3FO9A

Crystal structure of aldolase antibody 33f12 fab' in complex with hapten 1,3-diketone
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
219
structure length
219
Chain Sequence
ELVMTQTPLSLPVSLGDQASISCRSSQSLVHSYGNTFLNWYLQKSGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQGTHVPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin IGG2A - light chain
publication title Direct observation of an enamine intermediate in amine catalysis
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 219
sequence length 219
chains with identical sequence L
ec nomenclature
pdb deposition date 2008-12-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo9A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fo9A01
1OP3H 5F1SA 1X5YA 4JN1H 3OPZL 4UU9A 1DVFB 2A77L 4NHCH 2Q87A 1AY1L 2DQEH 1MFBL 4F7MA 4FOMA 2DI7A 1AI1H 2HT2D 3SGDH 2B4CC 5EU5B 4OD2B 3KHQA 4WHTB 3VXUE 4XPAL 4NUJB 5DFWH 4RMSA 5TJWK 5ICXA 4HUWB 3EO9H 2R1YB 4NHCL 5IMOB 2NZ9D 1AI1L 1I3RA 1ZS8B 3PWLA 4R2GD 5CP3H 4HGWB 1NAMB 5CINL 1S8DA 5TPWH 3P4NA 1U8KA 2IH1A 1NLBL 5MENE 1AD9A 3NGBB 2L4OA 3EO9L 2P5EB 2Q8AH 4RDQF 5EZJA 1WUNT 1A1NB 4WO4C 4XMKH 5K9QI 1RZGB 2X70A 4D0DB 1LMKA 4JGMA 1LE9A 4X7EC 3E6HB 3HUJE 1ZGLA 4O4YH 2Q7YA 4YDKH 2OJZH 3BPCA 3IXTA 5HGHA 2FD6H 5TPWL 4HPOL 3UTPD 4CDHA 1FL3B 1LQSR 3VWJA 3UX9B 5F6IC 5JR1H 3LQZB 3SE3C 3P77B 2E9IA 3WUWA 1Q9KA 3O6FD 4ONGH 3IFNH 1NBVH 1IARB 2H32B 3X3GH 4O4YL 4YDKL 5C0AB 1B2WH 2OJZL 4DCQA 3VXNB 1G6RB 2J1KA 4I3SH 3SDAA 5JR1L 2NY0C 3GMMA 4YXKH 5BRZA 2FJFA 5CCKL 3OKLA 4ONGL 4LRNL 2VXVL 1JPTL 5DHYB 2ED8A 3X3GL 1B2WL 5T33L 3STBA 2DQIH 1E4KC 5JDJA 4I3SL 5GGUB 1QSEE 5H94B 3ZT5A 4F9LC 3LV3B 2UYLA 1I7UA 4PJ7B 4PYHA 4YXKL 4ZFGL 2ZKHH 2FYYB 4OUUB 3AMLA 2RB8A 1Z9LA 2DQHH 4CMHC 2FJHB 1EJOL 3BGMB 4U0RB 3L3OA 2O26U 4AEIH 4OZHE 2DQIL 2NLJB 4Z8FH 3MLVH 3MRQA 3CSGA 1H3TA 3SY0B 1KJ2H 1AGBA 3VA6A 4LGPB 3VFUA 2AI0L 3V7AG 2ZKHL 3WFHB 1J8HB 4HIHA 2DQHL 2K7QA 5BVPH 4U1HA 4LPUA 2AXFA 2EKSB 3U4BH 5F72S 4AEIL 1NFIB 2XZQH 4PJ8C 3U6RA 3F7YA 2QR0B 4Z8FL 5CKGA 3MLVL 4JFYB 4LP5A 4X0KB 1F4YH 3JWNC 1QPXA 1KJ2L 2AK4D 3UAJD 3L7FA 4MNQD 1HHIB 2APFA 4KJPD 5FCUH 2APTA 2A6KA 5HVWA 4XNMB 5BVPL 3D2UA 3U4BL 3RUGF 1DEEB 5E6IB 3VFGH 2UZIH 4FFZH 2W60A 3WV0A 2BRQA 4YBQD 3KLHC 4JQVC 2NXYC 1P7QD 4NQVA 1F4YL 1UZ8B 2G5RA 3D1MC 1NBYA 2IBBA 3PV6B 3QUZB 4R7NB 5FCUL 1CE1L 4TVSa 4LSVH 5C0BE 1SJHA 3BZ4A 1MCHA 4M5YH 1S7QA 1R3KA 3VFGL 2VLLB 1GOGA 3PDOB 1K8DA 4FFZL 4F15B 4GG6E 3P4MB 3G5ZA 1MRCL 5D72L 4P46B 1I8MA 5FM5M 1CI5A 4HK3N 2R8SH 1FV1A 3D69B 4OGAD 3T77B 3KYKL 2APXA 3SCMA 4HWBL 3OMZA 4I2XB 4M5YL 3ZDZF 1CL7H 2D31B 1D9KC 1H0DA 2FSEB 2Z35A 2KQNA 4QWWC 5C0JB 1MIEH 1TVHA 1UCTA 3GMLA 1RZKH 1JHTB 3RPKA 3TYGL 2R8SL 3EOTH 3TBTA 2HLFD 1KSRA 3AAZA 4YUEH 5EPMA 5DK3A 4G6KH 1WT5A 2QADC 1CL7L 5L9DH 1OY3B 4HKXB 3BHBB 5GSRB 4QT5B 4AK1A 1QO3A 4PD4J 4FFVC 1RZKL 4YZFF 4HUXB 3ZYIA 3EOTL 1JYXA 4HHAB 5CSBA 15C8H 4M8VA 5BVJA 4AM0B 3ECBA 1IM9D 4YUEL 2ZSWA 4GBXA 1EEUA 4PJGA 3PGCA 5L9DL 4NO2B 3T0EE 4EIGB 1IJ9A 1JNHA 5SWZB 4EUPG 3TO4B 1BMGA 5T1LB 3L3JB 4O5LH 1SMAA 4JM2D 1KUMA 1QSFB 15C8L 5D1ZC 1UQSA 2X1PA 1ZHLA 5INDB 3CK0L 5E8OB 3H7LA 3MRPA 4G9FD 1NGWA 3G6JF 4NRXA 3N85L 4QXTB 2FZ3A 2XQYK 4NRZA 4YAQA 4Z7WF 1RFDH 5KSBA 3NFPB 1MJ7H 2YD4A 3LCYA 2JE8A 4G80A 2WBJC 4IIQB 3D39D 1BF2A 2VIRB 2JJSC 3RL1A 1NEZA 1QFUH 1WIOA 3VGGA 4TUJB 4FQXD 3FO1A 3ARBC 4ZS6D 3K81A 4MD5B 3K4DA 5D1XC 5SWQB 2J4WL 4PJIE 1RFDL 4CJ0A 3MJ9H 5FO9B 2QQNH 2Z8SA 3H9ZA 4NQDB 3H9SD 4UILH 3ARGD 4JANB 5L2KB 2HRLA 3S8WA 2LU3A 5DHVA 4YDLB 3TJEH 1FVEA 1U3HC 3MMEB 2ARJB 5DK2B 3L95A 4JY5H 5JIIA 3HMXH 1CWVA 4QHNB 1IL1B 3KPRD 1OCWH 3DX9B 3VI4F 1P9MA 4AH2A 1NCBH 3MJ9L 2GK2A 2QQNL 2FO4B 3OJDB 3VD3A 2CDEB 5DQ9A 2VMFA 4RMTA 3HMWH 2CRYA 4M8QA 5GGVY 2XA8H 4NZTH 4UILL 1QRKA 5GGRB 3T3MF 4U1SA 3G9AB 5F9AC 5DMYA 5I76B 4WU5A 3TJEL 4U1GB 4J12A 3UJIH 1P5VA 3F7PC 3O2DL 1EVTC 1OCWL 3CU1A 3BN9D 5DVNA 3RNQB 5C0NC 3QA3B 2YK1H 4GG8A 5IB1B 1KJVB 3B8SA 3L3HB 1BQUA 2GYSA 1KPUA 1IAKB 2XA8L 4NZTL 4QHUB 5SWSD 2DQTH 1AKJA 4GKZB 5HBBA 1P84J 2MKLC 2HFFB 3MV8E 3UJIL 1WIPA 4RGOL 1DQDL 3DYOA 4JQIH 4L8SC 3CFBA 4BQCA 3IRPX 1OAXH 3Q48A 1BQLH 1VACA 4F7PA 2DQTL 2CXGA 2F54B 3T0BA 2XTJD 3GI8H 1RUKL 2Z8RA 1KF9B 1TVDA 4PRNB 5E2UH 2I9TA 1BFOB 4PRIB 1A4JA 4OLUH 2FWOA 1G7MA 4JM2F 3EGSA 3K2UH 4Q0XH 1FN4B 1R24B 3VWKD 3PP3H 4DZBB 3CVIH 3FZUC 3OB0H 4HWNA 3GI8L 3I50H 4OZFB 4R7DB 1KIPA 3EBAA 4JRXE 1BWWA 1WZ1L 3INUL 2P8LB 3MNWA 5I30H 1HH9B 1ZTXH 3RY5A 3OAUH 3C09C 1CLZL 1T80A 2PYEE 5D6DA 5EA0H 4Q0XL 4EBQH 3AUVA 3SN6N 5C3TA 3CVIL 4CN1A 4BSWB 3I50L 2G75A 1RJLA 3D6GA 5DJYB 5HHNB 2VITA 4Y4KD 3TIEA 4BFBD 4X7DC 5I30L 3RPIA 5TE6H 1ZTXL 3OAUL 1BOGB 3I6KA 5IEKA 1NFDF 4N0UB 5KSAC 3FB7A 3T1WA 2HVKA 3RVWC 5EA0L 1CDCA 2AW2A 4EBQL 4XNXH 4HH9B 4JGJA 1MCRA 4DGYH 4X4XB 3DO7A 3P30H 1AH1A 2PW1B 4CVWA 2JB6A 4WNQB 3R1GH 1PLGH 3HZVB 5BZDB 1MIML 3VI3F 2FNBA 3SJVE 4BYHA 4U1JA 1BIIA 5FYKD 4OZGA 1JGDB 4KRNA 1RJZA 2W59A 3GRWA 3OF6A 4Y19D 4C4KO 4WW2A 2YSSA 4I1NB 1CD1B 3JUZA 3P0VH 5FECA 3QSKB 4DGYL 4JZOB 1RUAH 3P30L 1WC7A 1U95B 2JLLA 3V6FA 1N8ZA 1IFHH 1HSAB 1XGTB 4R6UA 5FM8A 1OSPH 5IFAL 4R90H 1VFOA 1FAIL 5CSZB 5ECJE 3HAEG 2IANA 4F3FB 3P0VL 3SPVB 1JZ5A 2VYRE 1RUAL 3VDAA 4LLWB 3MUHL 1XR9A 1Y6KR 1JIBA 1IFHL 3RAJH 1I85C 2R1WB 1OSPL 2E8YA 4JKLA 5IFJA 2GFBA 4OD3H 3U9UB 1OB1A 4JN2B 4M1GL 3ROLA 5HHMB 5E6YA 2ZG2A 5HVFB 1JV5A 1SYSB 4JJ5B 4V1DB 5DJ0B 1OGAA 2YC1B 3RAJL 1D5MA 3FB8B 3MLYH 4WUUE 3T65B 3P4OA 4TTDD 4OD3L 4U1IB 3CZJA 1K8IA 4ONFH 4IOIB 5CIPA 4ENEC 3ARDD 2VXTH 4YFLI 5B22A 2DJ4A 1CQYA 2DL2A 3PQYE 4NO0D 3MOBH 3CDYA 1R5VA 4H1LA 5I6XC 3PXJA 5KS9E 2IGFH 2H1PL 2H2SD 1PDKA 5F71A 4ONFL 1MPAH 4ZPTB 3TFKD 4JFZH 4ISVB 4TNVF 3QJFB 1IC4H 2NX5E 4KRPB 1LDPH 2Z92A 1IKFL 1EHXA 5JQ6H 4BSJA 3GSWA 3HZKB 5HYSG 4JFFB 2R1YA 1BVZA 1U8PB 2IGFL 3CLFH 5IMOA 1T20B 2WLZA 1YEEH 1QYGH 2HMIC 1ZS8A 3BDBA 1MPAL 4HGWA 3PG2A 3WLBA 1I4FA 1IEAA 3J8F7 4YHOH 3MGTB 4JFZL 4KRMB 1IC4L 2IH3A 3RVVD 1S5HB 3EOAB 4O2EB 4LCYA 1NMCC 5T5FL 1CVSC 3T2NL 5GGSB 5C9KA 1QNZH 1YEEL 1IGTB 1RZGA 1SBBA 3E2HC 4FQJH 4OCNC 3DV6B 4H0GA 3GBMH 4JPWH 1UB6B 2IMNA 4YHOL 2DM3A 3PGDB 3O3DA 4RISL 1EERB 4Y2DC 1GGUA 1FL3A 4MJ4A 5F9DC 5KOMC 3RY6C 1YN7A 2EEAA 2ORBL 2X4SB 3LQZA 4L9DA 1QNZL 5I74B 1CGTA 3SDXB 4HH8A 5DJXB 4YFEA 3VWJD 1HCFX 3GBML 4ZTOH 2H32A 5TDPB 5C0AA 3HUJF 3OL2A 4DZ8B 4LNRB 4B50A 3E3QC 5TQ2H 4X6BB 2BVYA 5J57B 4P5TB 4N8VG 4TSAH 3LB6C 4XZUB 3WDHA 4N1HB 4NC1C 1AD0B 1N0XL 4PP1C 2VRAA 3FT3B 1P2CB 5JUEL 3BDYH 1R3LB 4ZTOL 3S4SA 5BRZD 1U8NB 1AR2A 5C9JB 2YZ1A 3KPTA 3UBXI 1IT9H 1MLCB 4WI3A 4KU1A 5D93B 4TSAL 3P9LB 3TBSB 1HHGA 3TA3C 3VE0B 2FYYA 3FQRB 4O58H 2FJHA 4YBHA 4R0LC 4LPXA 3BGMA 2ZSVA 3QPXH 1M7DB 1FO0L 4M62L 2NLJA 2R2HB 9CGTA 5A43C 4L8CB 1IT9L 4DUVA 3RTQC 4YHLH 3SY0A 4L8DB 2R9HC 3GSRB 3MRGB 1OTUC 2Z9TA 4J3SA 4MA1C 4PGCA 4O58L 3QIWC 4P99A 3WIFB 4Z77A 2GSIA 4XNUH 2W07A 1D5BB 3QPXL 4K9EC 5F8QC 3V95A 1NFIA 2ARJQ 3QUXB 2FX8H 4P2QB 3P73B 4JFYA 4OZHF 5E4IA 4YHLL 2A74A 3DIFB 2EIZB 2P5EE 3D9AH 1F97A 1J12A 3CXHJ 1UCBH 4XNUL 4XNMA 2V5RA 1S9YA 4ZUTB 1FRGH 1DEEA 4Z7UA 2FEDC 4PS4L 4X4ZA 3D2UD 5EUKA 3KPSE 1FNGB 4FQ1H 3IJSB 1E4WH 2WM0A 1UZ8A 2IAMB 1NQBA 3LD8C 5FYKL 2DJSA 2WWMD 4HGMA 4P3DB 3QFJA 2IG2H 2WAHA 1OD9A 3TC9A 4WGWB 5MP6H 4APQA 3IVKB 2DMKA 1ULVA 4WFGE 3PDOA 3RHWF 2HKFL 5LQBH 4BH7B 3P4MA 4TYUA 4K7PL 1E4WL 3MRFB 4LRIC 1OP5K 5DLML 5BS0E 3F6IA 2KZ1B 4JFEB 4JPIA 5HYIA 2B5IC 3RX5A 2IALB 3T77A 1I9RH 1A6AA 4ZTPL 5I16A 4I2XA 4P2RD 1TZGH 5LQBL 1PKOA 2CLVB 2FSEA 4NKMB 3SCMD 5D96B 5E7BA 3QNYA 4NT6A 4OCWH 3QR2A 3A67H 3P2TA 2R2BB 1T5WA 4Y4HC 4ZODA 1I9RL 1SJEB 4PJ7E 4S1SH 1OAUH 2H9GB 1T83C 3U4EB 2EE6A 4V2CB 2YEZB 3SBWC 4G43B 5JXEA 1TZGL 5GSRA 1X3DA 4QT5A 4WHDA 2NY1B 4PJEE 5SV4A 4XI5C 4H88H 4E9LA 5C09A 3A67L 3O41A 5KAQG 4FNLH 2VLKB 4S1SL 4Q58C 4ZS7H 4R4FL 1RK0B 1LHZA 4POZD 3RWEA 5SWZA 5KTEH 2R69L 1E28B 4GBXD 3REWB 1MCWW 4XPBH 1XCQB 2ERJB 5T1LA 4H88L 1IGCH 2FEEL 3LQAH 5JZ7C 1A9BB 3O11B 4FNLL 2G2RA 4CL7A 1T0NB 2PTVA 3WFZA 2LTQC 5E8OA 3W39A 5M94B 1DZBA 5IMMB 3H3BC 2X4OB 1G7HB 1J10A 4O02L 4XPBL 4RWYL 4HIJB 3REVA 4XXDA 5M7QA 1IGCL 5J12C 2IF7A 2CKBB 3ROOB 3DX8A 2XQBH 1ND0A 2EDLA 1LO4L 4JZNA 4TUJA 4EZMA 4RAUA 3B9KC 2AABH 2JJTA 4WI7A 4MD5A 1KIRB 3I75A 5E99H 3O3EB 5LWYL 5FO9A 5IMLA 3K46A 5CLTA 5HTSA 2XQBL 1LK3L 3NA4A 4YR6B 5FGBC 3RU8H 5BMFL 2X4QB 3AB0C 3MMEA 3LKNA 1NGXB 2N56A 5C1MB 4WFHD 2ZG1A 4QHNA 1TZHA 5IR1B 5E99L 5DRNA 5ERWA 2MCG1 2CDEA 4PJIF 5C0DA 4LASH 4UIKH 3IYLW 3Q6FA 3GJFB 5CUSH 5HYJB 2XI9A 3FKUS 5FB8A 5FKAA 5HI3D 4Y89A 5JOFA 4XNQB 2UVEA 4YDJA 4HJ0D 3QI9A 3RNQA 2GJ6E 2CO6B 3MPCA 4LPTA 1S9WB 3WNLA 3L3HA 1BFSA 1ACZA 3FONA 5I8CB 3DVGB 3DRTA 4GKZA 2ZUYA 4DGIH 5E2TH 3RRQA 3WD5H 3C8DA 5GRZA 2CMRL 5ADOH 3GMQA 5IJKC 1AJ7L 1ZHKA 1MFDH 4OZIB 3BZFB 1NMAH 3CDGB 4UB0H 4HIIA 1BX2A 1VCAA 2Y5TA 4NNYB 4OAWB 4POYA 1GOHA 3P9WB 1QHPA 4JDVA 3TT1L 1FYTB 2A6IB 2YXMA 2JCCB 3S6CA 1EFXB 4DGIL 3WD5L 4XRCA 4WO4B 3M17A 1A21A 2WP3O 1VKXA 2I9LA 1CCZA 1B4RA 2J7LA 1NMAL 4PRNA 1WJ3A 3C60C 3BP6B 3QIBC 5CWSB 2DQCL 1ZLUK 3DXAE 2OR8A 2XN9D 4B41A 3O3AA 2IC2A 2IFFL 4U1MA 2PN5A 3OJ2C 5DGQA 1FN4A 5F6IB 1R24A 2YRZA 1I8LC 3T2OA 3D0LA 3EJZD 4DZBA 3VGHA 1MFNA 3MR9B 5C6WH 2UY7A 2VISB 5HHVL 4Z18A 3EZJB 2HRPH 4NZUH 1RZKC 4Y2OA 1X5ZA 3KPQB 2NY0B 4NQDE 5CBAB 2WIIB 3GK8L 1UM5H 3SGKA 5HHNA 5LGKA 1ZWIB 4KV5E 4XCYB 4C57C 4LAQH 3P9MB 4L4TA 4KHTH 4F37K 3QDHA 3V6OC 5I71C 2HRPL 1BOGA 3O4LD 2COQA 4N0UA 4FXLA 4PG2C 2OTWB 2HT2C 5E6ZA 3FMGL 3EYUH 3EOBB 3BPLC 1K5NB 4WTWA 4PRPA 4LAQL 4CMHB 5C6PB 4OCMC 4WNQA 5E2VH 1OAYL 3NIGF 3HZVA 1T7ZA 4N0FA 3NCEB 4NYLB 5BZDA 2ZPKL 3BH9B 5CAYB 2NZ9C 4ZUUA 5FF6B 2OK0L 4R2GC 3NABH 4LLYB 2W0PA 1BBDH 1IGYB 4OGXH 2CDFA 5D2NC 4LAJH 4OV6F 1SYVB 4LLQA 2DTSA 1KPVA 2HJLB 3WNKA 2CIIA 5IK3B 4PR5B 3ZKNC 1WITA 1U95A 5E2VL 1AGFB 1K3IA 4F2MB 4PJ8B 1S7VA 4MJ5A 3TBWA 5DEFB 5IW1A 3TPUB 1TTGA 3NABL 2HH0H 5CSZA 4OGXL 4BQ6A 3ZDXF 4YHMH 1FZMB 2IAND 2F54E 2DD8H 4P3WA 5ICYB 3WNMA 1U8JA 2UUDH 2RBLA 4JM4H 5DVOA 3BN3B 4JO2H 2NXYB 1W72H 4OLYH 4FP8H 3EO1B 1YUHA 4PRIE 4MXWH 1KELH 5I18H 1LP9A 4FQIL 3V8OA 2AJXH 4RFNC 4YHML 5ACLA 3BJ91 2DD8L 4G6MH 2PO6B 4X9GA 3IS1X 3M07A 1J87A 1T1XA 5LBSH 3W9EA 1RJCA 4JJ5A 4V1DA 4JM4L 4JO2L 5SX5K 3FB8A 3T65A 3IGAB 1W72L 3VFMB 2XRAL 4OLYL 2VDMH 4FP8L 4U1IA 1OGAD 1CG9B 1QSZA 4MXWL 4IOIA 4JDTH 2E6QA 5E5MA 1KELL 5I18L 3C6LC 5IMKA 2AJXL 1CFQB 3FOMA 2V5MA 3QG7H 4WU7B 1CU4H 4FQ2L 2CJUH 3WJJA 2LE9A 1D9KB 1RZIA 5EFIB 4P2YA 5B39B 2QQLH 3BQUD 3VGFA 3QHFH 1H3VA 2VDML 4KGJA 5CZKA 1RD6A 4RBPK 3P40A 1YEKH 3QG7L 3LN5B 3B9VA 3FQXB 4YJZL 3UTSD 2CJUL 3V7MA 3MREA 2Y6SD 5HY9B 2I60L 4XNZB 5CJBA 1BVLB 2AJSL 4NFBA 1CFNA 1N5YH 3DTXA 2X4RB 2EDNA 2OTPA 3QHFL 3OAYH 2BNUB 1A6VH 2C3VA 4UZGA 2J12B 4H5SA 4OQTA 3MGTA 2CUHA 3OKMB 4LL9A 3MV7E 2B2XL 4EN3C 3UAJC 2CUIA 5CS7A 4KJPC 1A6VL 4XBGA 1VESA 4XBEL 3CVHH 3QEGL 1T6VN 4IHOB 3SDDC 4XTRD 1MJ8H 3BZEA 1R5WB 3PGDA 4LEOA 5D1ZB 1XGRA 1C16A 4NN7C 3NCBB 4GW1B 4R4BB 5FOBA 4WW2F 4K23H 1VFBA 5FV2A 2VR4A 2D7TH 5A3ID 4U6HB 4WDIB 5HDBE 3MOAH 2WBJB 4YDVB 1AR1C 1MJ8L 4NUGH 3HPLB 4HWEL 3KLAB 1G7IB 3ARBB 5C0AD 3QCTL 5D1XB 3JTSA 5C92A 2CXKA 3LQMA 4P5TA 1C5CH 4OGAC 2D7TL 5DQJB 4XZUA 1P2CA 3MOAL 5BV7H 4PJ5B 4N8PA 4M3KB 4U33A 4TUKH 1PZUB 2GCYB 4NZRL 3V6ZB 5C0FA 1J0KA 4GH7B 2YD6A 1U3HB 4QHKJ 2OJEA 1MLCA 5ANMA 4JFDB 5GGRY 1C5CL 4NNPL 5DRZB 2HLFC 3VE0A 1W0VA 4OZFG 1GJIA 2LABA 5GS1C 5BV7L 4Y1AB 4F7TB 3RVUD 1UKQA 2WUCH 1KIUA 1JUFA 1KIQA 1HHKB 1JGEB 1T7WA 2R2HA 1ORQB 5CHNB 1IGIH 5D1QA 3FQTA 4L8CA 2P8MB 1A6WH 4HCRH 2YRLA 3GSRA 4KXZI 5ILTH 4L3EA 1N6VA 5JOEA 3OR7B 4JFFE 4HKJB 1VENA 3GUTB 1C8PA 3ALPA 1NJ9B 2VDLH 2WUCL 3VH8B 1ZV5A 1TNMA 4P2QA 4B7LA 4DW2L 1LE5A 1BLNB 1IGIL 4O9HH 1UH3A 5JPMB 1WBXB 3NCYS 1A6WL 2B1AH 4HCRL 4J4PC 1BQHB 4L8SB 5ILTL 1UACH 2HYMA 2XWJA 5IG7B 1B9ZA 3B3IB 2D4FA 4ZUTA 1UB5B 3QPQD 4KH2A 4PJ9A 1NCUA 3LVEA 2WBWB 1OP9A 3HC0B 4O9HL 3IJSA 4B7IA 1JNLH 4ZO7A 4PJXB 1AO7E 4IJ3C 3C5ZA 1T0PB 4NNXB 3LN9A 4NZDA 4YHNB 1AFVH 1S3KH 4FQXC 1FQ9C 3SDXE 3LKSA 2VQTA 5GSVB 2F15A 3QFJD 3MYJB 3QG6B 2J88L 4APQD 2BVEA 5DF0A 1JNLL 1TJIH 3U0PA 1X4ZA 2BY1A 4PGDB 5F7EH 1MAKA 1MWAA 3ARGC 1IEHA 3ZHDA 2R23A 1AFVL 3C09B 3IDGB 4P2OA 4L9LC 4HFWB 3O81A 4GXUM 3OR6B 3CMGA 3IFOB 5TGBB 6CGTA 2Z8VC 4P59H 3QXTA 3CXHK 1TJIL 2RJMA 2W65B 4UTBH 2CDGA 3HPJA 3S34H 5IUSA 4JFOB 5J13C 3C6SB 4EI5A 5F7EL 2GTWA 5TDNB 1NKOA 4ZOAA 5KSAB 3SDCB 4M93B 2FATL 3ISWA 3TVMA 1E27B 3BN9C 1T3FB 2X7LB 4UTBL 5JXED 4K55A 3QUYB 2IWGA 5IB5A 4L1DA 1NC4B 2E9JA 3Q2CA 3QQ9C 1RK0A 5C09D 1CF8H 2P5WE 1K6QH 4PJ7F 2WW8A 1HXYB 4PGEB 3WSQH 1CDJA 2GTZA 4MWFB 4GSDH 1XCQA 3S5LB 1TNNA 5SWZD 3UPCA 4IMKC 1A9BA 3O11A 4LCUA 1MLBB 3MCKA 1MF2H 5D7IA 3T0VA 1X5XA 2QSQA 4BQBA 2PW2B 1CS6A 2XTJC 3MRKB 1I3GH 8CGTA 1ZVYA 4CRPA 4K3EH 4KK5D 1G7HA 3V8CA 3IJHA 3WSQL 4GSDL 5DMGD 3ILPB 1NCWH 3ZT7A 4QRRD 1V5JA 4ORZC 3U30C 4DVBA 4R3SA 1MF2L 2Y7QA 4H25A 4TRPH 3VWKC 4RZCB 4KKCD 5C0EB 1I3GL 1S7UB 3T1FB 1RSFA 3ILQD 2BNQB 1F00I 1NCWL 1N3NB 2RQ8A 5DJAA 3HAEA 5D2LE 1UYWL 3RWHA 4YHYC 4Z7UF 4NRYA 3QXAB 2Y1VA 2ATKA 4TRPL 3S36L 3ALWA 1T2QH 2JB5H 2DIJA 2NY4D 3HZMB 1NGXA 3DNKA 1LILA 3OGCA 1N7MH 4LFHD 4JVUA 3GMRA 1BFTA 4MJIE 3K4ZA 4O51B 4U6TA 4GUPB 1AE6H 4OCLC 3HE7B 1AGEA 1JFQH 1F4XL 1T2QL 4KK6C 5E8DH 3PUCA 1XF5B 1G7PB 1N7ML 3IETA 4ZPVA 4CW1A 3MZTA 1KG0B 2F5BL 1TPXC 3HA0A 4OM1L 1GGTA 3QI9D 5I8CA 2DLGA 4D8PA 3DVGA 4WVRA 3BGFC 1JFQL 2C7UB 5E8DL 5I1LB 2VLKE 5K93A 2O61B 3QYCA 3EAKA 2VABA 4J6RH 3RX7A 5GGSY 3BZFA 2VXQH 2NW2A 2J6EH 4NNYA 3OX8A 1UXWB 1KTRL 1NMCB 3CAFA 3KAAA 4I3GA 2QEJA 1KJ3H 5ALCL 5JPNA 3ARZA 3E2HB 4J6RL 2P46B 1MJUH 3UTZA 1BZ7B 3KYMA 4RGND 3F7VB 1FG2B 3U1SL 2VXQL 3BP6A 2ICWB 3TCXA 4Y2DB 3ZZ1A 4LSRH 1WEJL 2R0WH 3SE3A 1KJ3L 1U8OB 4UV4L 2ZOLA 1YQVH 4NN5C 1F3DH 5C07B 4CDGC 2D0HA 1H3XA 2W9LA 1HN1A 5H35B 5C0GA 1LGVA 4LSRL 2PUQT 1DQMH 2PNDA 3ZE0E 2Z31A 5ELIA 3LSOA 4E41B 3KPQA 2R0WL 4MHHG 5GRUH 3TH2T 2UY6A 2BC4B 3DV4B 2GEEA 2J3SA 3FB5B 1YQVL 4XMLH 5C7XH 4EKXA 3HR5B 5EOCL 5IV2B 4L4TD 5KVGL 5EU7E 4MQXD 2OTWA 1E4KA 1XF4B 4KKLD 2UWEB 1OD7A 4GAYB 4MX7A 3OB0K 5GRUL 3UJJH 3VXPA 3TFKC 2IADA 1BM3H 3TA3B 2VLMD 4EOWH 5HYJE 4QNPF 4NQEB 4N8VA 4YGVB 5C7XL 3ULUD 4KV5F 4WV1B 5IM7A 1EDQA 5IB2B 4PRPD 5ALBH 5IP4A 4LPCA 1N0LA 2OR7A 3HG1B 5EBWB 2BNRB 5HDQH 3RTQB 1FZJB 4LLYA 1IGYA 1YYML 2QSCL 2VR9A 3UJJL 5CEZH 4MA1B 5EN2B 3OKEA 2EZ0D 4JB9H 2Y07L 3JVGC 1VB9A 3NIDE 5IK3A 4PR5A 3QIWB 1I1YA 3RVVC 4DKAA 4EOWL 3VD7A 1AGFA 5IBLC 5F7FA 5T3XE 3AS3A 5EC2B 3ULSA 1DLHB 2PCPA 3RWCB 1AGCB 4PJ8A 1JPFA 1EXUB 4OZIE 3K74B 3LKOA 3MLXH 5FGSA 3DSNA 1CYGA 3S97C 4TN9A 1FYTE 4DK6A 2JCCE 2ZZUT 4JB9L 4Y5YA 5INCA 3VG0H 5E95B 3QHZH 2BZDA 4J3WA 5JA9A 2UZXB 3PQYA 3MRNB 4IRJC 3LRGA 1U58B 3CX2A 3HRZB 4LCWE 3MLXL 1A1MB 3OZ9H 3VWJC 3SDYH 5D70H 2Y72A 4KK8D 5FKPA 4JE4B 3VRLF 2BXYA 3QHZL 3RP1A 5GZND 4PJCE 3FO2B 3E8UH 3VXUD 4X7CC 3LN4B 1ZE3C 4FG6D 2ADFH 3FB6A 3OZ9L 4ONOA 3SDYL 4JREB 4JR9H 4LCCC 4LSQH 3BO8A 1CGXA 1TMCB 2AV7B 2B5IB 4QRUB 2B7DT 3D25B 4JKPH 3LEXA 4EQ2A 4ODUB 3QWRA 4A6YA 2X2YA 5E8PB 2ATPB 1F6AB 1BD2B 1PG7X 4KJQD 1XGPB 5B39A 3KYOA 2ZOKA 4LCIH 4JR9L 2G60H 4LSQL 5MEND 4WEMB 1JGVH 4JKPL 3DGCR 25C8H 4Y4HB 3T8XB 3LOWA 1CGUA 3LN5A 1CGWA 1T1WB 1U8MB 3SKUD 2VXUL 1F90H 1CFBA 1T04B 4MNGA 4KRPD 3QQNA 1EHNA 1WSST 4HV8A 2YS4A 3IDJA 4LCIL 2G60L 4UIMB 5E70A 5JW3H 2HKHH 3L3IA 1JGVL 1MCBA 4PY7A 1NANI 4K7FB 1EAPB 2EO9A 2N4IA 1F90L 4KK9D 3I3BA 1C1EH 5DC9B 1HXMB 3MJ8B 5IHBA 3ULVF 3BP4B 3MO1A 1BBJA 5EO1B 2K9UA 3T3PE 3WUZA 1KBGH 2B0SH 5JW3L 4HWZB 3LRSB 2ICEA 1KN2H 3MRBB 1JE6A 3DI2B 5D1ZA 3H9HB 1RU9H 2LTQB 1B0RB 1C1EL 3QWOB 3WJLC 2WWMC 2P8PB 3B6SB 1KBGL 4UI2A 1PEZA 5J12B 2WBJA 3QXDA 1KN2L 3IDIB 4X6EA 3HPLA 5HHOB 1BVKB 1OSZA 2X4NB 3B9KB 4UT6H 5D1XA 4GMTH 4UQ3B 3VXSA 5KW9L 2CR3A 3FT4B 4V2BA 5DQJA 2WLYA 2YA1A 2YRPA 4PJ5A 4M6OH 4EDXA 2AXGB 4NKDA 2GCYA 3FFCE 3V6ZA 5TE7H 1A64A 1DANT 1I7ZB 3AB0B 3L1OH 3PABA 1KB9J 3AFLA 1SJVA 1LP9F 4GMTL 1L7TH 4TUOB 4JFDA 2QV2A 3IXAA 1HINL 5F1NA 2HTLD 4M6OL 3GM0A 4KJYB 5TE7L 2NPLX 4XH2B 1WT5C 3RIAK 1A9EB 4IOFD 4WWID 1K2DB 3QULA 4D0BA 1L7TL 3OKKA 2ENYA 3LZFL 4LU5H 5D1QD 1LO0H 2BSTA 5EULV 4FXKB 3Q5YA 3GUTA 3SKNB 5F89A 1YA5A 1KXVC 3WNOA 4L3ED 5ADPH 1A3LH 3DVNB 3BIBX 3BEWB 1NEUA 2YR3A 1CD8A 1G7LB 1BLNA 2BMKA 3UTTA 5T5NG 3I6LE 5C0BD 1WBXA 3VJ6B 4LU5L 5AZ2H 1YEFH 4U2YA 2VLJE 1LO0L 3CFIC 5BS0A 5I1HH 1QVOA 5IG7A 3BE1L 5ACZA 1AXTH 4NC0B 1OL0A 5ADPL 1YECH 3DROA 1A3LL 4HDIA 1MHEA 5DJ6A 5DEZA 3MX0A 2PKDA 4X99A 5IF0A 5FHBH 3RQ3A 4PREB 3HC0A 4KTDH 5J11B 4PJ9D 3QBTB 4PJXA 3EYVB 1V3JA 3KPPB 3VXMB 1YEFL 5DDHB 4HIXL 5E1AB 4YHNA 4M03A 3C5ZD 2XKNA 4H8WH 4Y16A 3UMTA 5F70A 2A73B 3MYJA 3MV9A 3PNWA 2X6MA 4OBSA 4PFEA 3QG6A 2VDRL 5FHBL 5EB9A 1H5BB 3FFDB 4RFEA 2X4PA 4WFFE 1T5XB 3GSVB 4NIKB 4PJEA 5KSUB 1NC2B 3VXRE 3GSUB 4Q9RH 3C5SB 4P57B 4H8WL 4HFWA 3T09A 4N1EA 2D7OA 3OAZH 3TBVB 4P2OD 4PJHA 3SDXF 3IFOA 1A7RH 3JWOL 5DR5L 4Z5RA 3NA9L 5BQ7B 2YPLB 3PF2A 4PV8B 1P9MC 2FB4H 1YNTA 1DFBL 2NY5H 1YEJH 2W91A 1JPSH 5TDNA 1I3VA 5J6HB 5KSAA 3CPLA 4EI5D 4QRQB 3EDEA 4W70A 4HJ0C 1A7RL 1E27A 2BK8A 2OQJB 1T3FA 4LEXH 1VPOH 3ARFA 3BPLB 3BP7B 3VFTA 3TGXA 1FVDA 1N59A 1YPZA 3TVMD 1ZHBB 5JDSA 2FLBT 2NY5L 1YEJL 1XFPA 1U8QA 5GS2H 4NPYB 5F7DB 4R2GB 3RUGB 3N1FC 5F7WC 5D2NB 4LEXL 3MRIB 4HZLB 2EDWA 3BD5A 4PLOB 5LXGH 1CLCA 1D5XB 3EW3B 4BM7A 4HUUB 2PW2A 4OFKA 1OAQL 1VFAB 1X7QB 2O5YL 4M5ZH 2VLRA 3UJTL 4NHUA 1CE6B 3L5XL 2UVFA 5LXGL 3LMJH 1XR8B 3BUYB 4X7TB 4MB4A 1I9JH 3IDNA 1GHFL 1L9MA 4CU7A 5IW6B 3RBGA 5F9JB 3EJZC 1I85A 1MUJB 4UQ2B 5B21A 3KNBA 2LU4A 3NCMA 1B90A 3O6FB 3QUMH 1KEMH 4QHLB 4MDJB 2O5ZL 1PSKH 1S7UA 3T1FA 4M5ZL 4LPWA 2FIRT 5IWLC 5DJZB 4YC2C 1KTDB 3LMJL 1V3MA 1I9JL 3WN5A 1FSKC 4EUPH 4KDWA 1PSKL 1F3JA 1H8SA 1MHHA 4MNHB 1YC8A 3FQNB 4OD1H 1Q72H 5GGVH 1EBAA 3MV8D 5HHPB 4HXAH 3BEVA 1U8HB 3DJ9A 5KVFH 3WFBH 1KCKA 2VSCA 4NP4H 5ISZA 3V2AR 4KZEH 4XVTH 3F5WA 5JXAH 1G7JA 3LHPH 3G6DH 5F7HA 1G7PA 3JV4A 4E42B 1DL7H 2X9WA 2FX9H 3AS0A 5KVFL 2BVQB 2Z91A 4NP4L 1LEKA 4KFZC 4ODVH 1ZOXA 1ZK9A 1BOYA 1GPOH 4XVTL 2C7UA 5I1LA 5JXAL 3U83A 3LHPL 5ID1B 3G6DL 2O61A 3V4VL 2YMXL 3T2PA 3G6JB 5H37G 1PAMA 3W0WA 4Z7WB 2FX9L 3GNMH 1RZ8B 2AJ3A 2V5SA 2F8OA 4ODVL 2AK4B 2WBKA 1P5UA 4YDIL 1GPOL 4MNQB 1A6TB 4NOBA 4HFUH 1CICC 4NQTA 2FH6A 1FG2A 1RUMH 3GNML 5GHWH 5J9PA 4NN7B 3G5VA 2AXJA 1P7QB 1KJMA 1CVRA 3KYAA 4GXUN 5A16A 1X5IA 4HUNB 3L6FB 4KUZH 1UZ6E 4X83A 3HNTH 4CVUA 5EU6A 4ETQA 4UV7H 2AEIT 4HFUL 2BVOB 1M6OA 2DL9A 1NCTA 2BDNH 4WTXA 1WCQA 5H35A 4Z7VE 4MA8H 2BNQE 3SGJA 1QKZH 1XZ0A 1FDLH 1MCLA 3CCHA 1CT8A 5ETUA 4KUZL 4U1NA 1G1CA 2Z31D 3SJVD 4DTGH 1MCIA 4UV7L 4OIIL 1J0ZA 3DECA 3FB5A 1FNFA 1VERA 2X4TB 3E6FB 1Z0MA 2BDNL 4AMKH 4QXUH 3D5OF 2NY6D 3MXWL 4IBLT 4KVNH 5TQ0L 4DQOH 4MA8L 4MCYA 3WS6A 1QKZL 2W0FB 3BQUC 1FDLL 2XZZA 4OZ4B 3WHXA 1XF4A 5TDOA 4GAYA 1T89A 3PWJA 3TA3A 3L7EA 4GAGH 1TJHL 2ADJB 3LKPB 4F80A 4NQEA 4R0LA 2YPKA 1SEBA 5JIPA 2Y6SC 1ETZB 4QXUL 5IB2A 1GZPA 3IDXH 4KVNL 2EDBA 4DQOL 2ZUQC 3HG1A 4KI5E 3RTQA 1IAII 1ZT1A 1XEDA 1RZJC 2D2OA 3OQ3B 1EO8H 1U42A 1HWGB 5H8DA 1IM9B 1TQBC 3QIWA 1G9NL 1IGMH 1PQZB 2ICES 4GAGL 4KGLA 1YEIL 3LPGA 4LMQE 4MHHI 2FECI 1I8KB 1S7WB 1LD9A 3HZYB 1FFOB 1K4DB 4IMLB 4O00A 2IQAB 4JM2B 1Y18B 4XTRC 3WEXB 5IOPB 1CFSB 3TNNB 4UOW1 1S9VB 1NFKA 1XAUA 3GM8A 1IGML 4I9WE 1NGYB 1H9VA 4LSUL 4PG9B 1Z6JT 3S35X 2VL5B 3HLAA 1A2YB 1WCBA 1U58A 4X6CA 3CJJA 4BQ9A 5A3IC 3PQYD 2W92A 3L5HA 3WBDA 1YYLH 3D39B 3PHOB 3FL7A 1LO5A 2DLFL 1RAMA 3X14B 4RX4D 4FQXB 3O3UN 2FBOJ 4QRSB 2ZJSH 4XHJC 2YOCA 43C9A 5C07E 3RBSA 2KZWA 1QQDA 3FT2B 3KYNB 1YYLL 3QZWB 2C5DC 1KEGH 5D7LA 3H9SB 4E41E 2AV7A 4PYGA 3MJGX 3E3QE 4AQ1B 1HIML 1SBSH 3ARGB 2MOVA 4E5XB 3GFUA 1IAIM 4L9LB 4ODUA 3STLA 1FZOA 2UUDK 4YNYA 3KPRB 2DWDA 2EC9U 3JUYA 3S88H 3FRUA 5JW5A 3TLRA 5J13B 2HP4A 3LEVH 3RVUC 4PJBA 4QWWD 2UWEE 1SBSL 4BZ1L 1HILB 1FFPB 1J1OH 3KXFB 5DUBB 3GBNH 5CP3A 4N90D 3VCLB 4QOKA 2W38A 1PG7H 3MLPA 4X98B 2MJWA 4PV9B 4EI6B 3GSNB 2QADD 4J3TA 4J7RA 5EO9B 3D18A 4IDLA 1EEYA 1V05A 3LEVL 4M61A 4XVUD 1QEWA 5SWSB 2BNRE 3K4AA 4MA3A 2QKIB 4P4RB 5DURD 1J1OL 2V7HA 1INDH 5BV7C 3GBNL 2A1WH 3DMMA 3L3KB 5CMAA 3VXTB 3ZMRA 2NY3D 3CMOH 3BP4A 2AJZA 5DZNA 4JFQB 3TWCH 3PWPA 1VDGA 5FCSH 4HWZA 3HI5L 3PHQA 2X1WL 3QPQC 3QP3A 3F65A 1KTKE 5ESVA 3W5NA 1ORSA 3H9HA 1Z5LB 1J0IA 1INDL 2XTJB 2A1WL 5CJ5A 3QWOA 4I0PA 3OAYK 2CLRB 3TWCL 2P8PA 1NCAH 4HS6B 4TOYH 4AL8H 3G5YB 4WTZG 2IQ9L 4LIQE 3U30B 5HHOA 4PGBB 3VWKB 1N6QL 4WUKH 4APQC 3FOLB 3QB7C 1EGJH 2X4NA 1KB5H 5IT2L 1FO0B 5LGJB 1NCAL 4M1CD 4TOYL 4XB8A 4AL8L 3VXSD 4NJAL 2J2ZA 3T0DA 4YHYB 5B3JF 2HLAB 3SGEH 5FGBA 5FM5O 1S7TB 1AGDB 1I7ZA 2A6DB 3DWTA 2AEWA 1EGJL 2HT4D 1NCNA 4HT1H 4PRHE 4NQCA 1JN6B 5DO2D 4Y4KB 1KB5L 1M05A 1ADQL 1WBYA 2OL3H 1G0YR 1Z9OA 1BD2E 1ZA3B 3LRHA 5FYJD 1KJ2A 5JHDE 1DE4A 2FCBA 3L3GB 4L29B 5LKNA 4HT1L 1K2DA 4GW4B 2XG5A 3PXHA 3QEHA 4Z7QE 2OL3L 4F7CB 3VGDA 4FXKA 1GZQB 4DK3A 4AY0A 3KPSD 1AQKL 4KXZH 4TVPH 1TPXB 1XF2A 1YQ2A 1X5AA 3AU1A 3BGFB 4NN6C 4Y5XC 3DVNA 4Y19B 1IZKA 1QA9B 3ZDYE 5FA4A 2R56L 4MXQD 1G7LA 5KN5B 3L3DA 1JWMB 2WQRA 1H3WM 3UTTD 4WFGD 1XCTA 3F62A 3VFWA 4QEGA 3FN9A 2ITCA 3NPSC 3IKKA 1FORH 2BCKA 5BO1H 1KB9K 1NGZB 5BS0D 3RWIA 3GMPB 4KK5C 2R0ZH 4R9HA 3TP4A 4PREA 2LAGB 1RJYA 5JMOC 5EZLB 2F8VA 2I25N 5DMGC 4RQQB 1JZ6A 1HHJA 4HWBA 3VXMA 1A7PH 5DDHA 3QIBA 3C60A 1EEQA 4IOSD 3VRIB 5JMRA 12E8L 1AHWA 1UGNA 4QRTA 4BFIB 5BO1L 3RX8A 4Q97A 4KKCC 5JW4R 2CLZA 4UNVA 2A73A 5TF0A 4Z76A 1DBJL 2R0ZL 4Y16D 4XXCC 2YBRA 5DK0A 3ILQC 2JK5B 3MV9D 1QOKA 4JCLA 4N1CA 1ZLVH 1A7PL 5D71H 5KSUA 4NN5B 4JG1H 3FZUD 1ITBB 4P57A 3BDXA 3CFDB 5GJSH 5B3NA 2NY4C 2HA1A 2VQ1B 4MJ6B 4QY8B 5BQ7A 3ARDB 5TH2A 2XT1B 1TZIB 1X5KA 4NO0B 2HN7A 5D71L 4BQ8A 5DWUH 1QLFA 4PLKC 1OOAA 5HVHC 5J6HA 3QDME 1DEDA 1II4E 5TFSH 2DB8A 3IFLL 4PG2A 5GJSL 4QRQA 4Q7DA 4RRPG 2HJKB 4UU9B 4WCYH 7FABL 3DSFH 1Q0XH 2E9WA 4DKEL 4HUVB 1JMXA 5T3ZE 5KSAD 2DQUH 2Q6WB 3RVWD 5A2IH 3BP7A 1CDGA 2X09A 1UVQB 1NMBL 3ARFD 4RIRB 3IFPB 5D8JL 1QUNA 5EIVA 5TFSL 5ICXB 2P43B 4LQFL 3DSFL 2DQUL 1PBYA 3MRIA 1I3RB 3PWLB 3U46A 4A6YL 1EBPA 4M9OA 1S8DB 2XWTB 4LVEA 3WIIH 1HQ4A 3P4NB 4HUUA 1T1ZA 2IH1B 3SKMB 1UM6H 4UDUB 1AD9B 3MRCB 4JO1H 5MEQA 3MRDA 3NFNB 4F58H 4OB5H 4LHJB 3KHOA 1LE9B 3O0RL 2V9RA 5B38A 1XR8A 1QLEL 1ZGLB 3BUYA 2VLRD 3OB8A 2B39A 2Q7YB 4FRWA 5E0QA 3IXTB 1QR1A 3WIIL 4PRDB 5IW6A 3FRPA 3MJ9A 1UM6L 4UQ2A 2P44B 3VWJB 5CKAA 1BWMA 4F58L 3V5HB 1QZ1A 1CTOA 1Q94A 3MLTA 1Q9KB 5CIPH 5DJZA 2X4UA 4ZFZA 4ZD3H 1RZ7H 2A9MH 3ARTA 3O2DA 4RAVA 3HMXA 1CFVL 2GJ6D 1EH9A 1A02N 2CPCA 4PJXF 1AC0A 3RGVA 5J1SC 4NC2B 2P4AB 5BRZB 3C6LA 1GC1H 3OKLB 1JVKA 5T1KA 1U8HA 4ZD3L 5LVEA 1RZ7L 2A9ML 3C9NB 4ENED 2GQHA 5H2BA 5EUOA 5A40E 2FDBP 2VXSH 5HPMA 3MOQA 5ISZD 2MQ0A 5EIQA 4GAFB 2UYLB 1I7UB 5F97E 3AGVA 1KCUH 1GC1L 3ALXA 1NAMH 4OBRA 4QHKI 5DYOA 4PJHF 1CGYA 1PYWB 3F12A 5I73C 4MJ2A 1NUNB 5DJCB 3NZHH 2EZ0C 3DXAD 3MRQB 2H41A 2DYPD 5ID1A 3VFUB 1KCUL 4K3HA 4QYOB 4FZEH 4MAUH 4ELMA 4HIHB 3RUGE 4FTVB 1NAML 5D2NE 1TFHA 4U1HB 5KJRL 2AXFB 3W0WD 3ET9F 5FYJL 4EN3A 2BJML 2AK4A 3IJYB 3NZHL 1A6TA 1YPZF 2E9BA 4H8WC 3UTQA 1EO5A 3D3VA 4XP1L 5K59F 2GAZA 1K3ZA 3L7FB 3DBXA 3SDDA 4GAJH 3EDJA 5F3BA 3BZDA 4MAUL 1N2RA 2A6KB 2YA2A 3JWOC 4RDQG 3CSPA 5LJYH 2MQ3A 1YEDA 4NBXB 2D9QB 3D2UB 1JPGB 2E6PA 3V6BR 1JF1A 4N0YL 3RWDA 1G6RH 2W60B 4M43L 4KK8C 3L6FA 4CN4A 2D9CA 3O9WA 3SO3C 4DOHB 5GZNC 2N1KA 5CBEB 5EU6D 1KENL 3RI5K 3ZDZE 1CFTB 3GKWH 3DX6A 3LS5H 1R3KB 2AK1H 1K8DB 1G6RL 1V8HA 3N9GH 2NY5C 1F4AA 3MROB 4MQTB 1WZLA 2YHGA 1OAKL 5GZOD 1I8MB 3JWDL 3E6FA 4AT6A 1FJ1A 4P2RB 1WFNA 3SCMB 2W0FA 3AREC 3WJJC 2QLVB 1H0DB 4YZFE 2DBJA 4W81A 5EOTA 1TVHB 3S98A 5GS1A 2ADJA 4KROC 3PL6D 1RIVH 2VDKH 4PP2A 1ETZA 3TBTB 2ESVE 3AAZB 4JLRA 1MI5A 5EPMB 1NCDH 2ZUWA 2XFXB 5CD5C 1YY8B 3DUHA 3HG1D 2E7MA 5DD0H 1FE8H 4KZDL 4FQLH 1J5OH 1PQZA 1OTUD 4KK9C 1RIVL 2VDKL 1L7IH 3FCTA 5BVJB 3MUZ1 1HKFA 3G6JE 1NCDL 4GBXB 4PJGB 3PGCB 2PETA 4PJCA 4Z7WE 4G8GA 5EU3B 3EDFA 2N7AA 1FFOA 1IVLA 1JNHB 1K4DA 4XC3H 2W9DL 1Y18A 4D9QE 4J4PA 4QLRA 5DD0L 3KGRA 5I15L 1FE8L 3V5KA 1J5OL 1NGYA 2AJYL 4LLVA 4X9IA 5CEZE 1ZHLB 4U6VH 3EOYG 3ABZA 3MRPB 1J8KA 4FQCL 4NRXB 4OLZH 2FZ3B 4YAQB 4S10A 3OWEA 3D39A 5E56A 5CGTA 5KSBB 3WE6B 4OTXL 3X14A 4G80B 4HJGA 3Q3GA 5HVGB 4JQXC 2Z93A 4ONHA 3RL1B 1NEZB 3AROA 3S35H 4U6VL 3ZTJH 5FUCE 1R3JA 3VI4E 4H26B 1KC5H 2C4FU 3FT2A 5I1AA 3MYZA 2F74A 2YA0A 2NR6D 3IAQA 3T3ME 3RNKA 1HWHB 5CZVH 5D7LD 1UT9A 1S7XB 3MXVH 3S35L 3BX7C 5DHVB 1YNLH 2KKQA 3A6BH 1KC5L 1MH5A 4NM4H 2VERN 2VWEE 4AH2B 2G5BA 4WFED 2PTTA 2MCPH 3W9DA 4C83A 5E9DA 5DQ9B 2E7BA 5I17B 1V7NH 5CZVL 1K4CA 4YHKH 4KKBC 3KXFA 3MXVL 5DUBA 4IOFC 4U1SB 2ICCA 4DUWA 1T03H 4KKAC 4W4OC 4WU5B 5JIHA 1YNLL 5D1QC 4GKSB 5GISH 4NKQB 3A6BL 4X98A 3TJHC 4PV9A 4NM4L 3GJEB 4PJAA 4QOKD 1Q0YL 1J88A 5FK9B 4GG8B 2MCPL 2NXZD 5DJDA 2QKIA 2D4DA 4M7KH 1V7NL 1KPUB 1QD0A 3NTCL 1NANH 4YHKL 4R8WH 5AWNL 1T4KA 3VXTA 2YKLL 3ARQA 3HN3A 5GISL 3DMMD 2PYFA 5DMKB 4IMKA 3B8YA 5C08E 4JPKH 4DN3L 3PWPD 5J1AA 1Z3GH 1VACB 1Z5LA 3ARVA 5F9WC 3O8XC 4ZFFA 4PJFB 5E03A 1E0OB 4G9FE 4CGTA 3C5ZC 1F3RB 2XZAH 4YO0A 2XN9B 5L88H 4I0PD 3A0OA 2I9TB 4JPKL 2GKIA 3STZB 3VWKA 1A4JB 1Z3GL 1G7MB 5FA3A 1BECA 3EGSB 2ADIA 4WJ5A 4BZ2H 1KIPB 5MEOA 3MNWB 4YC2B 5L88L 5DRWA 1NFDE 1INQA 4X6CF 4L3CA 4P2OC 3H9SE 1FSKB 3GSQA 1AGDA 4GXVH 4JHAH 5HI4C 2A6DA 1J7VR 1G9NC 1I9IL 1JN6A 3T4YA 3T0EC 1CDIA 1NDGA 5KVDH 5DUPH 2G75B 2VOTA 4S11A 4NQCD 2VITB 3KPRE 4LVNC 3O4LB 4BZ2L 3TIEB 1ZA3A 1OTSD 2OZ4H 3VI3E 5L7XH 3RPIB 4EI5C 3S3JA 4GKOA 3I6KB 1NCCH 3KG5A 3ZKSD 3FB7B 4GXVL 1N6UA 2QHRL 3L3GA 3LH2L 3QIUC 4GW4A 4JZJA 5DI8B 5KVDL 4HKZB 4F7CA 3HE6C 4CKVX 2JB6B 2OZ4L 1HCVA 1X44A 1XIWC 1OT2A 1AO7D 1JYNA 5E5UB 1ITCA 4Y19A 5IHZA 5GPRA 5SWSE 4U1JB 5KN5A 1BIIB 4RAHA 2HFEB 4OZGB 5FGRA 1RJZB 4PJBF 4WW2B 2YSSB 5FECB 3O2VH 1CXHA 2Y25A 2DI8A 1WC7B 3W11D 1IC5L 2F5AH 3V6FB 1ZA6B 4Q2ZB 1N8ZB 1NGZA 4HKBA 2GIYA 3GHBH 4KHXH 5EZLA 2R4RH 4X9BA 2CGRH 4RQQA 1RUPH 2IANB 1CICB 5I8EA 1FBIL 1KCRH 1Z9SA 4OZFH 4BH8A 3O2VL 1OAZH 3SQOH 3VRIA 3MZGB 3QIBD 3C60D 3GHBL 4XCEB 4ZSOE 1EAJA 4MB3A 5ITBH 4KDTA 5IFJB 4Q9QH 2V7NA 4KHXL 1SEQH 3KJ4C 1U92B 1OB1B 1MJJA 1KCRL 2MHAA 5EBMA 4JY4A 4JHBA 4RMRA 1I7RA 1BP3B 1JV5B 4YLQT 1OGAB 1FL6B 2DDQH 3QDAA 1IQWH 2IMMA 5ITBL 1D5MB 5EC1A 2WIMA 4OCRH 3VG9B 5A2FA 1XGUA 2PXYA 4MA7H 4X4MA 2P5WD 4FS0A 4F33A 3EO0A 1A7BA 3PGFH 1LVEA 5I9QC 1R5VB 3BQUB 4TNVK 2HJKA 4H1LB 4PBWD 2DDQL 3TZVC 1IQWL 3DGGB 4HUVA 4LSTH 2E7LC 1YMME 3CX5K 2Q6WA 4MA7L 4S1DD 4LVHC 1UVQA 3QZWG 3UTSB 4RIRA 2YD8A 4U7SA 3IFPA 4GOSA 8FABB 2BFVH 3GHEH 2Z92B 3PGFL 3OAZK 5D5MA 3OSKA 4JN1L 3BD4A 2ZUQB 3GSWB 3QEQA 4P5MB 4HLZH 2KUTA 4LSTL 2DQEL 5F7KC 1PG7W 4DVRH 5DD3H 1EZVY 4OFYA 3JVGA 2VZOA 1A22B 3WLBB 1I4FB 5I8KH 1IEAB 5L2JA 2XWTA 5CEYA 2IH3B 2BFVL 3CFKA 3GHEL 3ZKND 4LCYB 3SKMA 2EE2A 4UDUA 2R2CA 4IS6A 3MRCA 1VGKA 4JRYE 4CAGA 4NSKA 3NFNA 4DVRL 3UBXG 4PJDA 5DD3L 4N9OB 4TSCH 1O5DT 4QO1A 4XPFH 2C3WA 3O3DB 3OXSA 4W4NA 4IRJA 4PRDA 2WMPA 2XA3A 1C12A 4MJID 4W6XB 3TM6A 1KACB 1YN7B 3MLRH 2Q8AL 1J9CT 4NFDA 3V5HA 1PKQA 1HH6A 2DF3A 4X6DA 4XMKL 3VMOA 5K9KB 3B43A 5D7SH 2OXHA 4I8DA 3I6GB 3WDIA 2D0GA 4RA3A 3BWAA 3X3FH 2FD6L 1H15B 3T4AA 5I1CH 1W8NA 4BSVB 4C56A 1JTTA 2Z31C 4TTGA 2DBLH 4L4VA 4LCCA 1UWEH 2DJUA 2V2WB 3MLRL 3RGVD 1KNOA 2NY6C 3IFNL 3IU4H 1NBVL 1Q1JH 4NJ9H 1NGPH 1RZFH 4WHYG 3S4SB 1Z9MA 3ARYA 3C6LD 3C9NA 3M1BA 5T1KD 3ZSTA 5I1CL 3U36A 5JOPE 1KT2B 2WNGA 2XWBA 5A2KH 4NQXB 1UWEL 5I19H 1HHGB 3AC0A 4OFIA 3IU4L 1Q1JL 4NJ9L 1NGPL 1BEYH 4OQTH 2CIKA 2ZSVB 3OXRA 1C08B 1PYWA 2Y5EA 4K2UH 5FAAA 3BP5B 5DJCA 2VAJA 5MERA 1CXEA 1KXTB 1GH7A 5L6YH 5F1IA 2OCFD 4XGZA 1DQLH 4PGCB 4QYOA 2FGWH 2A2QT 4Z77B 2GSIB 3PWUA 2E8ZA 4FTVA 1U2CA 3QISA 1B6UA 4Z7VA 3MGOA 4CVXB 4K2UL 3IJYA 4JO3H 4JFHD 1KLGA 5C0CA 5IW3A 4BUGA 4EN3D 1ZXQA 2A74B 1DQLL 4Y5YC 1RMFH 2FGWL 4JG0H 3D3VD 1M4KA 3T04D 1S9YB 3SDDD 1GGYA 1JPGA 5IQ7H 1MCJA 3VGEA 2XZQL 1KGCE 4Z7UB 3MC0A 5MI0C 1U2HA 2AEQH 3WJLA 5EUKB 4HXBH 4UAOC 4KWUA 5IBUB 3NZ8A 5JW4Q 3RHWK 4KVCH 3QFJB 5CBEA 1RMFL 1OW0A 3O9WD 1CFTA 4APQB 5CFHA 1AR1D 4ZMAT 2BHUA 2Z0BA 3S3SA 2R39A 2UZIL 2XKSA 4XP6H 4NO3A 2AEQL 3MROA 2Z4QB 1A3QA 1TCMA 4JPIB 1DN0A 4KVCL 5EORH 3OV6A 2GSGB 3UEZA 4P2RA 1A6AB 4LSVL 4WTZA 1JNNH 5BRZE 5I16B 3F6LA 4XP6L 4FQQB 4DN4H 1BZ9A 4Y88A 4C4KT 3QNYB 4NT6B 4ZYKA 4U3HA 1T2JA 4LSDA 5EORL 1T5WB 3BGAA 5KANI 3BPOC 1N26A 3QDJA 3WL9B 3MJ6A 3GO1H 2IPKA 4W6YB 1UJ3C 5FYKU 2XFXA 1MI5D 1YY8A 4XVUC 4DN4L 1OARH 4GRMB 1MIEL 5E1HB 1IAIH 1NGQH 4RWHA 1G9MH 4LCWD 1YMHB 5C09B 3O41B 3VXQA 1IILE 1X6LA 2B1HH 4Y5XB 2NY3C 3V0AC 4G6KL 4R96A 3RWEB 5EU3A 3VFOA 4K7PY 5CEXA 5IVXB 3CGTA 1SVCP 1OARL 3UC0H 4G8GD 3L9RA 1A14H 4G8EB 5BZWB 1NGQL 4MAYC 3QEUA 1GYAA 4J4PD 4MGXA 1W72A 4ZQKA 2G2RB 3CLEH 2B1HL 3BXNA 5I1KH 1UKTA 4C58B 3CUPA 4G8FA 2FECL 3W39B 4JRWA 1QRNA 4QRRB 4ELMF 3RY4A 1A14L 1JCKA 1T0MA 3QDGA 2YUWA 3REVB 4XXDB 3WE6A 4O5LL 3X11A 1DVFC 4I18C 2K7PA 1UADC 1VFMA 3DX8B 3D87B 4WENB 1ND0B 1QBAA 1FNLA 4JZNB 4XB7A 3DI3B 3JV6B 3SKJH 4QTHA 4RAUB 4H26A 4M1CC 3WFCH 1A1OB 4LHUG 3I75B 1MJ7L 4JY6A 5IMLB 2DMBA 32C2A 5AAMA 3WHE0 1DUZB 2VZ1A 2R1XB 5HYEA 3DURA 2HT4C 1S7XA 2NY4B 5DO2C 4HQQH 1QFUL 3SKJL 2QL1A 3ZTNH 3LKNB 2YD5A 3WFCL 2EECA 4LLDB 4OV5A 1TZHB 4BK4A 3SE4C 3F8UB 5DRNB 4CVZB 5ERWB 3FO9B 3WUWG 4PLJD 5C0DB 5I17A 3Q6FB 5E9DD 3DUSA 4HS3B 3V52H 4GKSA 5FB8B 3ZTNL 3KXFD 5FKAB 4JY5L 4UNTA 3VFVA 3HMXL 5JOFB 4YDJB 3GJEA 4X4YB 3QI9B 1NCBL 4IDJH 5FK9A 1MCNA 4P3CH 5MEPB 3HMWL 3FONB 4MXQC 2RFXA 3DRTB 1UFUA 3MACH 2BVPA 3QQ9D 3H2WA 3NIFF 3GMQB 4RRPA 1L9NA 4X6FA 4ZNEE 3QFDA 1ZHKB 5DMKA 2NTFB 4IDJL 4BA8A 2YK1L 2VR5A 2VZSA 4WI4A 2CKBH 3LKQA 4TNWK 4P3CL 4HIIB 1BX2B 2Y5TB 2E7CA 4JDVB 2EDTA 3V9FA 5I1IH 3JWDC 3MACL 1U3YA 4K94H 1JTOA 2KDGA 4G9DB 4PJFA 4XRCB 4RGNB 3FFCD 1MVFA 3I84A 3M17B 1VKXB 2I9LB 1XH3B 2XN9A 1CGVA 3EYQC 4JQIL 4QCIB 3DPBA 1A6PA 1S5IH 2CKBL 5GS0H 3ZHLA 4Y16C 3STZA 5KSBE 1OAXL 1OF2B 3O3AB 1BQLL 4U1MB 1I1FA 5D4QA 1M71A 3N06B 5F7NC 4K94L 4XVJH 3D0LB 4P0DA 4AEHH 4MQSB 2R29H 3WO3B 3UDWA 5BW7C 5IWLA 4UMGA 1H3GA 1NL0H 5E2UL 5IVZB 3Q6GH 2GY7B 5GS0L 3IB4A 2J8UB 4M48H 2XYCA 5DEGA 4ORGA 4OLUL 4Z9KB 3GJFH 1T66D 3K2UL 1OWWA 1G7QB 2D7QA 4XVJL 4AEHL 4WI6A 4WFHE 3NIGE 4X5XA 1R3IH 3O4LA 3BAEH 5T1MA 1MY7A 4L4TB 1F2QA 1NL0L 3Q6GL 1JJUA 4HCRA 2VLJD 4M48L 4OIAA 2YWYA 4NOFA 4UBDC 5FUOH 3VW3H 3ZYZA 3L5WA 1WTGT 5T3XH 3ARFC 3EFFB 4HKZA 4KK6D 5DI8A 5DMJB 2SEBA 4PRPB 3EDDA 5E6IC 2ZCKH 5HGAA 1WAAA 4N0FB 5TE6L 1X5JA 4G6AD 1JNJA 5I73B 1DBMH 3ZDXE 4ZUUB 5FUOL 1GXEA 2IEPA 2HFEA 4XNXL 1EFQA 2CDFB 5T3XL 4LLQB 1E6OH 3FQUB 1KPVB 1U6AH 3HI6H 4H0HB 2CIIB 1KCVH 4QRPB 3R1GL 2Q3ZA 4WFFD 1PLGL 1IC7H 1ZA6A 1EO7A 3QXWA 2Q1EA 4Q2ZA 2F8XC 1ZVHA 3GMNA 1S7VB 2X9YA 3C2SA 4MJ5B 3VXRD 4TVPE 5IW1B 3TBWB 4P46C 4PJAF 5J6GA 4ZNCD 1MRFH 1CICA 5EG6C 1E6OL 1U6AL 3TESA 1KCVL 2NY7H 1U8JB 1IC7L 2H26A 3QDMA 1QLRB 1F4HA 4Y8DC 5HI5D 1ERNA 4XCEA 2L0DA 5BJTB 1EHLH 2EC9T 4R90L 1AXSA 2VAAB 4FABH 2DAVA 1U92A 1YUHB 1MRFL 5GRJH 1W8OA 1LP9B 3SO3B 3RWFA 4NO5B 4D0CA 2NY7L 4HX1B 1WK0A 4OM0H 4ZAKA 3VXUB 1T1XB 4YH6A 3W9EB 1F11A 3WN5C 5GGQH 3DUUA 4UUJA 1FL6A 1CR9H 3LKRA 3HI1A 1WISA 4FABL 3AMKA 5FYLE 3QNZB 3WO4C 3O3BA 3RIAF 5E5MB 3DRQA 4NCC1 5IMKB 3JTTA 3FOMB 2PXYD 2NY2D 1VGEH 3BQUA 3AREB 5GGQL 3TO4C 1RZIB 4PRAA 5MENB 1CR9L 3DGGA 4MSWA 3MLYL 5CZXD 5DJ8B 4X5WA 1ZLVK 3PJSB 1IKNA 3UTSA 4LHQB 2VXTL 4HPYH 4S1RH 8FABA 3MOBL 5I75C 3MREB 5GIRB 3U0WH 4P5MA 3CDFA 1CFNB 3UTOA 3DTXB 3BRGC 1NUDA 1HI6B 2EYSA 1YNKH 4IIQC 2C3VB 3QEQD 4XBPA 3OGOE 1H8OA 3WYRA 4H5SB 2DICA 4OFYD 4W6WB 4HPYL 1LDPL 3ZHKA 4F7EB 3GGWB 5JQ6L 1E4JA 4XP5H 5IBLD 3EHBD 4RGMB 3OG6B 4RFOH 3U0WL 3NPZB 3CLFL 3PWNB 3TNMB 1YNKL 1H3UA 2AKRA 1QYGL 4KY1H 4MDIB 4XBGB 3DVIA 4HLJA 3BZEB 3H9YA 2BOBA 2IANE 5DJ2A 4LEOB 1XGRB 3MLSH 1C16B 4N9GB 3SQBA 5FOBB 1MFEH 4XP5L 2BVTA 3BKCH 4M7JH 4RFOL 5I1GH 4XHQA 2NW3A 4IRJD 3X13A 1VFBB 1C7TA 1W2KT 4MVBD 3CFEA 1QSEB 4GRLA 4KY1L 5EZIH 5K9KA 4FQJL 4BZYA 1F58H 4FMFA 3PWVA 4JPWL 3CXDH 3I6GA 4U1GC 5E8NA 3WKMH 2AP2A 1H15A 3WMSA 4BSVA 2DOCA 5DMIH 3SGJC 3WNPA 3RA7H 1E6JH 2BSED 5I1GL 3JTSB 5GZOC 2AQ1A 2V2WA 4C56D 3WS3A 3HCVA 1U9KA 4L4VD 4OF0A 1JK8A 1F58L 5DD1H 1JI2A 3NN8A 2C3HA 2EE3A 1TCRA 2V9TA 5C0FB 3WS6C 1GSMA 1N5AB 1KT2A 5IJVA 2OJEB 1E6JL 5ANMB 4J2XA 5TQ2L 3TH4T 4NQXA 1T89C 3PL6C 4K3DH 5TE4H 1W0VB 4XAKD 2EDRA 3BDYL 5BXFA 5DD1L 2IBZY 3QCUH 1JUFB 1KIQB 3KPMA 1C08A 4ZG1A 4U1LA 3BP5A 4JKMA 3KR3H 5D1QB 2CR6A 3FQTB 1GRWA 4P9HH 3IAGC 3RL2A 2J6EA 3FAWA 1UH4A 2DWEA 2WP3T 4L3EB 2FL5A 4K3DL 5F7YC 5IBTH 2FR4B 4NBZB 5C0BB 4FHBD 4GLRH 4FTVD 2VC2H 4CVXA 1LE5B 1MFCH 4P9HL 4GG6B 5DRXA 1AIFB 3FJTA 3U4AA 5C0CD 5SV3A 3EYSH 2XWJB 5D5MF 1SMOA 5JNYA 1A4KA 5IBTL 4PJ9B 2FX8L 2VC2L 1JRHI 1Q9WA 1RQ5A 1MFCL 5AZEH 3CZFA 4MMXC 4UT7H 4MXVE 1JL8A 4L8BA 2APBA 3C5ZB 1SJXA 5MHSD 3MQIA 2F53A 1NH6A 3D9AL 3EYSL 4I13B 1UCBL 1A3RH 2BX5A 3LKSB 4MQ7A 4F9PC 1FRGL 2IFGA 4PJDF 5AZEL 3O45A 5C0AE 2NR6C 4LQ1A 4FQ1L 5DFVC 4UT7L 2Z4QA 5H37H 3H3PH 3U0PB 5CP7A 1VSCA 3NFSH 4KI5D 2LV4A 2GSGA 1MWAB 3CFJB 1UENA 2R23B 1GGCH 4P2OB 2IG2L 3VFSB 4R26H 4ZOBA 5MP6L 1YC7A 2HVJB 4X6DF 4M3JA 4FQQA 4XCCH 4P9MH 3RJQB 1WICA 2CDGB 3HPJB 3NFSL 4EI5B 1CDYA 1GGIH 2GTWB 4NDMA 5C86A 1GGCL 5F21B 3WL9A 4I9WD 3FAXA 2O93L 3TVMB 4EXPX 3QDJD 4XCCL 4GRMA 2NXZC 3HE6B 3TN0A 1P6FA 1YMHA 4OCWL 1GGIL 5IB5B 1HSBA 3QUKA 4MS8D 5KZCD 4Y5XA 1OAUL 1ZAGA 1J8HE 3DMMC 1F5WA 5IVXA 4H1LG 1UWGH 1MY5A 1V7MH 1P4LB 2WSKA 2GTZB 5BZWA 1D6EA 4G8EA 3RDTD 4NQSA 3VXOA 5J4MA 1T22A 5LAXA 4LCUB 3JZ7A 3MCKB 5D7IB 4ZS7L 1D5ZA 3ZKXB 2VDPH 1UWGL 1OPGH 5KTEL 3H7BB 4I0PC 1XT5A 3IJHB 2H8PB 1V7ML 4QRRA 3NACH 4Z7UE 3U0TA 5KVEH 1QRND 1LK2A 3LQAL 4DVBB 3QDGD 4R3SB 2Y7QB 4H25B 1A0QH 3JV6A 4XXCA 3QFJE 4LF3A 3B5HA 4PD4K 3KJ4B 3Q5OA 1A1OA 1OPGL 4Y5VA 1QFOA 3PDGA 5KVEL 4K71B 1DUZA 5DJAB 3HAEB 3SHSA 1F02I 2R1XA 4HJJH 3RWHB 3QQ4B 5F7MC 5FV1L 4NRYB 2DLTA 1T21B 1DQQA 4KMLB 2ATKB 5J89A 2AABL 2V2XA 5JO5B 3N0PB 3MV8B 4LLDA 1OTSC 3OGCB 4I2XE 3GMRB 4CVZA 1SY6H 3FO9A 3EJJX 1IGJB 4HJJL 1U8LA 4LDLB 5C08A 5IKCA 3A6CH 3BKYH 1FNSH 2JIXA 3RU8L 1AGEB 3TZVB 2P7TB 3THMH 1WWWX 4CMMA 4HS3A 1QFPA 5FXCH 3WFDH 1FCCA 4LVHB 3IETB 4Q6IA 4ZPVB 4X4YA 4CW1B 5DTFA 3CH1A 3MFFB 1SY6L 5MEPA 4LASL 1PX3A 2Y36H 2I07A 3A6CL 3BKYL 4UIKL 4D8PB 4JVPA 1FNSL 2AAVA 1LO2H 5F93C 5CUSL 1AC6A 3W11C 3WFDL 4JHZA 5HJ3B 2EIEA 3RIFK 2VABB 3L5IA 1X4XA 4NKOA 1CD0A 2NTFA 3ARPA 3WFEH 2R0KH 5ABDE 3CSYA 1SVZA 5SWZE 2NW2B 3QJHA 1NFDA 3P0GB 2XNAB 2Y36L 3OX8B 4HWUA 2PYEB 1MCFA 3MJ7A 4QF1B 4G9DA 5E2TL 1QSFE 1XF3A 2NNAB 5ADOL 2XZCH 2JJWA 5JPNB 1EEZB 5HYSB 1XH3A 3UTZB 1MFDL 2BSSA 3KYMB 4PRHD 2DLIA 4QCIA 3WFEL 2R0KL 1JZ7A 4PJGF 4UB0L 1AHWC 2C4XA 1OF2A 2VSDA 5D93C 5I1JH 5AAWA 3ZYOA 5KOVC 3KPOB 1BJ8A 2D0FA 5EZOH 5JHDD 1LEGA 2XZCL 5D7KD 2YD9A 2ILLA 2ZOLB 3T0AA 5IVZA 1OVZA 2BOCA 2WUBH 3UBXA 3H8NA 1P84K 2J8UA 5CGYD 5C0GB 2Z31B 3LSOB 3SJVB 5KSBF 1G7QA 5EZOL 4POUB 1ES0A 3KDMA 1HEZB 4UDTB 1ZLUH 4QNPE 5L2KE 4AZ8A 2NY6B 1PVHA 3QUXC 4I77H 5DUMH 4NZUL 3ZKMD 1ZGLM 4S1DC 4MX7B 5FDWA 3MBXH 1Y0LA 2FJGA 1DBBH 3VXPB 4CU8A 3EFFA 2IADB 1UM5L 1R3HA 4OQ1A 3UYRH 5CD3A 1R5IA 1RY7B 4YPJA 4N8VB 4GS7C 4KHTL 3HS0A 5IM7B 5E00A 4I77L 5DUML 1I1AD 1U91A 4N8CH 3ZTJG 3BIAX 3EYUL 3OKEB 4RMWA 3FQUA 1WWCA 3ES6B 3UYRL 1I1YB 4QRPA 3GSXA 1PY4A 1S9KC 3ULSB 1UEMA 2PCPB 1JYVA 1MRDH 1OLLA 5DFTA 1JPFB 2BY3A 3LKOB 2C4FT 2QQQA 4N8CL 5HXMA 5EIIA 3VRLE 3VD4A 1BBDL 2BSRB 4JDZB 3GIVA 4Y5YB 5INCB 2GUOA 3O2WH 2X10A 1CICD 4RGNE 4AIOA 5D9SA 3PQYB 1QLRA 1MRDL 2X89A 5MI0B 1RK1A 4OF7A 5BJTA 2VAAA 3QDMD 5KS9B 1DCLA 2VUYA 2HH0L 3A6OA 1YMMA 4GT7A 1JP5A 2VL4A 4LNVA 2J8HA 5FKPB 4NO5A 3B5GA 1UH2A 4HX1A 3O2WL 4U6YA 3VXUA 5DD5H 2X41A 4PJFF 4OF6A 4G42A 1LNUA 1S9XB 5AUMB 4ZAKD 3P11H 5HHQA 1ROWA 3RGVC 3FB6B 1D7FA 3QNZA 4U3XA 3BO8B 3GB7A 4HZAA 4FMKA 4LSPH 1A6UH 3LEXB 4G6ML 5LBSL 5DD5L 4A6YB 3AREA 1EZVX 4RMQA 5C71A 1RIUH 2J5LC 2I27N 1WQVT 3VMNA 2CUMA 5MENA 3KYOB 1F6FB 2ZOKB 4AIXA 4N0UE 4HMDA 5DJ8A 1YEHH 2FRGP 3PJSA 4JDTL 4YHIA 2VLME 4LSPL 1A6UL 3HUJA 3MODH 4CADB 1IQDA 1CU4L 3ULUE 1C5DA 3G08B 4IRSD 3ULVE 4YEEA 5DA0B 2QADB 3D85A 4MNGB 1RIUL 3VFPB 3V5DA 4ETYA 4G7YH 5GIRA 3SKOA 4HV8B 1HI6A 2QQLL 4LFHG 5HSFA 4OLWH 3IDJB 3H0TB 3MNVA 5DURB 1YEHL 4G6FD 1I7TB 3L3IB 4K94C 4PY7B 1OP3K 1YEKL 3MODL 2NY3B 3MUJA 4F7EA 3GGWA 1VADA 4FQPA 3VGBA 3BW9B 4Z7NE 4RBPH 3PWNA 4LIQH 4XP4H 3MO1B 3TNMA 1N5YL 5GS0C 1BBJB 3DX7B 4D9RD 1JTPA 1EHAA 4OLWL 4MDIA 1WAAF 4MAYB 3OPZH 1QP1A 4YGAB 4PY8I 2ICEB 2A77H 3QUMA 4N0CC 5EU4B 5ESAA 3ZSSA 4N9GA 2DI9A 4OZGF 2EO1A 3KPLA 5EU7C 4XPAH 4LIQL 4XP4L 1P6AB 2AS5M 1QSEA 3OKYA 3IS0X 3CVHL 1B4JH 4I18B 3O9WC 3QXDB 4EUPA 4LSSH 5F7LB 4GRLD 4JQXA 4X6EB 1L0YA 1J0HA 1OSZB 1LP9E 2VO5A 2G9HA 4JFXB 5HHME 1F45A 4OZHA 4Z0XB 4XHJD 4M4RA 5CINH 4K23L 3VXSB 4X5LA 4V1DE 3O6LH 1NLBH 4E0RB 1B4JL 4LSSL 3SGEI 4EDXB 2CK2A 4NUGL 4NKDB 4PUBH 4JAMA 4LGSB 1OM3H 1N5AA 3PABB 3OKDA 5B8CC 4DWHA 1VA9A 4HPOH 3O6LL 3IXAB 2OSLA 5HGDA 4LHUA 4WY7H 5F1NB 4PBVC 2H6PB 4PUBL 4TUKL 4KTYA 4W4OA 3LDBC 1OM3L 1U93B 5FHAH 1A6ZB 3KPSB 3QULB 4D0BB 3OKKB 4U6XB 5B4MD 5JORB 1GL4B 2BSTB 4I4WB 2HWZH 2FHBA 4WY7L 1GAFH 3BH8B 5F89B 2C1PA 2FR4A 1ZEAH 5C0BA 5CCKH 3MUY1 1NBQA 4LRNH 2BMKB 1JPTH 2ID5A 2VXVH 5FHAL 3UTTB 1RVFH 4U3CA 4GG6A 1AIFA 3DO3A 2AGJH 2EYTA 3T08A 5T33H 1E4XI 5JLZA 2DTMH 3DETD 5BS0B 1QVOB 2HWZL 5ACZB 1L0QA 1CD9B 1GAFL 2VDLL 3DROB 4FFWD 4HDIB 1MHEB 1ZEAL 5DJ6B 4X99B 4ZFGH 5IF0B 3O8XA 2F19H 4OSUH 1KXQE 3BYTA 1EJOH 1RVFL 2FLRT 2AGJL 3C8KA 2C1OB 2B1AL 1UACL 2DTML 4S0SD 2XKNB 4Y16B 5C8JA 2PF6A 1IM3A 5JW4M 4NKIH 2F53D 4XCNA 2AI0H 3PNWB 1EV2E 3MV9B 1V3KA 5A2LH 3U82B 4BELD 2F19L 1ZT4A 4OSUL 2ESVD 4PPTA 4RFEB 2X4PB 4HLZG 5E8EB 5GGTH 3DYPA 4PJEB 2R4SH 4MXVF 3CFJA 4O2FA 2F9BT 1S3KL 5T3ZH 3SO5A 3VFSA 2HJFA 4NKIL 1NDMA 4PJHB 2HVJA 5F9OH 3T0EA 4Z5RB 3BIKA 2GJZA 5GGTL 4PLJC 3VGAC 3VD5A 3IF1A 3MRHB 4ODTH 2R4SL 5ANME 2LVEA 1YNTB 3S9DB 4K7PX 4D9QD 5JHLH 1C5BH 5T3ZL 1MHCA 3CPLB 1CE1H 5CEZD 3QIUA 2APWA 5F9OL 4P59L 3ARFB 1QBBA 3HE6A 2P1YA 3S34L 3VFTB 1FVDB 1N59B 1YPZB 4ODTL 5JDSB 1XIWA 3TN0D 3DLQR 5JHLL 1C5BL 1U8QB 5FEBA 1MRCH 4L3EE 5D72H 4ZXBA 4WW1A 3N50A 4MD0B 3KYKH 2PO6C 1P4LA 1ONQA 3WXVH 2OMNA 4LP4A 4HWBH 4P2QE 4PJIA 1KTLB 1BJ1J 1MAMH 4K8RH 1J1PH 1EJ6A 3OJVC 3RI5F 1CF8L 4U1KB 1K6QL 3TYGH 3QRFM 4LKCA 3H7BA 5IQ9B 2H8PA 2VLRB 3ZE2E 3WXVL 4NHUB 1MAML 4K8RL 1PX4A 1J1PL 4YX2H 3ZLQC 3IDNB 3RVTC 4BKLA 4EJ1C 3KNBB 3VFRA 1IE5A 1RIHH 4K3EL 2GW5A 4KUCD 2DLHA 4M9PA 4XNZC 2GJ6B 4YX2L 3QQ4A 3WN5B 1T66C 1T21A 4JFEE 1J05B 3QXVA 3WO4B 5JO5A 1RIHL 1ZVSA 3MV8A 2YN3A 1F3JB 1MHHB 1T7XA 4ZNEA 2W0LA 3CK0H 2EDKA 1TTUA 2X9XA 1IGJA 3BEVB 3N85H 4P9HC 3TIDA 2OBGA 5ISZB 5EO0B 5I6XB 4PLKD 3TZVA 2P7TA 5C08D 2JB5L 4LBEA 2E7LA 1CLOH 3F5WB 4KTEH 3B2VH 1G7JB 2JIXD 3JV4B 4JZJC 3RZCC 1HDMA 3MFFA 4G6AC 2R2EA 2ZUVA 4D3CH 2Z91B 1LEKB 1DQJB 3DXAB 2J4WH 5I75B 2DYPB 2KQMA 4U7MA 1AE6L 1XGQA 4YPGB 3AXLA 3P0YH 1CLOL 4KTEL 3FTGB 3B2VL 5IFHH 5HJ3A 1OTTD 3HB3D 2HTKC 1MQKH 2ZCHH 4JRXA 3W0WB 4WWKD 5IROC 2AJ3B 2XNAA 4D3CL 5KSVA 4ZOEA 5JIKA 3F7RA 2PYEA 3EFDH 4QF1A 3P0YL 2NNAA 2H2PD 2VDQH 3Q0HA 5IB4B 3PDDA 5IFHL 5D7IE 4NCDA 1EEZA 4MMZC 5HYSA 1EGJA 2CK0H 1MQKL 2ZCHL 5HI5C 1HNGA 1KB5A 1ADQA 3O2DH 2J6EL 5J9PB 1MCSA 3G5VB 5IVXF 2CD0A 3I02A 1KJMB 4G5ZH 1XF1A 3EFDL 5A16B 2CSPA 3KPOA 4KDTC 2DKUA 2VDQL 4PRBA 5EU6B 4ZUSA 4ETQB 3S96B 4HC1H 1CIUA 1MJUL 2CK0L 4KMQA 4GRWB 4B0MM 1M6OB 1FNEA 4S2SA 4RGOH 4K3GA 2OL3A 4ODHH 1DQDH 1JPST 1XZ0B 5HYFA 4G5ZL 3CCHB 4PTTA 1CT8B 3SJVA 5ETUB 1ZHNA 4U1NB 1F8TH 4UDTA 1HEZA 4AIZA 3TO2B 1MCEA 2PXYC 2NY2C 4HC1L 1Q8MA 5AD0A 5IB3A 4KUCF 1L4IA 4JPVH 1BREA 1RUKH 3G04A 4ODHL 4Y4FA 4MCYB 1DQML 4YFLF 5CZXC 3WHXB 5TDOB 3PP3K 1T1YB 1F8TL 4TULH 3PL6B 3PWJB 1G6VK 3L7EB 4XMLL 4R0LB 2YPKB 1SEBB 1MAJA 4MLIA 1GZPB 3FHAA 4P4KA 4B53A 4EVNA 5L8JB 4JPVL 3D0VA 1UM4H 1WZ1H 4GMSH 3INUH 3GJFK 5F7UA 3QH3A 2ICWJ 3LQAC 1FFNB 4QTIH 4EIZC 1ZT1B 1CLZH 4TULL 1BM3L 2W1NA 2DMCA 2WQ8A 3ES6A 4RMUA 2Q8BH 4OLEA 2XXMB 3EHBC 3IDMA 4XT1C 5ALBL 4QRPD 4AG4H 1UM4L 4M02A 2XQYG 4GMSL 1LD9B 5HDQL 4QTIL 3NH7H 4WUUA 3DHJA 4KC3B 2BSRA 4YHPB 5CEZL 5C2UB 1S78D 4JDZA 3VDBA 3AM8A 2Q8BL 3VMPA 2EDXA 1UXSA 3BRDA 3QHTC 4QHMA 1I8IA 3JBG7 4S0TD 4WHCA 3B9DA 3IRZA 3HLAB 1WCBB 4AG4L 2OM5A 1MVUB 4X6CB 4MVBC 5ENWA 3WCYA 5DSCB 5KS9A 1MOEA 1B0GB 2VB5A 3NH7L 4RX4A 2A83B 3LD8B 3OG4B 2X89D 1MIMH 1YN6A 1LO5B 2FHFA 3SDCC 3VG0L 1YMMD 2E7HA 4M93C 1I1RA 3WIHH 1ZT7B 4FQHA 3U79A 2NX5A 3MBEA 5D7JC 43C9B 1N4XH 1S9XA 5AUMA 4GQPH 3QUYC 5FO7B 1QQDB 2VN4A 4DFIA 4P23D 5D70L 5D7LB 2BVUA 5IFAH 2C3GA 1DANU 3ZO0A 1FAIH 3GEWB 3MLZH 5F8RC 3WIHL 3STLB 1FZOB 2P42B 5FGCB 4YNYB 5ITFA 2R15A 2MWCA 1N4XL 1FVCB 3MV7B 3E8UL 1RPQA 2ADFL 4HEME 2YD2A 2DWDB 2FIKA 3ARED 1I1CA 3FRUB 5JW5B 3QO1A 4PJBB 1WFTA 2J8UF 4JRYD 5GS2D 4CADA 3MLZL 1IAOB 2V9QA 5FIEA 3G08A 4KROD 4M1GH 3LEYH 3VFPA 1I75A 1UJ3A 5DA4A 4QOKB 5GXBB 1FCGA 3D85D 2NXZB 3H0TA 3D18B 4ODWA 1TDQA 1EEYB 4HF5H 5CD5D 1I7TA 2DQFA 4LKXA 4GKNA 1QEWB 4M61B 3EYFA 4MA3B 25C8L 4XMPH 5I2IB 2OMBA 2V7HB 2YUXA 3LEYL 1QFHA 3DMMB 5CMAB 3BW9A 5DZLA 3ULUF 2AJZB 4KDVA 4N5EC 3DX7A 2WWKT 5T1DH 3PWPB 4MAYA 4HF5L 2VE6A 1AP2A 2HKHL 1A5FH 1URLA 2GITA 3PHQB 5DC4B 2H1PH 5EU4A 1RHHA 2AV1A 4XMPL 1TIUA 5ESVB 1M1SA