3FO9A

Crystal structure of aldolase antibody 33f12 fab' in complex with hapten 1,3-diketone
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
219
structure length
219
Chain Sequence
ELVMTQTPLSLPVSLGDQASISCRSSQSLVHSYGNTFLNWYLQKSGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQGTHVPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Immunoglobulin IGG2A - light chain
publication title Direct observation of an enamine intermediate in amine catalysis
pubmed doi rcsb
source organism Mus musculus
total genus 52
structure length 219
sequence length 219
chains with identical sequence L
ec nomenclature
pdb deposition date 2008-12-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo9A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo9A01
2YN5A 1V3LA 1GPOL 3V2AR 1A6UL 2UWEA 4QHLB 3VI3E 2FEEI 4G7YH 4IHOA 4MB5A 5DQJB 5BV7L 4WI7A 3CH8A 5KVMC 4AENA 2DDQH 1AR1D 5BRZD 5BV7B 4NGHH 1G9NH 5HHQA 2OR8A 2R0LL 3U2SB 2XQYG 5JHDA 5DHVB 1OSPH 3G6JA 5B3JE 2A77H 4D3CL 1RZJH 4XHQA 2BNRB 3RWJB 5KVDH 1UM4H 2BERA 1GH7A 2X9YA 4XPAH 4JY4A 2FD6L 3KAAA 2KKQA 4KI5F 3V4VH 3C6LC 1G7MA 1JCKA 1IC7L 3E1F1 4J3UA 2PNDA 3I50H 4PRBA 5IFHL 4RFNC 3OB8A 4DW2L 3WFDH 3K4DA 3O4LE 5T33H 1INQB 4Z78A 3RIAK 3QEQE 3QG7H 3QNZB 1K4DA 3JV6A 3T8XA 1S5IH 5CSZB 4GG8A 1ZOXA 4J3WA 4X6CB 4PLJD 4XMLH 4ELKB 4F7MA 3LHPL 4NQDD 3DHJA 2C26A 3LY6A 3LH2H 3P11L 2FLBT 4KQ3L 2IBZY 1FZMB 3HZKB 4JZJB 2X4OB 4MA7L 1NCBH 1OAYH 2EE2A 4JVPA 2E8YA 4RIRA 3U46B 1JZ2A 3CVHA 1IAIH 3ILPA 4XPGL 3ARTA 1JV5B 4L4TA 4Y4FA 4B0MM 5C0NC 3R06A 2OX5A 1CLYH 5JR1L 4HV8A 5EIIB 4PTTB 3SY0B 4MX7A 4JG0H 4CADB 5K9OB 1AXSB 2NNAA 2EDBA 4KWUA 5D1XD 2YKLL 3WXVH 3L5IA 5ID1A 4J4PC 5F1OB 4UV4H 2VXSH 2NY7L 3DETD 4PG9A 1X44A 4YE4L 1GIGH 5L88L 5F9AC 5JXAH 3STLB 5TQ2L 5C8JB 2VDRL 1SY6A 5IBUB 5IEHA 1MWAH 4JZNA 4ODXA 4F57H 1OW0C 3V6BR 3MRKB 2HYMA 4M4PA 4RMVA 5BMFL 4K9EC 5DLML 4L29B 2IANE 3G6AA 3KGRA 3PWVA 5T3ZH 2CDGA 4GRWH 2H32H 4W4NA 4R3SB 4PJBB 1ZLVK 3TCLB 1CXKA 5BS0E 1MY5A 4NRXA 1R3HA 4MYWB 1AP2A 1FYTB 1RAMA 1U42A 3MOBL 2BOCA 1F3JA 2OSLA 5EO1A 4LLYA 1OP3H 3QBTB 4PJAA 2IALA 4S1DD 1ES0A 5IW3A 5AEAA 1FFQA 1S9WA 3H9HA 1KLGB 3SDAB 3EHBC 2PYFA 2WV3A 5GGVY 4LDLB 4PJXF 3MRIB 4YGVA 3Q3GA 1JPSL 3P4OB 3MRBA 4GXVL 3SE8H 5C07A 2WUCH 1S7TA 3M8OL 5DK3A 2L4OA 2A1WL 4MAYA 5I74B 4N8CH 4P23B 5IK3B 1U91A 2ZUXA 1A47A 3IGAB 1P7QD 3KPPA 3GNMH 1UM6H 2W59A 3LEVL 2OQJA 2VDOL 4C83A 1BAFH 2EE3A 4NM8L 1DJSA 3UAJD 3PDOA 4JFZL 1XF5A 1V3KA 4KXZI 2G9HB 3O3EB 4RA3A 5EDXA 1U6AH 5D5ME 3I3BA 4Y4KD 5EFIA 2CRIA 4YHIA 3N85H 2QL1A 3NCEB 1B2WH 2KQNA 2GAZB 1BD2A 4PJIA 2EH8H 3U83A 1D3CA 1G7JB 5E56A 2BY3A 2PW1B 3F65A 3LS5H 3BN3B 5E9DB 4Z7VF 3VGHA 1BLNA 1XGRA 4HF5L 4CU6A 8FABA 4JQXC 4MVBC 1R3LA 1GGCL 2XWTA 4OGZA 4Z7WE 3LB6C 3RTQB 4UT9H 2JTDA 3WV0A 1SBSL 1MCWM 2ZUWA 5ILTL 4DN4L 4DVRH 2VLJE 4V1DA 4UAOC 4XBGB 5KOVC 1DBMH 3O2VH 3RWCB 2MTPA 1KT2B 3CUPA 4CN6A 1E27B 3SQOH 1R3IH 1HNFA 3BDYH 3DVNB 5K59E 5GS0C 1DANT 3BD3A 1I8LA 3RKDC 1QFWL 3GSVB 1J86A 5H37G 3WLWD 4LLQB 2I9TB 3ZL4L 1OSZB 2QQLH 4LMQE 2Y5EA 4XZUB 1QEWA 2X10A 1A7BA 4KAQL 3QDJA 1M6OA 4HMEA 5IMMA 1S5HA 2CKBA 3ARSA 4KI5D 2ADFL 1H3WM 3L3JA 3UTTB 5IMKB 1DN0A 2OL3A 1CFNA 3VXUB 4PTUA 4BM7A 4F58L 4J2XA 5KVGH 4XVUD 3AU1A 1B3JA 3CFKB 3SDCC 3RZCB 2GSGB 3QI9B 4RAHA 5EN2A 4ZS7H 1KPVA 5I18L 4AEIH 2I60H 2XKNB 4NQEB 1XGYH 4BZ1L 5J06A 4IIQA 1MI5A 3RGVA 3DECA 4UILL 3IT8D 1UB6B 4J8RB 4K3JH 3L95B 1QD0A 5E4EC 3GB7B 4M62H 4U7KA 1VCAA 3BGFC 1HWGB 1O5DT 3U1SL 1CDJA 3TA3C 5E99H 5BXFA 4OKVA 1T21B 4ODHL 2AXGB 2AV7B 4NJ9L 3MREB 2V17L 1EXUA 4G42A 2ZCLH 2FATH 3MNWB 4I48B 4S1RH 1I3GL 1KJ2L 5I1KH 1EGJH 4KJYA 1T2QH 3IXAB 1V7MH 1BREA 3VWKB 4YDLC 4OM0L 4BKLB 4X7DC 4I4WA 1JNNL 5H35A 2Z4QA 3VA6A 4ZNEA 5DD1H 4WFFD 1TJGH 4ZFGH 3JTTB 3F7VA 4D2NA 3NFSL 2OJEB 4YC2C 1T04B 4HHAA 2VDLL 2Y36L 3D0VA 4HUKB 4JFPB 4MA1C 4P2OA 3MYZA 5DWUL 2ICEA 2VQ1A 4XX1E 3GHEH 2GTWA 5IHBA 3QG6B 5FKAA 4RISL 1NUGA 5KAQF 3EDJA 3DX6A 2OTUB 1MCPH 3C5ZA 4G8FB 3K80A 3TT3L 1OOAA 4HWBL 4OZIE 4MCYA 4ZFOA 2RFXB 2ATPB 4LSVH 5EULV 3KNBB 2J8HA 5BZWA 3LAFA 5CEYA 5AD0B 2NX5B 3MXVL 1PJ9A 1T89A 3WS3B 4ZTPL 1J1XH 5CUSH 4ODTH 4HK0A 2BOBA 4NO3A 5D7LD 2H2SD 4HJ0C 1T03L 2R0WH 3SDXB 4KKBD 4PJDA 1NGPL 4FNLH 3B2UC 3G6DH 4LCUA 2HFFB 4ZXBA 4LLWB 1WK0A 4UDUA 4YXLL 3U7YH 1Y6MR 4G6FB 3AM8A 3ARZA 5FYJD 1KN4H 3OL2A 1S7RA 4P5MA 1J1PL 3S35X 2A83B 1J0YA 5HVFB 1RPQA 2IPKB 3DVFA 4PJ8C 1AHWA 5D7JB 4Y5VC 4Y19D 3V6OE 3FN9A 4BJLA 2BVPA 3ABZA 3VD3A 1FNSH 3VD7A 5KS9F 4LF3B 4MJ5A 4K7PY 2JB6A 4L4VB 5B39G 2G5BA 5JZ7C 3B9KD 1BOGA 2IQAB 5I17A 1VPOH 3ZDXE 4J6RL 2Q8AH 3PWUB 4M48L 5FHAH 3MLUH 2V9QA 1P4LB 4S11A 4XGZA 3FB7B 2EO1A 4L8SB 4JN1L 1UXWB 3GRWA 5BVPL 1F6AA 3QO1A 4QTIL 4UV7L 5D6DC 3FONA 3SGJC 3ARXA 4O02L 1B88A 4OCYH 3QWQB 1MAMH 3CFJB 4G6AD 1CXEA 1CWVA 1MHHB 3S4SB 2FECL 2NCMA 1NBVH 2V5SA 4HX1B 3P9MA 3K1KC 5D7SL 3ZKXB 4FG6C 3IXTA 3V0VA 2NY6D 4YHOH 4JFQA 3TT1L 1T1WB 5C0GB 3MRMA 3MRRB 1EO5A 4KGLA 1RHFA 1VFMA 5CSGA 2CDFB 4OLYL 2X4RB 2HKHL 5KN5A 2AABH 5DJZA 3T1WA 2IBGA 1TZIA 2G5RA 1FVDB 2YPKB 1T3FA 1WAAF 4RMTA 1A3RL 1JGEA 3NGBC 4OF7A 4QXTB 3LKQA 4M8VA 1K3IA 2WWKT 2VDQH 1ZGLB 3N0PB 4QT5B 3I9GL 3V7AE 2NY0C 2ZKHL 1ORQA 1NFIB 3TN0D 4O2CA 4KMTH 1IGMH 4NWTL 1X6LA 1NANH 2CIKB 2FWOB 1XT5A 4LLUB 3ROOA 4ENED 4HUXB 3WN5B 3WFCL 3TO4A 1OGTA 4U6VH 2P5WE 2L7UA 5E70A 4FQLL 4XPBH 2QADD 2B1AL 2NY3B 4P5TA 5JHLL 3C6SA 1LK3H 3N1FC 4XNZC 3RUGA 3RY6C 4HQQL 2A6IA 4EI6A 3QDMA 1AJ7H 1N6VA 1XZ0A 1Y18A 3FB5B 1ZWIB 4P3DB 3MLXH 4JHAL 4PLKD 5IGXH 1YEDB 1LO3H 3O8XD 3T3ME 1INDH 2GCYA 3Q1SH 4HKJA 3L3KA 5CEZH 1J9CT 4BZYA 3P30L 4LVOC 3VFVB 1G9MC 1MHEA 5A2LH 5IP4A 1ZT4A 2JB5H 1NDMA 2OLDA 2QQNL 4OV6F 4OV5A 2PCPA 2VLRE 5E6IA 3P73B 2ZJSH 1B4JL 2W60A 3QB7C 4PBXA 1IL1A 3LN4B 7CGTA 4MJIB 3S3PA 1MH5A 4JFHE 4PRPB 1RUPL 2HFEB 3HUJF 1I1AB 5C0DA 5I75C 4OCSL 5D1ZD 2IFGA 4MCZA 5BQ7B 5JORB 3PV6A 4MJ2A 4N5EC 4PY7B 2G2RA 3WS6C 3LEYH 4QKXB 1D5ZB 3MLZL 2WMPA 1S3KL 4RQQB 1K5NB 3KYMA 1HEZA 5IBLC 4HKXA 2J8UB 1OGAE 4OLUH 15C8L 3SGEH 3VMPA 4AIXA 2XA8L 1GGIH 2R9HC 4H8WC 1T6VN 5JUEH 4RDQF 5C0RH 2IADB 4GXUM 4X6BA 1BZ7B 1HXYB 1MRFH 2C1OA 3NIGF 5SX5H 4U7MA 2UUDK 3G6JB 3TBTB 4E5XB 5I66B 5LAXA 4DFIA 4GFTB 2QR0A 3C6LD 4PRAB 4HIJB 2YPLE 5KVFL 3O0RH 4U0QB 3BVNB 2MQCA 2GJZA 1B6UA 5IF0A 3TWCL 25C8L 1N3NA 2FO4A 4LCWB 5E2WH 3IDUA 4BELD 1GHFL 5HYQA 3TM6A 5B39A 5DC4B 3IFPB 1QVOB 1BOYA 3ROLB 3MCKA 4PJ9A 3GSRA 1FH5L 3BQUD 2DRUA 2AK4E 5F7EH 2AJXH 2B2XH 4WU7A 1YNKL 4RIRB 4QRPD 4KZEH 1PX3A 1XF3B 4QRRA 1PVHA 3DOSA 4Y1AE 3WXWH 2X09A 4GO6B 2DBLH 1NDGA 1PKQE 3KXFD 5E6ZA 3GSWA 4NQUA 5GS3A 1A4JB 4TVPL 1GZPB 3FO2A 4FQ2H 2AJUL 4OFDA 4J4PD 3QCUL 5DYOB 4UNUA 2P46B 5MHSD 3C9NA 2DQEL 4PG9B 3BPLB 3GKZA 1QBAA 1IC4L 1YMMA 3EOTL 1DBBH 1JPTL 2JCCA 1H8OA 3LVEA 4GW4A 3KPSB 1HQRB 1L4IA 2EEBA 5FF6B 4JG1H 3VD4A 4IOIA 4LU5L 4NFCA 3BIKA 3IDMB 1H5BA 3QISA 4HS6A 2J6EH 3ARDB 3DI3B 2CDGB 1NBQA 2N56A 3J7HA 1YNTA 4GKOA 5SWZD 4YIQB 2XFXB 2YD2A 5GHWH 3HE6C 1J8HA 1MAJA 2PO6C 1WIPA 5EBLA 5GGUA 3OGCB 5B22A 3RVXC 1JRHI 3T2OA 3WFHB 4XCNB 3UTSB 1U3HB 2P5ED 1P6AB 3OZ9H 4JKWA 3HC4H 4FQXC 1S7VB 1KCSL 5ERWA 3HI6L 1HYSC 2A0LC 3QJHA 4OD3H 4U1JA 2DJSA 3RVTC 4F7CA 2VWEC 1M1SA 1CVRA 3HKFA 5IHUL 3EHBD 3H6JA 2FSEA 4JDZA 4RGMC 3MROA 3QRGL 1KYOJ 5FCSH 5C92A 3AB0B 3GSNA 1OL0A 3HG1D 2EDKA 4PJBE 1Q9KA 1T1YA 1KJVA 5KSAC 3V4PL 1C8PA 3QAZB 5JLZA 3GK8H 3U9UA 1BZQK 5DFVC 1UCBH 1IKNA 1CZ8H 1R24B 2W0FA 4F9PC 1FYTE 1VEPA 2CLVB 3KPPB 4XH2A 3PWPB 4FXKB 1MOEA 1KIPB 3QZWB 5K9KB 3WSQL 4B7LA 1TZGH 4ONFL 1DBAH 1N4XH 1YZZA 5LGHL 3O8XA 4J3OC 1AE6L 3IDXH 3B5HA 4U6HB 3V5DA 5I71C 5T1MA 2NMSA 4FA8A 5E8DH 4OZHE 1KFAL 5HXMA 3RJQB 3S36L 3BP7A 2ADIB 4H88L 4E42A 1L7IH 1FAKT 1N6QL 4Y16B 3IAPA 4LSUH 3RBGA 1OPGL 3QYCA 1F13A 3MOAL 2FZ3B 2A9NL 1W0YT 4MVBD 4NNXA 1I9JH 3LB6D 1KLUA 3LQAH 1G1YA 3MLVL 4PJFB 3U36A 4JVWA 1WTGT 4I2XA 2DMCA 1XIWB 2EDJA 4GW1B 2VOTA 1WEJH 2V9RA 4X5LA 2NXYC 3SO5A 4G7VH 3D39A 3P0VH 5IWLA 3CUPB 2NTFB 5GS0D 32C2A 5I0DA 1KCKA 1UGNA 3RKDD 2RR3A 4F33A 4I18A 1F4XL 2D7OA 3OAUH 3FB6A 4QRQA 5ICYB 4JJ5B 1JHKH 5E9DE 4F7EB 2CRYA 2MOVA 4W6WB 4QNPE 1PG7L 3WBDA 1SVCP 1UJ3C 1YN7B 2N1KA 3TO2B 3D3VA 1CFNB 4TSCH 4LKCB 1NCTA 4ZDHB 1BECA 1ZT7B 4ZG1A 3LDBB 4YH6A 3SDCD 3M1BB 1ZANL 1G1CA 2WAHA 1GGYA 1AGDA 4WUUD 4POYA 5T3XD 1EVUA 3RZWA 1CXIA 4PJEE 3MOQA 4KRPC 3O3UN 3DNKA 4C4KO 1EHLH 1NL0H 2AGJH 3H3KA 4ZAKA 1BQHG 3UTTE 5CD3A 1U2HA 4NQDB 1Q72H 4L3ED 1ZEAL 3VXUE 3VXRE 2AQ3A 2FX8L 3TA3D 4PUBL 3QQ9C 3U0PB 2R29H 3O2DH 3V5KB 4JY5L 2BSTB 1A1MA 3JWNC 4M6ML 3UPCA 4EKXA 2ICWI 5KJRL 2ITDA 3FQTA 2VZOA 3QQNA 1MLCA 4M3KB 5HGHB 1CDIA 3HZVA 3WD5H 4NQEE 5DUPL 3BZFB 5GGTH 4L9LB 1WWAX 5ID0A 4NQVA 5D1XB 3VXPB 3GM0A 4PJ7A 3LKRA 1NGXB 5FIEA 4PS4H 1FNLA 4OB5H 1LP9F 5CP7B 3JWOL 4H20H 1WAAA 3SQBA 2X05A 1FC2D 5HTSA 3SE4C 2EXWC 2V7NA 4DK6A 4WI5A 1XGTA 3AMKA 3P9WB 5D2LB 5CEXA 1HINL 2R1WA 3E3QC 3MBXL 2PYEE 1G9NC 4HFWB 3AS1A 2V5MA 1CE6B 1RZJC 1I7UA 5CD5C 2OK0H 3JWDH 5DS8B 4PY8J 3U4AA 1DBJH 1A7RL 3L3IB 4NDMA 1OLZA 3UBXG 4QHMA 1ZHKB 3UTZA 1U8IB 5DJ6B 3PHOA 2DM3A 2Y5TB 1VFUA 4EDWL 4N0FA 5H2BA 5FXCH 5DUBB 1N7ML 5IEKA 3TVMC 3IS0X 3ECBA 3MLPA 5CEYB 1Q0YH 2APTA 4CAGA 1EK3A 4HJ0D 4HK0B 3VRIB 5JTWA 2Y1VA 3B2UD 3CLEL 3QXAA 4MQ7B 3C09C 1P7QB 1T1ZA 1R3KA 4X5XB 1EVTC 4FRWA 1K9TA 3UO1H 4O9HH 2FB4H 1RK0A 3BT2H 5HHVH 2Z35B 2VQTA 2C5DC 1T22A 5TJWK 4PGEA 5HI4C 1AFVH 3U30B 1I4FA 5FEBA 4NOBA 4Y4KB 4PJ8D 5I1HH 2VJXA 1A0QL 3EYQC 2DWDA 4Y7MA 1B0GB 4Y5YA 3SE3A 4UTBL 3O3DB 4YK4C 1J0KA 3JV5A 4KDVA 3SDXE 3RPIA 3HUJA 2QLVB 1HI6A 3FN3A 4U49A 4LLVA 2VL4A 5JZ7D 4LKXA 4JRYA 1UZ8A 3RL2A 5E8OA 1XGPB 2L7JA 3EDFA 4R0LA 4LSSL 5EZOL 1LDPL 3TNNA 4ZUWB 1PG7X 1HQ4A 2BDNH 1H3PH 1U8QB 2FH8A 5DK2A 1NCCL 4R90H 1CFSA 1NFDB 1MCBA 2NW2A 3ARYA 4EI5C 5J6HA 1QTYT 3DURA 5IR1A 4RRPG 5IQ7H 4WEBL 1FRGH 4LSPH 3BYTA 3MV7A 2LU4A 2VZSA 3WUZA 3IFOB 4NKIL 3DRTB 1NGYB 4L4VE 4IMLA 1YMHB 4XP9H 4Z77B 4FG6D 4YR6A 2BP3A 2IAMA 3BKML 2AJYL 3ZKSD 1AGBB 4HFUL 3QO0B 5J56B 3N50A 4DZ8A 4F7TB 2VDKL 3B8YA 4O58L 5DRZA 3MUHL 1P84K 2WP3O 1YY9C 3SE9L 1W8OA 5LGJB 4P49A 1AXTL 4O2EB 1V05A 4XCCL 4U1NA 1LO5A 4OBSA 1JGEB 3NABL 3T0VA 1RIHL 3GUTA 1JVKA 1C1EL 2D7TL 4HWEH 4S0SD 2Z91B 4CVXB 2W0LA 2NY0D 3OAYK 1WCBB 2BC4B 5SWSA 3L1OL 4XNQA 3VFOA 5FGCE 2BVYA 1BQHA 1MQ8A 5TPWL 3ZE1E 1F90H 4JAMA 5DF0A 1UWGH 2AJ3A 1AO7D 4JM2A 4NZDA 5ETUA 1VGEL 3ZE2E 2P8MB 1NCDL 3IRZA 3RWIA 3MBEA 4FZ8L 1QSZA 4P59H 5B38B 4I9WD 4E0RB 1MFCH 1TJIH 3TBWA 1ADQA 3G9VA 4PRID 5J1AB 1I7TB 5IKCA 1FNHA 1NC2A 2F5BL 4WHYG 1SEQH 3RWFA 1PSKH 1FL5A 5ICXA 4PJ5A 2DJ4A 1AQDB 3FAWA 3UMTA 4P2RA 4FABL 4H1LG 5FUOL 3B4NA 4N8VB 2JLLA 5JO5A 5ADOH 4XXCC 1CLOH 1I1FA 4ACPA 3V6ZB 1BJ1J 3MRJB 3P9LA 3WIHL 4YPGA 2UZIL 4ZFFB 1BGXH 5E8NB 1K85A 1X4ZA 2N7BA 1LK2B 5EU3A 4X4ME 3UBXA 4PJXB 4WI6A 4YDIH 3EZJB 4N5ED 2J2ZA 2H9GA 5CBAB 4QRTA 4TRPH 4L3CA 1HH6A 4P2QA 5E5MB 1I8MB 1YDPA 3MCLL 4ZUTB 5D7LB 5CGTA 5F6HJ 5IBLD 3OKOA 5IHZA 2R56H 4P9HC 3MRGB 3E6FA 1TETH 4F3FB 2R9HD 3QPXL 2DS4A 5AYQA 3BX7C 5IM7B 4N68A 4PRPE 1U8MB 2F19L 5FYJL 3VW3L 1AKJD 1C5CL 4GKSB 4AQ1B 1H3TA 4GMSH 2W0PA 1ACZA 3K2UH 5EU6A 2X4QB 5ANMA 5EZLA 5C08E 1HXMA 1Q94B 4K2UH 3HNSH 4FTVD 4GRLA 3D9AH 4XP6L 2PTTA 2F53A 1KTDA 5E03A 5TFSL 4YHPB 5FOJA 1H3XA 4Y19B 1M7DA 3RIFK 1UACL 2VYRE 2AXFA 4K3DH 4J3TA 4Z7VB 3QULA 4BQCA 3WL9A 2HJKA 5E1AA 3CZFA 3HMWH 4Y0GA 1XH3A 1S9XB 3B9KB 1F97A 4JKMA 2DQTH 3QUKA 2B1HL 3HHRB 3WJJA 1TQCC 1JF1A 3G6JE 3BPOB 1RZIA 3HRPA 4RFOL 4R96A 3LKPB 3LMJH 3RAJH 2E6QA 1WZ1H 4J3SA 1UH2A 3MC0A 4UQ2A 3WIFA 2IF7A 3F7QA 4QRRB 1DVFA 3PWLA 4XP5H 1P4IH 3KLAA 4RRPA 1R3JB 3GSWB 3HN3A 3I3EA 5C7XL 5A40E 2BSRA 2QQKH 5TDOB 3CDFA 4M43H 5CIPA 5AG9A 1KULA 2YXMA 4AZ8A 2ZSVB 2IPUK 1BIHA 3FRUA 5JNYA 4EN3A 2NY6B 3VD9A 1S8DA 2YPVH 4IOFC 3MRNA 4M7LL 3ARBC 1BJ8A 1N0LA 3L5XL 2IFFH 2FJHB 5EBMA 4CL7A 3QEHB 1KTKE 3VWJA 2X89D 2YA1A 2W9DH 2Q86B 5AYUH 4KJQC 5ADPH 3HE6D 3PWNA 2O5YL 4LGRB 4YHML 2VTFA 2HFGL 2NY5L 1ZVSB 4PP1C 3RVXD 5HVHB 4DKDC 3A6CL 3RWEA 5A16A 1I9RL 4IDJH 1VACB 1KOAA 4KTEH 4TSAH 4FQXD 1QRND 3DUHA 3BPCA 1EX0A 3MLWL 3SN6N 1HYSD 5KANI 2A0LD 3L3OA 3HA0A 3RVTD 3EKCA 3TN0B 3KPSE 5I1JL 3F5WB 4F7CB 2VERN 2VDNH 1IKFL 1A6ZA 2X7LB 4X7EC 3D2UD 5CINH 2QADB 4H25B 5KSAD 1H15B 5DFVD 1LD9B 1J1OL 4ZUSB 3U9UB 2P49B 1MJ8H 3UTSE 3DJ9A 2X9WA 1JPGB 3EOBB 2Q7YB 4F80A 2XZQL 4LRNL 3W39A 1YN6A 2FLRT 3QUML 4I0CC 2IBBA 4PJAE 3QUMB 4U2ZA 2YEZB 3O8XB 1RIVL 3H42L 4S1SL 2EH7L 4PV8A 2FX9L 1QLFA 5H94B 3FQUA 3S6CA 3AROA 3RDTC 1QO3B 3S34H 4H1LA 1CDBA 1IZKA 1A4KB 4NQSA 5FO7A 1E28B 1KBGL 3PGCA 1CGSL 1RUAL 3GGWA 4ZPTB 3NIDE 2CH8A 3CVHH 1ZVHA 4Y5XA 4XCYB 3RL1A 3GBNH 4DJMA 1QR1A 4GBXC 1CLZL 3VXNB 5EU7E 1PD6A 3EFDH 1J0IA 3OKNB 4M1DH 1JGUL 5E00A 3W9EB 5T1KD 4HUWB 3FT2B 3EO0B 5D1ZB 1WISA 3OXSB 4J12A 1IEAA 4PGBA 2NXYD 4L8CB 4OIIH 4RAUA 1NSNH 1E6JH 2GK0A 4YNYB 4HUUB 4GRWF 2CJUH 4L8DA 1OY3B 2VLKD 3V6OC 3RWDA 1NAKH 3AS0A 1BD2E 1SY6H 2YC1A 1HIML 1NCAL 2F15A 4BQBA 4HKBB 2F9BT 1XCQA 3F58H 5GGQH 2F5AH 5D6CB 2AJSH 2ZG2A 2VXQH 1BJMA 4KRNA 5LXGH 3P0GB 4HC1A 3STZA 1KXVC 4V1DE 2VDML 5KS9B 2ATKB 2DI8A 3WKMH 2CMRH 2VH5L 3C6LB 5GRYA 3GEWB 3NA4A 5C0IB 4KZDL 4BUGA 5DMYA 3BP6B 4Q6IC 4RFNB 1NGZB 1MHPL 5I73C 3PQYD 2I9LB 4G9FA 4KRPD 1JGVH 5IFAL 1IGCH 3VE0B 5EUOA 2ZUQC 1IC5H 1ZHLB 4V2BA 5HI3C 3K3QA 1R5VB 5FM4A 5J1TC 4HDIB 3QIBA 4JKKA 1LGVA 5DK0B 2AJVH 5T1DH 1E4WH 4MA8H 1CIUA 2BXYA 3QQ9D 5DRWA 1UKTA 4QRPB 5TH2A 5AZEL 3MNVB 5DUMH 3KJ6H 3KXFB 1YEGL 3CFCH 1U92B 3O9WA 4OI8A 3VXSD 1MI5E 2BNQA 5T5NF 4W68A 1MJ7H 3ZKQD 4JPVH 5K9JL 1U8JA 2LVEA 4B7IA 4I5BB 5MEQB 4GW5A 2EYTB 2YA0A 4K9EL 2EXWD 2A6KA 3DROA 5HGAB 1QPPA 4GSDH 5HDQL 4JDTH 1ZHNA 5FECA 4XMKL 5SWZB 5GIRB 5JDSA 5EUKA 2AEPH 1QR4A 2PO6A 3EDDA 4M7ZC 5CD5D 4P9MH 3LKSB 4R7DB 4R4NC 1J88A 3QFDA 2P5EB 3WHXA 3IFLL 5D7IA 3CH1A 1MNUL 2LTQC 3QNXA 2R0KH 3PHOB 5KSUB 2ILLA 3GMNB 4YXHL 1QRKA 3TVMD 3UYPA 4ZNEE 5DJAB 2QSTA 5GRJL 1VEMA 3ECBB 3WFEH 2CKBH 5D2LE 4V2CB 1CLCA 3HG1B 3PWJA 1A6VH 5J12C 2OL3H 1W0WB 5D5MF 5CJ5A 4Q6YA 1UM5L 2Z9TA 1Z2KA 4MQSB 1YC8A 2BY1A 1QA9A 3IDJA 1MFEL 4OZGF 4OSUH 5HPOA 2QV2A 3BWAA 4ISVB 1ZA6B 3DV6A 5HI4D 5FYKL 1JK8A 1MCOH 3EYQD 4Z7WF 4LFHG 4NCC1 4QOKA 2YUVA 3FAXA 3MRFA 4CBPA 2YZ1A 4J7RA 3UP1A 1KJMB 5I8OL 4YDVB 4Y4HC 3MV9A 5DRXA 1JF6A 3ZYZA 3NN8B 4OIAA 1S9YA 4PJDE 3O4OC 4XP1H 4ODWA 1BEYL 4K3GA 1KCVH 4NKDB 3RIFF 3SCMA 4U31A 2E5EA 3MUY1 4XCFH 1KELH 5I8CA 2CDEA 1FZJA 3V0AC 3LSOA 2AP2A 1G7PA 5C09D 5T3ZD 5I76B 1FGNH 4JREC 3VFWA 3PP4H 1CIDA 1OAQH 4UAOB 5FGBA 4EI5D 3BH8A 5GS0L 1ACYL 2ZSWA 5HYJA 3PXJA 5J6HB 4OD2A 3JTSA 3HE7C 3V6FA 3BXNB 3U4BH 3C2AH 3SKNA 2VZUA 3QEUA 1EMTL 4WV1A 1E6OL 4LPCA 3VU2A 1CE1H 3BSZH 5IB1B 3O4LD 2I5YL 3PNWB 2HVJA 4LMQI 3ZE0E 2OMNA 1DDHB 3QEQD 5HYSB 3AMLA 3QEGL 1C5BH 2YRZA 1HHJB 3C5SB 4OLZH 1GGTA 5F96L 3EO9L 3I84A 2VXVH 4YPJA 3P0YH 4PB9H 1S7QA 3FCTB 1NFDE 1YEHH 5IT2L 2C3GA 5I1GH 1YY9D 3U0WL 1CG9A 1IGFH 4MMZC 2EKSA 4EDXB 3SDCB 5EORH 4NPYA 4LSRL 3MJ9H 2F8XC 1NC4D 4WUUB 1QQDA 1IBGL 1LILA 3WFBL 4MQXC 4XPTL 5T1LD 3T0XA 4G3YL 1JWMA 1JNLH 1SEBB 1ZMYA 2HTLC 1CICA 5HPMA 3GFUA 1GXEA 1B6DA 5IG7A 4WY7L 2V2TA 1FFNA 4GAYB 1BJ1H 5E4EB 1EEQA 3BGFB 4KUCF 1P7KA 4L3EB 2ZG1A 3EYSL 4Q0XH 1V7NL 3TA3B 1FVEB 1EAJA 3W0WA 4QHKI 2IAND 5EU4A 1EIBA 5J13C 4I3SH 1J5OH 4YBLC 1BBJA 3GMLA 2XWJA 5D2NA 4C58B 4ZYKA 3SPVB 3THML 3ESVF 3LQAC 4WU5A 4LPWA 3LS4H 1K8DA 1G7LA 3X12B 3IAQA 3T0EC 4RZCA 4YDLB 3VA2C 1JWUB 1W72L 3FFDB 4LEXL 3B2VL 1JZ7A 2O61A 3HC3H 1J0HA 1FO0B 1KIRA 1ZE3C 1MRDL 1W72B 3BHBB 4M61A 5IIEB 1CFVH 4PJHF 4ORGB 5LWYH 2YK1L 4YX2L 4OZIF 3C60A 4YC2B 3WKNA 4XCEA 1D7FA 2J4WH 4MA1B 3GRWH 4LHUD 2Y07H 1OAXL 1ZTXL 4NZUL 3DWTA 4LASH 1WT5A 3MA7B 3KR3L 3OF6A 3NA9H 1W8NA 4DAGL 2HRPL 3KPMB 4NRZA 3VFSA 3GO1L 5JIHA 1D5XA 1NLBL 5FHBL 5HDOA 2I07B 5H37H 4IJ3C 1Z3GH 5DVMA 3HPLA 1J0JA 2WIIA 2XQBL 2C3WA 2DM7A 3BWUC 4KKAC 1MFBH 3UEZA 3AREA 2AEWA 1IGTA 3QXWA 1NGQH 3KPOA 1KN2H 4JFEA 3IU4L 3O41B 3QWOA 1DQJB 2D03L 3FOLB 3F7YA 4UT7H 1KG0A 4U3XA 5EU6B 2P8LB 4Y89A 4PJXE 1MCRA 2YUWA 4KV5F 3BMVA 5KSVB 1IQWL 4N0CC 4PJ8B 3SKMB 4XAKE 5LCVH 1KTDB 3LQZB 1NCWH 3V79C 4MJ6B 4Y5VB 5IB4A 1N59A 2F58L 5IOPA 3S9DB 5DJXA 2XA3A 4IEFB 5MEPB 1NAML 5JW5B 4N1HB 4JCMA 1S7XA 2EEAA 4GXUN 1U3YA 1YQVL 3T2QA 5I1CL 1NAMB 1TCRB 3N1QC 3UJTL 5C0AA 3IKCA 3L6FB 5L2KA 5CZVL 3FO1A 3U7WL 4TPRL 4JGMA 4IRJC 2QSQA 2LFGA 5CKGA 1KB5L 4G8EB 3S8WA 4Y19E 1KEGH 1G0YR 3KS0J 3J8F7 1KB5B 4NCDA 3JWDC 4Z7VE 5IBTL 1L6XA 1M4KA 2VNCA 4WCYH 4M6OH 2W38A 2X4PA 1FDLL 3IDNB 3SDDA 5DZLA 4DKEH 1OQXA 1E4XH 2Z31C 1KPUB 4WHCA 1IJ9A 3OWEA 4YQXL 2AKRB 3O6MH 3ARGA 4IOFD 3ARBD 3KPLA 4IS6B 4EXPX 3DI2B 3BRFA 5IROA 1KCUL 5I30L 4HXAH 1YPZB 3SGKC 2VXTH 1T7YA 4TULH 4QRRE 2R1XB 5D7KE 5BO1H 4KTDL 4ONHB 3M17A 1EAPA 1MPAH 3GSOA 4KJQD 1R5WA 2OI9C 3VGAC 1A7OL 3NGBB 5KOMC 4PP1D 4CMHB 4FQIH 3RA7L 2O5XL 4KUCD 3CC5A 3VGGA 1RHHB 1RIUH 1MEXL 4HIEB 1FN4B 1ORSA 5KSBA 3QHFL 2NY0B 4PP2A 3H9SA 3VGBA 2SEBB 2MPAH 2JCCE 3PIQA 4UQ3B 1T5WB 2VZVA 1K4CB 4TOYL 1HILA 1JWSB 1EEYB 1ND0B 3SKJL 4P46A 5EG6C 1OM3H 1T5XB 2EDFA 1AO7B 4DTGL 3HNVH 5JQ6L 3T3MF 5F9OH 5HGGS 2NW3A 3ET9F 4XNUL 4CVUA 4DN3L 3ULVE 3VH8G 4OLXH 5CAYB 4GKZB 5HHXL 3H3PH 4XNZB 4JR9H 1LP9B 3CMOL 2JIXD 4P5KB 4KRLB 3L3DB 3VFPA 4CJ0A 2CLRB 2VDPH 5FO9B 3DSNA 2XWBB 1PLGL 1YY8B 4LBEA 1JNJA 2PN5A 4QXUH 1NFKA 4ERSH 4ZMAT 1U8LA 4AH2A 2DLFL 4LGPB 1G9ML 1QLFB 3Q5TA 3RDTD 4HBCH 1JHLL 4DW2H 4KRMB 3NCMA 1T1XA 3WLBA 1CD9B 3C5JB 1PGRB 1UWEL 2H1PL 1BX2B 1XF4B 3O11A 3KJ4C 3FT4B 1FNAA 4NKOA 4FQ1H 4YHKL 5EPMB 4OTXH 3TPUB 1FQ9C 1I9EA 3IU3A 3V52L 1AGFB 1FNEB 2DQJL 3QT2A 5SV4A 3GHBL 2Z92A 1RUKL 4OUOA 3WNKA 1TZHB 2LQRA 1LO4H 5I75B 4XP4L 3DBXB 4NNPH 1OCWL 4NRYB 2ZUTA 4F9LA 4HIHA 1E4XI 5TE6L 1PYWA 5EC1A 4MAUL 2A6DA 1F4YL 1D9KC 5I19L 4YEEA 4YDJB 4N0RA 3B83A 5GSVA 2RB8A 4OZGA 4UDTA 4H8WL 1IGJB 3HI1A 4DGVH 4X7FC 5TDPA 2E3VA 2JJSC 3OJDB 4W6XB 1P9MA 2NXZC 4TNVF 4DZBA 1D6VL 4U3HA 3LEXB 1AKJB 3PP3H 4LP5A 4QHUB 4IMKC 4E41A 5E2VH 3ULVH 5D9SA 1HCFX 2HVKA 3E6HB 4JKLA 1OQOA 1A5FH 4FTVB 4ZTOL 5DJCB 2ORBL 1UYWH 4O4YH 5CLWA 4KMQA 4OKDA 4D9LL 1DSFL 1FE8L 4Y2DC 1EGJA 1WUNT 2EIBA 4FQHB 1WSST 2A6JA 5DD0L 5E8EA 1F11A 1EEZA 3GMOB 4G8GA 5CEZD 3EFFA 1I9IH 2P7TA 1D5BA 5FK9B 1N5AA 2VKXA 1W0VB 1SJVA 1VSCA 2GITA 2W92A 4BFEA 2XI9A 1RJLB 3QQ4A 2PW2A 5I8KH 1RZFH 3S5LG 1KB9K 4KQ4H 5ESVB 3PABA 1P5UA 1NLDL 3CX5K 1U8NA 3MA9H 1NEZG 2FNBA 2JELL 1IAOA 4RFEA 1IGIH 1FG2B 2CXKA 4NUJA 5KTEL 1WWWX 4NM8H 1IMHC 2VAAA 5CILL 1HHIB 1FGVH 2VIRB 1ED3B 4KDTC 5HY9A 1AD9B 2Q8BH 4U1LA 5ITFA 1CYGA 1FIEA 3M45A 4P4KC 1EDQA 4N0UA 5SV3A 4OZFB 4YHZL 4JQIL 4M93C 4WW1B 4ELMF 1A9EA 1MF2H 3OKLA 5CJQH 2B0SH 2DYPD 2X4SB 4D8PB 2DIBA 4QRPE 2MHAA 4DQOH 3BESR 4KDWA 4D0BA 5C6TL 2P5WD 3KXFE 3NBNA 4OFKA 1NKOA 2ICES 3FO9B 5INCA 5E5RB 5L8KB 2HKFL 3HE6B 1S7SB 2GHWB 1E0OB 2FYYA 5DJ2B 1CL7L 4G9DB 3FQRA 2QHRL 3MLTB 4NC2B 4FQXB 1QRNB 4DKFL 3VXQA 4TUJA 3X13B 2FBJH 4WWKC 1O0VA 4GAJL 5DD5L 3D1MC 4HJGB 4DOHB 4UINL 1WAAE 1IFHH 5TF1H 2QTEA 3FB8A 4H5SB 4YWGL 4RBPK 4S2SA 3FQWB 4AIZA 4RGMB 4CDGC 4I3RH 4LQFH 4F2MB 5DT1H 3WDJA 2CUIA 4PRDB 3D2UB 4OCWH 5IW6B 1NEUA 5H8DA 2ED8A 5KSAB 3RWHA 1JYVA 1X7QA 5DD3H 2Q76A 3GSQA 5D8JH 4M7JL 2X9XA 3VH8A 4JO2L 2IGFL 2DICA 3ARWA 4OFIA 2VE6A 4KY1L 1NGWA 5CCKH 3I6GA 4PJHA 4MNGA 1XCTA 1JUFA 1DQQA 4OD1H 4ODUA 3RNKA 1GC1H 2P8PA 2JJUA 5I71B 1FL6A 1T20A 3A67L 1A7PL 4ZUVA 3BDXA 2DKSA 1A6PA 4JFXB 4KC3B 1L7TL 4Y4HD 3HG1E 4Z18A 5DQ9B 5C0BD 4I1NB 3DVGB 3D85A 1BQUA 1OGAD 2NQCA 3ELAT 3BP4A 4GBXA 4NYLB 1ZV5A 4U2YA 5LGKA 3REWB 5T1KB 4TUKL 5EWIL 4KVNH 2Y7QA 4BFIB 2NXYB 5DMIH 4HKZB 5FYKE 5C0EB 3DMMC 3HE7D 4IRSA 4XRCB 4YFLI 3Q48A 4QNPF 4PG2C 2YPLD 3GMQA 4X0KB 2VLKB 4JFYA 1J05A 3ARFA 1N64H 3CFEB 1C5DA 1I8IA 3HUJE 2R4SH 5DJ8B 2DQDL 3L3GB 4JRYE 3FQNB 4DCQA 1U3JA 3RGHA 4QRSA 2OJZH 4YZFE 4O2FA 3TYGH 3CSBA 4QWWC 7FABH 1CTNA 3L5WB 4NWUH 3ZTJG 2VABB 5I15H 1KUMA 4MDIB 4FP8H 4CVZB 1UJ3B 4FQPA 2R2HA 3CVIL 3IF1A 2AK4D 3V5HA 2NY2C 4F7PA 3AFLA 1EUTA 1V5JA 3WIIH 4AK1A 5J9PB 3B6SB 1BVKB 4FXGA 5F1IA 4Y1AD 4Q97A 4Q2ZA 4MQXD 1JYWA 3NIGE 2XN9A 4ZQKA 4G6KH 3S88L 1QFWI 1DUYA 1MHCB 5IB5A 3PQYB 4KRPB 3BGMB 3EOAB 4B50A 4XVSH 2BNUB 1XGQA 3O45B 5DURD 2XNAA 4LEOB 1ETZA 5TDNA 5BVJB 3EO1A 5DRNA 2WWKO 4NKMB 4PD4J 2R0ZH 3UJJH 1MQKL 5C9JB 2N7AA 5GQBA 4ESKA 3GJEA 1ZLSH 2YWYA 3W0WB 4LGSB 2AV1B 4PREB 1PQZA 3S5LA 4Y4FC 2WK2A 1WBZA 2MCPL 4Z0BL 4LNRA 1NEZA 4X4ZA 3PGFH 3VXSB 1UZ6F 4JEGB 4GUPB 4APQA 5AZ2H 4QRUA 3T0ED 3L9RB 3WDHA 1CU4H 2LAGB 4G7YL 4X7SH 2R69H 3NPSC 1DEEA 1MJUH 2DDQL 4JFDD 5D72H 2DOCA 5C1MB 1A1OA 3QXTA 4NGHL 2DD8H 1G9NL 3KYOB 4NN6C 4UBDD 1OSPL 2A77L 1RZJL 2C4FU 4W81A 5KVDL 1UM4L 4XPAL 1BWWA 3QDAA 3I2CH 4Q9CA 3V4VL 4JLRB 3BKJH 2LABA 3I50L 2EYRA 1BVLB 1YEKH 3VFNB 1CDUA 3WFDL 1QSFD 2VL5B 3TVMB 1L6ZA 1MLBA 4PJ5E 4DUXA 3PF2A 4OM1H 5BJTB 5T33L 3QIWA 4NQCA 4P2RE 3QG7L 4RGNC 2HAZA 2MSPA 5F88B 3ARRA 1UVQA 3QUYA 4KKAD 1S5IL 4Z8FH 1F58H 1KENH 2VR5A 4XMLL 2GK2A 1CD1A 3LH2L 2A73B 4YHLH 2JK5A 4MAYC 3KS0H 5IMOA 1NCBL 1OAYL 3C09B 3QNYA 4A2MA 5FB8A 2WQRA 3G04B 1FVCB 1MCWW 1IAIL 4Z5RA 3PL6A 3W9DA 5MEOA 3IDYC 4Z7NE 3KG5A 4R26H 1A3LH 1CLYL 4OFYA 4JRWA 3LIZH 4JG0L 1CN4A 4OT1H 2C1PB 4JRXA 2VISB 1A7QH 2BHYA 3LN9A 5LBSH 3WXVL 3MJ7A 4N0CD 4PRNA 1Q9OA 4BUHA 4RAVB 2VXSL 3G9AB 5MEND 3TF7C 1UEMA 3TBSA 3KHQA 4GRMB 2OS7A 1XR9B 1RU9H 4NN7C 1U9KA 4YK4B 43C9B 1GIGL 3O6LH 5MI0C 3FT3A 5JXAL 2HJFB 4M4RA 3O2WH 4JFFA 4PBWD 1MWAL 2A74A 4F57L 1B0RB 1JPFB 5C0FB 3AAZA 1MWAB 3DGGB 5ISZA 3D18A 2W9EH 4F37K 4PJGF 5T3ZL 5F7FA 3LPWA 2DLGA 5EU6E 2GTZB 4KK9C 5ANME 5C09B 4CNIB 1LNUA 4GRWB 2H32B 4IRJD 1YEIH 2WWMC 3O3AB 2ZUYA 4MSWB 5I1LB 4EI5B 1ADQH 4J23A 4UIMA 4JPKH 1ONQA 5TE4H 3BO8A 4Z0XB 5IFJB 5FKPB 3ME0A 1HSBB 1I8LC 3KPRD 5JDJA 1BFVH 2LU7A 5DQDH 3UTOA 1PZ5B 2AJZA 2GJ6A 3GDBA 4NNYA 3T65A 1FFOB 1I7RB 2BHZA 3O4LB 3B8SA 3WO3B 2Z31D 2Q6WA 5I1EH 3R1GL 4CN4A 3QEQB 3IVKA 3L7FB 5A2JH 3MGOA 3SE8L 3R8BB 5GS1A 2WUCL 1PFCA 1M7IA 3E8UH 1QHOA 4N8CL 4ZODA 2AXJA 4IOSD 3VXRD 4HGMA 3GNML 3T4YB 1UM6L 2XQYK 3D48R 3MMEA 4HLZG 1BAFL 3EJJX 3GI8H 4RGOH 5FO8B 1NC4B 1NCUA 1U93A 2YD7A 3MV8A 1BQSA 1U6AL 5T1LB 2EDEA 1OWWA 4IIQC 3RGVC 2ICWA 3QFJD 3N85L 4CU8A 5SWQB 2FECI 1B2WL 2DJUA 2PTUA 2EH8L 4OGYH 4G80B 1WLHA 4K23H 2X4NB 3LS5L 1DE4B 1HILB 1QFUH 2HJLA 4MD4B 5HJ3A 4JN2A 3RVVC 1F6LL 3GIVB 3T77A 2IANB 4UT9L 3ZDYF 3CFBA 5F89B 2PYED 4OFVA 3IJYA 1U36A 4DVRL 4Z7UA 1DBML 3O2VL 4MD0A 5L8LB 3SQOL 4ALAH 2D9CA 1R3IL 2H8PB 1MIMH 2W9LA 3BDYL 3CXDH 3S97C 3P4MB 5JMOC 3MLSH 1A21A 1JFQL 4YUEL 3DX7A 4ONOA 2QQLL 3T2PA 5F1SA 1K2DB 3TBVA 4QTHB 3HZMB 4G43B 4X7CC 1A1NA 2Q87A 3N06B 3NIFF 4HWZB 2HWZH 4NQXB 3TWCH 3BUTA 3MRHB 4M9OA 5DJDB 3RJDA 3HPJA 4LHUB 4P2OC 5HHOA 3LKNB 5BOPA 3K81A 4BSVA 3K8MA 4X7TA 4I9WE 5KVGL 1LP9E 4EBQH 1BPVA 3LKOB 5F9DC 2DF3A 3C5ZC 4NT6B 4ZS7L 4YDKH 3SGDI 5FM5O 3VXTB 4AEIL 2I60L 4FFVC 1XGYL 5CIPH 5D5MB 2A6DB 1D9KD 1F42A 2F54A 2VN7A 4ETQB 1VB9A 4AJ0A 3VCLB 2ADGA 4K3JL 1HHGB 1LEIB 1T89C 4M62L 3Q6FA 2DQUH 5DTFA 4M7KH 3H7BB 4PJCA 2XPGA 3OKEA 5E0QA 2DQEH 1YEFH 5E99L 4Z9KB 2R2BA 3FTGA 5MERB 3PJSB 1LE9B 2B4CH 3MACH 4WFGE 1TVBA 2NXZD 4Q9BA 4ZXBC 4JFOB 3X14B 2UWEF 2D2OA 3O2DA 4Z7WB 4E41B 3AM8C 1FL3B 1EFQA 2LAAA 2AS5M 1EHXA 1DUZB 3DTXB 1HH9A 3EAKA 5I9QB 3QDGA 4ONGH 2ZCLL 2FATL 4S1RL 1Q9LB 1AHWC 5C0JA 5I1KL 1EGJL 1H8SA 1T2QL 1CGVA 1V7ML 5K9QI 1ZT1A 4ZOEA 5GS2H 4KI1A 3LN5B 4GH7B 5EO0B 2DQHH 1DANU 5DD1L 1TJGL 3VFTB 4ZFGL 4O51A 2EDNA 1CQKA 1SM3H 1CDYA 2P7TB 4TUOA 4D0CB 2X1OA 9CGTA 5E8PA 1TQCB 2C9AA 4OZ4B 2D31B 4FTVE 1AGCB 3GHEL 4PRHA 2G60H 1L9MA 4K8RH 2HH0H 1AIFB 1X6NA 5JPMA 4A6YA 1MCPL 3PABB 1CFTB 4GS7C 3L5JA 4NJAL 2EO9A 1JTOA 3EIFA 4LSVL 1NBYA 4WHYH 1HN1A 1N5YH 4G6MH 1FNFA 3KPQA 4OBRA 3L7EA 3GMRA 2E27H 4LPXA 3QWRA 4H1LH 5EOTB 3SJVA 5HHNA 1J1XL 2ZP0T 3IB4A 4ODTL 5CUSL 3VXOB 5FDWA 3D69A 4NO5A 2R0WL 4P4KD 4RMWA 4XI5C 4U1LB 3ARBB 4HEPG 1P6FA 1T4KB 4FNLL 5DGQA 3G6DL 5KANG 1X5XA 2P1YA 4ZSOA 2ARWA 4M00A 4OFPA 3QJFA 2XTJC 3V7MA 3U7YL 1G9EA 1UQSB 4UNTA 3D25A 4NSKA 2ZUUA 1FYHB 4HWNA 1KN4L 1MJJA 1SYSA 3S3SA 4Z76A 4KTYA 5IW1B 4BSWB 2ZCHH 2BFVH 5E2UH 5F3HB 1DLFH 1WBXA 3VG0H 3K4ZA 5L2JB 4Q7DA 5INDA 3TESA 1FNSL 4WWKD 2J8OA 3DXAA 3OKDA 3VFMB 1VGKA 5ESAA 3LRGA 1VPOL 2Q8AL 4ZD3H 5FHAL 3MLUL 1RK1A 1K3ZA 4PJAF 4XVTH 1RJYB 1ZLWH 4MZ3A 3TO4C 4HC1H 1YYMH 3BKCH 3KDMA 35C8H 3F12B 4X6DF 2ARJB 4P5TC 3BAEH 4HAFA 1LE5A 2VB5A 1I3UA 4X8XA 4YJZL 4DGYH 3KYKH 2F74B 4OCYL 2JIXB 1MAML 5D7IE 5IV2B 2C7UB 4RNRA 4DVBA 5ACZB 3LD8C 3ARUA 4UMGA 5C0CA 1BFSA 3BPNC 1JZ5A 4EOWH 4MNGB 4OZIB 4DOHE 1JUFB 1G6RA 3BEWA 2IG2H 2VWEE 1NBVL 1IEBB 3CFIC 3RDTB 2EDOA 1RI8A 4U1IA 4YHOL 3S96B 4U6YB 3TJEH 8CGTA 3ZYJA 3MGTA 1JNHA 2ZCKH 4ZUUB 5HYFA 5T5FH 1TLKA 5I1DB 3JUZA 1OARH 1Y0LA 2IH1A 3WMSA 5E6IC 2AABL 1QFWM 4PJIF 1IRAY 1X3DA 1LEKB 2Y9RT 4JE4B 3EGSB 4PR5B 4X4YB 5TGBA 4F37F 1LO0H 2VITA 5C08D 1RZ8A 3MLRH 1ZA3B 3I02A 5CZKA 2VDQL 4R9HA 3DMMD 4OAWB 4QOKE 4HCRA 4LLDB 2X4UB 1Z6JT 2XXMB 3DVIA 3DIFB 4FQQA 4OF0A 4X80H 3MV9E 4R2GC 3P77A 4KMTL 4TNWK 1IGML 3T0BA 2VZTA 3SKOB 4BH8A 4QRSB 4QWWD 4U6VL 3NFNA 1DFBH 1R5IB 1TTUA 4XPBL 3CPLB 3B5GA 3BZ4B 5JHDD 1FV1A 5EC2B 4WENB 4X99A 3N1GC 2NY2D 5FOBB 1LK3L 4WO4A 3PE9A 1I8KA 4EIZC 1BIIA 3IETB 2XZCH 5JPNA 4K71C 3VJ6A 5SX4I 1M71A 2CO7B 3OPZH 4Y2DA 5F1IB 2AEQH 1WITA 3NPZB 4Q6IB 3MLXL 5IGXL 4PJGA 5C3TA 3VI4F 4J3XA 1ZHBA 2IJ0C 1LO3L 3BI9X 3MYJA 4EVNB 4UU9A 1MVFA 4HUVB 5I73B 1INDL 3Q1SL 3U4EA 1FLRH 5CEZL 4RWYH 3X11B 1VKXA 4C54A 3GIZH 4NO2B 4JPWH 2ZUQB 4XBPB 3W2DH 4X6FB 5DD6A 3HB3C 5F1KC 3MO1A 1P2CA 5GGSB 2ZOLA 2JB5L 1NBZB 5IVXA 4PYHA 2DWEA 2BVOB 3HAEG 4PJ9C 3UCRA 3ZYIA 1S7WB 4RA0C 1IQDA 2ZJSL 2WSKA 4CW1B 1A9BA 3OR7A 1Z9SA 3DUSA 5I1IH 2AI0H 5E7FA 3IYLW 1TVDA 1X5AA 4L4TD 4Y4FD 5ENWB 1AC6A 4MWFA 3G5XA 1YJDC 5F7DA 3QR2A 3H8NA 3MRQB 3RWGB 2GUOA 1AI1H 3LEYL 4I0KA 2AEIT 3TBYA 3QUZA 5E6YA 4S1QH 4NC1C 1U95A 2E7HA 2V6HA 1SJHB 4X5WA 4KK8C 4ODSH 4OLUL 5GSRB 5JOFA 1T0MB 1GGIL 2CLZB 3ORJA 5JUEL 3U82B 5A43C 4Y8AA 2DYPB 5C0RL 3W0WE 5HGDA 1MRFL 1H5BC 3BEVB 1KIQB 5D2NE 5LVEA 3REVA 2Z93A 5IVZB 3TNMA 4OCXH 4F8TA 3MJ6A 3ULVC 4LHUG 3NFPB 3VXSE 1HHKA 4M7ZB 3OQ3B 3FQXA 1P5VA 4LLMB 4QXGH 1BF2A 3O0RL 4R7NA 1X5JA 1RQ5A 1XF2A 2LTQB 3AVEA 5IB2A 2R2EA 5DHYA 5F3BB 1BBDH 1XGUB 4GG6A 5E2WL 5J6GA 2FR4A 3P4LA 3SKUD 4RGND 3E0GA 3T1FB 1AY1H 2AQ1A 3OXRB 3OKKB 3E3QE 1JGLL 3WNOA 1SYVA 5J12B 5C07D 5GGVH 4MAYD 5F7EL 2AJXL 3F6IA 4TQEH 2B2XL 5IMOB 2AJYH 4JO3H 4KZEL 1J7VR 1IKNC 3QA3A 4J1UA 2VSCA 1RZKH 3WXWL 4PJDF 2DBLL 3ES6A 3MRPA 3H0TA 3FFCA 3OAZH 3CX2A 4FQ2L 4CN1A 1A14H 3SE9H 1VFBA 3U79A 1IAKA 5KZCD 1FJ1B 5DJYA 5GRWA 2CR6A 5BZDA 6CGTA 2IH3A 5IMLA 1LEGB 1QNZH 3QIUA 2XKUA 2YD1A 1DBBL 4RMSA 4Y4HB 3NCBB 2EC9U 1BD2D 5C0BB 1RZGB 1RIHH 1QLEH 2CK0H 3O4OB 1Z0MA 4L5FH 4JFEE 5C2BH 4JG1L 5KBNC 1OGAB 1TITA 3RU8H 1MVUB 5FA3A 2W65B 3WUWB 1T0PB 2J6EL 2DQGH 2ADJA 1UXSB 3S3JA 4KK9D 3TZVA 4U1GC 5GHWL 4C59B 2WWMD 1C16B 4JY6B 3G08B 3ZE0F 1M05B 4V1DD 3QXDA 4KHTH 4DGIH 3TFKC 1G7IB 4U6XB 6FABH 2FBOJ 4ZPVA 3HE7B 4HD9A 5IWLC 4JDVB 3OZ9L 3HC4L 3NOIA 2GFBA 2WLZA 2H45A 5DEFA 1LDSA 2FEDC 3UC0H 1J18A 4Z7QE 4OD3L 4K7FA 3UTQB 1E4JA 3MRLB 4I18C 2ESVA 3OHXB 4KGJA 2H26A 4DEPC 3GJFH 3QDJD 5L2KE 5DZNA 5CWSB 2V2WB 5C09E 5T3ZE 4GRWE 3EYVB 5ACMA 3GK8L 4YHYC 2AK4B 1UCBL 1CZ8L 2FL5A 4XNMA 1I1YB 1S78C 5F70A 3BZEB 4Y1AB 3IJSB 1TZGL 2DIAA 1DBAL 1PKQB 3QQ3A 3QXUA 1N4XL 1SJEB 3IDXL 1Z5LB 3RGVD 1MI5D 4KJPC 2X40A 4KXZH 5E8DL 2BVQA 1OHQA 3TIEA 2DQCH 3BOVA 5DURB 3QCTH 4WDIB 1TVHB 1L7IL 4X6EB 1GOHA 4ZAKC 4LSUL 2UZXB 1DL7H 1CGYA 1Q9WA 4LCYB 3GMPB 2PXYA 4C56A 3HAEA 3RVVD 1X4XA 5EH1A 3MCLH 4LAQH 5J13B 1I9JL 2EECA 4LPYA 3N1PC 4PGCB 4YBLB 4TTGA 4CRPA 3LQAL 1GSMA 5HHPB 5HHMD 1WEJL 4G7VL 3P0VL 4X4XB 1D5IH 4XX1G 1KTLA 4ELMB 5BS0A 1F2QA 4ZFZB 3T0EB 2H3NB 3H9SE 3O6FC 2FHFA 4MA3B 2HT4C 5IB3B 3RUGF 1AXIB 3OAUL 5F6IC 4QYOB 2NYYC 3P4NA 2FDBP 4JFDB 3TH4T 1UB5A 1N2RA 1WFUA 1D6EA 4EUPB 1AD0B 3TYFA 4P2OD 1OB1A 2V7HB 4TSCL 1F5WA 5JW4R 4MNQA 4HK3J 1OAZH 3CSYA 1ROWA 4WNQB 3V8CA 1CDGA 3QUXA 1XR8B 2X70A 4JZOB 1DZBA 3C5ZD 4ZS6C 1WBYA 1K8IB 1JYNA 5CHNA 1QSFB 5JW3H 3OBAA 4NM4H 4FFVD 4JO4L 1C12A 4FXLA 4IJ3B 1RZ7H 4AT6B 4NBZB 4X6DA 3EYOA 1JN6A 1EHLL 4YO0A 1NL0L 2AGJL 4OZHB 2ADGB 3BP5B 2GQHA 3BW9A 5ICZA 1Q72L 3ZTNH 3VFRA 2XPGB 2X41A 3VGDA 4GLRI 2R29L 4ZXBD 4TNWF 1HSAA 3O2DL 3O81A 4LPUA 2OTWA 3ETBF 2X5PA 4KVCH 4GT7A 1JGDA 1RUMH 1CGXA 2VMFA 3CDGB 4HS3B 1ODAA 2AK1H 1I3RA 3WD5L 1HOCA 4KMLB 5GGTL 4MHHI 4RMQA 4YHNA 1U0QA 3OJ2C 3QH3A 4WFEE 1CT8B 1FFPA 1MCEA 5MENB 4XNXH 5B3NA 4QCIA 4Y5YC 1SBBA 3SE3C 2VLJA 4LL9A 1ZS8B 3DSFH 3U9PH 3DUUA 4HPYL 3MV11 4PS4L 3T08A 4OZGE 4OB5L 4H20L 4OGAC 5IJKA 1RJZB 2CIIA 3LRHA 2ITCA 4KUZH 4R0LC 5EOCJ 4K7PH 4X8JA 3K8KA 2H6PB 1ZSDB 1NJ9B 3AXLB 2X42A 4TUOB 4E41E 4XXDB 2QKIA 4JHWH 5F1NA 3NAAH 4IRJB 1U8OA 1D5MB 3DX9B 4H26A 1FNGA 3CCHA 3S35L 2YSSA 2OK0L 3GMMA 3EYFA 3JWDL 2HMIC 1RUQH 1CR9H 2ZUVA 2DTMH 1JZ4A 5EU5B 2DQFA 4IM8A 5BOZG 3KPRB 1WC7B 1LHZA 1MCKA 3DRQB 4PJEB 1FPTH 2VLLA 4HMDA 2D7MA 1Q0YL 4NO0A 3U0TB 2Z31B 2R1YA 3Q6GH 3TIDB 4CU7A 2ICWJ 3MUJA 4CMMA 2IAMC 1U58A 3NMEA 1JHTA 4NUGH 4XI5D 3VGEA 3V7AG 3O3BA 5GISH 1TNNA 2XT1B 4WJ5A 5ESQA 4Z6AT 5DJ0A 3VXRB 3WE6B 3UO1L 4O9HL 2XTJD 1IM3B 2DN7A 2FB4L 4N90E 3LCYA 1CFBA 2JCCF 3BT2L 5HHVL 5KG9A 3HCVB 4FZEH 2EXYC 2OI9B 3EUUA 3VGAB 4JO1H 1AFVL 3LV3B 1OAKH 5I1HL 2Z8WC 5JXEA 1YNLH 2E7CA 4U1SB 1MREH 3QFJB 1HHHA 3GSUB 4LCCA 3UYOD 4N0YH 5BW7A 3ULVF 5B8CC 3G5ZA 5IJVA 4N0UE 2A9MH 4PGDA 5F9JA 4LSQH 5KW9H 1OWRM 4MNHB 4M8QA 4H0HB 1CGUA 1T7WA 3IDIA 3MUGB 3OG6B 3R8QA 1RK1B 3TO4D 1N0XH 2BDNL 4BSJA 4R90L 2YD8A 4JM2C 2PYEB 3DPBA 1GZQB 4P5TD 4U1KB 3HC0B 4WTXA 4I77H 3MBEC 4LVNC 4CDHA 3G5YB 4JANA 5IQ7L 3SOBH 2HRLA 1FRGL 4UUJB 4LSPL 5DO2C 3QDMD 5HVGB 4JPIA 4MXQC 3PUCA 3TEUA 2FIKB 3T4AA 5FAAA 1QSVA 3OKMA 1KJ2B 3VRJA 1VEOA 1UEYA 2PTVA 4XP9L 3I6KA 5ALBH 3O6KH 3WEXA 4HZLB 5D4QA 3FRPG 2CD0A 2HN7B 3KJ4B 4LARH 1FZOB 3UZVB 4I0PA 5EBWA 3LRSA 3HFMH 5E6ID 1CI5A 2FJGA 5EZIH 2E7BA 4XB8A 1DTUA 4BH7A 1DLHA 1U8PB 4PJHE 4G6JH 3CK0H 3MJ9A 1S7UA 4MNGE 4AM0A 4CUCA 2OYPA 4HWEL 1U8KB 1D9KB 4XAKD 1G7QB 2HT2C 2UYLA 5IVOA 2VRAA 3KYNA 2VC2H 2KQMA 5CKAA 3VD5A 3G5VB 4R2GD 1Y6NR 2R4RH 2V2XA 2GT9A 3MR9A 1EFXA 2WUBH 4HUNB 1F90L 4R4BA 1UWGL 1A6AB 1QSEA 2NXZB 2X4TA 3IS1X 3D0LA 5DI8A 1AGEA 2B7DT 2HG5A 4Q9RH 2YBRA 4GRLC 3MRDB 4P59L 4QF1A 5EZJA 1OT1A 4QY8B 3VFUA 1MFCL 1TJIL 3BIAX 4HGWB 4UOW0 2Z8RA 1QLRA 1VFAB 2FX7H 5GGRB 4M6NH 3PHQB 1SEQL 2DLIA 4L4JA 1PSKL 3DX8A 5DMKB 3C8KA 3ZSTA 4OQTA 3KPNA 4PV9A 1FAIH 1P1ZA 5FYLH 1KEMH 1KNOA 4KV5E 3FOMA 3HB3D 1X5IA 5ADOL 3ULSA 2GSIA 1IE5A 3MFFA 1CLOL 4PJ9D 3WJJC 4XPHH 1HKLH 2IMNA 4MD5A 1PEZA 2P24A 5EIVA 3KWWA 3GSXA 2PKDA 1MFAH 1BGXL 1T0NB 3DUSB 5E94B 4QRRD 5D7KD 3U6RB 1DVFC 2OMBA 4UIKH 5L6YH 1HDMA 1MCFA 1S9VB 4YDIL 2FJFA 5E08H 4URTB 4YAQA 3NZ8A 3OR6B 4PB0H 4E9LA 3Q0HA 4TRPL 2VAJA 5CEZE 2YRLA 2D9QB 1YMMD 4KK8D 1C08B 4EN3C 5HDBF 4P4KB 4EIGB 2R56L 4M93B 2EYSA 5CP3A 2BCKB 4PJ7F 2EICA 5FGCB 1TETL 2E7LA 3CXHK 5IBUG 2DQIH 3MODH 3JSSA 4OGXH 3VWJC 3CDYA 1DBKH 1VADA 1YUHB 4GKNB 1A2YB 4GMSL 3ZSSA 2B4CC 3K2UL 3ALWA 5ECJE 1BEYH 1KXTB 2HT3C 4EUPG 4K2UL 3HNSL 2DI7A 2OR9H 3ULVD 1J8HD 3D9AL 4WHTB 1F4WH 1FZKB 4CVWA 1OF2A 3HS0A 1YECH 3HLAA 5F72S 2YR3A 5B21A 3BRDA 4K3DL 1P4BH 4WWKB 4TTDC 2WINB 3HR5A 5DDHA 2BHUA 3HMWL 4P57B 3IDGA 1L9NA 1F45A 1G7HB 1U8HB 2DQTL 4GMTH 4O5LH 1B4RA 4X98A 4HPOH 2G75B 3MNZB 3LMJL 43CAB 3BKYH 3RAJL 5EB9A 2HLAA 2ZOKA 4NC0B 4K8RC 2QEJA 3PGDA 5I16B 2WBJA 1I7ZB 4XP5L 1P4IL 5IQ9A 3MJ8A 2VLRA 2D3VA 3OJVC 4HXBH 2QQKL 3JV4A 5GJSH 3AY4A 5FM8A 4M43L 4NQCE 5I8EB 5T3XH 4WI9A 2BMKA 1FIGH 1TTFA 3JVGA 1F3RB 1Z9MA 4JKPH 5AUMB 3WHE1 5DSCB 2YPVL 4OUUA 4P4RA 4WI4A 1IM9A 2IFFL 3FRPA 4MDJB 2BSSA 2CGRH 4Y5XC 1EPFA 2W9DL 1VDGA 2E9WA 5AYUL 2DI9A 4WUKH 1H3VA 5ADPL 1CFQA 5C08B 4N9GB 5L8JB 4JRXE 4YZFF 3TFKD 1REIA 5EO9A 3DMMB 3D39D 3UPRA 1NH6A 3IJHA 4IDJL 4LRIA 4DFHA 4D0DB 4KTEL 4TSAL 5JQHC 1IT9H 3DV4A 1JRHH 2FEDD 2C3VB 5C0BE 3HMXH 3DARA 5J89A 1A6TA 2UWEB 1IGYA 3HRZA 5CBEA 2ERJC 4IHOB 4KKNA 2ESVB 3A0OA 2VDNL 4U3CA 1KTRL 2Y23A 5ISZE 2V9TA 4QHLA 4AENB 2WBWB 1MRCH 1FO0H 5AAWA 5DQJA 5CINL 5HHQB 2OZ4H 4XMPH 5JHDB 1EHAA 2NY2B 2EIDA 3D3VD 1MJ8L 4JY4B 3U2SA 1S78D 2CO6B 2BRRH 1G7MB 5DHVA 5F97E 4UTAH 3RWJA 2BNRA 4PRBB 4KJPD 3BJ91 1J87A 2ED7A 4Z78B 4U6TA 5EOQH 1K4DB 3S34L 3JV6B 3T8XB 4ZAKD 1J0ZA 4GG8B 1INQA 4F7MB 4LVEA 2LU3A 3QPQC 1EV2E 3QNZA 3QIBC 5IESH 3CVHL 5CSZA 5D71H 3GBNL 4X6CA 4ELKA 3EFDL 4M1DL 3S7GA 4XC3H 3CVHB 3ILPB 5C0ND 4L4TB 1FZMA 4Y4FB 3HZKA 4JZJA 3VMNA 2FGWH 2X4OA 3R06B 3C08H 3ZDZF 1NUNB 3U46A 1RVFH 4HV8B 3MV8E 4MXVE 4MX7B 1KV3A 5TE7H 3O9WC 1J12A 3S37X 4OIIL 2NNAB 4XAWH 1JV5A 1NSNL 1E6JL 3D5OF 3MXWH 5ID1B 4JM2F 5EIIA 2CJUL 4PTTA 3SY0A 4CADA 5K9OA 1AXSA 1NAKL 3KLHC 5GPRA 2J5LC 1SY6L 2HT4D 4HULB 1T66C 4PD4K 3B3IA 3F58L 1KGCE 1WTLA 5IEHB 3NPSB 2NYYD 5GGQL 2F5AL 4JZNB 4ODXB 2VLMD 2APFA 2AJSL 2VXQL 5C9KA 3NCJH 3STLA 5C8JA 3G6AB 3PWVB 5LXGL 3H9YA 4NN6B 2XZAH 4OF6A 3MRKA 4ZO8A 4L29A 1WV7T 1NUFA 4NHCH 3WKML 2CMRL 1T7ZA 4NRXB 1R3HB 4K3EH 4JCLA 4R3SA 4PJBA 1AP2B 1E4KA 3TCLA 2WM0A 4ODBD 4POZC 4ELME 1XEDA 2BOCB 1F3JB 2R8SH 2OSLB 5EO1B 2CXGA 3T0EE 4ZS6D 2J88H 4LLYB 1QKZH 4PJAB 1WBYB 2IALB 1FYTA 4JJHA 1ES0B 3FHQA 5EOCH 4OJFH 3UJIH 4Z7NF 1S9WB 4Y88A 4JFDE 1JGVL 3ZZ1A 4RGNB 3H9HB 5ITBH 1IGCL 2PYFB 1IC5L 4YGVB 3Q3GB 1JE6A 3MRBB 5C07B 3ZTJH 1MCIA 3ZT7A 1S7TB 1KLGA 2I26N 2IPTH 2AJVL 3SDAA 5T1DL 1CDHA 1E4WL 4MA8L 4MAYB 3OSKA 1U91B 4P2CG 1KPRA 3P4OA 2BJMH 1KJ3H 3IDYB 5DUML 3KJ6L 2OQJB 4P23A 5IK3A 4C83B 3CD4A 3IGAA 1DQDH 1QSFE 3CFCL 3PDOB 3ZKMC 1TJHH 1XF5B 2Y06H 2M2DA 3GBMH 5FYKD 2J8UF 5EFIB 2Y6SC 5KZCB 1MJ7L 2F54E 4YHIB 4JPVL 4NN7B 2G9HA 3O3EA 4QCIB 5MI0B 2MMXA 1BD2B 4PJIB 4HT1H 4HIXH 4W4OC 1ZAGA 4OGAD 5GRUH 2GAZA 3SCMC 4JRYD 2IWGA 2CKNA 1UFUA 4HUMB 1KLFA 4GSDL 4JDTL 1G7JA 1BLNB 1XGRB 8FABB 2PW1A 1R3LB 2XWTB 3FJTA 3SBWA 1EA9C 1A6WH 1B0WA 2XIDA 4OF8A 2AEPL 3FZUC 5E9DA 1F4HA 1X5GA 4V1DB 5FGBC 3QDGE 4P9ML 3RTQA 2HMID 4LSTH 5C71A 5JQ6H 5MENE 1CD0A 3MV7D 1INEH 2R0KL 4XBGA 3RWCA 4N8PA 1KT2A 3KLDA 1P84J 1E27A 1WIUA 3DVNA 4WV1C 3X3FH 3CMOH 3WFEL 2ZUSA 2M26A 1QEWB 2CKBL 3S4SG 4WGVB 3GSVA 3QDJB 2IAMD 1M6OB 4LLQA 2I9TA 5IMMB 1OSZA 1S5HB 1A6VL 2CKBB 2OL3L 2E6JA 2OP4H 4XZUA 3L3JB 3LPGA 5F7LB 3RVWC 1DN0B 2OL3B 4PRHE 3K2MC 1HNGA 4PTUB 4G5ZH 4FMKA 4KPHH 1F8TH 3UTTA 4M5YH 1H0DA 4OSUL 3AU1B 4K55A 3VXUA 2EXYD 2H41A 3KPRE 5EN2B 4GQ9H 1MCOL 1KPVB 4AY0A 3CFKA 2VXUH 3RZCA 2GSGA 3QI9A 4IIQB 1MI5B 3RGVB 3OAZK 3VFGH 4RX4A 2DAVA 1CICC 3LQMA 4NQEA 2XKNA 5SWSD 1Q0XH 4XP1L 1Q38A 1KCVL 1UB6A 1U3ZA 3RNQA 4ZSOE 4J8RA 4WWID 3L95A 4M8QB 4XCFL 3GB7A 4OKVB 5BXFB 1KELL 2GYSA 4JM2D 1FGNL 5HHMB 1UT9A 3PP4L 2XTLA 5D2NC 3CMGA 1T21A 1OAQL 5E24E 3TJHC 1RJCA 4NN5C 3MBED 2AXGA 2XY1A 1H8NA 2QSCH 1EXUB 3LOWA 4G42B 3QFJE 1WGOA 5DO2D 1GCFA 3U4BL 3C2AL 4MXQD 3MREA 3O6FA 4KJYB 5GRVK 1NC2D 1QP1A 3DXAE 4I48A 3MNWA 1TQBC 4JM4H 1CE1L 3BSZL 3ZO0A 4I4WB 4PJ5D 4AL8H 5H35B 3CDCA 2Z4QB 1GGUA 3IXAA 1FE8H 4P2RD 3VWKA 2XYCA 5ALCH 1YEJH 4WW2C 1RULH 4BKLA 1UZ6E 1C5BL 4OLZL 3F7VB 2VXVL 3C60C 5F7YC 4FFYH 3P0YL 4HHAB 4PB9L 3D0VB 4P2OB 1YEHL 2APBA 2ICEB 3JTTA 2VQ1B 2WIMA 2OJEA 5CGYC 5I1GL 2GTWB 3NZHH 1T04A 1IGFL 1JI1A 4JFPA 5FKAB 1WT5C 2YUZA 4A6YH 5EORL 4NP4H 1DLHB 3MJ9L 3DX6B 4IBLT 4ZFOL 3C5ZB 2EEDA 3QG6A 3EYUH 5C0CE 2ZNXA 4MCYB 4BFBD 4ZFOB 4MS8C 4P3CH 2OTUA 2GEEA 4G8FA 5BZWB 2HT2D 4P2QD 1UH3A 2F8VA 2RFXA 4ODVH 2ATPA 2XRAH 3KNBA 5LQBH 4HWBA 2BOBB 3AREC 4NO3B 2KPNA 5K9QG 3C87A 3MR9B 4XBEH 4PJDB 5AD0A 2NX5A 4PJFF 3WS3A 4LCUB 4LQ1A 3I3DA 4ZXBB 1UJTA 4NIKB 3SDXA 4I3SL 4UT6H 4H0GA 4UDUB 3LZFH 4WEMB 4HLZH 5EU6D 2HFFA 3FMGH 4HH9A 4WIQA 1S7RB 4LLWA 4P5MB 4GRLD 3LS4L 1T7VA 1AQKH 2JJTA 1CBVH 3SDYH 2F53D 1AHWB 5F93C 3MLYH 1A64A 2A83A 2EE6A 3VXMD 2LVCA 4EQ3A 2BVPB 2IPKA 1ULVA 2A38A 2M1KA 4DWHA 2XOTA 4YBQC 4MJ5B 5D7JA 4IRZH 2JB6B 5KVEH 2G5BB 1CFVL 1VHPA 1BOGB 1MCLA 2DBJA 5I17B 5LWYL 1YEEH 4LF3A 4FFWC 1P1ZB 3NACH 3INUH 4I3GA 2J4WL 4XGZB 4L4VA 2DL9A 3GRWL 1BHGA 2IQAA 2Y07L 3PWUA 1MCSA 5A1AA 4LASL 1F6AB 2Z8VC 3QO1B 1P4LA 3FB7A 5EUOF 3HI5L 3NA9L 4L8SA 4NHUA 3FONB 1UXWA 4GS7B 1DVFD 5TQ0H 1X5LA 4PJGE 1G6RH 1GOFA 1OP3K 2E9IA 1Z3GL 3SDDC 4QHKJ 5EA0H 3CFJA 1QZ1A 4YXKH 3P9MB 3IXTB 5F71A 1MFBL 4EN3D 3V0VB 1MHHA 4JFQB 3S4SA 2NY1C 3MRMB 3AS3A 5IVXE 1NGQL 3ARGC 1KN2L 4HX1A 2VQUA 5IROC 1T1WA 5C0GA 5D96C 3VWJD 3MRRA 5J0BA 4UT7L 2XTJB 3BE1H 5KN5B 5DJZB 1TZIB 1WFNA 2HT3D 4OCLC 4WTWA 3H2WA 2CDFA 1T3FB 2X4RA 1WIOA 1LO2H 3LKQB 1JL8A 4HCRH 1FVDA 2YPKA 5LCVL 1NCWL 4QXTA 4UOJA 2EIZA 4M6AA 1B90A 5B8CA 1ORQB 4TTDD 5A3IC 5L9DH 4X83A 5AWNH 4O2CB 5GS2D 3OJMB 5D7IF 3ROOB 1NFIA 4P46C 3TO4B 1OGTB 2GJJA 1RSFA 2CIKA 2FWOA 4LLUA 2WANA 3MV01 4P5TB 1GAFH 3C6SB 4HUXA 5E2JA 3WN5A 2C4FT 1O7SA 1RFDH 4RMRA 4HS8H 3RUGB 4LSDA 3RRQA 1KEGL 4K8RD 2A6IB 2ZOKB 4EI6B 3QDMB 1XZ0B 1YA5A 1Y18B 3LD8B 1CL7I 3ALPA 3MJ8B 3QZWG 4WCYL 3BPNB 4M6OL 5ACLA 3ZDYE 2D7PA 4DKEL 3FB5A 1ZWIA 2GCYB 4HKJB 4P3DA 3L3KB 1P7HL 1YEDA 4AYFA 4TSBH 5D1QC 1TFHA 1UG9A 3O6ML 4FFZH 1MHEB 1GRWA 3TP4A 1ZT4B 1NDMB 3WO4C 1RV6X 1HE7A 4OV5B 2PCPB 3VFVA 4HXAL 5E6IB 4KH2A 2VXTL 4TULL 2W60B 1IL1B 4WFGD 2YUXA 4BFGA 1QBLH 5BO1L 1MH5B 1MPAL 3P73A 5C0DB 3NIFE 3LN4A 4MJIA 3TGXA 4MCZB 4FQIL 4PRPA 4F9LC 2HFEA 3ULUH 3PV6B 1I1AA 1RIUL 2G2RB 1L0XA 5BQ7A 2KL6A 4PY7A 2MPAL 4R2GB 3KYMB 1HEZB 1BP3B 1H3GA 4HKXB 1CF8H 1OM3L 1D5ZA 4RQQA 3H9ZA 1K5NA 1ZKAA 1P9MC 3HNVL 4LCIH 2J8UA 4X6BB 5F9OL 1V3MA 2C1OB 5TF0A 2DLEA 5JOEA 2WZPD 4OLXL 1PKOA 2IADA 2ZWLT 3H3PL 5LAXB 1BZ7A 1HXYA 2DLTA 1X4YA 3S37H 2QR0B 4JR9L 1UC6A 2B39A 2MQ0A 4K71B 4HG4J 2DM2A 4BYHA 3VXMA 3TBTA 4E5XA 5I66A 2VDPL 3N9GH 1L0QA 2GJZB 2UWEE 5IF0B 4PRAA 1TPXC 1AR2A 4HIJA 4QXUL 4ERSL 2ESVE 3WYRA 1N3NB 2FO4B 4CKVX 3W81A 3E2HC 3BVNA 4G9FD 5HYQB 4HBCL 3VG9C 3QHTC 4AEEA 3MUZ1 5B39B 4LCWA 4FQ1L 4OTXL 5JHDE 3MCKB 3QPQD 4PJ9B 3GSRB 1FG9C 5B4MC 3QIBD 2MWCA 1HZHH 3IFPA 1QVOA 3MX0A 4WU7B 3ROLA 3A6OA 1YJDL 1LO4L 3BQUC 2BVTA 1NDGB 4NNPL 1CK0H 1XF3A 3O9WD 2OCFD 4Z95H 3FO2B 1GVIA 2BNQD 1N26A 2BXZA 1A4JA 2GY7B 3C9NB 3KLHD 1CTOA 1GZPA 2DIJA 1YMMB 4KFZC 4DUVA 5E7BA 3CU7A 1T66D 5DYOA 4DGVL 2JCCB 3C8DA 3B3IB 2DLHA 4GW4B 1EO8H 4MZ2A 4C56E 1OAUH 5E4IA 4IOIB 3RY5A 2NTSP 3BIKB 4HS6B 1H5BB 3KPSA 1HQRA 4OLWH 5E2VL 4L4TE 3ULVL 5FF6A 4HZAA 1YNTB 1G0XA 1A5FL 1N8ZA 2QBWA 1UYWL 2PO6D 3IDMA 4WW2F 1J8HB 2O26U 4GJTB 4O4YL 3ARDA 1X5HA 1JMXA 5EBLB 5GGUB 4POZD 4YIQA 2XFXA 1MFDH 2VR9A 3OGCA 5DVNA 3WFHA 3I75A 4XCNA 3UTSA 3JXAA 5ERWB 1U3HA 1A7NH 3QJHB 4U1JB 1C7TA 4JB9H 1S7VA 3GSNL 2FSEB 1I9IL 4JDZB 5ELIA 3MROB 3GSNB 4NQTA 4UOW1 1Q9KB 1T1YB 1KJVB 5DVOA 3R1GH 5JLZB 1X5KA 4MNQE 1KPRB 5I8KL 1RZFL 2W0FB 4KQ4L 5FYJU 4XH2B 3TV3L 3MA9L 3Q5OA 3T0AA 2X1WL 2ENYA 1R24A 3ZKMD 1IGIL 2CLVA 4M9PA 3PWPA 4FXKA 1KIPA 3QZWA 2Y6SD 5K9KA 3V5DB 4RGNE 4X6DE 5T1MB 1FGVL 4QOKD 4Q9QH 2Q8BL 1R0AH 4U6HA 3BP7B 3MV9D 3OAYH 5C07E 4E42B 3FL7A 1ITCA 3HAEH 1MF2L 5CJQL 3SCMD 2B0SL 2LE9A 2ADIA 5DA0B 4DQOL 4Y16A 4Z7QF 5LKNA 2JKXA 4NNXB 5LG1A 3UYRH 2X44D 1IAII 1UH4A 4U1GB 3DLQR 1KLUB 2FZ3A 3FZUD 3U36B 1P69B 4I2XB 3EW3B 4QHNA 3U48A 2EDHA 4MMXC 3RHWK 5HYJD 3W11C 3D39B 1KSRA 1LWRA 4IRSC 4PJFA 4ETYA 4GW1A 1XIWA 32C2B 3BYYA 4PJIE 2FBJL 1PZUB 3ARFC 1NCNA 4F33B 4I18B 2NTFA 2O93L 1IFHL 5TF1L 5BCAA 5FGRA 3PDDA 4XWGH 4DEPB 4OQ1A 2NZIA 3FB6B 4QRQB 3WCYA 4I3RL 4LQFL 1JFQH 2RCSH 5DT1L 4KHXH 4YUEH 1I85A 4OCWL 3NTCH 5ICYA 4JJ5A 5L7XH 3D87B 3RVWD 4F7EA 5DD3L 5BRZA 4YHYB 1G6VK 1DEDA 5D8JL 3X3GH 3D3VB 1CGTA 1RURH 4LDOB 1H0DB 1YN7A 1YYLH 5CCKL 3TO2A 4LKCA 4FQCH 4ZDHA 1AGDB 5A2FA 1ZT7A 3BD4A 4OD1L 1GC1L 1NMAH 3M1BA 1CICD 1WZMA 1VA9A 3QDJE 2WBKA 5FUZH 4ZAKB 4FHBD 3SO3C 5CD3B 2RQ8A 3BDBA 3VI4E 3GBLA 3RNQB 1WWCA 5KSBF 4P9HH 1OTSC 4LHQB 4NQDA 3W0WD 3MZTA 1KCRH 4HGKC 1A1MB 1OVZA 4KVNL 2ITDB 3FQTB 3U0PA 1MLCB 3TJHD 3HZVB 4R4FH 3V5KA 5DMIL 2BSTA 5ID0B 4NQVB 1QFOA 4FOMA 4PJ7B 3LKRB 4U1MA 5HGHA 4APQC 5B38G 4HJJH 3BZFA 2V5TA 4L9LA 2YMXH 1N64L 3O6FB 5D1XA 1DQML 2J7LA 3VXPA 2R4SL 1NGXA 5F6IB 2OJZL 3A6BH 2BY2A 3TYGL 2V7NB 1XGTB 7FABL 4NWUL 3C60D 5CP7A 5CEXB 5I15L 4N8VG 4FP8L 5HHME 2R1WB 5CJOH 3OB0H 5CGYD 4HAGA 5D2LA 4XNYH 4LPTA 5SX5K 3WIIL 3OF6D 1I7UB 4LVHC 4HFWA 4DKAA 4LIQE 2DMKA 4NDMB 2JJVA 3TLRA 4QHMB 3UTZB 3BN9C 12E8H 2QJDA 4D9QD 1CE6A 3H3BC 4MS8D 5DS8A 4A2LA 3L3IA 4G6KL 4N0FB 5F7KC 1QYGH 5H2BB 5DXWA 1FSKC 5IEKB 1ZHKA 1U8IA 5DJ6A 4MHHG 3QIWC 4XVSL 4NJAH 4JHBA 2Y5TA 3QUYC 4NZRH 3HNTH 5DUBA 4AG4H 3ARED 3GI9H 2AQ2A 2R0ZL 3UJJL 4D9RE 4JFED 2O5ZH 1X9QA 2BRQA 3QXAB 5DVLA 3VRIA 1T1ZB 1ZLSL 1R3KB 3PL6C 1NMBH 4W6YB 4MQ7A 1RK0B 1P7QA 4HH9B 1H9VA 4X5XA 3UDWA 1T22B 3PGFL 4PGEB 1I4FB 2D0GA 1FCGA 4MB3A 3V4UH 2Z35A 5AZ2L 2DWDB 4XC1H 4Y5YB 3RI5K 4LFHD 4Y4KA 1CU4L 3DO3A 4W4OA 2LV4A 4YBQD 4X7SL 3RPIB 2R69L 3HUJB 3MCG1 1B0GA 1MIEH 1HI6B 1HK6A 4LLVB 2JJWA 3O3DA 5MP6H 1MJUL 4LKXB 1MCJA 5D72L 4GAGL 4JRYB 1UZ8B 3RL2B 1QSEE 5E8OB 2DD8L 4FFWD 3CLFH 4R0LB 4AEHH 3BFOA 5C0AD 5L2KD 3B9EA 3TNNB 1HQ4B 1XGPA 5DK2B 1MCHA 1NUDA 1CFSB 2CRZA 3I2CL 2NW2B 3FKUS 2J3SA 3BKJL 4ZUWA 4LIQH 1U8QA 3DURB 5E5UB 5IR1B 1KIUA 3RIAF 4NHUB 1B9ZA 5CMAA 1NFDA 3MV7B 1YEKL 5GJTH 3NVQA 3QHZH 3RFZC 3FO0H 3FN0H 4M03A 1FORH 4OM1L 4TNVK 3SDDD 4IMLB 4XVJH 3IFNH 3IFOA 4YR6B 1CS6A 1X5YA 3ISWA 4Z8FL 1F58L 1KENL 2IAMB 3DRTA 3PXHA 1NGYA 1QFHA 4M5ZH