4DVRH

Crystal structure of yu2 gp120 core in complex with fab 48d and nbd-557
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
EVQLVQSGAEVKKPGATVKISCKASGYTFSDFYMYWVRQAPGKGLEWMGLIDPEDADTMYAEKFRGRVTITADTSTDTGYLELSSLRSEDTAVYYCAADPWELNAFNVWGQGTLVSVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp120
publication title Crystal Structures of HIV-1 gp120 Envelope Glycoprotein in Complex with NBD Analogues That Target the CD4-Binding Site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate yu-2)
molecule tags Immune system/transcription inhibitor
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2012-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dvrH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dvrH01
1JGVH 2DI8A 5CEZH 3LAFA 3VFUB 5FDWA 3KG5A 5TE4L 4JPWL 1MAMH 4ZODA 4Z0XB 3SDYL 4JFEA 2F8XC 1N0LA 4NM4H 1OAKL 2NNAA 5DWUH 5KSVA 3QUXB 4OZGA 1U2HA 3W39A 1F00I 4IRZH 1CDUA 3X11B 5ITBH 2CLRA 2VWEE 3FO1A 4MLIA 3RNKA 4EIGB 1WEJL 3IS1X 2XZZA 3I3DA 5HYEA 2NLJA 5HDOA 4YDLC 3LQAH 4HIXL 2E7CA 1U8PA 2AJXH 2VIRA 2VDML 2BVUA 4P23C 2I60L 4JR9H 4X5LA 3D25B 3SGEI 4JFXA 4K23L 1CD1A 4JFDB 1YY9D 4RRPA 5IB1B 5DFWH 1T22B 3C87A 4UNVA 4UOJA 3RGVD 4LNRA 4HXAH 1WZMA 1YYLL 5GGVL 2Y6SD 1XCQA 5AG9A 4M6NL 5IKCB 5F1IB 5JQ6L 2F54B 4PJXF 5HHOE 4L29B 5EBLA 1M7DA 1CDCA 1YMMA 1P6FA 1VACA 5KVDL 3D0VB 1DLFL 1R3LB 5TE7L 1KV3A 1F6LL 4IDJL 1OAUL 3INUH 1ZVSB 3BIAX 5CAYB 2XG5A 5LQBL 4EI5B 5D9SA 5BZDA 5F89A 1FZKB 2G9HB 5C71A 3CSPA 2P24A 2APTA 1FFRA 1I7RB 3NOIA 1HQ4A 2YPLD 4KK8C 2PETA 3O8XC 4G3YH 2Z31C 5B39B 4ALAL 4WUUA 3RWCB 4JDVB 5IOPA 5BV7C 5IQ9A 3ULVF 1BVLB 2ICEA 1A4KB 3BDYL 4NQCB 1FV1A 1U3YA 4OGXH 4Y5YC 1Z9MA 4N8VG 4KC3B 4C58B 2R0ZH 3TO2B 4QGTA 2W9DH 3DX8A 4X0KB 1EHNA 3CH1A 5GRJH 1ZV5A 4XMPH 5M95B 2F5AH 1J8HD 1IARB 1H5BC 4JDTH 2CDEA 1A3RL 1Q9KB 1AO7A 3NACH 3QUKA 5A1AA 3TA3B 2EEDA 4L3CB 3DECA 3MNZB 1UVQB 4LCWB 3KLDA 3HZYA 5D1ZC 1DQDH 1R3IH 2A6JA 3V4PL 2B1HL 1DUYB 1EHAA 2PW1B 3MRPB 4U6YA 3BKJH 5H2BB 1D9KC 2JK5A 5E03A 3T8XB 1IGCH 2DTSA 3UTQA 1BOGB 2W07A 3MRMB 2WQ8A 4PLKD 5GGTA 4WCYH 2IANA 1I1AD 2ATKA 2VZVA 3PWPE 4UV7H 4OB5H 1UZ6F 4B41A 5DQ9B 1UEMA 1ERNA 1NFDB 3EDEA 4NM8H 4QHKJ 3CGTA 4GMSH 2J5LC 5ALCL 3NAAL 1D5ZA 1OCWH 3G6JE 4GKOA 5MEOB 4L4VB 3SKMA 2F5BL 2VZ1A 5J6HA 4JM2A 4TYUA 2QQKH 3G5VA 5SX4H 2VYRE 3WNPA 4CMMA 4O00A 1CG9B 6CGTA 5DSCB 4HWEH 4AL8H 4EUPG 5DLMH 4DK6A 2YZ1A 4HJJH 5H8DA 3T0EC 1UA6H 1S5IH 1JGLL 2P5EE 2JCCE 3PDOB 3FFCA 5EC2A 2XN9E 2AJYH 4K71B 1JZ7A 3P3YA 1KPRA 1FH5L 2PYEA 2OI9C 1S7RA 3QFJB 1DBBH 1YNTA 5HYIA 3TBYA 4WTXA 4GAJL 4BSWA 2DI7A 5I1LA 2XA8H 3GSUB 5JOEA 3FMGL 3KS0J 5IEKA 1OTSD 1XGTA 3V6FA 4HGWB 5HYJB 4MYWB 4MAUH 3Q3GA 4LSRH 3QCVH 3SE3C 2X4RB 4JPIB 3THMH 1MFCH 4MNGA 3TIEB 4NQSA 4F33A 4OZFG 3BQUC 2V17H 4GUPB 3TF7C 4WJ5B 3U4EA 3PWLB 1Q72H 1WBXA 3MV9D 3LV3B 3M8OL 1XF5A 1X4XA 1WIUA 4MD0A 4MA7H 2R0LL 4LSUL 4B7LA 2WP3O 2DD8H 2R2BA 5IUSA 3U0WH 5EUOE 1Q9LB 5FKAA 1XH3B 1P5UA 1S7XA 1YN7A 4HUNB 1T04A 4MB5A 5FCUH 5I1CL 4OLWL 1F3JB 5EO0A 4QXGH 4G6AD 4P2RB 3RIFK 1ZA6B 4K7PY 2A0LC 3GHBH 1QQDB 3LEYL 3SDXF 1CICC 4G80A 5HTSA 1JGVL 2EYRA 2GFBA 5CEZL 4OM0H 4GBXA 4LKXA 3O8XA 5I75B 1MAML 1ZT7B 5D6CA 4QRTB 35C8H 2OK0H 4HC1H 4NM4L 5IVXA 5C08A 5DWUL 2VOTA 4YFLF 4NRXB 1IQDA 2DQJH 4IRZL 3ULVH 2OBGA 4IMKA 5ITBL 4K8RC 2IPTH 2HFFA 1P7KA 1CDIA 3BKYH 1T0MB 4NO3A 3LQAL 1L6XA 2W91A 1J1XH 5SV3A 1C08A 1LK2B 4KK6D 3UX9B 2ADJB 2AJXL 2XKNA 5KSBA 1IEAA 2FGWH 4JR9L 3VFTB 1FSKB 2ZSVA 4G8EA 1EV2E 1BD2E 4ELKA 1VGKB 4JFFE 1OGAB 2GHWB 5D7JC 2ARWA 2FH6A 4F3FA 4LCIH 3IT8D 4NWUH 2VAAA 1KXVC 4HXAL 3CX2A 5TH2B 1I8IA 4KI5C 3VFNA 1U0QA 1FP5A 2BC4B 2AK4B 3BUYA 4DVRH 2E8ZA 1WJ3A 4HWUA 5C0CB 3TLRA 2I26N 2V9QA 4M7ZC 3VWKC 5SX4I 3BZEB 1CIDA 2X4OA 3INUL 5HDBE 3RFZC 4WWKB 4APQB 5F6IB 5CHNA 3KJ4B 5T5NG 3JWNC 5I74B 1SY6H 2RB8A 2OL3B 3T3ME 5E8EB 4O9HH 3CC5A 2ORBH 3UBXA 4NQXB 4G3YL 3DXAD 3HR6A 1BF2A 1REIA 1S7TA 1T7ZA 3FB8A 3NMEA 3T0EA 5C0ND 3DARA 2VZSA 4YDVA 3VXSE 1EGJH 5MHSD 4JY4A 3TNNB 2OSLB 4NSKB 4OGXL 1DQJB 3KYAA 1QA9A 2R0ZL 4MXQC 4HV8B 2W9DL 5J12B 1F4AA 5DJCB 1MOEA 5GRJL 4XMPL 1AD9A 1H8NA 2F5AL 4LU5H 3WN5B 1NLDH 2B4CC 2OMNA 4JDTL 2H32H 5F71A 3HHRB 1RY7B 3BPNC 4JFPB 4HX1B 4JRXA 3RQ3A 3NACL 3QO0A 5F3HA 1U8KA 5EDXA 1OGTA 5CFHA 3H8NA 5KN5B 4D8PB 3CAFA 3S3PA 3ES6B 4HUVA 1DQDL 1R3IL 1CFBA 3DUHA 3BAEH 1AKJB 4OD1H 3BKJL 5I1KH 4XBPA 5F9AC 1ONQA 1IGCL 5HHQA 3SPVB 3RWGB 4TULH 3TZVA 4OZ4B 4JFHE 1I7UB 4LLYA 4WCYL 4XX1G 2ZCLH 2DN7A 2VZ3A 4UV7L 4OB5L 1Y6KR 3EJZD 1S3KH 1NGYB 3NFPB 4NM8L 1BFSA 3FQNB 3SDDD 5EWIH 4GMSL 4JFEE 2R1WB 3MRNA 2O5ZH 1KIRB 3VXUD 1OCWL 2NY3C 1CL7H 1SJHA 2ICWJ 4HK0A 4LIQH 1Q94B 2QQKL 5FYJH 5D2NA 3BJ91 5D5MA 5TDPB 5L2KD 4WO4C 4BUGA 3ZE0E 4MJ2A 4HWEL 4AL8L 1A3QA 5DLML 2PXYA 5DJ2A 1YY9C 4HJJL 1JWMA 1PQZA 1UA6L 4NKOA 5DMIH 2ENYA 4QRPB 1S5IL 4S1QH 3GMOB 3G04A 3IJHB 2HFEB 1SMOA 3X13B 3PV6A 2AJYL 1U41A 3AS1A 2Y6SC 4JZJA 2HJFB 2EXWD 5J8OA 5C07D 1NMCC 2YD9A 1YY8B 1DBBL 3W5NA 3SE4C 1C12B 3GNMH 3IDJB 5CIPH 2FR4B 2XA8L 2P8LA 2NY5H 4R90H 1ZLWH 3LSOB 4NCC2 2MQ0A 4NQDB 3TO4B 4BKLA 1FL3B 3PJSB 4MAUL 1YMME 4LSRL 3QCVL 5I18H 3THML 2E6JA 1GC1H 1MFCL 1PFCA 4K07A 4O51A 3ULUD 4RFNC 4L3ED 4XGZB 4BH8A 2XOTA 2V17L 3V7AG 5KZCD 4X6BB 1FPTH 2VR4A 1Q72L 5DD6B 3T4AB 5IB4A 5HYFA 3BZ4A 4JFQA 3QJFA 4MA7L 3GUTA 2UUDK 5HYQA 4P57B 4S0SD 1DVFD 3B3IA 2DD8L 4UQ3B 3U0WL 3VWKA 1FO0B 4LOUD 3EBAA 3DYMA 3O9WB 3I3EA 5DJXB 3W9EB 4Q0XH 5FCUL 3S8WA 2V2TB 4JFFD 4QXGL 2HKHH 2BMKB 1HNGA 4O2FA 3GHBL 4WUUE 2IPUG 4NFBA 4OCWH 4JANB 4AQOA 4YBQD 1WZ1H 2Q7YA 4OCXH 5C8JB 5F7FA 4OM0L 5AG8A 2KQMA 3LPWA 3T65B 35C8L 2OK0L 4L4JA 4HC1L 1E4KC 2BSSB 5FYJU 4QHKI 1HDMB 1BBJB 3GSRA 1AO7E 5ICYA 2DQJL 1UXWA 4U3XA 3ULVL 1SVCP 2X1PA 2IPTL 1JZ5A 3M17B 5D7IF 3G5ZA 3BKYL 4L8DB 3ZZ1A 2Y23A 1YJDC 2WINB 3FRPG 4PLKC 3ZKXC 4UIMA 1G0XA 2BNQA 3CIQA 4FQHB 3BESR 4PTTA 1J1XL 2HT4D 1FNFA 5BRZB 1I1YB 3BE1H 3OB8A 3ALXA 4NFDA 1XF4A 2FGWL 4HJ0C 3MJ8B 4J3SA 4ZYKA 3LKNB 3VXSD 2M26A 5EUKB 1MQKH 3T0VA 4Z7VB 5HVGB 2ILLA 4LHUB 2IANE 4OCNC 4CN6A 1KTLB 4U1HB 5IMOB 3K8KA 1QRNA 4LCIL 1WWWX 2DQHH 1URLA 1WIOA 4M3KB 2AJSH 4NWUL 2HN7A 1K85A 2C3VA 3QNYB 2O93L 1DQQA 3EDJA 3GJFH 1GGCH 1KTDA 3V6ZA 4UAOC 1CL7I 4M43H 4QGYA 4DVRL 4M1CD 3DX6A 2O5XH 4MA3B 5JLZB 1CI5A 1FNEA 2GW5A 3C60C 3S4SB 2RIKA 3LEXB 4P49A 4XHQA 2ESVD 3JVGA 1K5NA 3REVA 1FVCB 2R23B 4EI6B 4W4OA 5D1QD 3BD3A 4MAYB 1QLFB 4MNHA 1SY6L 4WENB 5F7LB 3FFCE 3EDFA 3U36A 5E5UB 5BW7C 3TN0B 4X7DC 4O9HL 3F6LA 5I8EA 2ORBL 2PYEE 1CDHA 3ARPA 4OF8A 5CKGA 2G2RA 4NBYB 4EIZC 1S7QA 3KNBA 5IMKA 2LABA 3G6JF 4YR6A 1EGJL 2LU7A 1F6AB 3QDJA 5DGRA 1S7UB 4P4KD 1FGVH 5TGBA 1QPXA 1DLHB 1UXSB 1F58H 4MNGE 3K81A 5KANG 5KS9A 4LU5L 1YPZB 5DMYA 2VL5B 1NLDL 2NW3B 3ZDXE 1RJCA 2JCCF 3GMRA 3TIDB 4MVBD 1JNHB 3RL2A 1OP3K 2E27H 4LVHC 1ZLUH 4P2OC 3BAEL 3F7YB 5I19H 4OD1L 2D31B 3DGCR 5I1KL 1HOCB 5ESAA 2VAJA 4R0LA 4TULL 4TN9A 3ZKMD 1BAFH 2ZCLL 3CFEB 3FB7B 1IGTB 1MLCB 1S3KL 4OI9A 4EXPX 3KWWA 4I3RH 2WK2A 3EFFB 4Q97A 1BJ8A 5EWIL 5I9QC 3DJ9A 1QYGH 1IM9D 2O5ZL 2Z91A 4ZOBA 5C08E 4G6KH 3RVWD 4JZNA 3RWEA 5T1LD 1KIQA 1CL7L 4LIQL 2FJHA 2EIZB 5EUOF 4KK6C 1U58B 5KAQG 4MMXC 5FYJL 2FJFA 3MRFB 3QFDA 3HPLB 5EOTA 2Z8VC 3FQWB 5TQ0H 2VABB 1AGEB 1E4KA 4WEUD 5C9KA 5DMIL 3DI3B 1A7OH 1OPGH 4S1QL 2Q86B 4EZMA 3QEQA 5F7DB 3ZE1E 5JIPA 4P46C 4PRPB 5KSBE 5DRNA 3BRFA 1F11A 5F88A 1E27B 5DJZA 1WWAX 4YO0A 4F2MA 2M2DA 3RAJH 1SQ2N 3GNML 1FIEA 1RJYB 1PX4A 1KSRA 2NY5L 1NC2A 2BNRD 2IH3A 3SKNB 4R90L 2AXFA 1NDMA 5DHYB 4JQXA 3DTXB 4OFVA 1U3HA 3HRZA 4O2EB 2ZUQB 3H3KA 4WI3A 5C0RH 1S9WB 5I18L 1GC1L 3VRIA 4JREC 1I1FB 4PJDA 3TBVA 4G9DA 4TQEH 4NHUB 2DIJA 3CDFA 1FPTL 5J6GB 4BQ8A 1CIUA 4K3EH 3UZQA 4P3DA 4XWOC 4ETQA 1TQBC 3LH2H 5KSUA 1KGCD 5C0NC 4JCMA 1Y0LA 4GRMA 3SE8H 1AGFA 1YMHA 4S1SH 4Q0XL 5KSAA 2HKHL 3T0EE 2IEPA 3QIUC 4C56D 2AJVH 1I9EA 5M94B 4S1DC 2HVKA 4OCWL 1QSZA 3IDGA 2D0FA 3KPRB 1WZ1L 4HZLA 4OCXL 5CZXC 4YGVA 5CEXB 1K4CB 3V0VA 4X4YB 2GT9A 1MY7A 5HDBF 3FN0H 2QR0B 2ZOLA 3L5HA 1GGTA 3L95B 1OD7A 5CSGA 3HC3H 5CJ8A 4PJCF 3BH8A 3QCTH 1KCLA 2D0HA 3O6MH 4ZFZA 4JRXE 3T4YA 3T3MF 1MVUB 4MA8H 1UQSA 1VCAA 4BK4A 4UNUA 5MEQA 2ICWI 2HP4A 2EKSB 3HG1D 4Q9CA 4Y4KA 3FFCD 3KHOA 3S5LG 2YPVH 2BSRA 2ITDB 3NN8B 1QSEB 4P48A 1UWEH 2HFGH 1AIFB 4JDZB 4X5WB 3EJZC 3BE1L 4P9MH 1QBAA 1YUHA 3SDDC 1MQKL 3B8SA 1FJ1A 5K9KB 4I2XB 4P2OA 3RVVD 3L3HA 4KRPC 4MNQA 2FLRT 3QPXH 4GKSA 4WW1A 2A2QT 4C59B 3EHBC 1W0WB 1A4JB 4Y19A 2DQHL 3MMEB 3CFIC 2AJSL 3GRWH 5E1AA 1BX2A 4PJFA 2BK8A 1GGCL 1S78D 1MHCB 4M43L 3HC4H 4FFVC 2DQCH 1SJEA 3WNKA 1RHHA 2IAMA 4L8SA 5D2NE 5D5ME 5JPNB 1U8LA 2O5XL 4KGJA 1XGUA 5C0DB 4GFTB 5EG6C 1ORSA 4ODTH 4GXVH 2A6DA 1ACYH 2X42A 5INCA 2P7TA 4ZOCA 1GGYA 4NFCA 2N4IA 3FOLB 2FX8H 4MDIB 5I1JH 5DJDB 2G75B 4CN4A 4NUJB 1M7IB 3OB0H 3KPPB 1IC7H 3ULUC 2EDKA 2FATH 5DK2B 2X4NB 4P46A 2IGFH 2W60B 3FCTA 4YHPA 1FGVL 1HHGA 5ICXA 3ZE0F 1F58L 1DVFC 1EZVY 1YEFH 5HGGS 2O61B 3HZMB 4LOUC 1DE4A 1QBBA 1U8HA 5F7WC 1FYTD 1G9EA 2NXZB 2GSIA 4ZSOA 3BP5A 2E27L 1CFNA 2HJKB 1RSFA 3MBEB 2P45B 3QDMA 5I19L 1A9EB 1PDKA 4YBQC 1NUDA 4OAWA 4MQTB 4B0MM 5E9DD 5I17B 1ZGLB 1D5BA 1LO0H 5D7LA 4I18C 5GPRA 3DURA 5E0QA 1AI1H 1ZHNB 3VD7A 4Y2DA 5FYLE 1BAFL 1XZ0B 3L9RA 4BM7A 4MDJA 4YHYC 4D0BA 4I3RL 1A8JH 3ZT5A 4J2XA 1CGYA 3Q6FA 3QUZD 4U6HA 4HIHA 1QYGL 2FGZA 4G6KL 1L6ZA 5BZWA 2NY1C 5HYSA 3CVHH 4NQEA 1JPGB 4F37F 3C5ZC 4K7FB 1TJGH 4HS3B 1A6AB 5TQ0L 3EUUA 2BNQE 1C8PA 2FWOA 4PJHA 3AGVA 1A7OL 1OPGL 1YNLH 3WS3A 3TGXA 2F74A 3B5HA 5H37H 4J12A 3UTTB 2DQUH 4IOSD 4M1GH 4KJQC 4KJPD 2FO4A 5F3BA 1QZ1A 4MQ7B 4R4BA 3HC0A 1NC4B 5T1KB 3RAJL 1ZT1B 1QRNE 2C3WA 4J3OC 4IIQB 4PRIB 4GRWB 2GAZA 1T1WA 3KPQB 4TUOB 4XNUH 5C0BD 1BLNA 5IB5B 3AXLA 1D5IH 5KG9B 5HHME 1NUFA 1M4KA 5C0RL 5HI5C 5D1QC 4U1GC 1LEKB 5DJ8B 4Y4FB 1CF8H 1U8QA 4TQEL 4AH2B 3IKCA 2WBWB 5E7FA 2J7LA 5ACMA 4K3EL 4M1DH 1UKSA 4W6XB 3OF6A 3NIFE 3LH2L 2FB4H 5HDQH 3SE8L 4S1SL 4QTHA 1NEZG 1XR8A 5HPMB 2FX9H 3L3OB 4UB0H 3T09A 3RY4A 5GGSA 2AJVL 4AJ0A 4GW1B 2Q20A 1MFEH 2F53E 3QDJE 4JM2F 1N7MH 5CD5D 4NKDB 1CDYA 2ARJB 4LPWA 5JOFA 1MCNA 1PAMA 3LD8B 3FN0L 2Q3ZA 1CXEA 2VQ1B 3IVKB 4XWGH 5JPMA 3HC3L 4RGNE 5KS9E 4M8QB 3QCTL 3O6ML 2DKUA 4Y5VB 3NH7H 3BDXA 2BCKB 4MA8L 1WFNA 2PXYD 3RUGA 4YK4C 4YDJA 3TYFA 5DEZA 1Z5LA 4R4NC 4U1IA 1RZGA 1JTTA 1C7SA 2YPVL 2WLZA 4RRPG 5ACLA 1AH1A 1SYVB 2CUHA 5F9JA 4XZUB 1UWEL 2HFGL 5EU5A 4WNQB 1KB9K 5C0AA 4OCSH 2LTQB 5DD0H 1WV7T 5I76A 3DRTB 1FFOB 4P9ML 3MRKB 4U0QB 3CFDB 3BW9B 1TVHA 3VFMB 3W2DH 1BPVA 2W0PA 5IFAH 1IJ9A 3QPXL 4RZCB 5GZOC 2MHAA 1IEBB 2G5BA 3ZDXF 5J57B 4HWZB 3RL1A 3GRWL 5SWQA 1EEQA 1N8ZB 1X5ZA 1XEDA 2XFXA 1XIWB 4DZ8B 3HC4L 4DKFH 2DQCL 3QA3A 3TH3T 3N0PB 3P73A 3D18B 3WEXA 1D5MB 5IB3B 4M03A 4ODTL 3S36X 4GXVL 1U8MB 5FXCH 1ACYL 4Y4HD 3TT3H 1I3GH 3S37H 5IESH 1J0IA 3GMPB 1KULA 3QEQE 3VXRA 3LVEA 2Y25A 2FX8L 5I1JL 3B2UC 4NPYA 5I8CA 2Z93A 3HI5H 1IC7L 5KVEH 1T0NB 3CFJB 2FATL 3PHSA 4KKLD 1T83C 4X5XA 1P9MA 2IGFL 3ROOB 3BMWA 2WZPD 5DD5H 3MO1B 4X7TB 4XCNA 3RTQA 3C9NB 2V7HB 4C4KO 5JZ7C 3HE7B 1EIBA 1F4HA 4PJDE 2XACC 1YEFL 2VLMD 3AS2A 5FCSH 3OKKA 3KYMA 5FEBA 1JK8B 5I1DB 3DROB 4MCYB 2DKMA 5KSBF 3DUSB 1KG0A 4GKNB 1N3NB 5D96B 1T5WA 3GMQA 1LEGA 3N06B 4LLVB 1A7PH 3D39A 4Y5XB 1XGPA 5EOCJ 1H3PH 4PIRF 2ATPB 3RI5K 4PB0H 1D5XB 3RVUC 4YUEH 2R0KH 3KXFA 3P9MA 4HUKB 1LO0L 1QR4A 4KKCC 4WFED 5CBEA 1R3HA 4EDXA 3WDHA 4X6EB 4D94A 4NRYB 1AI1L 4DGVH 3R06A 3LKSB 1G9NH 5GGTH 4XBGB 1P1ZB 2MJWA 3O3AB 1A0QH 2WW8A 3SDAA 2Z35B 2DLFH 3DIFA 3U82B 3O6LH 4P5TA 2NX5B 4PJAB 3TA3C 1VFAA 3MRJA 4ODWA 4PGJA 3CVHL 5EBMB 1XCTB 1FFQA 3ZSTA 3HI1B 5FM5M 3MA7A 1L7IH 4K3JH 5GRUH 3RWHB 1TJGL 5F1NB 5EZOH 3BDBA 1CTOA 4GW5B 3RVVC 4Z9KB 3DETD 4NC0B 1YNLL 2VNCA 1K8IB 3MRDA 2AV1A 1DQTA 3LMJH 3DHMA 3ZHKA 4ACPA 2DQUL 4M1GL 4WEBH 3O2DA 5B38B 1PEZA 1S78C 1WIPA 4NCC1 2MFNA 5IHUH 1KT2A 4ZAKB 2AXGA 4Y19E 3FQRA 1LP9A 1IMHC 4XNUL 3MRRA 4PJFE 4RGND 5EO1B 1LEIB 1IKNA 3B5TA 1G7HB 1D5IL 1RZJC 3VFUA 3VWJD 3QWOB 2FNBA 5DUMH 1UJ3B 1H0DB 2MNUA 2BVTA 5DHXB 3BI9X 3NABH 3UP1A 2DQDH 1BWWA 3QUXA 1CF8L 3GMLB 2VQTA 4POZC 5HPOA 3OKMB 4OUOA 4M1DL 1SVZA 3M1BA 1INQB 3MUGB 2NW2B 3C6LD 2FB4L 3QIWA 3GJEB 5GZND 3WJJC 3VFVB 3P4OB 3F7PC 3OQ3B 5HDQL 3E3QE 2FX9L 3JTTA 3Q5OA 4RAUB 1W8OA 2DI9A 4UB0L 3D25A 2X4UB 4JFDA 3I84A 5IB1A 4KKAC 1MFEL 3UAJD 1N7ML 1CGVA 1JJUA 5D5MF 2GYSA 4Y16A 2VMFA 1U91B 3ARDD 4P4RB 2WUCH 4XWGL 4L4TB 1QFPA 5B4MC 1D6EA 1EUTA 1AY1H 1DCLA 3NH7L 4IRSB 3BEWB 4UV4H 4ZSOE 2DBLH 2F15A 3QEQD 4EI5A 1HHJB 1MHHB 3CLFH 2AEPH 3QDME 3UPAA 2PW2B 1FZKA 2G9HA 3VH8A 2HT2D 4OIAA 4OCSL 4N5UA 5DD0L 1I7RA 1L4IA 3QUZC 5DJ0A 5IJKC 1KYOJ 3W2DL 5D1XB 2COQA 4YNYA 2YUXA 5IFAL 5IFHH 3MJ6A 3CU7A 4OM1H 5SWSD 3WUZA 3VXNB 5BJTB 3EO0B 3N1FC 2ADFH 4NQCA 4KI5F 3W0WB 2EIEA 2OZ4A 2AQ2A 4RAHA 4X0KA 5DK3A 4L8CB 4LK4A 4D0DB 1B0GB 5I15H 1JPST 4DKFL 4FA8A 3QRGH 1MHPH 1JRHI 4AIZA 1XMWA 2BHUA 3CSYB 1ZS8A 4DUVA 4FOMA 3TA3A 1E28A 4L3CA 3ULSA 3TT3L 2CMRH 3WE6A 3N1QC 4LCWA 1I3GL 3MROB 4MD5B 3S37L 5IESL 1YA5A 1G7MB 1A1MB 1DUYA 1NGWB 1JMXA 4OI7A 2PW1A 3MRPA 4I48A 5H2BA 3DHJA 2D4FA 3VE0B 3T8XA 5EOCH 4M61B 1G7LB 3O11B 4M7LH 4WY7H 1BOGA 2ZUTA 3HI5L 3UROR 1RURH 5E00B 2W0FB 3MRMA 1OF2B 5KVEL 1FNHA 1HNFA 3WO3B 5JDSB 3LN4B 2VB5A 4XPHH 4NOFA 1AGDB 4OZIB 5DQ9A 5DD5L 5F1SA 1NUGA 4WWKC 4APQC 3KJ4C 4XHJD 5MEOA 4L4VA 3KPSA 2V2XB 5I8KH 4JE4B 3C8KA 2QSCH 4Y4KD 4N5ED 5E5MA 5I74C 1M7XA 2Y72A 3VCLA 1CG9A 4C83A 5EFIB 4LBEA 4NHCH 4XVUC 2V2WB 1A7PL 1T1YB 3ARWA 4POYA 1H3PL 4QRRD 4WU5B 1II4E 5CD5C 4X4ME 4PB0L 3PDOA 5DRXB 4YUEL 2R0KL 3RZCD 4MNQD 4FRWA 3UXFA 1UH2A 3OWEA 4Y19D 4DGVL 5FAAA 1G9NL 1EJ6A 5GGTL 5J12C 3QFJA 1TTFA 1FG9C 1OTTC 4E41D 3OR6B 3ARVA 3WN5C 3DVGA 2XKSA 2DLFL 5ID1B 2WWKT 3UTSE 3O6LL 4LLMA 1JGEB 3WO4C 3KLHC 3MUJA 4HGWA 5HYJA 4CL7A 3HFMH 2A6KB 5I6XC 1DL7H 5BVPH 2W9LA 3NIFF 2X4RA 5C0EA 4JPIA 1MCPH 3RUGE 1ND0B 3TP4A 3TIEA 1EHLH 4WIQA 1VSCA 2A38A 4GUPA 2FL5B 1L7IL 4K3JL 4WJ5A 1MEXH 5GRUL 1F90H 5EZOL 3TPUA 3WFCH 2NY6B 1QO3A 3LV3A 3VA6A 5CCKH 3EFDH 3BIKB 2HG5A 5C0AE 2FRGP 1Q9LA 4M7LT 3LMJL 1XH3A 2XQBH 3UCRA 3FJTA 5CZVH 4XVSH 4WEBL 4P2RA 2UZYB 3PIQA 2RAMA 1ZA6A 3G5XB 5DC9B 5IHUL 4ZFOB 1VKXA 4WFGE 3DVIA 4U0RB 5I1AB 4E5XB 3V6OA 3I3BA 2EYTA 3BOVA 1TVDA 5EIQA 5DUML 4Y4HC 3LRSA 4QRTA 2L0DA 3NABL 2CRYA 2DQDL 4WFFD 3MJ7B 2J8UA 4JRYA 1IC4H 4NRXA 1RZKH 3RKDC 3AB0B 4NCDA 5CSBA 5ILTH 2KZ1B 4HK3J 2A83B 1T0MA 3B9KB 1CDGA 3VXRE 5D7LD 2G5RA 3CCHB 4UQ2B 5FUCC 5LG1A 4KUZH 1KN2H 4KKLC 3PE9A 5CINH 4H8WC 5EU7E 2UZIH 1LK2A 1HE7A 4DZBB 3LPGA 3VFOB 2OX5A 3VFTA 1U95A 2W1NA 4KH2A 3QG7H 2JB5H 1VGKA 1OGAA 4RDQG 3VI4E 1HQRB 2ZG2A 1QNZH 1JYXA 5FYLH 2NXYD 1CDBA 4X4XA 5HXMA 2WUCL 3VXQB 1S9VB 3PDDA 4NQED 4D2NA 4K3HA 4AIXA 1AY1L 4WU7B 5C0CA 4M93C 1RZ7H 3TFKD 1QBMH 1P7QD 4UV4L 1BQHG 4F57H 3O9WC 4RMSA 5DMGD 2VXTH 2DBLL 3GB7B 1WC7B 3D39E 3CLFL 4LVEA 2AEPL 2PYFB 3VXMA 3DWTA 2B4CH 4M7KH 3KVQA 4LLAA 4FQQB 2OL3A 3KXFE 3TCLB 5E8EA 3BH9B 2FCBA 4B7IA 1LD9B 4NQXA 1ZLVK 4JG0H 1X4YA 5ELIA 5IFHL 3PWVB 4OM1L 3STBA 1EEYB 3W82A 2VXQH 3QJHB 2ADFL 2OSLA 2ZZUT 1R24B 4MLSA 4FMKA 3KYKH 3IFPB 1FZJB 4HUWB 4P0DA 5E2JA 4HV8A 5ESQB 1IL1B 3MV8B 5DJCA 5I15L 3ISWA 3QRGL 4HSQA 1BIHA 1MHPL 3S88H 4BQ9A 5IW1B 2E3VA 4IS6B 4J1UB 2ITCA 5A2LH 4ZXBB 4F8TA 1P53A 3MR9B 1VPOH 4B50A 3TBSB 5KN5A 5GRXG 4D8PA 2CMRL 2NZ9C 3WUWB 3EOYG 1AKJA 1SYSA 4OZHE 1DEDA 3R4DA 4XB7A 5EOCL 3VWJC 1U8NA 4M7LL 3SPVA 4WY7L 4C55A 5B21A 4OTXH 4BQ6A 1RURL 3I02A 2VLJD 4OZ4A 1I7UA 1LP9E 1M6OB 1JNLH 4XPHL 4UINH 1RK1A 2UV3A 5HGBB 4Z78B 2EKJA 3NFPA 1RU9H 1YN6B 2HAZA 1KJVB 3RX8A 4KK5D 3NFNB 5GZNC 3D3VD 3SDCD 1KIRA 1Y18B 3KPMA 3WLWD 5F8QC 5I8KL 2QSCL 1Q94A 1O7VA 2PO6D 3VFRA 2XYCA 2VTFA 5ADOH 5TDPA 1C5DB 3TN0C 1RD6A 3MACH 2Z8WC 1G7QB 4KK9D 3BP6B 4QHUB 3H3PH 2C3XA 3AROA 4HKJA 4NHCL 3PG2A 2H2PD 1UT9A 3WXVH 1KB9J 4HJGA 4ONHB 3GMOA 3RWIB 4PJFF 1C7TA 3QQ4B 3ARDC 3JXAA 1H15B 2HJFA 4JFDE 4WFGD 2YMXH 3L7EB 5AD0B 1ZT4A 2WWKO 4Q6IB 1YY8A 1X4ZA 2AEQH 5DD3H 5DI8B 2FR4A 5CEYA 3HMWH 3OTTA 1AXTH 3KYNA 1L0YA 4NQDA 3TO4A 3HLAB 1J0JA 2F54E 1HYSD 4HMDA 3HFML 3PJSA 1DL7L 5BVPL 1I9IH 1ZWIB 3WFHB 1MCPL 4XGZA 2HT2C 1EHLL 3U30C 1KUMA 5K9QG 3TVMB 1J0KA 5J11B 3JV0A 3F12A 1MEXL 1F90L 1S5HB 3WFCL 5DD6A 3V0WH 5DFVC 3FB5B 4P57A 5CCKL 4H0HB 3EFDL 4KWUA 5FM5O 3U9UB 4UQ3A 1JYWA 2XQBL 3FOMB 5DJXA 3W9EA 5CZVL 3SJVB 4XVSL 2V2TA 5DEGB 3DMMB 4TNWF 1MHEB 5GXBB 2BVPB 2BY2A 5FYKE 1AHWA 3AREB 2JKXA 2VRAA 2MQCA 3BMVA 4JANA 4JKMA 4NQCE 4PGDA 3HZVB 5C8JA 3QUYD 3KHQA 3T65A 1NCDH 1BFVH 5DS8B 2IALA 2BSSA 4FHBD 4PJ7B 4XNMB 4F7EB 1NCWH 4FZEH 3LQZA 4PP2B 1HDMA 1IC4L 1RZKL 3ZTJG 4FFYH 5ILTL 3RKPA 2DQFB 4AT6A 3M17A 4LCWE 4L8DA 4X6DB 4U3HA 2WINA 4N0FB 2KPNA 1OW0A 4KJYB 4G6FB 5E8DH 4GH7B 4JKLA 3D69A 4FQHA 1KN2L 4KUZL 2P44B 2R29H 5CINL 5EN2B 2UZIL 5BRZA 1I1YA 3X12A 5FM8A 4ZUTB 4JEGB 5EUKA 1OHQA 4XI5D 3SDAD 5KW9H 3QG7L 2JB5L 1CVSC 4NZJA 4PY8I 2ZUQC 4XHJC 4U1HA 5BXFB 1OY3B 1QNZL 4OFYA 1OAXH 5FYLL 3TYGH 3PABA 1TXKA 3JWOC 4V1DA 1NFDE 5JIKA 3G08A 3C5JB 2EE3A 3QNYA 2JTDA 2VUOA 1FNLA 4O2CA 1CCZA 4HKBA 4L4VE 3VXOB 4KUCF 2JJVA 3HZKB 3KPSE 5F8RC 3ZHLA 4PB9H 1RZ7L 5INDA 1QBML 2F8VA 4LLWB 4F57L 4MA3A 3RZCC 5JLZA 2VXTL 1MJUH 5GS0D 5EBGA 3CU1A 3LEXA 3S4SA 3KYOB 4OD2B 3O81A 1FCGA 3MZTA 1NBZB 3CFBB 3MGOA 3MLPA 1FVCA 2R23A 4EI6A 2B4CL 4M7KL 3K3QA 4MAYA 1QLFA 3U83A 1S9XB 2Q6WB 2C1PA 5ITFB 2GQHA 4BELD 4JG0L 2Y36H 3AVEA 4NWTH 3QFJE 2OJZH 4Z76B 1KCKA 2VXQL 1F6AA 4FQ2H 1RZIB 2QBWA 3KYKL 5HYJE 3QEHB 4YH6A 5FGRA 2VL4A 1DLHA 2ED7A 4MS8D 2ZOKB 4LDLB 1EVTC 2DB8A 3TNMA 3S88L 1YPZA 4HD9A 2VL5A 4H88H 3QEUB 3QIWD 3TIDA 1FIGH 2FBJH 3CH8A 1PKQB 3F5WB 1A3LH 1JNHA 1VPOL 4M7JH 2GTWA 3H9SB 5JIIA 4FFWD 1FAIH 3FQUA 4MWFA 4AENB 1RIHH 4ODXB 4J4PD 3E0GA 5DC4B 3F7YA 5DJ6B 2D31A 4IJ3C 4U2YA 3IJYA 1G7IB 1HOCA 1PY9A 2J12B 4P2RE 3QWRA 2BVEA 1KLGB 4KROB 5CSZB 3IF1B 1XGYH 1VADB 4OTXL 3ELAT 4WI5A 4Y16D 3TBWA 1AC0A 2FEEI 1JNLL 3RUGF 4UINL 3V6OE 1IGTA 1MLCA 4MJIB 4RGMB 5FKPB 4KPHH 1RU9L 5EU4A 3AM8A 4GKZB 4I0KA 1JYNA 4QKXB 3WDIA 3QULB 3MV7B 4JRYE 2Y5TB 2W65B 3N85H 1OAQH 4I4WA 4XTRD 5BVJB 3D2UD 1U58A 5ADOL 3MRFA 4QNPE 1QSFA 3MACL 5J0BA 3H3PL 3FQWA 3C8HA 4YXHH 4NKIH 2VABA 1AGEA 3WXVL 1WZKA 3EZJB 1R3JB 2FIRT 2NXYC 2X9XA 1G6RB 5IWLA 5F7DA 1CD9B 1Z2KA 4LGSB 5FYKD 4A2MA 5BS0D 1C16B 4PG9B 1N5AB 2YMXL 4PGBB 1GOHA 4YHMH 1OGAE 1JV5B 3EO1A 3TFKC 3O4LB 2AEQL 1PZ5A 2NY4D 4LMQI 4MQXD 5DD3L 1RJYA 3HMWL 3SKNA 1HCFX 1AXTL 4WW2B 3FL7A 3VXTA 5C92A 1UKTA 4PBWD 2NXZC 3U7YH 3DTXA 2AK4E 1Q38A 1I9IL 4S11A 5C0CE 1T5XA 1UWXK 4KHXH 1S9WA 3ARFA 1WITA 2P5WA 5IEHA 2RGSA 1I1FA 4R7NB 4NHUA 3WIFB 4P9HC 4TVSa 1IE5A 1NCNA 3S35H 3V0WL 3DUUB 1NCTA 3VXME 2EIBA 2Q3AA 1ODAA 3VI4F 3ESUF 4LPTA 2LVEA 2Q76B 1K4DB 5CLWA 4CW1B 4H25A 1F02I 4N0RA 1MNUH 3IDUA 3QXAA 1UKQA 4OLUH 2NY2D 3KPRA 2Z31B 2FEEL 3ARQA 3QI9A 2BHYA 3MJ9A 4N8VB 1K4CA 2JIXD 2D9QB 1HILA 2CXGA 3IB4A 4PBXA 4X4YA 5CEXA 2QR0A 3KPSD 5BV7B 3MYZA 3L95A 4G43A 1NCDL 1BFVL 3IFLH 3X14B 4LEOB 1NCWL 4FZEL 3PQYD 5L9DH 3RVXC 4X9IA 3P77B 4FFYL 2R1XA 3T04D 2D9CA 2YD7A 1P7HL 2QHLA 2FZ3B 1OOAA 2H45A 3D85D 2X44D 4YXKH 2CLZB 4JO4H 1NFKA 4WGVB 5E8DL 1F4WH 3NN8A 1QSEA 3O3DA 1EMTH 2R29L 4JDZA 4IIQC 4X5WA 2GJZA 1A6VH 3IRPX 3GSVB 3QPQC 4X80H 2A74B 4KK5C 4NNPH 5SX5K 4RIRB 4JPVH 1D9KB 4HKXB 5KW9L 5K9KA 3SDCC 4I2XA 5E1HB 3E2HC 5EU3A 4LF3B 1CZ8H 3WLWC 1OAXL 3NPSB 3T2PA 3TYGL 4RX4A 2PO6C 1A4JA 4Y4FC 2VSDA 3MMEA 1IGMH 2VLKB 4Y88A 3ALPA 2CSPA 1MHCA 3QIBB 4OSUH 1CLYH 3QXTA 4PB9L 1FQ9C 1MCLA 4U31A 3RIFF 4OZHF 3UDWA 5JPNA 4YWGH 1OSPH 2X1XR 1IBGH 4XB8A 5C0DA 1MJUL 1NGXA 4UU9B 4EUPB 3ZO0A 1MFAH 4WV1B 5IF0A 1LP9F 2OR9H 1BGXH 2XTJD 2X89D 3EKCA 3F65A 1JF6A 4MDIA 1HYSC 5DJDA 1G0YR 2DLHA 4S2SA 5IROA 2Y36L 4NWTL 2G75A 3MRCA 5ERWA 2B1AH 4NUJA 1M7IA 3KPPA 2OJZL 4Q2ZA 5DK2A 4FQ2L 2OI9B 4NQDE 4NC1C 2W60A 5DXWA 3T2NH 4FQLH 4WHTB 1IILE 3B8YA 4JRYD 3UTZB 4ELMB 4U1KB 5CKAA 4ZMAT 3EOAA 3WDJA 4PV9B 4H88L 4XVJH 4OZFB 1P84J 2WUBH 1FIGL 2FBJL 2Z92A 3QUMH 1A3LL 2E9WA 4G8FB 4LP4A 4M7JL 3GBLA 1GZPA 3WJLC 1FAIL 5FHBH 3MBEA 1RIHL 1A9EA 3B9VA 3GMNA 4J3XA 1MCRA 5I17A 1ZGLA 4DKEH 4FTVB 1KLUB 2VE6B 3QUYC 1YDPA 4U4BA 1T6WA 1XGYL 4OGYH 1XIWC 1AR2A 1ZHNA 4NQTA 1NMBH 1TZGH 4PJBB 1XZ0A 2YWZA 5DRZA 4JGUA 3FRUB 3Q5YA 2IC2A 3MLYH 1X5XA 5TDNB 2C4FU 1A7RH 1JWUA 4IRJB 4KPHL 3VRLE 5JUEH 4PRHB 1WSST 2DF3A 1CICB 4RBPK 3P4MB 4JQIH 4J8RB 4PFEA 4UILH 4NZUH 2FIKB 1OAQL 3N85L 5F93C 2EXYD 4LCUB 3VXMD 5FB8A 3DVNA 1PGRB 3I50H 5E2WH 5C9JA 4K7FA 2C7UA 3OG6B 4YXHL 4NKIL 3VGAC 4HS3A 1A6AA 2Q7NA 2XXCB 5BRZE 2BP3A 3EIFA 4GQPH 1T89A 2R2EB 4PJ9B 3UTTA 2GJ6B 4HUXB 1ZVHA 2XT1B 3X17A 2Z4QA 5T33H 1I9RH 4WDIB 4YHML 4MQ7A 1KPVA 3S96B 5D71H 4LLQB 5T1KA 4LRIA 1CK0H 1ZT1A 5D7JB 5IB5A 2PCPB 5KG9A 3U7YL 4PJ5B 5D96C 5FOBA 4ZUUB 4KHXL 3DVFA 4NDMB 1CTNA 1LEKA 5DJ8A 4Y4FA 4AH2A 4K94C 2YWYA 3SKJH 5MEPB 3BZDA 3S35L 4F9LA 4DOHB 3V4VH 3RHWK 4DUWA 5F72S 1L0QA 2XKUA 3LKOB 2DM7A 5I16B 3L7FB 1NFDF 5HPMA 5DQJA 5MENB 4U05A 4CAGA 3L3OA 4JQVA 1MNUL 5C6TH 4WTZG 5JXAH 4OLUL 1NANI 4YZFF 4NKDA 3V5DB 4FN0A 1RUAH 3FT3B 2MKLC 2VQ1A 3OGCB 3IVKA 3CFCH 5IMMB 4MJ5A 4NN6C 1A1NB 3IFLL 5CJXA 1YPZE 2QQNH 3OXSB 4J4PC 5IIEA 1T7VA 5CJBA 4XCCH 4Y5VA 5L9DL 2BCKA 1FL5B 3CVIH 4KDWA 3QHTC 4YXKL 4JO4L 2GCYB 5HJ3A 2XY2A 1F4WL 5TF0A 1SYVA 4ZAKC 4XZUA 1EMTL 1MI5B 3QDGA 4WNQA 4HPOH 1A6VL 1Q0XH 4I13B 1FFOA 3MRKA 1G1YA 4X80L 3BW9A 4NNPL 4NO5B 4JPVL 5EO9B 1I3UA 1CZ8L 1HHHB 3UTPD 1IEBA 4PBVC 3E8UH 5JMRA 1IGML 4ZS6C 4MB4A 1N8ZA 3N9GH 1XIWA 3O41B 2FSEA 4OSUL 1W72B 1M71B 1CLYL 1HH9B 3VH8G 3SGJC 1T2XA 1KB5B 4YWGL 3D18A 1QSFE 1OSPL 1IBGL 1D5MA 3HAEG 4HPYH 2BY0A 4XP4H 5FGSA 2EC9U 1MFAL 2GY7B 1FCCA 3B6SA 3RIAK 3DGGB 2NY4C 2OR9L 5ACZB 1BGXL 1YEHH 2V9RA 2HA1A 5DVKA 5J9PB 3BSZH 2RCSH 3RGVB 1S8DB 2B1AL 2AEIT 1G9MH 2DMKA 5FYKH 5CEZE 3VGHA 3ROOA 1NMCB 3IYLW 4IRSC 2QADD 3DPBA 3T2NL 4FQLL 2OZ4H 2QEJA 4X7TA 2BRQA 3C9NA 4TVPE 2V7NB 3HE7A 3SDXA 2P5WE 1IVLA 4XVJL 5E2TH 1PKOA 5E08H 4BYHA 5I1DA 2WUBL 3DROA 4MCYA 4XCEB 2H6PB 2R2HB 1MJJA 3QUML 4GKNA 1N3NA 3LPFA 5FHBL 4LLVA 4Y5XA 4PP1D 4ZOEA 3UMTA 2YPLB 4PLOB 4NIKB 3K4DA 1D5XA 3EDKA 4I9WD 4WI4A 5T3ZE 4DKEL 4X6EA 3QR2A 4OGYL 4CMHB 1O0VA 5CIPA 4V1DD 5TPWH 3FT4B 2XA3A 3LKSA 3UYRH 5JW3H 4XBGA 1NMBL 1P1ZA 1TZGL 3C2AH 3KPRE 1UH4A 5HHNB 3MJGX 5B3JF 3MFGB 3MLYL 1INDH 2Z35A 1J8HB 1A7RL 5EOQH 5JUEL 2NX5A 4PJAA 4LCCC 2CH8A 4JQIL 4UILL 4NZUL 1F3DJ 5DUBB 5EBMA 1XCTA 3BP4B 1U2CA 1RZJH 3GSQB 3CZFB 3HI1A 4OJFH 4CVUA 3I50L 5E2WL 4V2BA 4XCFH 4AK1A 1QSEE 2AEWA 1CXHA 1PJ9A 1K8IA 2HRPH 3MZGB 4UUJB 2P42B 1L9NA 5J1AA 2B20A 4H5SB 1ZA3A 3SOBH 1I1AB 3P9WB 3FZUD 5FYKU 5T33L 3U46B 3S3SA 5B38A 1I9RL 3D87B 4I2XE 5D71L 2AP2A 1CK0L 5FUOH 3LDBC 4F7TA 4JRWA 4UDUA 5EO1A 1LEIA 4BH7B 1G7HA 2FD6H 3K0WA 3C6SB 1UJ3A 1T3FB 4L9LA 1H0DA 1T1ZB 5E5RB 5GIRB 4PR5B 3NCMA 3GMLA 4UAOB 3SKJL 3OKMA 5GHWH 4JHZA 3UPCA 4N0CD 4QF1B 4UBDD 5FGBA 4LEXH 3V4VL 1KBGH 2NW2A 3GJEA 3VFVA 2NY0D 3P4OA 3MREB 2SEBB 1S7VB 1UACH 4X7EC 3QDHA 1PZUB 3WS6C 5C6TL 1MCOH 3MNVB 5DZLA 5JXAL 1AGCA 4ODUB 4XXCC 4NO0A 3E6HB 2ZJSH 4JCLA 5H94A 1RUAL 1U91A 2NTFB 3PXJA 3CFCL 4L4TA 3ZYJA 5CJOH 4LP5A 4O02H 2GJJA 5C0IB 1YC7A 3FAXA 2QQNL 1QSFD 2QHRH 1QKZH 1BWMA 3MV9B 3CDYA 4XCCL 5K59E 4EQ2A 3BEWA 3O6FD 3FONB 4RA0C 3CVIL 3O3EA 5K9JH 5FO7B 5T1DH 4YIQB 2OR7A 4RFEB 1HHJA 1MHHA 3IU3A 3CX5J 4HS6B 1D7FA 1WVZA 1DANU 1OM3H 1DANT 2IF7A 4W6WB 4HPOL 4FXKB 1Q0XL 2JB6B 5DJYB 2OJEB 5CEZD 2R9HD 4JKKA 5D1XA 5TF1H 3P0YH 3IJSB 3MLSH 1F6FB 4HIJA 5DJAB 2EXYC 5BJTA 5JW5B 3E8UL 1MRFH 3ARRA 3ARFD 3AB0C 2P5WD 1FVDB 3N9GL 2X1WL 5IB2B 4GLRI 3GIZH 4D0DA 5D72H 3B9KC 2H1PH 4MXWH 1BFOB 3CSYA 3D6GA 4HFWA 3K2UH 3R8BB 4HPYL 2HLAA 4LGRB 4CKVX 4XP4L 3SE9H 3MLTA 3ORJA 1UZ8A 1YEDA 1IAII 4YHZH 2VO5A 4XP9H 1MCQA 1UENA 1WBZB 5KBNC 1G7MA 1A1MA 1A6PA 2OL3H 3UTTE 1YEHL 3QCUH 1JF1B 2BVYA 4XCYB 3VRLF 4M61A 1ZLWK 2YD4A 1G7LA 3O11A 3BSZL 2RCSL 3BN9D 2AJ3B 4JKPH 1G9ML 5E00A 2W0FA 5FYKL 1OF2A 4PRIE 1ZHLB 4GRWE 1ZE3C 2UVFA 1AGDA 4UT9H 4OZIA 1QTYT 2OZ4L 1AXSA 5HHOA 2AI0H 4TSCH 1M05B 5CJ5A 3ARXA 3WFBH 5FA3B 4XAWH 4X6FB 5JHDA 2YXMA 2V2XA 5E2TL 1ZHBA 5JTWA 5E08L 1MFBH 2APWA 2ICCA 3EYVB 4JREB 4OGZA 3NCFB 4Z7VF 5EFIA 1F3DH 1RAMA 3MRHB 1T1YA 4K55A 1ORQB 2EO9A 3LQMA 5EZLB 1ES0A 3DXAB 3WHXB 3L5WB 3DBXB 4IOFD 2WQRA 1KTRL 1B0RB 4CADB 5E6ID 5D7IA 5DRXA 1MCWM 1XAUA 4ZOAA 5CGMA 4XAKD 5TPWL 4W4NA 3UYRL 5JW3L 4GG6B 4NNXB 1BIIB 1A2YB 3C2AL 2AKRB 2CK2A 2R56H 3O4OB 1INDL 2Q1EA 4QOKD 5TDOB 5ID1A 5EOQL 3NCCB 3GSOB 1KNOB 3VGBA 3WS6A 1NDGB 2A6KA 5IVNA 3ARGA 4XXCA 5DYOB 2ZWLT 4NC1E 1ND0A 2HT3D 3B9DA 3WFDH 1RZJL 4OJFL 4R8WH 2FL5A 4U1NB 3AC0A 3S5LB 1S7WA 3PWUA 2YZ8A 1OB1A 4XCFL 4JJ5B 3QDGE 3BIKA 5DF0A 4YE4H 2HRPL 1NCUA 4DEPB 2XZCH 3CSBA 3SOBL 4JLRB 1GJIA 4PJ8D 1Y6MR 3QZWG 4OF6A 3BRGC 3P9LB 5F1OB 3GJFK 3FQTB 1YPZF 5ANMA 3GKWH 4X9GA 5FUOL 3SDDB 4H8WH 4N8CH 3BVNA 2CJUH 1NQBA 3VXUB 1NCAH 3QHFH 4E5XA 3HE6D 2FD6L 5FO9B 3RWDA 1S9KC 3MLXH 2HKFH 2MPAH 3P4LA 5L2KB 3HCVB 3MJ7A 2IBBA 1GOFA 5GHWL 2D7OA 1HXMA 3OKOB 4NC2B 4OLEA 4LEXL 1KBGL 5DDHB 1NBYB 4Q6IC 3CCHA 4UQ2A 5JA8B 4J6RH 5FO8A 5C07B 5DFTA 2AQ1A 2YA2A 5C0JB 1UACL 2FHCA 2X70B 1MCOL 2I24N 1U9KA 1HQRA 1RVFH 1WF5A 5EPMA 3FQXB 3H9HB 4FQXA 2ZJSL 4OFDA 3OZ9H 4PD4J 5B8CA 3EJYD 4L3EB 1S9VA 2GY5A 3SDXE 5CJOL 1HSAA 4O02L 1LE9B 5KZCB 4RWYH 2QHRL 1QKZL 4N9GB 4FZ8H 3N1MC 4F7MA 2FHFA 3OAZH 1ZLUK 3PGCB 5C09A 4ORGB 1DVFB 5K9JL 3HI6H 2EZ0D 5T1DL 2CKBB 1T6VN 3DMMC 3GB7A 1WC7A 3Q1SH 4LDOB 3SGDH 4H26A 4JAMA 5CBAB 2PYFA 4JFFB 4U3CA 3AREC 3I75B 5ENWB 1OM3L 4CVXB 2QKIA 5T3XE 4GRLD 1J9CT 4FQQA 1OQOA 2XWJB 2ZNWA 3TCLA 3A67H 3MRGA 1HWGB 3TT1H 1PSKH 2DYPA 2EDRA 1AD0B 1EO7A 2QSVA 3VFSA 3G9VA 1FZOB 3P0YL 5TF1L 3PWVA 3MLSL 5D8JH 5BMFH 2X4QA 3S37X 2B7DT 1Q9WB 3QJHA 5DA4A 1MRFL 2NX5E 3ULVD 1D3CA 4PJAE 3BXNA 4GSDH 3PWNB 2X9WA 4YHYB 5C2BH 2LU4A 3GIZL 5ESQA 1KJ2B 1IL1A 3MV8A 1EAJA 3NFSH 5D72L 2H1PL 3LS5H 4MXWL 3MNWB 4PLJC 4DKDC 2CDFB 1UH3A 5IW1A 4K7PH 2UWEB 3K2UL 3OXRB 4ZXBA 3MR9A 4Q7DA 2BVOB 4X8JB 3SE9L 3TBSA 4YHZL 4XP9L 2ZSWA 3WUWA 3B5GA 1CE1H 1TZHB 3VXSB 4AZ8A 2OL3L 3P2TA 3QCUL 4D9QE 1X5GA 1RJLB 1DDHB 1I7ZB 2EICA 2VKXA 3IDNB 4JKPL 4MJ6B 1A6TB 3VGGA 1M6OA 2GIYA 4LHQB 1CGWA 1VFMA 4UT9L 5HGBA 2OTUA 2QL1A 2AI0L 4TSCL 1YN6A 3LHPH 1KJVA 3WFBL 4UBDC 5F7MC 3NFNA 5KJRH 5E70A 4XAWL 4O4YH 2NY0C 1Y18A 2F9BT 1PVHA 2ESVB 2DJUA 5IFJA 1FG2B 4DUXA 5JW4R 1MFBL 4JY5H 1GZQA 4EEEA 5D1QB 1A47A 1C5DA 4PJCA 4U1GB 1G7QA 3BP6A 4ZUWB 3QDGD 3GI9H 4RAVA 1EPFA 4G8GD 3V5KA 1EXUB 4ONHA 3DLQR 1CVRA 1NEZB 2AABH 1CFSB 3RWIA 2N7AA 1X44A 1H15A 4POUB 3L7EA 5AD0A 4P4KB 3IGAB 4OZGB 1X5KA 1GAFH 4WHYH 3W39B 2R56L 3O6FC 5GRZA 4Y8AA 4YHOH 2CLRB 3T3PE 4L4TE 3HLAA 1AP2B 4R2GD 5EU6A 2A73B 2NLJB 3WBDA 1BQSA 1J1PH 4HHAA 3FHAA 4OIBA 3WFHA 4HAFA 2D7TH 4MJ4A 1U8PB 1JCKA 3WFDL 3TVMA 4R8WL 3SGDI 1V3KA 2R9HC 1RHFA 1S5HA 1CD1B 2H9GB 5JXEA 4YK4B 1ROWA 5A40E 4OUUB 3FB5A 1X5HA 2B5IC 3WKNA 4YE4L 4DWHA 2WP3T 1FC2D 3SGKC 4HH9B 3X3FH 1MI5D 2XZCL 4LNRB 3SCMD 1IFHH 3WNLA 2CDGB 1MHEA 1OAYH 4ZFGH 1M7DB 2BVPA 2CIKA 1IC5H 1VACB 1YNKH 3GKWL 1N4XH 3HS0B 2VDLH 4H8WL 4N8CL 5K59F 5I66A 2DOCA 1IM9B 2CJUL 4PGEB 1NCAL 3QHFL 32C2B 5T1LB 5FYJD 3HZVA 1VGEH 5BZDB 5F89B 2HKFL 2MPAL 3MLXL 3RI5F 1ZGLM 4TVPH 5DS8A 3MLUH 1CBVH 3AU1B 5E94B 4XNMA 4PJ7A 1ZSDB 3EDDA 4CVWA 1IAKB 2FX7H 4F7EA 2P24B 4PP2A 1PX3A 4KDTA 1I85A 1T7YA 2DQFA 3GZKA 3OPZH 1MUJB 2YBRB 4X6DA 4N0FA 2FHBA 4KJYA 3F7RA 3EYQD 5IQ9B 3OB0K 4J6RL 5EC1A 5EN2A 1ZMYA 1VEMA 4L8BB 4WW2C 3IRZA 1T2JA 4XH2A 5GGRY 4C57C 2EDFA 5T1MA 3BZFB 5T3ZH 2N1KA 3DX8B 4ZUTA 2BNRB 3CH1B 2I07B 3BWUC 1UADC 5AAWA 3CZJA 5DRWB 2V5MA 1RVFL 1JHTB 5BXFA 2CD0A 4OZIE 3L3GB 3QUKB 2VQUA 3MJ9H 3OZ9L 3C5JA 5ID0B 1V7MH 4DJMA 5JHDE 3OKLA 2DLIA 3HZYB 2A6JB 1DUZA 4RWYL 3VXOA 3HZKA 2VN7A 4FZ8L 4IOFC 5E6IC 2BSTA 3JWDH 3UTQB 3HI6L 4NO2B 3NIDE 5SWZA 4OD2A 3Q1SL 1GCFA 1NBZA 3CFBA 3OKNA 1MFDH 4JO3H 5J4MA 4GRWF 2XWBB 5D7IE 2WWMD 4C56B 1MIEH 2KL6A 3HR5B 3A67L 1S9XA 2Q6WA 3IDYC 3TT1L 2D7NA 1PSKL 1T1XA 5EULV 1FHGA 1D5ZB 3T77B 5D8JL 4Z76A 5BMFL 4QO1A 4ZS7H 3A0OA 2YD3A 1RZIA 2F19H 1WT5C 3N1GC 4CMMB 4GSDL 3QEHA 4F15C 5C2BL 1J88A 5FUZH 1ZKAA 4YC2C 2ZOKA 3NFSL 4HAGA 3HG1B 3LS5L 1TCRB 4Z95H 3QEUA 5EC2B 3FFCB 4K7PL 2E7LC 1NAMB 1TENA 1PKQA 4PJ8C 2Z9TA 1KPRB 4OV6F 4G9FA 3V7MA 3H9SA 4P2QA 4AM0B 3P0GB 4AENA 1YNTB 4ODXA 3TBYB 4KFZC 1CE1L 5GS2H 5DJ6A 2IQ9H 3PL6D 2GK0B 3NPSC 1RPQA 1G7IA 5IEKB 1XGTB 4M00A 1KLGA 4LRNH 4NO0D 5CSZA 3P30H 3IF1A 5ANME 3RJDA 4TSAH 4U7MA 3AY4C 3QIBC 3U2SA 4NQSB 4GT7A 4MJIA 4YFEA 5C1MB 2IBGA 3LHPL 5KJRL 5DMKB 4MD0B 4GKZA 2KUTA 3WL9A 4O4YL 4QXTA 3V9FA 3KPOB 3MV7A 3MGAA 1N64H 2Y5TA 4WV1C 2W65A 4XRCB 1S7XB 5BVJA 4JY5L 4A6YB 4XT1C 1S9YA 3GI9L 4IDLA 4PRDA 4NBXB 2VXSH 2OLDA 2E9JA 1QRKA 3V5HB 1GH7A 4G80B 3ILQC 2EYRB 1IGFH 2AQ3A 2AABL 1C16A 3QDAA 4PG9A 1N5AA 3NA9H 4WI2A 2KBGA 1BQUA 5IVXB 1JV5A 4P23A 4EKXA 1GAFL 3O4LA 2EDXA 4YHOL 3NCYS 2EZ0C 1AE6H 3G6AA 1FYTB 1J1PL 5JR1H 2E9IA 3SY0A 3FO0H 4P5MB 4GRLC 2D7TL 3LKQB 5C09E 4R7NA 4WWID 3V0AC 2AV7A 1J11A 4UTAH 1CD0A 1OQXA 4I0PD 1MH5A 1MCEA 3DUUA 3T0DA 4C54A 5E9DB 1KCSH 3RWFB 3T2OA 3X3FL 4UMGA 2Q76A 1K4DA 4DGIH 1I8IB 2XIDA 1NJ9A 1QACA 4CW1A 1IFHL 4IRJC 2EIDA 4L3AA 1OAYL 4ZFGL 3BUYB 1IC5L 3ARYA 1YNKL 5HHOD 1N4XL 2VDLL 3QUZB 3K4ZA 4GRWH 2Z31A 1BFTA 5JHDD 2Z8SA 4N8VA 1VGEL 2K7PA 4PV8A 2X7LA 5IBLC 1QBLH 3MV8E 1CFQA 4TVPL 4N90E 4FS0A 2A9NH 4M02A 4Y5YA 3MLUL 4LEOA 3X14A 1CBVL 1QFWM 3ZL4H 2FX7L 5BQ7B 2BJMH 4EXKA 2ED8A 4BSVB 1FN4B 3P77A 4PJ9C 4HCRA 3CC5B 4NYLB 1BZ7B 1H5BA 2FZ3A 3OPZL 1QHOA 4NJ9H 5CP3A 2CLZA 4YDVB 2BXZA 4JY4B 4YAQB 4M6MH 4X98A 2EE6A 1JP5A 5D1ZA 1DN2A 3GSVA 4R9HA 4PJAF 5T3ZL 3TJHD 1J87A 1FYHB 3H7LA 5C0BB 1D9KA 4HKXA 4PRNA 4LF3A 3R0NA 4ODHH 4FXGB 1CXIA 3ARGD 3MJ9L 3QO0B 3MRQB 5F3HB 5IJVB 1TTGA 1V7ML 4YDIH 4IOIB 1FFNB 3QIBA 3ZDZE 1OP5K 4WI6A 1CGUA 4Z77A 1A21A 5L8LB 3RVTD 4PJCE 4X83A 4Y7MA 4L9DA 3STLA 3JWDL 5HHQB 1A5FH 1UG9A 4UU9A 2P8PB 3I6LE 3TZVB 1MFDL 4LLYB 4JO3L 3GBMH 5AZEH 4B5EA 4WV1A 4TTDD 1MIEL 3PWPD 1NPUA 3VFGH 4R2GC 5F7YC 3MRNB 3BUTA 3WV0A 4AEHH 2BZDA 1BOYA 2VR9A 4ZS7L 1A14H 2AW2A 2BY1A 5EA0H 4CJ0A 4FFZH 2F19L 1V3LA 4PJGB 4KAQH 5EU6E 3TCXA 1MAKA 4WHTA 4U1MA 5FUZL 3UTZA 2PXYB 4BA8A 4ELMA 4U1KA 5CP7B 4KMQA 1PQZB 2I9LB 4PJIB 5DHVB 3ZMRA 3WO4B 4Z95L 4PV9A 5GGRB 3G04B 1MVFA 4OZFA 5I6XB 3FN3A 5JOPE 4FQJH 1C1EH 1T4KB 2P5ED 3SE3A 3HMXA 3IAPA 4JZJB 3SCMC 2XN9D 4G8FA 3AAZB 4JHAH 3BQUA 1H3TA 2C26A 4GW4A 3VG9B 2IQ9L 1B4RA 3MRLB 2HTKD 2WBKA 3U48A 4H1LA 5FF6A 2DQTH 3T3PF 2VE6A 4LRNL 1K3ZA 4YHNB 1P2CB 3RDTD 3P30L 2UVEA 4FQXD 4Y1AA 1TJIH 1XGRB 4TSAL 4O51B 2HMID 2Q87A 1U8OB 3UC0H 3IETB 4PJBA 4U1SB 3FRUA 5TDNA 4U1JB 2VKWA 4ZUSB 1CXLA 3QJFB 5H35B 5HD8D 2Y9RT 1CICA 2XV6B 3I6KB 5FM4A 5C09D 5HYQB 1JTPA 4PJ7E 3WIIH 1AQKH 1VA9A 3EYQC 1HI6B 4J8RA 1N64L 4Y4HB 2FIKA 2OR8A 5AYQA 2HJLA 4QRSB 4NN5B 4X6DE 1R5IB 1ULVA 3OX8B 3O45B 4O2FB 4LCYA 3RGVC 1KOAA 2VXSL 5FOJA 3H7BA 1GC1C 2DYPD 3QISA 2Q7YB 4K94H 5F6HJ 1GYAA 2R2EA 5T3XH 3WHE1 1IGFL 4PJ9A 2GJ6A 3U0TA 3NGBB 5F70A 3D1MC 1UB5B 1QFWH 4HXBH 4WDIA 3S96A 3NA9L 1EHXA 3CXHJ 1Z9LA 2MTPA 5HGHB 1TVBB 3NPZB 1UXWB 4M4PA 4U2ZA 3L3KA 5D7JA 2PCPA 2YUWA 1CGTA 1AE6L 2ZP0T 4UIMB 4ZUUA 5JR1L 3GGWB 2K3TA 5HDLA 2VLLB 3FO0L 4HLJA 4NDMA 1BQHB 1OLZA 2WWMC 3U1SH 1XF4B 3ZT7A 2L4OA 4ZYKB 5SWZE 5MEPA 4M93B 4UTAL 1JYVA 1Q1JH 2BERA 1JWSB 1U93B 5DR5H 1TNMA 1PW3A 4G8IA 1KCSL 2K1MA 4CMHC 1BD2D 1I3RA 4WTWA 4WHCA 4OZIF 5L2JB 3LKOA 4DGIL 5I16A 1FBIH 3L7FA 1DQQB 5MENA 1KTDB 3V6ZB 3DX6B 4RQQA 2WBJD 1T2QH 3MUHL 3FT3A 3LKRA 4M9OA 3NIDF 1K5NB 1QBLL 5IMMA 4JFOB 1A1NA 2N7BA 2A9NL 2LE9A 2VUYA 3GSWB 3ZL4L 3BRDA 2BJML 3PL6C 3I6LD 1PKQE 1KXTB 1WTGT 1FL5A 2PTVA 3OAYK 2E7MA 5J3HD 1I1AC 4G9FE 3H9SE 4NJ9L 4P2QE 1RUPH 3LY6A 2RJMA 3DYOA 5IMKB 4YR6B 5JIHA 2BVQB 4M6ML 2ICES 3MQIA 1CS6A 2IH1B 1JUFB 1LMKA 1LO5B 4GAYB 4YHKH 3C09C 3TC9A 1TIUA 2AS5M 3QB7C 2HVJB 2E6QA 4RGNB 4EN3D 5KS9B 3VWJB 5EU6D 2Y06H 3BPOB 5EO9A 3RPKA 4ODHL 2ZUWA 4MJIE 3GMRB 4ZTOH 4ORZC 2Y07H 3RL2B 3SN6N 1VFBB 4YDIL 1T7XA 3O41A 2CO6B 1N5YH 5F7EH 3MV7E 3MV11 5IGXH 1IGJA 1M71A 3D9AL 5JXED 3ARBD 4F58H 1KB5A 3C6LB 5ESAB 5TE6H 1A5FL 2JJTC 4R0LB 4YFLI 3NA4A 4OIIH 3GBML 4NN7C 4WO4A 5AZEL 4HWBA 1OTSC 1NGPH 4JFHD 4LLDB 4U7KA 3HRPA 3OHXB 3KWWB 1EDQA 1ZLVH 1QFWI 1X5JA 3CMOH 3QBTB 3VFGL 3NZHH 4HBCH 5J9PA 2VWEC 2F53A 4AEHL 4JZNB 1KIQB 4JFED 4NKQB 4DGYH 3O4LE 3ARDB 5CLTA 2GSGB 2MQ3A 1A14L 1W8NA 5EA0L 5HHVH 4FFZL 1JVKA 4KAQL 4P2CG 3SE4A 4I0PC 5HGAB 5IVZA 3ILPB 2V7NA 1UM6H 2X40A 1JGDB 3MUZ1 4M5YH 3QEQB 5F7NC 4G6AC 4FQJL 1C1EL 1W0VB 5DRNB 4XCEA 1OSZA 2H6PA 2R2HA 5CMAA 1OD9A 2WMPA 1B88A 4UI2A 5DJZB 5DT1H 4JHAL 3C5SA 3U30B 4F2MB 2LVCA 3HKFA 3WIHA 3GSNB 4JVUA 2DS4A 3UZVB 4YBHA 5E2UH 2EDBA 3W9DB 1NDMB 5LGHH 1RZ8A 5SWSB 2DQTL 4EQ3A 3ZT6A 5JW4N 3HRZB 4HEME 1B2WH 1TJIL 5DZNA 4YPGB 3VXPB 1YMMD 4PJDB 3TBVB 3UC0L 4G9DB 1AGBB 2YRLA 2E6PA 3RU8H 4YEFA 5E8OA 2YC1B 3G5YB 5AAMA 4ETQB 2DM2A 2B0SH 1Y0LB 1AQKL 3WIIL 5SWZD 2EYSA 1AGFB 5IV2B 5DVOA 4KI1A 3BP4A 1X6NA 2HH0H 3PHOB 3CZFA 3TJHC 2QLVB 3FRPA 1GRWA 4OKVA 3FO2B 1KJ3H 4BQBA 5C7XH 2P8MA 2AXHA 4WUUD 4K94L 5ALBH 4UUJA 4YGVB 5HI4D 5T3XL 2DKSA 1LE5A 2ZOLB 1KYOK 2PTUA 3U46A 1QFWL 4HXBL 3SO3C 3BH8B 3S35X 3KAAA 3LZFH 4ZFZB 4RNRB 4PRBA 2IQAA 3DI2B 1AO7D 1GSMA 5LAXA 2DL9A 2UYLB 4KZDH 5ECJE 3C6SA 4Y4KB 1ADQA 5EH1A 1WK0A 1T1ZA 2JJSC 4I3SH 5CILH 2DQGH 2BOCB 3ZYZA 3MOAH 5GIRA 4TTDC 4G9FD 4KQ3H 4P2QD 3U1SL 4R7DB 4QRRB 1Q1JL 4QF1A 5DR5L 5GSRB 3L3JB 1QLRB 5GISH 2X9YA 1A9BA 4HG4J 3RZCB 4MNQB 3C60A 4WW1B 5KOMC 2IAND 3REWB 5D6DC 3MREA 4Y19B 1DBAH 2SEBA 3O4OC 3OJDA 4QHMB 1FBIL 1S7VA 3LIZH 4E41B 1IT9H 1FVEB 1J8KA 2IPKB 5BW7A 2YD8A 3DX7A 4HLZH 3MNVA 3MTRA 1UB6A 2QV2A 5D70H 1SJEB 3ZDZF 4PJEB 4L8SB 4HIIA 2YUZA 2XPGA 1U8LB 1HXYA 1T2QL 4JM2D 3PHQA 3E6HA 4RFOH 1ORSB 2NTFA 4UT7H 1ZAGA 4ELME 4LNVA 5C0IA 3RNQB 3GSXB 3MV9A 3UYOD 3FONA 2HTKC 4DEPC 2CLVB 2PR4H 1IM3B 3RDTC 1G7PB 4X6CB 4WFHE 1RUPL 3IDIA 2PYED 3F7VB 4RFEA 3SQBA 1WISA 3FTGA 3PV7A 1ZEAH 2DQIH 4IBLT 4FXKA 1T20A 4P23D 5DJYA 2OJEA 4Y1AE 1QR1A 4YHKL 5F6HI 1JIBA 4IJ3B 5HD8C 5LXGH 3IJSA 1A6WH 4PJBE 2Y06L 2DWDA 1DE4B 5LKNA 1LNUA 5DJAA 5JW5A 2I9TA 4ZSOB 4ZTOL 4CU8A 2Y07L 2B39A 3MODH 4HZAA 5IB2A 1N5YL 5F7EL 5IGXL 4TRPH 1MCKA 1NL0H 3BWAA 4F58L 2EXWC 5TE6L 1BFOA 3IKKA 4M48H 1D5BB 3IS0X 1NUNB 5D7LB 3FO9B 2G60H 1DZBA 1O7SA 5DZOA 1V05A 4LAJH 4OIIL 3QYCA 1EFXA 3OBAA 1UM4H 1NGPL 4KVCH 3PP3K 2GJ6E 3P40A 1P4BH 5DTFA 3ZYOA 3HA0A 4M5ZH 3MX0A 3CMOL 1E4XH 4XCYA 3NZHL 4GBXD 4HBCL 3O8XD 2YK1H 2NXYB 4HIHB 3JV6A 4PTUB 3U6RA 3GFUA 4PJ7F 4DGYL 1TLKA 3LEVH 5C08D 3ZHDA 2DMBA 4NQEB 5EB9A 5HHVL 1JNJA 3S98A 4OGAD 4PJ5E 3KDMB 4X6DF 1P7QB 2AJZA 2FWOB 4PJHB 5FA3A 3WCYA 4C4KT 1UM6L 4KI5E 4YPJA 5JW4M 4M5YL 2PF6A 2F74B 1F42A 4EDWH 3EYVA 5MI0B 1KJMB 4DOHE 5DT1L 4OBRA 5D1ZD 1GVIA 4LL9A 1P4LA 5DGQA 4DK3A 2J8OA 4Z7UB 3R0MA 3WHXA 3DXAA 5E2UL 3L5WA 3DBXA 4RCAA 3VRJA 3QH3B 4CADA 1A22B 5LGHL 1ZHKA 4NQUA 5MENE 5AZ2H 1DR9A 1B2WL 4U33A 1CD8A 4GG6A 4NNXA 1BIIA 4IHOA 4MD4B 2JE8A 1JI2A 5GGUA 2AKRA 3QIUA 1EVUA 4J23A 3OR7A 5TDOA 3T0BA 3RU8L 2HTLD 5J3HC 3GSOA 1KNOA 2HT4C 1G6VK 3KR3H 3RY6C 2B0SL 5H37G 5DUPH 1K6QH 2NTSP 3EGSA 3OGOE 4QTHB 1WICA 1XR8B 2HH0L 4P59H 2ZKHH 2IADB 2CKNA 4FXLA 4U1NA 4Z7QE 5I2IB 5L88H 3RA7H 4EN3C 3T0ED 1KJ3L 3FKUS 3NCYP 5C7XL 5E8PB 5ALBL 2VLJB 1WAAA 1H3VA 4JLRA 4XMLH 4M1CC 3R1GH 5JPMB 3VA2C 4XX1E 3CNKA 3P9LA 3LZFL 1R3KA 1NEUA 2D7QA 3ARBC 3SDDA 1D6VH 4YDJB 3WHE0 3D3VB 4P5KB 3SDCB 3SBWC 4JRXD 1Z5LB 3VXUA 4G42B 3E2HB 4DKAA 1UWXH 4KZDL 5FO9A 3JV4B 1UCBH 3BP7B 2PO6B 1XF3A 4I3SL 3CPLB 5L2KA 1UEYA 5F9JB 5CILL 2DQGL 1H3GA 3HCVA 5EU5B 3MOAL 5IBUG 4KQ3L 3BQUD 5I76B 3TESA 2APXA 1TVHB 3OKOA 5GISL 3G6DH 4HUUA 3TZVD 1OP9A 4P4KC 5DDHA 1NBYA 4LASH 4X4MA 3D48R 2G5BB 4Y1AD 4CU6A 3KPNB 1DBAL 1E4XI 5C07A 5SWQB 5HVHB 3LKPB 3LIZL 5C0JA 2HYMA 5C70A 1IT9L 2LU3A 2Q8BH 7FABH 2A0LD 2VLRA 5D70L 2A77H 4ZFOL 1U6AH 3MV01 2BSED 1TZIA 4MVBC 3P73B 4ZQKA 3UTSA 3FQXA 3H9HA 4RFOL 4UT7L 1GGBH 2FO1A 3T0AA 2J3SA 3H2WA 3Q6GH 1LE9A 7CGTA 3MFFB 4N9GA 4K9EH 5ISZA 3UJTH 1UFUA 3PGCA 4W68A 4I0CC 4YXLH 2KH2B 3DYPA 4ORGA 2X4SB 1DVFA 1WLHA 2PR4L 3ZKMC 1J5OH 2CKBA 5I8CB 4PUBH 4Z7WB 3GM8A 5CBAA 4U6VH 3I75A 5ENWA 1ZEAL 4CVXA 2DQIL 5GS3A 1LILA 3TV3H 1DEEB 3EZ8A 2P46B 1E0OB 8FABA 5L8JB 3RVWC 4XCNB 1YYMH 1A7BA 1AD0A 5E4EB 1NFIB 1FZOA 5LXGL 2UY7A 4ETYA 1A6WL 4TNWK 3QUYB 3NZ8A 4I18A 3P11H 2BOBB 4WRLA 3DSFH 3WFEH 4KI5D 1PBYA 1T5WB 3K7UA 1LEGB 3MODL 3PWNA 3FFDB 4HEPG 3DO7A 1XGPB 1KJ2A 4KJWD 4TRPL 1X5YA 1NL0L 5K33A 3MNWA 1Y6NR 3QUMA 3VWKD 2CDFA 4D3CH 5HI4C 1DJSA 2FECL 4M48L 1R3HB 5E2VH 5HGDB 2G60L 4R3SB 1FL6B 4LVNB 2C3GA 3RY6A 3R06B 3CJJA 1UM4L 3BPCB 3C5ZA 1MCCA 4KVCL 1TZHA 1QFHA 5FYLD 3VGAB 3SDAB 2H26B 1EEZA 2HRLA 1P4BL 4JO1H 4ONFH 4M5ZL 1E4XL 4A2LA 5ESVB 2YK1L 3BEVA 1VFAB 1I7ZA 4KHTH 3IDNA 1DBKH 4MJ6A 1A6TA 3LEVL 2E8YA 3WNOA 5HHPB 1X7QB 4ONOA 3DRQB 3MA7B 3VI3E 2WM0A 1F2QA 4MXQD 4NP4H 2R1YB 4AEEA 1KCVH 4E0RA 3QQ3B 3PF2A 2BNQD 1WTLA 2ESVA 2GI7A 4EDWL 4YFDB 1F13A 4K3DH 3BGMB 5D1QA 1OTUD 4F7CA 5D93B 4ZUWA 1J10A 1I4FB 5C0FA 4GJTB 4PREB 1WUNT 1EXUA 2LAGB 2DQEH 2MWCA 1HZHH 3QNZB 1QRND 4JM2C 1QEWB 1CFSA 2X4PB 2V5YA 1FRGH 1JPTH 5AZ2L 5C3TA 4BZYA 5FECB 5HHMD 4P4KA 3IGAA 4ENED 4HFUH 4JZOA 4E42B 4RBPH 1YEGH 4LGPB 2VZUA 3RIAF 4X7FC 3L3IB 1AP2A 3E1F1 3M1BB 3HNTH 2A73A 3QIWB 3KR3L 1PLGH 2VDPH 2NY3D 5DUPL 5J1TC 3MV9E 1K6QL 3VD4A 4LPUA 4MSWB 3QO1B 4NN6B 1SMAA 4P59L 3JTTB 4OLXH 2AK1H 4WO4D 2ZKHL 5EIIB 5L88L 4S0TD 2H9GA 3RA7L 3WLBB 1RJZA 4MGXA 4OUUA 1RQ5A 4OZHA 4DTGH 1HEZB 1G6RH 1L7TH 2F53D 3QDJD 4HH9A 1NGZB 2DWEB 4ZO9A 4Y16B 1F4XH 4HGMA 4XMLL 3R1GL 1N59B 4ELMF 1D6EB 2CDGA 4PLNC 4P3CH 2A1WH 2A6IB 1W2KT 3BIBX 3HS0A 5DK0B 1D6VL 4U49A 1IM9A 4GS7B 4Z0XA 4PGEA 2P1YA 32C2A 43CAB 5T1LA 1UCBL 3NCJH 4GOSA 1KACB 2PNDA 3D2UB 3VH8B 1RULH 2O26U 3AU1A 5E94A 3X11A 1ZSDA 1IAKA 4YHIB 1A1OB 3HAEB 5DJ0B 4M3JA 4GBXC 1SHMA 5JO5B 1MUJA 4YNYB 2YBRA 3G6DL 4LFHD 5BS0B 2XY1A 4LASL 2ADGB 4PJBF 4L5FH 4KRLB 3P0VH 3OJ2C 1FDLH 2CR6A 1J05B 4L8BA 4IMKC 4OGAC 3BZFA 3K1DA 2NY4B 1ITCA 2Q8BL 1T22A 1NMAH 7FABL 2BNRA 2I07A 1ED3B 2A77L 1U6AL 5J06A 5DRWA 4AIZB 1JHTA 1IC1A 1ZS8B 5IKCA 3L3GA 5F1IA 2F54A 4L29A 1E28B 3ULSB 1YEIH 5BV7H 1GGBL 5ID0A 3D0VA 1T83A 5IM7B 3WE6B 1R3LA 4KKBD 1OWRM 3Q6GL 4Y8DC 3RP1A 1ZVSA 4K9EL 1BMGA 5E99H 3UJTL 4HIEB 3QXDB 1UYWH 4I48B 5DVLA 4YXLL 4HCRH 2ERJB 4NO2A 1J5OL 3MCG1 5CP3H 4OV5B 1ZK9A 2VJXA 4N1EA 4PUBL 5CGYD 3IFNH 2ZCHH 3BHBB 3DXAE 4U6VL 2V5SA 4CU7A 2XWBA 3TV3L 3S6CA 15C8H 1NC2D 4C56A 1T66D 1JZ8A 2Y5EA 3HR5A 5MHSE 4HJ0D 2HTLC 1YYML 5B39A 2W38A 3RWCA 2NY2B 4JDVA 4JVPA 1U3HD 4GG6E 5D2LB 1BVLA 2JIXB 2OS7A 1A4KA 1Z9SA 3T77A 3KPSB 1RV6X 3C8KB 5E5MB 3P11L 1SBBA 3TO2A 5GGVY 3DSFL 3WFEL 3VCLB 4C83B 3PQYB 1WBYB 5T5NF 1Q8MA 4LBEB 1BZQK 4X9FA 1Q9KA 3HG1A 3STZB 1TCRA 2DIBA 3D85B 3UBXG 4KJPC 4LCCB 4D3CL 4NOBA 5KOVC 3MNZA 1UVQA 3GI8H 5LGJB 3C60D 5KSAD 1NAMA 5E2VL 4EUPH 1MY5A 5A43C 2VDRH 1KF9B 2PN5A 3H0TB 4AM0A 3KLAB 4J3TA 3CDGB 3DVGB 1WAAE 4CRPA 2GK0A 3BPLB 4JO1L 4ONFL 1U3ZA 4LLMB 2R4RH 3U4AA 1AXIB 2EC8A 1DN0B 3K74B 3VDAA 4KHTL 2J4WH 1DBKL 2DMCA 5ETUB 5C0EB 5K93A 4V2CB 5C6WH 1NFDA 1PEWA 3VXUE 3TPUB 4NP4L 4TNVK 1QO3B 4Z7QF 3LDBB 1KCVL 5DMKA 5L2KE 3I6GB 3TZVC 4Z0BH 3BO8B 3V8CA 5IHBA 2HG5B 3KPOA 4PGCB 1KEGH 4OZFH 3V52H 4XRCA 1EA9C 5DSCA 1HINH 4K3DL 2XTLA 1G1CA 3HMXH 4H1LG 4TUKH 3PIQB 4A6YA 2YXFA 1HKFA 4RWHA 2XTJB 3IDMB 1OWWA 4N1HB 1VKXB 4P2OD 2HWZH 4PY8J 3V5HA 2DQEL 1HZHL 5C07E 1A6ZB 1SBSH 3WJJA 2EYTB 1GHFH 4H1LH 5KVMC 5D2NC 1FRGL 1JPTL 2DRUA 3L6FB 1MQ8A 2VLRE 3LRSB 1A0QL 4MXVE 2PXYC 3GSUA 4W70A 2J8UB 4HFUL 4JRYB 2IAMD 3CLEH 3VFPB 1IAOB 3ULUE 4L3EE 1YEGL 4JZJC 2YKLH 3HNTL 5E8NB 4HF5H 1GPOH 1PLGL 2C5DC 2VDPL 4XPFH 1FYTA 3HB3D 5ISZE 3DV6B 4P5MA 3VG9C 2OP4H 3LKQA 3PWLA 1SM3H 5SV4A 1EFXD 4OLXL 2AK1L 1U95B 9CGTA 4PY7B 3HPJB 3L5XH 1ACZA 5J13C 5E9DA 3OKEB 4K8RH 4DTGL 1KCUH 1F3JA 3Q2CA 3RWFA 5ADPH 4X4XB 1G6RL 1NH6A 1L7TL 4P46D 2DDQH 5DURD 2W9EH 1RZKC 1F4XL 1QQDA 4Y89A 1I75A 2Y7QB 4P3CL 2A1WL 4KJWC 3Q5TA 1SEBB 2N56A 3NVQA 3QUZA 5IJKA 4KTEH 1ZT7A 5F9OH 3SEPA 5FFLA 2EEAA 3OKYA 2I27N 4RA3A 1JNNH 4NN5C 5F21B 3NCJL 3VXMB 1RULL 1P84K 3QDMD 2EEBA 5BQ7A 2Z8RA 2UWEE 3HNVH 4Y0GA 4U7SA 4BSVA 1FN4A 4OFKA 4NYLA 3NGBC 1BZ7A 4XWOD 2P48B 1ETZB 3UBXI 2CPCA 2ADJA 4Y2DD 3NCEB 3EOTH 4L5FL 3P0VL 4YAQA 4QRQB 1NBQA 4MCZB 1FDLL 5GRVK 2LQRA 1YEKH 1NMAL 1IGYB 1QPPA 1S7SB 2RR3A 3QIUD 2QQLH 2XQYG 3JV5A 5C0BA 4S1DD 1C5BH 1ZOXA 5TH2A 4FXGA 5CZXD 3UPRB 1N6UA 1RMFH 2ITCB 2BC4A 3MRQA 5IJVA 2AK4A 1OTUC 1U92B 3SKUD 1YEIL 5BV7L 3EYOB 3BN3B 2YUVA 1KFAH 3WYRA 4DN3H 4IOIA 1FFNA 3BZEA 2ESVE 5CWSB 5E99L 4KUCD 3QXUA 1SYSB 1A6UH 3JTSB 1DSFH 1UYWL 3LRHA 4WWKA 4APQA 4ODSH 4HCRL 4XNQB 4QLRA 1U8NB 3TBTB 4HQQH 2P8PA 3I02B 3U9PH 5AEAA 1PY4A 1CLOH 3IFNL 2ZCHL 4ENEC 2P4AB 1RK1B 1VHPA 15C8L 3T0WA 2WANA 4UTBH 2PUQT 3VI3F 4K7PX 1GIGH 4RMTA 5E4IA 3JVGC 1MWAB 3TNNA 4KRPD 3KS0H 4OZGE 1EAPB 4NSKA 4W4OC 1DQJA 3KPMB 1NCBH 3EHBD 3VFRB 1K8DB 4PJGA 4DQOH 4HKZB 3DETC 3JUYA 4QHLB 2YRPA 4HKJB 3WN5A 4F8QA 3OF6D 5CP7A 4FFVD 1W72H 2I9LA 4JFPA 4HX1A 2GK2A 4PJIA 4HJGB 5DHVA 3SKOB 5GGRA 5MP6H 4AEFA 1KB5H 4NKMB 1MIMH 3GI8L 3ES6A 1T4KA 1QD0A 4N0UB 1ZT4B 3AAZA 3HNSH 4BFGA 2VDRL 2B8OT 4HWBH 4RGNC 5AWNH 3V4UH 5CEYB 3ZKND 3BPOC 4KMLB 3RWGA 2VLRD 3KYNB 3MRLA 2R4RL 4OD3H 3QZWB