 2LTQC 2Y5EA 2AERT 4PJFF 4YO0B 5K9OA 3S37H 3OJDB 4RAUB 3QIBA 1WWWX 1IGCL 3CZFB 2X6MA 2CDEA 3IDYC 2DKSA 1CS6A 2HFEB 1TCRB 4WFED 3P4NB 3C08L 2O26U 1MCNA 3L5XL 1A4KA 1KPVB 1FYTD 4GAGH 1YEGH 3V0WH 2QQKL 4EI6A 1A6WL 4PY8I 4J7RA 2VLKB 2A6DB 3RWHB 3UYRH 1AKJA 4WDIA 5E4IA 5JXAH 5GJTH 1HEZB 3GM0A 3HMWL 3WHE1 2F53D 1NFDF 5DO2D 5KANG 3F6IA 4AEEA 5MEQB 2F53E 1SVCP 3IDUA 1QRNB 3NN8A 3C5SB 1H5BB 1II4E 4JFOB 2GJZB 4YHOL 4S0SD 2P5WB 5JDSA 2E7LA 4I18B 3TIEB 4UTAH 4Q2ZA 2IQ9H 1KEGH 5K9QI 1BM3L 1J0YA 5FHAL 1FFOA 5JW4R 3VFMA 2OX5A 1FDLH 3X13A 3VFTA 4GAJL 3P11H 2XG4A 3A6BL 4H0IA 1MF2L 3MV8B 3TA3D 4UNUA 1QFPA 4L3CA 1NCWL 5D2NC 4NHCH 3U30B 3MLRH 3RJDA 4Y16C 2OS7A 1JV5A 1QA9B 1F3DJ 2ATKA 5EUOA 3W9DA 1FYTA 3I02B 4U1JA 1YY8B 3VCLA 3RA7L 1P7HL 2PXYA 1CR9H 4WU7A 5I8OH 5IIEB 4RAVA 5DR5H 4ODTH 3U46B 3NIGE 1OTTD 3BZDA 5EZOL 2YSSB 2YD5A 3MNZA 2DDQL 4OT1H 4FP8L 3T0EB 2IANB 3FFCE 1VACB 3I50L 3CVIL 5EZJA 3WKMH 1J8HE 3Q6FB 4YHPB 3NIFE 3ZKMD 3MV9D 3ILQD 2J3SA 4JVPA 3KYMB 3ZTNL 4CVXB 5T3XE 3UROR 3MV9E 2A0LD 1KPUA 4DN4L 1IFHH 1HH6A 3EBAA 1GIGL 3FTGA 3RJQB 1JVKA 3T8XA 2Z92B 4HWBL 1MI5B 1D7FA 3TJHD 1T4KA 3U83A 3QXAA 2H3NA 4N0CD 5E99H 4YZFE 3VFSA 4NFBA 2JELH 3O4LA 5CJOL 5JQ6L 3AAZA 5IMLB 4BM7A 3S3SA 4U1NA 4P59L 4KVCH 3DV6A 3BP4A 3T2NL 4PJGF 1GGUA 1OY3B 1EVTC 3V95A 5KG9B 1HNFA 5IW6B 3AU1A 4RWYL 3FB6B 4FQQA 4TPRH 2J88H 5HGHA 3FO2A 1R0AH 1HOCB 3G6JF 3RQ3A 1XF3A 4KHTH 3TT3L 2EYSB 3HE7C 3F7QA 4KI5E 1KIPA 4XGZA 2VR9A 4G7YL 3WS6A 1RZGB 3AXLA 1R24B 3EO1A 1GC1H 3B6SA 4LSSH 1QLRB 5K59F 4HSQA 4JRWA 5L2KD 3B5HA 5HI4C 4PJ9A 4X5LA 2RFXA 4U1LA 1SJXA 5ECJE 2IQ9L 1YEDB 3HPLA 4JRYB 3IXTB 4ELKA 2C4FT 3Q1SL 1A9EB 3MLZH 3ZDYE 1AE6H 3MNVB 5I30H 4G8IA 4KU1A 5E6IC 5FF6A 3VXUD 4CDGC 4IRZH 5HVFB 4NRZB 1KUMA 5CJ5A 3TO4D 3TCLB 2GTWA 4I3RH 2BHUA 1VKXB 1ZLVH 3V6BR 4JLRA 4NRXB 1AQDB 1RY7B 1S7WA 5EO1A 5AYQA 1FNLA 2NY5L 2ICEA 5I8OL 1CGVA 1VFBB 4PJBE 1CDHA 4G7VH 5DR5L 2ICWB 1QFHA 3CMOH 3M45A 3UTTE 2AAVA 4UU9A 2RCSH 4OT1L 2VWEE 4YGVA 1RIHL 2ZG1A 2C1PB 3HI1B 5EBWB 1QBAA 5DRNA 5EIQA 4LPYA 1D5ZB 1KACB 2AP2A 1MFDH 5ITFA 2NY4D 1FVEB 3SKUD 5DWUH 1ZLUH 1XZ0A 2QKIA 1IFHL 4WWKA 1KIRB 1F90L 4OIBA 4JY6A 1WAAE 3EHBD 2WMPA 4BSVB 2HVKA 3P4MB 3B9KC 4XCCL 3UTSE 5A43C 1GC1C 1F02I 4PS4L 4L8SB 3L3IB 3T4YA 3UO1L 5HHQB 3OAYK 3V52L 3FRUA 1PX4A 4P3DA 4X0KA 5D1XC 5F44A 3K8KA 3RHWK 1RUKL 3UPAA 1ULVA 3FQWA 3QUYB 1QD0A 4NGHH 4PJ8C 1R0AL 3QRGH 4KHTL 4LMQI 5I76A 3SCMD 1AXSA 5C0DB 1CDYA 3O0RH 3I6LD 4PJ5D 5MHSD 5I1CH 1I7TB 2XRAL 4WTXA 4LHUB 4MJID 1EEQA 5K9JH 2BDNL 2YEZA 5CLTA 2A9NH 3TO2A 3WL9B 4WO4C 4JFZH 5GGRB 4WW2F 4WHTB 4XCYB 3CGTA 4WY7L 2Z93A 5EOQL 3OKKA 4QWWD 1QFWM 1Q72L 5ACZB 1FIGH 3BPCA 1A7NH 4G8GD 3PABA 3GI9L 2HG5B 2JJSA 2VN4A 5TDPA 4M1CC 3RVUD 1IT9H 2AQ1A 1I3RA 5KOVC 1N0LA 3RGVD 4NWTH 4NN5C 4I3RL 3JV0A 2DTML 3WDHA 2GUOA 3IDXH 2ZCHH 3VH8B 1A2YB 1X6NA 1DFBH 3FQNB 5HDBF 4YHZL 4XAKE 4MDJA 3SKOA 3NGBB 4FQ1H 4JFEE 3RHWF 3SCMA 1HYRC 1RUAH 2D4FA 4XC3H 3EZJB 4PJ5A 5EU6B 1Z9SA 4PR5A 3OWEA 4JM2D 2MCPL 1YYLL 1YJDH 4X7CC 3MROA 4MJIA 5KSBF 1IILE 4GXUM 3JUZA 3ZZ1A 2ZG3A 1KLFA 3VD7A 3RPIB 5TH2B 2NY1C 1LWRA 1HHJB 3TVMC 3DECA 1Q0YL 1BQHA 4ZXBB 1CTNA 2ZSWA 1J10A 4HGWB 2BP3A 1LO3H 2ZUSA 1L7IH 3BUYA 5DXWA 3SKMB 1FFNA 3H0TA 3R1GH 1QPXA 2EE6A 3ULUE 2NZIA 2YN3A 2XKSA 1FVDA 4TVSa 1MCLA 5GSVA 5SX4H 4XRCA 7FABL 1UVQA 4BQ9A 3NH7H 1T20B 5L2JB 1MLBA 1LGVA 3ULVF 2X9YA 3TEUA 4UOJA 4RSVA 4QO1A 4J3UA 4F58H 1BQLH 5C92A 4NQCE 5EUKB 3CSBA 4JG0H 3CDYA 5T3ZL 4GSDL 4XX1G 4EDXA 4NGHL 3U0TB 4AZ8A 4JM2A 4CUCA 3S4SG 2YZ8A 2HT4C 2OP4H 1RUQL 1J8KA 1CFQB 2VLLA 1IL1B 3O0RL 2BVPA 1H15B 3AM8A 4Y2DD 5GS3A 5DTFA 3H42H 2DMKA 4Q97A 1QR1B 4XBEL 1CDIA 2X9XA 1VENA 5GRJL 2P8PA 2BOBB 2A9NL 1XF4A 4HS6A 2OSLA 2WIIB 5T33H 1S78C 3KXFA 5E0QA 3LDBB 1GPOL 2IPTH 2EKJA 3PXHA 1OSPH 4P2CG 1KN4H 4XPBL 2D0GA 2FX7H 2EYTA 2HVJB 2EIBA 1YJDC 2J12B 4D8PA 4YDLC 3VH8G 3D48R 2NY7H 2Y9RT 1X5IA 4XT1C 1YNTB 2YUVA 4FXLA 3EDKA 3BVNB 4Q9BA 4XNMB 3DUHA 4FXKA 4CMMA 4JJ5A 3MGTB 5KAQF 1F4WL 2HP4A 2NTSP 2OTWA 4NSKB 1KBGH 3FB7B 5D1QD 5MI0C 5DD5H 1CLZH 3CUPA 1NGZA 3UXFA 1CLYH 4Z7VE 1FG2A 4Q74A 3TYFA 1RUAL 1CI5A 4G42B 4EJ1C 3QDGD 1I1FB 3BXNB 1DSFL 3SDXA 4D9RD 1MQ8A 2YD8A 1OW0C 3HMXL 4QHKI 1JTTA 5CILH 3CFJA 3MBEC 5DRWB 2VLJB 1I7UA 1PZ5A 3D2UB 2DKMA 2ITDA 1PYWB 1S7VA 2OTUB 2X1QA 1DVFC 1MAKA 4AEFA 3VRJA 1HXMB 1LO3L 1L7IL 4WTZG 4GKZB 1CL7L 3GIVA 2OCFD 4Q6IC 5F88B 5C70A 1D5BB 3TH4T 1U8IB 2DL9A 1P2CB 4M4RA 3DIFB 1MCRA 1WFOA 2NTFA 1T0MB 5BRZE 2G75B 5GSRB 5ESAA 1QPPA 2VLKD 1C1EL 4KWUA 2ZG2A 3IJYB 4D0DA 1N6QL 1ZT4B 1A7RL 2VLKE 4ORGB 5C0GA 4ONGL 5D1QA 1UA6L 3IDIB 3MRGA 3EIFA 3GSWB 3QEHB 3RUGF 1KB9K 4LVOC 1CLCA 1E28B 3CFEB 3GSUA 3WJLC 4XP4H 3QEQE 4OI7A 1NCDH 1OAZH 1QRND 4NRYB 3LB6D 2Q6WA 4NNPH 4KRNA 2PTTA 3V6OE 1AI1L 2P5WD 1DEEB 3D0LA 3BPLB 1OLLA 3ZLQC 4O4YH 1EX0A 2H1PH 3VWJC 2V2WB 3QG7H 1W72L 3BH9B 2HFEA 1TCRA 4KUCF 1T0NB 3V9FA 1AR2A 3MV8D 3VXRE 1G84A 1QLFB 3HI6H 4N0UE 1T6WA 1LO0H 1MEXH 3KPRE 2IPTL 4BQBA 4OLVH 4Q9CA 5GS0H 3GUTA 1OTUC 4NC0B 3B5TA 3VU2A 1Q9LA 1OSPL 4WV1C 3ZSSA 1KPVA 3HC4H 1QFWI 5DA0B 1V5JA 4HD9A 5IHZB 4N8VA 3U0WH 1EIBA 5KVFH 1EEZB 3GMNA 5FOJA 2R2EA 4ZUUA 3VGGA 2A6DA 3RWHA 5ETUB 2APWA 2WINB 4FQJH 4I5BB 3HRPA 3SKNA 5D5MA 1WISA 5H94B 2P45B 2DWDA 5MEQA 1MRCH 2JJVA 3ZDXF 1T21B 5H37G 2YPVL 4G6FB 3T0ED 4OM0L 1JPSH 2IAND 2HMIC 1EK3A 4JFHD 1PAMA 4JFOA 3MUZ1 2GJZA 4L9LB 4NQDB 2UWEB 4I18A 1FNFA 3TBVB 4ERSL 2BMKB 2DF3A 3O6FB 3GGWA 5ISZB 4PJGB 1BGXL 2AI0L 5ICZB 4PRDA 4PREB 1MI5D 4F7TB 4LPTA 3W0WB 4HKXA 3MSPA 1MI5E 1D6VL 3OJMB 1BVKA 1IM9B 5DRXB 4D0BB 4DQOH 4YC2B 5GGSY 4H8WL 3KPSA 3BKML 4UQ2B 1YY8A 3LKNB 4I8DA 2R0ZH 1P9MA 4I0PC 3SGDH 5IIEA 3SE8L 4E41A 2DIBA 3U46A 5IV2A 4M4PA 1CU4H 2YSSA 1Z2KA 3RTQB 3BN9D 4UINL 1WUNT 5FYJU 4QY8B 3RX5A 4HIHB 4DFIA 3R8BB 2IANA 3LPGA 5BQ7B 4ODSH 3BW9B 4R0LA 4Y1AE 5E5UB 3JVGA 3Q6FA 1FH5L 1OAZL 1JNNH 1OT2A 3WFEL 2NY0C 3P3YA 4CVXA 4PRNB 3ARFA 4GG6B 4U1MB 1U91B 2CJUH 4F7EA 2YXFA 4X80L 3SDAB 4JRYD 1P4BL 5I0ZA 1TQCB 3QG7L 4LRIA 3SGJC 4H26A 4LDLB 5IMLA 4YBQD 1MAML 5JW4M 2FATH 1EZVX 3U2SB 1RZIA 2FJFA 1MEXL 4DAGL 3BDYH 2E8ZA 3EZ8A 1JJUA 4J1UB 4N0YH 3PWPB 1BBDH 1FZMA 2AJVL 5L6YL 5IW6A 2W0PA 3FB6A 2EIZB 1YYML 3RGHA 1HOCA 4ONFH 4DKFH 4JRXE 4JZOB 1A9BA 43CAA 1NJ9B 2APXA 1R5VB 5EPMB 1RZGA 5F89A 3RRQA 1QLRA 4Z7UF 1ZOXA 3L1OH 2K3TA 4EN3A 4KQ4L 1X5HA 4ZUVA 1TDQA 1IQWL 2KZWA 1I7ZA 5C0EB 3C2AH 3KYKH 1YEDA 1LEKA 2IBZY 1A22B 1AP2A 4JRYA 5CS7A 4EI5A 3MJ9L 4R8WH 3CU1A 4L3EE 1DQJA 5DMGC 1WBXB 1PFCA 4IDJH 1UZ8A 5IJKA 1FFQA 5FDWB 2JIXB 1UWGH 1KPRB 4MVBC 2F5AL 3H3KA 1U8LB 3LRSB 3AS3A 2ADFL 4KKBD 3TCLA 3C6SA 2GITB 1CGXA 2F9BT 2PW1B 3VWKC 5KVMC 5IFJA 4IJ3C 5GISL 1OAXH 5JXEC 4I1NB 3WNNA 1LE5A 4ZO9A 4ZUSA 1PGRB 5DMKB 3WO4C 1EHAA 3QUYD 3ARQA 2DICA 1NBYB 5DUPH 1CU4L 4MQSB 3LEYH 5D9SB 4AG4H 2DJUA 4LQ1A 4M1GH 3TJEH 2DB8A 2R9HC 4Y4FC 4LHUD 4M7LL 2AVGA 3HI1A 4RISL 5EBWA 5T1KB 3BGAA 5IVNA 3QR2A 5IBLD 1D5ZA 4NNYB 3S35H 3NA9H 5LXGL 1BFTA 3GSNL 1HI6B 3I6KB 3VG0H 2CJUL 1ZSDB 1U3JA 4FA8A 2VSDA 2WWKT 4PTUB 4OZ4B 4DGIL 5CD3A 2VL4A 3FO9B 1PQZB 1U8MA 4JR9L 4J3VA 4HUWB 3V8CA 2XFXB 2Y6SD 4L8SA 3E1F1 4N9OB 1X5GA 5EORH 5F96H 2P47B 1XGUA 3NABH 1KJ3H 2VERN 2EKSA 1NEZA 5TQ2H 3QDMB 1BBDL 3QAZB 5KSBB 2HLAA 4IM8A 5KN5B 1GHFH 4APQB 5GRUL 1CGWA 3QUYA 3GSVA 1ZLSH 2Z4QB 5KVGH 2DQTL 4OZIF 3O6KH 5CGYC 3QWRD 4YFDB 3LZFH 4BYHA 2CPCA 2V5TA 4MCZB 5EU6D 2AEQH 3QXDB 4MDIA 3FOLA 4LHUA 1N0XH 2FYYB 2DI8A 4DZ8B 2YMXL 1UXSB 3OB8A 3VG9B 5HD8D 4JHAL 3BIBX 4XCYA 4Y0GA 4ODHL 4ZXBD 3S5LA 5IEKB 4RMTA 4M7LT 1CXHA 5EZLB 2JJTC 5SWQA 9CGTA 4I9WE 4PJAE 4FABL 3OAZK 2IAMB 1KG0B 5FYJH 2XXCB 1RD6A 4WEBL 4FHBD 3O3UN 4IRJC 4WHYG 1A6ZB 4XAWL 4GMTH 3D39A 3ARRA 1HH9B 4JFFA 4OI8A 3CX5J 3VH8A 3TP4A 5K9QG 3HRZA 3U79A 3KHOA 1S9KC 1QSFB 4WW1B 4KZDH 1F4AA 3IFNL 1A1NB 4PPTA 3QI9B 2ED8A 4IMLA 5ADOL 1P53A 3OKYA 2W9LA 5E94B 1JK8A 3RPIA 2R4RH 3LKOB 1HSAB 4NPYB 4I0KA 5DK2B 4KVNL 4DVBB 4U7MA 3UJJH 4XC1H 4LCWB 3EOTH 5DRZB 4ZFGH 1AR1C 3QB7C 2Z8VC 5GHWH 3VG0L 3EYUH 1J1PH 5AG9A 4JE4B 3SKMA 3K2UH 5T3XH 2AGJH 2BSTB 1N2RA 4PJIF 1LE9B 1EMTH 4X6DE 1T2QH 3IAGC 1YEFH 4LCIL 2BJML 2J8UB 1UH2A 3F7YB 3MLYH 5L2JA 5B39A 5C0BB 5EORL 3JTSB 4LLVA 1CXFA 4MWFB 4NJ9H 1B6UA 1O7SA 1FZJA 1JMXA 1NGYB 4DTGL 2AXFB 2ZWLT 5KVGL 4PJFE 4U05A 4OD1L 4QRQB 1G7LB 5CUSH 3LZFL 2NNAB 1CFQA 4IOFD 3MRCA 4TTGA 2CKNA 5B8CC 1JFQH 2DLHA 2QHLA 4QRSB 1NMBH 2HT3C 4RCAA 5HYJB 5JR1L 1A6TB 3JWDH 2B1AH 2W07A 2VLJD 1T89C 2FL5B 4XI5D 2WIIA 2W38A 2CDGB 3D2UD 5MENB 3EYVB 2VLJE 3MNWB 1S5IH 3IU4L 1GGIH 3K1KC 3HZMA 4XH2B 4GOSA 2NMSA 5JW3L 2AK4E 2AKRB 1XR9A 5ALCL 5I1JH 3RUGB 4KJWC 1NFDE 1JGDB 3ZKXC 1BOGA 3MXWL 1QOKA 2Z8RA 3HPJB 1IC7H 5GRZA 4O2FA 4ELMF 2OLDA 3QCTH 1FQ9C 4NSKA 3FB7A 1NLDL 3SJVE 3FN9A 1FIEA 5EG6C 5BJTA 3MX0A 3EGSB 2BNQE 5F7EL 4J6RH 1I4FB 4G42A 2NY6B 4M9OA 3GSRA 1I1FA 3N85H 4KZDL 1DJSA 2D03H 3QA3A 4K94L 1MRFL 1KB5H 5LGJB 2V9QA 4JZJC 5FUZL 3SPVB 1RZJH 1LDPL 5DRWA 4ZSOB 4YQXH 1X5AA 3PHQA 3D2UA 3ES6A 1IAKA 5KAQG 4ZNEE 1PYWA 1PKQB 1C5BH 3QUML 4XC1L 5CP3H 3EOTL 4IIQB 4ZFGL 1HXMA 1NCTA 4RIRA 3EYUL 5IKCB 4P5MB 1LO2H 4KJQC 4GKZA 3G9VA 1D5BA 2DM7A 3EYQC 3TIDA 4LPXA 4KI5C 1YEFL 4AM0A 1ZT4A 3JWDC 4ZAKC 4UT7H 4ORGA 1S5HB 3IDIA 2H26B 3QEHA 2E8YA 3RY6C 3OR6A 5F9JB 5HI3D 5GZOC 3VW3L 4JPKL 2BXYA 2G5RA 4NKMB 4G6FD 4NRYA 3QNXA 4Z0BH 4NQDD 1X4YA 3K7UA 1T2XA 1EGJA 4ZDHB 3LS5L 4JEGB 3O6FD 4J4PC 1SY6L 2VUYA 1NMBL 5F7MC 3OR7A 4M7ZB 5ISZD 4I2XE 1AD0B 5D93C 2C3GA 2YPLA 1EO5A 3W0WD 4UAOB 1IM9D 1G0DA 2WWMD 4JPIA 4TTDD 4QXGH 2F74A 3PL6C 3G6JE 1W2KT 4MJ4A 1FORL 2HTLC 4TOYL 4C57C 5ETUA 1KJMB 5FIEA 1FNEB 1RZJC 1A6VL 3WO3B 4DZBB 1RUMH 3O2DA 4I5BA 4K9EL 2BFVH 2VWEC 3NFNA 3MXVL 4K2UH 4P2QA 5K59E 1VB9A 5D6DC 3UPRA 4A6YA 5INDA 3DVNA 2ARWA 3RTQD 4GKOA 4NWUH 4ONOA 1T21A 1QKZL 4YBLB 1AFVH 2N1KA 3UAJD 1JYVA 4L9LA 5LWYH 3VMPA 4ORZC 2UWEA 4CADA 2FSEB 1OTSC 3O3BB 1RIUL 3TBVA 2MWCA 3ULSB 3IDGB 3B9AA 4U1IB 2EDXA 3WV0A 5FM5O 3B8SA 4RGNE 3QPQC 2ITCB 1JGLH 5ISZA 3ARBC 3SDAD 2VL5A 1QQDB 5ICZA 1ZEAH 3EAKA 4PREA 3VXSA 4XVUC 5IVXA 1SMOA 4OLWH 3W0WA 3BRDA 3KPLB 5TE7L 1IM9A 5DRXA 5C71A 1MH5A 4XZUB 3D25A 1FAIL 3V8OA 1CDJA 4UQ2A 1MWAH 3QT2A 1L9MA 1OD7A 4LSVL 2D31A 3PWPD 2EEBA 2PO6C 2NX5A 3ULUH 5B3JF 3U36B 2VIRA 2DQEL 2IFFH 3ARTA 3HS0B 3AFLA 1OARL 1T1WB 3FO0L 3RTQA 4JHZA 3ZT6A 4UT7L 5CJXC 1VHPA 4QY8A 2ERJB 5H35B 2IH3B 2OQJB 3ROOB 5BQ7A 3LKSB 4YBHA 4JO1H 4G3YH 2FO1A 4G9DB 2A74A 3O4LE 2GSGA 5J4MA 3QUXC 1LK3H 3RDTB 4GG6A 2IC2A 4U1MA 1SYSB 4HLJA 2GK0B 1CL7I 5DQDL 4W6XB 4GBXB 3SDAA 2P42B 1QHOA 5FYKE 3ILPB 4M00A 4UV7L 2FX9H 3B9DA 1ZLVK 1ETZB 5IEHB 2JIXD 5JHLH 3U2SA 5E5MA 4J1UA 1G1YA 2L4OA 4OB5H 4QXGL 4WNQB 1BLNB 1RHHB 1V3MA 3WYRA 3N1PC 4ZFOA 5KBNC 4K8RD 1P4IL 3U4AA 2EIZA 5E8OA 4J2XA 2AEPL 3BUTA 4LAJH 5B38B 4K2UL 3ZT5A 2BVYA 1R5VA 4FTVB 4GT7A 3MJ7A 2X5PA 4ZS7L 1C5CH 3WJJC 5BCAA 1JZ3A 4QXUL 1ZLUK 1CFBA 1CXKA 2R1WA 4LSTH 5LWYL 4HFWB 4LARH 1A4JA 5CBEA 5T1KD 5DC4B 4HKZB 4UUJB 1I8LA 1YC8A 3DYPA 3ULUC 2QADB 4KJYB 4PGCB 1I9JL 2VUOA 4R3SB 2G60L 4DW2H 3C60A 4YAQB 5E70A 1JGLL 4K23H 1I9RL 2Q7YA 2VLRE 3KR3H 4Q0XH 1CK0L 4AEIL 4JKMA 4TQEH 4F15C 4LFHG 5MERB 3LPWA 4ZD3H 2X1OA 3CD4A 5CBAA 1MAJA 4PGEA 2A6KA 1K6QH 2EEAA 3LRSA 4Y4KC 3RKPA 5JNYB 1CD1A 4OZIB 2GITA 3PXJA 4N90E 2EE2A 4XXDB 5HDBE 5AZ2L 3CXDH 1MWAL 4R97C 2PW1A 2OZ4H 1H3PH 4HT1L 4YHKL 5BVJB 2OL3A 2YRZA 3QDMD 4HKBB 2X4QB 5FO7A 1IKFL 5DT1L 4NUJB 5L9DH 5DMKA 4Y5VB 3QDME 3C6LC 4BH7B 4U7KA 4APQD 2IFFL 4LPCA 5LQBL 4M6NH 3BJ91 1CFVL 5D9SA 2GT9A 5HTSA 5FYLE 2QQQA 4HMEA 2NR6C 3MRRA 5DD1L 2WUBH 1IMHC 1MRDL 5TPWL 1HI6A 4ZO8A 5DEFB 5GGTL 4JANB 1IAMA 4KH2A 4LKXB 5DJ0A 4P2OB 4PTUA 1GCFA 2CO7B 4KKNA 2Y36L 4YJZL 3ULVD 4WFFE 1D5XB 1JYXA 1IE5A 3NCFB 4HWEL 4EBQH 2FX9L 1E4KA 2EDDA 2IAMD 1NGQL 4UT6L 5DDHB 4PJCA 3STBA 4TSCL 5JHLL 4LQFL 5KSVB 3KNBB 2BK8A 1ONQA 5I1DB 4OD2A 3SDDA 4JJHA 2HLFD 3D85B 3GSXB 1TQBC 5DJXB 1HKLL 1MJJB 1NCCH 3H2WA 2ZUTA 3HNTL 2VZ3A 1I8MA 3SQBA 1MELA 4APQA 1GOHA 2JJUA 4B5EA 4DCQB 1T1YA 2Z4QA 4ZPTB 3I3EA 4KDTA 5HJ3B 1PD6A 1QSFD 1XGQB 3RWDA 4HG4J 3DX7B 4KKAC 2FJHB 3QI9D 1AO7B 2FYYA 1HDMB 5CFHA 1U3ZA 4PLJD 2COQA 5I6XC 2R2HB 4LSTL 2Q7NA 2KPNA 1KJ2H 4LARL 5CSZB 3AY4C 1IRAY 3IGAB 2HT2C 1FL6A 4LCWD 5EOTB 4M62H 5IEKA 1MCPH 1SEQL 5F8RC 4UDUB 1NAMH 3KR3L 2HN7A 3PWLB 3SE4C 1P1ZB 1E4WH 5JOFA 4KV5F 1YEIL 1KG0A 5HHMB 4MB4A 1K8DA 2PTVA 1YY9C 1A6ZA 32C2B 1G6RA 1HH9A 4HS8L 5IM7B 5DEGB 5C0BD 3VFGH 4XNUH 4PP1D 2OZ4L 4JHWH 5K33A 3VI3F 1QYGL 3QFDA 2HRPL 5DLMH 1N7ML 3ZYIA 3CK0L 3LHPH 2A1WH 3QIUC 3V6OC 5L9DL 2VZVA 3MRKB 2P8LA 1QSFA 5CP7A 4WUUB 4WW1A 5TE6L 1NMCB 3MLTA 5ICYB 1JNLH 3CIQA 3ZE0E 2VXUL 4X9FA 3IF1A 4O02H 2I26N 4Z7WA 4U6YB 5CWSB 5HDQH 2QHRL 3S3PA 3MA7B 3LKOA 3WMSA 3L5WA 5J1AA 3VD3A 1YMMB 1AY1H 1CG9B 4LSPH 5HYJD 4ISVA 4LPUA 3QH3B 2LTQB 4LCCA 3WEXA 3CNKA 4R4ND 2XPGA 5HYJE 1WGOA 2EC8A 2ESVB 3N9GL 3L3HA 4QCIB 1ADQL 1GYAA 4IHOA 5MEND 1Z3GL 5EC1B 4O5LH 4HHAB 3IDYB 4ELMB 4BJLA 2C1OA 1J0IA 3O6MH 4L4TE 4U2YA 5D96C 2UUDH 4XVSH 3VGDA 3OKDB 1P84J 2J8UA 1L4IA 3QPXH 5C0BA 1J87A 1UJTA 2FLRT 2YUZA 1PY4A 1OPGL 4HPYH 1ORSB 1WCBB 4OFIA 1OM3H 5CINL 3K8LA 1LO4L 1NGYA 5IB4B 1I1RA 1WWAX 2FO4A 4G6MH 2YA2A 5F1NA 3KXFE 1ES0B 1S7SB 4HIXH 4NZUH 2D7PA 4QRQA 2A2QT 2GIYA 4F7PB 1BWMA 4KUCD 1CT8B 2NY6D 2H32H 3DSNA 3AREC 5JORB 2PUQT 2F54B 2NCMA 4XPHH 1IGJB 6FABH 2FZ3B 1KULA 3EDDA 3ZE2F 5DJYB 4HQQH 3L9RA 5EO9B 5T1LA 1A6TA 3OKNA 5J9PB 3FT4B 2CDGA 5F8QC 1B4RA 5I2IB 1CFNB 2NW2B 4NN7B 1T7ZA 2VXVL 3VFUB 4M62L 1QNZL 4YHLH 1PKQE 4TVPE 1KGCD 1MCPL 2B2XH 5I17B 4YK4C 5I1KH 2LQRA 3T65B 4Y16B 2CLZB 1BECA 2F8OA 2LVEA 5LVEA 1J86A 4X4XA 2CGRH 4HGMA 3IDMB 4X6FB 3EYSH 3SDXE 3LIZH 3V0AC 3TBYB 3VFGL 4TSAH 4XNUL 4BK4A 1KFAL 1M7DA 5DLML 3PP4H 3HAEB 4BUHA 3LHPL 1DUYA 3OKEB 2A1WL 3EGSA 1QSZA 2M1KA 4PJXA 5TE4L 3GMPA 5ESQB 1RULH 4DVRH 1I4FA 1OP3H 2Y4SA 3N1FC 1TJGL 3KJ6H 1NEUA 5D7IF 5EBMB 2XA8L 3KPQA 4O02L 3MRDA 4UB0L 3QIWC 5LGJA 1JZ8A 1MCFA 3HC0B 3SPVA 2ILLA 5DSCB 2Z8SA 1NDGA 4TUOB 2PW2B 1JI2A 2QSCH 4JO2H 5HHNA 2RJMA 5FGBC 1T22A 2C3WA 4KROC 4QRRA 1HSBB 4IIQA 1MLCA 3BKCL 2ORBH 3MUY1 1CICB 3SEPA 5IKCA 5DZNA 4KMQA 4XXCC 5SWSB 1CD9B 3DTXB 1UKSA 3ARGA 4U1KA 4FFWD 5EIIA 4FG6C 3HR5B 3D69B 4X6EB 3DRQB 3CVHH 3CC5A 3P9WB 5IW1A 4KK8D 1S5HA 3A67H 1C08B 1RK1B 2N7AA 3SDCA 4MS8D 2R1YB 5CHNA 5F9JA 4NCDA 1U8QB 2WBJA 3GJEB 5FK9B 3HE7B 2GY7B 5F21B 4LLDB 4BQ8A 5I1GL 4HIXL 4MA1C 3FQTA 4OKDA 4OQ1A 2H2PD 3NCBB 1C7SA 4HF5H 1R3LB 5E2TH 3FONA 2GJJA 3OXSB 4PB9H 1NANH 2HKHH 2PCPA 1AD0A 4OSUH 1EDQA 1A5FH 4YDIL 4M7JL 1MQKH 3VGAC 4LSRL 5D5ME 1A7OH 3HZYA 1J0ZA 3O3AB 3IKKA 1VGKA 4ALAL 2P1YA 4G9FE 1QACA 5M94B 4YHLL 2AEWA 4OCRL 1FCGA 2QL1A 3GZKA 3BWAB 4LFHD 3MYJA 4HIJA 1GZQA 4Z7NF 1FNEA 2W65B 3C8KB 3QUKB 4XP6H 3HAEG 1PKOA 1TJIH 5DUBA 2ICCA 2XTJC 4Z7UE 1RU9L 2R29L 3LIZL 3EO0B 5E6ZA 3UTPD 5GGSA 4AIOA 1CGTA 2APFA 2K7PA 4K3EL 4GRMB 3T3PF 4P46C 4OTXH 1XEDA 1Y18A 2L0DA 4AT6B 1OAQH 3CX5K 5C0CB 1G7JA 2OJEB 1RULL 3G08B 3ULSA 4YH6A 4U1IA 5IB2A 3QUZA 3KJ6L 3KPSE 3RDTD 1DN0B 3OPZH 4OCWH 3BDXA 3QP3A 4KHXL 4GBXD 5CEXA 1QQDA 2P24A 1ZT1B 4G5ZH 3RZCA 2QSCL 4AMKL 2P5EA 4YFEA 4E41E 1M6OA 1XF2B 2X4SB 1R3HB 1F11A 3QNZA 4P2RE 3JBG7 2ORBL 4U6VL 4XZUA 1YA5A 3RU8L 4LHQB 3CSYB 5CZVH 3B9KB 4BFBD 3SE3A 5BO1H 3VGHA 1G7HB 4MSWA 4WVRA 4L8BA 4LDEB 4LU5L 4HJJH 4CNIB 4I48A 2I9TA 3B83A 2BXZA 3KJ4B 3X17A 3T3MF 1Q9KA 1OB1A 1JWUA 5D1XB 3WXWL 5IQ9B 3MJ8A 3WNOA 4KKCD 4HAGA 3LN4B 4PJEA 2YC1B 5F7DA 3KLDA 4F9LA 2PR4L 1FRGH 4FTVD 3TBTB 3LY6A 4N9GB 3BFOA 3LKSA 3MR9B 1XIWC 1YEHH 5DMJB 4H20H 1MJ7H 1T7VA 3TCXA 1INQB 3V79C 3RWGB 4K7FB 3RDTA 3EFDH 4GJTB 2D7MA 2GK0A 5D72L 4HF5L 4LKCA 1IEBB 4ZPVB 1LP9B 5FHBH 1MCKA 2QADD 5JPNB 5HHOB 5KSAC 3HNSH 3O41B 4C83A 2ZSVA 3EOAB 4I77L 4WO4B 2QQLH 1K2DB 3ILPA 3RL1B 3TN0C 2XICA 5IEHA 2IF7A 5I71C 5E8NB 1E4JA 2ZCKH 4PRPB 3VXMB 3OZ9H 4HS3B 4PJHF 4F80A 1BLNA 1EFXB 2ZUVA 4HFUH 3UBXI 3FB5A 1NC4A 2Z9TA 2OK0H 1T66D 1ZANL 5CCKL 5B38A 3D9AH 1B0RB 3HHRB 1F58L 1BAFL 2W9EH 4OTXL 1XF5B 15C8H 2AJYH 2PYFA 4IDLA 4EUPH 1FE8L 4P9MH 3QWOB 1ZA3B 1X44A 4GAYA 4GKSA 4Y5YC 3DO7A 4UUJA 3L95B 5KOMC 5FFLA 3VA2C 1MHEB 2AEIT 4OZFA 1GL4B 3NFPA 1YDPB 2VR5A 4PGCA 4R3SA 2NY1B 3J8F7 4R96A 3MTRA 4YAQA 4RFNC 5C7XH 4P2OD 3TVMB 2FX8H 4NM8L 4MA3B 2DQHL 5JTWA 3IFOA 5MERA 4D9QD 1T1ZB 2VE6B 2R2BB 4UIKL 1JGUH 1FGNL 5F1OB 4PRIA 2CKBL 3KLHC 1AXIB 1KCRH 4Z7OE 4MJ6B 3KPNA 1FVCB 1A1MB 4XXDA 4L8DB 4AY0A 1T0PB 4FQIL 5BO1L 4ENED 3LKRA 4PG9B 1N26A 3D85D 4OLXH 1J0HA 3O9WA 1XGRA 1IAIH 2DD8H 2FIKB 2YD4A 2BY1A 4BH7A 2W9DH 5GS1C 5JIIA 1EA9C 3WS3B 4KQ3L 1TETH 3NPSC 5HYEA 4FOMA 3VE0A 5C0FB 1ZVYA 1FRGL 1G9NL 4AL8H 1ZE3C 3DV4B 3LH2H 1MUJB 4QF1B 4OLUH 3E0GA 4N0FB 1AO7D 1KCLA 1MJ7L 1F4XL 2E7BA 2X09A 4QT5A 4YE4H 1AO7E 1D9KC 5DEFA 3BOVA 2ZPKH 4OZHE 1EO8L 4PJIE 1OOAA 1T7WA 1YMHB 4LKXA 3K1DA 4FMKA 3UTQB 3WKNA 4LBEB 5HGBA 3WIFB 3EUUA 1N4XL 3JV6A 3QCVL 3QCUL 3UJTH 1EHLL 1IZJA 3QO1A 1IGIL 1BFOB 1JHTA 3KAAA 1QVOA 5GGUB 3IFPB 4RBPH 1FBIH 1KNOB 1KCSH 1M05B 5HHMD 3Q5YA 1ZT7A 3G04A 1CFTA 4J3WA 3CDFA 3KNBA 4GLRH 5I1DA 5HHME 1AGEA 3MRIB 5E9DA 4L4VB 3EO9H 3GSXA 4RGOH 1MJJA 4S11A 5SWZB 3QQ9D 5DJ8A 3L3OB 1U3HC 3U9UA 4DCQA 5HDOA 2OK0L 2CK0L 1KJVA 1H3TA 1JF1B 3GKWL 4V1DB 5HJ3A 3CSPA 1KTDA 4WUUD 5MI0B 1S7RB 3DX7A 1A3LH 2ADGB 1HDMA 3MZTA 4PJDF 1EVUA 2AJYL 1WZ1H 3FOMB 1OAUH 3BRFA 1IGFH 1OAKL 2IG2L 2Z31A 5IB3B 5ICXA 1YMMD 4CU6A 1IEAB 4EDWL 1DBBH 3IGAA 3BPNC 3D39E 3QDJA 3BHBB 3B3IA 4Q9RL 1I3VA 4S1SL 5CJQL 4JFFE 2ESVD 1U8HB 2XZCL 4LLWA 1BIIA 1KIQB 2Q76A 1P1ZA 3FCTB 1DVFB 1TZHB 5F7YC 4R90H 4YPGB 4BUGA 4Y4HB 1CDGA 1XCTA 2DWEA 4X7TB 3L3KA 1BVLA 3QIBC 3IJSA 4Q6IB 4UILH 4YR6B 5IM7A 4NBXB 2XKNA 4HH8A 5DEGA 4XPGH 3V4VL 4UI2A 4WUKL 1FFRA 3MOQA 4OFPA 1HHGB 4NO3A 5DK0B 3MUGB 1G7PB 4MCYA 3MRKA 2DD8L 2B0SH 4WUUA 2BHYA 1HINH 3ARUA 5ICYA 4LVOB 2XNAA 5C8JB 3U7YH 5IJVB 3HC3L 2F54D 4AL8L 1OGAB 4PRHE 3BKYH 5BW7A 1IQDB 4MAUH 3TPUB 1CF8H 3QH3A 2ZUWA 4FZEL 5D8JH 12E8L 1WT5A 2ZPKL 3F12B 1WIUA 3VWJB 5D7KD 4QCIA 5CIPA 1I1CA 2QQNH 2IH1B 3DO3A 4OF8A 1FLTX 2V5MA 4HBCL 4JM4L 1EHNA 4HHAA 4QTHB 5TDOB 4H0GA 1B0GB 4QRPA 4N8PA 1T80A 3NZ8A 4CW1B 2E7LC 2CIKB 1H0DB 4X4MA 1V7ML 2AQ3A 3CLEL 2EDWA 1FBIL 2LVCA 3O2WH 4Y16D 4PRAB 4YZFF 5D2NE 5E1AB 4GQPH 2HJKB 4WV1B 4HWUA 1UM6H 5CMAB 4YXHH 4OFKA 4Z7QE 4OBSA 2YR3A 3EO9L 4ZS6C 1XGYL 5B8CA 5D7IB 1EAJA 1WCBA 3KWWB 2PYEA 1PZUB 2EDHA 4G80B 5EA0H 2XWBB 1KCVH 2AS5M 1ACYL 1HHKA 1ES0A 1S7SA 4RGNC 4F7PA 1CT8A 2PXYC 4GXVH 3VXQB 5C0NC 2NY3B 1IGJA 4KI5F 5C0JB 1JYWA 1B6DA 5KANI 3WLBB 4JKPL 4H25B 5DO2C 3OKLA 5AYUL 5EO9A 2C5DC 3GMMB 5ENWB 3SE9L 5J9PA 5DJCA 3FT4A 3TNNB 3BQUA 2ZCLL 4OKVB 1EXUA 1LO5B 3IJHA 1E27A 1JWSA 3W9EB 1CICD 1CXEA 4LCYA 4W81A 5E7FA 4XWOC 4S1DC 1OVZA 3MGOB 2MHAB 3PGFL 5C07B 3ZDYF 3MLWH 4BSWA 2CLZA 5SWSD 4R90L 1MJUH 1IEHA 4QOKA 4M48H 1EZVY 4PY7A 1RZKH 3WFZA 5J8OA 4X6FA 1S7UB 5JOEA 2RHEA 2R0KH 4I0PB 4LAQH 5EZIL 3HUJA 4JO4L 5A3IC 4N5UA 3ZKNC 4HWBA 1JHLL 3OKEA 5DJZB 1MCOL 1AC6A 4KTEH 4MX7B 1R3KB 4PJBF 3HE7D 3PJSA 3DPBA 3GRWA 2QBWA 4XNZC 3BRGC 4JFQB 2F8XC 5D7JB 5HI4D 4X8JB 3P30H 3EKCA 1KTLB 2PW2A 4QHLB 3GO1H 5FYLH 3CH1B 1A3RL 2BRRH 5IMKA 1CF8L 5I74C 3WS6C 4HZLB 4P3CH 2D0HA 5D8JL 5HDLA 3W39A 3MCLH 1CICA 5AAWA 1B4JL 4W4NA 4MNQB 3ZKMC 3ILQC 4EOWH 4YEFA 5C0AA 1RK0B 4PJ9C 1NGXA 2AV1B 3ZSTA 5HYQA 4N1EA 1N3NB 3DTXA 3NCJL 1WAAF 4G6KH 5FYKL 2EDJA 1A6UH 1LVEA 1TIUA 3O2WL 2BC4B 4KXZI 5J1SC 4OIAA 1AD9A 3RIFK 1RURH 1X5FA 5HI5C 2R1YA 5IK3A 3RNQB 2VABB 2Y7QB 1WF5A 3K0WA 1V3JA 2YPLE 4BZ1L 3ISWA 5C6TH 5C0CD 1K4CB 5GQBA 1YECH 3BKJL 1NLBL 4DUXA 5DF0A 1RZKC 2XWJB 5HPMA 4P49A 4A2MA 5J6GA 2EYRA 5I1IH 3JSSA 4PLKD 1SEBA 4RAHA 1PX3A 3NCCB 2DTSA 5F1SA 1N5AB 4P2QE 5GGVL 5B3NA 2D9CA 1AGFB 3K3QA 4IS6B 4NN6C 5FUOL 3MLUH 5CEYB 3B9KD 3BWAA 2B5IC 2BNRA 2FLBT 2W65A 3C8KA 1BREA 3QUKA 4WWKC 5I16A 4GFTB 3GSNB 2GK2A 3VWKB 2VITA 5D1XD 5IESL 4IJ3B 2IMNA 2R0KL 4LAQL 2WP3T 5I66A 2FH6A 4E42B 5F71A 4HDIB 3VXSE 3RIFF 4AT6A 5IVXE 1C5DB 3IS0X 5C0CA 5KS9F 3CDGB 3MV01 4M5ZL 3LQAC 5A1AA 1UQSB 3ARVA 4RA0C 5C86A 4Y4FB 4N68A 2R1XB 1WBZB 1FAKT 1UWXH 2IEPA 5JA8B 5HHOD 2NX5E 5J12C 3THML 1ZT1A 5FYLL 5JLZB 3DOSA 3QHFH 5FKPA 1DBAL 1G7QB 5EC2B 4WO4D 1XF2A 1R3HA 3MODH 1K8IB 5F9WB 1KCUH 4JO3H 3UX9B 2DBLL 3WNKA 3B9KA 4R26L 3SDYH 1R3IH 1J05B 5IOPA 1OCWL 1DBJH 4PRPD 3VXMD 3ULUF 4CNIA 4M1CD 1WITA 3LQAL 1EFXD 5IB5B 4HCRL 4G6KL 3T77B 1EEYB 1ZA6A 1H8OA 1KN2L 3P0YH 1P84K 1YPZB 4TUKL 2X4TB 3MLSH 3LN4A 2JJSC 3TBTA 4P5KB 3GI8L 4BZ2L 4NUGL 2OM5A 3OJ2C 1F6LL 2CRZA 2X7LB 1JCKA 1INQA 1F3JB 3O4OC 1Y6KR 3M8OH 1FO0A 5JW4N 4UDTB 3CFCH 4K7FA 3W11C 3PWNB 4DGYH 4L8CB 1SYVB 1RJZA 5JHDB 1IEBA 1LP9A 5JPNA 5HHOA 5HHXH 3RL2B 4PTTB 2NY1D 3EOAA 3SCMC 3QFJB 2KUTA 3RL1A 3TVMD 2IGFH 4HGKC 1WWBX 3HCVA 1DBKH 3DROA 2VJXA 3EYFB 3MLVH 5E8NA 3EDEA 4NQVA 4LRNH 2P7TB 1EBAA 4PRPA 5IMMA 5E1HB 4HS3A 4Z18A 1EFXA 2FHCA 3SKJL 4CDHA 5IHUH 1ZTXH 3EYOB 3CZJA 3MV7E 5F6HI 5DFVD 1S7TB 2GJ6B 1I1AA 1W0WA 1ZHKB 4MD4B 4QHUA 4YDVA 3DYMA 1Q1JL 1KLGA 5IQ7L 3RWEB 4GRLA 2FR4B 4LSQL 3QWOA 4FFYH 4PUBL 4Y5XC 4QHMA 3KYNB 2FD6L 3G5YB 1NCBH 5IROA 2HT4D 1MHEA 4YNYA 4AIZB 1E6JH 1G9ML 5DGRA 5IWLA 4P5TA 1CD8A 4KV5E 4CJ0A 3FQXA 2Q3AA 1U2HA 3PGDB 5E8DH 5JQHC 1YN7B 4JM2C 2Q8BH 2VE6A 1PBYA 3U7WH 3GNMH 1S78D 3JTTB 3MODL 3PWUB 1RMFL 3AM8C 25C8L 3L7EB 4WFGD 4XCEB 3DUSB 4MJ6A 5F9AC 5ILTH 1PLGL 3W2DL 4YXKH 2CSPA 2C3XA 1IC5H 1MFCH 4L4VD 3NFSH 5DHVA 1DBJL 5SWZD 1F4YH 2MNUA 4TSBL 4YGAB 1OD9A 2FIKA 2QR0A 4I4WA 4GRWE 3GSOB 2EZ0C 1RIVH 1F6AA 4W4OA 3DNKA 4RX4D 4HC1A 2JK5B 4V1DD 3BE1H 4WI6A 5EBLB 2F19H 3I6GA 4LIQH 1FZOB 4QGYA 1L7TH 1MUJA 1I9IH 3E8UH 5IGXH 4N0FA 5BZDA 3MRHA 4L5FL 5IFAL 3M8OL 4PJCE 4LP5A 2WQRA 4EXPX 1YMHA 1I8IB 4IMKA 4NKQB 3WIFA 2VDNL 4HIEB 4JDTH 1T6VN 4Y19B 1IAIM 3AB0C 4XBPB 5AUMB 3IFPA 2C4XA 4OIIL 4PYHA 1W8NA 2ZJSH 1DVFD 1QSEE 2IGFL 4Y4HD 3WLWC 3MUHL 4N1CA 4MD0B 3FQUB 5DZOA 4Y8AA 4U6TA 2F58L 4QXWA 5SWZA 3CJJA 3HMXA 2AJUL 2O61B 3GEWB 4RRPG 5C2UB 3ZKXB 4S1RL 4TVPL 5IHUL 3X3GL 1JGEA 4JZNB 4OZGF 1NDMA 1LNUA 2CMRL 1E6OH 5I18H 1JF1A 3FFCB 4RX4A 1G1CA 3EDJA 3TC9A 5C2BL 3NCYP 5C08A 1J8HB 2A77H 4HLZH 5F7UA 1S7RA 3ZE2E 2J4WL 2ADGA 1UH4A 4M43L 4C56B 2GSIB 3PHSA 4P4KA 2YRLA 1ZGLA 2CQVA 3DRTB 4NHUB 2O93L 3OX8B 1HWGB 5GRWA 1A02N 3FOMA 1K4DA 3QJFB 3RX7A 1OGAD 1PW3A 4FFYL 4J3OC 5D1QC 1NCBL 2ENSA 1OGAE 3MRMA 5E2WL 2MJWA 2WK2A 4XNYH 3RKDC 3BHBA 2UUDK 2UZIH 3QEUB 4J3TA 4MXQD 4OGYH 4LPVA 5C09A 3VWJD 3VD4A 4HW6A 2Y06L 4FXGB 3S37X 2WWKO 2G2RB 1KIQA 1ZHNB 2CLRB 4H88H 3BP7A 4JY4B 4R9HA 4ZOCA 5F3BB 5DD6A 4U1HB 4Y4HA 3UBXB 1GZPB 3O6LL 1FNGA 1M7IB 1EJ6A 4X7TA 5CSGA 3UZVB 3MLXL 4R4FH 2CO6B 3VMNA 4FZ8L 1OTUD 5JOPE 1B2WH 4PV8B 4HIIB 5ILTL 3CLFL 5HXMA 2LAGB 5F97E 3DMMA 3NCYS 4G6JL 5HVHC 1HHGA 3HI5H 1W72A 3LRHA 4AQOA 1CTOA 3VI4F 1MCWW 4CU8A 4ZAKB 1F8TL 4JHBA 1RIVL 4CN1A 4YWGH 3O3EA 1XGTB 4LOUC 1S9VB 4JDZB 4DEPC 5C8JA 3WJLA 4NQTA 2F19L 1CLOL 4NQEA 3MC0A 3WUWB 2NY3D 1L7TL 1IM3A 5FO8A 5C0IB 3UZQA 3J7HA 3TPUA 2BSSB 2XG5A 2HJFA 3G5VB 3H3PL 4KK5C 5F1IA 1RZFH 3F12A 2XWTB 3VWJA 4XMPH 1BPVA 1G0XA 5GIRB 2IH1A 1RAMA 4P23A 5LJYH 5TDOA 2DQIH 1KF9B 4LPWA 5D93B 4CW1A 4I18C 2CIKA 3GMQB 3HLAA 3P73B 4WFHD 4QXTA 5FA4A 3I9GL 1H0DA 1NBVH 5FKAB 5M7QA 5MEOB 4HPOH 2QEJA 2UZYB 4ZO6A 1BF2A 5C07D 4EVNB 3E2HC 5KSUA 4WCYH 1MFAL 2PNDA 1LEGA 3FT3A 4PJBB 3PL6B 2DLGA 5DS8B 1CQYA 3UTTB 3R8QA 4I0PD 1UCTA 1WZMA 2H6PB 1TNMA 4NP4L 5DD3H 4M8QB 1EHXA 2YK1H 1JRHH 1E6OL 1P6AB 1WFUA 5B4MC 2V5RA 1AQKL 2R39A 4OLZH 5F93C 1P9MC 1WEJH 4KTDH 3DUUB 4KUZL 2W92A 2DJ4A 3CDCA 5C0JA 5CZXC 4CL7A 2VXSL 3WLBA 5IR1A 4PRBB 5DQ9B 4KK9C 1I3GH 3N06B 5ENWA 5BS0A 5D7JD 1Z9MA 4U33A 4XPTL 3TNNA 2IQAA 1T3FA 3S36H 1N59B 1RJLB 3ARSA 3L6FB 3UBXG 4NO0B 1A6AB 1LO5A 1U9KA 3FB8A 1TFHA 3ARBB 4YUEH 4IBLT 4R0LC 2UZIL 3WN5A 5FO9B 3JVGC 4OGYL 4OFVA 3UYOD 2JB5L 4Z7NE 4MNQD 1UC6A 4AH2B 5A2LH 4GO6B 2H9GB 3MGOA 3ARFC 4G8EA 4MNQE 4K7PL 4PJXE 4IOSD 1OT1A 3P40A 5IVOA 3U1SH 1DDHA 3MACH 3GMRA 5E5RB 1DE4B 4LRIC 3IU3B 4NO2B 2B1HL 2PO6B 4AJ0A 35C8H 1KXVC 1RZ7H 1YQVH 3T0VA 3OAUL 5BOZG 4N0RA 3HI5L 5GGRY 1ACZA 2VDRL 4XVJH 2X4UB 4QRRE 4XNXL 2ATPA 4FFZL 1VSCA 1BD2E 4ODXB 1T83A 3O3DB 4O2EB 2YKLH 4JFQA 2CUIA 5EU5A 5D7JA 3QUXB 3RX8A 1WICA 5EN2B 4HZLA 4X9HA 1RZFL 5L8KB 4XMPL 4NM4H 1FG9C 4EN3C 1FCCA 4X5XB 1DANU 1NFIB 5FGRA 5DMGD 1FYHB 3MA9H 4OF3A 3O2VL 2DLFH 1NBVL 5J6HA 4EI5C 4MVBD 5C9KA 4P4RB 4IRSA 5BV7L 2BVOB 4WCYL 3H7BB 3OB0H 2FB4L 4NZRL 3MMEB 4K3JL 4MZ2A 4JFEB 3VWKD 5IJKC 3MJ9A 4M6AA 4PD4J 5JXED 3C5ZC 3WIHL 1MCQA 1JPTH 1PG7L 2VABA 2ZOKA 2VC2H 4GKNB 1JHKH 2LU3A 4ETYA 1CDBA 3QO0A 5J3HC 5ELIA 2DQGH 1WIOA 1K4CA 1RUPL 4OLZL 4X6CF 1I1YA 4X99B 1GOGA 3PUCA 1MWAB 2YD2A 1P4LA 2E9JA 2R9HD 4K3DH 4OCXH 4Y4FD 1ZHBB 3BIKB 3TM6A 1AXTH 1L0XA 5DZLA 4ZYKA 2VAAB 3CFBA 1P5UA 3W5NA 1UACL 3IDJA 4JG1H 3BGMA 3KPOB 4PV9B 1U8JB 4PJHE 5DD0L 1AGFA 4OCYH 1J1OH 1INDH 4GG8B 4IS6A 4F15B 3GMOB 2R0WH 4Y2OA 3UTSB 4F33B 3ZKQD 3H9SA 1MIEH 2WLYA 1X4ZA 1U36A 2CUHA 4PJAF 2CRMA 4FQ2H 3OKOA 1YZZA 4NQCB 5F7WC 3U1SL 4DWHA 2EIEA 4R97B 2DKUA 2PF6A 3L3GB 3MOBH 1HYSC 3AS0A 3S34H 4LLMB 1MFBL 4YHMH 3GIZH 2FH8A 4LDOB 5GJSH 3MOAH 4XVTH 4KKBC 3C6LB 4L8SC 5LAXB 4HDIA 2F5BL 4JN2B 2P5EE 2DQUH 5ITBH 2WW8A 4XVJL 3BO8B 1NC2A 5ALBL 4HULB 3CDGA 5CGYD 3RNKB 4XPFH 5L88L 4X5WA 3PQYE 3TZVA 3OHXA 3QUYC 5IBTH 3SGKC 3RBGA 5JHDD 5DFTA 4LLUB 1D5IL 2EDOA 2V2XA 4ZFZA 5JLZA 4X9BA 1P7QB 1K3ZA 3QFJD 3KVQA 2C3HA 1K8IA 2H8PA 1TENA 5F6IC 1N64H 4AYFA 2J6EA 5IBLC 4PJEE 1FNSH 4AIXA 3P77A 5BVPL 3TYGL 4LEXL 1BJ8A 1VA9A 3TBSB 2R8SH 1J05A 4P9HH 5DYOA 2GAZA 1WC7B 2X1WL 1KOAA 3EJZC 4HKJB 2DLFL 4QEGA 5IBUB 5IB5A 3D0VB 3P0VH 2XN9E 4M1DH 3T77A 1EEYA 4ZUTA 4DGVL 4NQSA 2AK1H 5DURB 1KYOK 1TQBB 1YPZA 2VXQL 4Z7VB 2X4TA 5E8EB 4TUJA 2GJ6D 3TBWB 5A2KH 1Z6JT 2Y6SC 3MRNB 1VADB 2BVQA 3DURA 1LD9B 4S1QH 2A6JB 1FC1A 1TZGH 2JCCA 5EU4A 1JHKL 3UC0H 3ARDB 5DVOA 2Q87A 1E4XL 4UDTA 3VMOA 1GOFA 1HILA 4HXBH 5HVGB 3O11B 5ID1B 4L8CA 1SYVA 4QRUB 4F9PA 4JVWA 3UJIH 1A0QL 2ICES 4OAWA 4POYA 2ICWJ 3RL2A 1HQ4A 4PTTA 1C16A 2VXTH 4M61A 1AXTL 4FQXA 1U95B 2K1MA 4RQQB 1F45A 1YEEL 4JG1L 1AR1D 4Z76B 1U8PA 4U1GB 5BRZB 1MFEH 3EYFA 5HBBA 4OCYL 1B90A 2P7TA 1TVDA 5T5NF 5KJRL 2FHBA 2YHGA 4RGMB 2AJ3B 5EH1A 2EDQA 4ODVH 4H0HB 3EYOA 3HA0A 4ODWB 3RWIB 3QEQB 3S88H 2GJ6A 3MREB 4PJDE 2VZUA 4MD4A 3LV3B 3MRLB 4CRPA 4Q9QL 4NO5B 3U6RA 4U6HB 3WXVL 4YHML 5INCA 1EV2E 4QGTA 1P7KA 2R4SH 3V5HB 2CLVA 2DQUL 3C9NB 3KYNA 4YX2L 1A21A 1N6VA 4WHDA 3PWVB 1J12A 1YN6A 2V17H 4UV4H 3LEVH 3ZO0A 4AIZA 5E8PB 3VFOA 3BISA 3VXRB 2NPLX 5FYJE 3PGDA 2HT3D 4LLQB 3VFPB 4N0UB 3KPRB 3V4PH 2EH8H 4NZTH 3CFIC 4Y19D 4NKDB 1UENA 2FBOJ 3ECBB 3JTTA 4Y19E 5IBUG 5JZ7C 3L7EA 5E00B 2YD6A 5D6CB 1KEMH 2ID5A 3QZWB 4LASL 5B22A 5KTEH 5DUMH 4ZNCD 2UYLA 3I2CH 5FOBB 7CGTA 5DI8B 2X4PB 2BHZA 4KJWD 1BQSA 1NBZB 1U8OB 2F53A 4URTB 3L3JB 4OCMC 4OUUB 1UXWB 3FFCD 2NZ9C 1S7QB 3KPPB 43C9B 4LEOB 1J8HD 5EBLA 1EGJH 1AJ7H 1FZOA 4XP5H 3B2VH 3I75A 2OR9L 4X4YB 5T3XD 1DUZB 4C56D 5IFHH 1WV7T 1SM3H 4U3XA 1DLFH 4N8CL 4PYGA 4RDQF 2QLVB 2EXYC 1H3VA 4C56E 4GH7B 5DJ6B 4J3SA 4HXBL 3RWCA 1I8IA 2OYPA 2B20A 5E9DE 3S37L 3TA3A 1F13A 4E5XB 3UP1A 4HIEA 5HYSG 2VXTL 3BSZH 3K4DA 4N5EC 4H5SA 2YPKB 5J13C 1TCMA 3LD8C 4OD3H 1XGPB 1S3KH 4JFXA 4XCFH 2PTUA 3G5XB 3FRPG 1KC5H 3VXOB 3FQUA 3O2DH 1NCNA 2HJLB 3DJ9A 4YK4B 4KJQD 2EO1A 4XI5C 3QRFM 4GAGL 1YEGL 4A6YH 4K71B 3V0WL 4X8XA 1JF5A 5C9JA 3UYRL 4JZNA 4KI5D 5JXAL 5GJTL 1XH3A 4JFDE 4PBXA 3VDCA 3QUMA 3QDJE 4KAQH 4Y1AB 4ZAKD 5C6WH 1J8HA 3S88L 4KZEH 2HYMA 4HUUB 1V8HA 5D2LA 2Q86B 4X98A 3VXPB 3MV9A 3OX8A 3D6GA 3QJFA 5IMOA 2Z35B 4FQHA 4UTAL 1KEGL 4IOIA 5L7XH 4UV4L 2I07A 3LEVL 4YHIB 1FDLL 3QEUA 4W6WB 4Z77B 3BN3B 3VJ6A 5EUOF 4J4PD 3P11L 3QZWG 4JPVH 1S9YA 4KROB 1ZHNA 3V4PL 5L8JB 2CLRA 2EH8L 4R7NB 3OBAA 4NHCL 1SQ2N 3MLRL 5F3BA 4U1HA 5FECB 3BPLC 1QSVA 1XR8B 3TT1H 2VDMH 5K9KB 3FHQA 2AABH 3FQRB 4R7DB 1Q94A 1GSMA 3V0VB 1LEIA 2JKXA 1CR9L 4JRXB 3X14A 1SJEA 5AD0B 3UTTD 1SY6A 3KDMB 4ODTL 2EC9U 2NXZC 4PBVC 1XGTA 3LQZA 1T1XB 4JDZA 5L2KA 1EUTA 4NJAH 8FABB 4QRPE 3VFVB 3WUWA 4BFEA 3WKML 5DC9B 5HGGS 5IFHL 5C0IA 1M71A 4X4ME 5DHYA 1T5XB 1NCUA 2BSSA 1OTSD 4MJ5A 3MRPB 4MQXC 4QTIH 4TULH 5F7NC 4L3EB 5EFIB 4KGLA 1CZ8H 4M3KB 1KTRL 1UT9A 4ODUA 1QO3B 1T5WB 3NVQA 1FV1B 3QPQD 5GIRA 1R5WB 1UYWH 4NO0D 3UTSD 4D0CB 3ARBD 4L9LC 3BD3A 3VXUA 5E99L 2PYEE 3GMQA 2JELL 3HB3D 2G9HB 3PWJB 4BFGA 5FKAA 3TO4A 1WFNA 1WZKA 5FB8B 4H1LA 4MAYC 1AHWA 1CVSC 4KVCL 5F3HB 4HJGB 3O2DL 4BKLA 5DS8A 2KKQA 3UTTA 4A6YL 4DOHE 1J1XH 2PO6D 2H6PA 4CMHB 1RSFA 3BEWB 4TPRL 2J88L 4NNXB 2GTZB 1AGCB 2Z0BA 1YUHB 4WI9A 4F3FA 3DUUA 1GC1L 4LSSL 5CJ8A 4NKIH 1VFOA 3S4SB 3Q6GH 5BXFB 4QOKE 3RTQC 3QUXD 2V7HA 3VXTB 5D70H 1RJLA 1GGCH 1HHHA 2AXHA 4NQUA 1VCAA 3CVHB 2Z91B 1HNGA 1SJHB 1YEJH 2VR4A 3MLZL 1JPFB 1AE6L 3HUJE 2GQHA 4AH2A 5I30L 4JQVA 3GHEH 3O45A 5I15H 5TQ0H 1QFUH 4K8RH 2OL3H 3OF6D 4IRZL 3SDAC 2VDML 4M3JA 2PN5A 2AABL 1U3YA 3HG1E 3CCHA 2A73B 4L1DA 3GJFB 5D4QA 2PO6A 4L29B 1ZVSB 4XAKD 2CXGA 3ZE1F 1CE6B 4JFED 5KS9E 1CGUA 1ND0B 5ANME 4G7VL 2I60H 3CMOL 2EXWC 2X70B 4HX1A 4JAMB 4QNPF 3ZHDA 4PGDB 4OGXH 3MLPA 4LCUB 2RCSL 3QJHB 2FWOA 4GRWH 1MSPA 2D7NA 4HH9B 3O3DA 3L7FB 4O2EA 1UM4H 2LFGA 4HK0A 1R5IA 5DGQA 1S8DA 1QEWB 2KBGA 4JFPB 3U48A 3NTCH 1Q9OA 3QUXA 1CXIA 2K7QA 1M4KA 1QUNA 4JFYB 1URLA 1MFDL 5DWUL 3FZUC 3MO1A 4AEHH 1IGMH 3L5JA 4DKAA 4PJAB 3ULUD 5CEZH 5KSAB 1DCLA 3S8WA 4G8GA 1FZKB 3KGRA 1Q9WB 1WZLA 1MPAH 4X5XA 3CFDB 1NFIA 5AWNH 5JIPA 3BPOC 4RMVA 3WFBH 1OQXA 1I8LC 1KLUB 3C5JA 4Z0XB 4KDWA 5DMIH 3RGVA 1UM5H 4X83A 4ZFOL 4PB0H 5I71B 3C60C 3H7BA 3SY0A 5FV2A 2E27H 8CGTA 1PG7W 3ME0A 2W0KA 4NQCD 5IF0A 4JFEA 3WHXA 4POZC 3HN3A 3BZFB 2EIDA 5F7KC 3V6FB 4GKNA 1WFTA 3M17A 3C6LD 3CFKB 4X7EC 4F57H 4TRPH 3FO1B 3QRGL 1CFSB 2YD1A 1LK2B 2AW2A 1UWXK 3F5WB 4K8RC 2CKBB 2VQUA 4J3XA 5I1CL 5I1HH 4GUPA 4KRLB 5K9JL 1QLEH 1VPOH 4Y5YB 1D5MA 2NR6D 1W0VA 1TNNA 2BNRE 2VAAA 1TITA 4JFZL 4NYLB 1NBQA 1DN2A 4QHNA 4X6DB 1FGVH 1P7QD 2FRGP 3KPOA 4PV9A 1U8JA 3VFNA 4RFNB 4R2GC 3HZKA 2FGWH 1FIGL 4PGJA 2AJZB 1A7NL 3S96A 3QULB 1G6RH 2APTA 3DVGB 2CD0A 3QG6B 2VH5H 1JWMB 4MGXA 5I15L 1IT9L 2O5YH 4UBDC 2OL3L 4KTYA 2OI9C 3VGFA 4UTBH 4NQCA 4LVNC 4NWTL 1U92B 5GGTA 1TVBA 5DURD 3IDXL 2ZCHL 4PJFB 4LLMA 5EO0B 3FAWA 1E4KC 1DFBL 3G5ZB 2YA0A 4Q6YA 1A3QA 4FQ1L 1DQDH 5GS1B 4OCLC 3MCKB 4XC3L 2E3VA 4OGXL 4XTRC 3SDDC 2IALB 3NPSB 3ARDD 4LGPB 3RNKA 2BRQA 3GMLA 4Y2DA 3H8NA 1MHHB 3QAZC 1YJDL 1XT5A 4KKAD 1UJ3A 4MNGE 4APQC 1EERB 3DHMA 4OFYD 3ZE0F 5IVZA 2FJGB 1DLHB 2Y72A 1D9KB 4KDTC 3JWOH 4U6XB 1P7QA 2AK4B 5E4EC 5HY9B 4AEHL 5ERWB 3U0PB 3DSFH 3R1GL 3D18A 1NFDB 5LCVH 1MPAL 1JZ2A 5BRZD 2MSPA 2CIIB 3WFBL 3MFGB 4PJ7A 4LLYB 1WC7A 4HKJA 4OLYH 3INUH 4EUPB 3NCMA 3NH7L 4LSUH 1JI1A 2F8VA 5EWIH 3SJVB 1YY9D 2E27L 4Z7VA 4JM2F 3B9VA 2BNQB 3LKPB 3X11A 4Z78A 4F58L 3FT2B 3QEQD 5C3LD 3TBWA 1BQLL 4PY8J 4OCNC 4LNRA 4MB5A 5ADPH 4JG0L 3EFFB 1QBMH 4PG2A 4BQCA 3WCYA 3QDGA 1BZ9B 2HLFC 2X4OB 3ARDA 4F57L 3KG5A 3S3JA 2OP4L 2R2CA 4HMCA 4P3WA 3GK8H 4QRUA 4YO0A 1PJ9A 3CAFA 3OJDA 1L0QA 1FPTH 1NUNB 4OFYA 4RAUA 3H42L 3U4EB 3FFDB 3BGFC 3CZFA 3R06B 4RMRA 3VXRD 4E0RB 1H3GA 2C3VB 3BX7C 3P4NA 1MCHA 5AZEH 5I1LB 3BZ4B 3KPRD 4RQQA 5T33L 4KFZC 1FGVL 4KC3B 2LU4A 1IARB 1KN4L 2FX7L 4OZGE 1G6RL 4OF5A 1TPXC 4F8QA 4X6BB 2H41A 4LCCC 2VLKA 2AJ3A 4NFCA 5K9OB 2NY7L 4KK6C 1HEZA 4UTBL 2CDEB 4ODWA 3ALXA 3RWIA 3NZHH 3QEQA 3MREA 1WTLA 3JWOC 3RVTC 1Z0NA 3LV3A 1ADQA 1KBGL 3SDXF 5DD5L 1CLZL 1QRNA 3V6OA 4C58B 4C4KO 3IT8D 2OBGA 1CLYL 5D71H 3C5SA 1H5BA 3V5HA 2P5WA 3TIEA 3C9NA 3LAFA 1QZ1A 3B8YA 4EI6B 5T5NG 3PWVA 2BOCB 3FMGH