3FO9A

Crystal structure of aldolase antibody 33f12 fab' in complex with hapten 1,3-diketone
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
219
structure length
219
Chain Sequence
b'ELVMTQTPLSLPVSLGDQASISCRSSQSLVHSYGNTFLNWYLQKSGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQGTHVPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin IGG2A - light chain
publication title Direct observation of an enamine intermediate in amine catalysis
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 219
sequence length 219
chains with identical sequence L
ec nomenclature
pdb deposition date 2008-12-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo9A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo9A01
3LPWA 2BVPA 1TIUA 4KJPC 1TETL 3MRMB 4G9DB 5CSGA 3GDBA 4NFDA 4XCCL 4WHYG 3QFJD 4PJAA 5INCA 3RFZC 1FZKB 4A2MA 4Y16A 5ADPH 5FOBB 2ZCHL 3EDDA 1JN6B 3KPNB 4WW1A 1V3LA 1Q1JL 5F7DB 3RA7L 1DQLL 1CGUA 3GIVA 2A0LC 1HINH 2V17L 1RZFL 4TVSa 4GLRH 1WV7T 4BUHA 1UFUA 1W8NA 3SDAA 1RULH 5K33A 4ZPVA 4XMPL 3T3ME 4LASL 4X99B 5DJXA 1WBZA 3PABA 1CI5A 2M2DA 3BT2L 4L5FL 1HHKA 5D93C 3HUJB 4BQ6A 5DHXB 3M45A 3U0WH 3U4BL 4NDMA 2FH6A 4C83A 4FOMA 4WWKA 3RGVA 5IG7A 1E4XL 4FQCH 1AGDB 3FB5B 1AGBA 4JKLA 3IXTA 1I7TB 3QDJB 1YEJL 5HTSA 3BWAA 5AZEL 5KSVA 1IC7H 1KXQE 2I07A 3BZ4A 2LU7A 2AXHA 2BNRD 1Y6KR 2VLRB 3L6FB 4O51B 1KNOB 1DQMH 5E9DE 3WDHA 4EI5C 4F9PC 3G5ZB 4GAJL 3KLSA 3U0TB 3VG9C 3EYVB 4U6YA 1NDMA 5JW4Q 2H8PB 2VDOL 1KLUA 3OAZK 2E3VA 5GPRA 4ZMAT 3AAZA 4LEXL 4LDLB 5HHXH 4JZOB 2YUWA 5DQ9B 5SWSB 5GSRB 1CGYA 2CIIA 3O3UN 4QOKB 5I1LA 2CLZB 3EYQC 5IMOA 3K3QA 1AR2A 3ZL4H 1HHHA 2P5WA 3I50L 3I6GA 1D5ZB 1I7UA 4JFYB 1MNUL 2VH5L 1Q8MA 1YEFL 2A83B 2Z0BA 1MWAH 3MRJA 1OQXA 5D6CB 1NCAH 2IGFH 3O2DA 3R1GH 3PHQA 5JXEC 1KEML 5B39B 3MFFB 1N0XL 4UU9A 2VXUH 2CLRB 5IW1A 3C2AL 1J5OH 1YQ2A 3FN9A 2CRIA 3MYZA 3VJ6B 3E2HC 1A7OL 1N26A 3F65A 3MR9A 4NUJB 3K1KC 5FV2A 3FN0L 4MD5B 4DEPC 3MODH 4LCCC 4ODWA 5C0BD 4JZJA 1SJHB 4OAWB 4E41B 5DK2A 4MQ7A 4JPVL 3SDXA 1BOGA 5GS1A 1T4KB 3I9GL 4NQXA 1AXIB 5DJCA 3ARGA 1ZLWH 4PRBA 1TXKA 4YHKH 2Q86B 2ZUVA 4PP1D 1V05A 1N6QH 4JKPL 1KIRB 2BSRA 1HQRA 1UB6A 2UZYB 3L3IB 3RI5F 4JANA 5I6XC 4R4BA 2VDRH 4UILL 3KPQA 3OAUH 4Z5RB 5ALCH 2NY1D 3E6HA 5DD1H 1J05B 4H1LA 5DLML 3KYAA 4KGJA 4RWHA 3SGEH 1R0AH 2YD9A 5D7JB 5I71B 4M8QA 5JMOC 5BZWA 4UQ3A 1U8IB 1AHWB 1M7IB 3ROOA 2BVEA 1FC1A 1F11B 1P4LA 3VW3L 3W11C 3ARRA 4M1DL 4QRPA 1MCWM 3OKDB 3WN5C 4G5ZH 5EU3A 1IBGH 1YMHB 2R1WB 4S1RH 5KOMC 1S9XA 2J4WL 3BESR 2L0DA 1V3MA 1CVRA 2J8UA 5EZLA 4P2RB 1XGQB 2H41A 5DO2D 2DS4A 1R3LB 4YBQD 2AK4E 1ETZB 5JW5B 5MEOA 2YPVL 4PLJC 2R0WL 1F4HA 1MLBA 2VWEE 5KANI 3AM8C 3FT3A 1E6JL 4MXVE 3K4AA 3TWCH 3Q5TA 5C09D 3TVMB 3HN3A 4H0IA 4YGVA 3VGBA 2VUYA 4HS3A 3PWUB 4HAFA 4G7YH 1YEEL 1EBAA 3BZEA 3TN0D 5ADOL 3WFBL 3A0OA 4M48H 1TTUA 1GGCH 1YYMH 1YEGH 2JJVA 2H2SC 1BBJA 4ORZC 3PJSB 2E27H 4G6JL 3VDCA 3C5JA 5C2BL 5GGUA 3QDGA 1Q72H 1ZWIB 1L9MA 4KI5D 4MGXA 4KTDH 4K8RD 2AI0L 2APVA 1U6AH 3QIUC 1H3PL 1RSFA 5EH1A 1Q9WA 5J57B 1NUGA 5FHBL 1AKJA 1E28B 3SGKA 4LKCB 5B3NA 5MENE 3ZE0F 2DQFB 3U7AA 3N50A 5KANG 2KBGA 3O3BA 3SE3A 5E5UB 4HEME 3TBVB 4I3GA 4OZ4B 3JUZA 4H5SA 3HC3H 4Y5XC 3B9KB 3GSXA 4HMCA 3JZ7A 2XNAB 3B2VL 4PGCB 4D94A 1TVHA 1A1OA 1S8DA 5ICZB 4XVTL 3VFPB 4N0CD 3K8LA 4F7MA 4UBDD 2C7UA 4PJDF 2D4DA 1X5YA 4WNQB 1NC4D 2J88L 1UJTA 2H32H 3PGDB 3MGTB 1MH5A 3EHBC 1TJHH 4X4MA 2Z92A 2DWDB 4P57A 4DFHA 4KI5F 4TUKH 2AEWA 5JOFA 2E6QA 1MCIA 3L5HA 3JV0A 1NCCH 5E95B 5I9QB 1HH9B 2NLJB 2EKJA 3CX5K 2NW2A 1OD9A 3I6KA 4ZFGL 1FNSL 5I66A 2PNDA 4KAQH 1ZT7B 5I1EL 1BD2E 4LL9A 4AL8H 2ADIA 4UT7L 1GGYA 1MJ7H 4KZEL 4K3JL 2AEIT 4UDUA 1Y0LA 2FJGA 4LCWD 5DHVA 5TE4L 5ACZB 3L7FB 4MNQB 4NQDB 3MXVL 5GGSB 2QLVB 3ARDC 5LWYL 4IS6B 3OR6A 5I8KH 3TA3B 1PY4A 2UYLB 1QVOA 2HN7A 1UWGH 4U1NB 2SEBB 2O5XL 3P73A 2BOCA 5J1SC 1P2CB 1H3GA 2VXVH 4I2XE 5C08D 3IU4L 5IV2B 1WFOA 3P11H 1MHPH 5MP6L 3UAJC 4OV5B 1KN4H 3AY4A 3FQRA 5FAAA 3MLZL 2F74A 5FUOL 3T1FB 2D0GA 5A16A 5AWNL 4CN4A 5JHLH 3DI3B 1KCSH 2P5EA 5TH2A 1U2CA 3QDJE 4PJEB 5T3XD 3S37X 4U1SA 1E27A 5MHSD 3O4LD 4F3FA 3IDUA 2EEAA 2G9HA 4PJ8C 5EUOA 4P2QD 3WJJC 5ITFB 1T66C 1T5WA 4QRTB 2VO5A 3GM0A 3AGVA 4DZ8A 5IP4A 1EAPA 3BIKB 3GEWB 4LIQH 1B2WL 3GJFA 2G75B 4WO4B 4QRRB 2AJSL 2OP4L 3FRUA 4OLZL 4RGNB 5C71A 5L9DH 4I18C 4QHNB 5ID1B 3MUJA 1T83A 1XF4B 2VMFA 4KRPD 5GS3A 5FB8A 4UV7H 4O2FB 2HVKA 3ZHLA 3RU8H 5BXFA 3BXNB 4U1JB 3TO4B 1RZJC 5CEYA 3T1WA 2EYSB 5I1HH 4HIXL 3TZVB 2RBLA 2WBKA 4UZGA 4HZAA 4M7KH 4ZD3H 5GGRA 3CFJA 4Y2DA 2CK0H 2HFGL 5E2TH 4OCSL 3QEUB 1KOAA 4R6UA 3U4AA 4JN2A 2ENSA 2XTJD 2VERN 5DD0H 4Y89A 4RWYH 3SKJH 1FRGL 4XP1L 4ERSH 1HXMB 5DQDH 3RL2B 1RUQL 2AJXH 3W5MA 3I75A 4HS6A 4GKNA 3RWJB 3FB6A 2BX5A 4X7DC 5E94B 3FQWA 3O8XC 2PO6D 5ID0B 2VXSL 1CDUA 4F57L 4JVPA 4NT6B 4EUPB 5DK3A 2P8PB 2DQIH 4YXLL 2Z31A 4MMZC 3WIFA 2D31B 3S37H 4R96B 1GOHA 1EEUA 4F8QA 3WYRA 1T22A 1NAMH 4G9FD 3P4MA 1P4IL 2DQDH 2ZUTA 3D85D 1J0JA 1QG3A 3K2UH 1IQDA 2YD6A 4M9OA 4ORGA 5EBLB 1KBGH 1BREA 2Y4SA 1MIML 2QSTA 4OGZA 4PG9B 1XGYL 1J88A 3OKMB 4XMLL 1S7RB 5I75C 1KIPA 1UB5B 1Z9SA 3IJYB 4F58H 5D2NE 4P3CH 5D7LD 4P48A 1J12A 2XWJB 4R3SA 5E5MA 5TGBA 1AE6H 5E00A 5C0AA 5CEXA 1OOAA 4APQD 1OAQH 5BS0B 4Y8AA 3MRHA 2FEDC 5EU6B 4XXDA 3UYRH 2EYRA 5KSBE 4NRYA 3IDNB 1QBLH 3PL6A 4I4WA 1QFWI 5I1IL 4YEEA 1XR9A 5ENWA 3AXLB 3U2SB 3C5SA 4HQQL 4M6NH 4X7FC 2PYEE 3T2PA 1U93A 5K9KA 3QI9A 1MCFA 4PJ9A 4YFEA 2FJFB 2IANE 3HZVB 4RA3A 4DN3H 2ZUQB 2EXYD 2R9HC 1VGKB 4FQIH 4ELMF 2QL1A 4EN3C 5HDBE 3RWHA 4Z7VB 3BJLA 3HC0B 4XPHL 1GC1C 4UAOC 2BVOB 25C8H 1AY1H 1J10A 1QRNE 4LSQL 3WFEL 1CL7I 2IFFH 4RNRA 3UPRA 3ARBC 1AO7A 4KKLD 3HG1A 1XGUA 3QO0A 2OI9B 4L9LA 3C9NB 3TFKC 1C1EH 1MFEH 2YXMA 5IB4A 4DCQA 3DX6B 5GS0C 1A1MA 1LO4H 1MHHB 4RISL 4XP6L 5CGMA 4XMKL 4J3XA 4U6TA 5GS1C 5CD3B 2GT9B 5E08L 4P46B 3TPKA 4NZRL 1EFQA 4OFPA 5IVXE 4HIIB 1QBML 1J87A 3BP7B 1DFBL 1CLCA 3ZLQC 4NO5B 1BWWA 1G7PB 3QAZC 1P6FA 3CLEH 3DV6A 2FIKB 3PWPA 2IBGA 5GGQH 4TNVK 2R2CA 4OGXH 3W39B 5D93B 5ISZA 3FOLB 4HBQA 5ADPL 3GFUA 4JO2H 1X3DA 3EOTH 4NKOA 5JXAH 4F7TA 2XIDA 1MIEH 4LNRB 3V8CA 4TRPL 4MXWH 4OBSA 4KMTH 1HINL 3QDMB 3B6SB 1A6VH 1FDLL 4U0QB 3FB8B 1K4DA 3K81A 4PJGF 3C60B 4Y19E 4QXUH 2P45B 1HK6A 1IEAB 3DMMD 4IM8A 1XCTA 2CH8A 3I84A 1CTOA 2GAZB 4B53A 4EI5B 2CO6B 4YHIB 3VG9B 2IF7A 2OTWB 3U4EB 3DVIA 2OTUA 5HDQL 4N5EC 3MACH 3CH1B 3U0WL 3FQTA 2OSLA 8FABA 1JK8A 4KMQA 2XPGB 5DYOA 3KPRB 4DK3A 4FQCL 3FRPG 5LJYH 4E42B 4LMQI 4JFDB 5GRUH 1DBMH 1G6RA 2YA2A 4P4KD 1OP3H 1JV5B 3BAEH 3MV9A 4KKNA 4PGEB 5CKGA 2XA8H 3CVHB 2NPLX 4V1DD 3GUTB 4TUOA 4YNYB 4MNQE 5D1XD 5E7BA 2FGWL 3GO1H 1PZUB 5E8DH 4WV1C 5BOPA 3UTZA 5ALBH 4LF3A 5FCSH 4NCDA 5EO9A 1J1OH 2G2RB 4XP9H 1N4XH 4ETQB 1AO7E 1VERA 5CBAB 3E2HB 4AH2B 1IARB 3EYFA 5HHXL 3SN6N 3MO1B 3VXRA 3VGAC 3GSOA 4LCCB 4X6EB 5EIIB 3TH2T 1I9EA 2MSPA 1QTYT 3F7RA 3QNXA 4MZ2A 1I3RA 3ZL4L 1YNTA 3MJ9A 3BHBA 3UJJH 3JBG7 1TJGH 5A2JH 5JPNB 4DTGH 4WDIA 5KSAC 1JPSH 4S1DD 5TE6H 5H35A 2EE6A 3HZYA 1FO0H 3MCG1 3ARSA 1KT2B 5F9OH 1SJVA 1NCAL 4FXKA 3R1GL 2OJEA 5B22A 3VXSD 2VXUL 4XTRD 1W8OA 2R2BB 4ODXB 5D1QD 3OJ2C 1N59A 1RZIB 5IR1B 5JR1L 1HEZB 1YEHH 2EIDA 1PD6A 2YUVA 4RAVB 4D0DB 4NRXB 4U2ZA 3LB6D 3S3JA 2B0SH 2QQKL 1EPFA 1DBJH 4X8JA 1IM9A 4Q0XL 4YHKL 1N8ZA 1DEEA 5CUSL 1AQDA 1JF1A 2E9JA 1N6QL 4JRXE 2P8LA 3WN5B 1A9EA 5T1KD 1KN2H 3ZDZF 4AENA 5ESVB 5L2KD 2HT4C 4PJ5B 2P48B 2VDRL 1ZV5A 4JY5H 2DQHH 5EIQA 4XZUA 3OAUL 3O3DA 3KLHD 2DTSA 1NEZA 5DD1L 5JQHC 4OCLC 5HGGS 2BSED 1S7XB 2IPTL 3BPOC 4PB0H 3L3OB 4ZODA 1R0AL 2AXGB 3RIAF 1Z5LB 4BH7A 2NZ9D 5DR5H 4BUGA 3WKMH 3CFEB 3GSQA 4N0UA 3SJVB 2FR4A 3LKSA 4EDWL 4IHOA 2OR9L 3TH4T 1JZ8A 5JPMB 5C6WH 1CT8B 5I74C 3VFRB 1LK2A 1MCPH 1WSST 4XCYB 1RAMA 5C0IB 3VWJC 2LFGA 4PGDA 1IBGL 1S3KH 1A6AA 3QIWC 4S1RL 5JIHA 2DMBA 5DD5L 3LKOA 1B0GA 5EWIH 1KLFA 1VFMA 2W9EH 1ZS8B 2XOTA 1WF5A 3HE7B 5HVHC 2ADFH 1BMGA 3FOMB 1XH3B 2DIJA 3HPJA 4OKDA 4PJFA 2WWKO 4ONHB 1BPVA 5C0GB 3JSSA 3FN3A 1S9VB 1F3JB 2XWBA 5E2WH 5EOCL 4EXPX 4Z78A 5BS0E 1CE6B 1KCVH 3PP4H 4HCRH 4XPBL 4G7YL 3PWVB 3IAPA 4NJ9L 1A2YA 2FSEB 5LXGH 4M48L 2EEDA 1YYML 2IH1B 2VE6B 1Q0XH 3ESVF 3MA7A 1A4KB 5K9JH 1OAKH 2IC2A 1LE5A 5DK0B 5LQBL 1ZEAH 4JM4H 1KENH 2E27L 3EJYC 4QHMA 4Y5XB 1MI5A 1QLEH 1RIVH 1I9RL 1PYWA 4BK4A 3SDCB 1X5KA 1T03H 2V5MA 1FFNA 2QKIA 2N56A 1F4YH 4MNHB 5LCVH 4FG6D 2X1QA 3FQUA 1U6AL 4MCYA 3ZE2E 3WUZA 2V9RA 4NC0B 1RZKH 4KRNA 4GQ9H 2E9WA 3C8DA 4N0FA 5C92A 2FO4A 2XXCB 4X4XA 1WBYA 5KVFH 5E9DD 5GRXG 4UDTA 3L3JA 4DVBB 3OB0H 1RZJL 5JZ7C 3TNMA 3MMEB 4H8WH 4NO0A 3K8MA 2R8SH 1KGCD 3LV3B 1YUHB 1R3JA 3HC3L 3NH7L 4C57C 3CGTA 1Q9OA 2VUOA 1ZHBA 1MCWW 1A6UH 2Z31C 4YHPA 3S4SB 2V2TB 4TSCH 6FABH 4DAGH 4R7DA 4H25B 2DLHA 3SDDD 4C56D 1O7SA 4Y4HD 3ARDB 2A74A 1ZHKB 1GJIA 4IMLB 4XHJC 2H6PA 3O81A 2W9DH 1C5CH 1XGTB 1TLKA 4YX2H 4MCZA 5BQ7B 5E7FA 1FHGA 4TUKL 5KZCB 3ULUH 2ADJA 2C3GA 1NCCL 2FWOA 2VL4A 4CADA 1IGCH 3T0EA 3RKPA 4RDQF 3LRSA 5C0CA 3CXDL 3X14A 1UZ8A 2C3HA 2I60H 3U1SH 3OJVC 4AL8L 4ZSOB 4GXUN 1MJ7L 3O3AA 1NSNH 4LPTA 1E4WH 3LN5B 3CSYA 4NPYA 2HAZA 1GCFA 4KVNL 5I8KL 3UBXA 3MV7B 3ULSA 4PRNA 5DEFB 4DWHA 4PJ8B 1I1CA 3VWKD 4OD1H 2AK1H 4FA8A 2DBLL 2X41A 1Y6NR 4GRLD 3WFHB 5GGRY 5I0DA 1FG2A 3HI5L 2VXVL 2EE2A 3NFNA 3ARVA 4ODUB 3P11L 3H0TA 1W72A 1XF3B 2HLAB 1U8LB 1P7QA 2W0FB 4BFIA 1GHFL 4Q9RH 5JOEA 3Q3GB 3RL1B 3BISA 2BVPB 2GSGA 2F5BH 2FB4H 3RVUD 4KQ3L 1T2QH 4Z7NE 5D2LE 4PJ7A 2ZCKH 4U6VL 4GFTB 5INCB 2W60A 2NY5H 1MI5E 4L9LC 4UB0L 3IAQA 2WBJD 3GJFK 5D5MB 1T0PB 1I3VA 2NY0D 3KPSD 4JEGB 4BSVA 5IM7A 4FTVE 4HWNA 3V79C 4DZBA 5B38A 1GC1L 2V2WA 4P5TD 5A2LH 4Q6IA 3D3VE 4LIQL 3GIVB 5ACLA 1ZANL 2BVUA 4P0DA 4MXQD 4AT6B 3MYJA 1F6AB 4JKWA 2N4IA 3FRPA 2CDEB 1MWAA 1RZKC 1TJIL 4LGRB 4H0HB 4DJMA 1JBJA 3CCHA 3O8XB 5L9DL 3GRWL 1YQVH 1CICA 4H88L 4BQBA 2YD3A 3WNNA 2AK4D 4UV7L 5DJXB 5GS0L 1WBZB 5F1IA 4TULH 4O02L 1HHKB 4H8WC 5I1HL 5B8CA 4M00A 1JRHH 4I48A 4HGKC 4M7KL 4NDMB 4ZD3L 4R4FH 3DX7B 5EDXA 1DEDA 4WWKB 1BJ1J 3RGVB 1QSVA 3VXUA 3L95B 5IG7B 3V7AG 5HI5D 5DD0L 5I75B 2BY1A 4RWYL 3SKJL 4NGHH 1YYLL 2B1HH 3BWAB 4ERSL 3MLPA 2AJXL 2F15A 3EZ8A 3ELAT 4D0CB 1SJEA 2I07B 3X3GH 3DO7A 4OF8A 3BZ4B 1X5JA 1RZ7H 1MCEA 4I5BA 2YEZA 3L1OL 3UYOD 4DGIH 5C0CE 2D7NA 4NQUA 2DQIL 4GBXA 4HD9A 4TQEL 5ITBH 4N1HB 3IYLW 3V5KA 3S37L 4U6YB 1NDMB 1NAML 5KVEH 4Z7OF 1KLUB 2DQDL 5H8DA 4P49A 3K2UL 1KB5H 2NTSP 2QADD 4YHZH 2X4RA 3AAZB 3IXAA 3S7GA 5CLWA 1CCZA 3SE8L 5MEND 4JDVA 4XVUC 5KAQF 2VLKA 2CIIB 4JFEE 5I1LB 1EVUA 3ZT7A 1MAMH 5IGXH 4F58L 4P3CL 4PJCE 2FD6L 1ZGLA 1UWXH 3PWNA 5FHAL 1HHHB 2P5WB 3I6GB 3WS3B 1AE6L 1I7UB 5DXWA 4X6BA 4EN3B 4AMKH 2CGRL 4N1CA 3PIQA 4ISVA 3UYRL 3KYNB 5D7IB 3KPLB 3MRJB 4J3SA 1KJMB 4X6CE 4NBXB 3IDXH 5EORL 3VXME 4XC3H 3PHQB 4LLQA 5SV3A 4UU9B 1HI6A 3D2UD 3F12A 4J1UA 2HTKD 2FBJH 2ZNWA 4IRJC 2CXGA 4NBYB 4WCYL 4ODWB 1D5MA 4JY4A 4D0BA 1V3KA 2A73A 4Z7UE 5DK2B 2HA1A 2OS7A 3SDXB 1WGOA 3QXWA 1BOGB 5EULV 5GS1B 1IKNA 1QSEA 3G5YA 4NQXB 3VD4A 2ARJA 5DJCB 1BD2D 3ARGB 1EBPA 5J9PA 4PRBB 4FQIL 4YAQA 5CZVH 4U6XA 4ZTPL 1RV6X 4P2OD 4PD4K 1ZGLP 2Y06H 3D69A 4AY0A 1CXIA 3RWFB 1AY1L 1H0DA 4M3JA 4NHCL 1B4RA 5DGRA 4CBPA 4UQ2A 2BSRB 2PETA 1JGVH 1UB6B 5F6HI 3WCYA 3Q48A 5C0ND 2QV2A 4YPGA 2F54A 1C1EL 3E6HB 4H1LB 4JRYE 1GRWA 2R2HA 1LO4L 4G6AC 2E8YA 4A2LA 5T5NF 5BZWB 2NNAB 1ZAGA 4UQ3B 4OF0A 4ZAKC 3CLFL 2O26U 1T1ZA 3H6JA 3ROOB 3P0VH 1AC0A 3JUYA 1MUJA 4OLYL 4QRPB 4Y2OA 3QDJD 2XY2A 5DSCA 3I6LE 5EU3B 1G7QB 5E2JA 1S9XB 4MQSB 5GGQL 2J8UB 4BQCA 3UEZA 4TNWF 4XXCA 3MV01 4O00A 5JXAL 4NOBA 1FYTA 5TFSH 5MEOB 1HZHH 3P4LA 2XACC 1MLBB 4MS8D 5I19H 1QLRA 1QFWH 1VFBA 3FT3B 1A6VL 4FFYH 1HSAB 4L9DA 5CGTA 3SE9H 2ZSVA 4YGVB 3TBWA 4OZIB 3TF7C 4OQTA 1UH3A 4QXUL 5SWSD 4G8EA 1NBZA 3IGAA 1IAKA 3H9HA 1S7WA 15C8H 2AABH 3OMZA 2H1PH 4KK6D 4PJXA 3HUJF 4WUUE 1QHPA 2MMXA 4ZPTA 1BBJB 2VIRA 5HYJA 3C5JB 2Y7QB 4Y4KD 4MNGA 1DUZB 1PEWA 1NBYB 1INQA 3IS0X 1Q9WB 4TVPH 2DTMH 4M7LL 3KHQA 4U1KA 5GRUL 1DBML 4RIRA 4FQXA 4U3HA 3QYCA 1FORH 3BP6A 4XB8A 1EJ6A 5J6HA 4N9GA 3O3BB 4OIIH 3GHEH 2VC2H 4E41D 3CAFA 3VCLA 3M8OH 1AGEB 3LIZH 2VDQL 4BZ1L 3GO1L 5E8DL 5EIVA 4HGWA 1KC5L 2VQUA 3A6BH 4H5SB 5ALBL 4YDKH 4U0RC 3O6FA 1CXHA 1J1OL 2UV3A 1FZJA 1N4XL 1NCWH 4XP9L 2K3TA 4RRPG 1TVHB 2X42A 4G6MH 1A1OB 1S8DB 3LRHA 3CD4A 4M61A 3B9EA 4F7MB 1RUKH 4LSRH 3RVTD 2C7UB 3F58H 3QXAB 4M3KB 4OLVH 3LKPB 2GTWA 4J4PC 3VGDA 4Y1AA 2Z8RA 2ZPKH 1MH5B 4M6MH 3QG7H 4OZHA 4P57B 3UJJL 1TJGL 3EO1A 5JOFB 4DTGL 3X13A 1JPSL 5TE6L 2J5LC 1ZVSA 3OKYA 2NW2B 1FO0L 5I66B 1KJ2A 2VR4A 1AP2A 5F9OL 1QFWM 4JFPA 2AJYH 4HMDA 5E8PA 1FAKT 2NW3A 3S8WA 4GXVL 3C08H 4I3RH 4MVBD 2UWEA 3OG4B 4KRMB 5CSZA 1Y0LB 3BDYH 2FJGB 3W81A 5DHVB 1GZPB 1YEHL 1JZ3A 3BPOB 5IB2A 1AQKH 3OR6B 2IAND 2X70B 3LN4B 4UOW0 1FYTE 2B0SL 2HN7B 5BV7C 2B8OT 1DBJL 4O58H 3RY5A 4Z0XA 1C5BH 3P73B 2BOCB 4OF7A 4PRHE 3WNLA 2FNBA 4UV4L 4IJ3C 2MPAH 3WJLC 1E0OB 1YMMB 1B9ZA 1QRND 2ARWA 4L4TA 3T0EC 1WVZA 4KJWC 4C55A 3W0WA 3RZCA 1ADQA 3FQRB 3TVMD 1YY9D 4JM2A 2F74B 5GGTH 2WV3A 5A16B 1KCUH 5I30H 5F70A 2D7MA 4JY5L 3D18A 2R0LH 2DQHL 2P5EB 4HUXA 2UZIH 5TH2B 4K71C 3QPQC 5ANME 5ICXA 4AM0A 3DARA 4U1SB 4XCNA 4LAQH 4PB0L 4WHDA 1E27B 3K1DA 4FQJH 5DR5L 2G9HB 1EFXA 1FL3A 3RWIA 5EUOB 2CUHA 4YWGH 3P4NB 3WKML 2WQ8A 1HCVA 4QF1A 1X6NA 1T5WB 3ARED 5FYJL 2WWMC 4ZS6D 4DZ8B 4EKXA 4OCMC 1EAPB 4ZNCD 4GUPA 3GJFB 4W68A 1KELH 1MCPL 3R8QA 4O2EA 1HH6A 3MLWL 3QQ9C 3HR6A 2E6JA 3O2WH 5DMIH 4U1LB 1OCWH 3FRUB 2GIYA 3EGSA 1UG9A 2HVKB 1F2XK 4PLKC 5BXFB 2OQJA 2ADFL 2E7HA 4PGJA 4AEEA 3GGWA 3O0RH 4G8GA 5F8QC 1KPRA 4HZLA 5GGRB 2IPUG 4Y2DB 1IGJA 5J3HC 5DFVD 4Y19D 1PJ9A 3CPLB 3H8NA 2ZWLT 5D7KE 2DJSA 2X9YA 4LIQE 5D7IE 5EOCJ 4EXKA 4Q58C 4FFWD 5LXGL 4HIEA 3Q1SH 4NO3A 4WU7B 5IWLC 3I75B 4HS6B 1Q0XL 4GKNB 3FB6B 5K9JL 1YC7A 3FQWB 3UTTE 5DRNA 2RCSH 4PV8A 2L4OA 4JM4L 4GKSA 4P9HH 4F7EA 1QLEL 1RIVL 2Z31B 3WIFB 2VDPL 3RWDA 5BVPL 3U48A 1T22B 1TVDA 1F4YL 3P4MB 5LCVL 1MELA 4AEIH 1I8MA 3V4UL 4ORGB 1RZKL 4GQ9L 1XF2A 4BKLA 5FYKH 1QPXA 1TENA 4NQEA 8CGTA 1VFAA 1KIPB 4GW1B 1OP5H 4R7NB 4MNQD 5KVFL 4NQDD 5GRYA 3QRGH 1MQKH 1DBKH 3TA3D 3OKNA 4R3SB 1MAKA 1D7FA 4U31A 5JDJA 3BGFB 4H8WL 5IQ9A 5I1CH 4NQVA 5E00B 2VZUA 5C0AB 5CEXB 2R8SL 5EA0H 1SM3H 1G9MH 4U1HA 3MRHB 4DUVA 3W0WE 5C0RH 1A6UL 2EYRB 4TSCL 3S88H 4G8IB 1QZ1A 4DAGL 3IFPA 2YRZA 3PL6B 4NN6C 3GIZH 4I4WB 1OSPH 1XR9B 4GG6E 5ENWB 1JF5A 5TF0A 3VI3E 4HFWB 4NQCE 2W9DL 3WUWA 2VAAA 1FBIL 4YX2L 3C5SB 1U93B 4WHTA 1NKOA 2NY2C 5K9KB 4NFBA 4PJ9B 1RJLB 5D72H 4L8SC 3U36A 1Z9LA 4AIXA 1IGCL 1CFQA 2I60L 4HW6A 1MHEA 3QSKB 4DK6A 3U83A 2PR4H 4KDVA 3JWOH 4GMTH 5E8OB 3D39A 1LDPL 4GW4B 3UPRB 4RNRB 4JZNA 1ZKAA 2JB5H 2VITA 3PGFH 3HG1B 1XGUB 3LKRB 4FZ8L 4WO4D 3QO0B 4L9LB 3WLBA 3GSNA 1DLHB 1FE8L 3QUXA 2BFVL 1MY7A 4OD1L 2AK1L 5E2UH 1LK3L 4DCQB 3IFOA 2HFTA 1I3UA 1XAUA 1KJ3H 4I0PD 2BNUA 2NX5A 3GHBH 3PGCB 3QJHA 4GAYB 3VH8A 1DQDH 2CDGB 4Q9RL 1BF2A 3QXUA 5J89A 4JB9H 5K59E 3P0GB 3RVXC 5TPWH 5I1GH 1IEHA 2F5BL 4PJEF 4WFFE 1U58B 3KPOA 2VLMD 4D9QE 2XZCL 1U8JA 5IF0B 3HCVA 1BQSA 2ZCKL 3FKUS 3BIBX 2Z8VC 4R8WH 3PWPB 1AR1D 1W0YT 4LPXA 5TQ0H 5ISZB 4FMFA 4QT5A 5I1KH 4Z95H 4CVZA 3IRZA 1K2DA 4Z8FH 1P7KA 2Y36H 4OZGA 4NKOB 2OX5A 1A4JA 4PG2A 4WI5A 5DA4A 4LLDA 2G5RA 1F8TH 3HHRB 3IDGA 1K4DB 5AUMA 1BQLH 1CGSL 3EO9H 2A77L 5FM5O 3HA0A 3L3HB 2ZJSH 1RU9H 3OSKA 4Y4FD 4LPCA 1YQVL 2IMMA 2GJZA 3O45A 4TULL 1DLFH 1F4WH 1A7PL 1T7YA 4A6YA 2OZ4H 4QXTB 3FQTB 2DLTA 2OSLB 5BS0D 3W82A 8FABB 5CJQH 1JK8B 1I1AA 4LCIL 3ZMRA 3WSQH 5DYOB 2W65A 3B2UC 2LVCA 3FO2A 2NY7H 3SCMA 4NGHL 2B1HL 4PRPE 3H3PH 3JTSA 1G6RB 1P53A 4KTEH 1QHOA 5IEHB 3MV9B 1OT2A 5EZJB 3OL2A 2NY6C 5M94B 1RZ7L 1DE4A 4TUOB 2EH8H 4JHBA 4DGIL 3ZKSD 3WV0A 2EICA 3UTZB 1X5FA 3JVGC 4LF3B 5F9WC 5KVEL 1A3RH 4TTDD 5EO9B 1KB5L 4KJPD 1J8HA 4D9LL 3JWOC 4NBZB 5HI4D 3EYFB 3VXRB 1HHIA 1GGBH 3GSOB 4IRJB 1NGPL 3Q2CA 5HPMA 2CIKA 1HOCA 2DDQH 3RTQC 4G6KL 1I3RB 4KROC 4S1QH 3ZTJG 2RHEA 1JYWA 3BHBB 4WDIB 4AMKL 1GVIA 5FUZL 1DBAH 3GMPA 3GBMH 3HZYB 3VRLE 1Q9KA 2OYPA 3UC0H 1UKQA 3SY0A 3IDXL 4FXKB 2CJUH 2JJSA 4XC3L 1BLNA 1TZGH 1JPGA 1JI2A 3GK8L 4GAGH 4ZUSA 3EFDL 2FBJL 3KXFE 3G6JA 1QD0A 2IMNA 1N59B 1QRKA 2FBOJ 2VLJA 4MA1C 1F3RB 3ZE2F 3LMJH 1VADA 1MCJA 1A02N 3PDDA 4Z7VF 4M93C 1UZ6E 5CSBA 1CFVH 1IM9B 4Q7DA 3N06B 3RHWK 1N8ZB 3V6ZB 1DEEB 1UCTA 3HAEG 4M5YH 3UMTA 1AQDB 4K3EL 4NHUA 1JF1B 1HN1A 2Y06L 4Y8DC 3ZHDA 1T2XA 1BECA 2P8LB 1NH6A 2NXZC 4NP4H 1A9EB 4PBXA 2YD5A 1Q94A 4AENB 1BQUA 2GCYA 3V0AC 2BVQA 2BVTA 4MDJA 4OD2A 3M07A 3O3DB 1F3DH 3LS5H 3HLAB 3JTTB 3EJJX 2PTUA 1DDHB 2YXFA 4EI5D 4N9OB 5JW3L 4BH7B 4YO0A 3S97C 4BELD 3LPGA 3GSQB 1HYSD 1MCNA 2F5AH 4GSDH 1RUAL 2FR4B 4I3SL 3QZWG 3P0VL 2DF3A 2Z91A 4TOYH 4HUNB 1HHJA 3UTSA 1J18A 4JAMA 1BJMA 4JFDD 3EYQD 4PGDB 5J12C 4D8PA 3AS1A 1A6AB 4JM2C 3MRQB 1QLFA 2V6HA 2FATH 3LKOB 4Y5VC 1EO8H 1B0GB 1ZA3A 4LVOB 5BV7L 4FTVD 5AAMA 2WLZA 3OJMB 2D0HA 3FT4A 2UY7A 5TFSL 3HPJB 5GJSH 3D3VD 2WIIA 2CO7B 4G43A 3BE1L 2X40A 2FHCA 1KCRH 1QFWL 2PKDA 3DVGA 5I8OH 5JXED 2CR3A 1YPZA 4X4YB 2XWBB 4NN5C 3QHTC 4Z78B 5LBSH 1JGLH 5IT2H 3SE9L 1FFOA 4HX1B 1A7RH 3QA3A 3OX8A 5JIKA 4GMSH 4HUVA 1A2YB 4JRWA 2AABL 15C8L 3TYGH 2VZVA 5C07A 3PXJA 2NR6C 3MA7B 4IOFC 1D5BB 1YY8A 3HNSL 4LCYA 4BH8A 4LLVA 1LE5B 4B7LA 2G5BA 2YRPA 1N2RA 4QHMB 2IH3B 2Y1VA 2H3NA 3SOBH 4P4RA 3AB0B 2HG5A 1FFNB 2ITDA 2QKIB 3GI8L 4XNZC 1CL7L 4KPHH 3IDMA 2E6PA 2ICWA 3FQUB 1B4JL 4Q9CA 2YN5A 1MCSA 4TVPL 4HC1H 3MV11 2DTML 4X7SL 1LNUA 2VLJE 1FFQA 2C5DC 4C4KT 5IMLB 2PTTA 3CH8A 4LHUG 4N0FB 1FORL 1IGIL 2FO4B 3IT8D 4X4XB 1WBYB 1HYRC 2VC2L 4UDTB 4ODSH 2J5LB 1RZ8A 3T0DA 1UJ3A 3MGOB 3TBSB 1DVFA 3LIZL 3TNMB 1FVDA 4NO0B 3WE6B 2DLFL 1BFVH 2A6JA 3A6BL 4CKVX 2F8OA 5IQ7H 1FGVH 3FT2B 1Q9OB 4L3EA 1ZHBB 3QPXH 4OZFG 1CR9H 4YHPB 4JPIA 5I17A 1VEOA 5FGCE 4G6ML 4S2SA 1A6WH 4JFED 4MZ3A 4R7DB 5AYUL 5SX5H 3B4NA 1OWWA 4FQ2H 3H42L 4OLVL 1IGYA 2H6PB 4PJ5D 4PRIA 4ZOAA 1TITA 5BV7B 2ZPKL 1JHKH 1HKLH 4M6ML 1TFHA 4PR5A 2R2EA 3GSWA 5CD5C 2ADJB 2FWOB 4PLJD 3BSZL 3BO8B 1MCDA 3T0EB 4CADB 3T4AA 4QHUA 3LRSB 3VXMD 4G6FB 3X14B 4XI5D 1UZ8B 2AJYL 4KKAC 3N1MC 4RZCA 5EZOL 5DJ0B 2IAMA 1W2KT 3C08L 3HR5A 3O3AB 4I3RL 4S0TD 1MCQA 1UCBH 1KXTB 1VESA 2O5ZH 4Z7WA 1AQKL 3UBXB 4MD0B 2GJ6A 3ULSB 2H2SD 4PRNB 1YECL 1LO2L 3VRJA 4O58L 1ULVA 3GSUA 1PKOA 3ULUE 5E4IA 4NM4H 2MPAL 4JDZA 2LABA 4HV8A 3H0TB 1W72B 3QQ4A 1P7QB 5F9JA 3QIUD 5IHZA 2XICA 2GW5A 5FV1L 2GSGB 5ELIA 1ERNA 4OKVA 4TYUA 2DQJH 5FGBC 2R0LL 4JRYD 4PJ7B 1BBDL 3QUKA 2W60B 2H26A 5F7MC 3C6LC 4FQJL 3QUYC 1VFOA 4IMKC 3PQYA 4YWGL 2ESVB 1FNFA 3CUPB 2JJUA 5IM7B 4BSVB 1QSZA 1T0MB 2XRAH 3TEUA 5L8KB 5EO1A 3WIHH 2GTZA 4Q6IB 3K8KA 3DUSA 1KELL 1NCTA 3RNQB 4XVJH 2GFBA 1I8KA 2AGJH 3O2WL 1OCWL 1B88A 3CCHB 3EHBD 3RUGA 3B5GA 3A67H 4ZNEA 3O9WD 3MLRL 1CICB 5JOPE 1X5XA 2X1WL 1INDH 5F1IB 5CJXA 3ULVH 2B39A 2YZ1A 3O0RL 4L3EE 3V6OC 1CFBA 1QA9B 2NY4C 1U95A 5DRWB 5LKNA 5B8CB 1GOGA 4I48B 5MEPA 3NIDF 4JFFB 3WLWC 3VXUB 5FK9A 2BSSA 3S35L 4XAKE 3MRDA 1IGMH 3KNBA 5DEGA 2EXWD 4P5MA 4WUUD 2ZCLL 4P23C 3ARDD 1CG9A 3MBEC 1NFDA 1SJEB 4GW5A 5I1DA 4JKMA 3G5XA 5CP7A 4GRMB 2RCSL 4G7VH 2YEZB 4I5BB 2X89D 3STBA 5KZCD 4JR9L 3NIGE 4GBXB 4PD4J 1CQYA 4ONGH 4YDIH 1MRDH 2OLDA 3V5KB 4F7PA 3BQUC 3UAJD 1FLRH 3QO1B 1T1YA 5IJKA 3GBLA 4AEIL 2QHRL 2X4RB 3IXAB 3BH8A 3MLYH 1CD8A 4JDVB 2R4SH 2IALA 2VLKB 3KPPA 5FYKL 5FXCH 4Q97A 3SCMC 2NY2B 2OR8A 3QRGL 5F3HB 1JVKA 1MQKL 4L8SB 3MV7D 1JP5A 1ZGLB 3PWNB 4PJ8D 1FH5H 1T66D 5EA0L 1SM3L 1G9ML 4X6BB 4WFED 1CF8L 1PLGH 2WUBH 5A2FA 3PIQB 3U7WH 4ISVB 3HAEA 1C8PA 3S88L 3L9RA 4LLQB 2ED9A 1HI6B 2CQVA 2RGSA 4J1UB 1D9KA 1XF5A 1V7ML 4JDTL 4L8BA 1XCQA 2L7JA 5DJ6A 1D5MB 1G1CA 4JY4B 2Q6WA 4HJJL 2A73B 4JPKH 2Q8AH 4JO4H 5D72L 1OM3H 2UUDK 1WC7A 1QSEB 3G5YB 2ARJB 4NQSA 5J9PB 3MOBH 4WI4A 4U6XB 5FOJA 2BNRA 3VXQA 5JW4M 2PR4L 3OR7A 3JWOL 1A5FH 3MRRA 3D69B 4GMTL 1H0DB 1RHHA 3QZWA 3DWTA 4UQ2B 1WT5C 3CDFA 4XPGH 3SKNA 4QYOA 4JFQB 4HFUL 3H2WA 3O8XD 1BZ7A 4YPGB 2F54B 2P4AB 5E2UL 4PRHD 3S36H 2QQNH 2R2HB 3NFSH 1LO0H 4NQTA 3ULVC 4LPYA 2D7QA 3B9AA 3TV3H 3D9AH 3TJEH 3GHBL 4DOHE 2GKIA 3D6GA 1DQDL 4L3CA 1F97A 4I1NB 3HMXA 4JB9L 4LLWB 3KHOA 3BDBA 5TPWL 5I1GL 3DXAE 1BVLA 4ZUVA 4PJHA 1MUJB 4JJ5B 1RFDL 4GS7B 5F7FA 1IVLA 4CVUA 1CLYL 1FSKC 5J1AA 2JCCA 2Z35B 4IRZH 5D5MF 3LKQA 4ZOBA 5FECA 5DWUH 4IDJH 1GZQA 2BNQB 5TQ0L 5FM5M 2IBZX 2PW2A 4XWGH 5I1KL 2WQRA 2WWKT 2Y36L 4TNVF 3QFJE 1X5GA 4ODTH 2FEDD 4PPTA 3O4OB 3NAAH 2HYMA 5C0BA 5DJ2A 1QLRB 1VFBB 3DO3A 3HMWH 4W70A 1KJ2L 1F8TL 2ZSVB 3EO9L 1TZIA 4R9HA 1LDSA 3TBWB 5BO1H 5CFHA 4LLAA 5L7XL 1ZLVH 2NY6B 4FNLL 4G8EB 4KY1L 1NBZB 2IPKB 1GAFH 1S7UA 3IGAB 3H9HB 1S7WB 5E6IC 5CZXC 4PJXB 3DHMA 1B0WA 3RZWA 4L8DA 1N5AA 1DANU 3K46A 2R0ZL 4ZPTB 2VIRB 4XPFH 5HYJB 1F4WL 1DLFL 2BHUA 3FB7A 3PWJA 2OZ4L 4MNGB 4EN3D 3HC4H 2HFEB 5CJQL 4H20L 5D7KD 1CU4L 3K2MC 3WSQL 4I0KA 2VZ3A 5KVGH 12E8H 1JGEB 1INQB 3BKML 3ARBD 5D6DA 2NY7L 4LP5A 5TJWK 4U1KB 4KXZI 2KL6A 1ADQL 3HZMA 4FQXB 4RIRB 2W0PA 1KTRL 4ZS7H 4KTEL 1BIHA 4GRWB 2XV6B 1O5DT 4KROB 4ZDHA 3UTTD 3TFKD 2D7OA 5J6HB 5E99H 5TDPA 4N9GB 5GS0D 3DSFL 5IVNA 2VISA 3VCLB 3S96A 1I85C 1E4KA 5JDSA 2LE9A 1WFNA 3C5ZC 3VD5A 4HGWB 3OKOB 2GQHA 2O5YL 1A3RL 3O6FB 4J6RH 3FTGB 3HNVL 5GRJH 1FZJB 1KSRA 1UYWL 3QISA 4IRSC 3DYPA 4UT6H 4M61B 3RPIA 3RWEA 4MA1B 3M1BA 4TVPE 3QNYA 2JTDA 2DDQL 5C09A 4Y1AB 3CXHK 1S7TB 1P84J 4M93B 2IG2H 4S1QL 4OZHB 2DQCH 2NXYD 1ZHLA 5D7IF 1K4CA 5C9KA 3EO1B 3U0PA 4PY7A 3TN0A 2XXMB 1DBAL 4PJBB 4N8CH 1UJ3C 5KBNC 5GISH 4OCNC 1F4XL 3UC0L 1KJ2B 1PX4A 1U9KA 1WWBX 1HE7A 1R6VA 2CJUL 2ESVE 3INUL 2IADB 3KPMA 5E8PB 1AXSB 1TZGL 2ZUYA 4NQCD 4GAGL 2UWEB 2DMKA 2QSCH 1FL6A 2B20A 5CSZB 3D48R 1CXKA 3SDXF 5C9JA 4FRWA 1N0LA 2Z9TA 2FIRT 1J86A 1L7IH 5F7KC 1NGQL 2V2XA 2VZOA 2XT1B 5GSVB 4N5ED 3MRLA 4UIMA 5FYKU 1CFVL 4Z0XB 2K1MA 3OF6D 1FNAA 4M5YL 4MQTB 2X4PB 4CMMA 1A6ZA 4Z77A 4FFVC 4L4TB 1K9TA 4HWBA 2HT2C 5EC1A 3QEQA 1NUDA 2PXYD 1HWHB 1U92A 5J12B 3RZCB 4OTXH 1R5WA 2FH8A 4JM2B 2A6DB 3T77B 5EBMA 1IAII 4RGMC 1U3HA 3D18B 2RJMA 1LO3L 4HUXB 1AH1A 3LS5L 5ICXB 4AM0B 4XCNB 4MHHI 1H5BC 1SY6L 4X5XA 2CMRH 3FFCA 3WFDL 1G9NC 1EXUA 3RWIB 3VI3F 1NC4A 1HKFA 4MJIE 1JNHA 4QF1B 3GB7B 2X7LA 1WJ3A 2HKFH 5F88A 4HUWA 2EDLA 4LMQE 4GUPB 1H3WM 2HMIC 1TETH 4O2EB 4EDXA 2J8UF 2J7LA 3OBAA 3BKJL 2GK2A 2N7AA 3B5HA 3EGSB 2FATL 4ZQKA 5A3IC 4B7IA 5DT1H 5KSAD 2OQJB 4LCWA 4HKJA 3GGWB 1NAKH 4IEFB 5DI8A 5GJSL 4G8GB 4W4OC 4HZLB 4OZIF 1KCRL 3ZE0E 4LSUH 3RA7H 1IGJB 4EQ3A 3NBNA 1EUTA 2V7HB 1MQ8A 1JGLL 5I8CA 3LAFA 2V17H 4BJLA 5C08A 4OLUH 3VMOA 1G0XA 5DURB 2BXZA 4NO3B 3TYGL 5F7UA 4K3HA 4XMPH 5BVJB 1D6VH 3MOQA 4ENEC 1V8HA 5DRNB 4PV8B 1CVSC 1NC2D 4GKSB 4X7TA 3BT2H 3DI2B 4P3DA 4L5FH 4W6WB 4PJDE 3RWDB 1T0NA 3O4LA 5ERWA 1M05A 2HTLC 1E4XH 2DYPD 3SEPA 4HC1L 1I8MB 1BVZA 3MV8A 4P2QA 2HT4D 3CDGA 4HF5H 2DL2A 4KI5E 1ZLUK 4LPVA 3ZTNL 1YEJH 1XF2B 4BKLB 4NQEB 1VFAB 1TNNA 3RWCA 2HFFA 3SGJA 1MFAL 3OKNB 4NNXA 3F7VA 4LRIC 4R0LA 5IQ9B 4NQVB 1BFVL 4GAJH 4U1HB 5IQ7L 2MCG1 3RBGA 4CJ1A 2RFXA 1YMMD 4J23A 1AGFB 1MREL 3IFPB 1G7LA 3VWJD 4FQ2L 2Q3AA 5FYLL 3QIWD 4I0CC 4MAYC 3HKFA 2YD8A 1H3UA 3ZYOA 1RJCA 2VAAB 5FYKE 1JHKL 1HKLL 2A1WL 2DQEH 4WHTB 3H9SE 4XCEA 4F37K 1B3JA 3U36B 2P49B 1I8LA 3ZKMC 3QFDA 4M43H 2Y5TA 3V2AR 4P3WA 5DC4B 3BMVA 2PO6A 1MHEB 2FX7L 5CJOH 2R56H 3KXFD 5FCUH 1KEMH 1WAAE 3D39B 4ZTOL 3C2AH 4OZFH 4JZNB 2VITB 5JO5A 3BPCA 3HS0A 3UDWC 2Z4QA 5DJDA 3MRPA 3VGGA 1HNFA 3FQNA 3C6LB 3D85A 3WLBB 4NNYA 5HHMB 1D9KC 3GSNB 2EC9U 3QUXB 2ZOKA 3EJYD 1DL7L 4KK5C 1LO5B 3BRDA 4JPVH 1JL8A 4OM0L 1QNZL 1I75A 3T65A 5MEQA 2BNUB 2XKSA 2XKNB 2NX5B 2ZG3A 3QJHB 2KPNA 4X6DB 3CDYA 3O3EB 4UOJA 5C08E 3LEVH 4Q9QH 4RMTA 4APQA 3LKNA 5L8LB 3KPOB 4EBQL 1U8JB 1ZSDA 3HCVB 1UWXK 3NCMA 5EUOF 4ZFOL 2R29H 3GMQA 1TCMA 5JZ7D 2NY4B 2EDRA 4QT5B 4CVZB 4RMSA 1K2DB 1P7KB 4OZGB 2YSSA 4WTXA 1HSBB 4QTIH 5IW6A 5CILL 1UQSA 4KK8C 3TIEB 5JIPA 3WIHL 1BFOB 4C54A 1CN4A 3ES6B 4LLDB 5IKCB 3VW3H 2J6EA 1QP1A 4P23B 4XVJL 2AGJL 3MBEB 5AUMB 4XHJD 3BP5A 1IAOA 3B83A 4RMWA 3U6RB 4JGJA 3A67L 1TZHA 3PHOA 3RWGB 2JIXA 1UM4L 5DVMA 1INDL 3U9PL 2AEPH 3ULVL 1A6PA 1S9WA 3O45B 4OV6F 1JHLH 5CJ5A 1JTOA 2YPKA 5SWZB 4YPJA 4A6YB 1B0RB 3VFOA 1P9MA 2YPVH 1AD9A 5D7JC 5DJAB 5FYJD 5I71C 2RAMA 1I1AB 2X4NA 1E6JH 4ZXBC 3ME0A 3UYPA 3FO2B 4KKBC 5LAXA 1IGML 3EO0A 3SCMB 4L4JA 3JTSB 2XTJE 3WFBH 3F7YA 3QWQB 3GMRB 1DE4B 3L5IA 5E5RB 2PUQT 3GNML 4HLJA 5DJZA 4G6JH 5C2BH 1UKSA 1MRDL 4YDIL 3WHXB 1BWMA 2VNCA 5DJYA 5CHNA 1OGAE 1FLRL 2HLFC 1FFRA 1T1WA 4XBPA 3CK0L 1JWUA 2RR3A 1J8HB 5EPMA 1H3PH 3MLYL 4G9FE 4S1SH 2A38A 1J1PH 3MRCA 3R06A 4M8VA 2UVFA 1JNJA 3HG1D 5BMFH 3LS4H 3QQNA 5HPMB 1MRFL 1J0ZA 4ELME 2H9GA 4FQHB 3ALXA 1X5LA 3GSRA 5IVZA 2BHZA 1FH5L 5D7LE 2X05A 4NZJA 1PLGL 3P77A 4F7CA 5IEKB 2WUBL 4QRUA 3DMMA 1E4KC 4R4NC 3GMPB 3A6CH 1Q9KB 1LILA 4DQOL 3ARYA 3B2VH 3RGHA 1JPGB 1MCBA 5GHWH 4X8XA 2Q7YA 4ZUSB 2OK0H 3RRQA 1HILA 1RIUH 5TE7H 3G6JB 2J8OA 2J88H 3HRZA 4OUUA 3CC5A 4P9MH 4E5XA 4YHNB 1BGXH 2DB8A 5GRVL 5KSUA 1Y18A 3EZJB 4RMRA 1OM3L 3EJZC 5ESAB 4P4KA 2X9XA 1S7QA 3LD8C 2OCFD 4MSWB 3MOBL 1U8HA 2XN9B 4L4VB 4YLQT 1FNSH 2DM7A 1WZ1H 2P47B 4V1DA 3WNPA 1M7DA 4NHUB 1A5FL 5D1XA 3B9KC 1SBSL 1Q94B 4XPGL 3V4VH 3GZKA 4K3JH 1ORSA 5JORB 2GCYB 2I9TB 5CIPA 1RK0A 4MDJB 5LWYH 3O6KL 3LY6A 3ROLA 2D2OA 2P7TB 1EHXA 3S36L 1WLHA 5C0JA 5DRZA 3RI5K 1LO0L 4NKIH 1L6ZA 5GXBB 4U1MA 1YEKL 2O5XH 3TV3L 4YO0B 4PJGE 3D9AL 2E5EA 4EUPH 5HHOA 5I9QC 2HRLA 3BMWA 4MJ5A 1RVFL 4WW2A 1JGUL 1LP9A 4XVUD 5C8JA 2Z91B 5BRZE 3ILQC 1ZVHA 3VFSB 4JAMB 2EIZA 1HIML 4N0YH 3QUMA 4D8PB 5AWNH 3VD7A 1QLFB 4IDJL 4RAUB 3NA4A 3VXSA 3G6DL 4LKXB 3X11B 4L1HA 4XWGL 1ZA3B 3OAZH 1U3HC 1J1XL 2NY3C 4ODTL 1U8OA 4WU5A 1UXSB 2YKLH 4L1DA 1QR1A 3WNKA 2WIIB 4G43B 1OTTC 1XIWC 4LGPB 3HMWL 3DVGB 5KS9B 3DUUA 4JJHA 1YPZB 3V0WL 2EE3A 3UJIH 4M1CC 3QEGH 2FECI 5BO1L 2X1XR 3VXRD 3I02A 3QA3B 4IRJD 2E7CA 3OX8B 5JOPD 1GAFL 2E7BA 4U1IA 3UJTH 5C07B 1VACA 2M1KA 1A3QA 4EVNA 5T1KA 3E3QC 4XPFL 4LCYB 1G9NL 5DHYA 4BH8B 2G5BB 4KWUA 5L2KA 3F8UB 2BY0A 1N2RB 3NTCH 1BJ1H 2H3NB 3HC4L 4P4RB 1C16A 2HG5B 1VSCA 4XAKD 2ITDB 4M7ZB 3IS1X 1SVZA 2WNGA 2XZQH 4WI8A 2HFGH 2ICWB 12E8L 2ITCA 3FO1A 3VXOA 5SX4I 4E0RA 1LNUB 2PTTB 4ZS7L 1RUQH 5E99L 5H37H 3QUZA 4OCRH 3STLA 4ONFL 1PZ5A 2JJTC 1OAXH 1U8KB 1EJOL 4G6AD 2VXSH 2HWZH 1GGIL 4F57H 1UJ3B 4KHTH 1DVFB 3MUY1 5KVDL 1FVDB 3LSOA 4ZAKD 4YXLH 1SEBA 1L0QA 3TO4C 4F80A 4J6RL 3C6SA 3QXDB 5GRJL 4LFHD 3QG6B 4POUB 3NGBB 4JPIB 3TZVC 5I17B 2Q76A 5EN2A 4UT6L 5EBWA 1OT1A 1FV1B 1XGYH 3IF1A 4X6DE 1BF8A 5GRWA 4PRIB 3PDOA 2PCPA 2EH7H 3JV4A 2IG2L 2R2EB 3GSWB 4MWFB 3HI1A 1W0VA 1NANI 5J1TC 3OGOE 2K9UA 1IZJA 5CAYB 3ZDZE 4RSVA 3T4AB 3V6OE 4JFZL 4QHUB 2P24A 4PGBA 4LQFL 1A8JH 4NKDA 3GMNB 3NPSB 2WLYA 3HR5B 2PW1A 4RGMB 2A9NL 1T5XA 4MB5A 1H5BB 3V9FA 4Z7WB 2RB8A 1L7IL 4MD4A 3VRJB 3GSUB 1IEBA 1JMXA 4BZYA 1DN0A 1AC6A 4HXAL 4JDZB 5E9DA 1KFAL 2YN3A 3QQ4B 5F1SA 5F9JB 1M71A 5FO8A 5IHZB 3Q6FB 4KXZH 4XPHH 5SWZE 2Y25A 1GOFA 4OTXL 3D0LB 3VFWB 3CFBA 4LSQH 3WFEH 5CS7A 5J6GA 3U7YH 4CW1A 1AJ7H 4OKVB 1XFPA 3V6FA 1OLLA 4HGMA 3NCYS 3BRFA 1ZLSH 3SDDA 2H26B 5KN5A 4Y4HA 3S3SA 5J4MA 2BSTA 2LV4A 3CVHH 4NOFA 4XP6H 5CLTA 5LVEA 1AIFA 1H3XA 2EYTA 3DXAD 2HKFL 4NZRH 1QBMH 3AUVA 4X98B 2AXFA 1X5ZA 1UENA 3WNMA 3DUSB 5IB3B 4G42A 2YD1A 4J4PD 5HGHA 1WK0A 4XX1E 5CJBA 1OARH 3RUGB 3EOAA 5B21A 2OI9C 5DT1L 2WK2A 1NAKL 2LAAA 5MEPB 3VWKA 2HVJA 4B5EA 4TRPH 4LSUL 4GRLA 2Y07H 4K94H 4P46C 5FK9B 1D6EA 1KTKE 1B6UA 1FDLH 1FN4B 4OLUL 3MRDB 3KNBB 2ZUUA 5DEGB 4P5MB 3Q0HA 3MLVL 3KAAA 4Q9BA 1CG9B 2AXJA 1NFDB 2QBWA 4Z18A 3IJHA 1S5HA 5J7CC 1SEQH 1OGTB 3SKMA 5I1DB 1D6VL 3G5XB 2F19L 5CP7B 3L3DA 5IFJA 3UXFA 1I1YA 1CWVA 3ULVE 5HDQH 1PY9A 3T0ED 2AQ1A 4F7PB 1K8IA 1H3VA 4KJWD 4AIZA 1HDMA 1T1YB 3EFFB 3IDIB 1GH7A 1P9MC 5ESQA 4MAYB 1BZ9A 2XN9E 1MVFA 3BH8B 4HF5L 1UEYA 1IAIH 3MRNA 4CGTA 1T21A 5F6HJ 4HKBB 5E8NA 2BRRL 4FXGB 4P5TA 4PV9A 4QWWC 3C60C 4YR6A 2YPLE 1OVZA 3L5XL 2NCMA 5I18L 4F2MB 1JIBA 3U82B 1A7QH 1SQ2N 1FVCA 1JCKA 5TF1L 2FGWH 3LEXA 3MXWL 2CKBA 1P1ZB 2AK4A 4YIQB 3HAEB 1KGCE 5IK3B 4OI8A 4FFZH 1F5WA 4TVPD 3QQ9D 3STZA 1JWSA 4NCC2 3RKDC 1D9KB 1XF5B 2XZZA 2JK5A 4C56E 3GM8A 3VFVB 4L8BB 1MJ8L 5DJ6B 2DQEL 3VXNA 4WEMB 4HH8A 2K7PA 1LD9A 2LVEA 3WDIA 2KZWA 4M43L 3VA6A 1ZT1B 2ESVD 1S7VB 5J3HD 3EYOA 3BEVA 2BNRB 3GKZA 1TVBA 5CJOL 2R56L 3OR7B 4J3OC 3MRRB 5FCUL 2X4OA 1RHHB 3QZWB 3EDJA 1CLOH 5EUKA 3O41A 3CU1A 3LVEA 5DD6A 4OD3H 3SKNB 5T1LB 3CSBA 2F53E 2VJXA 3RJDA 5JR1H 5DQJA 1WCBA 2MQ3A 5FA3A 3FHAA 5MENA 3CZFA 2UY6A 2QQKH 4OFKA 3T0BA 4JVUA 4WFGE 1J0HA 1QYGH 5GGVY 4Q0XH 1J0YA 3ECBA 5CUSH 5TDNB 2DJUA 4OGYH 6CGTA 2GUOA 3MNZA 3VFUA 4JFFD 5GS2H 3LEVL 4JO1L 4Q9QL 2X4SA 2XFXA 1QBAA 3I2CH 1IGTA 2CKNA 4K94C 1N3NA 4PJ7F 1INEL 1A6TA 3C2SA 3AVEA 1BVLB 1IAIM 4PJHB 5J11B 4NCC1 4BA8A 4JHAH 4BZ2L 5B3JF 3IFLH 5J1AB 2JCCB 5DDHB 5FECB 3LKQB 1RJYA 3DROA 2R29L 3UX9B 1GZQB 4O4YL 3D2UA 1JPFA 1DTUA 1T7VA 2IPTH 4MJID 4LU5H 4TSAL 2GY7B 4WRLA 2L7UA 4QTIL 2W1NA 4R26L 5C0BB 4ZXBB 5DJ2B 4Y5YA 4EDWH 3KPSE 2OR9H 2QEJA 1JN6A 1QEWA 1BD2A 1TZIB 1VPOH 1TQBC 4P2OA 1KLGB 2LU3A 5DD5H 3SO3B 2C3WA 1S7UB 35C8L 5LGJA 4WI3A 4LHUB 4NO2B 4Z7OE 2AEPL 1N5AB 5MERA 2BZDA 4JFHD 1JHLL 3KR3L 4L8CA 3FB7B 4XTRC 3PWJB 3FZUC 2VZSA 3J7HA 2X10A 3ARFA 4PUBL 2NY1B 4X99A 4I2XA 4PP2A 2P42B 3N1FC 5EOCH 4NZDA 4OZFB 1ZHNB 3L5WA 1PSKH 4HWBL 3CIQA 3IVKA 4POZC 4XP5H 5DTFA 4XPBH 1YZZA 3HZMB 1IC4H 4NJ9H 3BYYA 4ZDHB 1T89A 1UKTA 3UTOA 5TDPB 1KYOK 2ICEA 3S96B 5E56A 3AC0A 4IIQC 4CN6A 3QDJA 5LQBH 3FAXA 3N9GH 1F58L 1I1RA 1I9RH 1KUMA 1EEQA 1N7MH 3HE7C 3DTXB 1G84A 4F33A 4NWTL 4O51A 1KNOA 4F8TA 2EIBA 4X9GA 1NMBL 4S1SL 1J1PL 1FFPA 3RPIB 3RWEB 3M1BB 4GKZA 3NMEA 3QNYB 5BMFL 2H8PA 3LS4L 1T7ZA 5C09B 4F9LA 5FF6A 4LDEB 4WTWA 3BP4B 2PN5A 3LD8B 1ZHLB 2HJKA 2DMCA 1K4CB 4YHYC 1RZJH 3QUZC 4XGZA 5SWSA 3U0PB 4PY7B 1MCRA 2HRPL 3TN0B 2FX9L 3NH7H 5GZNC 2CLZA 4KV5F 2ATPA 3A6CL 3TCLB 4YJZL 2DICA 4DW2H 1SYSA 3U46A 1MFCL 3SDCC 4PLOB 1D5ZA 4Y4KA 5GHWL 4JFYA 5FYKD 5DVNA 2OK0L 1FL6B 1LEIA 1RIUL 5TE7L 3H9SD 4L29A 4P9ML 2I5YH 4KK9C 1BGXL 4BYHA 2BNQD 5B39A 4WWID 3MFFA 1M6OA 1U91A 3VG0H 3MRLB 4UIMB 2DQUH 4D9RE 1DBBH 3WEXB 1BM3L 4CMMB 2X4QB 1PKQB 1S7SA 1WZ1L 3CXDH 4Z77B 3B2UD 5FKPA 4OT1H 4E41A 1UACH 3QEQB 4DKDC 5I16A 1R5WB 3V4VL 5KG9B 5EBMB 2NY6D 4FABH 3MSPA 2ICWJ 1U3HB 4KVNH 1NMAL 2NY3B 5EU5A 1NGWA 3IDYC 4MA8H 4X5XB 4FG6C 4RFNC 3FFCB 2DBLH 4NKIL 5D2NA 2A9MH 1EXUB 1NC4B 5EU7E 1XIWB 3HI5H 1K6QH 1JNHB 4Q2ZA 1EO5A 3GSVB 4CMHC 1OTSC 2X7LB 5F88B 1GHFH 3HUJE 4YXKH 3DBXA 2Y72A 1QFHA 5KSBA 3VI4F 4N0YL 4KQ3H 3RTQD 3GBNL 1MHCA 1AHWA 1P4BH 4KROD 2C4FU 1FC2D 1M7IA 3IETA 4U6VH 3LPFA 4ZQKB 1T1XA 3WHE0 1F11A 5IHUH 4EQ2A 1WAAF 2ZSWA 4UB0H 4KTYA 2PYEA 2JKXA 5IROA 3OKDA 4LCWB 4HKJB 4Y4HC 5DI8B 1KJVA 1YMHA 2YKLL 5IMMA 4HULB 4MAUL 2IANA 2I25N 2VLRE 4GAFB 1GC1H 3ZKXB 3UJIL 3MA9L 3NCYP 3QEGL 3N1QC 5I8CB 2MNUA 1ZANH 1G0YR 3ZKQD 4PJXF 3O2DH 5JA8B 2QR0A 1TJIH 4WTZG 3ZT5A 2MOVA 1QRNA 1NEZG 3UJTL 5F89A 3GRWH 2NYYC 5SWSE 4H88H 3TVMA 5B4MC 5GS0H 4QOKE 1OPGL 5GIRA 1C5DA 3NTCL 4P3DB 4O02H 1BOYA 2XQBH 3T2OA 4Y16C 4B41A 1MEXL 1UVQA 5EU4A 2XZQL 1T0NB 2FZ3A 2NXZD 5ERWB 1L9NA 1FCCA 4GRWF 3MLTA 2B5IC 5IVXA 3MV8B 4P2QB 4AJ0A 4LRNL 1YYLH 1ZWIA 3AREA 3SBWA 4KDWA 2Q3ZA 1OAUH 1WWCA 4OCRL 2VN7A 4FQLH 3ZZ1A 3C8KB 3RWCB 2HFFB 3QHZL 1OAXL 4NNXB 3MJ6A 5L88H 2HWZL 3L1OH 4ZUWA 3SDAC 4KHTL 1OGAD 4M4RA 4NM8L 4R0LB 4H1LH 2JELH 4TQEH 4LKCA 4E41E 3RVUC 5CGYC 4DKEH 1C08A 1G7MB 5HHVH 4PS4L 1VHPA 3CFDA 2F9BT 2VRAA 1N64H 4L4TD 4U3XA 4WWKC 1G7LB 1OW0A 3TYFB 4XC1H 3RGVC 3SE8H 4U2YA 4OZ4A 2WIMA 4JM2D 4OZHF 1JNNH 1JF6A 1R5VA 2DIBA 2LTQB 3BD5A 4Y19A 2EH7L 4PJBF 2FD6H 2AAVA 4HWZA 5FHAH 4XCEB 5I2IA 3VRIA 4TN9A 1JTTA 4OB5H 1FQ9C 3ORJA 3QFDB 2CGRH 3TH3T 3WHE1 3NABL 2UWEF 1NBQA 3REVA 2PO6B 4U6HA 3NA9H 5EORH 2P8MB 4AEHL 5GGVL 1ND0B 4URTB 2VZ1A 5JO5B 2VWEC 2NR6D 3AS0A 3FQNB 1ZT7A 4NNYB 4WCYH 2VTFA 3V0VB 4X4ZA 5E8EA 3PV6B 4OLEA 4HPYH 3T65B 2CLVB 4YHOH 5ACZA 5MEQB 4MNQA 3UBXI 4NQDA 3G5VA 5DZNA 4P2RE 2VAJA 4JM2F 3ARPA 4G8GD 3TA3A 1NPUA 4ZTPH 5SX4H 43CAA 4NHCH 5CCKH 4U1NA 4APQB 3W9DA 1P2CA 3U7YL 1AJ7L 2I24N 2E9BA 1ZSDB 4N5UA 1NGXA 4JVWA 1PEZA 1ZLSL 4YEFA 3GMQB 3MRGA 1FNLA 2C1OA 4PREA 3CVHL 4JZJC 1T04A 2V9TA 3CFCL 1D3CA 4WI7A 1N6VA 1Q38A 2YSSB 1MLCA 3E6FA 5F7NC 4M6AA 3QH3A 5IW6B 3CLFH 5BRZD 3ARGC 5K9QI 3MREA 1I3GH 1BX2B 5DGQA 3AS2A 3KWWA 4BFEA 4R90H 4OLYH 3BP5B 1IAOB 4QRTA 3UBXG 1VEPA 1OARL 1ZE3C 3S5LG 1NANH 3PHOB 5CD5D 2JIXB 1JJUA 4QRSA 2D0FA 2G75A 4MX7B 1S9WB 3QDAA 4WO4A 2YPKB 3F62A 1WFUA 5CINH 3VFOB 4HLZH 4KKAD 4V2CB 3NZHL 4LLYA 3IB4A 2IQAA 1DR9A 5ID1A 2Y07L 4K94L 5F1OB 4NC2B 4AQ1B 5J13B 4Y5YC 1S9YA 5LAXB 4FS0A 4HH9A 4JN1L 4I0PA 3EO0B 1VFUA 4JRXA 1S5IH 3F7YB 3NIFE 1SEQL 2VDKH 5DHVH 3BVNB 5K9QG 2E7LA 5DJZB 4WHYH 4ZYKA 3QBTB 1HXMA 5EO0A 5HGDA 4LOUC 4QNPF 5B38G 1MOEA 5DJYB 3RWJA 3V5HA 1H9VA 4XBPB 5D1ZA 3MTRA 1JWUB 1YEDB 3ARFC 1JWMA 1IAIL 3SPVA 2P8PA 2GHWB 4NRZA 4M7LH 3ARWA 3CDCA 4XPAH 2YD7A 4W4NA 2WM0A 1CD1A 1Z3GL 5AD0A 2H9GB 1I1FA 1G7IA 3C6LD 3QUYD 4OUOA 5IBTH 1FNHA 4QO1A 4UNVA 5EBLA 5IVZB 1A7QL 4NQDE 4DGVH 3IU3A 2JE8A 5C1MB 2VDQH 4BZ1H 3P77B 1T3FA 4F7CB 1KC5H 4Y4FA 4QRUB 3DMMB 1A7NL 3JWDC 4FFZL 1ROWA 2IBZY 5JTWA 1EZVY 3DHJA 3P4OA 4I13B 1I7ZA 3MCKA 2Q7YB 5BS0A 3GJFH 1HILB 3VXPB 5I73C 2F58L 5CP3A 3HRZB 4OUUB 3CC5B 4E5XB 3SGKC 3OKKB 3DX9B 4LVNB 5KSUB 1MCOH 1Y18B 4Y7MA 2NY4D 1OTUC 3DX8A 2DBJA 4ZG1A 1K3IA 5JHDB 4PJEE 4J7RA 4K7PY 3SE3C 2CR6A 5HYQA 1A3LL 3WLWD 3U9UA 1M7DB 4PBWD 3ZSTA 4NFCA 5FUCE 3UTPE 2FJFA 5D7SH 1L4IA 1EGJA 1CLOL 4GXVH 4P23D 7FABL 3QJFA 3MBED 1ORSB 4OD3L 1C12A 1VGKA 4Y4KC 4BM7A 4BQ9A 1RK0B 1EEZB 1X7QA 4Z7VA 3ROLB 5C0JB 4QRRE 4RGNE 4CNIA 5DRZB 4UUJA 4X6DF 2X2YA 1QYGL 4HHAA 3BQUD 5SWZD 4UV4H 4OGYL 5GZOC 5HHOB 4MJ5B 4K23L 4WW2B 2EE9A 5F93C 3I2CL 4POYA 3DX6A 1LP9B 1MSPA 1TQBB 1MHHA 4HUMB 3P9MB 4JPWL 4JHAL 2EIZB 3IFLL 2GT9A 3QUMB 5EOQH 1TPXC 4WTZA 4OZGF 4FZEH 2CRMA 2VLME 3BP7A 1E6OH 3VXSB 1ZMYA 1NMCC 4YE4L 5C0DA 2C4XA 3SDYL 2BOBA 2OL3A 4LU5L 1IM3B 4RBPK 3RNKA 1U8OB 1G7PA 5D2NC 2FIKA 1QR1B 4TNWK 3K4DA 4ZOEA 5FYJH 4U33A 3W39A 3DUUB 3TCXA 3RL1A 2K7QA 3FQXB 2EEBA 1UM5L 5HD8C 1VPOL 3AY4C 3MLWH 4U1IB 4IIQB 5MI0C 1VACB 1EHLL 5CBEB 4U7KA 1X6LA 3T8XB 1R3HB 3E8UL 5DHYB 5L2KB 4P2YA 1UA6H 3B43A 2M8XA 1C16B 4RMUA 3ZHKA 2APXA 3UO1H 4EI5A 4YHIA 2ITCB 1PSKL 4F15C 3DURA 3LDBB 5GRZA 5L6YH 1VCAA 5EU6E 4XP5L 5D71H 1X44A 3FO1B 3VXOB 5KTEL 5DC9B 4E0RB 1FIGH 1IC4L 3NPZB 1RURL 1CFNA 4QRQB 4PJIB 3LZFH 1IZKA 3TPUA 4X5LA 4YHYB 3QUZB 3NCCB 1PZ5B 5D2LA 3ULVD 5I8EA 5CMAA 4LARH 4JFDA 5F7LB 4YDLC 1T83C 3N9GL 1F00I 3LSOB 1SEBB 5HHNB 2MQCA 1N7ML 2VDPH 4MDIA 5BVPH 2XN9D 4L4VD 2D03H 4V2BA 3F6IA 4CRPA 3C6SB 2BHYA 1DN2A 4FTVA 3GUTA 4LVHB 3UZEA 2Q76B 5INDA 5EN2B 4Y2DC 5DVKA 3V4UH 4BSWB 3D3VA 1Q0YH 3P30H 4Z7VE 4YXHH 2YPLD 3OWEA 1AI1L 4KMLB 1TCRB 3ZE1F 4K7FA 2B2XH 2G2RA 1AD0A 2PCPB 3PDOB 3AREC 3BKCL 3EAKA 3JV4B 3HI1B 1W0VB 3HE6D 4MLIA 1FIEA 4LCCA 1JUFA 3QIBD 3BD3A 4TSBH 2P24B 1KIUA 4PGBB 4DW2L 4CU8A 3G6JF 1H8NA 3T09A 5JPNA 2FLBT 3DVNA 2BCKA 3ULVF 2PW1B 1T5XB 4DUXA 3FO0H 2VDLL 5E6ID 5CZXD 3IDYB 1Z0MA 2I5YL 4RFNB 1FBIH 5HGBA 1YNKH 2BJMH 5HGAA 4MD4B 5DFTA 4YHML 1IQWL 3VG0L 2DQUL 4CMHB 1DBBL 1IEBB 2A2QT 2RQ8A 1DP0A 1DN0B 3BGFC 4XVSH 4OFDA 5E9DB 4OT1L 1T20B 1UACL 4X6FA 4GXUM 5FO8B 3OPZH 2BRQA 5ILTH 2F53D 3CFBB 1LDPH 5J6GB 2AS5M 2A6IA 3PL6C 3QDME 4FZ8H 2R69H 4FABL 3V6FB 5DD3L 1B90A 5D8JH 1G6RH 3BH9B 1QSFB 1FE8H 1CGWA 4JFEA 1PQZB 2BFVH 4MA8L 4WFGD 5E70A 3RDTD 3S5LA 1REIA 4NIKB 4Y4HB 3SDDB 1LK3H 2BSTB 3C5ZD 4PJCA 2A9ML 4D3CL 3B9VA 2W91A 2XZAH 4PJ5A 4P5KB 1DZBA 1K6QL 3QI9C 4PJ9C 5IBLC 1KPVA 2EYTB 3UZQA 4AIOA 2CKBL 3HPLA 4IRSD 3O2VH 5DZOA 4YXKL 2AXFB 3MLUL 4X6CA 2AVGA 4JQIH 3VXMA 3KPRE 1WWWX 2Y6SC 2XZCH 3K74B 4XNYL 3VU2A 1P4BL 3BI9X 4XH2A 5T1DH 2EZ0C 4PJAB 3EOAB 4JFDE 5IHUL 4X83A 1CT8A 5I1JL 1IC1A 4LHQB 4Y16B 5KS9F 4Z7UA 1YPZF 4WW1B 2EKSA 3MZTA 5C6TH 4J8RA 5D4QA 4ZO6A 3ALWA 2B5IB 4GRLB 3QQ3A 1D6EB 2OBGA 4ZO7A 3O2DL 3FOMA 2GK0A 1CGSH 2A77H 1RZGA 3QIUA 4HS8H 4JHWH 3IJHB 3SDAB 1S5HB 4ZPVB 3SKMB 3MJ7A 1CE6A 4O5LL 3FMGH 3L3DB 1GSMA 3PABB 4OCXL 1I1YB 1A7PH 3W5NA 4JRYA 2XQBL 4FFVD 5LG1A 1QQDA 2HT2D 2IH1A 1K8IB 4C83B 4AIZB 4LCIH 2R23A 1HDMB 4W81A 5ESQB 4PB9H 1AGBB 2NY0B 5C3TA 3IXTB 2YWYA 4Y5XA 5F1KC 1T21B 5F9AC 3C8HA 1Z9MA 5E8NB 5KSVB 1RIHH 4PTUA 2YC1A 1OAUL 2DKUA 4I0PC 4PV9B 3T04D 3ALPA 4FQLL 4YR6B 4DUWA 1UWEL 2IFGA 2HJFA 5L88L 3QWRD 1FVCB 1WITA 2JELL 2V9QA 3AMKA 2E7LC 2CKBB 4C58B 4DKEL 3O9WA 3NCJL 4OF5A 4Q6YA 5HHVL 2AK4B 1A22B 1N64L 2QHLA 4CJ0A 2HMID 1AR1C 1WWAX 4D9LH 4XC1L 4K7PL 5D1ZC 1JWSB 4LSVH 1NGPH 1EDQA 1JNNL 3BPLC 5A3ID 1RUPL 2JK5B 2VR5A 5IMOB 3Q5YA 4G6KH 4PJ5E 4H25A 4EIZC 3IJSA 4WUUA 3ARDA 1LD9B 4OB5L 4HJ0C 1NCDL 4F37F 4IMLA 4NWUL 2ATKA 5FUZH 2FECL 3P0YH 3UPAA 3BEVB 3NA9L 1ZTXH 2X4OB 4HWUA 4Z7WF 4PBVC 5IW1B 3GK8H 3SJVE 5EUKB 3O41B 3EFDH 3UCRA 3MR9B 4Y88A 5DD6B 2EDNA 1RUML 2V5TA 5DQJB 4ENED 2QADB 3VD9A 4JZJB 4D9RD 1NJ9A 3CZFB 5MENB 1BHGA 4MQ7B 1J11A 4NYLA 3WS6A 2XG5A 5F96L 4EI6A 1O7VA 2FHBA 1HNGA 4HPYL 3NN8A 3LN5A 4YHOL 4YFDB 3JWDL 3BEWA 1U3JA 4PJ8A 4LSPL 2HTLD 4G3YH 3MNZB 4K3EH 3VFUB 3WJJA 1VGEH 2X4SB 2XFXB 5CCKL 1N3NB 2CRZA 4JG0H 1CK0L 1HQRB 3WUWG 4KHXH 4JANB 1KYOJ 2HLAA 4R4BB 2DWEA 3KPQB 3NIDE 4XBEH 3Q3GA 1JPFB 4PJIE 2R1XA 1BFTA 2EDOA 5JW3H 4OBRA 5HI4C 4I18A 4M8QB 1BAFL 3BZFA 3BIAX 5I15L 3QCUH 2W9LA 1RUAH 4Y5YB 3K0WA 4OJFH 3IKKA 4I3SH 1X5HA 4M1GH 3NACL 3KJ6L 1P4LB 1I3GL 3RUGF 5D5MA 4MAYD 2Z8WC 3QCTH 1QEWB 1BD2B 4R90L 3I85A 1J0KA 4P2OB 1CZ8L 3BN9C 4LBEA 5LGJB 3G04A 3OKLA 5C0EA 5EZLB 4AT6A 5BV7H 1F6AA 5MERB 3ZKMD 3AROA 2CDEA 2VLRD 4BK5A 4L8CB 2H32A 5CINL 3VH8G 4QY8A 3O8XA 3ARFB 5DA0B 3MLXL 5D9SA 3BE1H 4NUGH 1WICA 3C09C 4PRHA 3IFNL 4I2XB 4PP2B 1NFDF 4LNVA 3L5WB 4MLSA 4OM1H 4OFVA 3IVKB 4HS3B 5DTFB 5C86A 4BQ8A 2JB6A 4J12A 3BZEB 1S5IL 1D9KD 3DX7A 4QOKD 5IB5A 2VDKL 2AV7A 4KK5D 3L95A 5ACMA 2ICEB 1OLZA 3CX5J 3HNSH 5HYSG 5ANMA 1T7XA 5GGUB 4LVOC 3SQOL 3QDGB 3LQZA 4QGTA 4D0CA 2VLLA 3GI8H 3QXVA 5DS8A 1CL7H 5FDYA 4F33B 1W72H 1B4JH 5JW4R 5I73B 2X6MA 5FEBA 1FFPB 1AKJB 2J1KA 4X7SH 4XPAL 3FO9A 4GKZB 4KJQC 1IGIH 4CDGC 4ZSOE 1MJJA 4JCLA 5DRXA 4KUCD 5T1LD 3TC9A 1HYSC 4JO3H 5FF6B 4HXBL 5IBTL 2IQ9L 3S6CA 4LQ1A 4DGVL 2HJKB 4JFXA 4XGZB 1I9IL 1M1SA 3MV7E 1F90H 1QSFE 3GKWL 2DJ4A 2DLFH 3BJ91 4KK8D 3SKOA 2ATPB 1IL1A 3GSXB 4WFEE 3AB0C 1SYSB 3U46B 1I8IA 3ARZA 3WS3A 4KQ4L 4Y4KB 4YFLF 5AYUH 2FO1A 2W38A 5DUML 4EN3A 1LEIB 3H42H 1X5IA 1A14L 1KTLA 1FZOA 3KYNA 5D7IA 4L29B 3KPLA 3KYKL 1KJMA 3ARBA 2Z92B 1MCOL 3I3DA 1M6OB 1U91B 3BOVA 1R3IL 3UTTA 4PJAE 3BSZH 5D7JD 3GRWA 4FQPA 5IMKA 4YQXL 2AJ3A 3I6KB 4XAWL 1S7SB 5D5ME 5FKPB 4ZXBD 4KKBD 2KZ1B 1CLZL 4KUCF 4KFZC 4PY8J 2ADIB 5EZOH 5D7SL 2NMSA 1DQQA 5I16B 1TPXB 1K5NA 1XF1A 4UDUB 1A47A 1P69B 1XGRA 1FL5A 1NMCB 4JGMA 5EU5B 4LHUD 3RWFA 4JCMA 1YECH 1NGWB 1QVOB 1LO2H 3MPCA 1VENA 4P2RD 5D2NB 4OCWL 5AEAA 4W6XB 4PGZA 5GJTL 2MWCA 3S35X 2HLFD 3TJHC 4Q2ZB 4JGUA 4PJHF 4HWEH 5FO9A 3F7QA 2BY3A 1UEMA 2JCCF 3RX5A 3B8YA 3DBXB 4RAHA 5KSBB 4QXWA 2NNAA 5IFAH 1NAMA 2APTA 4E9LA 2YUZA 5EOQL 5MI0B 1MHCB 4FZEL 4GG6A 3IETB 4S10A 1E6OL 3D1MC 1T1XB 4UTBH 3KYOA 1BBDH 4NQCA 2ZSWB 4KJYA 4F3FB 2PYEB 1I9JH 2DLEA 4R4ND 1A9BA 5IMMB 1KJVB 1GPOL 1G7QA 1RMFH 1NFKA 2IANB 1WTGT 4F15B 5ETUA 2KUTA 5IB1A 3SQBA 1WFTA 1J7VR 4YC2B 3OF6A 3S98A 1WIPA 2QR0B 1QRNB 5F89B 1WZLA 2PXYA 5KW9H 3MLRH 1WUNT 4XI5C 4UT9L 4YDLB 3EJZD 5FB8B 1HSAA 1SBBA 4OZIA 3PP3K 4X80H 5GIRB 5K9OA 1C5DB 2YS4A 1UA6L 5CEYB 3T2NH 5DC0A 2P5WE 3CFJB 1UVQB 5EU4B 5FIEA 2FZ3B 3UO1L 1UC6A 3B9KD 5L0QC 1QO3A 3OAYK 4WV1A 4JN2B 3MLTB 5L6YL 3CMGA 5D71L 3S35H 5IVXB 2Y7QA 3VMNA 4Q6IC 1FIGL 3KLDA 2ZCLH 3LZFL 3AREB 3ZDXE 2ICWI 1DUZA 1NBYA 4PTTA 4HDIA 4ZUWB 4LARL 1CICC 5FKAA 3KVQA 3DECA 3GMMA 4JR9H 2W0KA 4ONOA 2D03L 3SDXE 2APWA 1C08B 4EOWH 2C3XA 1OL0A 3CFDB 5B8CC 5KSAA 3ILQD 3QEQD 2QHRH 1IQDB 4CAGA 1WEJL 1AGEA 4I77H 4N8PA 4QKXB 1Q0YL 1TMCB 3P30L 4YXHL 3OB8A 1SJXA 4EJ1C 1R5VB 2B2XL 1EO7A 4Y19B 5CEZH 1U3HD 5JNYA 2NY3D 3WXWH 3G08A 2D9CA 4HWZB 5E5MB 4LSTH 5TGBB 5I2IB 3FFCD 3VRIB 1ZGLM 3FHQA 3QXAA 3LKPA 1CF8H 4TSBL 1OTTD 1XIWD 2WMPA 3NIFF 4AG4L 4XT1C 2VKWA 5AG9A 1U3YA 4XXDB 4GBXC 4M1CD 3REVB 2MTPA 1NC2A 3O9WC 4NRYB 4U6HB 1MVUA 2YRLA 4J2XA 4TPRH 3FO0L 4RFOL 2XWTA 1V7MH 4JDTH 1EIBA 4OQTH 3WL9A 3H9YA 1YNKL 4PRPA 2BJML 4QRPE 2DYPA 1JRHI 1OQOA 4HJJH 5E8EB 1DQJA 3QI9B 3TIDA 3RIFF 3A6OA 1GZPA 2J8UE 2EXWC 1ES0A 3G5VB 4XVSL 1BQHG 3UTPD 2X70A 3LN4A 3RWHB 3OPZL 1PX3A 43CAB 4L3AA 5HJ3A 3VFGL 5ILTL 3AS3A 3LEYH 3W9DB 1JNLH 2AQ2A 3N85H 1AO7B 1OAZH 2R69L 2W0LA 3HB3C 4QRRD 5D8JL 1YMMA 4RGND 3RAJL 4FQ1L 4HFUH 1G6RL 1NGXB 4OZIE 1NCUA 4GRWH 5F44A 3VWJA 3GMOA 3MRGB 4AYFA 3QIWA 5F7EL 5IB4B 1H15A 4H26A 2C1OB 4PREB 4UTAH 1NDGA 1A1MB 2XYCA 1T04B 3TO4D 2XZAL 4TUJA 4WI2A 3B3IA 4M7LT 3WS6C 1MLCB 3E6FB 2I27N 4KI1A 1IKNC 2EDEA 3TZVD 3QH3B 1I7RA 1A1NA 2A6KA 4H0GA 3O2VL 3QDGE 3MREB 4OFYA 5JMRA 3NFPA 1MCHA 1NCNA 3KWWB 3P4NA 4JQIL 4JQXA 1RFDH 3MV8D 4LFHG 1CLYH 4XB7A 3DV6B 5HI3C 1JYVA 5T1DL 5H2BA 3KXFA 4QRSB 5D96C 5C6TL 2Y5EA 3MJ9L 4U1LA 5HYSA 2MCPH 4F7TB 2FRGP 2IEPA 4LLYB 5F9DC 2IQAB 1BVKA 2M26A 1KCKA 3ZYJA 2EDXA 1KJ2H 3P9WB 1C7SA 1S9YB 1FO0A 4MMXC 2D7PA 4HH9B 4I0PB 4JRXB 5L7XH 1EGJL 1JPST 3SKUD 4NZUH 2FCBA 4FNLH 4U1GC 4HS8L 4JHWL 4GS7C 4KY1H 3M17A 1P5VA 1XCTB 2QQQA 3B9DA 3CPLA 1QFUL 2QJDA 3FMGL