1FN4A

Crystal structure of fab198, an efficient protector of acetylcholine receptor against myasthenogenic antibodies
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
211
structure length
211
Chain Sequence
DIKLTQSPSLLSASVGDRVTLSCKGSQNINNYLAWYQQKLGEAPKLLIYNTNSLQTGIPSRFSGSGSGTDYTLTISSLQPEDVATYFCYQYNNGYTFGAGTKLELKRTAPTVSIFPPSTEQLATGGASVVCLMNNFYPRDISVKWKIDGTERRDGVLDSVTDQDSKDSTYSMSSTLSLTKADYESHNLYTCEVVHKTSSSPVVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOCLONAL ANTIBODY AGAINST ACETYLCHOLINE RECEPTOR
publication title Crystal structure of Fab198, an efficient protector of the acetylcholine receptor against myasthenogenic antibodies.
pubmed doi rcsb
molecule tags Immune system
total genus 31
structure length 211
sequence length 211
chains with identical sequence C
ec nomenclature
pdb deposition date 2000-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fn4A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fn4A01
5IMKA 1NMCB 3GBLA 5E2UL 4QHNB 3VGAB 5KSVB 2G2RA 1S9YA 5ECJE 2OL3B 2EH8H 1KFAH 5TF1L 5C0JB 4MNQB 2EC8A 1E6OH 3D9AL 4WWKB 5E6IA 1LO5A 1JGEA 3RZCA 2XPGB 5CINH 1XCTB 1RIHL 4Z7OE 1A6TA 4X4XB 5EU7C 4ZODA 1YECL 4G7YH 3GGWA 2WIIA 1G7IA 4KQ3L 1SEBA 5JDSB 5CLTA 3IS1X 4HPOL 5C2UB 5IFAH 2HKHH 4M48H 3LKQA 2CRZA 5JR1H 1KCSH 2MJWA 2GJ6D 3HRPA 4Y16D 1FAIL 2GY7B 4U6VL 4WI9A 4HH9A 1NCTA 2V2WB 1OAZL 3CIQA 3MLTA 1CT8A 5C07B 3UXFA 1FN4B 4BSJA 4F2MA 4DN4H 5DD6B 5GRJH 1MCWM 5AWNH 4NWUL 3N06B 1A7RH 4X5XA 5FV1L 5DMIH 4AH2B 3ETBF 4N9GA 2OTWB 2VOTA 3UTSD 2XOTA 3T8XA 3EOAA 4PRPD 2W0KA 5BS0E 3WXWL 2VDKL 3ULUL 5HHPB 5I15L 2G60H 4OZHB 3QNZB 2VE6B 3QAZB 3HZKA 3OXSA 4Z7VB 1U8OB 4DKFH 2OR8A 3SDXF 2J8OA 3X11B 2IBZX 4WCYL 5IT2L 1WK0A 2DBJA 3HI1B 3ARDC 1T89C 1TVHB 2VXTH 3KPMA 5MENE 1D6VL 5JORA 2A9NL 3ROOB 4BM7A 2ATKB 2VLLB 4LU5L 2VLRE 4LAJH 3RPIB 5IMOB 4OZ4B 4XX1G 4M4RA 5HYSG 5ANMA 4D9LH 4PR5A 3TNMB 4NQSB 1BBJA 1YPZA 1QLRB 1QLFA 3QDGD 4XHQA 3RIFK 5I0DA 1IQDA 1A8JH 3FKUS 1G7QB 2Q3ZA 2MQCA 2J8UF 4GAYB 1YNKH 4EDXB 1WICA 1J87A 4LIQH 1YYLH 1QBBA 4PJDA 3FHAA 1OAXL 1NAMA 3IDMB 4KVCL 1DUYB 1NCAL 2NLJB 2BSTB 2ARWA 4JFFD 4WV1B 3B3IA 2OJZH 2HVJB 3MTRA 4Y4FD 1S8DA 3V4VH 3FQUB 4WFGD 5IQ9A 5GRZA 4JG0H 2IPUK 2BSED 1HZHL 1OHQA 4V2BA 1JN6B 1A7PL 4JRXD 1LDPL 4PJCF 4UT7H 2GJ6E 1A3LL 5I1CL 4XNYL 3IFPB 4HKJB 5F97E 5ILTL 1NKRA 3BJ91 3QWRA 4HFUH 1ZKAA 4LCCB 3WMSA 1N59B 1S9XA 1L7TL 5C0IB 3MLZL 4LQ1A 4MCYA 5SWSB 3SGDI 2PO6C 3PGFL 3OKMA 3BX7C 1MPAL 1ES0B 4YHOH 2B39A 1LDSA 4B53A 3S36L 2R39A 2XI9A 1JNHA 4PRPE 1MF2H 4NKIL 4IHOA 2CDFA 4XP1H 1X4ZA 1OT2A 1ED3B 5IJKA 5E9DB 4L8SC 3QWOB 2OX5A 5KVGL 5EORL 5BZWA 5EPMB 5JPNA 1K3ZA 4EI6A 1LO3L 3AB0B 3ULUC 3MACL 1Z0MA 2YA0A 4MA1B 1FZMB 4NRXB 3GJFB 1EGJA 1IKNA 2XWBB 2EECA 3MRDB 5FUZL 5C8JB 2WBJB 2ZCHH 1S7SA 4HS6B 4P2YA 9CGTA 4LBEB 1UM4L 4U1HB 4R96B 5JHDA 5HHMD 4JPWL 3C5ZA 1FO0H 4H1LA 3SDAB 2PTVA 2HT4C 3QDGE 2YN5A 4KUZH 3T4YB 2D0HA 1IARB 3HZYA 4LVHC 4YE4H 1F4XH 5E8NA 4UUJB 4L4TB 4ETQA 1DQJA 1F90L 4UT6H 1MHEA 3SKOA 3K4AA 1DANU 3TO2A 4ZUSB 5IB1B 1N4XH 2XTJD 2RFXB 4H8WC 5ALCL 1UC6A 4M93B 3OAUH 5DD1L 4P3CL 3O2VL 3E6HA 4RDQF 5C0ND 4JFFE 3DVNB 4J1UA 3RL2B 1MJJA 1HINH 4TUJA 3R06A 4PV9B 3WIIL 5FDWA 1OP3K 4WFGE 4M7KH 1ACZA 4G5ZL 1QBLH 3PP4L 5CJOL 2DI9A 4P5KB 1TZGH 3FO2B 1OM3H 4X8JB 4ZO8A 3ARBB 4PGDB 3NFPA 4G8IB 4PLNC 1HXMA 4NP4H 2R0WL 2CLRA 3HE6C 3NIGF 4LPXA 4ODVH 4Y88A 1CLZH 1EFXA 2YBRA 4G3YL 2BHZA 4OLUL 1ADQL 4PP1C 1KJ2B 4M5YH 3VXPA 4I5BA 3RFZC 4L1HA 3EOBA 1NANH 2VZOA 3MBEA 3MRCB 2JE8A 5FOBA 1A7NL 2FJHA 1QFWI 2IPTL 3DYMA 3HE7B 5HGHA 4LOUC 3B2UC 5BV7H 4GRLB 4FQCL 2DQIH 2H6PB 4HV8B 3BP6B 3HTLX 2JTDA 3GMNB 4QF1B 3UTQB 3L3IB 1LK3L 2DD8H 2Z31C 3KAAA 2B2XL 3VW3H 3LN5A 3QWRD 5E2WL 5DRWA 1IGYB 1NMCC 4E0RB 3D69B 3TIDA 3VWJB 3VGAC 1QKZH 1MSPA 4X9HA 3N9GL 4A6YL 5J3HC 1QBAA 4IRSB 1EO7A 5L8JB 2AJSL 4WWKC 1YEHL 1X7QA 4WIQA 4QRSB 3VDBA 1RIVL 3UYPA 1KPUB 4HW6A 3O3DA 3WS3A 4CVXB 1VGEL 2X9WA 4EQ3A 4UNUA 3MJ8A 1ITCA 3MYJB 2QQKL 3W82A 3MGTB 1CR9H 1NGPH 2MFNA 2VZ1A 1EHNA 1MWAA 2EC9U 4HX1B 1JP5A 2EH8L 1KFAL 5HHME 2X4PA 1KCVL 2ARJB 3CJJA 4BFIB 3DV6B 1N2RA 2R9HC 4TSBL 5DQ9A 3BN3B 4PJGA 5EWIL 5A43C 4G7YL 1KLFA 2D03H 2YSSB 3BUTA 4QRUB 5TGBA 2NZ9C 2A6DA 2V7NB 3DX9B 1CTNA 1MHPL 3BPLB 1H3TA 2HKHL 3H3KA 2X5PA 1I1YA 1WEJL 1KCSL 3OMZA 3BMVA 3BQUA 4PJFA 5DRZB 2AABH 5IGXH 4JFZL 4EUPH 3V7MA 5HYQB 3VA6A 2BNQB 2M1KA 4M43H 2EZ0D 3TIEB 3QEQA 5JHDD 4G6ML 5B39B 3TFKD 5LAXB 2P8PA 5GRJL 2EXYD 3DMMC 3STLA 3C5ZD 5AWNL 4XNXH 1NBZA 1RV6X 1YPZE 1A21A 3NZ8A 4Z7UB 3LEXA 3UPCA 3QAZC 4ZXBA 3GSNH 3WFCH 2VDPH 3F5WB 5ACZA 1EJ6A 5C0AB 5F1OB 5EB9A 4BH7A 4K3EL 4FXGA 4NWTH 3V0VA 4PJDE 2VLMD 5E8EB 3HRZA 4R7DB 4MJ6B 3VDAA 3MV9B 1DBBL 3IDUA 3SBWA 4L8BB 4TPRH 4NKQB 1TJHH 1INDL 2RB8A 2I9LB 3GMMA 5EOQH 5FKPA 1JZ4A 3BZEA 1CBVH 1A6WH 1JTPA 4DKFL 2H3NB 4ONOA 1J11A 2A0LD 4P59H 4XP6H 2DWDB 2DRUA 3GMLB 4DAGL 2VXTL 1S3KH 1RU9H 3N1FC 2XYCA 4PJEB 1IGFL 2AJVL 3HCVB 1G84A 4RZCB 1Y0LB 1UXWA 2YRLA 1S5HA 4Y4KA 3N1QC 3RJQB 2VZVA 4MWFB 3WUWA 3ULSB 5BO1L 2E9IA 1A6UH 1YEDA 1EFXD 4QRRB 4Y19A 3OR6B 1SHMA 4KV5E 3GSXB 5HYIA 4GUPB 3DX8B 3FB7A 5F6HJ 3MBED 3SY0A 4AZ8A 2UZYB 1BWWA 2LV4A 4Y7MA 4HWZB 1QEWB 4WV1C 4RFNB 5B4MD 2W0LA 3V6ZA 1YYLL 1X5GA 1PKOA 5DJXB 5T5FH 2VUYA 2BC4A 2GFBB 1CL7H 4M7LT 4PJXB 1JNNH 4LAQL 5I16B 5J8OA 1KJ2L 5JMRA 1TZHA 2WZPD 3ZDYF 2VXVH 4R8WH 3WXVH 4F33B 4TN9A 4LCCC 4X98A 3V4VL 3B43A 1KJVA 3OX8A 2BVQA 3PG2A 4GAGL 3VXNA 1J1OL 1GPOL 3MV8B 4CMHB 2V5TA 4PJ5D 3MRKB 4DVRL 4UT7L 5FV2A 4L3CB 1RZ8A 3PIQA 4K7PX 4HFUL 1LE9A 4PLJD 1JPFA 4NFBA 5JHDE 3IFOB 3FN0L 3WS6A 4NN7B 3VXUE 3L5WB 1UYWH 2NX5A 1I7ZB 3SGEH 5K9KA 3MODH 2VISA 5TH2B 4O02H 4YNYA 3EO9H 7FABL 3ULUF 4LSUL 4GLRH 3IDNB 3A6BL 2W9DH 5IBLC 2VLME 3GSRA 1K2DA 5K9OB 3AB0C 1G6RA 4NJ9H 4MA1C 1EMTL 3J7HA 1T4KB 4XCFH 2I07B 4NKOA 2CKBA 1BMGA 4S11A 2WBJC 4G8FA 3TBTB 1HXYA 3QEQD 4KMQA 3U0WL 2I25N 5FB8A 4AY0A 3WNKA 1LGVA 3EJYD 1H3UA 1MRCL 1KTLA 5DHVA 4UTAL 1IFHL 1FZJA 3SDAC 2AS5M 2LAAA 5FHBH 1OAKH 1NDMA 4ZXBD 3V5DA 5IFHH 1T04B 3L3GB 1H3XA 3STZB 4XVJL 5I1IH 5IW1A 3VFPA 4WENB 3W0WD 1FO0L 2Q76B 4YJZL 43CAA 3GUTB 4M93C 4KUZL 4ENED 4RIRB 1DR9A 4YE4L 4KK9C 1OSZA 3CNKA 5I66B 3IFNL 4QTHB 2VC2H 4WFHD 3IGAA 4M1CD 3WIHA 3LRHA 1CF8H 3NTCH 3S34H 3GIVB 4B7LA 4ODSH 5SWZB 3IVKB 2AJUH 2R69H 4TTDD 1FGNH 5E8PA 5IHUH 4Y4KD 1YY9D 3ARBC 3FOMA 1BF8A 1F6AA 1QG3A 3GM8A 5C9KA 5MHSD 1R3KA 5K33A 4J2XA 2DYPB 5B3JE 1UWGH 4F58H 3QUZA 4PRHA 3MBXH 3VG9B 4Y19D 1JWUB 3BEWB 4P23A 4YHNB 3HLAA 1OM3L 3BKJH 3PL6B 3KPRA 2HFEB 3MNZA 4ZPVB 1JWMB 1MCPH 5HJ3A 2X7LB 3MXWH 2UWEF 1IEBA 4PLKD 4NP4L 1LD9A 5AZ2L 3T0AA 1OSPH 1UG9A 3HE7C 4Z8FH 3OKOB 3KXFB 1E4WH 5T3ZH 4GRLC 1QHPA 4PJ8A 4PBXA 5GZOC 5HY9A 1JUFB 1XGUA 4PJGE 5AUMA 4OCSL 5JW5B 4I3RL 2YA2A 1G0YR 4K71B 4PRIA 3LS4H 4UV4H 5KAQF 1Y6KR 4KMLB 4XXDA 4MXQC 5F9JA 5BQ7B 3P73A 4DUXA 5BV7L 2JELL 4P5MA 4IRSC 5C08B 5AYUH 3KLHD 5L0QB 2FB4H 2YPKB 3G6JE 1SY6H 4WUUA 5DEGB 1S9WB 2JK5B 1ERNA 1KNOA 1D6EB 1QKZL 5DHYA 3ILPB 4LPYA 1AGDB 1E6JH 2ORBH 1ZOXA 2OBGA 2RQ8A 5T3XH 4Y8DC 1U41A 2NX5D 3ZDZE 5C86A 4PGCA 2CJUH 4U1JA 1YC8A 1JTOA 4GRWE 3IXTB 4Q9RH 3GZKA 4M6OH 1H0DA 3EKCA 1JZ2A 4WW1B 1REIA 1IKFH 1FJ1B 2YUVA 4S1QL 1EAJA 2CK0L 3BPLC 4MVBD 5AZEH 2WW8A 5C0RH 1SJHA 4MCZB 5I8OL 3PWNA 1UH4A 2ZSWB 2UUDH 2WV3A 2UUDK 4OCYL 2CDEA 5F7KC 5DSCB 1U93A 4H26B 3DURA 3PNWA 3FT4A 1WIOA 1HDMB 4OZHF 2V5YA 2P8MA 3V0WH 3G6DH 3K2UH 5BZDA 5FHAH 4Z7VF 3SO5A 1D5ZA 2C3VA 2FR4B 3GMRB 5A16B 1MFAH 5BVPH 3OKEA 4EUPG 4Q9QH 3GSQB 3QWQB 4NQEB 2QSVA 4KKAD 3AAZB 4FOMA 3BAEL 1J1XH 4P9MH 5ITBL 2XA8H 4RGNE 2NY4D 4YHMH 4ELMB 4EZMA 2X4QA 3WLBA 5I1GH 4HF5L 4DGYH 3EO1B 3RVUD 3KLAB 4NJAH 4GG6E 5DJCB 2Y06H 1C5CH 3VDCA 4N90D 2X41A 4PJHE 3UPRB 4NZUL 5JA8B 1AXSB 1R3JA 2YPVH 3CVHH 2WM0A 4XCNA 4NKDA 1MFNA 5J11B 1JVKA 4KPHH 2DKMA 1II4E 3FQXA 5TE7L 4EOWH 4TPRL 2HWZH 3D1MC 1MCBA 4YDKH 1KELH 4PS4H 4BQ9A 1VDGA 3WN5B 4OIAA 1CGXA 1CBVL 1NLDH 1DEDA 3QUZD 2C26A 5JQ6L 3BVNA 3CK0H 1HHHB 1U8IB 4P59L 4P23D 3BN9C 3QUMB 4PD4J 4HIEB 4LCUB 3I6LD 5KOMC 3KPRD 1S3KL 3I75A 3GRWA 5IVXB 4LPVA 2XXCB 1Q9LA 4C54A 4WGVB 4L29B 4R3SA 2P7TA 2W65B 5ABDE 1FC2D 4RFNC 5DEZA 1DEEA 2A74A 1MAJA 2OXHA 4X4ZA 5D1XA 2NX5E 4PJ8D 2QQNL 4J3TA 4MMZC 5H2BA 3UZVB 3WE6B 1S7WB 2VITA 2H32B 4W6XB 2IPKB 5F3HB 5IG7A 4Z95H 2XZZA 1NSNH 1DQTA 1L0XA 3MV01 4PG2C 4PRID 3PHOA 2BOCA 2CQVA 4M03A 3U6RB 3O4LD 4E9LA 1G7HA 2PXYA 2LVCA 3CSPA 1RZJC 1RI8A 5F8QC 2J6EL 1JNNL 1RJLA 1Z9LA 2PYFB 3RWHB 1FNGA 3I3DA 4R8WL 2UV3A 2GQHA 3B8YA 4JGMA 3WXVL 1INQB 2HMIC 1W72A 3QXAA 2E9BA 3SPVA 3Q48A 1HILA 4XPAH 1SJXA 2G75A 4NN7C 1AIFA 1ZS8A 1D5BA 5DRNB 4LKCB 4X4YB 1VA9A 4NUGH 3SE3A 4F7CA 3MFFB 3MOBH 4YBLB 4LPUA 1Q9WB 5HDLA 2B5IB 1BP3B 3VRLE 3S98A 2DIBA 4FMKA 3F62A 4S1SH 2HN7B 3AUVA 2I26N 2X4UA 3MODL 4O02L 4P46A 4N90E 4Z7QF 3QO1B 2JJSA 1CGSL 5DWUL 3LQAC 2NXYD 2YK1H 1MJ7L 1CD9B 1NCDH 4JFPB 1KUMA 4KK8D 4O51A 1SVCP 5F6IB 3QZWA 5I17B 1QOKA 1XMWA 1NEZB 5MP6L 4XCFL 4OCRL 2XRAH 3OKDB 1OAUH 4NQXB 4KROD 1Q9KB 4LMQE 3FQWA 1OP5K 1T5WB 2IBZY 1F13A 3PWJA 4PRHE 4KDWA 3OGOE 2QQLH 1ZTXH 3I6LE 3SGJA 5EZIL 4LLUA 4XPBH 3BDYL 1OAKL 4XP5H 3KWWB 3WFEH 5BJTB 4D9RE 1VHPA 5C3TA 4MQXC 1JRHL 2CXKA 2F19H 1KN4H 3ME0A 2NMSA 5I1IL 4X6BA 5EZJB 4XBGB 4ZO9A 4MD5A 1F4WH 1KIRB 4X5WB 3D18B 4Z76B 1IAIM 2B4CH 2GUOB 3MV7A 5DUML 1CDBA 1G7LB 3SE4C 1N64L 3T1WA 4GO6B 4KKNA 5JA9A 2BOBA 2VL5B 2VMFA 4PRIE 1ZE3C 3G9VA 3MUJA 4U1NA 1CF8L 1JGUH 4NGHH 3S34L 3NCEB 3D85B 2H1PH 1KPVB 1TFHA 3NFNA 1TNNA 5IR1B 2FX9H 3VG9C 5FK9B 2R69L 2MCPH 4I13B 5ESVB 3PL6C 2I5YH 4WUUE 1DUZB 1LK2B 5IHUL 4EJ1C 1G1YA 1D9KA 2O5XH 3QG7H 3FTGB 1AP2A 4OLWH 4XTRC 1A9BB 5D1XD 1CDGA 3TJEL 3S9DB 5E99H 1RUPH 5GJSH 3BKJL 3QUML 4WW2A 5J13B 4E42A 3EGSB 2R1WB 2BVTA 5J6HA 1QVOA 3EZJB 4YZFE 2VL4A 4K71C 3G04A 4KKLD 3MOQA 3QSKB 4MYWB 5EU3A 4ZQKA 1I8LA 2PXYD 1CXKA 3UTSB 3BEVA 4PRPB 4BUHA 5FCUH 4KUCF 3T3PF 5L0QC 2C7UA 5IK3B 5HHXL 2PCPA 3BGFC 3HUJA 3X14B 5KN5A 5IFJA 2DLFH 3LS4L 4Z7NF 3GSUB 5F44A 1WBZA 1A6AB 3CSYA 4OD3L 2YRZA 5FM5O 1TCRB 3RWCA 3O9WB 3PE9A 3Q0HA 3NA9H 1BJMA 3WFHA 1NDGA 3TM6A 3RA7L 1WFOA 2AKRB 3QFJA 1DTUA 3D3VE 5ICZB 4LP5A 2V2TA 3HC3H 4IM8A 3SEPA 4LGPB 5DURB 5F96H 5D2NA 3WUZA 3CCHA 4XCYA 5C9JB 2FX7H 3K1KC 1N5AB 5I76B 3ZE2F 4P3WA 1S7UB 2W0FB 5DJZA 1TETH 3SQOL 4YWGH 5SX4H 1JNLH 3ET9F 1RJYB 3LKOA 3T65A 5KG9A 4XBPB 2M8XA 1YN7B 5C0RL 4Z7UF 4RMWA 1INEL 3WFZA 4LLDB 4RFOH 1DN0A 4A2LA 3TH4T 2DS4A 4N0YH 4HWUA 5DVOA 4DN3H 4JFFB 4KK5C 1R5VA 3FO0H 5TDPB 2AQ3A 3QQ3A 2NQCA 1HIML 4Y4FB 3V0WL 1PBYA 1QR1A 1WVZA 5F7NC 3O81A 1CWVA 4FP8H 2JIXB 2R2BB 2FD6L 3RVVC 4U1SB 5FECB 1XR8B 2ADFH 2H9GB 5FHAL 3WCYA 4DK6A 3MMEB 2FO4A 5FYJL 4JKKA 4JRXB 5BVPL 3F7YA 5EOTA 4LLMA 1FLRL 5IMKB 3GNMH 4KDTA 3V5KA 2BNUB 1RUML 3FFCA 1J1XL 4P9ML 1P2CB 1N26A 2XA8L 1C1EH 1IAKA 3EO0B 4XC3H 2VLKB 4YHML 2MNUA 5J11C 4Z78A 2FHCA 2Z35A 4PJEF 4UNVA 3MV7D 4RISH 2HLAB 3S3PA 4DGYL 1U91B 3MRQA 3EJZC 5BMFL 2GCYB 2NY5C 1A6TB 1I3GH 4JO4L 2WIIB 1G7IB 3WN5C 4EI5A 3TF7C 1S7QA 2EYRB 1SEBB 1TZIA 1U8KB 4RNRA 3TWCH 1KT2B 4YX2H 3ULVC 1MI5A 3LKQB 3MGOB 2ZWLT 5KANG 3ZE1F 1HHKB 1IGJB 1YNLH 3JTSB 4D0BA 4Y4HC 3WLWC 4X83A 1D9KD 5F3BA 1KELL 3BH8A 4OLYL 5T5NF 3BP5A 3S35H 4F2MB 1SYVB 1WTLA 1CT8B 3MLTB 4NRYA 4O58L 4PJXF 2YD2A 1IRAY 2VKXA 1RK1A 2X42A 3QHFH 1QRNA 4PJ7B 4X5XB 5JNYA 1OB1A 3BZFA 4YHZH 5AAMA 1A4KA 4PJ9A 4RRPA 5K9QG 1FC1A 1MQ8A 3LPWA 2V6HA 4I0PA 1FDLL 3ESUF 1K85A 5HHMB 3MLVH 4NO3A 1P1ZA 1A1MA 4Z95L 4MDIB 1RY7B 2ITDB 2ICWI 4LLWB 4OQ1A 4YIQA 1CFSA 4F8QA 3TV3H 1DQMH 1XF1A 3HZKB 3P9WB 3AREA 1CGVA 1L6XA 3GBNH 1R24B 5A2KH 2DQJH 1RUAL 2QSTA 1AC6A 1K8IA 4PRBA 2PUQT 3U9PH 4I4WA 2XTJB 2YWZA 3DTXB 3DV4A 1E4XI 3KPMB 3QFJD 4YBLC 4OLEA 3AY4A 4FFWC 2R23A 3GJFK 1I9JL 5AAWA 5HPOA 4PG9B 2B5IC 1ORSB 4OGZA 4OM1H 1ACYL 3T0EA 1NQBA 5ANMB 3TT3L 3LEYH 2HTKC 2KKQA 3MLPA 3SOBH 4LRIC 3MOBL 1QLFB 3P9LA 3UAJC 2EDBA 2AJ3B 1F11B 4QO1A 2NW3B 1I4FA 2CKNA 3MRRA 4FQQB 4F9LA 4FQJH 1IC7H 2BCKA 4HUVB 3UPAA 2GTWB 4S1SL 2GEEA 5F6IC 5C1MB 4PJDB 3MV7E 3SDXA 1P7KA 1N3NA 2HFGH 5FYLH 4YO0A 4KI1A 3KYKL 1JMZA 1NAMB 3H7BB 4DKEH 4XXCA 1TPXB 4JO3H 5D1QA 4LHUA 2MQ0A 1KYOK 4JFQB 2YK1L 5FYKL 3DRQA 1OF2B 3ARSA 3DXAB 1CXIA 1UZ8A 4MXVF 3MLUL 3CX5K 4UV7H 2CH8A 2YPLA 2XRAL 3QUYA 4KI5C 4LSPH 2Z0BA 4E41A 5DJDA 5CIPA 4PRAB 3FFCD 5CLWA 2ENSA 4IMLA 4AL8H 4U1KA 1A2YB 1FFPA 3MRFB 2J1KA 2AK4B 2ZG3A 4JN1H 5ID0A 5D6CA 3TCLA 4HKXA 1ZHNA 2F19L 4JZNA 4EI5D 5KVFL 3ARGB 1DLHB 1JNHB 4XP4L 1HI6B 1MI5D 4G8EA 3RGVB 4OF8A 3G5VB 3MLWH 4G42B 4OLZH 1JCKA 3A0OA 3HUJE 4X6DA 3K46A 5L9DL 4PJCA 2HG5A 5BZWB 3QG6A 1AKJB 3PXJA 5JPNB 4KKCC 2OQJA 3BXNB 3DUUA 5CZXD 3IU3A 2Q8AH 1E28A 3A67H 3NCBB 1QRND 2I5YL 5GRXG 5J13C 5F1KC 4YFLF 3QFJE 1X44A 3IU4L 4F7EA 4M3KB 2BJMH 2BVOA 1MLBA 4J3SA 3B9KA 4DK3A 4AEIH 4L8CA 4I0PD 4ODTH 5D2NE 2PR4H 3TYGL 5CD5D 1ZGLP 1B2WL 1OGTB 5DUPL 3BSZH 5GJSL 1FZOA 3QPXH 2FNBA 4K7PY 1B0RA 3C5ZB 3MRNB 3BO8A 3OJMB 3BGMA 4MD0B 3S37X 5MEOB 3W2DL 2NTFA 3HZYB 4ZAKC 1MVUB 1V7NH 3ARED 1A4JB 1DZBA 4H20H 5L2KA 5D6DA 4BQ8A 1O0VA 5DJ6A 3SKOB 4ZOBA 3O9WC 5EBWB 1U95B 1PYWA 5FCUL 3TO2B 2F58L 5I1JH 2VXQH 2YS4A 3BZDA 2OLDA 5ACLA 3TPKA 1M1SA 2EEAA 5DC4B 3RWFA 3VXTB 5IB2A 1PZ5A 3ZYJA 5JW4M 1TMCB 5LG1A 1NPUA 2XFXA 1MJJB 1J1PL 1RZGA 1U9KA 4YHPB 3R06B 1RZKH 1NCCH 3T0ED 4Y2DA 1M7DA 4POYA 3NA9L 5J1AB 1ZHBB 1BJ1J 3KJ6H 4BSWA 3DO7A 3C8KA 4YR6A 3M8OL 3FFCE 4XH2B 4HJGA 3GSVB 1HXMB 1KOAA 1UWXH 5F96L 2CLRB 1QP1A 2AXFA 4M6MH 4DEPB 1UJ3B 3QPQC 3QDJA 4QEGA 1ZAGA 4OZGB 4KTDH 4FZEL 4LPCA 1U8HB 1BFVH 3OHXA 3EOBB 5CBEA 4LHUD 4YWGL 3MBEB 4M9PA 4ELMF 1JNLL 4G80A 1Q94A 1QACA 3KYMA 1UM5H 3GO1H 2ZCLH 4BH8B 4ZOEA 4Y4FC 3CZFA 1MI5E 4HT1H 2GSGB 4WI7A 5IJVB 2H2SC 2BVUA 2YPLD 3QUYD 5GS1C 4BUGA 4E41D 2BSRB 5HHNB 1DQQA 1F02I 2H41A 4N0YL 5DO2C 4KAQL 4B0MM 3N85H 4HEPG 4C83A 1SEQL 2A6KB 3QRGL 4P3DA 1W0YT 4XGZA 4K3JH 2ADFL 1JPSH 4NYLA 4HC1H 1BZ9B 4M9OA 4PJ5B 2K9UA 3V2AR 1JYNA 2DTMH 3O3DB 4YPJA 3WS3B 3ULVF 1OD7A 1FIGH 4OI8A 1C1EL 3WBDA 3HNVH 5IVXF 1GZPB 4CKVX 1WCBB 4GKNA 2X4PB 1H9VA 3IDJB 4RA0C 4RISL 3WHXB 2DB8A 1TTFA 4HSQA 4PJGB 1KXTB 3TH2T 4QT5B 3IS0X 4WHTA 2VIRB 4K9EL 4JRYB 1LEIB 1A6PA 4U3HA 1FFNA 2QKIB 5TGBB 3KNBA 1CDCA 3TWCL 1ZWIB 2A6DB 1TVDA 3WNPA 3QQ4A 3K4DA 4IMKC 5F7FA 4KGLA 1XF2A 1HQRB 5B38G 4JQXC 3ARYA 5IHLB 1I1YB 1KCKA 4U31A 3HPLA 4PJFB 4IJ3B 3QIUB 1XF5B 3LQMA 1FYTA 3HAEA 3CH8A 3B9KD 3S35L 3NFSH 5E03A 2CRMA 4QHUA 1MLCA 3GI9H 4MDJA 1MHCB 3QEQB 3PDOB 3O6KL 4K3GA 3T0EE 4CDHA 4K23H 2P8PB 3BP7A 5JLZB 3CXDH 4C58B 1U8NB 3PWLA 4GRWB 2J2ZA 4NUJB 4Y5VC 4ZXBB 1D5XB 4PY7B 2JB5H 3DRTA 1K8DA 2OI9B 1OPGH 1R3LA 5L2KD 3RWGB 1G7JA 1WTGT 5GS0H 5E56A 1T83C 2PTTA 1R5WA 2EXWD 2CSPA 3SDXE 1MIMH 1RZ7H 3W0WB 2P46B 2XTJC 3U0PA 1UFUA 4DUWA 2NR6D 5GISH 3BDXA 4U2ZA 3TV3L 1R5IA 1BQHB 3GMMB 4I0CC 5FKPB 3IAGC 3LQAH 4YGVA 3BYYA 3B5GA 4G8GA 4XBEH 1I3VA 4QKXB 3U9PL 2YPLE 5HYEA 2YXFA 4N1CA 3JSSA 1O7SA 5EIIA 1AY1H 4K55A 4MS8D 4DFIA 1CTOA 1S5HB 1JF1B 4FHBD 1EPFA 2IH3A 1O5DT 3WUWB 3QDJD 3ARDA 1T89A 4PGEA 3CFEB 3BKYH 3GMOB 4Y19B 1D7FA 1S78D 3RY4A 3UBXG 1CK0H 3SCMC 1MCOH 3SY0B 3PABB 1TPXC 3W5NA 5IVOA 4KTEL 3V9FA 1AGFB 2AXHA 4NBYB 1BX2A 4XC1H 4L4JA 5DFTA 4KI5F 3OKNB 2I60H 1JYXA 1RZIB 2NCMA 3D87B 1UT9A 4JN2A 3V5HA 2VDQH 4X6DE 3UTTB 4PJCE 5CAYB 1KACB 3ECBB 5FA3B 2HJFA 3RY6C 1NGYB 3BJLA 3DYOA 4X98B 3VFNA 2Z8SA 1KJVB 1W0WB 1FH5H 5JHLL 1VGKB 4UV7L 5GGRA 5AEAA 4LSPL 1NANI 3NCYS 5J9PA 3CSBA 3JWNC 1F3JA 1H8OA 1RZ8B 4K9EC 3PIQB 4PGBB 4AL8L 3CFCH 2DICA 4WY7H 3TP4A 4HLJA 3ARGC 5B8CB 2UVEA 2DAVA 4UT9L 4ZS6D 3GMPB 3RGVC 3SGKC 3JV6A 4FTVB 4HCRH 4NSKB 4JG1L 4PP2A 2ESVA 2YD1A 3C2AH 2QL1A 4NO2A 2PO6A 5L2KE 4FFZH 2DWEA 1LEGA 4PD4K 4XWGL 3MLWL 5ISZA 2IADB 4XNMB 1VKXA 3GBML 1FYTD 4NKOB 2YD3A 1FCGA 4HBCH 2WQ8A 1GZQA 1FAKT 1HXYB 1BVLB 1J0KA 3KHQA 5KJRL 3K81A 3TBSB 4XAKD 4OCXH 4NM8H 4FQHA 1JPTL 1M05A 4GS7B 4L8SA 4KJPC 4DJMA 2EXYC 3NCCB 1FZJB 3C5ZC 5IROC 1I3RA 1QFHA 3JXAA 1NDMB 3G5ZA 3MO1B 1V3KA 2BJML 1VEMA 4FZ8L 1JGLH 1HHIA 1IAOA 5JIIA 5D1ZB 1S9VA 4ODTL 2E6QA 1DBMH 1DQLL 2KUTA 3QDJE 4DGIH 3KG5A 1FQ9C 2NY4B 3FB6B 3QPXL 1B4RA 3K1DA 1E4JA 3O0RH 43CAB 3Q6GL 3U7WL 3TVMA 3RTQB 5H37G 5DK0B 4G9FB 3QHZH 2VXSH 1V7NL 2FEEL 3IGAB 1WWAX 4K94H 4H20L 4M8VA 1ZLWH 1ZK9A 4JVWA 5CJQH 1MFEL 2BHUA 4G8GD 4KJYA 1V05A 3K80A 3QEGL 5I1JL 5DA0B 2FJGA 5B22A 2A0LC 3MLSL 5E2VH 3BFOA 4N0CD 4RMUA 1TQBC 4QXGH 4LCYB 5EUKA 1OQOA 4PRNA 3DROA 2DLGA 1FRGH 4L8DA 2HFTA 3DBXB 5E1HB 4KTYA 1NBVH 4N8CL 1NCCL 3SKJL 1OT1A 1IM9A 1BQHG 3ARDD 3G6AB 3NIGE 3WJJC 4DEPC 1UJ3C 1J18A 3UJTL 4CW1B 4HEME 4ZYKA 3HLAB 4XPFH 1J8HB 1T1XA 2D7TH 3KPRB 4APQB 4L3EA 5D7LA 1F00I 2W59A 4DTGL 1Z2KA 4DKDC 1NGXB 3UYOD 5EBMB 5B4MC 2NY0B 3VFSB 2F54B 5E5UB 4PJIB 3L9RB 3EIFA 3V4UH 1CXLA 4X8XA 4BZ1L 3NACH 1CFTB 3W39B 4UIMA 2D4FA 2EDFA 2VLJB 2NY7H 3VFMB 3PJSB 3HE6A 1UM5L 5F70A 3GO1L 2ZCLL 3N50A 4GW4A 5HD8D 4R7NA 1W2KT 5KW9H 3ZT7A 4CUCA 4XVUC 3O4LB 4NQDA 4M1GH 1RK0B 2ADIB 5EU7E 1YEFL 2E6PA 3LV3B 3N1GC 3PWUB 3W9EA 5DMGC 3GDBA 1KCUH 1P84J 1FYTE 3MRJA 1LWRA 1SJEA 4GRMB 4LSTH 2HH0H 1A02N 2UWEA 3PWVB 3QUXD 4XAKE 1YMHB 5DZNA 5J06A 4UQ3A 3HI5L 4K3JL 3VD7A 2Z31A 4HC1L 2EIEA 1CL7I 4JY4A 3F58L 2DTML 3H9SB 4XCEB 2BDNH 5F21B 3VI3E 2ESVD 4QHNA 2PO6D 4LFHG 5KSVA 1H0DB 4I3SH 1V7MH 2VYRE 1QFOA 5C0JA 3LN9A 4MNQA 4WWKA 3HNVL 5ETUA 4PJ7F 2XPGA 2BNRA 5ISZD 1XCTA 4KJQC 3W81A 2HT3C 3IETB 4J6RH 4ZSOB 4HGWB 4J23A 3I85A 4NRZB 3QIUC 1PY4A 3RNQB 2CDEB 5ESAA 1KTKE 4P2OC 5JDSA 3FAWA 5GHWH 3DURB 3TNNB 4ZFFA 4G8GE 5EO1B 5I1HH 1QBML 4O4YL 4F7MB 1TIUA 2ICWA 2FEDC 4AIZB 3EJYC 3C5SA 5J6GB 2Z92A 4ODUB 1UQSA 1YYMH 4JY5H 2CGRH 3OB8A 2V2WA 2C3VB 2WMPA 3OJVC 1FN4A 3P2TA 4YHKH 3S88L 5DD6A 3ULUD 4NBZB 5EA0H 3DJ9A 2NPLX 5DI8A 1EEYB 2LU7A 3CXDL 4BQCA 4BYHA 4N0UB 3TVMD 4XHJD 1MJ8H 2C1PB 4CU7A 3TT1H 4AH2A 2P43B 3HMWH 1PVHA 4ENEC 2OTWA 1BREA 1G9MC 1OPGL 4AMKH 4BK5A 1R3JB 3DMMA 2VAJA 5C09A 5F7UA 4NKDB 43C9A 1FYHB 4H0IA 5HHPA 3M1BA 4G6JH 2QADC 3QNZA 3OAYH 1DSFL 1NH6A 5I8CB 4HK0A 1CVRA 5KZCD 4UMGA 4Z7VA 1BVKA 4PJDF 1JRHI 4L3AA 1IM9D 2R0ZH 4P2RB 1RHFA 3C08L 3HI1A 1LO4H 1MRFH 4NN6B 3ROOA 2WQRA 3PWPB 1ORQA 2VLLA 4L3ED 2VDOH 5D7LD 1DBAL 4PB0L 3QRFM 1AY1L 3RPIA 5KTEL 4EXPX 4OZ4A 2EDLA 2OZ4L 2A74B 1ADQA 1G7PB 3MCLL 4CVUA 3TNMA 4NQSA 3BKYL 1OQXA 4JHBA 4OB5L 4IRJC 2NZIA 4V2CB 1A6VH 1G7QA 4B41A 4OZFG 1B6UA 1HSAB 1MCOL 2NY1D 4GAYA 2ESVE 1ZVYA 3HE6D 4EDXA 4OQTL 4RWYH 2ICCA 1N5YH 3MSPA 4XC1L 3S96A 4PP1D 1T1YB 4LF3A 4NQDD 4ZUVA 2I60L 5E4EB 5IMLB 5ISZE 3R0NA 2WINB 2P5WB 2NLJA 2VDQL 2JJWA 2PF6A 4H88H 1RJLB 4LL9A 4WV1A 2HVJA 5D2LA 4WUKH 1FNGB 1CICA 2ILLA 3CX2A 4LOUD 3FQUA 5BRZA 3UO1H 4XP9H 3QXAB 3SPVB 3SKUD 1JN6A 5B8CC 4HXBH 4RX4A 2Z31D 4JPKH 5CHNA 3ZDXE 1KTDB 1ZS8B 4HKJA 3NAAL 4S0SD 4KZEH 3ZYIA 1ZT4A 4F7CB 2ID5A 4Q9CA 5J3HD 2I27N 5SWSA 4M6AA 3CFCL 5A40E 4MNQD 3ULUE 5MI0B 4AG4H 3EFFA 3RAJH 1GVIA 5HI5C 3THMH 1CE6B 2BNRD 3GI8H 4MVBC 1I1CA 5LXGH 1I9IH 2X4UB 2GT9B 4PJAB 4MAUH 3C2AL 4TRPH 1AH1A 3S4SB 4FFZL 1R3IH 2O26U 2R9HD 4O51B 3C8HA 4GS7C 2CIKB 5IW6B 1J88A 5EZLA 1NGQH 1JPGB 4XX1E 5EPMA 1JFQH 2NZ9D 4XMKL 3HMXH 5GGTH 5C0EA 3MJ6A 4U0QB 5D1ZC 4NM8L 4MMXC 4KRMB 5CKGA 4CVZB 1GGCH 4NRXA 3GJFA 2NY4C 2ZG1A 2XWBA 3EYSL 3WD5H 4AEFA 3MRDA 5C8JA 1MCCA 2WBJA 1GGIH 5D7LE 3RTQC 1QLEH 1EIBA 3I3BA 4U1HA 4DKAA 3DMMD 1VFUA 1PLGH 2A83A 2MWCA 5C09D 5JW3H 1DBML 5IB3B 4MD5B 5DVMA 2IH1B 3T4YA 4Z0BH 3O0RL 4OCWH 2R56L 2EDDA 3O2DH 4L4TA 4Q2ZB 1KC5H 35C8H 3EYOB 1RPQA 2CRYA 2VXSL 2WIMA 5EO0B 3AS1A 4MJIB 1I9RL 4K94L 1RVFL 2B1HH 2LTQC 3BIBX 4OZGF 5GQBA 1VFAB 4JKLA 3UCRA 1DQDH 3B4NA 4UZGA 5IB1A 2RFXA 4NQDE 3VGDA 2RBLA 3BGAA 3WFDL 4FNLL 2Y07L 5FF6B 1C16B 3W9DB 4QXGL 3DVNA 4ZFGL 4APQC 1N6VA 4PV9A 2IGFL 2UWEE 5BVJB 3SE8H 4J8RB 4DOHB 5C0CB 1JE6A 2NY0C 1P4BH 4P5KA 4LSVH 3FO2A 1NL0H 1UEYA 4XPFL 2XZQH 5KANI 3ARBA 4PGJA 4NNPL 4G8IA 2VQ1B 5IV2A 2X4RA 3G04B 4MNQE 2H45A 4JRWA 5E00B 3MX0A 5AG8A 4HDIB 1YQVH 3HZVB 2BNRE 1KJ2A 2DKSA 3K7UA 3BEVB 5FUCC 1DE4B 1OLZA 3MRCA 5A2LH 4IBLT 3OJ2C 2C7UB 1TJIH 4DCQA 3QCUH 1KEGH 1CICD 5BRZD 4IDJL 2FH8A 4CL7A 2E27H 4O00A 2OSLA 5K9QI 4MB4A 3MUY1 4GRLA 3WDIA 5KW9L 4HV8A 2H6PA 4OLXL 3BP6A 4RX4D 4PJGF 4QF1A 3UTQA 2ERJB 3IJYA 1CCZA 3VRIA 4N8VG 1IGYA 2YKLH 4E0RA 2B20A 3IDYB 4TULL 1ZEAH 3D69A 4LSTL 3QFJB 2J88H 3CVIH 3ZKXB 5DT1H 4JDTH 1KENH 3H42H 5INCB 4IRSA 25C8L 4QRSA 5GJTH 1RURL 4PJFF 5D2NB 4ISVA 3L3DB 4CVXA 1QNZH 5JW4N 4J3UA 3MYJA 3MGTA 2P1YA 3MJ7A 1CFBA 2DQFB 2BFVH 5C09E 2X1OA 2ADGB 2ARJA 4BFIA 4OZHE 5KG9B 3DV6A 3QB7C 3VFGH 3KVQA 4GRWF 3MRLB 4KK8C 2MKLC 4P4RA 1PW3A 2FZ3B 3B8SA 1DN0B 3VGFA 2J4WH 4Z7VE 4QRUA 2PTUA 5IBLD 1HCFX 1ZVSB 1GSMA 4S1DC 1XCQB 4KMTL 5GHWL 1M6OA 4I18B 3S4SG 2DQUH 4FQIH 3TBYB 1QR1B 5JXAL 1OTUD 4YAQB 5DRZA 1T1WB 2WBJD 5HYQA 2BNQA 5T1MB 3RP1A 3FCTB 3UC0L 4Y1AB 2FO4B 2F5AH 4GJTB 4GXUN 5FGRA 1V3LA 3JWDC 1PG7X 4R0LA 1FO0A 3FFCB 4EBQH 1NBQA 4LGSB 3T2NL 2VXUL 4L4TD 1IGMH 2HJKA 4IDLA 4CDGC 2R8SL 3F5WA 5LBSH 2W9EH 1B4JH 5C0AA 1C08B 4FQ1L 4FQXB 2EE2A 4AMKL 1AHWB 1NAMH 4WEMB 5DVLA 1QPPA 4WEBH 2FATL 1H8SA 5E8EA 5IEKB 1BEYL 4R7DA 1S7QB 4MJ6A 4RNRB 3MV9A 1MAMH 4L8BA 4XNUL 1BJ1H 4NN6C 2ZZUT 6FABH 2I9LA 5CMAB 1UB6A 4I0KA 2D0GA 1LVEA 4FFYH 1L9NA 2H3NA 3BP5B 2R0ZL 1WBYA 4YXKH 1BVZA 5EU5B 2EE9A 1EVTC 3GMLA 4OCLC 3ZT6A 2XQYK 4LPWA 3ARBD 3HCVA 4RZCA 5CFHA 2VDOL 5LQBL 1FFOA 1QRNB 1AC0A 4WTZG 3RQ3A 5AG9A 3BZFB 5SWSE 1S7TB 5EOCJ 1QFWL 3ORJA 3ULSA 2B1AH 4QRRA 3GSXA 3P4OB 3DX8A 5E4EC 4M7ZB 5CUSL 4NO3B 4HWZA 1QEWA 4YIQB 4RWYL 2VSDA 5J57B 1CQYA 1BZQK 5DJXA 3IDIB 5GZOD 2GFBA 2XZCL 4NNXB 4PJXA 3HS0B 5E9DE 4YPGA 5I16A 1V5JA 2X05A 5FDYA 1G6VK 4H88L 3U4BL 4PG2A 4F33A 5I19L 3DV4B 3L7FA 3T0BA 4D9QD 3UO1L 5T1KA 1WJ3A 4C4KT 1EGJH 2R23B 4XP9L 4JVUA 4IRSD 5MI0C 1TQCB 3HFMH 4FQLH 4MA3B 3MRKA 1G0XA 1MCNA 1VADB 2HFFB 4YDIH 4L3CA 1RHHB 1JHLL 1N6QH 3PHQA 4KUCD 4UI2A 5HTSA 1LO0H 1FORL 4R4ND 4H1LH 1X5ZA 3ZLQC 1RQ5A 3IFOA 4HUNB 2VDNL 4Z7QE 4PTTB 4ZOCA 1I4FB 2XKNB 4AG4L 1AFVH 2BCKB 3L5WA 1NC4B 2VR5A 4N5UA 1LE5B 5IESH 1WBXB 1I7ZA 1IAIH 4EVNA 2X9YA 4L4TE 1ZGLB 3HR6A 5LXGL 3NPZB 4UIKL 4MAUL 3IDNA 4LHUB 4OF7A 2XXMB 2F74B 3OKYA 4JFDA 2V5RA 1XF3B 2GYSA 3FMGH 4JGJA 5I6XB 5B21A 1RFDH 1NGQL 3BIKB 2BNQD 1HHGB 1JZ8A 1LO2H 3FQRA 3TBTA 3QUYB 1NJ9B 3P0VH 4MSWA 4L5FL 4E41B 5SX4I 2QEJA 3ZMRA 4HJJL 4IMLB 4U1KB 3EDDA 4K7PL 5GIRB 3EDJA 4PYHA 1FFPB 4KWUA 1IEAA 5CJBA 5C0AD 1T04A 3L3GA 3TCLB 2Y23A 1XFPA 3STZA 3I50H 4JZNB 3TLRA 4BFBD 2Q76A 3MV9D 3GUTA 1MCFA 2Z91B 4S2SA 4RIRA 5I66A 2FYYB 4AM0A 4QTHA 4MA8H 4NQCA 4JHWL 4OFIA 4PYGA 1KC5L 35C8L 5CJ8A 4X6DB 2IAMB 1A7QL 4PJIF 2HG5B 3VH8G 3GIVA 1G9EA 3D25B 1DQDL 5IBUG 4LLYB 3G5YB 1T7WA 5SWZA 4JM2D 3SKMB 3SE4A 3IU3B 1BFSA 2DYPA 4D9QE 5F8RC 3Q6FB 3BN9D 4QRRD 1JWUA 4YHNA 1P4BL 4LSVL 1A22B 4JHAH 5JW4Q 3RIAK 3SDDA 1Q9OB 3PL6A 2HFEA 4ZPVA 2XZQL 5L7XH 3VXOB 1MWAH 1JWMA 1HNFA 5EC1B 2X7LA 2VWEC 2P42B 1MQKH 3E8UH 5I1LB 1LILA 4Z7NE 4UOJA 3VD5A 3Q5OA 3KXFA 2G5BB 4NC1E 1YQVL 3U7YH 2J6EA 4HIXH 1V3MA 3U82B 4D94A 5L2KB 5DJ6B 1JUFA 5JW5A 1BAFH 2XG5A 1ETZB 1WWBX 3I9GL 3OTTA 3I6KB 1KEGL 3IDYC 5T1KD 3FQTB 1PZ5B 5HHVL 4P4KB 3ZKXC 1ND0B 5BQ7A 3QCVH 2AI0H 2V2XB 5C08A 2R29L 5FEBA 2IG2H 2JCCB 3MLRL 5D2NC 4B7IA 2VABB 5DEGA 2BNQE 1S9WA 3LN4A 2HMID 3ZE2E 1PQZA 4BSWB 1EEZB 3AC0A 1VESA 1D6EA 4JJ5A 5DT1L 1AGDA 4IS6B 1KENL 1FNSH 4GRWH 1YEKL 3MZTA 3DARA 2AXFB 1NMBH 1EV2E 2LABA 3VD3A 5C7XH 3QDJB 1E27A 3FRPG 4YBHA 3GKZA 4CU8A 1SM3L 3R8BB 1TITA 5C0AE 4ODBD 4KVNL 4RAVA 1FJ1A 4JFDD 4I18C 1WITA 4X7CC 4MCZA 3MV9E 2ZSWA 1IJ9A 2QQQA 3MLYH 5D9SB 1WWWX 2RIKA 5TQ2L 2IBGA 3UBXI 2E7LC 2A77L 3KDMA 3MXVL 1CLOL 1T2QL 2R4SH 2RR3A 1HDMA 2UZIH 4XI5D 2JJVA 2CUMA 4C83B 3E1F1 3N0PB 4YK4B 3U4EA 1GIGH 4FQIL 4ORGB 4P3DB 5D71H 4WU5B 3VMNA 4XMPH 5KVDH 2FR4A 3GMRA 3CSGA 5A16A 5C92A 2XIDA 1RD6A 4X6FB 3KS0J 4S10A 4NQEA 2F5AL 3C8DA 1EUUA 4HBQA 3AAZA 2BVPB 4FQXC 2ZCKH 1AHWC 4ELMA 4QRRE 1M4KA 3DSFL 4WHYG 4BFEA 3OG6B 5ID1B 1MFCL 3HNTH 4ZTPL 4EBQL 5EO9B 3LKRB 3EO1A 3KLAA 5DJCA 1IGML 4NQCD 2C4FT 4MQXD 1ZLSL 3ZE1E 3UPRA 1B4JL 4R90H 1AXSA 2IFFH 2QSQA 3FB5B 5I1DB 5DJ2A 1Q1JL 2BRRH 2BVEA 5HDQH 1JI1A 5SWZD 4PJXE 1JV5A 1MAML 3MRHB 1GCFA 5CZXC 2O61A 3ZZ1A 3IYLW 1NFKA 4XZUB 1SYSB 5E2JA 2DYPD 1XGYH 4TUKL 4XPGH 3WN5A 1AI1H 5GS2H 1AO7B 3HAEB 1HHHA 2XACC 1U8IA 1OLLA 2KQNA 2X1WL 4DGVH 3MV8E 3QUMA 4MDJB 4HIEA 2BXZA 3HPJB 4LCUA 4N0FB 2PN5A 3CXHJ 3SDDD 3PL6D 2R2CA 1H3PH 1CE1H 5CD5C 4Y4HA 3BP7B 5GGSY 5IVXA 1GGYA 4M7ZC 1AD0B 4UOW0 3FT2B 3CLFH 4HS8L 4L29A 2W65A 4LEXH 4WNQA 1U8QB 3DRTB 5CILL 5A2IH 4FG6D 4LVNB 4ZS7H 1G7JB 4HWBL 3WE6A 1S7WA 2H32A 5F3HA 2IPKA 1R5WB 2ZPKL 4J12A 3QISA 1BIIB 3BD5A 5GRYA 5F6HI 1C7SA 1G6RH 4K3HA 4ONHB 1Y6MR 4ZUWB 5A1AA 3FONB 4JFDE 4ODHH 5C08D 2CKBH 1F4HA 1TQCC 2DQCH 1VFOA 4YGVB 4PJAF 4R4BB 3FL7A 3RWHA 4RGOH 5TE4H 3RHWF 4OF0A 5DHVH 3ZKSD 5H94B 1INQA 1NUNB 1AR1C 4X7TB 4TUOA 1EGJL 4YDLB 4UILL 3OF6A 5DRNA 4X4YA 1HEZB 3ARDB 4P57B 4HWEH 1N6QL 3MFFA 1IQWL 1Q9WA 3QQNA 5CSZB 1UWEH 1LEKA 1R3HB 5DGRA 3RRQA 1RUQH 1K4DB 4XXCC 1IGIH 1YEEH 1C5BH 1FPTH 3WIHH 1BX2B 2HN7A 3IDXL 1JZ6A 4WGWB 1UADC 1FVCA 1Z3GL 3U46A 3U9UB 4XB7A 1KEMH 4LRIA 5M95B 5I6XC 5ICYB 4MXVE 4NQCE 5L8LB 3QO1A 1EERB 3QFDB 3HB3C 1TDQA 4JFPA 2N7AA 4K07A 3T3MF 5SWZE 5I17A 1G9NC 3U0TB 3FMGL 1KB5B 3INUH 1HKLL 1NEZA 2PYEA 3LEVL 3OKDA 1JYVA 4NQXA 4NQED 1LO2L 2AQ1A 2AQ2A 4KK5D 1TLKA 1S7XB 1T5WA 3M45A 3FRUB 1ZVHA 3MRGA 1EXUA 5DQDL 4ZUTB 4X7SL 4HPYH 1B88A 1F2XK 4FMFA 3NMEA 3QUXB 3UTPD 1YEIH 3PV6A 4HKBB 2GTZA 1CD1B 5BJTA 1YJDH 4TYUA 4P0DA 4R4FH 1BFOB 1QHOA 2IAMC 1FVDB 2KL6A 5HBBA 2BX5A 3KXFE 5EZJA 3CFJA 1ULVA 2W9LA 4XBGA 1KIRA 3D18A 3BH9B 2GUOA 1EK3A 1QSFB 3HG1B 1LEGB 3RBSA 4PREB 1YMMB 4JREB 3EJZD 4K8RL 1XF4A 4X9IA 5ISZB 2VL5A 5GPRA 2IEPA 2VR9A 1VKXB 5BOPA 2ITCB 1S5IL 3D85A 2JJTC 1U8PB 5IR1A 1GZQB 2V7HB 5FKAA 5C08E 5FK9A 3L6FB 4OIIH 4DZBB 5ESVA 4Y4HD 3BE1H 3BZ4B 3WLWD 2AXJA 3T77A 1LK2A 4F9PC 3RVXC 3H9HB 3V52H 1N6UA 3FTGA 4C4KO 3IKKA 3QIBB 4EN3C 2R4RL 1A9BA 4NFCA 4PTUB 2G9HA 5D72H 1HHIB 1IAOB 3W11C 1S9VB 1NKOA 2PNDA 3PUCA 1KLGA 2LFGA 1BOYA 5L7XL 1F42A 3SHSA 2R1WA 3UJIL 2EXWC 1DVFD 2P45B 4OF3A 3TVMB 2NR6C 2EKJA 1FSKC 4P4KC 1UA6L 3UTSA 5EH1A 3U7YL 4HIXL 1UACH 3LRGA 4URTB 1MHHB 2AJXH 5D70L 5IK3A 4ZAKA 1I1AB 2I24N 3L5JA 4KJWD 3BYTA 2CDGA 4LNRB 3MUHL 1A6AA 3DROB 4L8DB 5HYSB 1TCRA 5KZCB 5HI3C 3OF6D 3O9WA 1KTRL 2VUOA 2IG2L 4FXKA 3QDMB 4G6KH 5I1EH 1OCWH 5I9QB 5E8DL 2AKRA 2P44B 3GM0A 4ZYKB 4NQEE 1MFBL 5ICZA 1S78C 5IM7B 5CGYC 4L3EB 4KRPD 5D7LB 3BKMH 1FNSL 4ELME 4JM4H 1Q38A 2AK1H 3VD9A 1MCRA 2MPAH 3C6LB 5HDOA 3GHEL 2HTKD 2MHAB 4GG8B 4OBSA 5DD0H 5C9JA 3D39D 1S7UA 2W0FA 1JZ7A 5T33H 1OGAB 3P0YH 1WZ1H 4UIMB 5ALBH 5HXMA 2AERT 2J7LA 5JXEC 1VPOH 1RJYA 2NY1B 3HR5A 4Y89A 5F9OH 4V1DD 4XBPA 4ZFOL 3KYOB 1GC1H 5F88B 4Y2OA 4YK4C 5FYJD 1FZKB 4R7NB 2N1KA 5DGQA 1HQ4B 2AP2A 4M62L 2PYED 5FA4B 1F8TL 1LNUB 2NY3B 3K74B 2FGWH 3WHE0 4OM0H 3JBG7 1FGVL 2JF1A 3X3GL 2VKWA 5TDPA 2YD5A 3ULVE 3GRWH 4LARH 2BRQA 2JIXA 1WWCA 2R2BA 5GGUB 4U1SA 5FECA 1XR8A 2H9GA 4XMPL 5IVXE 4K8RC 1DFBL 3O4OB 4K7FB 3MMEA 5GS1A 5I2IB 5C3LD 2QR0B 2ZUQB 4JY4B 3JZ7A 4ZS6C 5KSAC 1NCUA 5MEPB 5CEZL 2BNUA 4WO4C 2ZCKL 1P2CA 3E0GA 3EO0A 2VLKA 4H5SB 4AQ1B 5JQHC 3T4AB 4ZMAT 1ZA3A 3O6ML 4XVTH 3HNTL 4XCCL 2HLAA 2K3TA 5ETUB 2YMXL 1U91A 2BNRB 4PV8B 2FCBA 2GCYA 4R90L 3K0WA 4JO1H 1NMAL 1QZ1A 2DQHH 3D85D 5FM5M 1UKTA 2EYRA 1U8KA 5ESAB 1KT2A 5K59E 4Q74A 5JZ7C 4O9HL 4ZFFB 1W72H 3MGOA 1MY5A 1HHKA 1IGJA 2ICWB 4TOYH 3JTSA 4IOIB 5DMYA 3C5SB 2Z92B 2HA1A 1UQSB 1A47A 4I9WD 4XPGL 4KKCD 1AI1L 2X1XR 1SYVA 4F57H 3SKNB 5BCAA 1HHJA 4DGVL 4IMKA 3RX7A 1YN6B 2WUCL 3R0MA 5SV4A 4LVNC 3EHBC 4JQXA 4IRZH 1H3PL 5DI8B 4PJ7A 3SJVD 4U1IB 4MD4B 2GKIA 5HHOA 4WEUD 4DUVA 3DMMB 5C09B 1EVUA 1IGCL 3RHWK 43C9B 2VZSA 3M1BB 1F2QA 5DFWH 3FHQA 1U36A 4MDIA 4ZAKD 2ITDA 4LLWA 4CNIB 4Y5VA 3QIWB 3CLEH 4HK0B 4MB3A 2UVFA 4N0CC 3BRGC 1R24A 1NCBH 2Y5TB 4TSAH 1T83A 5JUEH 3O9WD 4OGAC 4YDLC 1BVKB 3EOYG 4Z77B 2CKBL 2GK2A 5GSVB 4HIJA 3QULB 3ZTNH 5FYJE 3L7EB 2OP4H 4QXTA 3LIZH 3WSQH 2PYEE 2BERA 3DTXA 1GAFH 3SE9L 1ORQB 3PP3H 1OARL 2DQEH 5HHQA 3PP3K 5DURD 4AEHL 4PG9A 1ORSA 4KHXL 1FFQA 2DM3A 4JPIA 5F89B 1P53A 3X3FH 4KI5E 4NQUA 2UY7A 1HKFA 2XN9A 4JB9H 2AJ3A 1F11A 5FYKD 2NW3A 1UWEL 4FQQA 2JB6B 2R1XA 4PFEA 3H3PL 3LD8B 3JVGC 1IGIL 1N7MH 3QPQD 4HUVA 4QHKJ 5LGHL 2GTWA 1C5BL 1FPTL 5KVEL 1GGBL 2FHFA 3S96B 1K4CA 4LF3B 5HD8C 4ZUVB 2VZTA 3VG0H 3SCMA 3H7BA 5DJ8B 4OTXH 5IEHB 1DLFL 2OTUB 5HI4D 4JFQA 3FQNB 2YXMA 4WTXA 5D2LB 3MJ9L 4KKBD 1OF2A 1CICB 5BRZB 4A6YB 3AFLA 3DXAA 2JIXD 4JFYB 2H2SD 2B8OT 3QUXC 4UNTA 1FNHA 5GXBB 4X6DF 1AR2A 4UDTA 5CHNB 3VGEA 5DO2D 3D48R 1MREH 4I9WE 4PRAA 3RY6A 1ZT4B 1KIQB 2VLKD 5D8JL 1RUKH 4U1MB 3X13B 3ARWA 3MA9H 1A2YA 3MRFA 5FXCH 5DJYA 1YEIL 3EFFB 2AK4A 1T03H 1KN2H 2NNAB 1BBDH 1AGCB 1F45A 1YJDL 4JREC 4KHTH 4R4FL 2A73B 1DBJL 3HC0A 2OK0H 5F71A 5FO7A 1F3DJ 3BD3A 5BOZG 4XPHH 3ARGA 1DLHA 1PEZA 1SBSH 5B38A 1H5BA 3UTSE 1HI6A 3B9EA 3JV5A 2VDRH 4ZTOL 3RGVA 3G5VA 4U2YA 3SGKA 4G42A 1B0GB 3BWAB 4DWHA 1BLNB 1UVQA 5EZLB 1XR9A 1AKJA 1JJUA 5EOCH 2Z4QA 3ILQC 3QIBC 4TVSa 3BXNA 3U4AA 8CGTA 5C0EB 4NM4L 4LK4A 4ODWB 4OIIL 1CDJA 1IT9L 2K7QA 1C8PA 2XZAL 2A9ML 2R15A 1XGPB 4PBVC 4FQ2L 3LHPH 3TVMC 4XHJC 5HHOD 1CLYH 2JCCF 3VXRD 5D72L 2M26A 4HUXB 1A7OH 1OGTA 2A83B 1I9EA 4UB0L 2WBWB 5IROA 3MRNA 4KC3B 4MD0A 3GIZH 1U3HB 5MEOA 1E4XL 1U6AH 3O3EB 1I1AC 5FYKE 1BQUA 3AU1B 4D0CB 1MVUA 3IDGB 4WDIB 4KK6C 1A4JA 2HKFH 3RWIA 3KPNB 2XQBL 5C0BA 2Z8WC 1JF5A 3MOAL 5EBWA 1U95A 1UACL 5I18H 3DETC 2AJXL 3RY5A 5IB5A 3VXTA 5I9QC 2P48B 3BT2H 3DI3B 1T0NB 3KPPB 5T1DL 1OP3H 4YHPA 4ONGH 1MEXL 1A14H 3C6LC 3MYZA 5J1AA 3UBXA 1MELA 1ZHBA 1C12B 5I1EL 5HVFB 2XN9D 4JRXE 3S5LB 4M6NH 4QXUL 1OL0A 4HUWB 3UJJL 3EFDL 5C6TH 4U6YB 4XH2A 3GSVA 3GK8H 3P40A 4FABL 4K2UL 2VLKE 4LSQH 2NY1C 4JM4L 3TH3T 5IMMB 5IBTH 1JHKH 5IV2B 3WJJA 2X4RB 1UJ3A 3S37L 3U7AA 4OZGA 4CJ0A 4F8TA 1KJ3H 5GSRB 1RMFH 3SCMD 1MCSA 5GZND 1U8HA 5T33L 2NY3C 1WZ1L 3ARVA 2AEPH 5ALBL 1ZLUH 1VPOL 4DCQB 2VB5A 1ZLUK 2X1PA 3DXAD 3CDGB 4W4OC 4BH8A 3RKDC 4ZUUA 2OSLB 5TQ0L 5KBNC 2GSGA 1EJOL 3H9YA 5IJVA 1GGUA 3MUGB 4NBXB 4MJ2A 3O4OC 1TJGH 1ITBB 2FGWL 2BSRA 5HHNA 3IJYB 2UZXB 2ZUQC 3VRIB 3O6FC 2DQDH 3VE0B 2A6KA 5LCVL 3U79A 3GRWL 4LARL 4NZTL 4P9HH 5FUOH 2KDGA 1J0HA 2AK4D 5TPWH 1NFDB 3FT3B 4JR9H 4PJ7E 1BZ9A 1FL5B 5CSBA 4PJ5A 4CADB 1AQDB 4ISVB 3OWEA 3FAXA 2C5DC 2O5YH 1WC7B 4N5EC 4QRPB 3ARGD 4RMSA 5J4MA 3MJ7B 3P4NB 3VFOB 1CN4A 3VWKB 1GZPA 5HPMB 3S6CA 4KZDH 1WCBA 1E6OL 3RGVD 3BD4A 3IDJA 3WHXA 5CINL 3O2WH 3VI3F 4QT5A 4P4RB 3I02B 2NY2D 2VIRA 3ARRA 1AKJD 1XAUA 3KPLA 4GKZA 4JRYA 4MLIA 1LEIA 4NZRH 2FLRT 2QKIA 5E8OB 1ZWIA 3DGGB 3B2VH 4TVPD 3VD4A 5IFAL 3RX5A 4HKZB 1M6OB 1NUFA 1HQRA 4M48L 4OUUA 2XTJE 1MAKA 5JR1L 1I1RA 1XGQB 3QIUA 1XF5A 1ZLVH 4QHMB 1ZLVK 4MB5A 4P2OA 1KYOJ 2ZJSH 3U2SB 4F57L 1MHCA 3PDOA 3LH2H 3ARFB 4DN4L 4KJPD 4ZFZB 2A6IB 4R0LB 1FO0B 5ANME 1T21B 4PB9H 5JLZA 3CX5J 3GHBH 4YDVB 4G6AD 1A7RL 4YLQT 2AGJH 2XV6B 1U8NA 1M7IA 2XN9E 4HIIB 1CZ8H 1I3UA 4NUJA 4OV5B 3QIWC 5DMIL 1D5XA 2HJKB 4PY7A 5IQ7H 1CXFA 5HYJB 4JPVH 3RWGA 5C0BD 1H3VA 2EH7H 1CFNB 3T0VA 1P4IH 3W0WA 1OTSD 2G60L 1A3QA 4GOSA 3VJ6B 3IRPX 3KPSB 5JOEA 3QZWG 4I2XB 4JFXB 1BQHA 1UB6B 2CO6B 4X80H 2X4SA 1MFDH 1NCBL 3DXAE 3JTTB 3MRPA 5JUEL 5A3IC 2GJZB 1WBYB 5CIPH 2IWGA 1CGTA 4JM2B 3TO4B 1U8LB 1X5LA 5INDB 3CC5A 1T6VN 2QSCH 4CJ1A 1JF1A 1FFOB 3KLDA 3LD8C 4UBDC 2DQGH 1IM3A 4XPTH 3RPKA 3V8CA 4BSVB 2VTFA 2AK4E 3CFEA 3GMOA 4D9LL 1C5DB 3V6OC 4JB9L 4OKVB 3WEXB 3LSOA 4U1LB 3QQ9C 3PABA 1N8ZB 5GGVY 1NLBH 1L7IH 2ZNXA 1AGFA 2RHEA 3S5LG 4GQPH 1YNKL 2RCSH 1N7ML 4LIQL 4UDUB 4MQTB 1CICC 5BV7B 1T1ZA 4OT1H 1M7XA 3OKNA 3HI6H 4IRJA 1RZIA 4OI7A 1AXTH 3UTTA 4YPGB 2DBLH 3ECBA 1BZ7A 3KS0H 4MA7H 5FA3A 5I1KH 3NVQA 3IXAB 1YNTB 2OJZL 1NGYA 3L7FB 3E2HB 1AJ7H 5T1KB 3M17A 4XVUD 1W0WA 4TVPE 4CBPA 2AV7B 4HLZH 4JG0L 4HC1A 2IPUG 1VGKA 3EDKA 5DMGD 3LRSB 1VEOA 4UU9A 2IF7A 1MREL 3PHQB 3Q5YA 4LASH 4PGBA 1Q0YH 3RL1B 1DCLA 1RUKL 3QT2A 5B8CA 3MA9L 4HZLA 3BW9B 4CGTA 1T03L 3ZDXF 3GMPA 2VQTA 3U30B 3B9VA 4YHOL 4EVNB 4GXVH 3UMTA 4FTVA 4NSKA 2B7DT 4QCIB 4JRYD 2OK0L 2COQA 4BJLA 1KG0B 4XPHL 5C0BE 3JWOH 1GJIA 1PDKA 1MF2L 3CDCA 4KJQD 2HT3D 4JFDB 3CXHK 2IADA 4XP1L 3NN8B 4XNMA 2W60B 3QIUD 4EUPB 1CG9B 3BISA 1UJTA 1OWWA 12E8H 4P2OD 3NBNA 1OTUC 4HXAH 4NQVB 5ICXB 4KGJA 5GRUH 3FQRB 2ICES 3RX8A 1BVLA 3VMPA 4G9DB 4MSWB 3TBSA 2FEDD 3MRMB 4D8PB 1CU4H 5TDOB 4XVSH 3WL9A 1LP9B 4YHIB 3CFKB 1BFTA 1YEGH 2X70A 5GGQH 3ROLB 1U3HC 2EIBA 3GSNB 2CUHA 3MO1A 2FSEB 4JFEB 1JL8A 1IEAB 2SEBB 3LHPL 4OJFH 3RVWD 4WI4A 4HGMA 1OD9A 2ZCHL 1A5FH 5K93A 5D1ZA 4NC2B 1A7OL 5D7SH 4OZGE 2EE3A 2PW1B 3FB6A 3ZE0F 3BMWA 5DJ0B 3OR7B 1QQDA 3RTQA 1U6AL 4S2SB 5HVGB 1SBBA 2Y4SA 5DK0A 5F1SA 1F4XL 4G9FA 4AM0B 4NQCB 2KZ1B 4UT6L 2HKFL 3QCTH 1FV1A 2QADD 1MOEA 1N4XL 3KR3H 2E7HA 3CMOH 1M71A 5DR5H 2JKXA 3OAUL 2EDTA 4LCYA 1P69B 3IKCB 1HINL 3DBXA 2OZ4A 1X5AA 5FAAA 4TTGA 4M7KL 15C8H 3G6AA 1QBLL 4M5ZH 4YQXH 4OZFA 3WKMH 4CW1A 4UTBH 1TZGL 4PJ5E 4Z0XB 3SDDB 4NKMA 3OAZH 4MJ4A 1J8HA 2Q87A 2APWA 3OAZK 2YOCA 4APQA 4QNPE 5LWYH 3L5XH 4OQTA 1KCRH 4FA8A 4HG4J 3GMQB 5C6TL 1TCMA 3GK8L 3QI9D 1NGXA 3QUKB 4JO2H 5EBMA 1JHKL 3PQYB 3VFSA 2F54A 4PJIA 1KGCD 4GQ9H 4IRJD 4ODVL 3L9RA 3U1SH 1CLZL 2VN4A 3LKNA 1RMFL 1KXVC 3L95B 3F6LA 5CKAA 4BA8A 1CFTA 3W39A 3UTTD 4M5YL 1Z9SA 2VLJA 1A9EB 2AV1B 4JKPH 4JRYE 3OZ9H 3VFMA 3PJSA 4MAYB 5DVNA 4GMTH 3AM8A 5LVEA 4WFFD 2BVYA 4U0RC 3O4LA 2E8YA 4MNGB 1RK0A 3U83A 2ADIA 2DQIL 2KH2B 3ABZA 5I1AB 3LV3A 3PWUA 1BF2A 2X4OA 4LFHD 4PJFE 5DQJB 2NW2B 2AAVA 2DD8L 4ONFH 3VW3L 3BGFB 4GRMA 5LJYH 1OAQH 5EIVA 2DI7A 2Y25A 3LN4B 1WZMA 1IEHA 1PQZB 3BHBB 3PWVA 3QEQE 5DK2B 3F7PC 1KLUA 2Q20A 4P9HL 1H15B 1ROWA 1YMHA 2C3GA 3KPTA 4JJ5B 4R4NC 1N0LA 3VWKC 1NAKH 4NC1C 4RRPG 4FTVD 1E27B 3H9SA 4XCEA 3T0DA 2O5YL 2P8LA 5JIKA 3TA3A 4HMCA 1U92A 1CR9L 1NGPL 3QXWA 1FNEB 2HRPH 4N8PA 5HI5D 5CWSB 1B3JA 1MCDA 4RAVB 4C56D 4MQ7B 3DOSA 1T20B 3K8MA 4KZDL 4YHLH 3SDYH 2XKUA 3H0TB 3W0WE 2H2PC 1NC2B 4TSCH 1PKQA 2CLVA 3IETA 4ZSOA 4HGWA 4JQVA 5DEFB 3OXRB 4NRZA 3RNQA 2MSPA 2D03L 4YDJB 4WFHE 4NZRL 5LGJA 3KDMB 1HOCB 3TNNA 3B2VL 5EO1A 3CH1B 1NFIA 2F8XC 3ARFC 4F7MA 4AIZA 4R0LC 5J6GA 1HE7A 4ODUA 3U4EB 3CFIC 1E4KC 5CP7B 1IAII 1EBAA 4XB8A 2AABL 2VR4A 1AGEB 5IGXL 5AD0B 5GRVK 4M43L 5E94B 2V17H 3IFLH 4JKWA 5D1ZD 5MHSE 3MLXH 4JE4B 2ATPA 1H8NA 1EEYA 4Y19E 5DUBB 4PB9L 4LDEB 5HDBF 4XNXL 3GHBL 4N0UA 2AGJL 5DJAB 3RTQD 5DC0A 1PGRB 2C1PA 2QV2A 4G9FD 3GSNL 3WFCL 2VDPL 3EYQC 5CEXB 2XWTB 4NWTL 4JCLA 2MMXA 2AJYH 4DQOH 1KGCE 2UY6A 5DJ2B 2EDXA 2VDLH 2ICEA 1JV5B 3UTTE 3VXQB 5I8CA 4JM2C 3TO4C 1J0YA 5IF0B 1TJHL 2O61B 4D3CH 1AGBA 1S7RA 1YQ2A 5EOQL 1A6WL 4P2RA 5E2UH 4WFFE 4XRCA 4XP6L 5TF1H 3H7LA 1J8HD 3PWPA 2FGZA 4DFHA 1PX3A 4APQD 1RU9L 2GAZA 5D2LF 4Y4HB 1I8KB 3MNWB 1PG7H 1RIHH 4G7VH 1YECH 4WNQB 2NY0D 2F54D 4RMTA 1G7PA 3KLSA 2UYLB 5BV7C 1A6UL 4LQFH 5KSUB 2ZOKA 4L4VD 2VLJD 1HSAA 4FTVE 1UM6H 1JTTA 3TPUB 1NLBL 1DVFB 1FAIH 2A2QT 4U6VH 2Y6SD 1IC5H 4QHLA 3E2HC 1OAZH 1T1YA 4OT1L 3HI6L 5IMLA 2EDEA 5T5FL 2WINA 3EBAA 4FRWA 1CL7L 2P5WA 1AXTL 3P11H 1FNFA 2QBWA 2VXVL 1CGYA 2X40A 1WQVT 1AJ7L 4X9FA 4TUOB 1FG2A 4KH2A 3I3EA 2ZOLB 4HLZG 2NYYC 1D5MB 1KTDA 1A6ZA 2VDKH 3H9SD 3U30C 3ULUH 4LCWB 5GS3A 3CGTA 3TA3D 1Q0YL 1LEKB 1PG7W 1KIPB 3KYNA 4KRPB 1CE6A 3EYVA 1IC1A 5DTFB 2X89A 1UYWL 2FLBT 1FVCB 3U46B 5IT2H 4N9OB 4X99B 2GT9A 4I1NB 4G9FE 4NCDA 2DMKA 3D39B 3MR9A 4PJAA 3EO9L 1D6VH 3VGGA 3S4SA 2IQAB 2W9DL 3GSOA 4V1DB 3O45A 4XI5C 1UKQA 2CIKA 5IW6A 3C60B 4NJ9L 5FO8B 1JPGA 2GY5A 4JEGB 4H8WH 1FG9C 2PYEB 5F7DA 4HXAL 4S1DD 3L3KA 4U3CA 1OP5H 4LLAA 4Q6IB 5GRUL 3QJFB 3MRGB 4GKSB 1EXUB 3LKSB 2DF3A 1T6WA 4PGZA 2D2OA 1WIPA 4XVSL 4CVZA 1EO5A 1GGTA 2DIJA 4ZPTA 1J8HE 1YEGL 3KPRE 3PV6B 2GTZB 5FHBL 3IF1B 1OAXH 5JOFB 5IFHL 4KVCH 1NCAH 3RIFF 1WIUA 5CBAB 4YFEA 2F54E 4PJIE 5IB3A 4OZIB 3CFJB 2IH1A 4X6EB 2IFGA 1HZHH 2VLJE 4Q2ZA 4ETYA 1A7PH 3FB8A 3EYOA 1XF4B 1LDPH 5EO0A 4F7PB 5I1CH 2VC2L 4MJIA 4XNYH 5MENA 4X6CB 5E1AB 1A7BA 5ILTH 1UH3A 1VFAA 4P2RD 3GKWH 3NTCL 1L7TH 3O4LE 3MLZH 2XY1A 5FUCE 4LHJB 5FKAB 4ODSL 5FF6A 3PWPD 1C16A 2AJUL 3W9DA 3ZKNC 1FGNL 3CMOL 5DR5L 1SMOA 3WO3B 3SDDC 1X5JA 4HJ0D 1MPAH 1NGWB 3MQIA 3T77B 1YC7A 1CDUA 3S36H 4F15B 5BVJA 4J8RA 5C0CA 5IUSA 1UWGL 3IJSB 5LKNA 15C8L 4F58L 3MBXL 2APBA 2G9HB 2ED7A 4UTBL 2OL3H 4FG6C 1KLGB 3H9SE 1MCPL 2VQ1A 2E9JA 3MXWL 4QLRA 3SJVB 4MAYC 4JO2L 4MX7B 3CMGA 1NFDF 5EORH 5E00A 1OSPL 4Z8FL 4HDIA 4U6XA 3HZVA 1E4WL 5T3ZL 1PKQE 2P5WD 1LO3H 3W5MA 5IHZB 1DE4A 4ZSOE 4MNHA 3NCJH 1U8JA 3OZ9L 1DL7H 4ZAKB 1HWHB 4PY8J 3MRIB 2X4NA 4AENB 4UV4L 4NHCH 2CDGB 5FUZH 4GMTL 3AS0A 1ZA6B 3GJEB 2ARJQ 4XWOD 5AYUL 4W70A 2FB4L 4FXKB 4U7MA 3V79C 3KHOA 1BPVA 1SY6L 1WZKA 4QWWC 2WK2A 1OAQL 4HWNA 1F3DH 5F1IB 1SQ2N 1F90H 5INCA 3RWDB 3WNOA 1E6JL 2ORBL 3QNXB 1HH6B 2VRAA 1NAKL 2X89D 5T3XL 4N0UE 3L3DA 2CJUL 4R9HA 5E08H 5ALCH 4Q9RL 4M6OL 3MV11 5DD1H 1AD9B 4R2GB 2DQFA 1X9QA 3O3AB 3AGVA 2HRPL 4I77H 3T04D 2EO1A 2WWMC 1IKFL 3HR5B 2BMKB 3WIIH 2ADGA 3SDYL 5AZEL 4TNVF 5L6YH 3MRLA 4G5ZH 1PX4A 1KPRB 3PP4H 2FZ3A 5CJOH 1A1NB 3NZHH 1LQSR 5E70A 4LVOB 3CU7A 4YUEH 1ZVSA 5EDXA 3RDTB 1VSCA 1XCQA 3QBTB 4P2RE 4I18A 5E95B 4PRDB 3TBYA 3EYFB 3G6DL 1A64A 3K2UL 2DDQH 3PWPE 4YAQA 1T1WA 5D4QA 5T1MA 2E7LA 4OLUH 1I7TA 3FCTA 5GS1B 4Y1AA 1MFAL 3V95A 4Q9QL 3GFUA 1TENA 3IFLL 3VU2A 3MLXL 1A7NH 5KSBB 3MREA 3Q3GB 1FBIH 4HUUA 4JM2F 1FL3B 4R26H 3D2UA 1DDHB 2IPTH 1ZA3B 1UCTA 4LMQI 4QTIH 1HN1A 5I1GL 4FQCH 2J8HA 4NJAL 1C08A 1C5CL 2Y06L 4FQXA 4IIQB 4MJID 4BKLB 5MEND 3O8XB 1LK3H 1AHWA 1B9ZA 1J05A 2B2XH 3N1MC 3DX7B 2YPVL 4Y5YB 5E2WH 3CVHL 4GW5B 2VLRD 5IEKA 2E7MA 5IKCB 4DQOL 1ZT7B 4KPHL 2XT1B 3PXHA 2P5WE 2L7UA 4EOWL 4O2EA 2HWZL 1YEHH 5CMAA 4KU1A 4YDKL 5ENWA 4PS4L 1VGEH 4CAGA 5CEYB 4OI9A 2QQKH 4JDVB 5C0CD 1NLDL 5EU5A 3CK0L 1HHJB 4JLRA 2ED9A 5F7HA 1KCVH 3HHRB 5JTWA 1PG7L 5GGVH 4TSBH 1S7TA 4G7VL 1DVFC 2ZNWA 5EWIH 3TBWB 4Z7WB 5HHOB 2OR9H 4LQFL 4NNYB 2D9QB 1JIBA 3VXRB 3P4OA 1MHPH 3OGCA 1QSEB 1ZSDA 1VACB 2HRLA 3NOIA 3ZKQD 1UM6L 4PJAE 1WEJH 2IC2A 1NUGA 4LDOB 1NSNL 2XWJA 2D31B 4Y5VB 5EU6B 3VFRA 1IC5L 1VB9A 4JFZH 3UDWA 4EKXA 3GEWB 4KJWC 3IDIA 1IBGH 4NNXA 4G6MH 5DLMH 4LLQA 2EKSA 3HS0A 4HIJB 3BP4A 3S7GA 3QH3B 4F7TA 3P11L 4QXTB 4OFVA 4MHHG 3FOLB 3GJFH 4JZOA 1FNAA 5HHQB 5D7IA 5I30H 3FRPA 4MA3A 4KRPC 4XPAL 4K3EH 1VADA 2HFFA 4Q97A 1EHLH 1RHHA 1CGUA 3LB6C 3LKPB 2AJZB 4JPIB 4OFYA 5SWQA 4NUGL 1DBBH 4DZ8B 2Z93B 2XN9B 2P5EB 1OW0C 4JQIH 4PTTA 1INDH 1LP9F 2R1XB 2XKNA 5F9WB 1U58B 1JI2A 1G0DA 1NC4A 1LE5A 2DM4A 3CUPB 1WBXA 2X2YA 3T3ME 2E9WA 5D7KD 1ZGLA 3C60C 1K4CB 3SCMB 4DAGH 4JANB 4MJIE 3NIDE 3FO9A 1IGFH 2AJVH 4Q6IC 3C87A 3H3BC 4OF6A 1I75A 1Q8MA 2F74A 1NCDL 1XF3A 4GMSH 1NGZB 1QO3B 5F9DC 4GBXB 5IVZB 5BO1H 3JV4B 4BQ6A 3BIKA 2BHYA 3VFTB 1HHGA 4H8WL 4U7SA 4Y1AD 3WDHA 4UDTB 3S3JA 5F7WC 1OAUL 1NJ9A 3P30H 1I7RB 2E8ZA 4DOHE 5C0CE 5C0DB 3D2UD 1FL6B 5GIRA 2QQLL 5EZOH 1ZTXL 1WT5C 5DJYB 3BOVA 5IWLC 4XPBL 3SDCC 2Z8RA 4XP5L 3BRFA 3WFEL 4FQXD 3MFGB 4LAQH 7CGTA 1KJ2H 1KN4L 3HC0B 3HZMB 5FO7B 4E5XA 2EDQA 3M07A 1FFRA 4CN4A 5B38B 1H5BB 2VN7A 1F4WL 3PV7A 2Z91A 3FZUC 4O2FA 4QRTB 2VWEE 2B4CL 4GAGH 2FYYA 1J1OH 1GPOH 1CDYA 4DVRH 1UVQB 4M1DH 2IAMA 1DJSA 4F15C 2NY2B 1XR9B 1JGUL 2EDNA 3GKWL 4NGHL 3E3QC 3D25A 2Z4QB 4LLYA 3VA2C 3G5YA 2H1PL 2O93L 1HYSC 2DI8A 1CIUA 2FX9L 3SKMA 3TGXA 3FN0H 5J1SC 2EO9A 3FO1B 5E6ID 2MCPL 3RZCD 4WJ5B 4IEFB 1T0MB 2JJTA 3WIFA 3Q6FA 2GK0B 2O5XL 3GB7B 3QG7L 2V5MA 2DIAA 4OLWL 4HWBA 7FABH 1YA5A 4LSUH 1J7VR 1SVZA 3A6BH 1Q9OA 4LHQB 1RUPL 5E99L 2OL3L 3VXOA 4F9PA 5EC1A 3DVGA 1P5UA 5I1LA 4R6UA 5KAQG 4EN3A 1RULH 1EMTH 1WSST 1QSVA 1R0AH 4LEOB 3CDYA 2G5BA 2ZUSA 4M7LH 4LCIH 2G5RA 3RUGB 3RWIB 3U0WH 1KULA 1NUDA 5C0BB 1MRCH 2FRGP 5D7KE 3VFUA 1ETZA 1KIUA 3TYFB 4UTAH 3NCJL 4KQ4H 1IFHH 5IB5B 3I6KA 1DL7L 5JMOC 2OS7A 3FQTA 4Q0XH 2DLFL 4P4KA 4NHCL 1ND0A 3VXSB 1LHZA 2V2XA 1YUHA 2Q7NA 2JCCA 4I48B 5KVMC 4XVJH 2VABA 1EH9A 3UBXB 4JAMA 4OFYD 3VXUA 1GXEA 4Y1AE 1OOAA 1AR1D 1TQBB 1EEZA 1IVLA 1W8NA 5F7EH 1IAMA 1YDPB 4QY8B 4R2GC 2YD7A 4IS6A 3IFNH 4A2MA 4TNVK 3HC3L 1NC4D 2FECL 5LGKA 2EICA 1P7HL 1KCLA 2FX7L 5E08L 1PJ9A 2F53B 3H2WA 4FXLA 1I8IA 3QO0A 2YC1B 2OR7A 2ZP0T 1TETL 4LVOC 1X5YA 1VFMA 1T7VA 3RI5F 4I77L 2E7BA 4YXLH 3RDTC 5HI4C 4J4PC 4KKBC 5D9SA 3R1GH 5L6YL 4ZUUB 4QXWA 4UQ2A 1I1FB 3REVB 4RFOL 1TNMA 2NY6D 2ZUWA 3NZHL 3HB3D 2CR3A 1ZT1A 4YUEL 5JXEA 4H0HB 3UZEA 3DNKA 2WLYA 2D4DA 4DN3L 4NO0A 4H0GA 3FO0L 2EYTB 1PD6A 4QRQB 5AZ2H 4ORGA 4FP8L 4WU5A 5TF0A 2DDQL 4YC2B 2B4CC 3QEUB 1T7YA 1QRNE 4X6FA 3CFBB 4OCSH 2PW2B 4LKXB 2BVPA 4IIQC 4I3RH 3O8XC 3ARXA 3GNML 5HGDA 4Y5YC 3D5OF 1FBIL 2APVA 4R26L 4XC3L 5ID1A 3KYAA 5EO9A 4CU6A 3LKRA 3O41A 5D5MB 2JELH 2FX8H 4ZDHB 2Q7YB 4QTIL 5E2TH 5KSAA 4U33A 4OBRA 2IAMD 4WO4A 2ZUUA 1I3GL 4ZOAA 3FB5A 3KPLB 4GKZB 5I1DA 3ES6B 8FABB 2HT2C 3RNKB 3MRHA 4YX2L 1XGTB 4RMQA 4OUUB 1YNLL 1RZJH 1XH3A 2GITB 4XZUA 1SYSA 5L2JB 1AO7A 3PGDB 4HG4K 1U0QA 1HCVA 4W6WB 4P2OB 4F37F 5D7IE 2CUIA 5K59F 5SV3A 3HPJA 4N0FA 1G7MB 3EYUH 3RWEA 1T3FB 3BUYB 3DIFB 4S1QH 2CK0H 3MUZ1 4M8QA 3RVXD 5I8OH 3QHFL 1AD0A 1MCWW 3FT2A 3NGBB 4WI5A 4P2QB 5GGVL 1M7IB 3CDFA 4EN3D 4YHZL 4OCYH 3VFVA 1U8QA 2GSIB 3W11D 3ARPA 4QOKA 4KRNA 2OR9L 4MZ3A 4G43B 4WI2A 3L3OB 1MRDH 4HD9A 1BIIA 4AK1A 1JWSB 1EAPB 3MLVL 1F6LL 3F12B 3G6JA 4ONHA 4PJBB 4P4KD 1DQML 4ZUWA 5CD3A 1K5NB 1QUNA 3FONA 3GBNL 2X4SB 1IBGL 4RMRA 2DQJL 3IT8D 5DDHB 3MRPB 1RIUH 3BAEH 5DLML 3VXMB 5ITBH 4R4BA 2QADB 1T0PB 3AXLB 3VXUD 1P4LB 1UXSB 3MZGB 5H94A 3S97C 4HF5H 4O2CB 4E41E