4DVRH

Crystal structure of yu2 gp120 core in complex with fab 48d and nbd-557
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
EVQLVQSGAEVKKPGATVKISCKASGYTFSDFYMYWVRQAPGKGLEWMGLIDPEDADTMYAEKFRGRVTITADTSTDTGYLELSSLRSEDTAVYYCAADPWELNAFNVWGQGTLVSVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/transcription inhibitor
molecule keywords Envelope glycoprotein gp120
publication title Crystal Structures of HIV-1 gp120 Envelope Glycoprotein in Complex with NBD Analogues That Target the CD4-Binding Site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate yu-2)
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2012-02-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dvrH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4dvrH01
1KPVB 5DVOA 5TE6H 1XF5A 3HMWL 1CXHA 3ZDYE 5JR1L 3O6FA 3OKEB 4GUPB 5IWLC 2X4UA 5GGSB 1I3UA 4JGJA 3RTQD 2FH6A 3RWCB 1FNAA 4IBLT 5DQ9A 2C5DC 1FLRH 1C1EH 2R4SH 4ODBD 5C0GA 3G6AB 2F5BH 1KCLA 2JJVA 2HLFD 2G60L 1PDKA 4D0BB 4WFHE 1P6FA 4G7VL 4QYOA 4OLWH 4X6FA 4EN3D 4Y5YA 3DUSB 1Z9LA 2CRMA 1NBQA 4FQIL 4OFPA 5E8DH 3UYRL 4G80B 4UV4L 1X5AA 1RJZB 3RVVD 4MD0A 3MUGA 3HE6A 4E5XA 1RIVL 3D0VB 1A7NL 4CUCA 1BF8A 3O2WH 5EH1A 5CEZE 1EIBA 5C0DA 3MRDB 5F7UA 1MQKL 5IVOA 1UXSB 4U1IB 3GSNA 1F3JB 4NT6B 5EO0A 4NNYB 3S3SA 4ZS7L 5SX4I 1OGAD 2DQGH 1W72L 3SCMD 5D71H 2VLMD 4WI6A 3G9AB 2X4QA 3P77B 3RNKB 2NQCA 1JGEA 3MRLB 4P23B 1EAJA 1T83C 2W60B 3MV01 4NC2B 3T0EA 3SE4C 1YNLL 2V2WA 4X8XA 3RZCA 2B4CL 4KFZC 5DJDA 4I1NB 4DN4L 4XHQA 3B2VH 5IOPA 1AI1L 1OT2A 4DOHE 1RUKH 2Z8SA 5IMMA 5J7CC 3MTRA 2GSIA 1D5XB 1GGCL 3H42L 4FFWD 4Y19B 4ZDHB 3DVFA 4MNHA 3S37X 2XKUA 1XGTA 3HRZA 4OZIB 4M7ZC 2Q87A 2BOBA 3FQTB 3RWFA 3FTGA 4HGKC 2FYYB 3KYKH 5CCKH 1BAFL 1UJ3C 5E8NB 4J8RA 4JHAH 5GRVL 5CAYB 4C4KO 2A38A 3DSFH 4PJ8C 2BERA 3O2VL 4Y1AE 5EUOA 5DJ0B 3IFNL 1B2WH 1WT5A 2CXKA 3JV6B 1LO5B 1HIML 2EO9A 3D85B 3HC0A 3KDMB 5AUMB 1IM9A 2P1YA 5JA8B 1N8ZA 5MENB 3DUUA 1FIGL 1ED3B 3HNTH 3K46A 1YEIH 5I19L 1YEFH 4D9QD 2B5IB 4H5SA 2I9LB 1A21A 2ILLA 3O6LL 2Q86B 1HQ4B 1MNUH 5E9DD 4MDIB 3PXJA 4OF6A 3NGBC 1AO7B 4GKZB 3AS1A 4DWHA 3QWOA 5EO9A 2XWBA 2AEPL 3LKOB 1KT2A 5FUZL 5HGAA 4R7DB 2HJFB 2V17L 4M7LL 5GIRB 2DQIH 4XPTH 4P2QA 2EIDA 5ITFB 5TE4H 1NSNH 5SV3A 5ACMA 1PSKH 1CK0L 3O4LD 2J8UE 5CINH 1ONQB 4MZ3A 3PGFH 4YZFE 4YEEA 2C7UA 4LK4A 4OD3L 2BY0A 1I1YA 5I1LB 5DD3H 4YHKH 4P4KA 4EDXB 1J87A 3MODH 3QXAA 1ZMYA 2EDDA 2YUXA 4RGOH 1MLCA 1QR4A 4UAOC 1MH5A 3HI1A 5C8JA 5ITBL 5I74B 4NKMB 4F7EB 3T0DA 2WW8A 3LS4H 2P8PA 1FVDA 1K4CB 3TM6A 2AJXH 1ZEAH 5KSUB 2KKQA 4TULL 4BQCA 1ZGLB 4X8JA 4XNXL 3O3UN 3QISA 1K8IB 4DKFH 5CBAB 1N6VA 3QNZB 1Q9LA 4MAYC 1EFXD 1V7NH 4K8RC 5FAAA 4U6YA 1I9JL 3FB6A 3WV0A 1LO3H 3FQXA 1YC7A 4OB5L 3WN5A 4QXGL 3SDXE 1I7TB 5SWZA 3N85H 3AS0A 2VDMH 1JRHH 3EO9H 4PJGE 1RHFA 4OZ4A 3MRCB 3UZEA 5C3TA 4XVSH 2GJZB 1HCFX 1OSPH 2IQAA 4E0RA 4FG6C 4XP1L 5J8OA 1U91B 1OWRM 4UINL 4HIJB 5JPNB 1FZJB 3EFFB 1VDGA 1LO4L 1CVSC 1CGWA 3IDXH 3KHOA 5I75C 3NN8B 3CLFH 1CDUA 4FQXC 1UM4H 1IVLA 1E4KA 2XNAA 1DQLL 1V05A 2YRZA 4X6DF 2IH1B 3OXSA 2K7QA 5CHNA 4RISL 4JFXB 1A2YB 1LK2B 4KWUA 2NNAA 5IJVA 2ZKHH 4R90L 2E6QA 2NXYB 4ZO8A 5GGUA 2YPVL 3QPXL 4GAJH 3JTSA 2GK2A 1ZLVH 1UH4A 1OPGL 3RDTA 1UYWH 4LSSL 5IM7A 3CXHK 2XQBL 3UTSA 4KRPB 1JNNL 1OGAE 4O2CA 1QBBA 3I50H 2VLME 2JELH 3U0TB 3HB3C 3JVGA 3HAEB 2IALA 5E6IA 4NRZA 1RK0A 1M4KA 4HAGA 1OGTA 2F74B 4JRXA 3AGVA 2WBJB 3L1OH 2WUBL 4OQTA 4GQPH 5F7WC 1JHTA 4CDHA 3NCMA 4XAWL 4NQDB 5D1ZB 3W2DH 3NCFB 5I9QC 5I1GH 3ZDXE 1MRCH 2GY5A 2R0ZL 5ETUB 4GFTB 2IJ0C 3QCVH 5T5FH 4HUWA 5DJ6A 2P49B 4M6OH 3C6SA 4HUNB 1LEIB 1QSEB 1U8QA 4MAYD 1MJJB 2VLJB 4JPIA 2R23A 2G2RB 4RGNB 2EH8L 4XPGL 3KLSA 3DRQB 3LN4B 4NN6B 5I16A 4KHTL 4XBEH 5HYJB 5JIIA 1ZWIB 5JPMB 1IGFH 3IJHA 5TQ0L 5FFLA 4EXKA 4XRCB 4FG6D 4WW2F 3NMEA 4Y4FB 1D6EB 1MCKA 2ED9A 5HGHA 2V9QA 4S1RL 5DD0L 4RX4A 3RBSA 2EE9A 5C92A 2C3VB 2I9TB 4KRLB 1OARL 4L4JA 1NBVH 1FSKB 4MJ5B 2B0SH 4D9QE 5I1AB 4UT9H 1MWAH 4RRPG 4L5FH 4GRLA 1GC1C 1U8JA 4LSQH 2H45A 5E9DE 4JM2C 4YDJA 3CFEA 4XCNB 4Y16C 1LO2L 2DQCL 3FO1B 1P7QD 2HT3D 3I2CL 4WHYH 2O5ZH 2PNDA 5CP7B 2EYTA 4JZJA 4K94H 4K8RL 1INQA 1KEGH 4JFEA 3DMMC 4CADB 1KCVL 4JB9H 2VXQH 1A6UL 3GUTB 4DVRH 2P45B 4PRID 4ZTOL 4HMDA 4B7IA 1F11A 3VGFA 4TTDD 3HB3D 2Y36L 2P24B 1KPUA 4GSDH 3O4LE 2BHUA 4UQ3B 5DZNA 2BJMH 3ARGC 4L3AA 3W0WA 2X10A 3ECBB 3T4YA 2KZWA 5B3NA 1I7ZA 4HKXB 4I18B 4RCAA 3SDCB 4LLWB 4ZUWA 1I9EA 4PJXB 2DD8L 4NRYA 3BRGC 1H8SA 5HYIA 4JAMA 1I1FB 3SJVB 5IHLB 4L8SA 3Q48A 1Q1JH 5TF0A 5BVJA 2AI0L 1FE8H 3KJ4C 4MQTB 5F89B 1U3HC 4KXZH 4PJ5E 4M3KB 1S9VB 5C0IB 5K59F 1N4XH 3F12B 3GSQA 3TBYB 2IF7A 1T7ZA 4DN3H 2BSSB 3KPOB 4TSAL 3L6FA 2AJSL 3ZDZE 5CZKA 3I3BA 2WINB 1R5VA 4IOIB 5E2WH 3X12A 4AT6B 5IQ9A 4JFYB 1K8DA 5B21A 3DLQR 5T1DL 3GMOA 4U1HA 3FMGL 2W0FA 5LGHH 1YY8B 3HR6A 3RA7H 3M1BA 4NQXB 4X6DA 2M1KA 2MSPA 5KVEL 2I25N 5GJTH 2Q7YA 4F7TB 3PWUA 3PWNA 4ELKA 5GGVL 3QI9A 5JXEA 2WMPA 1U41A 5CSZA 4LSVL 2XA8L 2X89D 1ADQA 1D5ZB 4HV8A 5IB3B 4UB0H 4UNVA 3U82B 5JUEH 1Z3GL 1NFIB 2EDRA 5GSRB 1MWAA 5D1XB 5L2KD 5CJ8A 5EB9A 4NQEA 4EVNB 5F9AC 2NY0C 3MJ7B 1NBYB 2VIRA 2E9IA 3U30B 4JY6B 3VWKB 4XI5C 1AKJD 4M5YL 1RZIB 4E42B 3MRFB 2D9QB 5ERWA 4ETQA 4ZMAT 3HUJA 4HX1A 1B6DA 3VGDA 1X5XA 3TPKA 4LCIH 3C5ZA 1OP5H 3SE8H 1CDIA 1T1WA 1SJEA 5HHQB 4RMTA 3UPRB 3G5XB 4XMKH 1JYWA 1NAMB 2VLKD 1I3GL 2GITB 3ARGD 4GT7A 1BQHB 4DGYH 1JZ3A 3BEWA 3LQAH 5J11C 1IEBA 4UOW1 4LLUA 1ETZA 4D0CB 1NFDB 1FAIL 1YC8A 3GMMB 3QQ3A 5EOCL 2DI9A 3CU1A 5HHXH 1XGRB 3GK8H 4FQ1H 2CKBH 1KEML 1ND0A 4OKVA 1LEKB 3AMKA 1FO0A 1YEDA 3BMVA 1RIUH 1U3HD 5D7SL 3RJDA 3RY4A 4TVPD 1RU9H 2AKRA 3MRGA 5HDBE 4WO4B 3MLVH 4XZUA 3KPPA 4Z0XB 2AABH 3RU8L 4HMEA 2NY4B 3PHQB 1J10A 4XPAL 5KVFH 1R24B 5ACLA 2APFA 1MLBA 3GRWL 4XC3L 1Q9KB 3G08A 4X7DC 4YO0A 4YQXL 5C0RH 5CUSL 1VSCA 2UV3A 3FN3A 3ZE1F 3U36A 1FV1A 5FYLH 1T20B 4U1NA 4GAGH 4JQVC 2QJDA 1IBGH 4O2EB 2ESVD 5MI0B 2ZUQB 4U3HA 5HI5C 3NABL 1DVFB 4GKNA 1LE9A 1UCBH 1A64A 4XP9H 1TQBC 2GTZA 3QIBA 4OUUB 1MY5A 2PXYA 3FOMB 5HHOB 4DGVL 5AWNL 1FN4B 3ALPA 1ERNA 2CUMA 5I76A 1CFBA 4KK8D 2XA3A 4QRPE 4XI5D 4BSJA 1BBDL 4OBRA 4JFDA 2K9UA 4TVPL 3S5LG 4DKDC 5JOPD 4G9DA 3RWIA 4RAVB 5T1MA 3O9WC 4YUEL 4DGIL 3U2SB 1I8MB 2FJHA 3BHBB 1XCTA 3T2PA 4LGSB 2V7NB 3G5YB 1CICA 3OQ3B 2A9MH 3UTPD 5EIIA 5ILTH 3WYRA 3KPRA 3P9MB 2J6EA 4HT1H 4P5TA 1UWXK 1KPRA 1EEUA 3MCLH 2R2CA 3ZLQC 2FO4B 5J06A 4PRIE 3PWPD 1JUFB 2NX5B 2OTWB 5HGBB 4NDMA 5DHVA 3AREA 5DGQA 4NZJA 3CAFA 3LPWA 2H32B 1TNMA 4OCXH 4PJBE 1A1OB 2Q6WB 4ESKA 1NLBL 3DUHA 3NAAH 1FYTD 1CE1H 3QUXD 4P0DA 4XB7A 4W70A 5GSVA 4P2RB 4G6JH 4KK5C 4BZYA 1YPZB 4JJ5B 4IOFD 1ZT7B 4XWGL 2IBZX 1Q72H 1A9BB 5CJOL 3QFJB 2YC1B 2VXVL 5T33L 2BY1A 3MLWL 2YPKA 3OZ9H 1IAII 3MLYL 5BXFB 3O6FC 3QBTB 1S9KC 4HPYH 2AK4A 4HWZA 5DRZA 5C0BB 1PG7H 2OX5A 3TFKD 4N9OB 1X3DA 3FT3B 2PR4L 4Z7UF 1HILA 1S9XB 1RUMH 3HE7D 2XWJB 4UIMA 1AD0B 4J3OC 1FORL 4BFEA 3REVA 5HYSB 3WFCH 5HI5D 1GYAA 2HFTA 1HXYA 5F96L 4Y5YC 4YHIA 4GRWE 4HWBH 1ORSA 3QXVA 3T1WA 4G8FB 5J6HB 2RIKA 3D18B 4MQ7B 3HMXL 3Q2CA 2OR8A 4PJ9A 4O2FB 4LAQH 5BZWA 4G8EB 4PJEB 5L2KE 1D6VL 4UMGA 4UIKH 5HHMB 4HKZA 5F1SA 3V2AR 3O9WD 4FTVB 4NQSA 3WBDA 4X7SL 4MA8L 2WV3A 3EW3B 4JO2H 4NM8L 4YNYA 4CDGC 3RWJB 4HK3J 1DBMH 3C6LB 3SO5A 3KYNA 3V0WL 2RFXA 3FQRA 3RKPA 3B9KB 4CVZB 4PJHF 3LV3A 3BDYL 1I8LA 4UOJA 1QHOA 5FO9A 3WE6B 5IVNA 4NWUH 2VXTH 5D7LA 5TDOB 1E4WL 1AQDA 1R3IH 3T0EC 3VRJB 1EV2E 3RZCC 1PFCA 5EU6A 4X9HA 2FB4H 2O5YH 2F8VA 4MDJB 1YEEL 2VLKE 1CGUA 1BIIA 2QADC 3MJ9H 2DLHA 1S9YA 4WNQB 1MCQA 1RUQL 2GT9A 4NN5C 1OAQL 3QAZB 3JTTA 5L2JA 3CDCA 4N0YL 4ERSH 3LQZB 4A6YL 5JHLL 1P4LA 4XBGA 4WRLA 1K9TA 2A77L 5FGRA 4OAWA 4G5ZL 2C1PB 1NC4B 4NNPH 1D5BB 1MCFA 4P57B 2FEDC 1AQKH 5DDHA 4TVPE 1DL7H 4P3CH 1KIQA 1QPPA 3I02B 3OAYH 4G6KL 1WWWX 5LCVH 4PD4K 4YFLF 1DUZB 4HPOL 1WIOA 2YPLB 4HZLA 1WT5C 5KN5A 2R29H 1UKSA 4G43A 5KG9A 1M6OA 3B9AA 4PTTB 1DDHB 3RPIB 2EDFA 1SVZA 4FOMA 5E5MA 1IKFH 4J1UB 1RD6A 3UJTH 2XZZA 3TJEL 2ESVE 5BV7H 5TH2A 3GB7B 3VH8A 2CJUH 3HS0B 3WKMH 1TTUA 3L3GA 4H8WC 1INDH 1NAKH 1V5JA 2YEZA 3L5WA 4X80L 4UILH 2VJXA 2EDOA 2ZUXA 1BVKB 1L7IL 2ITCA 5EZOL 1EHNA 1TNNA 3PE9A 4XNQA 3CMOH 1YNTB 1ZA3A 4JANA 3NFPB 4UU9B 3U4AA 4Y4HA 3MPCA 2FR4A 3GSRA 2DM2A 1RZ8B 3QQ4A 3VFPA 2PCPB 4OIIL 1CYGA 2DJUA 3RP1A 1OAKH 4RQQA 2VUOA 1UZ6F 3EDKA 5BS0D 1MFAH 2AAVA 5JOPE 1JMXA 5FA4A 4W4OA 3U9PH 2HTLC 3THML 4I77L 2Y06L 5I71B 3LKPA 3U7WH 3UTPE 2FBJL 2ZNWA 4IMLA 3WFZA 3CVHB 1N0XL 1XT5A 1GGTA 3LHPH 4TUKH 4MNGB 4JCMA 4DZ8A 4YXLL 1P2CB 4P4KC 2UZYB 2B2XH 1EO8H 2QADD 1OTTD 3ZYOA 1XGQA 3BYYA 3PWPE 2JJWA 4GKSA 2DBLL 1WK0A 1A3RH 1DBJH 1G7JA 4F7CA 2F58L 5IVZB 3RUGB 4FQJL 4ZUSB 1OT1A 4ZQKB 1CZ8H 1F58L 1JGLL 1S5IH 3L3HB 1FFPB 1ZS8B 2L0DA 1TIUA 5JLZB 3NA4A 4Z7UA 2X44D 3MRBB 4JFOB 1BX2A 2FZ3B 5EG6C 1FYTE 2FEDD 3LB6C 3KHQA 1KLUB 4QGYA 1RFDL 2BVYA 3B43A 4Y2DB 3V4UL 4O4YH 3BGMB 4GLRH 4EUPG 3GSNL 4RIRB 4OIBA 2NMSA 2NY2B 3CDFA 3MV8D 5AYUH 5AEAA 3WN5C 4PBXA 1TVBB 4XX1G 2YD6A 3WO4B 2QR0A 1H3TA 3DURB 2J4WH 3MRHA 4I48A 4PJDA 2OTUA 1DQQA 1R0AL 2ED8A 4JM4H 3OGCA 1RPQA 4MNQD 1I9RH 4OM1H 3JSSA 2HFFB 2XTLA 5EUKA 3E2HB 1KNOA 4HWEH 5D7KD 2EDLA 2ZOLA 3L3KB 4LARL 4OCYL 1KENH 1E4KC 3QIUB 5FUCC 4PJHA 3T65B 3VGEA 3ULVH 3VG9B 3ZSTA 3GSUB 5E6ZA 1J18A 2IGFL 2XKNA 3L3IB 4N0CD 4ZPTA 1WCBA 2AGJH 2VDLL 3DXAB 2R1XA 3C60B 3BISA 5C9KA 1R5IB 4NKDB 5IBUG 1AR1C 3CFJB 1TZIA 2K1MA 3SDAD 1YEKH 3RDTC 3ULUF 2JB6B 2LAGB 4EI6A 2OI9B 4M9OA 7CGTA 4F3FA 1TZHA 4JPKL 2PYEB 3PGDA 1B4JH 2B39A 1I1AB 2ZJSL 3EJYC 2R4SL 3ORJA 3OF6A 3JVGC 3QEUA 1JNLL 1ZLWH 5E6IC 4H26B 4P4KD 1JZ8A 4X9IA 4RMUA 5GGTA 4MQSB 1A4JB 1J88A 5T3ZL 2BHYA 4NSKA 5DRWA 3L9RB 5E8DL 5JDSB 3LEVL 4TSBH 2DWEB 3UO1H 4DQOL 1QO3B 3CPLB 4EIZC 1GGUA 4GW4A 3MXVH 4H8WL 3VFUA 3CSYB 5FOJA 1YUHA 4APQB 1I85A 3TZVA 1CG9B 3O2WL 1KF9B 1QFOA 4JN2A 43C9A 3LB6D 3SKJL 4F2MB 4PJIB 4U6HA 5FECB 5CP3H 3RUGF 3QXDB 1VERA 1UWEH 2CRYA 5HHPB 4H25B 3MRJA 4WHCA 5LGKA 3CX5J 3UBXA 4LSUL 1DQML 4Q6IA 3IF1A 4PV9B 3QEHB 3MLXH 4PFEA 4HK3N 4HIIB 4Z8FL 4V1DD 4PJAB 4AQOA 1J0YA 1I4FA 4Z76B 3U4BH 5ALBL 4ZYKA 4QRRB 3BO8B 4Y5VA 3V7AG 1X5FA 2DM4A 4HSQA 4X83A 1UXWB 3TPUB 5E56A 4KZDH 4ODUB 3QCTL 4PR5A 1BZQK 4Y0GA 3X13B 2YUVA 3FFCB 2ORBH 4GRLC 4QRQB 1RJCA 2E6JA 3KLHC 4R26H 2VABB 4HHAB 5C09B 5EIVA 2F53B 2F54B 5E70A 3VFGH 1ZHKA 1LEGB 4JQIL 5CFHA 1CD1A 4JZJC 2UYLB 2X4OA 4U0QB 5H94B 3UTSD 1A6AA 4HF5H 3H2WA 1AD9A 5BS0E 3FL7A 1T4KA 2ZSVA 1TJIH 1B2WL 2DQJL 2EDXA 3EJYD 4WIQA 4TYUA 3MQIA 4KROD 5LGJB 4YDVB 4P2OB 4Q2ZA 3S36H 1BOYA 1IARB 4JRXD 4EI5A 5JXAL 5CKAA 3C9NA 3HNTL 3STZA 5GZOC 1YEIL 2MNUA 4HKBB 4WU7B 4F37F 1JI1A 3RZWA 4PGDA 3OGOE 3BEVA 2YS4A 4NO5B 2A6KA 1JF6A 5J3HD 4Z7WE 1HHGA 3SKNB 1QFWI 4LRNH 1MNUL 2JK5A 5KOMC 2CLZB 2HFEA 5IW6B 3V52H 1KELH 4TUOB 1TCRA 4L8SC 5D7JB 4U1JA 2N7AA 5IROA 5BRZD 3NACL 1RHHA 3IDNB 1FDLL 4JDTH 4OI7A 4ODWB 5IUSA 2NY6C 2G9HA 2DQIL 2X1XR 4N0UA 4PG9B 3BE1H 2Z8RA 5KS9F 3RWGA 3TCXA 1IT9L 3QNXA 2P5EA 4XXCA 4KY1H 1NSNL 4Q9RL 3MGOB 1PSKL 5I1HL 3VE0A 4M02A 2A6IA 5A1AA 3DV4B 4U6TA 4G9FD 3QUMB 3MV8E 1PYWB 3LKRB 2UUDK 3B2UC 4GOSA 3FO2A 4BJLA 4M4PA 3IFOB 2N7BA 1DQJB 3DBXB 3LSOB 5DD3L 4YHKL 5E94B 3RX5A 4JFFA 3MODL 2DDQH 1PQZB 4G42A 3ARYA 5GS1A 2FEEL 1NQBA 3QI9C 2APVA 4OQTL 3RVWD 3HLAA 5JXEC 1J11A 4YFDB 4MNQE 3LS4L 2EDJA 5D7KE 2AJXL 1KN2H 4RBPK 4GRLD 1S7UB 1FGVH 1ORQB 3WUZA 4JFPA 3KLHD 4OZFB 5BJTA 2WWMD 2YRPA 3GSVB 3C8HA 5CJBA 3GSXA 5GHWH 4DKFL 1AC0A 4P2CG 1IC7H 1V7NL 1GZQB 1D9KB 5M94B 4XTRD 4G8IB 4JFED 4XNUL 3C5ZC 4L4VA 1CFVH 4ODVH 1ZANH 5B39B 1UCTA 2JCCB 3S4SB 1U6AH 2VDML 1JRHL 1T21B 2F8OA 4F15B 2OK0H 5F9JA 4ZSOE 1Z0NA 5E5RB 3FT4A 4U0RB 1YQ2A 1YA5A 4LAJH 3EKCA 1FZMA 1MI5B 8FABB 3CLFL 4MLSA 3VWJA 5IJKA 4BKLB 1FC1A 3BH9A 5F9OH 3TH3T 1UQSB 1MREL 4YHNB 2HKFH 5CS7A 4Y4KD 2ICES 1A6TB 5I2IB 4YE4L 1C5CH 3VXRB 4UNUA 5DK0A 3N1MC 1NMCC 1KJ2A 4L9LB 3ZHDA 3HTLX 2DMCA 2ZUTA 1XGYL 1HH6B 3B2UD 3I50L 5HGGS 3KPNA 2JELL 5TDPA 1FZKA 1A5FH 3G6JA 5EWIH 3ARBA 4V1DE 1DE4B 4OGZA 3L1OL 5H35B 1W2KT 4LCWA 3V6ZB 1A4KB 1DN0B 3ARFD 2LE9A 3P11L 1CFQB 1YECL 3QIBC 4IRSB 1HHHB 1MRCL 1RZGB 2PXYC 2MCG1 4XCFH 3P73B 5EC1B 3QCVL 5T5FL 1LVEA 1JYVA 3BX7C 4M03A 3DGGB 2OL3B 2BCKB 1FL6B 1H5BB 5FHBH 3WIHH 2H2SC 2CLRA 1LDPH 2K3TA 3QYCA 1BECA 2X1PA 3DX9B 1CR9H 3C5ZD 1CICC 3NIFE 3Q3GA 4JRYB 4P5TC 4FZEH 1KB9J 3C87A 1H9VA 4QWWC 1XGPB 3RWDA 4EJ1C 4XBEL 1XH3B 3T0AA 3UTSE 4XNMB 1JWMA 1IGFL 5F3BB 2DS4A 5DRXB 5D2LA 4ZFZA 2HVJB 5KVGL 3LAFA 1T0NA 1D5IH 4LSRH 4GW1A 4JRXE 1OTUC 4X98B 3GO1H 3VA2C 2E7MA 1K3ZA 4PJ7A 3I6GA 5KS9A 4M5ZH 3HHRB 1S3KH 2RCSL 1ADQL 5CZVH 2B0SL 3BPCA 4UT9L 4X7TB 3FQWA 1MWAL 3O8XA 4GMTL 3ILPB 4NJ9H 1CLCA 1WZ1H 1IGMH 3BZFA 3OB0K 5E8OB 3PJSB 4XGZA 3P4MA 4BH8B 1U8MA 2V2TA 5BRZE 1TVHA 5CIPB 4Q9BA 1U8NB 3BP7A 2R8SH 5F1IA 3H9SD 5EBMB 3ZZ1A 2FSEA 1KEGL 1UB5B 3DETC 4BSWA 4JB9L 2CMRH 2VSDA 3EZ8A 2XFXA 4IIQA 4DVRL 1JPSH 1QBMH 1G7QB 3P40A 3SGDH 2NR6C 4EDWL 4GSDL 4NQCA 4M93C 3MFGB 4G9FE 2FD6H 4HDIB 1CBVH 2CQVA 5H8DA 1C5BH 1AGFA 3ETBF 5F88A 4JKLA 5A3IC 3ZE2F 4YDKL 3K2UH 3BP6A 3L3OB 4ORGA 2P43B 1G6RB 2BMKA 4M6NL 2CGRL 2PXYD 3PWLA 5GS2H 4PB0H 1EGJA 2GK0B 3QHFH 4S2SA 4TPRH 4O5LH 4H88H 5EU5B 1RJLA 3RL2B 1Q1JL 1T0MA 3C2AL 1FE8L 4PJ9C 1J7VR 1FO0L 3D48R 5EBWB 2H2SD 4LVOC 5DMYA 3VXOA 2FIRT 4OF0A 1RZ7H 4LF3A 1UWGH 3BAEH 1ZT4B 4XVTL 1JK8A 3IDGA 5E2WL 4G7YH 1R3LB 3WFHA 4X6CF 5FYKH 1ZVHA 4O9HH 5H2BA 1I8LC 3CZFB 4WUUD 4JFEE 3KYMB 5C0FA 1NKOA 2QEJA 3P0GB 3RA7L 1I8IA 5C9JA 2FLRT 2DL9A 2JB5H 1VGKA 3L95A 2I60H 1TCMA 3O45A 1IZJA 1OTUD 5HVGB 1SBSH 1FQ9C 3C5SA 3CFBB 5E7BA 1KTKE 5C0AA 3VRIB 1T04B 4OKDA 1HOCA 1E4XI 4X6EA 3MNVA 5JUEL 4ZO7A 4AEHH 1B4RA 4RFEA 3U0PB 3F5WA 1RMFL 3TT1H 2YZ1A 3OR7B 3SPVB 5JW3H 3MRNA 1AGCB 4OI9A 4P4RA 4PJFB 4RFOH 2R2EA 2AK1H 1DEEA 2MPAH 5HSFA 3KLAB 4JR9H 2R39A 4DUXA 3QZWB 1A7RL 2VZ1A 1AGEB 1FRGL 4LCIL 4MJIB 4LPXA 1YJDC 4HCRA 3SE8L 5FYLD 5FDWB 1K85A 2R2BB 2VL5A 3TO4A 4DCQA 4XMKL 1H3PH 3MRQA 4Q74A 4XNZC 5DMJB 5EFIB 3WIIH 5T1KA 3QEQA 5HXMA 5DYOB 1M7DA 5GRXG 3A67H 3ME0A 3WJJA 4D94A 3LQAL 4G8GB 1BQHG 3C5JA 3VFVB 5GGSA 5DEFB 4F37K 3AS3A 1LD9B 3RWCA 4F9LA 1QSZA 2JTDA 1L9MA 3T3PF 3GK8L 4FQ1L 5GGVY 2A1WL 3TN0B 4OSUL 4RSVA 5FKAB 4L1DA 2HT2C 5T3XH 4HXAH 1BLNB 2Q8AL 1FL3A 4PJ9D 1P84K 1FNGB 1M7IB 1RU9L 3PWJB 5ADPH 4Y4HC 4K3DL 4WV1B 2D7TH 3DUSA 3V5KA 2UY7A 2AABL 1S5HB 4F8TA 4KAQH 1CGYA 1AY1H 1XR9B 2GFBB 4GAYB 3NIDE 5GRUH 2AXGA 1K2DB 3OV6A 5K9QG 3D0VA 3HUJE 4RWYH 4ZOEA 3V7MA 2X4NB 3BPNB 5TF1L 3IKCB 2IAMD 5KJRH 3PDOB 5FEBA 4NKIL 1F3DJ 1BEYH 5L9DH 3F7YA 1Z9OA 1H8NA 4HJJH 2C3WA 1NC2B 3PDDA 4LHQB 3O3BB 5FV1L 3X3FH 5ISZD 3STBA 3U7YH 3PDGA 1LK3H 1UCBL 3IXAB 3P77A 3RNKA 4GMSL 4P23A 1ZHBB 4KJQC 2GTWA 1C16A 1SYSA 5DO2C 1N59B 3FO9B 4FQHA 4K71C 2A6JA 4Y19A 3WHE0 4Z7NF 2NY3C 1CN4A 4C56D 1GGYA 4QRUB 5DJZB 3MMEA 2A9ML 5F93C 5ILTL 1U8OA 4HT1L 5DURB 4NZTH 3WLBB 3GSWA 3FQTA 4LBEA 3T1FA 3S3JA 2NY5H 1FVEB 2D31B 4WWKA 3L5XH 5HPMA 1A6PA 3VFRB 1KIRA 3EJJX 1H3XA 3MV9D 4N1HB 2OZ4A 4OV5B 4BYHA 1MQ8A 3WUWB 5BV7C 1MY7A 3FB5B 5DLMH 3FQUB 5CBEB 1Y18A 3OKKB 4HQQL 1KJVB 2VITB 4DVBA 1LO5A 1S9WB 3D85A 4OLYH 3NAAL 4FXGB 3SO3C 1KLGA 4ELME 1HEZA 3QCUL 4KKBC 5MENA 35C8H 4Y4HD 1YY9C 2YKLL 3DIFB 4RWHA 4HULB 3WCYA 5C0NC 4OGXH 4GXVH 1WFOA 4YDIL 1AXSB 5GZNC 3IU3B 3ZTJG 4E9LA 4HPYL 3C8KB 1PG7L 4FMKA 1AO7A 1YJDL 2AEQH 1NGXA 4R2GD 4M7KH 4KMLB 3LKOA 2ZNXA 3BUTA 4P46B 3D39B 4WUUE 4OFKA 3VA6A 2F19H 4PGEB 5ITFA 4HUXB 4HFWA 3PG2A 1GXEA 5DHXB 4LLMB 2J2ZA 1P4BH 1VFAB 3SY0B 1L0XA 3OR6B 4LKXA 4BFGA 4Z7VF 1GOFA 4KJQD 4PGBA 4Y88A 3VXUB 4BUGA 1CXFA 2HJKB 4XBPB 3GKWH 4LLQB 1FL5A 1K5NB 3TZVC 1W0WA 2BOCB 5E24E 4YWGH 1YNKL 4LHUD 2AJVH 1T80A 4UIKL 2ZZUT 1MCOH 1OLLA 3BPOB 3GGWA 4JO2L 1CDJA 1DBML 2VLLA 1WFUA 4Q6IC 1JPGB 4J3WA 2BSTB 5KSUA 1L7TH 1E6OH 3NZ8A 1B90A 5E4EB 5IKCA 1ZGLA 4NWUL 3EDFA 4BZ2L 3B5TA 3WNLA 3ZDYF 2F5AL 4JG1L 2Y5TB 2W0KA 3T2NH 1NKRA 5FYLE 3RAJH 3P4OA 1XIWA 1IGYA 3B9EA 4L29B 5LJYH 2B7DT 3DVGB 4Y5VC 2FB4L 5DUPL 1E6JH 2BNUA 4JY4B 5LG1A 1LNUB 2C3HA 4WW1A 5E08H 2DI8A 2MTPA 2AVGA 2N4IA 5DD5H 3L5JA 4OD1L 5EPMA 1I7TA 4BH7A 3HG1D 3LN5B 4IRJD 5D2NE 2YN3A 2EH7L 5E0QA 4AENA 3OKNB 1TENA 1OQXA 4OZHA 4QLRA 3BD4A 1FZJA 3EFFA 4NNPL 1U2CA 3H3KA 3NH7H 3LD8B 3FRUB 4PGJA 5GZND 1AQKL 4HIEA 1BOGB 4OCWH 1IQDB 5EN2A 3EOTH 1SJHB 1MUJB 2DWDA 2E9BA 1HSAB 3M07A 4PTUA 5C70A 4M7JH 1KCKA 1S78D 1ROWA 4KDTA 4NO0A 5DTFA 2FL5A 3C2SA 3VXNB 5T5NF 4EI5C 4KKAC 3UJTL 4JVWA 1CGXA 3VW3L 4GAFB 5BV7L 4QHLA 1MEXL 2FJFA 1T2QL 5I66A 2QKIA 5KSAD 1LP9E 4K7FB 5ISZE 2KUTA 1HI6B 1QKZH 1INDL 1NAKL 4JKPH 4UILL 6CGTA 3HAEA 4U1SB 1QD0A 4YLQT 3O0RL 5IROC 3CMOL 1NBZB 5DQDL 2R1YB 4PP2A 1T2XA 2QSCH 1U8LB 3A6CH 1H0DA 4HBQA 1QSFA 3IDYC 2BNQB 3CX2A 1OAKL 4F9PA 3MR9A 1U2HA 4NO3A 1MFAL 2XWTB 4XXCC 2OR9L 4MHHI 5ETUA 2D0HA 3U9PL 5F9WC 4C56E 3D3VB 1M05A 4HFUH 3EYFB 5MERA 4N0RA 1A22B 1U92B 3EUUA 3LHPL 2DRUA 3DHJA 3L3JA 2APBA 3VXSA 5IB2B 4WFGD 5E4IA 2B2XL 1EO8L 4Y2OA 5HI3D 5CEXA 1KB5A 3D87B 5GS1C 5EU4B 5GGTL 1FNSH 3CJJA 3MV9E 3LS5L 1DBJL 3MJ8B 3DVNB 3DRQA 2DQHL 2ICWA 3ULVD 1AGBB 3ULUC 4UOW0 3Q5OA 1QLRA 5ICXB 3WSQH 1U8PB 5J0BA 3VXMB 3O41B 4QTIL 1UH3A 3LDBB 4XRCA 1R6VA 4MCYB 4W81A 4OIAA 1I3RB 1CTNA 3V5DA 2A83B 5AAMA 1MCHA 4EQ3A 5DFVC 4G6AD 4Z78B 4CU6A 3TBSB 1SM3L 2QLVB 4MA1B 1NGPH 2H2PC 2W9DL 2IANA 2Y07H 2ZG3A 4LCCA 2OJEB 4HIHB 5B8CB 5F6IC 4JDVA 4HS6A 4LVHB 1L6XA 5HVWA 4RGMB 1KC5L 4XCNA 4KVCH 3DX7B 4Z7VA 1QZ1A 3U46B 5DRNA 1XZ0B 3VGAB 4EI5D 4X4XB 3WDHA 3R06B 4JM4L 1RK1B 4KKAD 2EDBA 1K4DA 2J8UF 4YZFF 3RGVA 4JKMA 4MCZB 4HWEL 4D8PB 2LQRA 1ZA6B 3GUTA 3VWJC 5IJKC 5DJAA 4UT6H 4MX7A 4IRZL 4K3EH 2D0FA 2P24A 1EBPA 4UQ3A 2HP4A 3MRKB 4JKWA 2DKMA 3KVQA 4WGWB 5IHZA 3HZYB 3MJGX 3OX8A 4P59H 1KLFA 1HNFA 2HTKC 3OPZL 4HKXA 7FABL 4LLWA 3RNQB 2XTJC 4PJXA 4LEOA 1J0HA 4LCYB 3FB8B 1JGDB 1NCTA 2MCPH 3KNBB 4BZ1H 3V0AC 1BVLB 3WNKA 3HNVH 3BPLC 3PQYD 1VENA 4ORZC 4HZAA 2IWGA 3R0MA 5IW1B 3KPQB 4PJDE 3ARBC 4QT5B 4X99A 3GJFH 5FB8B 4IOIA 1HHIA 4AT6A 4KH2A 4JFYA 3SDXF 5I17B 1WAAA 4OF5A 4PJGF 4TSBL 2ATPB 5DZLA 3UO1L 1T7VA 2FX7H 1SJXA 1YY8A 3MXVL 4NQXA 1QQDB 2SEBA 3TVMB 2H6PB 3RIAF 1NEUA 1RULH 3HG1E 1MFEH 4GG6E 3ARQA 1MIEL 5DFVD 4H0IA 2EDNA 3V6OA 4GBXD 3DWTA 2EKSB 5IB3A 1UWEL 4HK0A 4HXBH 1Z5LB 1NANI 2GSGA 5GSRA 4JO4L 5FGCB 2VERN 3LEXB 1UEYA 4PUBH 4PLOB 4XVUC 1KYOJ 3MJ7A 5BCAA 1JI2A 3MLXL 3SKOB 3VWKA 1DSFH 1WC7A 4EBQH 3N9GH 4NM4L 1KJ3L 3U4BL 5IV2B 5HGDA 4R0LA 2WQ8A 1P1ZB 3O3EB 3W82A 4JCLA 3VU2A 3GMNA 4AMKH 1N26A 3K80A 4GG8A 4PGCB 2NYYD 5DSCB 3DTXB 1M71A 4KZDL 2BXZA 4LSPH 2KDGA 1N64L 4JO1H 3G5XA 3ULUL 3S34H 4ZNCD 1NAMA 4HLJA 2GJ6B 4K07A 3O8XC 3BIAX 3HI5H 4I2XE 4PJ5B 4L4TD 4R26L 1LO0H 2HTKD 12E8H 3FONA 2ICEB 5MHSE 1V7MH 1MCEA 2FCBA 2G75B 3ZDXF 3MROB 2XTJD 3VD4A 1FZOB 2NY7H 2H32H 4QXUL 4WI8A 2KH2B 3NPZB 2J5LC 2LAAA 2NLJB 4Y1AA 2IMNA 3V6FA 4WDIB 5JW5A 4J3TA 1LEKA 5C71A 5GJSH 4KGJA 4PJ8B 3KWWB 2XOTA 4IIQC 3IFLH 1TJIL 2VN7A 4U6VH 1SYVB 5LWYH 1J9CT 1F90H 1NL0L 1ZK9A 2WUCH 3OKOA 3S36L 4HH8A 3ARBD 1T5WA 5J1AB 2A2QT 4NKQB 1NGQH 4YHPB 1IC5L 5TPWH 3WHXB 1UVQB 4L8CB 4WFGE 5D96C 1BZ9B 4UNTA 3ZYJA 1QLEH 1KELL 4YBHA 4FFZH 3GBML 3ALXA 3U6RB 2E27H 2DL2A 3HZMB 4LQ1A 3P9WB 3PL6A 1IL1B 5L88H 2Q8BL 1B9ZA 8CGTA 2HLAB 2DYPB 3I6KB 1GRWA 1DVFA 1IGCL 2CIKB 1GJIA 3BE1L 1HH9B 4OUUA 3TC9A 2Z31B 4LDOB 3REWB 4KY1L 2J8UA 5LXGL 3OJDA 2UZIH 4XVUD 3CSBA 3EOBB 4U7SA 1KJ2L 1ZHNB 2Z92A 4I5BB 2CKBB 1R3JB 1S7WB 3A0OA 1IGTA 3ET9F 25C8H 4PLJD 2Y72A 3U2SA 4ZFGH 2X7LB 4NRXA 3V0VB 2DDQL 4U7KA 1D5MB 2NY1B 4UAOB 3P9MA 2EDHA 3GIZL 1C5DB 3VXTB 1VEMA 4U31A 3I9GL 3D69A 2FX8H 4CNIB 3O8XD 4QF1B 2FO4A 1KN2L 2ID5A 3HCVA 1FGVL 2EXYD 1EHLL 1Q94B 2NX5A 4XPHH 2OTWA 2HFGL 1BMGA 5HGBA 4QEGA 4NCDA 4LPVA 5GHWL 3MRIA 3FN0L 1FJ1A 1IC7L 4PRDB 1A1OA 1W72A 2Q6WA 2ITDA 4N0UE 3SDXA 1FNLA 4PJCB 4QHMB 5KVDH 1A6VH 1YEJL 1YPZA 3TO4C 1DLHA 1U6AL 5GGQH 3ZDZF 4ONHA 3LRSB 2DMBA 2YC1A 3BH8A 5FHAH 3BWAA 3PQYE 1GGBL 5KSBB 1B88A 3O6KH 4EN3A 5C0BA 4JFFE 2RHEA 4E41B 4F9LC 5J13C 3VFNB 5J9PA 5I75B 5FYJH 3K3QA 2V2XA 4YHYC 2PW1A 4FQXB 3CC5B 1S9XA 1Z9SA 2P5WB 4QRPB 4KK9D 4YXHH 5HVFB 1I7RB 1L6ZA 1PKOA 2HKFL 3IFPB 3Q6FA 5HYSA 1YZZA 2ERJB 3EJZC 3W81A 1J8HB 1VGEH 5A43C 1C5CL 1AXIB 4KK6D 1A47A 2BFVH 2Y23A 3IDIA 1KULA 3SCMA 4KC3B 1HKLL 5FCSH 3LEYL 2Z35B 5I8CA 1YYLH 1A5FL 3RWJA 3TBVA 4EOWH 32C2A 4F33A 4ONOA 1N6QH 5EWIL 1BJ1H 4JGMA 5IFHL 3ILQC 3B9KA 5ADOL 3TP4A 1BM3H 3UJIH 2W1NA 4OCRL 5I0DA 4IHOB 3DI2B 3T2QA 1A6WH 1R5WA 3CFDA 3UJJH 4P23C 4LMQI 4XCFL 5I9QB 5TDOA 1MCIA 4P9HH 4WJ5A 5D70L 3CVHH 2PETA 5BO1H 5D5ME 1EDQA 3M8OH 4MDJA 5AZ2H 4LSDA 1OLZA 5FHBL 3WIHL 2NTFB 3KXFD 1LDPL 1JBJA 1W0VA 1HHJB 4OZGE 4L4TE 1WBYA 2R9HD 3VFOB 1CR9L 2XTJE 1KTLB 2X1WL 5A2LH 3INUL 4YHZH 5HDBF 4S0SD 3TO4D 1IM3B 5CMAA 2C1PA 1CGTA 1G7MB 1Y6KR 1NCAH 4PY8J 2R69H 4OTXL 2UWEE 1SY6H 3TEUA 2X1OA 1XF4A 1CLYH 3I02A 3G6JE 3TYGH 5J89A 3EO1A 1B0GB 4LSRL 1GAFL 2A74A 5AYQA 2O61B 1FGNH 3GO1L 5GS2D 5I1DB 4XCYB 1S3KL 3BVNB 1JGUL 5E9DA 1R3KB 1MFNA 3B6SB 1DDHA 4I3GA 2AJYL 1WZ1L 3X11A 1IGML 3KPSB 5E6YA 2MKLC 3S35H 4PY8I 4JFQA 3ULSB 4JM2B 5I1CH 4HWNA 4JFHD 5FO7B 3WNOA 2BSRA 4Y16B 3T0WA 2HG5A 2YK1L 1TMCB 5FYKD 3QDMB 4HKJB 1QLFB 1TJHH 1BVKA 1NEZG 2CMRL 3MNZB 1QA9A 3DMMB 3U1SL 3O4LA 5HYFA 3NFPA 1OTSC 5IVXB 3GM8A 3GNMH 5C7XL 2JIXB 1CQKA 1RZ8A 1CLOL 3NFSL 1F4YH 2FD6L 5SWSB 1CBVL 5CJQH 2WIIB 1C5BL 2FGZA 1FG2B 3PGCB 2ARJA 5E2VH 1JWUB 3QULA 4LVEA 5DC0A 4XCEB 5D2LE 5F97E 1E27B 4KRMB 3AFLA 1A3LH 1UJTA 1CD9B 4P23D 4JEGB 4PJ7E 3SEPA 2EYRB 3NPSB 5JDJA 3QH3B 5CEYB 4H88L 1U95B 3DOSA 4AH2A 1ZHLB 1U8HB 4I0CC 3RIAK 4RMVA 3KJ4B 2EIZA 5A40E 3TYFB 4PJBF 1FBIH 5IFAH 3LH2L 1PZUB 1I7UA 5I74C 4Y19D 1UWGL 4ODXB 5F1NB 3TO2A 4QXWA 1EFXA 2X5PA 3GI8H 3MFFB 4G7YL 2OSLA 3QUKB 5HY9B 4XPBH 5MEQB 5FYKL 2FBOJ 3L3HA 1X5GA 3KAAA 4KDWA 4LPWA 1P9MA 1BVZA 1M7XA 3DX6B 3KR3H 3ZTNH 5TE7L 1ES0B 1CL7I 1DUYB 4JQXA 1WV7T 3IGAB 1KLUA 5INDB 1A0QL 3TH2T 2JB5L 1RZJH 3MGAA 3BGMA 1EH9A 1MRDH 4QRSB 2A73B 5ID0B 3DNKA 4DEPC 1EEYB 1SBSL 3C08H 3O4OC 1S7SA 5FA3A 4LGPB 2E9WA 4NN7C 3BZ4B 2NW2B 5T3XD 1JZ4A 2X4RB 4ENED 3D85D 3WNPA 4AEHL 3DURA 2DIAA 3JWDC 5B38A 4NUGL 2ICCA 5IBTL 5MEND 3BGAA 5JW3L 1XF2B 1LMKA 2E7BA 2Y7QB 4HLZH 3MBXL 1TPXB 2NY0B 4GRWF 5IMOB 5DJ2A 3Q6GH 5FIEA 3O81A 3GHBH 2HFFA 1HSBA 2AK1L 1X5KA 1DR9A 5D7IB 2OP4H 4JR9L 5FOBB 3M45A 4D3CH 2A6DB 3AAZA 3OAUL 3QIUA 3T65A 2X4TB 3GSUA 1AO7D 4MD4B 1EVUA 5I8OL 3DXAA 2OXGA 3D25B 1OTSD 3C60A 4NKDA 1H3PL 3WIIL 1FH5L 4KDTC 5KZCB 2NXYC 4NC1C 3GIVB 2WZPD 5JHDB 1RURL 3A67L 5F7KC 2AJZB 2AXFB 2OZ4L 4JZNB 3VRLE 4K3JL 2DM3A 3X3GH 1II4E 2PYEA 1JFQH 4R7NB 4V2CB 4HUVB 4HXAL 3IJSB 4PGZA 5T1LB 3OBAA 5CKGA 4FXLA 4OLZH 4KJYB 3MO1B 1MFBL 2XI9A 4YIQB 1T1ZB 1Q9OB 5ACZA 1PX3A 4XMLH 1MJ7L 1NDGB 2D7TL 4MAYA 5JDSA 4DK3A 5D1ZC 1BQUA 4F9PC 1AY1L 2QQKH 5GRUL 2CUHA 3KXFE 1QO3A 3CPLA 4U1GC 1FNEB 1HQRB 3ARDB 1ZTXL 3CSYA 3TCLA 2FATH 4ZAKB 5F71A 4MB4A 4LKCA 3UTZB 1G0YR 4M1GL 4OLVL 4PJIA 5FM5M 1J8KA 3IB4A 2Z93A 1BFOB 3FQNA 4P99A 1WBXB 1UM5L 3BKJH 5D93C 3X3FL 3BUYB 1MAJA 5EIQA 4RGNC 2BRRH 4QRTA 4EZMA 3VD9A 3QEHA 4JY5H 1TQBB 3QUMH 4PJAA 3E6FA 3UYPA 3BKCH 1P4IH 3KPLA 4M8VA 4AM0A 3RI5K 1JPTH 3BO8A 4BK5A 2OLDA 3WFDH 2OXHA 1S7QB 2R0LL 3TPUA 2VDNH 5IB5B 3RVTC 3ZKXB 4FQQB 4Y7MA 3EOAA 1P7QA 3LKQB 1QUNA 3X13A 2MQ0A 3WLWC 1IGJB 4JFHE 3GMRA 1NCCH 4LCCC 3OKLB 4NZTL 5FYKE 3GBLA 1HHKB 4BSVB 2VABA 3QR2A 4OZFH 2NY5L 2NXYD 3FRPA 1EEZB 3L5XL 4FABL 1TITA 4IM8A 2D0GA 4KQ4H 5AZEL 1AC6A 2H9GB 4FZ8H 5I1JH 4PJBA 5I8KH 3QO1A 1QFWH 4KRPD 1UH2A 5DLML 5MP6H 4WI4A 3WUWG 4P2YA 4FXKB 4YBLC 1HXMA 4YDLC 4DTGH 1RZFH 3W9DB 5JA9A 3FO0H 5KTEL 3QEGL 3EYUH 5DMGC 1DZBA 2OM5A 3JWDL 4ZOCA 5SV4A 1G9NC 3F7RA 3S5LB 35C8L 2WBJD 1UADC 4M1CD 4M6MH 4HH9B 2IPUK 4HKBA 3G04B 4NQDD 1R3HA 2JJTA 3NCEB 5D1ZD 1EJOH 3NCCB 4GXVL 3VD7A 5JQHC 5C07B 5IBLC 4Y19E 3O6FB 5T5NG 5EDXA 1KFAL 2WP3T 3WXWH 1MHEA 1J0ZA 2I27N 3KJ6H 2AS5M 4NOFA 4OZIE 5BQ7A 5DQ9B 1OCWH 5EC2B 2B1AL 2PN5A 1J0JA 4PG9A 4P3WA 3GMQB 4FQCH 3NCBB 3TT3H 4RGND 3MGOA 3HZKA 2ENSA 4QYOB 5CILH 4X6FB 5DVMA 1VCAA 2X89A 5HYJD 1BQLH 3QUMA 1PYWA 4MD0B 3O6MH 3MUGB 5L2KA 3HE6B 3ZKND 4E5XB 4M43H 4OT1H 5T3XE 3GKWL 3MUY1 3IFOA 4Y4FD 5EORL 2AJVL 5IMKA 4TRPH 2XT1B 2OBGA 4KTYA 3FFDA 3RVTD 4AG4H 5C0DB 5MENE 3V6OC 1JNJA 2VR4A 4LPUA 1MPAL 1NCDH 3QRGH 2FNBA 1CGVA 3GSNB 3EYVA 3TV3H 1G0XA 2G5BB 1L7TL 1E6OL 4P9ML 2XZAH 1WBZA 4OZFA 2X4QB 1TETH 4LEXH 1VKXA 1AO7E 3U30C 1PG7W 3CMGA 3VWKC 1CU4L 4MXWH 1KV3A 4UQ2A 2KZ1B 1WFNA 1U0QA 3T2NL 5FO8A 4Q7DA 4R0LC 2FLBT 3T0EB 4M00A 1E6JL 3RZCB 1D9KA 1CQYA 4G6MH 3H8NA 5DJDB 2WLYA 5E08L 4I3SH 1KB5L 4HAFA 3B5HA 1X6NA 5IOPB 4YBQD 5DD5L 2FECI 3HC3H 3TBWB 3NZHL 3S4SA 1T21A 1GIGH 4QHUA 1NCWH 4MNHB 4EQ2A 2PTTA 1XGTB 3GI9H 3RWFB 1SJVA 3SDCD 3MACH 5DA0B 1MI5A 8FABA 1J5OH 3ZKQD 3HPLA 4OCWL 3SJVD 1UZ8B 4BKLA 5IBLD 1GCFA 1JL8A 4Z5RB 2EDQA 4U4BA 4TOYH 1BIHA 4YHNA 5FV2A 4M7JL 1GPOH 5EUOB 4B7LA 4TNVK 4JFZH 3X14A 1A6TA 5I2IA 1LE5A 1IM9B 3PWVA 2ESVA 4XP6L 5CIPH 3N1GC 1N8ZB 1F6AB 3DUUB 1WIUA 3K4AA 2YA0A 3V95A 3WJLA 3QG7H 1CDYA 1PZ5A 4H5SB 1HH6A 1QKZL 3GSOB 3SGEH 2ADGA 4JKPL 5L8KB 5LBSH 3DECA 1X4XA 4YPJA 3GHEH 3KGRA 1G9NL 2H3NA 1EO5A 1NUNB 3PL6C 1U58A 3B4NA 2IFFH 2QSCL 3A6CL 4OZHE 2BNRB 4HEME 1KT2B 1A4KA 1DVFC 1G6RH 5D1XD 3WEXA 4HD9A 1PBYA 4P2QB 4UDTA 5GGRY 1IC4H 4F57H 3OL2A 3DGGA 2OL3A 2ZOKA 3VWKD 1H5BA 4KI5C 4NCC2 1MCWM 4K23L 4CW1A 3PWPA 4PB9L 3UC0H 4NC1E 3DX9A 1P7KB 3MZGB 4YX2H 5L7XH 1UA6L 3O2DH 3QXAB 1XF3B 1FNSL 2J88L 1MLCB 4HJ0C 3P4NA 3HI1B 1DFBH 1NGYA 2A0LC 3IU4H 3HMXA 5KW9H 2NZ9D 3JUYA 4XNMA 4Y5XA 2GY7B 3AU1A 4BQ9A 2X70A 1FYTA 3QUXA 5I73C 3ZE0E 3A6BL 4Z7OE 3ARVA 4IMKA 4HWUA 3QB7C 4Z7WF 5I8EA 4X6BB 2QHLA 3CX5K 4K7PH 4X98A 4OLUH 4NGHH 5TDNA 5TGBA 5SWQA 1F00I 1Q9LB 4NQDE 4OFVA 1NGPL 2Y07L 4U6YB 5DUMH 3FB6B 3ILPA 4NZUH 4KQ3H 5DS8B 4DFHA 1MAMH 1N0LA 3FQXB 2APWA 3WN5B 4BH8A 4KVCL 5ESQA 5SWZB 4WO4D 3SGDI 3CDGB 2QQLH 3IVKA 2B4CC 3HE7A 4QNPE 2NY4D 5L8LB 5C0EB 1MIML 2ZUWA 2AQ1A 4U2ZA 2HLFC 1A7QH 5EBMA 2IQAB 3LKNB 3SGKA 4EN3C 2P8LA 4W4NA 4RGNE 4W68A 4UT6L 1OHQA 1Q0XH 4O02H 2XNAB 1NAML 1KBGH 4MYWB 3ZKMD 3IJYB 3BDBA 4LHJB 1ZKAA 3RRQA 3F58H 4D9LH 3VGHA 2E7CA 1DVFD 3SBWA 4EUPB 1H3WM 3Q5TA 2E9JA 4IJ3C 4MAUL 4NUJA 2V6HA 3NIGE 3UEZA 5GGUB 1OB1A 2D7NA 3JTSB 1QVOA 4NQVB 5HHOD 5CLTA 3RDTB 4BFIA 1OD9A 5BZDA 5IQ7H 3JWOH 2GK0A 2PO6B 3CFCL 3HFMH 3SCMC 1IMHC 5IM7B 1S7TA 1XCQB 2D9CA 4KI5D 3NFNA 3F8UB 5HBBA 1AR2A 3HNSH 2XKSA 1TJGH 5C0CB 4UUJA 1CF8H 2IALB 2EE2A 1ZT4A 5E6IB 4NRZB 1RK0B 3B9KC 1J1OH 1OGTB 1EERB 1E4XH 2HN7B 1C12A 4KTEH 1JHTB 4FFWC 4XH2B 4OI8A 2LVEA 3V4VL 4PP1D 2D7MA 4JHZA 1OAYH 2NX5D 1RULL 5IBUB 5DJ6B 1MFEL 1G7LA 1G9MH 1AIFB 5CZXC 3C6SB 3BKYH 2RGSA 3DROA 3FAXA 3QAZC 3BGFC 4JPIB 2R23B 4L3EB 4XPFH 2Y25A 3BI9X 4PJXE 2VN4A 2VYRE 4P2RD 4M9PA 4PUBL 4I4WB 3SJVE 4FQ2H 4BQ6A 5ALCH 3VJ6A 3AB0B 4HGMA 3QFJD 5I16B 1DSFL 1RZKC 5DI8B 1VEOA 4YPGA 1AGDA 3N9GL 4N0FA 5IP4A 3IJHB 3NTCL 4HS3A 1T22A 4AMKL 3QZWA 3O3DA 1MVUA 5C0BD 5EA0H 5HGHB 1J1XH 1M1SA 4WEBH 5FDWA 4JO1L 4LLVA 1EPFA 2BC4A 3DGCR 4OUOA 1WAAE 3H0TA 5EFIA 4LSTL 2WWKT 3HI5L 1PY4A 4N5ED 4HIXH 1V3MA 1BBJB 1LO0L 1G1CA 3VFVA 4KZEL 2R15A 5DEFA 1LD9A 2JE8A 2VAJA 4JKKA 3V6OE 2W9EL 5FKAA 5BS0A 4CN6A 2EYTB 4JZJB 3B9DA 1INQB 1SEBA 2FJGB 5HHMD 5JQ6H 5CEZH 4U6VL 5LWYL 2OQJA 4FTVD 2QTEA 4G6FB 1A7PH 2HH0H 3C6LD 1FHGA 1S5HA 1Y0LB 3NIFF 3B9KD 1N5YH 2DICA 1K2DA 1NGQL 4Z7WA 3W0WB 3BXNA 3T4YB 3JZ7A 1NMAH 4OGAD 2IPUG 2VR9A 5DJCB 1WIPA 3RVUD 4MD5A 3K81A 1I7ZB 1YQVH 2F15A 5E99H 4ZUWB 1MCJA 1U42A 4NRYB 5BOPA 4P9HC 1NMBH 2COQA 2BVOA 4L8SB 1F3DH 4CMHB 5CZXD 2X4SA 1RSFA 5BVJB 5B38G 3MNWA 2XG4A 3QHTC 5JW4R 2HRPH 5BW7C 3UPCA 3GSQB 2NY6B 1NFDE 3WO3B 3L6FB 2YD7A 2VXUH 3MBEB 4S1SH 4C57C 4NYLA 2CDEB 1R5VB 3X12B 1AXTH 1ZHBA 2UZIL 2M2DA 4MGXA 3MV8A 1K8DB 1NC4D 1P9MC 4M61A 2YWZA 2R4RL 4U1HB 1N59A 2W0FB 3MCG1 25C8L 4JQXC 3CFKB 4ZTPH 4X6DB 2FGWL 1N3NA 4ZFGL 4DZBA 4Y2DC 4QRUA 4MNQA 2Q7YB 3PWUB 4ELKB 5FYJD 1OF2A 3QI9B 4M6AA 3QWRA 5DVLA 5CSZB 3F62A 3WO4C 5KSVA 4HV8B 1FVEA 3CK0H 2FX8L 2D31A 4QOKB 4LQFL 4F7PA 1PY9A 15C8L 4NQEB 4F80A 3SE9H 4ZUTA 1IAIL 4WENB 5FCUH 3FQUA 4IDJH 5J12C 3SDAA 4MMXC 1GH7A 1BREA 2DQEL 4CJ1A 3QIUC 5ERWB 4ETQB 1EUTA 2DQUH 4FXGA 3E6HB 3T0XA 4S10A 5HHOE 3T8XB 5KVDL 1A6VL 3C60C 3KS0J 4ZSOA 5GGQL 1T1WB 1PJ9A 2XZCL 2GIYA 4WY7H 3BT2H 3MLTA 1RZKL 4KI5E 5FHAL 1Y6NR 3BW9A 5DC9B 3HMWH 3E8UL 3O6KL 5JR1H 2OI9C 1IEBB 4LLUB 1ETZB 3EFDL 1OM3H 5ESAB 3S96A 5E8EA 1ZGLM 1AHWB 4X9GA 5FYJL 4K9EH 3K8LA 1KCSH 5JMOC 4YGAB 3EGSA 1XF1A 4OKVB 3BJLA 4N8CH 4YXHL 4OQ1A 4WEUD 2IMMA 5IR1A 3S98A 2NX5E 3UXFA 4G7VH 3MRGB 4FQIH 4XZUB 1IGIL 1KN4H 3BIKB 3KPPB 4WW2B 4X5XA 4YAQB 3UYRH 1RIHL 3VXUA 5M95B 4MA3B 1CFSB 2HJKA 1NLDL 3VXPA 4XBPA 1MLBB 4X5LA 2ADIA 2WLZA 1UB6A 3BKML 1A7NH 5EO1A 3G08B 4JDZA 9CGTA 2VRAA 4P2RE 2D03H 4V1DA 1YPZE 1FV1B 4J3VA 4GRMB 4U1NB 4Y2DD 4EOWL 1N6QL 3ZO0A 4LLDA 2ZCKL 3QFJE 3FRPG 3PHSA 4JPVL 2NY2D 2MHAA 1BM3L 2BSTA 2Q7NA 4FQLL 4KKCC 4PPTA 5DK2A 2R0WL 4PRBB 1F8TH 1P5VA 2O26U 5C0BE 3UJJL 2GTZB 1OAUH 3H6JA 3QIBB 3TIEA 1TQCC 3L7FA 4P9HL 4MJ4A 3CVHL 4L29A 5BO1L 3DVGA 3M8OL 4JY4A 5AZ2L 5HVHC 5IEKA 2VZUA 1U8IA 4XC1H 2WP3O 4JFDB 1IJ9A 2ARJQ 3H9HB 4G9DB 5T1MB 3RWIB 3AXLA 1Q0YH 4O58H 3W9EB 2HT3C 3QIUD 4KHXH 1PLGL 3H42H 3PHOA 1MCDA 1MCWW 2FJHB 1OOAA 3DXAD 3C60D 1CICB 4YHZL 5EIIB 3DRTB 3KPRB 4P5TB 3OKNA 1RJYB 4NKOA 3UTQA 1KPRB 4TTDC 1S7RA 5KBNC 2GKIA 4PJEE 1VPOH 1JGVL 3NIDF 5HHME 4FTVE 2WANA 5CGYC 3HUJF 1CLYL 1IQDA 4NDMB 2R56H 2QSTA 5DHVB 3FCTB 1JP5A 3AREB 5DGRA 1QBAA 1HSAA 4OF8A 2PYED 1NJ9A 1FFOA 1I1AD 4RDQF 2XPGB 5IB1B 1HIMH 5DR5L 3BP5A 4M3JA 3VFWB 2X42A 5BRZA 3FHQA 2QV2A 5GSVB 3ROLB 2FIKB 4LASL 1XGUA 1F6FB 2VH5H 2JJTC 2RR3A 5I19H 5D8JL 2QSQA 4CMMA 5GRJL 1PX4A 1QG3A 2YPKB 2ZWLT 5HI4C 3O6LH 4APQD 3OHXA 2DKSA 2AK4B 1OAXL 4HWZB 4NHCL 5DRZB 3TWCH 4AEFA 3GNML 4G9FA 2R1YA 4MS8C 1HILB 1BJMA 1U8LA 4NJAH 2AEPH 4L3CA 3Q0HA 1F4YL 2BNQA 4S11A 3EYSH 4UIMB 5CJQL 5DJ8A 4CRPA 2XWTA 2VZSA 3REVB 1X4ZA 4KKCD 2GCYA 1HXYB 4YHIB 1A3LL 1CK0H 3NA9H 5C2BH 5FYJE 2W91A 1U92A 1C08A 4QRRD 4I0PB 4OD3H 3SDYH 2VC2L 1JVKA 3OKMA 3AS2A 3EYQC 5BZWB 1FBIL 4HMCA 4DK6A 3MV7B 3MV11 4NQSB 3DVNA 3UCRA 1AGBA 3FFCD 4ELMF 5D9SB 3NBNA 4ZUUB 3GI8L 1U8PA 4PRPB 3VXMA 3KYNB 3O41A 4XPBL 3FQRB 5L8JB 5DJYA 1HZHL 3LV3B 1XR8A 4PY7B 4ISVA 1VFOA 4LCUA 5C09D 5FO9B 3P0VL 2F53D 2F54D 4XNXH 5HHVL 3MSPA 5C08B 2A83A 5D7LB 3VDAA 5CGYD 1C8PA 1RZJL 1D9KC 3PP3H 5EU6B 4KGLA 2OJEA 1I9JH 4PBVC 2Q1EA 1S9YB 2F9BT 3JV4A 6FABL 2I5YH 2DLFH 4OB5H 4QXGH 5GGSY 3JTTB 3DX7A 3PIQA 5CD3A 4P2OD 2H41A 4F15C 2FHCA 3SQBA 2APXA 1DBKL 4MXVE 4DUWA 5IT2H 2VQ1B 1BFVL 1P4LB 4XBGB 1RK1A 2H1PH 4HS8H 4OAWB 1PVHA 1JTPA 4MNGE 4XP1H 3GHBL 4JLRB 4Y4KA 4A2LA 1JN6A 4UINH 4KMTH 2AV7A 5EU3A 2OP4L 4D8PA 4F58L 4D3CL 2EDKA 5DDHB 5HI4D 3FKUS 1KIQB 3QQ9C 5D7JD 2BRQA 4R6UA 5DFTA 3M17A 3RUGE 1DQLH 3MRKA 3MYJA 3L3DA 3HZYA 1C7TA 4MS8D 5F44A 3D2UB 3UTOA 4HZLB 4RISH 5KN5B 4XNZB 4S1QH 4G43B 4R90H 4YR6A 1M6OB 2DTMH 4OCNC 3RNQA 4B0MM 3N06B 2YPVH 1J0KA 4GS7B 5E5MB 2CD0A 2CR3A 4R9HA 2HKHH 3RIFK 4CJ0A 2Q3ZA 3FB8A 3X3GL 4R8WL 3WJLC 3KNBA 1BVLA 2XQBH 1EO7A 5TH2B 3ARFA 3VH8B 2R1WA 1JFQL 1QEWA 1JNNH 2Q76A 4ALAH 3L3GB 1F02I 2EC9U 4F7MB 1EAPB 4X7CC 5ESVB 4X4YB 4OLZL 2YEZB 2NXZC 3L5WB 3V8OA 3MYZA 3KPQA 3BOVA 4N1EA 2ITCB 3EYQD 3LRHA 3KPMA 4XNQB 4KK8C 1ZA3B 4JANB 3SKMA 4XMLL 5IG7A 3MLUH 2WUBH 2FR4B 1NANH 2V5MA 1ZT1A 2QQKL 1VESA 4RQQB 1QQDA 2R0ZH 3TVMA 2H6PA 1J1PH 4MWFA 4GQ9H 3VCLA 1Z2KA 1A7BA 1H5BC 4OM0H 3DXAE 3LKPB 4RA3A 2KL6A 4IMLB 1XAUA 4I9WD 1D9KD 2EKSA 3BKJL 4DZ8B 1Z5LA 1D7FA 3PV7A 4FNLH 1YN7B 5IEHA 3LIZL 4Z77A 1XGQB 3LEXA 2BRRL 5I0ZA 1MFCH 3JV0A 5DEGA 3SKOA 4F7CB 3QUML 4Y5XC 4KHTH 2PYEE 3BKCL 3QG6A 1S7XA 2GAZA 1F45A 1P1ZA 3O3EA 3QUXC 2CO6B 2V7HA 1U36A 1MSPA 4IMKC 4Z7UB 4IOFC 5DSCA 2VDNL 1LP9F 1MI5D 1T7WA 4NWTH 5B4MD 1CFNB 3GJFB 4X7FC 4K71B 5DWUH 4QKXB 3QQ9D 5C2UB 1OARH 3H9SA 2NY3B 4RZCB 1MCRA 4R4BB 4FN0A 2J3SA 3TFKC 1MHHA 3TNMB 3RJQB 5I30L 2ICEA 2QR0B 4J23A 3VXRD 2G75A 3JV5A 3HE7C 3MROA 4I48B 4PJDB 5GRYA 1FZOA 1ZLVK 4PJIE 2OTUB 1DQQB 2DQCH 5I1JL 2N1KA 1HK6A 3SGKC 3B8YA 3I2CH 4UT7H 2BVQA 3OGCB 4WDIA 2RAMA 3QJHA 1QFWL 4K8RH 2LV4A 4DTGL 4YGVA 1KNOB 1WWCA 1P7HL 3G6DH 1KCVH 4AYFA 1RVFH 1SYVA 4ELMA 1A6UH 2IPKA 2ZOLB 4ZTOH 2YZ8A 4M1DL 3BYTA 3EYUL 2NXZD 2Y36H 4PJHB 5D72L 1F6LL 5BMFL 2XKNB 3RKDD 4ZPTB 4PJAE 3SO3B 3P0YL 4H1LG 4JG0L 4M6ML 5KVMC 5D1QB 4QRRE 3CVIL 1MELA 3SBWC 3DYOA 2F8XC 2AJ3B 3UTTB 4IRSD 4M8QA 1BZ9A 3TIDA 1TZIB 3QIWB 4QHNA 4EI6B 3IDMA 3OXRB 3FFCE 4Z9KB 5I6XB 3GMLB 1IL1A 4U1LB 4WUUA 2YD4A 3FB7A 1OCWL 5HJ3A 5IMLA 2VDPH 3VD3A 2CIKA 5C09E 1F3RB 1HH9A 5I1EL 2F53E 2F54E 4FQCL 4TSAH 2V5RA 2YD9A 2Z31A 3REWA 4JRYD 5AD0A 2WNGA 5ICZA 5CILL 1T1YB 4PRAB 3EOBA 1ZSDB 1VEPA 2CKBA 4NSKB 5DRWB 5HYEA 1BQLL 1L9NA 3QFDB 5T1DH 1I75A 3FMGH 3O6ML 2W65A 2ADJA 2W07A 4OT1L 4GW4B 5IW3A 3VFUB 5GRZA 3C8DA 1YUHB 1N6UA 2IFGA 2VL4A 3TZVB 4HC1H 2JKXA 2HVKA 4XB8A 4JN2B 5FK9B 1INEL 3BMWA 4OCSL 1ZLUH 3P9LA 3VXTA 1NCDL 3RWHB 3QRGL 2XA8H 4LSVH 2AEIT 4YFEA 5JZ7C 3MRJB 4OFIA 1Z3GH 3UBXB 1CE6B 3MA7A 3O11B 2XZAL 1Q94A 1U93A 4OLEA 5HTSA 2OL3L 3CH1A 2Z91A 5EBLB 1I4FB 5K9OA 5FUOH 1IFHL 4ZYKB 4Y5VB 4QY8A 4I3SL 2DQTL 3BD5A 2ZCLH 5D2NA 3HC3L 1MJUL 2CDFB 1FFQA 4PR5B 4K3HA 4PJDF 3OJMB 2Y6SD 3T0VA 3NVQA 4ODHH 3GI9L 3RY5A 5KSBA 3PP3K 4XCCL 3CU7A 1IEAA 3MACL 3I3DA 1BJ1J 4E41A 1OW0A 3VFNA 5EOCH 3VFTB 2W9LA 2IH3A 4J6RH 1CD1B 3MOAL 1QFUH 4GG6F 1KEMH 4TOYL 1A6AB 3QHZL 5D7SH 1IAIM 1T4KB 1GC1H 2IAMA 3LKSB 4WV1C 1OP3H 3FHAA 3HZVA 3B9VA 1KCRH 3RU8H 5ANMB 3CCHB 4XPAH 3C9NB 2QQNH 1OTTC 4I9WE 1LP9A 3TBTA 5ISZA 4PGDB 1XEDA 3GRWH 3BEVB 4XC3H 2A6KB 3QG7L 3WL9B 5C0JA 4FP8H 1UM6H 1G7HB 2Z35A 2JK5B 2WBWB 4LLYA 1DBBL 2JCCE 1TCRB 3BSZH 3D6GA 1IE5A 1XFPA 1A1NA 4WHTB 5IK3B 1RHHB 3HRPA 1F4XH 4TQEL 4U6XB 2IFFL 5DVNA 5DFWH 5HHNA 1YN6B 2Z9TA 2G9HB 3B5GA 5JZ7D 3IDYB 3QA3A 4C56A 3BDXA 3RWGB 1MI5E 2E8YA 1YDPA 3QNXB 2P5EB 1OAZL 3O3AB 1IC4L 4N8VA 4DGVH 2AW2A 2FWOA 5F9WB 2IPTL 2A6IB 4S0TD 2YA1A 5CWSB 3BN9D 2V5YA 1BBDH 1HHJA 3FO2B 5DJXB 4YXKL 3OJ2C 3ZL4H 4KVNH 2EDWA 4DGIH 3MV9A 4KJWC 4KTDH 3VXRE 4MJID 4JFFB 4YX2L 4HWBA 4IDLA 5L7XL 1DJSA 3QDJA 4G42B 5EZIL 1OP5K 3HLAB 1DFBL 3IU4L 1VFMA 1MF2H 3H9YA 1JZ2A 5CLWA 2YMXH 4N0CC 2V5SA 1JNHA 5TQ2H 4BA8A 1WJ3A 4G8GD 4FS0A 1H8OA 4JFPB 2AXHA 5BJTB 4K7PL 2I07A 4MXQC 4NGHL 4OLUL 3TN0D 3SDAC 5E1HB 1KYOK 4C59B 4KUCD 5EU7C 1BWWA 5IHUH 4WI5A 3B6SA 4NZUL 4KQ3L 1CTOA 1EVTC 1MAML 4L4VB 5F6IB 1CI5A 2VWEE 2W59A 4MJ6A 2DJ4A 3U4EA 4X0KA 2EEBA 3K7UA 2IBBA 4L8DA 2QQLL 3FT2B 2XRAL 5F9JB 5T33H 3MJ9A 2BY3A 3QDMA 4HKJA 3RHWK 3IKKA 5FKPA 1UGNA 1FZMB 4JRYE 3VWJB 2PR4H 4LU5H 4KPHL 4JPWL 3NOIA 3BH9B 1V3KA 2APTA 1NC2D 1BD2B 2VE6B 5SWSA 1AJ7H 3DO7A 4ODSH 4LHUA 1FG2A 3G9VA 1FORH 1GL4B 3EAKA 5F96H 5GGRA 1NGZA 2AERT 2VQTA 5L0QB 4FRWA 5DK0B 3RL1B 2X9WA 1ZLSH 4P49A 5IQ7L 5DZOA 1UACH 1U95A 1ZHLA 4ZFOB 1I9IL 2L4OA 5JNYA 2VLRA 2XN9B 1CL7H 4QXTA 2OJZL 5JORB 1D6VH 3HNSL 1ZVSA 1TJGL 1CF8L 4NM8H 5TDPB 4CVXA 4KMQA 1FZKB 4KJWD 4XP5H 2ATKA 3RBGA 3MFFA 3QUKA 1CT8A 5FM8A 5MEQA 1E4XL 5DURD 2UZXB 3QWRD 4KTEL 4LIQL 3P2TA 4LCWB 3WFEH 3BDYH 1GGIL 3HG1A 1X6LA 2X4PB 2CLVB 4IRJA 4GG6A 3LMJL 1T1XB 5JO5A 5INDA 1PG7X 3QNYA 1ZAGA 4MB5A 4QRSA 3LPGA 43CAB 1F2QA 1RAMA 4OBSA 1YEEH 1D3CA 5TE6L 4MXQD 1NCUA 4YH6A 1AH1A 1RUQH 2H26B 1OAQH 5E1AA 5C6TH 4GXUM 2FH8A 1DLFH 5IFJA 4N0YH 4XPFL 4NFCA 5C6PB 2GW5A 5JHLH 1VB9A 4FQ2L 5DQJA 1SMOA 3S88H 5ALCL 1QR1A 1FLRL 1C1EL 4ZPVA 3RWDB 4A2MA 4KROC 2F5BL 3LD8C 5FOBA 3MUZ1 1P5UA 4OLWL 3QPQD 3S37H 4ZFZB 4M62H 5EA0L 1J1XL 1T0NB 4ZFFB 2CPCA 4K9EC 4WEBL 5J3HC 1QRNB 4HPOH 5KS9B 5KSAA 4W6XB 4B5EA 4P46D 4I2XA 3D39D 2AJUH 3GIVA 4KRNA 5DC4B 4HIXL 4P5MB 3TNNA 3BZFB 2HRLA 2HJLA 3U0WH 4JZOA 3P4MB 4JZNA 1T66C 5DD6B 2V2TB 3IDJA 3TJEH 1DQTA 1PKQA 4C54A 3QXWA 2OMNA 2W0PA 1TVHB 3IS1X 2OR7A 2MQ3A 4RAUB 3BP7B 2DQGL 3GJEA 3VXUD 2FDBP 4HUVA 5D71L 3NCYP 4H1LH 3MRPB 4BSWB 4R3SB 5JQ6L 1T89A 1Q9OA 4OZGF 1EEQA 3R0NA 1FPTH 1NDGA 4PJFE 1A7PL 4NQCB 3AUVA 2HMIC 3VFSB 2YXFA 3B2VL 4RNRB 3E1F1 1RUKL 3P4LA 1AGFB 3ARDA 5F88B 3RVWC 2RB8A 3UTZA 1F4WH 1TZGH 4MJIE 3BP6B 5D96B 4ORGB 3T77A 2BMKB 4ZXBB 2UWEF 1WICA 1G7IB 2Y06H 3PWLB 3LVEA 4FMFA 2DB8A 3BWUC 1FVCA 1WWBX 1NMBL 2FBJH 1BPVA 4TUJA 1BFOA 3G6JF 4P3DA 1T0MB 4YXLH 2WWMC 1IAMA 3KYKL 2HRPL 3RGHA 3MLSH 5CCKL 3VXOB 1CGSH 4G8GE 3IXTB 4JHAL 4LF3B 2VXUL 4S1SL 4Y89A 2DM7A 4U1KA 3IDGB 4XTRC 3DSFL 3LDBC 1F58H 1AP2A 1S7QA 4G3YH 5C0FB 3QUZB 3BESR 1QSVA 1S7VB 4FQQA 1I8IB 4NQUA 5C9JB 4MA1C 3SDDB 3OAYK 1IGJA 3V4UH 1VGKB 1YEFL 5F21B 3GSNH 3O45B 3OKLA 1S8DA 4R4FH 3C5SB 4LIQE 4BSVA 5C0AB 4RGMC 4X6EB 3KPTA 3CK0L 3MNVB 3TJHD 1EEZA 2DLGA 1DTUA 2BVPA 4RFEB 4Q0XH 3F5WB 4JE4B 2QL1A 2H9GA 5FM5O 5D2LF 3QDGB 3SE9L 4DUVA 4V2BA 1T66D 5CP3A 4Y4KC 1I8KA 4X4ME 4P4RB 2R2EB 3SGJC 4PJ7F 4IDJL 3R1GH 5GRWA 4NP4H 4XPTL 5TE4L 4C58B 2DKUA 2DQUL 4P48A 4WHYG 2W92A 5CINL 3PGFL 2VDLH 2NPLX 3PQYA 3OKYA 4DCQB 1T5XB 3MRQB 5I15H 2HMID 2BNQD 5ICYA 5T1KB 1OSZA 5ID1B 3QEQB 4RDQG 3MRRA 1M7DB 2C9AA 4JO3H 3D0LA 3T08A 4RGOL 5C07A 3STLA 3N1FC 1OM3L 3VDBA 3C5JB 3D3VD 4S1DC 3ARFC 5J13B 4JPKH 4K9EL 3I75A 4L8BA 1KCSL 4PYGA 4YHYB 1G9EA 1MCPH 1ZEAL 4HGWA 5EC2A 2ZJSH 3OWEA 2GUOA 2BP3A 4H20H 1T03H 1FL3B 1JNLH 3GMQA 4N8CL 1JCKA 1QFWM 3L7EA 5T3ZH 4GBXA 3V5KB 4K94C 1KN4L 5HYQA 3LEVH 3VXMD 1EXUB 3B3IA 4DQOH 1LO3L 2AXGB 4EXPX 4PRHA 5F3HA 3TVMC 5EU7E 4H8WH 4LDLB 2X6MA 2EZ0C 3N85L 3EO9L 5JIPA 2D03L 3SE3A 3F6LA 1A9EB 2PTUA 3SKJH 2R2HA 4XVSL 1OSPL 3F7YB 1OVZA 3KG5A 3FOLA 2W38A 4UZGA 3IDXL 2CRIA 3V4PH 4PRNA 2G5BA 4LSUH 1DQMH 4NIKB 3K1DA 1F8TL 1UM4L 3VG0H 4UDUA 2DQFA 5B3JE 3AROA 3KYOB 5D5MA 1OAUL 2WM0A 2XG5A 4HBCH 3MRMA 4Z8FH 1X7QA 1KIPA 4ONFH 3VRLF 2VO5A 2VZTA 2GTWB 5ALBH 1C16B 4OZGA 4L4TA 1J05A 3D39E 2ZKHL 2N56A 1SYSB 4XC1L 2LU4A 4GAJL 4FQHB 1Q0YL 4O58L 2IADA 3TBWA 1UYWL 2A6JB 4KHXL 2R0KH 3OAZH 3WDIA 3QCTH 1O5DT 4CVWA 2ZG1A 3PV6A 3MMEB 1U8OB 3VXUE 3VMPA 2UWEA 3GSWB 3HC4H 3VDCA 4P5KA 1P6AB 4LBEB 3T1FB 1KG0A 1VPOL 2P7TA 4WWKB 5IB4A 3QJFA 5EOTB 5HPMB 1N5AB 1KIRB 2NTSP 4JQIH 1UZ8A 2R56L 4CN1A 4S1DD 5CSBA 2C4XA 4Z5RA 3W2DL 3LY6A 5I1GL 1YMMA 1E0OB 1MJ8H 1Y18B 4O51A 5F1OB 1X5YA 2DQJH 4DVBB 3IYLW 1Z9MA 2EC9T 4X6CB 4NNXA 1ZLWK 3SGEI 4M6OL 1KLGB 1HEZB 4U3XA 4PREA 5JXAH 1H15A 3ROOA 4NPYA 1F6AA 2EKJA 5A16B 2VH5L 3G5ZA 3CDYA 3Q1SH 3SOBH 2E3VA 2EYSA 3BP4B 2HA1A 2VKWA 3GSOA 4N8PA 4NHUB 1EJ6A 3TVMD 2EZ0D 2PW2A 3T04D 3ARXA 5J6GB 3TWCL 2GHWB 3NACH 3ARPA 1NGXB 3VI3E 1FDLH 4NJAL 2BNRA 5INCB 4EUPH 3E0GA 3LQAC 1I3VA 3EYSL 2CDGA 2P48B 1NDMA 2Z31C 4XAKD 1KTDA 5I18H 2JF1A 2G5RA 1IT9H 4Q9RH 1CD8A 4HFWB 3GDBA 1NBVL 2NZIA 5I1HH 3NA9L 5C2BL 3DSNA 2YXMA 4LKXB 4YK4C 2AQ2A 4L5FL 3ZT6A 3DX8B 4PGBB 3PABA 5ENWA 3SDYL 4LSQL 1BFTA 1FL5B 1W0WB 1WQVT 3U9UA 1P7KA 2YSSB 2NY1C 1XF3A 3H7BB 4D0DA 3GGWB 4OQTH 3S36X 2O5ZL 3DV6A 4R97B 3HPJA 1NEZB 4K94L 2VLLB 2VXSH 2GJ6D 1KJMA 3LQMA 3C09C 2VXQL 4PJ5D 3WIFB 5IKCB 3NZ8B 1UC6A 4IS6A 5AAWA 4X6BA 1X44A 4X4ZA 4QTHB 2BJML 1HKFA 3P4OB 1XIWB 1IGYB 3L5IA 1BF2A 5AG9A 2BNUB 2BNQE 4PJ8D 4WW1B 1Z0MA 4XNUH 5D2NC 3SQOH 4DEPB 1TTFA 3O4OB 5DS8A 4OZIF 2I5YL 5KANG 2DLFL 4NN7B 2ICWJ 3CUPA 3D3VE 5EPMB 5LAXA 4BH7B 3U79A 3CDGA 5IT2L 4FQPA 5C0EA 3WIHA 1MFDH 2V5TA 2H1PL 4HS8L 4AENB 3LKNA 2KPNA 4MSWB 1N4XL 4OZHB 1G0DA 4KMTL 1IQWH 1PD6A 4U1MA 4DN3L 1OW0C 4AIXA 3K0WA 4HIEB 3P30H 2VISA 1H3UA 1HDMB 3DJ9A 5EZLB 1A14H 5EN2B 2DWDB 3VXME 2ICWI 3IJYA 1MREH 4PTUB 2ZP0T 3HR5A 2MOVA 4QHKJ 2YHGA 5LGHL 2ERJC 3WHE1 2DYPD 2IAMC 4XP4H 1Q8MA 4N8VG 4S1QL 3PP4H 4EUPA 2DTML 4NO0B 3OKDA 5DTFB 2RJMA 2FL5B 2Z31D 4YE4H 5GJTL 4NQVA 2VSCA 2HKHL 4HJGA 2PO6A 5F72S 3V5HB 1N2RA 2DTSA 4QHLB 4UB0L 1XCQA 2FJFB 5I66B 4ALAL 2QKIB 3CSGA 3VH8G 1XGYH 5D6CB 5C0CA 4BK4A 4QHKI 2XXMB 3IAGC 2H8PA 5FXCH 2E8ZA 1HNGA 2NY1D 5MEOB 3MLUL 2HN7A 3KXFA 4PP2B 4HG4J 3GBNH 1H0DB 1U8KA 1QSFB 4XH2A 3P11H 1YECH 3GEWB 2VR5A 4RFNB 3MR9B 4NO3B 1F97A 4URTB 4U1GB 2IG2H 1EZVY 2AV1A 1J1PL 5DHYA 4GQ9L 1UWXH 1AIFA 3GMPB 4OM0L 1KPVA 1M05B 2P42B 4HW6A 5MERB 4GJTB 3IT8D 4DGYL 3L3JB 3VXSB 3OKEA 4GUPA 4K8RD 4L3EA 4FNLL 1TLKA 5CEXB 1KB5B 5D93B 3LZFH 5HHXL 4I4WA 1MFCL 2CKBL 1X5JA 4X5WB 2ICWB 1SMAA 5DI8A 1QLRB 3G6AA 1HYSC 1RIUL 1WLHA 5CGTA 1WF5A 3MOBH 3PXHA 4D0BA 4J12A 5E5UB 1KUMA 5KVGH 4E41D 1WISA 3MLVL 4NWTL 3V5DB 2FX9H 4G80A 4NBYB 4LHUG 1RJZA 5DWUL 5MEPB 5KVFL 4FQXD 4LPTA 2RCSH 1ADQH 4JREC 2P5WD 3RWEB 1TVDA 2IANB 4QRPD 4LCCB 4GMTH 4JDVB 5C0RL 2Q20A 3CLEH 4OZHF 4HS6B 1BBJA 3MRDA 1J8HD 1KIUA 5FYLL 4R2GC 4GAGL 1IBGL 4Z7VB 5DK3A 3WS3B 1UXSA 4U1IA 1FFNB 5DRNB 1MCBA 1F3JA 2ADFH 4I0KA 4NT6A 4NNYA 1JZ7A 2A9NH 1H3VA 3OAZK 4OCMC 4UT7L 1K4DB 3TA3B 2HAZA 3RGVB 4XP9L 4XAKE 3G6DL 4XNYH 2FJGA 1G7PB 4YBLB 4YDLB 1RVFL 5FGCE 3MRLA 3G5VB 2W60A 2VQUA 5DJAB 4MX7B 2PUQT 4EDWH 1JF1B 5DVKA 2AP2A 1Y0LA 5IHZB 4TSCH 4FA8A 3OX8B 1GZPB 5DJCA 4YDKH 1D5XA 4ZDHA 1WUNT 4M6NH 2CGRH 3VFMB 3NPSC 3ZE0F 5IF0B 4LEOB 3QRFM 4Z7OF 3H9SE 4OZIA 5DXWA 2NW3B 1MAKA 3MCLL 2GJ6E 3C2AH 2EE6A 1FO0H 2FYYA 3ESVF 2VDPL 5E8NA 4LP5A 3MBEA 1ZVYA 1NCBH 4XVTH 2CDEA 3QDJD 4X99B 1HHIB 3IS0X 4OCXL 5DJ0A 2FHFA 2E7LA 2D7PA 4I8DA 3JV6A 4QNPF 1B0RB 3KDMA 3A6OA 5AUMA 1QTYT 4IRJC 2WQRA 3ZKSD 2P44B 1TDQA 1HYSD 1CE1L 3CFKA 4G6JL 2SEBB 1ED3A 4HC1L 4LFHG 1Q72L 4K2UH 2YA2A 2I9LA 3OZ9L 2Q86A 3JBG7 1HQ4A 4MDIA 4QOKA 4HK0B 4RMWA 2GSGB