1FN4A

Crystal structure of fab198, an efficient protector of acetylcholine receptor against myasthenogenic antibodies
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
211
structure length
211
Chain Sequence
DIKLTQSPSLLSASVGDRVTLSCKGSQNINNYLAWYQQKLGEAPKLLIYNTNSLQTGIPSRFSGSGSGTDYTLTISSLQPEDVATYFCYQYNNGYTFGAGTKLELKRTAPTVSIFPPSTEQLATGGASVVCLMNNFYPRDISVKWKIDGTERRDGVLDSVTDQDSKDSTYSMSSTLSLTKADYESHNLYTCEVVHKTSSSPVVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MONOCLONAL ANTIBODY AGAINST ACETYLCHOLINE RECEPTOR
publication title Crystal structure of Fab198, an efficient protector of the acetylcholine receptor against myasthenogenic antibodies.
pubmed doi rcsb
total genus 31
structure length 211
sequence length 211
chains with identical sequence C
ec nomenclature
pdb deposition date 2000-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fn4A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fn4A01
3A6CL 3QFJB 4Z78A 1TJIH 3FAWA 4P57B 2J4WL 3I6GA 3SQBA 4NQUA 5JR1H 4KDVA 4QRRD 4G8FA 2P45B 5ALBL 1FORL 2UV3A 1F4YL 4GKOA 4LU5H 4NQDD 3ZSSA 2B0SH 2F9BT 3L5HA 2HRLA 1Q72H 3G5XB 4NQEE 4OGAC 4FZEL 3JV6B 5CSGA 5IVNA 4EXKA 4R0LB 3GSWA 1AD0A 1MJUL 3X3GH 5I1JL 4OCWL 4FRWA 2F5AH 2D0FA 2VLJA 3ES6A 5KVDH 3LQAC 2HA1A 3HE7C 1JGVH 4X5WA 3BZFB 2DLFL 1M6OA 5IHUL 5MEQA 4PG9B 4L3CA 2R2HB 1P5VA 1SEBA 2IF7A 1NDMB 3SGDI 1QA9B 3BE1L 4YXLH 3V0VB 3GSQA 5I18H 1TFHA 4U1GC 1XF3A 4JRYA 5ENWB 3WS3A 4NZRL 2D7QA 4XPBL 2GJZB 2FX9L 5A2JH 5HGDB 3HNSH 4GSDH 1VEOA 3CSGA 3W2DL 4F3FB 4K2UL 1QR4A 4N9GB 3CDGB 3SDAA 1UJ3C 4IDJH 3SKOB 3MLVH 5A3ID 4U6TA 5JNYB 3L3GB 1F58H 4QRTB 5TQ0H 4XP6L 2W60B 3IJSB 4QNPF 2A83A 3TYFA 2AQ3A 1FJ1A 4JY6A 1AHWC 4LKCB 1SVZA 1BZQK 3TP4A 1KPUB 3TCLB 3QUYA 2Z92A 4P23C 5ADOH 3KG5A 5F7MC 1J0KA 4JQVA 2HT4D 1KXTB 4YFEA 1MNUL 5MENB 2PXYD 1U3HA 4H88H 1SJEB 1WCBA 1T3FB 5E6IA 1H0DB 1HINH 4JJ5B 1A3RH 4H5SB 4HK3J 4DTGL 2A74A 4G6JL 1XF1A 1UACH 4U0QB 3PIQB 1KXVC 4R90L 1Q0YH 2DQTL 4N90E 2HT2D 4DKDC 3BPNB 5HHQA 1T66D 5DMIL 3MV9B 3STLB 3FT2B 1G1YA 4JFHD 4U1JB 4KV5E 2R2CA 3ULVC 1CVRA 1I8MB 3WXWL 3MJ6A 3O4LB 5IB4A 5L2KE 3MRDA 4N8CL 5KS9B 5KVGH 2FB4H 2PNDA 4FTVB 4PG2C 1NSNH 4YDLC 5MEND 5D1ZB 1I7TB 5FB8A 5I1HH 5HHOE 3U6RB 1HNGA 1GGCL 3U82B 4ETQA 5GGSB 5I6XC 3MRLB 1T04B 5E94A 1EHAA 2SEBB 1IC7L 1RMFH 4WGWB 2E6JA 1RZ7H 5JW4M 3AC0A 4F7EB 4GKNA 2I9TB 4LF3B 1N5AA 4LAQL 5ESQB 4GBXB 1QYGL 4LDLB 5GGVL 1GIGH 4PRPD 4QYOB 4PJ8D 2VB5A 3OJDA 1XEDA 3FQNA 1QSEB 3L95A 3O4LD 2FBJL 5FYKU 4NZTL 1B0RB 1NANI 1X5YA 1A1NB 5D1ZD 4NCDA 1YEGL 4QXUH 1WBXB 5L88L 2YBRB 4B5EA 3QBTB 4MZ3A 5HGHB 1PW3A 2KQNA 1A4JB 2XQYG 3UC0H 3HPJB 2OTPA 4MJIA 5GJTH 2X4TB 4CDHA 1CFQB 5T3ZD 2Q6WA 3J8F7 3KYMB 1UXSA 1AXSB 2VSDA 3HMXH 4ZFGL 5AG8A 3SKMA 3TBTA 3W0WD 3NGBB 1J1OH 5K59E 4XVTL 5JXED 4Z7WB 4GBXD 1ETZA 3GO1L 1EIBA 1UEMA 3EGSB 4KRPB 4F33A 2Y36L 1TTGA 4NSKA 3SDXB 1HWGB 2XTJC 4PYHA 1QSED 4JZJA 4ENEC 3MREB 4OUOA 4JKWA 4PRAA 4DQOH 4TRPL 5FYJE 4MVBD 1EDQA 4WWKA 5ADPH 4PJDA 4N0YL 5CP3H 3O8XB 3VWKA 4TPRL 4X4YB 3V4UH 1PQZB 2VABA 5JW4N 2A6DA 4HQQH 7CGTA 1FV1B 4LKXB 2DKSA 4JHZA 3I85A 3VXPB 4PJBB 1AY1H 4CVUA 1ZHLB 3ZDYF 5LGKA 4OLUH 3O11B 2AJYL 5DI8A 4P4RB 1RY7B 5BMFL 4Z76A 5E1AA 2ID5A 3UTOA 4G9FE 2ESVB 3BZEA 3EAKA 2CLZB 3CFJB 5I30H 2C1PA 2C5DC 1FSKC 1WC7A 3OGOE 4XAKD 3MLRH 1CDCA 4XNQB 1P9MC 3O8XD 4L9LB 1OARH 5L9DL 1J0JA 4MDJB 3P11H 4C4KT 4XVJL 4ZNEA 4ZTPL 3UYRH 5F9AC 1CQKA 3PL6B 1M7DA 4PR5A 1UWXK 2Y6SD 2K7QA 4LIQL 1KIUA 1KN4L 2BSRB 4G80A 1UADC 4JFFA 4JRXE 4F2MB 5JLZA 3GUTA 1ROWA 2ED9A 4NPYA 1KT2A 3U9UB 4ZDHA 4NQXB 3T77B 1B0GB 1BGXH 4D9LH 5FCUL 5I8OH 4BFIA 3RUGB 2YZ1A 1AXIB 3BDXA 2XKUA 1JWMB 3MUJA 2E27L 1EEZA 4XZUA 3S88L 3CVIL 4JHBA 5JHDB 5EO0B 4YXKL 3HZYB 3QEQA 4QRUB 2OS7A 4GS7B 4IS6B 2J8UF 1F4WH 4L4TB 1Y6MR 2CIKB 1EXUB 2EEBA 5I75B 3DX6A 4I2XB 1Q9WA 3HUJB 3OGCB 3DURB 3JXAA 3PL6D 4YAQA 4KJPC 2KH2B 3RWEA 4GW4B 4M7KL 1NLBL 3SE9L 1PSKL 3TH2T 1YDPB 3SQOH 1X4YA 4RIRB 5D2LF 1LE5B 3VFUB 3AMKA 4R26H 2XQBL 4PRHB 5T3ZL 3C5ZA 5D7LD 1IAOB 5HDQH 5JHDD 1DBJL 3CZFA 4PJHE 3UJTL 3GSUB 5CJXA 3ARUA 3CH1B 3P4OB 3FFDB 3CX5J 4RAVB 4I0CC 5FYJH 5SX4H 4L4TD 4U0RB 5D70L 1ZTXL 1QSFE 1NLDH 5EIVA 2B39A 4LP4A 3PP4H 3IFNH 5KZCB 5HJ3A 4HS6B 3BPOC 1G6RH 2ZSWA 3QNYB 3LS4H 1JGEA 1J8HE 1YNKL 3G6JE 4MA1B 4NWUL 1OF2A 2M8XA 3GSRA 3WJLC 2QQLL 2W91A 2I9LA 5GGQL 3TFKC 1U2HA 1U8HB 1UM4L 4YO0B 1CS6A 2HMIC 4M6NH 4KAQH 4PRHD 1F00I 3B3IA 3GI8L 3TIEA 4EDWH 3QDJE 4F7PA 4FQCL 3THML 3TBYA 3PWPE 2E9BA 3S96B 4P2OC 1FZOA 1S7QB 4BQ6A 5EO1B 3P9LA 4BFGA 3BP7B 3RVTC 5KZCD 1I9IL 1AP2B 2I60H 3VD9A 1HXYB 4ODWA 1KPVA 3TZVC 4X6BB 1F6LL 4NQCA 3A6BL 5DD0H 5AUMA 5IM7A 5F70A 3UXFA 4HV8A 3CH8A 4WW1B 3NCFB 2J5LB 1HDMB 2QQKH 3BGAA 3IFLL 2EE9A 5DTFB 5FDYA 1KIRB 1TJGH 3MGOA 4NC0B 2XWJB 5TDOB 3UROR 1YPZB 2WUBH 3IU4H 2DDQL 4B50A 4PJ5B 2YD5A 3L7FA 4FXKA 3FOMB 5SX5H 3TN0B 4NKIL 1MCHA 3MACH 1ZS8B 4TVPH 4Z7UE 4JR9L 2R0KL 5I1GL 4W6YB 3MRKA 4ELKA 4Z6AT 1JPTH 4LHUB 3ROLA 1NAML 2YXMA 5FKAA 4JFOA 1ZLUH 3BPCA 1OGTB 3IDXH 5K9KA 3ARTA 4P3DB 4JGUA 3TO4B 3WO4C 5D93B 3OJ2C 2J88H 2DD8L 2IPKA 2DTSA 1NBZA 3HC3L 5ACZB 3D39D 2YD3A 1UM6H 3U1SL 4HF5H 5IOPB 3TN0D 1GPOL 2FL5A 1GL4B 2KKQA 2H2SD 3O9WD 3STBA 3SE8L 3ES6B 3BWAB 4AENA 1A14H 2AV7B 4BQ8A 1ZANH 3G6AA 3SJVE 3OAUL 3O2WL 4OM0L 5ELIA 3BN9C 5C6TL 4LHUD 2LAAA 3L7EB 3QCUL 5DEGB 1BX2B 1T2QL 5DWUH 1DFBH 2CO6B 3QUXC 4DOHE 3O2DA 3QO0A 5CIPB 3TO4D 4ODTH 5A16B 1SEBB 5DJ2A 2LE9A 1RV6X 4NOFA 5CKAA 2D31A 4ZAKA 2EKJA 4OD2A 4LPVA 4PRIA 2F74A 1V8HA 5HY9A 3FZUD 3W9EB 1FC2D 3WS3B 1YNLL 4MQTB 2FEEL 5IVOA 1S9WA 1U8JA 1BFOA 3LZFL 4KKAC 7FABH 3MLWL 2ZOKA 4PYGA 4XPAL 3UTTE 1PLGL 3O41B 5J56B 3RWJB 2VL4A 5CZXC 4OCMC 2AABL 4KTDL 2ZUQC 4OF8A 2Y5TA 3U4BL 4HJ0C 5E4EB 5IEHA 2A1WL 4Q0XL 1MFAH 3S37H 4MX7B 3PABB 3IS0X 1YMHB 2FLRT 5IMOA 3D18B 1MF2L 3P9MA 4OCYL 1R0AL 3JUYA 1YEDB 5HDBE 5B8CC 1X5HA 4XWOD 2B5IC 2HN7B 1YEHL 4EUPB 1U3HB 4F8TA 2ERJC 1WCBB 3BKYL 4YK4C 4NP4H 4W4OC 4MMXC 4Z5RA 1LK3H 4XMKL 4XX1G 2DWDB 4XP4L 3F58L 3C9NA 3E6FB 1ZV5A 2DM2A 1MHHA 4YDVA 1S8DB 5HYJE 1PKQA 2ICWJ 1U8NA 4P2RB 5HHQB 1OLZA 4LRNL 5ISZA 3TT1L 2OR9H 4H0HB 3CFDA 3G5VB 2CGRH 4B41A 1CGXA 3P4NA 2V2WA 1DL7L 2H8PA 4WW2F 2CLRB 1HKFA 3VXRD 1ITCA 4DVBA 2GJ6D 1U3HD 5CILL 1TTUA 1OP3K 4ETQB 4K3GA 5BRZB 1XGUA 2WLYA 4M61B 5C2BH 3I2CH 2QKIB 1F3RB 3WLWC 4K7FB 3RQ3A 5FK9A 4Z9KB 5J7CC 2VLLA 1A7NL 1OHQA 1NBQA 4P2RD 1IM9B 2NY6C 4GT7A 5J12C 4Y5XA 1JHTA 5C71A 5FYKD 4AZ8A 3OJDB 1X7QB 1QBLH 2D7TH 2MNUA 4HJGB 5MI0C 1NCBL 4KZDH 2DJ4A 2YUXA 1JRHL 2AK4E 4R4FH 4M3KB 3IB4A 3KYKL 3QIBD 3WUWG 1A4KA 1F97A 2N7BA 1T1WB 1IAIH 4HGMA 4WI7A 5BRZD 2W65A 5CUSH 2EO1A 1K4CA 2VUYA 4MJIB 2EDNA 4RGMB 1EEYA 1C5CL 2D0GA 1IGCL 4RMUA 4U3HA 3BXNB 1QR1B 5DHYA 1ETZB 3PGFH 5CLTA 3DMMB 1IM9D 3MRFB 3ZTJG 4F33B 1U3YA 2QSCL 1ZE3C 3PDOB 2C7UB 3AY4A 4JZJB 3SO3B 4Z18A 1DQMH 3NA9L 1JYVA 4PRAB 4DFHA 5SX4I 1RUKL 1FNSH 4L8DA 3JVGA 4PJEB 4WWKB 4JM2D 5DGRA 4PP2B 1LE9A 4PB9H 3RWDB 3WBDA 2IALA 4P2QE 1HE7A 1WFOA 3FRPA 2EDKA 3MNWA 1DANT 4G8GE 5FF6B 1XF4A 3LEVL 2EH7L 2BVTA 5F21B 1YEKL 1NMBH 4RZCA 3RJDA 3DMMD 3TJEL 3QI9B 4A2MA 5SX5K 4HUWA 4IRSD 5IB2A 3NA4A 1MH5A 1CBVL 4KK9D 2FO4A 4OKVA 4FG6C 1JNLL 2GIYA 1U2CA 2MPAH 3RKDD 4ZXBA 3MFFB 1NBYA 4KROB 5IWLA 3SEPA 4E41A 2C1PB 4CL7A 1GOGA 4QKXB 1ZLUK 1WC7B 3W82A 1PD6A 3MUHL 2BNQE 4XCYB 1S7WA 2Z0BA 4P5TA 1YYML 3RZWA 3MO1A 1E4XL 2MCG1 2C26A 4BH8B 1LO0H 5ILTL 4XPTL 3Q2CA 3UO1H 2BK8A 3BUYA 4L3EE 1MRDL 4JKLA 3DVNB 3WIHA 3ALWA 3BP5A 3QI9D 4G80B 4JFFB 5JLZB 1T6WA 5F9DC 3S6CA 4NPYB 5D96C 3HZMA 1MIML 3MUY1 3EYQD 4L9DA 4TNWK 1A6WL 1VGEH 4ZUWB 3GSOB 1EO8L 1ZKAA 4PGCA 1RK1A 1QACA 4LVEA 5JZ7C 3O2VL 4FP8L 3MLSH 1FL3B 5CWSA 2ZUWA 3BN3B 2Z31C 1ZWIA 3OJVC 3QEQB 5E2TL 2Q87A 4H25B 2X4UB 3LQMA 3MCG1 4ALAL 5ALBH 1N4XH 3B83A 2EDTA 1Q9WB 2V9TA 2X10A 5F1NB 2GHWB 3FQRA 1E27B 4OIIH 4LRIC 4NN5B 3N1GC 3RWEB 1FFOB 1D7FA 4NCC2 2CKBB 3ZMRA 1MAML 4ZNCD 3DROA 3OQ3B 1B90A 1MCOL 1HOCA 5IHBA 1YNTA 4X98A 4KJYB 3JTTB 3KYNB 4HKJA 2E7HA 5I1JH 3UTSE 4GRLD 5GIRA 4K8RC 1D5IL 4K7PL 4F37K 3GK8L 2DLFH 3CZFB 5I73B 1OQOA 4ESKA 5IHZA 4P9HL 5BOPA 3GJFH 3QXDB 3KPRE 4YDKL 5IG7B 3VFRB 4O51A 3BE1H 2E3VA 1JNHA 3QFJE 5HJ3B 4WO4C 5T5NF 4TSAL 15C8L 5T1LA 1CFNB 5JPMA 5MHSE 3AM8A 1S5IL 2HJKB 3L5WA 4HCRA 4NZRH 4XPBH 3RWCB 5TDPB 4DGVL 2FX9H 4Y19A 3F6IA 3W2DH 5EA0L 4KJWD 4K2UH 5JDJA 1QPXA 1MFNA 1OSZA 1HIML 4PJGF 3L3IB 3MOQA 1D5ZA 5DQJB 4H8WL 2V9RA 4XCEA 5JIKA 4OV5A 3O45B 4XP6H 3TIEB 1ZA6A 5FGSA 5C86A 1MJJA 4NZDA 5C6WH 3KLDA 5D6CA 4U1NB 3BESR 3NIFE 3P9LB 5BQ7A 4MB5A 1MAJA 3IAGC 3RVUC 4LVNC 2Z8RA 3FONB 2VUOA 4LLMA 1MNUH 3WNKA 2ZSVB 2VZ3A 4KVNL 3TNMB 2PYEE 5AUMB 1U8QB 5DRXB 3BX7C 1U8IB 4M62L 4DTGH 4G6JH 4P46A 5E9DA 2F5BL 1B4RA 4GRMA 4M7LT 4R90H 3B2UC 2DQTH 3WUWB 2V6HA 3G9AB 3N1QC 4NC1C 3BEVA 5DMIH 2Y06L 4HS3B 2APFA 4WUUE 3WFZA 1E4KA 1BD2B 5CINH 3BP4B 3RL1A 3FRPG 4CADA 4N8CH 5C9KA 3CX5K 1OQXA 3TPKA 1EX0A 1IAKA 4LCWE 1UYWL 2LABA 3WSQL 5JQ6L 3D0VB 2VN7A 4JFHE 5IB5A 1MCKA 3TVMC 5K59F 1D9KC 4UDTA 5DHVA 3MRKB 2YK1L 4ZOCA 1IC7H 5KG9A 2AJUH 1IKNC 3R1GH 3VI3E 1GGTA 4JFOB 3BPCB 5MENE 1X9QA 4WV1A 43CAB 4Y5YC 2EC9U 3RX8A 4LAQH 3KPOB 1K9TA 3C09B 1QYGH 5GGVH 5C0ND 1AI1L 3ALPA 4NN6B 1NBZB 5CHNA 4AIOA 1BD2D 3X17A 3EYOB 5F88A 3VFPB 1MCSA 2ZUUA 1ZK9A 2OCFD 4NZTH 2FL5B 1QSZA 3MV9E 3B5TA 1DLFL 3W9DA 5JA9A 5L88H 1IILE 3EUUA 3O3EB 5IFHH 4FQJH 2KQMA 5KS9E 1TNNA 4FTVE 5CD3A 1AIFB 2NY0C 3QRGH 4UBDC 3NAAH 4ZFGH 1FVCA 3IDNB 1NEZA 2P7TA 3MXVL 1KJ2B 4WFGD 1IAII 3GO1H 2DAVA 4DZ8B 5GXBB 3BMWA 4ZAKB 5L2JB 3MRIB 2Y36H 5T3ZE 2F74B 4W70A 1M7IA 4YH6A 2VZ1A 2JB6B 4G9DA 1S7VB 1JWUB 1ZGLP 3IJHB 1U8JB 4C56D 1BFOB 3EYUL 5F44A 4M7LL 1I3GL 2ZOKB 2E7BA 1U42A 5ICXA 5DJ0A 1KTKE 3DRQA 5DVNA 1QSEE 5F9WC 1VGKA 4EI6B 2Y5TB 1HHIA 1B2WL 3FQWA 4TPRH 1MJ8L 4EDXA 1I3VA 2XA3A 4OIBA 3LIZL 3FO0L 2CK2A 4HKXA 4JY4A 2CRMA 4WIQA 5D9SB 3BWUC 1VB9A 2NZIA 2AJYH 3IDUA 5BMFH 2D7OA 3VXQA 4Z95L 2AKRA 2NR6C 4Z7WE 4MWFB 2MHAB 1VACA 3KGRA 3QYCA 1JI1A 1E4WL 25C8L 2XZAL 5KSBB 2Z9TA 4HGWA 1BVKB 3OKDA 5HYQA 5D2NC 1MHHB 3IFPA 1KEGL 1DN0B 5D4QA 3BD4A 5E7BA 1ZT4A 5L9DH 5FUZH 5ISZB 3TBVB 4XVJH 2XACC 4IIQB 1MCEA 1QO3A 4FQXC 4QHMB 5A2FA 3DV4B 2V2WB 4LIQH 1UGNA 4NKDB 4CVXB 4Y0GA 1OAUL 5DUML 1A6VL 5LJYH 2IQ9L 4DVBB 4XPHL 3LKNA 3BGMA 4AM0A 5FCUH 4OQTA 4PJBE 3K8MA 3OX8A 5JOPD 1R6VA 2W38A 4X7CC 2E27H 4X6EA 3S88H 3CVIH 5E1HB 3C6LC 3VXMB 4YXKH 2BOBA 5FK9B 3GJFK 2VLLB 2ESVE 1HSAB 5IVXF 3G6JF 4LFHG 3ILPB 3MRBA 1AD9A 4Y5XB 2YD9A 2F19L 5GS3A 1LDSA 1NLBH 4M7KH 3QRFM 2JE8A 4NUJB 4M43L 4XPFL 4KC3B 3SE9H 3UYOD 4MXQD 1ZA3B 3IT8D 1SYVB 3RIFK 3VXUB 2KUTA 2HFGL 2W65B 2XQBH 5T3ZH 2AW2A 3MUZ1 5I74C 3VXMD 5I1IL 3UJTH 1T1YB 3DSFH 4LCUA 3KLHD 4ELME 3RUGE 1UKQA 3EJYC 4JZOB 5ESVB 5D70H 1ZTXH 3GBLA 5JHDE 4PRNA 4I48A 1MHPL 3O6FB 1JL8A 3OKYA 1YNKH 4NNXB 1K8DB 1DP0A 2OQJA 4NWUH 1A6UL 3UDWC 2QQLH 2BY2A 5GGQH 3VXUD 2VITA 4Q97A 1IE5A 2GTZA 1UM4H 4HXBL 4UQ3B 3UTQB 4Z7VA 4K3EL 2IALB 5DSCA 3MXWL 1T0NA 5KSAA 3AFLA 3MNWB 2JB5L 1FCGA 3PE9A 1EERB 4G43B 1YYLH 4MB4A 1JYXA 5C08A 1VFBA 3THMH 4Z7UF 3IFOA 4PRHE 2XKSA 3VGFA 1A21A 5J1AA 2H9GA 2MQ3A 4OFVA 1GAFL 4KK6D 2EIZA 5F1OB 1QSVA 5EU3A 2AQ2A 4Y89A 4KXZH 1U93A 3O6FD 1OTUD 4NOBA 1NEZG 2JTDA 3EJJX 4OCSL 4E41B 4OT1L 3A6BH 4S1QL 4LBEB 1IGYA 1HHJB 1S7WB 4P5TB 1C5BL 3B9KB 1T0MA 2ICWI 3D5OF 3IFLH 4R9HA 5E7FA 5DJ6B 5CSZB 5I1LB 5KAQG 4C59B 4HSQA 1RIVL 2RHEA 2IFFL 1ORSA 3QG6B 1ZEAH 3CCHB 3FQUB 2DDQH 2EYTB 3QDMB 5CBAA 3LN4B 3QUZB 1OAZL 1JK8A 3PWUA 4NKIH 1HH9B 4GAJL 4LNRB 2W9LA 5E8PB 4JR9H 5I1GH 5GRVL 4OFPA 3SBWA 5CWSB 3C2SA 4JY5H 4EI5A 5HDLA 5A3IC 32C2A 3B9KD 4KI1A 2RJMA 1K8IA 1NGYA 4FQHB 3C5SA 3O3BB 2E6QA 5EC2A 3BD5A 1WSST 2DD8H 4NZUL 2V5TA 5D7KE 3HC3H 1YY8B 4JQXC 3QDMD 5C0GB 1RVFL 3QUZD 2P1YA 1I1FA 1HOCB 1FFPA 4X98B 3U1SH 2D4FA 4OCNC 5T33L 2HT4C 5DQ9B 3DRTB 1YPZE 2PXYC 1KF9B 5K33A 3SE8H 1WWWX 1Z6JT 3JV4B 4PJ5E 3OAUH 3W11D 3O2WH 3BVNA 1WWAX 4CVZA 5C6TH 4BM7A 4R3SB 3QCUH 3QG7L 1MUJB 5HDBF 1WLHA 1QHOA 4L4JA 2VL5A 5IHZB 1R3LA 2EYRA 5AG9A 2X7LA 1N3NA 5IW1A 2HT2C 1JI2A 1KCLA 3PGDA 2JIXA 1QLFA 1T66C 3QNXB 3QQ4B 1IGFL 1DEEA 2I25N 4HH9A 3DXAB 4PGDA 1PZ5A 4Y19B 5D7JC 3LZFH 5BO1L 2ADIA 4XPAH 1XF5A 2Z8SA 1GGIL 1PLGH 3P4LA 2M1KA 3BOVA 2AABH 4KTDH 3SPVA 3U4BH 3NZ8B 4OGXL 1CL7L 1CE1L 2LTQB 2A1WH 4Q0XH 4CU6A 1NGWB 4QRSA 5CEYB 3OXSA 1IT9H 1TMCB 4F15C 2CIIB 4HLJA 4OCYH 3BPNC 4ERSL 5JO5A 1R0AH 3LEXA 4JCMA 2COQA 2BVPA 3HE6B 4PJ8C 4LLMB 3DXAD 1YEHH 4EN3A 4J1UA 1KCRL 1VKXA 3BKYH 3RDTD 4QHLB 2A6KB 1J86A 5D1ZC 4XMKH 1AKJA 1MQKL 4XP4H 2GYSA 3F58H 1N64H 2AEIT 5GS2D 5INDA 5JMRA 5JUEL 4QXGL 1C7SA 3X3FH 1NC4D 3VI4E 2X4SA 4LRNH 2A73A 3BEVB 3WN5C 4F7CB 2DOCA 3D3VA 5DURD 5IQ7H 4M7ZC 1Y18B 3TH3T 5JXEC 5IW6B 4N0UB 4GBXC 4X6CB 3RL1B 3JTSA 5HPMA 3L3HA 1DL7H 3HE6D 3STZB 3HPLA 3ARXA 4LFHD 3P2TA 5CILH 5IB5B 3TF7C 5SV4A 3C8HA 5DJYA 3VW3L 3RVWD 4YZFE 3SDDA 1F11A 3VJ6B 1DBML 1KV3A 4H0GA 3KPMA 3RWFA 2AV1A 4LMQE 2V5RA 1R5IB 3GMLA 4YBLB 4X99B 1SEQL 3BW9B 4RWHA 5C9JA 1A7NH 5EG6C 4JFXB 3HMWL 3PV7A 3M17B 3NGBC 1CGVA 4LQFL 3MNVA 2NW2A 4QCIB 5JXAL 1A6ZA 1HHKA 3DO7A 3OWEA 3QP3A 1K5NB 1ORQA 4FOMA 4U1KA 1XCTA 4P2RE 3RWGB 3KYKH 5HXMA 5FM5M 5FYKE 1YJDL 4M93B 3WEXB 2QV2A 1UVQB 4HXAL 2AP2A 1YECL 3ESVF 3IKCA 1GGBL 4ZO9A 5CD3B 3QJHA 5D2LA 3QA3A 1A3LL 1C5CH 3LRGA 4L1DA 3DBXA 3RNKA 3IJYA 4IEFB 3RPKA 1RZKL 1E4JA 2VLRD 5F71A 3WLBA 5CAYB 3MV7B 2ZJSL 2QSCH 4JFDA 5C09B 5FHAL 5SWQB 5DC4B 3U4EB 5J8OA 2Y6SC 5FA3A 1I1AB 5IMLA 2YPKA 8FABB 5H35A 5DJ0B 4TTGA 4L4VA 1XR9B 5I19H 2H1PH 3DRQB 1J5OL 1WAAA 5FKPB 1AJ7L 4Y4KD 4D8PA 2BVOA 2FNBA 1OM3L 3SKNA 2X4RB 2J1KA 4U3CA 5CIPH 4EDXB 3LEVH 5F7LB 2EH7H 4OCRL 4LLWA 1LEGB 1Q9OB 3Q6GH 5E8OB 5EU4B 4UT7L 1GSMA 5ID0A 3OKLA 1YEKH 3RPIA 4L9LC 2GCYB 4X5LA 1RZGB 4JY4B 4MJIE 3VA6A 4XH2B 3TJEH 3MV7D 4X80L 3P73A 5C09D 1RFDL 3MRJB 3K2MC 3IXTA 3VXQB 1G7IA 3PL6C 2AKRB 4I5BB 2GITA 4MAYB 1CBVH 2KBGA 1I1AD 1JNLH 5JA8B 1VACB 4XPGH 4ONOA 4BQ9A 1WTGT 4FA8A 4LLVA 2ZOLA 2IPUG 4FQIH 4EEEA 1UJ3A 1JUFA 1ND0B 1KN2L 4IOIA 2MSPA 3IFPB 4ZTOL 1HHGA 1YYMH 5DF0A 4KXZI 4PTTA 3TO2A 4NBXB 1ZT4B 3VH8A 4TTDC 4UIMA 1PVHA 5ILTH 4XPTH 4JAMA 4PJDE 3VGHA 1QO3B 2R39A 4GS7C 1CI5A 1MRDH 3MA7B 2VZSA 1AHWA 3PUCA 4BQBA 4R4ND 3BKML 5I75C 5EZLB 4EUPH 1A7RH 3I50L 4P23A 3F6LA 4MAYD 3RA7L 4PLKC 4CDGC 3L3KA 3JSSA 1A6WH 4AM0B 5E99H 2UY6A 3BHBA 3VE0A 1EO8H 4FP8H 4G6AD 2QQNH 1U8KA 3BH9A 2X89A 3DX7A 2ZG1A 1FBIL 5CJQH 5E2TH 4S0SD 4OZFG 2AK1L 2JCCF 4ALAH 4XP1L 1XAUA 2I27N 5FYKH 1FRGH 2DQIL 3RNQA 3LKRB 2GFBA 4POZD 4EQ3A 1MAMH 1QEWA 3FQTA 4P5MA 1CDUA 1MCOH 4ZNEE 1T4KB 2DM4A 4PG2A 3T2NL 1W2KT 1YEIL 1PEWA 4MD0B 1E6JL 4WHTB 3DX8A 2ZCKL 1JBJA 3I3BA 4JFFE 4E5XA 3NIFF 4K7PH 1Z2KA 3Q5YA 3GK8H 1LO4H 5DD5L 3REWA 4XGZA 3K7UA 4HH8A 4P9HH 1MCRA 3CK0L 4YDKH 1VSCA 3ELAT 1AFVL 1CF8L 1EO7A 4JDZA 4I48B 1AR1D 3QEQE 4RX4D 4XNXL 1DSFH 2DM7A 15C8H 1S5IH 3O6ML 2FATL 4QRQA 4DGVH 5KVFH 3EOBA 2XWTB 4MA7L 1KJVA 4GLRH 4JFEA 4OBRA 1W0WB 1HIMH 3BH8B 3N85L 4UAOB 4YPJA 3BEWA 2AAVA 4TSBL 4H8WH 4OLXL 2FEEI 3VDAA 4BSWA 4OZHB 3X12A 3LKPA 5LKNA 1JE6A 4PLJD 1VFBB 2Z91A 4HWBL 4MQXD 2FWOA 2HFEB 4G7YL 1WV7T 2EIZB 1BBJA 3RRQA 2V7NA 5HI3D 3I6LD 4RMTA 1U93B 4XXDB 3G6DL 1QBAA 4O2FB 2ZG3A 4XX1E 1NGPL 4MD5B 4MJ6A 2XWBB 4KVNH 2C4FU 3TN0C 2DYPA 5EOCJ 1KB5L 1UB6A 4Z7QE 4TYUA 2H2SC 3GSNA 2J6EA 2RFXA 3FKUS 1BIHA 3O9WC 4Y1AB 2F5BH 4KUCD 1G7LB 2GY7B 2B8OT 2HRPL 3EFFA 3DIFB 1LEKA 3CPLB 4U1SA 1T1XB 1K6QL 2Y06H 3Q0HA 3TO4C 5DRNB 4C83A 4LGPB 1T1ZB 3NTCL 1BJMA 5KS9F 1M05B 5FOBA 3VXSB 3FZUC 1QNZL 4X6FB 1UYWH 3WSQH 5JQ6H 3GM0A 4B7IA 2A2QT 4B7LA 1GZQA 1F5WA 4CNIB 3UTZA 4HFUL 2YK1H 2L7JA 1R3KA 4HIIB 4RMVA 1GH7A 3R0MA 3BGFB 3UTPE 3MUGA 4EI5B 3WNOA 4Y1AD 4YHIB 3B9DA 4XCNA 1K8IB 4RNRB 3JWNC 4GQPH 3DI3B 4NQCE 5EC2B 3SGEH 1I8IB 3VFVA 3KYOA 1JTTA 3CXHK 5EZOH 1BFTA 4LARL 3HC4L 2Q7NA 1ERNA 1FG2A 1QD0A 4G8EB 4X7TA 1IBGL 4ZS7L 5A43C 5FIEA 3OZ9L 3VXSD 4XWOC 3VH8G 5I1CL 4JG1H 1Q1JH 4WFHE 3ARZA 3QPQD 1D5XB 3VU2A 1NMAL 2Y7QB 4CVZB 2O26U 1Y0LA 3HG1A 5H2BA 2OTUB 3H3PL 1VPOL 3K46A 3BPLB 2OL3L 2OYPA 5JDSB 3MXVH 2X7LB 2NNAB 5HI4D 5IW1B 4Z7WF 2QBWA 3L5JA 1L0XA 1QLFB 5DJ8A 2CKBH 5EU7E 4L8BA 4D9QD 4QY8A 1KG0B 4KDTC 4LLAA 5C0EA 3VFWA 1I8KA 4R2GB 4M7LH 2CDGA 1XF5B 3FMGL 4ODUA 1Z9OA 4YBHA 4PY8J 4JM4L 2VKWA 5EBLB 4NO0B 1K4DA 2FCBA 3F62A 1B2WH 1MJ8H 3MRNA 4PS4L 3HCVA 4PLNC 3LIZH 2VLKB 4PLOB 4QRPB 3V4PL 2YWYA 2BX5A 2BRRL 3M1BA 4HKZA 4OZFB 5D7IA 1NCUA 3B43A 4Z95H 5HI5C 4MS8D 4R2GD 1ZXQA 1RPQA 5IMKB 3Q3GA 2A6JB 5GGUB 2WBKA 3WJLA 2LQRA 1E4WH 1AKJB 2XZAH 3QIBC 4PRIE 5I1KL 2X41A 3D87B 1B6UA 4GAYA 4OFYA 4PJAB 4YDJA 3U7AA 5INDB 2LVCA 4R96B 1KEGH 2C4XA 4NO0D 1KJMB 4OZIB 1XZ0A 2I5YH 5JIIA 2XFXB 1IZJA 2VLKD 4P2OA 4QRPD 3BQUB 1H3TA 3CFEB 4LLYA 4P9HC 3T3ME 1OAUH 3RL2A 5DUMH 4NQSA 1A6VH 5J57B 5EBMB 2IQ9H 4XPHH 1NJ9A 1AH1A 5K9QG 3BT2L 4ELMF 3TZVA 1F11B 1LK2A 1XGPB 1AGCA 3KPMB 4ODSL 2BSSA 1HXMB 2NZ9D 4KGLA 5E2WH 1NCWH 4JM2C 4X0KB 1S7TA 4LMQI 1CFTA 2G2RB 5J11C 3SDYH 5C9JB 4LSVL 3FB6A 2BSED 4H8WC 5KSBE 3MJ9L 4RGMC 5E2UL 3ULUD 1P84J 2NW2B 2MOVA 3QUKA 3T4AB 1HWHB 1HNFA 1P7KA 3HMXA 2F19H 3KDMA 3BQUD 3DMMC 5C0BA 1PKQE 1U8OB 2P8MB 4QOKD 4XPFH 5A2IH 5ISZE 1SYSA 5CBEB 4LCIH 4IRSC 3ZTJH 3SO3C 4KK9C 1OTTD 5FA4B 3RKDC 2HFGH 3NCYS 4P9MH 3QJHB 5DJZB 5I1IH 4YJZL 5TE6L 1DQJB 4P99A 1DCLA 1CLZL 2P8PB 3WIIL 3VFNA 1K2DA 5CP3A 1JGUL 4GAGL 1GOFA 2VQTA 4QXWA 5HGAA 1BMGA 4HW6A 5EOTB 5FA3B 1MHPH 5DJCB 5IMLB 1A6UH 4UOJA 4WEBL 5DYOA 1KGCD 1G9ML 1T20A 3H9ZA 4C58B 4XBGA 3EYQC 1S7UB 4D8PB 1QLEL 3L3DA 1CLOL 3FFCA 4HXBH 3NCMA 4FFVD 2HH0L 1TVBA 1RU9L 1I7RB 1WTLA 2R1XA 4IHOB 3SKNB 2JB5H 3HE7B 1JF6A 5IJKA 1RJZA 1KJ2H 3IDMA 4JPVL 3L3OB 3VXUE 1FL6A 3BIAX 2VN4A 3LMJL 3RPIB 2D03L 4GLRI 1JP5A 1YA5A 5L2KA 4YHPB 4DFIA 2P24A 4MDIB 1GAFH 2OMBA 4HMCA 2ICEA 1H8NA 1JMXA 1RUQH 3I6KA 5ERWB 2WWMD 4P3WA 1M71B 5HHMB 3RAJL 4OGAD 2ZOLB 4WNQA 3GKZA 1UJ3B 4S1QH 3U9PL 1JUFB 3G04A 4RGNC 4D9RE 3LPFA 5IEKA 4GRLC 3NFNB 3HE7D 3MYJA 3D2UB 5F97E 5FUCE 3TO2B 3VH8B 2MQCA 3B9AA 1P4IH 5I76A 3IRZA 1FNGB 1RIVH 2IFFH 1PAMA 4MNQB 3AAZA 4RWYL 3K74B 3EDJA 4GW5A 2PKDA 4HWEL 5FDWA 3L1OL 2GKIA 5JIPA 3DOSA 4NNPL 3ZKXC 1OAZH 4P23B 4EIZC 1U8LB 1B0WA 4H26A 5B8CA 4ISVB 1T7YA 4ZUTB 5HHMD 4RAUB 3BHBB 3VRIB 3DVFA 3GGWB 4KJWC 4H1LH 1G0DA 1C12A 2JJUA 1U8KB 3DX7B 2IH3B 3QWOA 2FHBA 3V79C 3D2UD 3PNWB 4E41E 2R4RL 3ULUL 3D48R 4KI5D 2DQEL 2BCKB 4Z0XA 1GHFH 4MNQD 4NZUH 2QLVB 2GFBB 2VOTA 4KHXL 1G7PB 4KRLB 3FQTB 3OR7A 4YC2B 3T2QA 1F3JA 1CQYA 5BJTB 2D2OA 4YDLB 2QSQA 5T33H 1QP1A 3Q1SL 3SGEI 1YQ2A 3FOLA 4WDIB 2DQGL 5DJXA 3VRJA 5I6XB 1IGIL 3QDME 1G6RA 4OCXL 2OZ4L 4HUMB 1B4JL 2XZQL 1FN4B 5E00A 4XGZB 3KYAA 4L1HA 1FYTB 5B38A 4WHDA 4PREB 4NQVA 1I75A 1N8ZA 2NX5B 4I4WB 2AI0L 2N4IA 2WM0A 3ULVD 1IGFH 4QRQB 2MWCA 3GM8A 3A0OA 5BO1H 4N0FA 4QHNA 5CEXB 3VI4F 1S7SA 2DQJL 4JVWA 1GGIH 1OB1A 3QUMB 1VA9A 3QCTH 3SHSA 3P0VH 2CDEA 3VXNB 4GQ9L 1MLBB 2D3VA 3OKOB 2HVKB 4OGXH 4ONHA 3CJJA 1CL7H 2IWGA 4U2ZA 1CE1H 1ACYL 1FYTD 1TQCB 2VXUL 3GMMB 2VJXA 2R1WA 5T3XL 1A1MA 2X4OB 3GMNA 3HNTL 3D0LA 2CXKA 1CGYA 4JRXA 2HG5B 4YZFF 4ZOEA 4ERSH 5BCAA 3UPRB 5C0NC 2NX5D 2Y9RT 5B4MD 1JPST 5C0IB 2HJLB 1MI5B 3KPSA 2XTJB 3QCVL 3ARWA 5J6GA 1Q94B 1KCRH 5KW9H 3HS0B 4GW1B 1GVIA 2DYPB 3BISA 4JZNB 4QGYA 5AZEL 1MQKH 3GSNB 3LN9A 1YUHB 5JW5A 3U30B 3U0PA 5JUEH 4QXGH 4Y19E 3EFFB 4EOWL 4U1IB 4U1SB 5EU6A 3MR9B 1R3JA 3E3QE 1T5WB 1DBAH 5C3TA 5I16A 3HR5A 3C09C 1CDGA 4PY7B 5AD0B 5E2VL 4OZGB 3D25B 5D1QA 1MI5D 1NDGA 2O61B 3LY6A 3CSYA 3H9HA 5DVMA 4YBQD 3VW3H 3UTZB 2XI9A 4LCYA 1R3KB 1DBMH 3CSBA 3T4YA 3EZJB 3N9GL 3NZHL 3LV3B 4PJHA 2X4NB 1FSKB 3IAPA 4DN3L 1V3MA 1AE6L 3MBXL 2XXMB 5K9JL 2F8OA 1SEQH 3LSOA 2DBJA 3NCCB 3BZ4B 3KLAB 3KYOB 1I1YA 5GRZA 4EZMA 4PTUB 5F7HA 4LQFH 2X1QA 5JXAH 4X7TB 3IF1A 3MMEB 4JLRA 2A9ML 2F54A 2ENSA 1XR8A 3FO9A 4G42A 1EVUA 1UFUA 4G5ZL 1YJDH 3VDCA 4HXAH 1W0VB 1YECH 3VMOA 4TQEL 1KULA 3OF6D 1GGBH 3FCTB 2KL6A 5IMMB 4UI2A 3QDJA 1LO5B 1JPSL 1QQDB 4BZ2L 3PWPA 2E7MA 2EDWA 2Q3ZA 4HIEA 2WAHA 2C3WA 1RZKH 3MRHA 5D5MB 4L8BB 4Y5VC 1FGVL 4U7KA 3X13A 4QY8B 5FHAH 2NPLX 4LRIA 3GIZL 3LRSB 3QH3A 2N1KA 5MEPB 2BNRB 2GTWB 1FZMB 1J5OH 4MQ7A 4IRZL 1AJ7H 4PJDF 4WFFD 1CIDA 2BMKA 1OM3H 3KHQA 5E2JA 2WV3A 1W8NA 4HUUB 4OCRH 4UT7H 4CN6A 3OKNA 1PGRB 4CMMA 5EORL 4IIQC 3F65A 2R0WL 3PV6B 2NY3B 4GUPB 5D7IB 4WO4A 3QXWA 5LQBL 3D69A 2YA2A 4NGHL 4OGYL 3QUML 2AJSL 5GRVK 5GS2H 1QG3A 3EO0A 5DFWH 1AGFA 2BNRD 3DX9B 3FQXA 4ZFFB 4MXQC 3KXFB 1KN2H 2E8YA 1FZKA 1NFDA 4ZTOH 4NM8H 1Y6KR 1XGQA 1YMMA 3KLHC 2W0FB 1U6AH 3KPNB 4P2OB 1HQRB 4QHUA 4I18C 1NEUA 5D7SH 3BKMH 2YR3A 3HZVA 3PP3H 2NY3D 2QQQA 3I50H 3RA7H 1BBDL 1JZ3A 2EZ0D 1FAKT 4M5ZH 1NJ9B 2EDQA 5DJAA 2P44B 3IDGA 2Q7YA 4YFLI 5GRJL 2BSSB 3KXFD 4CU8A 1S7TB 3ARSA 1I3UA 4J4PD 4YNYA 1CFTB 1IZKA 4M7JL 1FBIH 1H15B 2Z4QB 3OAZH 2FHCA 1UXWA 1XF2B 4XP1H 3MCKA 5F3BA 2DQIH 4Q9CA 4Y2DB 1P7KB 2WIIA 4HIHA 3WNNA 1U8PA 3RVTD 3UTTA 4KK6C 4HUVA 1UC6A 4EQ2A 1YEIH 1A1OB 3O6FC 1OTUC 1ULVA 3TVMA 1D9KA 2WMPA 3KWWB 3H0TB 3IS1X 1IKNA 1X5LA 4G6KH 5DD5H 1S9YA 5F9JA 2R8SL 2G75B 1A7BA 5FGCB 5IF0B 1VDGA 3CK0H 4JFYB 4Y5YA 1QZ1A 2FX8H 1IL1A 1AFVH 2XTLA 4MJ5A 4LSSL 1CF8H 2G9HA 3V8OA 5JORB 1MFDL 1BQHA 1UKSA 4F57L 1MCNA 2W1NA 4Y2DD 4Z7QF 2VWEC 1ZGLA 3S4SA 4HEPG 4HAFA 1EJOL 3K81A 5IK3B 1KPRA 2DF3A 2FATH 3O6MH 4X9IA 4PJCA 1YQVL 4S10A 4WRLA 1T20B 4PY8I 4MA7H 3T65B 4XTRD 3FFCB 1N5YL 2DJUA 3N85H 2VAJA 4TSBH 4JN2A 3ARPA 4Q9RL 2UY7A 3IDMB 2JJSC 4ZUSA 1I1CA 5CEZD 5I1AA 2DS4A 2YEZB 1BP3B 5GHWL 3QUXB 3B9KC 5FECB 4GRWE 4XBPB 4O9HL 5C0JB 4G7YH 1SY6L 2DN7A 3H42L 1T83C 1KELL 3WS6C 1ZMYA 3EW3B 2FJFA 1IEAB 1DVFA 3CU7A 1CL7I 3G6DH 4F9PC 2GSIA 1P84K 3QUZC 1NGPH 1RK0B 4PJXA 5DD6A 1CFVH 3SGKC 4WNQB 2UZIL 5T1KA 2X4QA 5DA4A 5ID1B 4X7SL 3MNZB 4WJ5A 4NCC1 4OLWL 4XVSL 3MYJB 3W11C 2R23B 1YJDC 2DQCL 2HRPH 3H9SB 4YGVA 2VDRL 5D72L 4MA8L 5CP7A 2XRAL 3QUXD 4Q2ZB 5IGXL 4PV8A 2E9WA 2BNUB 4Z7VE 4GW5B 4JFQB 2EIDA 3OKMB 1OP5H 3RGHA 1BFVH 5LBSH 4FZ8L 5SWZB 3NTCH 2YKLL 5IUSA 1R24B 1QRNA 4H26B 4UDUB 5HYSA 1JZ4A 1RZKC 1EVTC 5C08E 1QNZH 3WCYA 1J0ZA 1FH5L 3CC5A 2ERJB 2E7CA 4YK4B 3QDAA 1UA6L 1T22A 3WE6A 2AJZB 5CZXD 4X83A 4NRZA 3AROA 3QWOB 1P1ZA 4JANB 4DKAA 1TETL 3MRMA 1J1PH 4R7DB 3H9SD 1IGTB 4NFDA 3TBWA 2FH8A 4Z0XB 4F7TA 4I9WD 4Y1AE 4LARH 4FQXA 3HC4H 1G6VK 2GUOB 4F7MA 1XT5A 4ZQKA 1I7ZA 5SWZD 5E8DL 4ZS7H 3GJFA 4LLDA 3OZ9H 4P3CL 2QHRL 2C3GA 5SWSB 3QEHA 1BOGA 4NHCL 1TCMA 3FOLB 5IHLB 5DJXB 1DLHA 2ZKHL 4AQOA 1G6RB 5C0RL 1KTRL 1NMAH 3RDTC 3L9RB 4GG8B 1G7HB 3H3PH 1HEZB 1P7HL 1VPOH 3VXSE 3VG0L 3MROB 4I0PB 2BJMH 3C6LA 4O58L 5D1XC 3TC9A 2ARJQ 2VIRA 4UNUA 5AYUL 3MLTA 1H5BC 5CSBA 6FABH 4KMTL 4NQVB 1N8ZB 4Q7DA 2LTQC 2IBGA 3NMEA 2EE6A 4HBCL 2W0PA 2VDMH 5CLWA 3B8SA 1EA9C 1O5DT 5FO7A 3DSNA 4FQQA 3O4OB 4Z8FH 2Z35A 4RRPA 5MI0B 4Q9QL 2OI9B 4N0FB 5GRYA 1LNUB 3FMGH 4HBQA 5SWSD 2HVJB 3DYMA 4R4BB 4TSCH 3R06A 4L29B 2ICWA 5CEZL 4J3WA 3T3MF 2W9DH 4I0PD 1A6PA 4NNYA 4L3EA 5DRZA 2F53D 1RUAL 1NCCL 4X8XA 35C8H 2APWA 3GMNB 4PGBA 2FDBP 1DQLL 1S9XB 4QF1A 3PP3K 3V4PH 2BRRH 1VADB 2R69L 2A0LD 1NAKH 4WU5B 4OTXL 2CPCA 4GXUN 1ZSDA 2YRLA 5IQ9B 3EYFB 1SJHA 1YEFH 3UDWA 1MCPL 3WFBL 4GXVH 5MP6L 2ICCA 5I1KH 1ONQA 3MRPA 2FEDD 3GMRA 3OAZK 3S4SG 3VXTA 3QIUA 4ZFZA 1OT1A 4Y2OA 4Y4HD 5J9PB 2HP4A 3EOYG 1TVHB 5GQBA 2QSTA 2EO9A 5EU6B 4B0MM 4O5LL 4K3JL 4YBLC 5DGQA 4OZ4A 3V6OC 3HR5B 4DAGL 5FHBL 5ACMA 3MODL 4QRRA 1CT8B 2EXWD 4P5KA 5A40E 1N7ML 1QFWM 4NQDA 3V6ZB 4U6XB 5GSVB 3FN0H 4QO1A 2VLKE 3BT2H 5F7DA 3RI5K 4JKKA 4HFWB 4OLVL 4ODSH 5CJ5A 1TLKA 5D71H 2VLME 4MB3A 1I9JL 1PZUB 4Y4KC 2EE3A 3C60D 5TDNA 3ZE2E 5BVJB 1N0XH 4LSVH 1CD1A 2JF1A 3V7AG 5I8EA 3MJ9H 1I1YB 1FO0B 1T21B 5E2UH 4P57A 4PJAE 3QQ9D 3MC0A 4OZIE 4JLRB 3DVGB 2AJVL 4QT5B 1D6VH 3D3VE 4Q58C 2VRAA 3NN8A 4QWWD 5ESAB 3G5XA 4LP5A 1EMTH 5TE6H 2Z31B 3LDBC 1A47A 3BZFA 1CLZH 3WIIH 2PCPB 3U36B 3R0NA 3V95A 1JGUH 4GAGH 3FO1B 5DJDA 5AAMA 3RTQC 1KXQE 1NDMA 4JQXA 4R4NC 1QA9A 4GMTL 4WEBH 4MAYC 2VDOH 1G9MH 1H3UA 3BP6B 4OF3A 3CFKA 5ENWA 1TJHL 1QLEH 1CLOH 4APQB 2PXYA 1RU9H 5E03A 2I9TA 5JZ7D 1JPGB 3K4AA 4N9GA 3CDGA 4G6AC 3SKOA 4W6XB 2Z31D 4J3XA 5JNYA 2P47B 3L3GA 1OP5K 4QRTA 2D03H 3X14A 4D2NA 1DUZB 1INQB 4JPWL 1JYNA 2W60A 3IJSA 1WT5C 4KMQA 4S0TD 2HKHL 4LGSB 2NXYB 2YS4A 4POZC 3OAYK 4LKCA 2FECL 1KPUA 4LHJB 3TCLA 3DVIA 3FQXB 4JFDE 1U8MB 5MENA 3U9PH 2VQ1B 4APQD 5FEBA 5L0QC 3ME0A 1T3FA 4K8RD 1SM3L 3MCLH 4JJ5A 1EAPB 3H7LA 4H5SA 3C08H 1WAAE 2FX7H 2DLIA 3TJHD 4RWYH 5T1MB 3PIQA 5L7XL 1JZ5A 4HWEH 3L1OH 3BSZH 3BO8A 4OZFH 3NCBB 4ZOBA 5C0AB 4NNPH 5FM5O 5FFLA 4PRPA 3STLA 1AR1C 2NXYD 1CGSL 3FT2A 4LVNB 4PJ8A 2Q8BL 2R4SH 5DJAB 1I8MA 3O4LA 1BREA 4MZ2A 4W68A 2HLFC 3QZWB 3B6SB 4PJ9D 5D1ZA 1I7TA 1IEBB 4HPOL 1FFNB 2H32B 3U6RA 5GGSA 3BD3A 3MRLA 1UXWB 3QDHA 2SEBA 2EH8L 3ULUH 1BFSA 1OCWH 1ZVHA 5CGYC 3QULA 4F7EA 2CUMA 1UWGL 2O5ZL 2XZZA 3INUL 3W0WA 4LF3A 4HIHB 4KHXH 2IG2H 4M48L 4MQXC 5JXEA 5CZKA 3FT4A 2B7DT 5TF0A 4P59L 5ESQA 4GBXA 1U8PB 5C0AD 4AL8L 4XNMA 4U6VL 4XCFL 3RVUD 3IKKA 4MA3B 4MNQE 5DEZA 5HI3C 3Q1SH 2YXFA 4KKCD 1QSEA 1JN6B 3ROOB 4M4RA 3S9DB 2DQGH 3TVMB 1D9KB 1ITBB 1IGIH 1PYWB 4OCXH 3MV8B 5KSVB 2OSLB 2OZ4H 5DK0A 2XZQH 3F12B 1S9YB 1AO7B 4IM8A 5F9JB 4GOSA 4UAOC 5FO8B 5HGHA 5KJRH 1A4JA 1E6OL 1FO0L 1J1XL 5I8CA 3EYSL 3HPJA 2K3TA 1KCUL 2X4TA 1CFQA 1AXSA 2X40A 2AI0H 4N9OB 1DTUA 4Y4FD 2ORBH 1U95B 2V7HB 3FL7A 1XIWC 3EGSA 1EK3A 4JB9L 3HB3D 4JO1H 2R56H 1S9KC 3SDXA 2DQJH 2QTEA 4UNVA 3ULVE 3TVMD 4UMGA 3MREA 4GQ9H 3MV8D 3IYLW 1GRWA 1AO7D 1ZT1B 2NY0B 3VD7A 3T0EB 3B4NA 4ZFOB 1ACYH 2VXUH 3MLYL 3O8XA 4DKFL 3IDYB 3HNTH 1UT9A 2XNAB 3M8OL 4OD3L 4X4YA 2UUDK 3MRRB 4O00A 1FV1A 3SCMD 3QCVH 4S1DD 1FYTE 4JE4B 4JDTL 4FFZL 2HTKD 4PJBA 1ZHLA 4PJXB 4WY7H 5DVKA 3O11A 4YFDB 3DJ9A 1KIPA 2NX5E 4P4RA 5AZEH 2X4QB 1RHHB 3BZDA 2OJEA 3TIDA 3K3QA 4I8DA 1J18A 3QPQC 5TFSL 3VFTB 2CLZA 1QVOA 1I9RL 1KNOA 1BZ9A 3CFJA 5GGTL 4CU7A 3OMZA 4LOUD 4YWGL 3T0ED 3QJFB 4XNQA 5BZWB 3FB7B 2OLDA 5HI4C 4L9LA 2WQRA 2XIDA 4MNHA 4MDJA 2NY2B 5E2VH 1HH6A 1QUNA 3JWOL 2BVQB 2Y07L 3PL6A 3ZT5A 3RGVB 4F2MA 1H3WM 3CXDL 2IGFL 4YEFA 2Q86B 3HZKB 4BK5A 3WE6B 3U9UA 4NQXA 3N9GH 3NZHH 1ZLVH 3T77A 4YUEL 4NRZB 2R2BB 2XTJE 4DN3H 3BUTA 1G9MC 4K3DL 5D2NB 3RUGA 1AE6H 3MRMB 3S35X 5K9JH 5FAAA 2XN9D 3MV11 5D7LA 4JG0L 1MCWM 1B6DA 2VE6A 4OQTL 3GRWL 1I4FA 5EO0A 5JHDA 3HZYA 2VZUA 4QRUA 4FQXB 4YHZL 4F7MB 1G84A 3RBGA 4L4TA 2NY2D 1GZPB 1RSFA 2CIKA 1EXUA 4I2XA 3HUJA 2NMSA 3OGCA 2DKMA 3DURA 3QEHB 5JPNB 3SE4C 4R2GC 1CXIA 3RGVD 2YPLB 1SBSL 2P8LA 1ZHKB 3MSPA 3C8DA 1YDPA 1LE5A 3FB5B 3VFUA 3C6LB 3C5JB 1JPSH 4BZ2H 4PRHA 1YC8A 3MLTB 2PN5A 4WFED 3RFZC 4OF6A 1IAOA 5CJBA 4A2LA 3ULVH 2ZCLH 3GSUA 1FGVH 1J8KA 3CH1A 3P4OA 3FFDA 4RAVA 5E6IC 3GIZH 3VMNA 5KAQF 3CIQA 2D4DA 3TA3B 1ZHBA 1A7PL 5DUBA 4HS6A 1R5WA 3QNYA 1BQLL 4KKNA 2VNCA 4IRZH 2YPLD 4U1MB 5HHPB 2ICWB 3EIFA 1H3PH 5DS8B 2NZ9C 4MXWL 5IB3B 3WJJC 5C1MB 4YO0A 4D3CH 4WFFE 4JO4L 3QISA 4WI4A 3HG1E 2V17L 4QF1B 5EORH 4ZMAT 1L0YA 1X5KA 2R0WH 3PHOB 3ULUC 1ZSDB 5LQBH 1S7QA 2X4PB 3QEUB 3V5DB 4NGHH 5EO1A 4OQ1A 3TA3D 3V52L 5HYIA 3QUMH 5D5ME 3BP7A 1T7WA 2Q1EA 5FO9B 4XMPL 1AP2A 3IETB 1FFQA 1OTTC 1ONQB 1HXYA 2CSPA 3GIVB 3MRPB 5I8KL 3GMRB 4Y16B 4ZFZB 4X6BA 1OSPL 3V9FA 1WFTA 3HC0B 4ZFOL 2J2ZA 3UBXG 4LSPL 4TNVF 2VXVL 4WW1A 4OGZA 1HDMA 4OZ4B 5CFHA 3ZLQC 1RZJL 5DTFA 2H3NB 3QXVA 2EC8A 1KIRA 5TDOA 3KPLB 4LSDA 1BBDH 3DI2B 1YPZA 1BIIB 3VGGA 2H26B 4D0CA 3D39A 2DTML 1WZ1H 1KB9J 2HFTA 1OP9A 2R0ZL 1MHCA 4P0DA 3WL9B 2JJVA 3H7BA 3FOMA 2WUCL 4EVNB 3TN0A 5GRJH 1U3ZA 5D7IE 4NRYA 3U7YL 1ZS8A 5I15H 4Y16D 3O9WA 4FFVC 2J8UB 4M7JH 4J3VA 4JCLA 3IXAA 3SGJA 1CD1B 2EDYA 4LHUA 1WWBX 1OGTA 1AXTL 4P3DA 3TO4A 4NN7B 3E0GA 1UB5B 5C8JB 1MHEB 4XWGL 2RIKA 3NN8B 3QQ3A 5AZ2L 5ACZA 5HPOA 2WWMC 1UWXH 4MD4B 2X1XR 4GRWF 2VZOA 1H3VA 3PWNB 5IOPA 1NGXB 5J1SC 1IKFL 3DUHA 2QL1A 3V0WL 3IGAA 2AEQL 1RIUL 3BWAA 3PDGA 1RJYA 2AV7A 4R8WH 2R8SH 3U46B 1YEJL 4HLZH 2ITDB 3QPXL 3L7EA 5DEGA 1BX2A 1HZHH 1KACB 1MFDH 1F6AB 4FNLL 4F57H 3S36H 5DJDB 1Q9KA 5F7NC 5CIPA 1YY9D 2UWEB 5A16A 4A6YL 2RCSL 4WHCA 2IMNA 1T5XA 1L6XA 1KLGB 2M2DA 4AMKL 4QTIL 1A9EA 2EDBA 3CFKB 2OJZH 3W9EA 1W72L 2PXYB 4LSRL 4Z7VF 5C0BE 3KPQB 3V5HB 4FN0A 4U1HA 1MVUB 1MWAB 4N0CC 2ED7A 3O41A 2X1PA 4FQLL 4Q9RH 3RWJA 1F8TL 4LCCC 4B53A 3LKOB 4MHHG 2H45A 1OPGL 1GC1L 4O9HH 3X14B 4DK6A 2ADJB 1SY6H 4KI5C 3H42H 1KELH 5IVZB 4MX7A 4M9PA 3PABA 3X11A 3WXVL 1YMHA 3MRGA 5FGCE 3S3PA 4KDTA 3D18A 5E95B 4GG6A 2BERA 5ETUB 5D7JB 1YEDA 2YD1A 2KZ1B 3ZHDA 3EZ8A 3HRZB 1Z3GL 2UZIH 5TF1L 1ZLVK 2HN7A 2VC2L 1MOEA 1L6ZA 2FRGP 2ZZUT 4HK0A 3VXRA 4EUPA 5BVPL 4X7SH 2GJ6A 3VD4A 1KTDA 4OLWH 4UIKH 4XVSH 2CRZA 5L6YL 2DQCH 2MKWA 2XKNA 2DWDA 2VDRH 3NABL 1V3LA 3MGTB 1U92B 2DMBA 5D72H 4MA8H 4M6AA 1OWRM 2XRAH 3E6FA 3FFCE 5IGXH 3L3JB 4N0RA 5ITFB 1RZ8A 1DUYB 1S8DA 3BO8B 4F15B 4FZ8H 1KTLA 2YKLH 1NCDL 4L8SC 3QNZB 4P2RA 4PRPB 1C1EH 4PJ8B 3QWRD 5F1IB 2IQAB 3G5VA 1FH5H 4YC2C 1HI6A 2PW2B 4FABL 4QGTA 5D7JD 4QTHB 3PHQB 2CLRA 1S5HB 2APBA 2OXGA 1UA6H 4XNYL 3OB8A 3QIBA 2DI9A 3WNLA 5I66B 5BRZA 1TETH 1X4XA 4M61A 3FRUB 1KENH 2ARWA 2QKIA 4UV4H 4K7FA 3WN5B 3QULB 5BZDA 3FB8A 3W0WB 4M7ZB 5FXCH 3FT4B 2P4AB 3ECBA 4MAUL 4XNMB 5E8DH 5B4MC 1IM9A 1F2QA 5J3HD 1C8PA 4UTAL 2D7MA 4I9WE 4D0BB 4TUOB 4NHCH 1X7QA 4NQTA 4HJGA 1IARB 4YDIL 2ZKHH 3MJ7A 5SWZE 5C0RH 3OR6B 5DK0B 3CFIC 4LEOB 1NGQL 3VRLE 3VG0H 1T1WA 4JM2A 1C5DB 1PG7W 2P5WB 5CGTA 1DANU 5AYUH 5GGRY 5I8CB 5AWNH 1LGVA 4KMTH 5H8DA 3CUPB 4ZSOA 5J0BA 1TQCC 1OT2A 4HBCH 3BXNA 3UZQA 5LCVL 1QR1A 2EDXA 3D1MC 2LU4A 4Q9QH 3DMMA 3MRFA 3UBXB 4ZPTB 3O3DB 3PDOA 4LHUG 2HJFB 1DJSA 2VDLL 2C7UA 4IRSA 1MFBL 3IRPX 4YBQC 5ALCL 4XXCC 5CEZH 4BUHA 3WNMA 4OLYH 4PJEA 1HILB 3E2HB 3U30C 2P5WD 4KWUA 4PP2A 3RWDA 2K9UA 1RUAH 4NDMB 1NCCH 4G6ML 2NXZD 3IU3B 5FF6A 2PF6A 4LPYA 4CJ0A 3PWJB 3QO1B 2DMCA 2R69H 1ZLSL 1XGTB 3RY6A 2WANA 3RU8L 3ZE2F 4PP1C 3QI9A 4KKBD 1KIPB 1A7OL 1MCPH 1TIUA 3WFBH 1CG9B 1MFCL 5MP6H 5ICYB 2OJEB 3C2AL 1KFAL 3TIDB 1BHGA 1MWAL 1SMAA 1D6EB 1P2CB 5JW3H 3MFFA 1QVOB 1KNOB 1BZ9B 3P4MB 1EUUA 4HX1A 1RD6A 4XCYA 1G7QB 4O5LH 4K3JH 1NAMB 4MJ2A 2H2PD 4DGIL 1BWWA 3CFBB 4MNHB 4BH8A 3MODH 2WSKA 1HH6B 4N8VA 4U05A 3FT3B 1N7MH 5GRUH 5ICZB 5K9QI 1IRAY 3FO2B 2Y23A 3DVNA 4R97C 4OLVH 3WKML 3HFML 1SQ2N 3LKQA 3KPSE 1MCLA 1RUPL 1I9JH 4ZUWA 3GSOA 4LLUA 4KRMB 4GRLA 1IQDA 1TZHB 5D7LB 1V7NL 4JPIA 3ULSA 3VFSB 1FL3A 2VE6B 4PV9B 1I4FB 4H25A 3UPCA 1ADQL 4EUPG 4TVPE 2X4UA 5IR1A 3G08A 4RQQB 3NACH 2AJVH 4PJIA 5EU6E 5F1NA 1E27A 1FNFA 1PX3A 5F8QC 1FFOA 2YPVL 2CKBA 5KTEL 4XVUC 5FM4A 2P8LB 2VXQL 3NCYP 3P9WB 2CMRL 4KJYA 3JTTA 3KYNA 3JBG7 4AEHH 3K1KC 1OP3H 3H9YA 4TTDD 3H2WA 5IESL 3QXDA 2DMKA 2L0DA 3EBAA 1BZ7A 4XI5D 3WFDL 4ETYA 5IG7A 3VFRA 1ZHBB 4GMTH 5FV1L 2EDRA 2NY3C 4PLKD 5DUBB 1R5WB 2EZ0C 1CFNA 1TDQA 1WAAF 4LPXA 5FGBA 2HFFB 1TJHH 2HJKA 3RWCA 4IMKC 5TDPA 2F54E 1OY3B 2XY1A 1CGTA 4YXHL 3PQYB 1N6VA 4J4PC 3ARFB 3L3IA 5DQJA 1CDIA 4LPTA 3T2PA 2OX5A 3NCEB 1NFIA 4JPWH 3O45A 3TH4T 2NQCA 4KMLB 3UMTA 2HKHH 4U1NA 4Q74A 3SOBL 1JHLL 4PD4J 5I71B 4XNUL 3PDDA 4KQ3L 4HWNA 1A2YB 3FONA 1RZIB 3SKUD 2XXCB 1VFOA 2GAZA 2C3VB 2ZSVA 4NQEB 1T03H 3TNMA 1U8QA 5DRXA 2YZ8A 3PQYD 1U8IA 2ZPKL 3ARFD 1CXHA 1LO2H 3VXOB 1EAJA 5L7XH 3EO1B 1QBML 1B9ZA 4EBQL 3WUWA 3VMPA 4U1LB 1WZKA 1C16B 3ARBB 2Y72A 1FLRL 4Y2DC 4HS3A 1CGSH 5CZVL 2Q8BH 4D0CB 3D39B 1BAFL 5F96H 1BD2A 3BP4A 4Z7OE 4ZUVB 1MHCB 5C07B 3H7BB 3BRFA 5JHLL 3I75B 4NRYB 4HPOH 4XTRC 3D0VA 3O9WB 4NQED 3IXAB 2C3XA 1PBYA 4DZBB 2HLAB 2B1HL 2NLJB 4YHYC 2EH8H 4GFTB 4PB0L 2I07B 1Q72L 5EO9B 1NFDE 43CAA 1UWGH 3INUH 3DARA 4M48H 2FSEB 3AS1A 1R5VB 3QDGB 3EDEA 4P59H 4AL8H 1WFNA 3ARBD 3KPOA 3ARQA 4LSTL 1P5UA 4U6VH 5CD5D 1K3ZA 1YMME 2CLVB 4XCFH 3X3GL 3QQ3B 2FH6A 2F5AL 2ZNWA 3UZEA 3EYOA 3VFPA 5C07D 4C56A 5IIEB 3RZCB 1HK6A 3IGAB 4N8VG 4UOW1 1RJYB 3UX9B 3O3EA 1FHGA 3QIWB 1FO0H 1J1XH 3EYSH 2D7PA 1KCUH 5CCKL 1AIFA 4Q6IC 2YRPA 4MXVF 3G5YB 3IDNA 1Q9KB 5ANMA 2AXGB 2PO6B 1KJ2A 3QDGD 2AXJA 3TT3L 1T5XB 4DZ8A 3VA2C 3T0BA 1YEEL 5D6DC 3MRIA 5L2JA 3SY0B 1A9EB 1IVLA 2Y5EA 4NC1E 4POUB 4S1RL 5ITBL 2JB6A 4PJGB 1S7VA 1JWUA 3IJHA 3GHEH 5TQ0L 4U1HB 5DO2D 3RZCD 3AU1A 3OHXB 4NFCA 1CD9B 1KB9K 3V8CA 4EI6A 3QIWD 5D8JL 1J87A 1SHMA 4F9LC 3DUUB 2ZUYA 1BQSA 3M8OH 4OD3H 5EIIB 5MEOB 2PO6D 4Y5VA 1JWSB 3X11B 3MRGB 4N90D 4JDTH 4FFZH 4GG6B 4M03A 1HINL 5ECJE 5GS0D 5EC1B 5D9SA 5LGJB 4M5YH 3V7MA 2NY7H 4HK0B 3VXRB 4K8RH 2GJ6B 1KTDB 4JO2L 4MWFA 4L5FH 4PJCE 5TFSH 2MHAA 5EUOA 2XKNB 5GGTH 5HGBB 2BC4B 5KSBA 1DBBL 5HHOD 5F72S 1BVKA 4H1LA 1RZ8B 3CU1A 3TBSB 1FNHA 2L4OA 3E6HB 1DN0A 3DECA 2ADFL 2C1OB 1KTLB 1AGDB 3LS5L 3TBVA 4IIQA 3JWOH 3T0EE 2Y07H 4QHMA 1HI6B 1TCRB 1IAMA 3DV4A 4NKDA 1ACZA 4CVXA 2LU3A 4Y8DC 1BOYA 3CXDH 5HVFB 3BYTA 1FL5A 1UZ8A 4XRCA 2QADD 5FYLD 3QIBB 4WI9A 3LPGA 4YHNB 2CH8A 4K3DH 3V7AE 1NFKA 5F9OH 4PJXE 4J8RB 5BV7B 4JEGB 4LSUL 2BP3A 3MJGX 4I0PC 4JG0H 3AM8C 3GRWH 3VXMA 1KCKA 5BZDB 3FB8B 4YHZH 1HSAA 3ILPA 3ECBB 3FN9A 4I18A 5E8NB 4YHKL 2A0LC 5HI5D 3O4OC 3UC0L 2OI9C 2NTFB 4NUJA 3MJ7B 1SBSH 4K9EL 3S5LG 2H32H 4ZPVA 1QRNE 2G5RA 1ZA3A 1SYVA 2W9EL 1N2RB 3DUSB 3VXUA 4JFPB 4JM2B 5J11B 1AQKL 2FEDC 3GMQB 5M94B 1CU4L 4ZSOB 4Y4HC 2NY4B 3DGGB 1T1YA 4ONGL 5D2NE 3CVHB 3U0WL 4KTEL 4U6YA 4JZOA 4WFEE 3ARDB 4G6FB 5ESVA 4XNZC 5F8RC 2BHUA 2EXWC 1A02N 1P6FA 5FM8A 4KH2A 4P46C 4BFEA 1A7PH 4IRSB 2BVEA 1WUNT 1BQLH 5I2IB 3O6FA 2DL2A 4I77L 4NNXA 2MKLC 1K8DA 3WHE1 1CDBA 1U58B 3QSKB 3QHTC 3QFDB 4MXWH 3OXRB 1UH2A 4UQ3A 1E4KC 1D5BA 4G9FD 4YR6B 1NC2D 3UTQA 1AY1L 3C60C 1BLNB 4XBEL 2CUHA 4JO4H 2V17H 1XCQB 4G43A 1NUDA 2NY4D 1EHXA 5D7IF 3QQ9C 5GS0L 2NYYC 3ARDD 4G6FD 1DQDL 1FZJB 4FHBD 1DR9A 4RSVA 5B21A 5CMAB 3MLRL 4WV1C 1II4E 2E6PA 4QWWC 5I8KH 5EN2B 2MTPA 2BZDA 4RMWA 4HX1B 3P0YL 1NBVL 2FECI 5GZND 4LBEA 4LSPH 1HHJA 2VXVH 1EFXB 2DQFB 2EXYC 3B9KA 1WF5A 1RZJH 5IJVB 4ZD3L 5DJ6A 5CSZA 3F5WB 4GJTB 5I1LA 4N8VB 4NHUB 4OD1L 3MZGB 5J6HB 1T83A 2YUVA 3WS6A 1KLUA 5DVLA 3QG6A 3EDDA 4XP5H 3CCHA 3FQUA 4HDIB 4F9PA 2EYTA 1QSFB 3QDMA 5FYLL 3LN4A 2R0ZH 1UWEL 1MVFA 3QUZA 1E28B 2WUCH 3SGKA 2LVEA 3GZKA 1QRKA 3LKQB 3U7YH 1HH9A 4RGNB 5IVXB 4LNRA 3MLUL 2EICA 5E8PA 3G6JB 4LLUB 3CMOL 1F4WL 4GRLB 2X6MA 1IQDB 4P2YA 4JDVA 4JPIB 3ULSB 3A6CH 2P5EB 1EFXD 2J4WH 1AXTH 2H6PB 2RAMA 4CN1A 4X7DC 2X42A 2KDGA 5IR1B 3G08B 4FQHA 3O3BA 1NMCB 1FORH 1S9VB 4PJIB 1F4YH 3ZKXB 2FIKB 3B8YA 5GISL 2O5YL 2V2XB 4MGXA 3HR6A 4XWGH 3VG9B 4KGJA 3HNVL 1YY8A 1QSFD 4H1LG 3GI9L 5C0GA 1BQUA 4QRRE 1CXEA 4FZEH 4KY1L 5DQ9A 1IKFH 1ZT7B 3DRTA 4NQDE 1MJUH 3H6JA 4RGND 3C6SB 4W4NA 3V0WH 4APQC 1J8HD 4OCWH 2AEQH 5FYJL 1RIUH 3G5ZB 5BV7L 3JV4A 3AGVA 1YEJH 1O0VA 4WGVB 5FGRA 2PETA 3IFNL 4R3SA 1MUJA 2P5ED 4IOSD 5IHUH 2BVYA 2GSGB 3TJHC 4FNLH 3LS4L 3T0VA 3WMSA 1M4KA 5GZOD 2J8UE 2UZXB 1BZ7B 4A6YH 2RCSH 3PF2A 4UT6L 3GBNL 4DEPB 2VXTL 4OBSA 4AT6B 4O02L 2DB8A 2Y4SA 3QNXA 4YX2L 2NXYC 4AMKH 3QQ4A 1W72H 3DXAA 3JWOC 4LSRH 4LQ1A 3EHBC 2CD0A 5IBLD 4AJ0A 3RDTA 4PJ9C 4EDWL 1F4XL 4FQLH 2F58L 1F8TH 3RY5A 4UU9A 4Z7UB 3MPCA 2WWKO 4KV5F 1GC1H 1F3DJ 1NC4A 1IM3A 1H5BA 1NFIB 2DRUA 3NZ8A 3CVHL 2I60L 1H9VA 1MEXL 1NGWA 4R7NB 5J4MA 5CEYA 1FGNL 3WXVH 2MFNA 2CIIA 4WEMB 5DD0L 3T0DA 1X5FA 3T1FB 4P4KB 3HE6A 4V1DB 1Z3GH 5TF1H 2VC2H 43C9A 1A0QL 4KKCC 2UWEE 2GAZB 5BVPH 2Q20A 1RUML 1DE4A 4QHLA 2A6KA 5L6YH 1CD0A 4NM4L 3S5LB 4PGEA 3SJVB 2V2TB 12E8L 3SDCD 2HWZL 1I85C 4PJ7A 1NCDH 4F7CA 4ORGB 3DYOA 1BEYL 1Y18A 4Y4FC 5IW6A 4N0UA 4M1DL 3WXWH 4X6CA 1YN7B 4FABH 4WU7B 4P4KD 1GYAA 3HB3C 2UYLA 4V1DD 2P49B 3STZA 4XNYH 1GGCH 4H0IA 4TULL 3QXUA 4IRJB 3ARGD 2FIRT 3VJ6A 2A6IB 2W07A 4LIQE 3ZSTA 4LGRB 3VFMB 1R5IA 3SJVD 3MTRA 3S98A 1RJLB 4X99A 3BW9A 5JOFB 3V6OA 4JFXA 1EFQA 4BZYA 4MAUH 1N59B 2VLRA 5FOJA 3M17A 4KHTL 3VWJD 4UTAH 2E8ZA 2R2EB 4QCIA 1A14L 1FVEA 3SCMC 1ZANL 4S1DC 2HTKC 3O3AB 1K5NA 2FBJH 4AIZB 4C56B 4AEIL 4YDIH 3IAQA 4WVRA 3EO9L 3NFPB 2XY2A 4M1CD 4RMQA 2C9AA 5C0CB 3RWGA 1GGYA 2UVEA 4PRPE 2Z93B 1YEGH 5DWUL 3W39B 1NGQH 1DDHA 3LD8B 4PD4K 1FIGL 2CR3A 4ODTL 3HKFA 4Y4KA 4IRJD 3WEXA 3O4LE 5E0QA 1UVQA 1UJTA 1JJUA 3WDHA 5DK2B 4LOUC 4MLSA 3T0EC 1ZOXA 5ANMB 1P53A 4XVTH 5LCVH 7FABL 3CLFL 3IDYC 5HYJB 2R1YB 1U3JA 4HUNB 4JVUA 1HCVA 3RWHA 4ACPA 1RZJC 3MV7A 5HGGS 5C09A 3P30L 2VDLH 5GGRB 1Z5LB 5SWQA 3W0WE 3U4EA 5HTSA 1MFBH 1DQQB 1I1AA 2CQVA 5ALCH 1PEZA 2WBJB 5C0CD 3AU1B 4TRPH 8FABA 4AH2B 1DN2A 1XR9A 4QXTA 1OGAB 4MSWA 1MJ7L 5FKPA 1I8LC 5I1DB 4N0YH 4G7VL 4CGTA 4U33A 2ATPB 4M8QA 5C0FA 1MCQA 2X4RA 4G6MH 4KJQD 1VFAB 1CICB 1L7IL 1VFUA 4Y5VB 1LEGA 1Q9OA 5E8OA 5EU4A 1ZLSH 5HYJD 4NP4L 2GCYA 1RZGA 1LK3L 2NY2C 3RU8H 4XH2A 3C87A 1A7OH 3MRJA 1EGJL 2IH1A 1MFCH 4I5BA 4MAYA 1PG7X 3C2AH 5DQDL 1KFAH 1V7ML 5H94A 1MWAH 3RGVC 3MRCB 1HHHB 2WBJD 5EUOB 2AK4B 1NUFA 2OR9L 3SDXE 1OGAD 1UCTA 1ND0A 4H1LB 4M4PA 2K1MA 1A8JH 4X5XB 3CMGA 4DGIH 1CICD 3BIKA 3KVQA 1WT5A 4ZTPH 4XAKE 1RULL 4WI6A 3MA7A 4O2CB 1N6QL 2VDNL 1KN4H 4U4BA 5EZLA 1FL5B 1UZ8B 4XRCB 3WKMH 3HFMH 4PJHF 1RUPH 3WHXA 2YA1A 2AK4D 1P7QD 4TNWF 1FLTX 1V7NH 1EH9A 1KUMA 4ODXA 2D7TL 5CGMA 4P2QB 4KZDL 4PGZA 1ADQH 3KNBA 4I18B 1F6FB 2DI7A 1GC1C 1G7MB 1LEIA 3MBEB 3LKRA 4RX4A 4DUWA 2YPVH 5KTEH 5CUSL 3TA3C 2VXQH 4JREB 2FJGA 1PSKH 4ZPVB 2CMRH 2WBWB 4Q6YA 1T4KA 1MCIA 4J6RL 4MD0A 4X4XB 4WHTA 3T8XB 3Q6FB 4OM1L 1JV5B 4IOFD 1EEQA 2X1WL 4ZG1A 1MREL 1DBJH 4U6HB 1EHNA 1Z0NA 2BNQB 5T5FL 4P2QD 4F37F 5IESH 3T04D 4U6YB 1QTYT 4G8GD 3OKEB 5D7LE 3WFDH 3MBED 4X4ZA 1O7SA 2WLZA 1VERA 4WEUD 1KIQA 1Q8MA 4M9OA 4C55A 2EE2A 5DMKB 4L4TE 1IMHC 1MLCB 1UENA 2XWTA 4I2XE 3HUJE 3VFOB 4P49A 4YXHH 2VDQL 1D5BB 4Y16C 2UZYB 1W0WA 3BH8A 4K94L 4J3SA 1URLA 4J12A 4GKSB 5IB1A 1JPFB 3GI8H 4OZHA 2BNQD 4FQCH 2VH5L 4HT1L 5EOCL 3SDDC 5C3LD 3BRGC 5H37H 5TGBB 1L9NA 2HFEA 1JHLH 2X5PA 3MJ8B 4KQ3H 4JQIL 1I9IH 4UUJB 5I17B 3T3PE 5JOEA 3BIBX 4G8IB 4XXDA 1NFDF 4O2FA 1CTOA 4DCQB 5TH2B 4MD5A 5IFJA 2XWBA 2ZPKH 3CNKA 3I9GL 3AS2A 4Y1AA 3NVQA 1HYRC 1G7LA 4JPKL 2AJXL 2V5MA 4EBQH 4EKXA 3TYGL 3P40A 4HKBA 3C8KB 3DIFA 3AVEA 3CPLA 3PQYE 3RP1A 1T1XA 2IPTL 1FLRH 1KLUB 3GMPB 1YY9C 3MJ9A 5CZVH 5DRNA 1M1SA 4NN7C 3RVVD 2YSSB 1T1ZA 3MLSL 4POYA 2D9QB 1M05A 5JHLH 3VXSA 2HT3C 4J23A 4X6FA 1C7TA 2BSTB 1D5MB 2JCCB 1H8SA 2R0KH 4CNIA 1N4XL 4JDVB 3UJJL 4HIIA 4N5ED 2B1HH 4W6WB 1NAMH 3AB0C 4OIIL 4XAWL 3UTSD 4PB0H 4YHIA 2AXFB 3NCJL 4RNRA 4QHKJ 3PWLB 1I8IA 4LSTH 4O2EB 4E0RB 1HYSD 1N26A 3HAEB 4HZLB 3KPRD 3AREB 2IAMB 4G8EA 4X7EC 3QFJD 1GPOH 4LHQB 1I3RB 5MHSD 3WFHA 5HSFA 2YUZA 3D39E 1CLCA 1D5XA 4OM0H 1R3HB 2Y7QA 5C07E 2R15A 2OTUA 2PYEB 3IDIB 1QOKA 2BXYA 5CCKH 1T2QH 1DBKL 4RAHA 1J05B 3SE3C 5JDSA 4DUVA 2NNAA 2JJWA 4MCZB 3VD3A 4P48A 3TT3H 3LN5A 4DKEL 4PJCF 2GEEA 3ZKNC 2YC1B 3TPUB 3LKSB 5F7YC 1SJXA 1XGRB 1YEEH 5DT1L 4S1RH 2OXHA 1KG0A 3N1FC 3ARED 1YNLH 2IAMD 4AY0A 5ITBH 4WUUB 3SE4A 1EPFA 3ZDXE 3EOTL 3QDGE 1BJ8A 3MLWH 2IBZX 3RDTB 3GHBL 1KJ3L 2YN3A 1JFQL 4OAWB 2Y25A 4UQ2A 4LCWB 3I02B 3TV3L 4UU9B 1U0QA 1X6LA 3ARVA 5D1XB 5JTWA 5EBLA 3PWVA 5D8JH 2PYED 1NC4B 1IM3B 1H5BB 4NO0A 3U7WL 5DURB 1C08B 5HHNA 3VFGL 3I3EA 3MLZL 1MF2H 2VLKA 4QRPA 4J3TA 4PJXF 2ZNXA 5J3HC 4OZFA 3T1WA 43C9B 4WUUD 3LRHA 4ODVL 5INCB 5IMKA 4Z7NE 1DE4B 4JO2H 2A6JA 5GGUA 4Z77B 5IKCB 2BOCB 4LCWD 5BS0B 1DBBH 4PJGE 5D1XD 4PJAA 3WJJA 4PGEB 5GS1C 5CINL 4R96A 1KJMA 1UZ6E 4JJHA 4OZIA 2ADFH 4PJ7B 3KPPB 5T1DL 4AG4L 3TT1H 3LS5H 2XFXA 1A6TA 2K7PA 1LD9B 1HQ4B 3BQUA 3CFEA 2AJUL 3OKKA 3R1GL 2UYLB 4QOKA 4NFBA 5EBMA 1G0YR 3OB0K 4GG6E 1UQSA 5I0DA 4NT6A 5C6PB 1XGPA 2FZ3B 3MV9D 5BS0D 1HXMA 1I7UA 4LSUH 3VXRE 3D85B 3ZHLA 5FYLE 4X0KA 2OZ4A 2GJ6E 2WWKT 2G2RA 3SKJL 4YE4L 2NXZC 4FTVD 4ZYKA 2OTWA 2VLRB 2ZUTA 1RQ5A 4X8JB 3F7VB 2DWEB 1FVEB 4YHKH 1JF5A 3HI1B 5MERB 3T4AA 2XG5A 5IFHL 4FQJL 1BJ1J 1NCBH 1Q0XL 1U8OA 5LWYL 1JRHH 2P8MA 4K9EH 1X4ZA 4KKBC 3QRGL 3L6FB 5CBEA 3NAAL 1DDHB 3CDFA 2W9EH 5FA4A 4Y4KB 5E4IA 1AQKH 4KFZC 3RIFF 5EBWB 4KUZL 1CU4H 3E2HC 3D85D 3B9VA 5DJZA 1REIA 1IGCH 4ONGH 1DQJA 1VHPA 3CAFA 2NY1C 5BRZE 2H2PC 5F6IB 3U0WH 1P4LB 4KTEH 3RWHB 5DXWA 1T0PB 2P8PA 2V5SA 4NO3A 3O81A 5JIHA 3UP1A 5EOTA 1OAYL 1JGDB 3T0AA 4I77H 5DJCA 3NA9H 2EDHA 1RUKH 4QXTB 4OKDA 1CFBA 2PTVA 4MSWB 1S7UA 3E8UL 1WICA 1KB5B 3LDBB 4KVCL 4M8QB 1I7RA 4IHOA 5C0FB 4XBEH 4KRPD 3HE7A 4NJAL 1KLFA 4XHJD 1WBZB 3QAZB 1NUGA 3L3OA 4OF7A 3F7YB 4WW2C 5GS0H 3RTQB 1TTFA 1SMOA 4YHPA 4TUKL 1RI8A 3CX2A 4MDIA 4ZSOE 1DQDH 1KYOJ 3FAXA 5E08L 2IH1B 1XFPA 4HC1L 3ILQD 5ERWA 1M71A 5H94B 1JMZA 1QFWL 2Q76B 5FUZL 3UBXI 3UAJD 3ZT6A 2YOCA 3P0YH 4K71C 4N8PA 1NBVH 5EFIB 3CFCL 4LCCA 3NFNA 4LSQL 1JNJA 1E4XH 3D2UA 4ZD3H 3BIKB 1GCFA 4RCAA 5GRXG 4PJEE 1FNGA 2ATKB 4OD1H 1J0HA 4MNQA 3V5KB 2FD6L 2ESVD 3RTQD 4ELMB 2ADGA 4XI5C 1T89C 3DTXA 4TN9A 5FYLH 1UWEH 2F8VA 1K3IA 1U8LA 1MIMH 4ISVA 3ARYA 1JZ8A 4ZUTA 3CZJA 4KK5C 3WHXB 4RAUA 3MLUH 3VRIA 3CMOH 5GRWA 5L0QB 3TNNB 4DUXA 3GGWA 3W5NA 2DLGA 1V3JA 3O2VH 1FQ9C 4N1CA 2IANB 4ODXB 2IH3A 5EOQL 4ZUUB 2OL3B 3KNBB 3PNWA 3AS3A 3NBNA 1LEIB 3LB6D 2BCKA 4L8SA 3V6FB 5GISH 2O5YH 5J89A 1G7PA 5TPWL 3ZZ1A 1T6VN 3AMLA 2O93L 3HNVH 3LQZB 3GI9H 2VR4A 2FJGB 2JELL 5I9QB 5BJTA 4KY1H 3DSFL 1FC1A 4I3SL 4YPGB 4WDIA 5BV7H 1D5IH 1KEML 1FN4A 3OG6B 1WEJL 4BSJA 2WW8A 2IAND 1Z0MA 3ARFC 4ODBD 4RGNE 1H3GA 5IVXE 1XH3B 1S7XB 1FYTA 4CW1B 1QFUL 5EUKB 2UWEF 2EKSB 4PREA 4UT6H 3DV6B 3GBNH 2VXTH 2NX5A 4I4WA 2P5EE 4O02H 4YX2H 4TSAH 1KIQB 1BVLB 3V6BR 4OUUB 3EJZD 5I71C 4NJ9L 5HVGB 5J13B 2QR0B 2HLFD 3VDBA 1S78C 2I24N 4PJIE 5CEXA 5EA0H 1YYLL 3BMVA 4MHHI 1F4XH 3QUMA 4AEFA 2F58H 1ES0A 2VAAB 4RFEB 3VXNA 1LO3L 4X6DB 1MLBA 3U83A 3OKOA 2CDFB 2APXA 5IB1B 3N06B 4BSVB 2HVKA 3CVHH 2DJSA 2FGZA 4HAGA 5CGYD 4MMZC 1MEXH 1P6AB 3GMMA 1FGNH 1V05A