1L7TH

Crystal structure analysis of the anti-testosterone fab fragment
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
220
structure length
220
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFTFSRYALSWVRQTADKRLEWVASIVSGGNTYYSGSVKGRFTISRDIARNILYLQMSSLRSEDTAMYYCARAYYGYVGLVHWGQGTLVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-testosterone (light chain)
publication title Crystal Structure of an in Vitro Affinity- and Specificity-matured Anti-testosterone Fab in Complex with Testosterone. IMPROVED AFFINITY RESULTS FROM SMALL STRUCTURAL CHANGES WITHIN THE VARIABLE DOMAINS
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 47
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2002-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l7tH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l7tH01
4F57L 3QO0A 1F2QA 4ELMA 4H8WL 4XWGL 1Q9WA 2CUHA 4LSTH 4OZHF 1FZJA 3HMWH 3Q48A 5D2NE 1BEYL 3LMJL 4G8FA 4NIKB 2GTZA 4OCYL 2YRLA 5FOBA 2EC8A 2FIKA 1T5WB 3TH2T 5MENE 4RGNB 4JQXC 2V7HA 1MIML 3O9WC 4RCAA 4TTDD 5JPNB 1CFTB 2HTLD 5I8CB 1BLNB 4U2YA 1N2RB 4LRNH 2YUWA 1BHGA 4H1LB 3QA3A 3KYMA 1QBMH 1T66C 2FLBT 2ZUQB 2PCPB 4K23H 4LDEB 4XTRC 1U41A 2XKUA 3QG7H 3RWEA 2HN7B 1T04B 2NY1D 1CR9H 2VLJE 3PL6B 3CFJA 1YN6B 3S35X 5CSBA 3L3DB 4ZDHB 5EUKA 5I9QB 3RVVD 4N8VA 1OP5K 4NKIL 5E8NA 4WFGD 1I85A 1Y18B 3UBXG 3DYOA 4HG4K 2ED8A 3AS2A 4NBZB 4LLDB 2YEZA 1N5AA 3T0EB 1NCAH 3OXRA 2VLJD 3BH8B 5TH2A 3HNTH 3SBWC 4UUJA 3C5JA 3EOBB 4NZTH 1N6QH 1WWBX 2Q6WB 4D9RE 3D39D 4X5WB 4JB9H 4NC2B 2J8OA 4P2RB 4GJTB 1NGYA 1Y6KR 1IBGH 1NGPL 4YHOL 3P4NB 4OZGB 1OTTD 3OBAA 2EDJA 2YMXH 4YK4B 5DWUH 1MRCL 1VEPA 2VC2H 3MCKA 2FHCA 1TDQA 3SHSA 3KPSE 1KXQE 1U8QB 4NWUH 5I18H 2R69L 4ONGH 2NY3D 1FVDA 3N9GL 4TOYH 3O2VH 3CMOH 4OT1L 4YHPA 1OAYH 4L3ED 2BSTB 4I0PC 3UROR 1P2CA 4LL9A 4YHZL 4AMKL 1OW0A 3S96B 4JREC 2AV1B 1NAML 3MV9B 4D8PA 4L3CA 1JJUA 2UUDH 4LIQH 3C5ZD 4N90E 4PYGA 4WU7B 4PJAF 2V5MA 1AJ7L 3S5LG 4XNMB 2CKBH 3VXTA 4WDIB 1FO0A 2BSRA 2KQNA 4C83A 1FNEA 1DEEA 5CWSB 4IRZL 1JTPA 4L5FH 1MFCL 2O5XL 3IAPA 4GBXB 1S7QB 4KJWC 4X4ME 1EJ6A 3NCEB 2XWTB 4JQVA 1FVCA 3DV6A 5GGVY 2PYEB 4JZJB 5TDPA 3LQZA 2ZUSA 2Q86B 3IDIB 1J0ZA 5C6TH 4HX1A 1KFAH 4HS6B 3O9WD 1UG9A 5D9SA 4F7PB 1CICA 1IGTA 2QKIB 5CGMA 1YN7B 1BIHA 2CRZA 4Z18A 4APQB 2XTJC 3OKDA 1I7ZB 3KPMA 2YPVH 1T66D 4OF8A 2EYRB 4NRXA 2OK0L 1UADC 4XTRD 5KN5A 2UWEE 3FO0L 3QFJB 3LKNB 3PGFH 1ACYL 4O2EA 5EC2A 1P4LB 3B9KB 3SJVD 1ZT7A 4C54A 3E8UH 3O2DL 3F12B 1RSFA 3UTPD 1OTSC 2HFEB 4NGHH 1KELL 5L88L 2X4UA 4WTZG 5KW9L 5I1EH 1A7RL 4P5TC 5D5MF 3P9WB 1IGJB 3U0PA 3W82A 3CH8A 5ALCL 1XF2A 1M4KA 4PREA 4N1CA 3PWNB 4PIRF 4ODTL 3MOQA 1RPQA 1FN4B 1JK8A 5CJ8A 2JTDA 4Y5YC 4MA8H 3STLB 1MHEB 5J1TC 4NUGH 5H94A 4PRHA 4G9FA 1ZWIB 4HCRH 4I0KA 3G6DL 4LU5H 4M6NL 2R4RH 5T5FH 3VXSD 1BZ9A 3LKQA 4KU1A 4M5ZH 1JNNL 4CMHB 1CE6B 4L8SB 5L8LB 4LSRH 1CL7L 1J0HA 3QO1B 2Q8AH 1ZGLA 2OTWA 3EYFB 4I0PD 4KFZC 5ACZB 1RU9L 1ZHBA 2NY4C 5CEZL 2SEBA 5TE7H 1F4AA 4RDQG 3NTCH 3CZFB 5D2LA 1R3LA 4TTGA 1JFQL 4YPGB 4X7EC 4HQQH 1DUZA 4YXHL 1Q0YL 2XACC 3KYKL 4S1SH 4I1NB 5C0DB 4FTVE 5C0CB 4KJWD 3K1DA 4WVRA 5B39A 5L7XH 3OMZA 2ESVD 1YEEH 4HD9A 2GSIB 4PRBB 5F9WB 3I9GL 4D0DA 1ZHKB 3CK0H 1FZOB 1MCKA 4IRSB 1NBZB 3GUTA 2BC4B 1NMAL 3S97C 1KYOJ 2XTJD 1NGWB 4FTVD 3UTZA 2Y6SC 3OHXA 5CSZB 1MFBH 1C8PA 4GRMA 4PLNC 4QF1B 4JG1L 1LWRA 2EKSB 5ANMB 4H20H 4KI1A 5CCKL 3GSRB 4HEME 2VQ1A 4PJEB 3GRWH 5ESAB 4XMKH 3SCMC 4XP6H 3RBSA 2GFBA 3HI5H 4FHBD 5DQDH 4XNYL 4XCYA 3ABZA 2VO5A 2DWEB 1OTSD 5TFSH 3TO2B 5HY9B 1TCMA 1VGKA 4YE4L 1FSKC 3OG4B 4P5TD 3S3JA 2BNQE 4NO2B 2VUYA 1N5YL 4PJIF 4O2FB 4GRWB 4YLQT 3O8XA 4JY6B 1RFDH 4OCSL 4DW2L 1FVEA 3IETB 2DTSA 1TVBB 4H5SA 4NHUB 5GGTL 5SV3A 3OB0H 1KLUB 1NC4A 1Q72L 2VABA 3OAUL 1PW3A 1R3JA 5E08L 1RULL 4GMSH 3PDOA 4HUKB 1I9JL 1KV3A 3EOYG 1GOHA 3IKCB 1CE1L 3LZFH 1VSCA 1FZKB 3SQOH 3LV3A 1NANI 2BCKB 1CVSC 2DQEH 2NY4D 5SWZE 5EZLB 1Z3GL 5BRZB 2NW2B 3AFLA 3VI3E 1TTFA 4EXKA 4ZPVA 1Q1JH 1A6PA 4PGDA 1H3WM 3GMPB 4MJ6A 4YHLL 2H8PA 1ZVSA 1H5BB 5IT2L 3MV7A 1E6JL 1S8DB 5DRZA 4QOKE 4ZFFA 4K2UH 1OW0C 4PRNA 1NKOA 1T3FA 2X44D 2A77H 1QHPA 3QUKA 5SX5H 4RGMC 3F7VA 3PGDB 3L95B 1T2QH 1AGCB 2PW1B 4L4TE 3VRJA 4OZIA 5D7IA 3BZEB 4F8QA 4L9DA 4ZOEA 4F7CB 2PYFA 3RWDB 4CDGC 3RKPA 4G8IA 4UAOB 3IB4A 4LIQE 1X7QA 2Q7YB 2Y6SD 1QYGL 1B2WH 3T0AA 4HS3B 3V0VA 1AO7A 1FL5A 4NKDA 1T21B 3SY0A 3MREB 1CD8A 2Y7QA 4GSDH 4HH8A 3V0AC 5I2IB 2W9DH 3S34H 4PJGA 2ARJQ 3MLVL 1MNUL 5ITBH 3QEGL 1IGFH 3KPPB 2WWMC 4YQXL 3SCMD 2GUOB 3CFDA 3TO4C 1J8HD 4HSQA 3BQUA 4AM0B 3SGKA 1RJLB 4AL8H 1JPSL 4ZS7L 1GGIH 3ZE2F 2WUCL 5D71L 2YPKA 1NC2D 4TYUA 2HKHH 4ZD3H 3OKMB 1HN1A 4YFLF 2EYSA 5IROA 1TENA 4ENEC 2G9HB 2DN7A 3DX9B 2JCCE 4FQQB 4TRPL 1A7PH 4NNPH 5A2LH 4MYWB 4ALAH 3WS6C 5SWQB 1U3JA 3DETC 3KNBA 1ZT1A 4FZEL 1GGUA 1ZANL 4PY7B 4QRTA 1TVDA 1YEJL 2HP4A 3LD8C 2YSSB 3HE7A 3ARFC 1MWAL 1EEZB 3MRHA 4DN3L 2B4CL 4BK5A 5E00B 3QEQA 5GGRA 1WZ1H 4NCC1 4X7TA 4KZEH 5KSBA 2E27L 4LLWA 5DRXB 4JO3L 1QVOB 5HHOA 1YYLH 1Q9KA 4RWHA 3AM8A 2I24N 1OP5H 1IAOB 3CC5A 3V5HB 2YN3A 3CLEL 1HILA 1A47A 2EDBA 3MRQA 3WIHH 4EUPA 2EE2A 5IHZA 1P4BH 4CVXA 2R0KH 4JFFE 3GSNH 4KHTL 2GJ6E 5IB4B 2ZCKL 4YGVB 4BUHA 4XBGB 3VRLF 2DQGL 4QT5A 2DQUH 3GHBL 2R56H 2XZAH 2XPGA 1DBBH 4K7FA 3CAFA 2Y07L 4MHHG 1R3HA 1DBAL 2VL4A 2IGFH 1MVFA 4JFFD 2FBJH 3BEWB 3LY6A 5KS9A 2AK1L 3VH8A 1MWAB 3ZLQC 2EYTA 4N0UB 4MWFA 3QIBC 2LFGA 3EAKA 4OV6F 4OF7A 3D3VA 1NLBL 3TT3L 3RNQB 3MXVL 4UZGA 2R2HA 4PJ8B 4RMRA 5T1DL 3HC0A 1M7IB 1YEHL 2Q1EA 3J8F7 3P73A 5LGHH 3Q6FB 3Q3GB 4WEUD 2VZ1A 2PW2A 3DVNA 3U48A 5F1NB 1ZT4B 1UM5L 2BY0A 4BKLA 1KPRA 4NO0B 4PJDE 2X9XA 1S9WB 4DKDC 4M00A 3VD7A 1FYHB 5SWSB 3RWGB 1JRHI 3X14A 3VFPA 2WWMD 4K94H 4MLIA 3R0MA 3TO4D 1CFQB 2GSGB 1G9NL 2C3WA 5H35A 3QQ4B 1U9KA 3QULA 2VWEC 1WTGT 4KTEH 3EOAB 3OGCB 3DJ9A 3KJ4C 4K3JH 1DN2A 3ULVH 1GYAA 2VDQH 3VI4F 3EYOB 2AABH 3KYAA 1ZLUK 1G7QB 1JPGA 1NGQH 5DJ6B 5LJYH 5HVWA 2MQ3A 4E5XB 4FQLH 3U7AA 1XF5A 3DETD 2J12B 4C55A 3QNZB 2P42B 4HWZB 3HI6H 3ARFD 3SOBL 4BFIA 1YJDC 5DD1H 1S7SB 5I1KL 1QEWB 3MGAA 3TIDB 4AT6B 4OD3H 1IM3A 4P48A 1O7SA 1SYVA 4R4BB 5FYLD 1YEDA 2D03L 4MQ7A 2FGWL 3WLWC 4DTGL 3FKUS 3I3DA 3NCYP 3BIAX 2QR0B 4OBSA 3ZKXB 4RRPA 5HHPB 4MAYA 1WT5A 2PTTB 3QUYC 3QAZC 3WUWA 3NCFB 4G9FD 3EW3B 3GBNL 2EE3A 3QRGL 5BO1L 1I8MA 3RWJB 1RJCA 4KRMB 1S5IH 4RGOL 1QQDB 4WTWA 4YR6A 3KLHC 1A2YB 5MEQB 1X5GA 4Z0BL 4B53A 4ODSH 1RZJL 5LBSL 4ODBD 1U42A 2BNRE 4XRCB 3VG9C 4N8VG 4UOW0 1NCBL 2OR9L 3QIBD 3LRSB 3NPSB 4TSAH 1T5WA 5HD8C 5JPNA 2J5LC 1CFTA 1RK1A 4TN9A 5I8CA 1RVFH 2W91A 5C0RL 5DZNA 1N2RA 5IMLB 3TCLB 1X6LA 4H1LA 1ONQA 3UDWA 2PCPA 1B0GA 5EZOH 1FGVH 2AJ3B 2OZ4A 2DMKA 1JPST 2HN7A 5F72S 1T04A 2E8ZA 5GS0H 3WV0A 4JO1L 4IRJC 4X9FA 3ALWA 4N0CC 1U95A 3PL6A 2K7QA 5AAWA 1YN6A 5ID1A 4B41A 8FABB 5DR5H 2B7DT 4R97B 3LQAC 1AFVH 2P8LA 43C9A 1YUHB 5FECB 3BIKB 4NRZB 1S7XB 1Y18A 2HG5B 2VXTH 1XZ0B 5DXWA 4LLDA 1WGOA 5D93B 5FUCC 2DKMA 1OY3B 3BH8A 4OIBA 5FUZL 3L3HB 3HRZB 2FLRT 4OD1L 5FXCH 3V9FA 5ADOH 3SPVB 2Q6WA 4X5WA 3BQUC 1T1WB 4P2RA 5D7KE 3LKOB 3P4LA 2DS4A 3ZL4H 4MMZC 4UNUA 3VGFA 3P4NA 1AQKL 4OZGA 4WFFD 4DFIA 5IF0B 3X3GL 3WNMA 2VL5B 2ZG3A 1GIGH 1ZA3B 1IAII 3GNMH 1SY6A 1YQ2A 3GB7B 2BFVL 1MF2H 4KRNA 1G9MH 3MLZL 4OZHE 4ZAKB 5IW3A 3B9EA 2BSTA 4RMWA 1FFQA 1MJJB 4I4WB 1N6UA 4LASL 4I3GA 3MRRB 4DN4L 4XP1L 3E2HC 3S96A 1CLOH 1I9IH 2AV1A 3PWUA 5JMRA 2DQJL 3QUYD 2YPLD 3HE7C 1GGTA 2Q76B 1NC4D 4UINH 3U4EB 4U1IB 3MV9A 4KVCH 3WEXB 1AD0B 4NOFA 1C08B 4WU7A 3ULVC 1UYWL 5HXMA 3HC3H 2YA0A 1JNLH 2YKLH 4RFOH 5KVEL 4G8EA 1QLEH 5IB5B 2PUQT 3AM8C 4FQPA 5CWSA 1DFBH 1T6VN 3P9LA 4KXZI 5AZ2H 3KLHD 1TTUA 3O6LL 3R1GL 4GG6F 1I3RA 4GBXA 1DL7L 1HHJA 1S7QA 3BDBA 3IAGC 2XWTA 4CVZA 4UB0L 4JZJA 1KG0B 4KMTH 3PP4H 2Q86A 3BKJH 3IDIA 3IS1X 4R7DB 1NUGA 2HFGH 4HS6A 3R0NA 5HD8D 4JFDB 5T33L 3MA7B 3QDGE 1ZHNA 1U8JA 4FQXB 1A0QH 4NZRH 2LU7A 4APQA 4WUUB 4WW2A 3U0WL 1I7ZA 5DVOA 1BX2B 5TPWL 1FHGA 1NBVL 3QPXL 2OTUB 3MLRL 4R7NB 3SDXF 3T4YB 2XZCH 4V1DB 4J3VA 1HKLL 4FRWA 1KJ2A 3LS5L 3Q5OA 3QFJA 4IRJD 1G0DA 3FB6A 4N0CD 3NBNA 4ZSOB 3WFCH 5H2BA 1F58L 1HINL 4RNRA 1OAXH 5D72H 5F9OL 2OI9C 5I1IL 3VRIB 1IEAB 3P77B 1UXWB 1MJUH 4MQSB 3F12A 1TZGH 1MCLA 4M93C 1CFSB 1RIUL 1WJ3A 4P23B 3P3YA 4R4FL 1E4KA 3GIVB 3DVIA 3S37H 5GRVL 3T1FB 1IGJA 2QLVB 3BFOA 4P9HL 5CINL 5I30H 1BOGA 3QQ9C 5BS0B 2IWGA 3PWNA 1RURH 5JHDB 4EOWL 3W0WE 3V5KB 3STLA 1MHEA 4PJAE 4NT6A 5DS8B 1KIQB 2DM7A 5DT1H 3NIDE 2IH1B 5I1GH 1CE6A 4L8SA 5B39G 3ZT6A 4HKZB 3AMLA 2P5WB 3QO1A 1W8OA 4HGKC 3G6AB 2M1KA 1RIVH 1C5BL 1L6ZA 4ODUB 2N56A 5GZOC 4KGJA 3HE7D 2HVJB 4DGIH 5ERWB 4JFEB 2QQLL 4JO2L 2JELH 4PJ5D 1JYWA 3ULVD 4S1RL 5IIEB 2VLKD 2GJJA 3BZDA 4O4YL 5FM8A 4GS7B 1XGTB 2B2XL 4CW1B 2VUOA 5C0DA 3ULSB 5C0CA 5FHAH 2VR9A 4HIXH 4J6RH 1EA9C 2CXKA 1FQ9C 5BOZG 2XN9B 1WT5C 3EYSH 2VDRL 2GSIA 4PRBA 3NA9H 1CT8B 1OAQL 3FB8A 4UBDC 5J4MA 1ZHKA 4WWKB 1FZOA 1XMWA 4YBLB 4IRSA 1NJ9B 3SDYL 4MDIB 1SJXA 2BVEA 2BC4A 4CRPA 1OPGH 4HFWB 1G9MC 3LEXB 5JW4R 1AI1H 4LMQI 5GGUA 3UTTE 1G7IB 5FYKH 5J13B 1RUQH 1OQOA 1NUDA 4LCCC 5D5ME 3TZVC 1DBJH 4OQ1A 2DL2A 4OI8A 4QF1A 1IM9A 1QFWL 4QGTA 5ANMA 2DMCA 3MV8D 3HMWL 4PJEA 3TN0D 4UMGA 1IKFH 4X99B 1UVQB 3Q1SL 3SKMB 4WHTB 1I3GH 1RUMH 1CBVL 2DWEA 2P47B 5I71B 2NNAB 5EZIL 3TO2A 4G9DB 5E8EA 5HYSB 1T4KB 4LRNL 1PAMA 1KPUB 1QPXA 4JHWH 4WI6A 4ODVL 5IWLA 3FFDB 3OGOE 3JWOL 4XH2B 1TXKA 4NO2A 1U8PB 4O2FA 2XI9A 3QQ9D 3F58L 1N4XL 3MJ9H 3PIQB 5I9QC 4UV7H 3CDGB 2DTMH 4NDMB 2ZPKH 3IETA 3VXRD 1YYMH 3FHAA 2DLIA 1TVBA 2E3VA 3NAAH 4NHUA 1X3DA 3MUHL 5EU4B 4HBCH 2LAGB 3L5WB 3ARGB 1MJ7L 1XR8B 2E9BA 5IP4A 3A67H 3IKCA 3TV3H 3X13B 2YD8A 3IXTB 4ONFH 4BJLA 4HKJA 4LLAA 2XQYG 3FMGL 1YEKH 3IDYB 4LSVL 3HNTL 3PWPB 4OLXL 3S4SB 5GZOD 4U1LA 2ADIB 3ULUL 5F7KC 3C08L 3QNYB 4WUKH 5CHNA 3QPQC 4ZTPH 5EZLA 3EFDL 5BRZA 2NW2A 4FXGB 3QDAA 35C8H 4GKNB 1WFNA 3NCMA 4GW4B 4G43B 3GMPA 5D2LF 1ZLUH 3LKRB 1LO4H 1UWXH 3HG1A 5D70L 5T3XD 4G7VH 2DYPD 1F6FB 1J12A 3WO4B 3BPOC 1ZLVK 3TPUA 4EQ2A 2V2XB 3IFNL 5IEKB 1F6LL 2V2TB 1S8DA 3ARBB 1CFVH 2FR4A 4YDLC 4OFIA 1JZ2A 4IBLT 4MZ3A 5JXAH 1SEBB 3PGDA 3L95A 3CSGA 2AQ1A 5DRWA 1OLLA 4RIRA 5K59E 4UBDD 4Y19B 2XKNA 3GDBA 1EO8H 2FECI 4L4VE 4F7CA 2DJSA 4LIQL 5T1LA 2Q7YA 2B1HL 3DMMB 4HS3A 2CKBL 4KK6C 1K5NB 5KOMC 3D6GA 3D18B 5MEOB 3FFCE 1CZ8H 3TZVD 2AERT 5AZEH 4LVHC 3MREA 4PJIE 4L5FL 4LQ1A 4IM8A 5I2IA 4HWBL 3PP3H 1VADB 2FJFB 3LPWA 3JXAA 2GUOA 1W72B 4PG9A 3S6CA 2AJVH 4AM0A 3P30H 3H9ZA 3HRPA 4WW2C 4G6MH 2YWZA 3WXVL 5DHYA 1UJTA 3WN5B 1AR1C 3OKMA 3UJJL 1AGEB 3UTSD 4XP9L 5DVMA 1KN4L 1UKSA 3UEZA 3O4LD 1A7QH 4PJ7B 2NY5H 2G9HA 4L8CB 5CUSH 4EUPG 5A40E 1UH4A 3T4AA 4FQQA 4B0MM 5K9QG 4FP8H 4G80B 3PGFL 1GGYA 5D6DA 4F15C 3KG5A 4OIIH 3T0XA 5I1AB 2C9AA 5SWQA 3IAQA 2YA2A 3AY4C 2WWKT 1F45A 3PQYA 4PY7A 3TH3T 2YSSA 5CP7B 1NDMB 2AJYL 3RUGB 1QNZL 3MLPA 5CD3B 1EEZA 1HWGB 4KJQC 5E00A 3QDMB 1HDMB 3C60B 4MX7B 1E4KC 1MFAL 2Z4QB 5DMKB 3T08A 1FDLL 3P11L 5E2TH 1NMCC 4LAQL 1P84K 1RZIB 4M7JL 5DRXA 3VFRB 1QVOA 3VH8G 3BSZL 1IAOA 3ZYJA 1Z2KA 3K2MC 1K3IA 3QPQD 1N7MH 2EH8L 1L4IA 3OX8B 4R3SA 4XCFH 2LAAA 5IB4A 4YGVA 4OGYH 3U83A 4HWUA 2YUZA 3PV6B 4FQ2L 4R90H 5L2KB 1JWSB 3T77B 2FX8L 1HI6A 5KANI 3C6SA 2OBGA 3C2AH 1DE4B 4M5ZL 5GJTH 5A43C 5EO0B 1PDKA 1A3LL 1WZLA 5C08B 5F96H 3TBVB 3F62A 2A6KB 1QFOA 5EZJB 3V4PL 5JR1H 1D5ZB 3AU1A 1UGNA 3KPTA 4PPTA 4OZIF 4ODHL 4XBEH 5D7IF 4PJFA 4OLWL 3ZE2E 1MHPL 1R6VA 4L4JA 3RNQA 5CFHA 1WK0A 4PJ8A 3TCXA 5D96B 3VXUB 4XXCC 1M7IA 2FATL 2AK4E 5L2JB 3RA7L 4Y1AB 5CEYB 3Q6FA 3Q3GA 1OAZH 4GAJH 1DCLA 4KK6D 3OKEB 4HQQL 5IESH 4HUWB 1GSMA 4PP1C 5F1NA 1ZT4A 3K2UH 3CFCL 4M7KL 2EDFA 3HI1B 1S9WA 1JV5A 1QBAA 2A6DB 1T80A 4NC1C 5BW7C 2HFTA 4OLYL 3RVUC 5SWSA 3RWGA 4LFHD 2V6HA 5CIPH 4X98B 1T6WA 4GUPB 2GSGA 3ARDC 1CDYA 1GGCH 5DTFA 3QQ4A 5BMFL 1NUFA 3EOAA 3OGCA 5LGKA 3D9AL 3V6OA 1AR1D 3BP7B 3B8SA 4RWYL 2J7LA 3HZVA 2AXHA 5B21A 5AYQA 2GK0B 4PGZA 5FYKE 4M1DH 3EYOA 3PDGA 5BZWB 1WF5A 1EHLL 4RRPG 2Q8BH 5DJ6A 4KUCD 4R8WL 1EBAA 4DEPC 3LS4H 3DI3B 5LAXB 2P49B 3CFKB 4E5XA 3MRIB 3WUWG 1JGVH 1KCVH 2FYYA 2VDPH 3VRLE 1BZ7A 5F6HJ 3GSWA 4X4XB 3W81A 4GW5B 4M6OH 4Y4KC 2CK2A 3DXAE 1KCUL 4KJQD 4DKFL 3BKYH 5TFSL 1QEWA 5IWLC 4AT6A 3K8MA 4TNVF 4G6FB 1JN6B 5MHSE 3MA9L 1QFUL 4QHKI 1K4CA 4ONHB 3SO5A 5C07E 3MLSL 4TNVK 5DD5L 3BDYL 1KTRL 1PYWA 2QR0A 3LRHA 5HHPA 3IF1B 4Q7DA 2EZ0C 4NQUA 1MHHB 5HYQB 1X5YA 3O6FB 2NZ9C 3AROA 4B7IA 4MJIB 2WINA 3WYRA 4H1LG 5I1HH 2Q7NA 3V0WH 3MRDB 4OTXL 3N1MC 1I9RH 5CGYC 1PLGH 2CO6B 5D4QA 4JLRB 2NY5C 2CLZB 2WAHA 1AGDB 4HGWB 1QQDA 3AVEA 1REIA 3AUVA 1A2YA 1X5LA 5MEQA 5I73C 5DD0H 1UT9A 4JCLA 3SQOL 4MCZB 4XRCA 1QTYT 4LCWE 3LRSA 3QEHB 4X5XB 2KDGA 2A6JB 5DD6B 1ZGLM 2VAJA 1QACA 4UDUA 3UXFA 1E28B 4I8DA 4XC3H 5B3NA 4GLRI 3MZGB 4X6FB 4X7SH 1MCCA 3JVGA 2NYYC 3TCLA 3U36B 2Z35B 3AS3A 3HE6B 5ALBL 3VI4E 4PP1D 2AJ3A 4FQCH 1IILE 4CL7A 3RVUD 1KJVB 5IK3A 5EBMA 3LOWA 1C1EL 4PS4H 1T2QL 3ARPA 8FABA 5C0BB 5HGHB 3G5VB 1QRND 1Z0MA 3G6JB 3ARDD 5BOPA 3PUCA 1FO0H 4NRZA 2HG5A 1CL7I 2H2SC 1XZ0A 4E41E 1GGBH 1K8DB 4NN6B 4LF3B 1IM9D 3IS0X 1JRHH 5ESVB 4JDVB 4Y2DC 3DO3A 5GS1B 1CTNA 2YUVA 3L3HA 3HRZA 1YQVL 4EN3B 3SPVA 3RTQB 1IGCH 3S34L 1T1WA 1QA9B 3MRKB 4NNXB 3NABH 3BIBX 2IG2H 4MXVF 4XNXH 4Y4KD 2VL5A 1KOAA 2NCMA 4AL8L 3D2UA 1GGIL 2EDLA 1IGIH 3TYFA 3GB7A 4JRYB 4ZAKA 3QXAA 3JUYA 3BX7C 1INDH 4R0LB 4P46C 5HGBB 4PV9A 1EZVX 4I4WA 3D1MC 3HNSH 3MRRA 5IMMA 4HIEB 5E9DD 2EZ0D 1URLA 1A7PL 3GM8A 2I60L 2NZ9D 1MAML 3U4EA 4DVRL 3VD5A 3WEXA 1AD0A 5HHMB 1C08A 1MPAH 5CGYD 2BX5A 1DQML 3MYJA 1KC5L 1UZ6F 2Z31C 2VZVA 2XY1A 3BZ4B 2BVQB 2PF6A 3MLUL 1RZFL 1KG0A 1RZ8B 5JZ7C 4ZYKB 1P69B 3KLSA 5FIEA 2DLFH 1DVFB 3ZDZF 4PJ9C 4XVSH 4JFDA 3HG1D 3MA7A 1HEZB 1CK0H 2G60L 4FQXA 5FDWB 2MWCA 2AXFB 2NPLX 2NYYD 4W68A 4WUUA 2F54B 1KN2L 2OTUA 3WIIH 4ZNEE 1ES0B 4R7NA 1FL6B 3T4YA 5EOQL 3D25B 5EORH 4P59H 5J3HC 1E4WL 5JQHC 2JJSA 1U3HB 5L8JB 4OM0H 2HLFC 3A6CH 1DQQB 2WBJB 3E6FB 5HHVH 1ZLVH 2MPAH 2ICEB 2VLRB 4MNGB 4MXWH 3VRIA 3P77A 5T1LD 1UXWA 3QZWB 2WK2A 1CFSA 1KJ3H 1J1XL 1RZKC 1MCIA 4XVUC 3WL9B 4QTHA 1RV6X 1HH9B 4Y2DD 3VXPB 4JPVH 1KEMH 1NUNB 2ORBH 2P4AB 3H8NA 3DUHA 2IEPA 4NM4H 4S2SB 3T1FA 5DHXB 3SN6N 1O5DT 4KAQL 1NDGB 5BS0A 5EBLA 4G5ZH 1QSEE 4Q6IC 4ZFZB 3RFZC 4JY5H 3V5KA 1CXEA 5JW5B 4L9LA 4RA3A 1A7OH 3GMQB 4KZDL 5INDB 2R23B 4ELME 2C3HA 5F7UA 2IH1A 3WIFB 1TITA 4NQXB 4KQ3H 4GG6E 4NZUL 2VDQL 3TH4T 4NNYB 1QSED 2AABL 3B2VH 2Q87A 4P46D 1TJGL 1AH1A 4XPHH 5F7NC 3PQYD 4N5UA 2YZ8A 4XNUH 3V6FA 2FSEA 5ERWA 3FN9A 4FFWC 4JFEA 1RJYB 2EDRA 4EDXB 4XVTL 3HI6L 3HAEH 1A4KA 3T8XB 3KPRD 4YEEA 5FB8A 1XGTA 4G7YH 3SDXE 4OD3L 4OLUH 2Z31D 1MREL 1T83A 3BD5A 3KJ6H 4IS6B 4U3XA 1CXLA 4Z7UA 3V52H 4RQQB 4ORGB 4O9HH 3SGJA 5KTEH 2HJLB 2XN9A 1CGSH 5DA4A 1D5XA 1U8LA 2IALB 5JZ7D 4BSWB 1LP9B 1FBIH 1CT8A 3I2CH 4PJ9D 4UILH 1E6OH 4NQED 1E0OB 1U8NB 5DRNB 4WWKA 1G7HB 1IZJA 5L0QB 1YDPB 1NJ9A 1NGZB 4GQPH 5E70A 3CXHK 3OWEA 1JHLH 3LEXA 4PJBA 1UKTA 3U79A 3WFBL 1G7IA 1H15B 4KQ4L 3OKYA 1FH5H 1S5IL 4JM2C 3EYUH 1PG7L 4NJAH 2CR6A 4M1GL 2CSPA 5J9PB 5J3HD 4S1QL 2JJUA 4PB9H 4TUKH 2UV3A 3RAJH 3FOMB 2HLFD 4X99A 2ERJB 2DBJA 1UVQA 4D9LL 3SKMA 5FF6B 4TSAL 4YUEH 4H25B 1FNFA 2DQDH 5ILTL 5DI8A 2NNAA 3TBTB 4G9DA 5HYSA 1T4KA 1CF8H 4PTUA 2F53E 7CGTA 1KPUA 4XVUD 3M45A 5D7SH 4P5KB 5ENWA 3IU3B 3FFDA 2Z0BA 3JWDH 4U0QB 4XH2A 1U8PA 2OS7A 4WGVB 4K3HA 4BQ6A 1B3JA 1D9KB 4UT6L 2JJTA 5GS0L 3UZQA 1UH2A 3D69B 3PIQA 4NM8H 3UTOA 1Z6JT 3CDGA 5CLTA 5DR5L 1BVKB 4NDMA 2RB8A 1LGVA 4JFXB 2DBLL 5HTSA 1AFVL 4DAGL 5EU4A 4K71B 4U1JA 3ARGA 4XHQA 1L9MA 1XR8A 5F1IB 2APWA 3RNKA 4PB0L 1VGEL 3OKOB 5GRZA 1WIPA 2NXYB 3IXTA 5ISZE 1G6VK 1P9MA 4LOUC 4I13B 5DFWH 3PWPA 4LSDA 4RMUA 3S4SA 1AQDB 2YD2A 2B0SL 4CVWA 4ZXBC 1J1PH 3QEUB 4GW4A 4G43A 4FFWD 5B8CB 5HGGS 1BVZA 3LKRA 3U0TB 3W39B 3M8OH 3LDBC 3MRPB 2R4SH 1KCRL 1JI2A 4AG4H 2V2XA 5IEKA 3C6LA 3TC9A 1XCQB 2V2TA 2XZQH 3ARBA 5D7LB 4JFHD 1N6VA 4POYA 2W9EH 4OCWL 1M05A 4DUXA 5J11C 4WI7A 3KPNB 1SEBA 5LWYH 4J12A 4GRLC 1CLOL 1I9IL 4Y19A 2K3TA 5J89A 4HXBH 5F9AC 4JVUA 4UINL 3WXWH 4FXKA 1SYSB 4TSCH 3HA0A 2CKNA 4HUNB 2YKLL 4JM2D 1K5NA 1LVEA 4OCLC 4EI6B 1EJOH 3D18A 5MEOA 3SKJL 1ODAA 3U7WL 5ECJE 4WCYH 4KVNH 3MUY1 5C0AD 1MCJA 1F4XH 1YEGL 1TIUA 5F7EH 4HT1H 1VADA 3DUUA 4OF3A 4KI5F 5EIVA 2FJFA 4PJEF 1HE7A 2AJZA 4KMTL 3PWVB 4NBYB 3CSPA 4NYLB 3BKJL 4C59B 1W72A 5HGDA 2GY7B 2HFGL 3BN3B 5FO7B 2C26A 4UIKH 5EA0H 4PRHE 5EU6B 5HYJE 1Q38A 3W9DB 1MJ8H 3WN5A 4ZO8A 4YHKH 1K2DB 2IAND 2GHWB 5INCB 4PJ7A 5T5NF 3TGXA 4L8CA 4YWGH 5DO2C 3VE0B 2A73B 2VZTA 2WP3T 1JGLL 1F13A 3BPLB 3S37X 1I4FB 4G80A 4NUJA 5I1AA 1CQYA 1C5DA 5D72L 5D2LE 3UZEA 5JORB 2HH0H 5CP7A 3TWCH 1NDMA 3RUGA 5CD3A 1B4JH 5HYEA 3QDMA 1HDMA 4FQJH 4MX7A 3WNPA 2AJSL 1O0VA 3KGRA 2Z4QA 5DMKA 2Y72A 5F7DB 2M8XA 3ZMRA 1RZIA 4PRPB 4HHAB 4LOUD 5LCVH 3GBML 1LO3L 3RIAF 4JHAH 5HDQH 5AWNL 1RURL 5F7LB 3RIAK 4ZXBD 12E8H 1EEYB 4L9LC 2Z93B 4RAUA 1CDGA 3CPLB 2B5IB 5L2KA 3B5HA 4Y5VC 1DE4A 2VDNL 3JWDC 5I1GL 5EO0A 3VA2C 4WO4C 1FNAA 3VGDA 4J3OC 4GRLD 4MNQD 1M6OB 2APXA 1KLFA 4MSWB 1D5ZA 2DOCA 4MD5B 5I1JL 4FFZH 3E3QE 3DPBA 4UU9B 1FYTD 1T5XB 3OJ2C 4HJJL 4JG0H 5D2NB 5C0GA 3NACL 2BVYA 4AEIH 1D5BB 2QQKH 5DJXB 3THMH 3VXUA 3WJLC 5BZDB 3U4BL 5L2JA 4Y1AA 1JF1B 5CEYA 4P3CH 2NY1B 5F6IB 3OKEA 4HUWA 3O3EA 4Z7VB 3SGJC 3L3JB 3N85H 3VFGH 3HI1A 2H1PL 1AC0A 3GM0A 2A6DA 4O2CB 4S0TD 4ZO9A 4HJ0C 4XPGH 1JZ4A 3CGTA 1QKZL 5FCUL 5HJ3A 1XH3B 4W6XB 4LLYA 4X98A 1BQHB 2BMKB 2EIEA 1EHAA 5KJRH 1A14L 1Q8MA 2VLJB 3DSNA 3PV7A 4HUXB 4U1NB 5FOJA 3BP7A 1OPGL 1AI1L 2PTVA 4LSUH 2V5SA 4I3RH 5EDXA 5FYKL 3W9EB 2EIZB 2GK0A 5HYIA 3D39B 4J3TA 5DO2D 5BZWA 1K6QH 4OQTA 1TZHB 5C09A 5TQ0H 1OF2B 3VG0L 3BGFC 5LAXA 1GCFA 3CFKA 4M02A 3MRIA 2AP2A 1IKFL 5CD5C 5LQBH 4QHMB 4FMKA 3HKFA 4X4XA 2JE8A 4ZOCA 2NY3B 5CBEB 1IVLA 3QUML 5C0IB 1X5FA 2FL5B 1UACL 4L3EB 1FFOB 4XC1H 2A9NL 4ZUUB 5IHUH 1ETZA 4EBQH 1DBKH 4BH7A 1JN6A 4YXKH 3QUZA 4QHLA 4Z8FL 1XIWC 3TJHC 5E4EC 5BV7B 4F57H 4NN7C 4H8WH 4XWGH 3C5ZB 3IDMB 3MJ9L 4OZIE 1MHHA 5D7IE 5HYQA 1P7QD 3O6FA 3OF6A 1H9VA 4U1HB 5F3BB 4MJIA 3JTTB 3MNVB 1BEYH 3LMJH 1YYML 3MRDA 3NAAL 4GAFB 4PY8J 1X9QA 4OCYH 3SDDC 3ZHLA 3BRDA 4JLRA 4HBCL 3U1SH 1AO7E 1DQTA 2J6EA 2CLZA 5J6GA 3DARA 1GHFL 3FHQA 1I1RA 1P9MC 4HGWA 1HNGA 4CNIB 3DV4B 1GRWA 1PEWA 3RQ3A 4WO4D 4DGYL 4PJGE 3O9WB 2ICWI 4ZTPL 3QEHA 1RD6A 3SGEI 2A6JA 5DD6A 5C70A 2J1KA 3UYRL 3ZT5A 1EERB 2Q3AA 4Q9QL 4X6FA 1BVLB 2VAAB 1R5VB 3C6LC 1OGAD 2Z35A 3HE6A 4ELKB 1IKNA 3IFLH 1JGDB 4Q9BA 3BMWA 4NKIH 3FN3A 5CILL 3P4OA 1PKQB 2DIJA 2H26B 2XA3A 3SJVB 2D9QB 4KKBC 1KJVA 1JCKA 3EFFA 4FFYL 4HJ0D 4LCUB 2HYMA 3EBAA 5FGRA 2QHRL 5JOPE 5M94B 3G6JA 3BEVA 2HJFB 1EO8L 1QR1B 5TE6H 3QEQE 2VTFA 4J3SA 4AH2B 2BERA 4QGYA 1K8DA 1YPZA 4NO5B 3TBWB 4LF3A 5CEXB 1NGPH 1WLHA 4G8GE 5HHOE 1C5CL 3IRZA 5ESVA 1MRCH 3SE4C 1BWWA 5GS1A 1A1NB 5JOPD 1ZTXL 4EN3A 3RTQA 2R69H 2R39A 3BP4B 3BMVA 3UX9B 3CVHB 1QA9A 4OT1H 5CD5D 2VOTA 1CGWA 2BRRL 3UJIL 1TNNA 1BIIB 3P0YH 1MRDH 4NNXA 2ZKHL 3VXSB 3VXQB 3PGCB 1RI8A 2AJVL 4O5LL 1FLRL 4YHZH 2AKRA 3P30L 4AMKH 4G8GD 3QXDB 2X4NB 4I0PB 1BD2E 3Q5TA 5FA4A 1NAMH 4JRYA 5A2IH 5E2UL 1W0VB 1T1XB 4JREB 2JB5L 3UJTL 2NTFA 3HS0B 4X7CC 1XIWD 2DQFB 3EUUA 4R0LA 3TJHD 5KS9E 1AJ7H 5CUSL 2P8PB 1F8TL 4PJCB 1T7XA 5DC4B 1WC7B 2XICA 3ARTA 4IRZH 1D3CA 4ETQB 4P4RB 1MFCH 2O5XH 1FCCA 3FRUB 5I8KL 3TA3A 4F9PC 3GSOA 3HFML 3RJDA 1EVUA 3SDDD 3GKWL 1JZ5A 2X9YA 5IMOA 2ESVB 1OWWA 4ZG1A 2XKSA 5A2KH 3V95A 1QZ1A 3FQRB 3U9UB 4LSPL 3BZ4A 3IT8D 2BVQA 3V8CA 4HC1H 1L0XA 3BO8B 4P2CG 4WFED 4Z95L 1HSAB 4ZYKA 1DVFA 2XY2A 2OK0H 1DSFL 2XTJB 1WEJL 4FTVB 2M2DA 3FO0H 1Y6NR 1MELA 2IPKB 3B83A 1CIDA 1HEZA 1F97A 2D7NA 2P24B 1D5MB 2AXFA 1ACYH 3C6LD 1DQJA 2F54A 4R90L 1BM3H 1KB5L 5ITFA 3O2DH 1ES0A 1FL6A 5GJTL 4MZ2A 5JW3H 4H8WC 4KKBD 1U3HA 5TJWK 3F7QA 3LIZL 3UPAA 1DQQA 2WBJA 3SQBA 5KW9H 4MXVE 1L6XA 2VLRA 4NN5C 5IB1B 3VXMA 3WD5L 3VFNB 5ALCH 3VWJC 3QZWA 2RAMA 4DQOH 4ZQKB 4G3YL 5F9JB 3S9DB 4P5TB 4ZFOB 3LN5B 3PHOA 3OKKB 4PV8B 1UH3A 2Y1VA 4FNLL 2X1WL 4MLSA 3I85A 3PABA 1OAZL 1HH9A 3X12B 3NVQA 4NQDA 4Y5YB 1DQLH 1ADQA 1A1OA 3G6DH 3ILPB 4OSUL 5HPOA 1NDGA 1JNNH 5DEZA 1CL7H 1FFNA 2C4FT 5DA0B 1G6RL 3B6SB 4MXQC 2EDKA 3BH9B 5JW5A 2IADB 1KB5B 3EDJA 4IMKA 4QRPA 43CAB 2C3XA 1DBML 4G6AC 4QRRA 1RU9H 5INDA 5IQ7L 2R23A 2V5RA 5CEZH 1MIEL 2CLVA 2OJZL 5C0EB 1UZ6E 3GSVA 4JFYB 2HLAB 4RX4A 4XAWL 3QBTB 3WJJC 1SBSL 4W4OA 1XF1A 2NY4B 1G7JA 4NNYA 4M1DL 4V2CB 5DDHB 2EH7H 1JFQH 3IJYB 3V5DB 1INQB 3RX5A 1JI1A 3ZDZE 4YXHH 1T1ZB 3VXOB 1Q0YH 3WBDA 5J1AB 3KYKH 4RGNE 3DHMA 4JZNA 1EIBA 1S7UB 1RJYA 4EDXA 3QWOA 6FABL 5DK2B 4Z7WB 4KKNA 1BZQK 3BE1L 3HUJB 3QUZC 1TMCB 3I9GH 1X4YA 3T8XA 1OL0A 1CQKA 2NY2C 2RFXB 4K9EH 3BGMB 3BT2L 3GO1L 5DHVH 1BBJA 4RQQA 4ORGA 4KDVA 2HJLA 3GMLB 1YMMD 1MI5D 1CYGA 2IALA 2ZUYA 4LDLB 2IBBA 4BSWA 1LP9A 3K4DA 3SKNB 1Q9WB 1U8NA 1W0WA 5EOCJ 5DRNA 4JG1H 1V5JA 3G5XB 3NFSL 1G7HA 5CCKH 1YDPA 5HYSG 1NGZA 3MRMA 4P2QD 1NEUA 3CX5K 1X5AA 4KJYB 1BOYA 2RR3A 3FO1B 1FORL 1PLGL 2FO4A 4LPYA 3T0EE 1HHKA 5LXGH 1UXSB 1PSKH 4XNYH 3EZ8A 2V7HB 1V7NH 1KIUA 3U6RB 3SCMB 3VGBA 5H8DA 1J8HB 5EU3B 3A6BL 3CX2A 4P2RE 3FOMA 4KK9C 3U46A 3QA3B 4YE4H 1NSNL 3C87A 1IL1B 1NC2B 4XAKE 5DEFA 1J87A 5FF6A 2HAZA 4ZMAT 1C7SA 1LE9A 3VWJD 1FSKB 4X8XA 1JTOA 4FXLA 3C8DA 2ILLA 4OCSH 4X7SL 3O11B 3H9SE 4WFHE 4EDWH 5BVPL 5AG8A 3I6GB 5IHLB 4P5KA 4HKBB 2C5DC 1BJMA 3S4SG 1Q72H 5E8NB 5IW1B 4UQ3B 4FQCL 2CGRL 4XAKD 1D9KA 4C56A 5F44A 3TFKC 3D69A 2YEZB 4LARL 1CE1H 5FKPB 2VE6B 2E7BA 1MH5B 4KGLA 3VCLB 3MV9E 3OXRB 4MXQD 1BVKA 4JFXA 3H9SD 4ZPTB 4UUJB 4KHXL 3S36L 4PRAA 4N0FB 1FO0L 3H3PH 4H88L 2GITA 1QBLL 1P84J 1U36A 4LLQB 4EI5C 1NGYB 3WDHA 4F9LC 4YHLH 5C09D 3NCJL 2DB8A 1UZ8B 2DL9A 2PYEE 3MCKB 3T2OA 4F58L 2D7QA 2WWKO 1IGCL 2G5RA 1E6JH 2D0GA 3QEUA 5C92A 4PLOB 5B8CA 3EDKA 3U0TA 3W39A 3WNKA 2NR6C 4QWWC 3QUZD 5CBAA 4JFFB 4ZOBA 2NY2D 4RGMB 1XCQA 4KY1L 5D7LA 5JIIA 1S3KL 1SJVA 1BGXL 5A1AA 3QJFA 5LG1A 1QYGH 1GC1H 3VXTB 3KPNA 4C83B 3MOAL 3TA3C 3LN4B 3QFDB 5F7YC 1WFTA 1HHGA 3KR3L 3HZMA 4QRSA 1SYSA 3MLVH 2Z8SA 3QEGH 4A2LA 4OGZA 4YQXH 2BY1A 1ZK9A 2D7OA 4EI6A 5E6ZA 1JPSH 4ZS7H 2X9WA 4DCQB 1IGTB 4KRPC 2BVPB 2IQ9L 4PGCA 4Q0XL 5D71H 3TO4B 5GGSB 1MUJB 4KK9D 3NZ8B 3PWVA 3KPMB 2IPUG 3VGEA 3FTGA 3QDJD 1CFBA 5FO7A 3S7GA 3STZA 2G5BB 2NX5A 4TRPH 3FOLA 5F7MC 3W9DA 3QCVL 4FA8A 1CK0L 3W5MA 1K2DA 4FZEH 1ZANH 1ZT7B 1T7VA 3VE0A 2A73A 1MWAH 5D1XC 4BSVB 4AEHL 1G1CA 1KXTB 1MCEA 4DN3H 2B4CH 3LD8B 1KNOB 3TFKD 3ARFB 1I4FA 3VMPA 5IMKB 2E27H 3QXWA 3T1WA 5JORA 4HIHA 2P46B 2AQ3A 3CLEH 5E5RB 4C58B 1MHCB 4ODXB 2LU4A 2B1AL 2NY6C 3PXJA 1OARL 4LBEB 4EI5D 4KHTH 1QUNA 5D1ZC 2ZCKH 5F7DA 5AAMA 2WBWB 1KJ3L 4HHAA 5C0CE 4AQ1B 4AIZA 5BVJB 3RBGA 4JPVL 2HJKB 4G9FB 4NKOA 3GHBH 4KKCC 2FJHB 1DLHB 2P5EA 1ORSB 5HVFB 1DBAH 2Z93A 4RFEB 5E1AB 5J0BA 2AK1H 1EPFA 2NR6D 1A7OL 4HXAL 4U4BA 2SEBB 5CEZE 2YD6A 3H7BB 4KQ3L 1NLBH 3TT3H 3QIBB 5ANME 3MXVH 5E5UB 5EIQA 4BZ2L 5T1DH 4BFBD 4KI5E 1YEHH 4PJEE 4XPHL 4Y4HA 3RGVC 5ID0A 5KANG 1X5JA 3TA3D 3AXLA 3HMXA 4MSWA 1UM5H 5F21B 5GS3A 4MD5A 1AXIB 3KPLA 1N8ZA 4X83A 3N1PC 4UT7L 2BXZA 4IOFC 4UU9A 1T5XA 5D2NA 5B39B 3N50A 1D5BA 5BZDA 5DJXA 1YJDL 4MGXA 3QXTA 1JF1A 4JZOB 3ULUF 4D0DB 5MENA 1G9NH 2UVFA 2VERN 4MJ4A 3VA6A 4Z7VA 3L3JA 1E4XL 1EAPA 4JRXD 1G9EA 4KRPD 3DUSB 3KJ6L 4MB5A 1ZVYA 4O2CA 3FN0L 2DWDA 3OHXB 3KJ4B 1FBIL 1MQKL 3Q2CA 5CP3A 4YDKL 1BQHA 4GRMB 3UYPA 1VDGA 5I15L 1E27B 2VLJA 4HUXA 5GS2D 3DOSA 2VQ1B 3RWCA 3BHBB 5F8QC 3MRFB 3W9EA 2EIZA 3D39A 1FH5L 3V4UL 4AYFA 4PJ7F 3SOBH 1AHWA 5D1XD 3LAFA 3TYGH 5I6XC 3GK8L 1WBZB 5I1KH 4P5MB 2QL1A 2YS4A 4QCIA 3MJ8B 5BRZE 2D7TL 3K7UA 4QHMA 4EZMA 2FGWH 1YNLL 4DTGH 3PNWB 4XGZA 3X3FL 5CBEA 5C0IA 2FL5A 4MD4B 2NY6D 3LN9A 1FFOA 2MQ0A 1ZLWK 3TEUA 4ZUUA 2IPUK 5D1ZD 1CF8L 1FVEB 4NQDD 2OM5A 3REVB 3EO1A 3QUYB 2YPLB 3QAZB 5D7SL 3QRGH 5BO1H 1NC4B 4J4PD 2VABB 6CGTA 3RZCA 4Y7MA 3KPSA 1ZHLA 4RGOH 1NL0L 4OZHB 3C5ZA 3IDMA 1PZ5B 3HN3A 4QRPD 4LK4A 1WQVT 4HLZG 4QRRD 5F3BA 1GOFA 4I9WE 4OAWA 4Z0BH 1RZJH 5LBSH 3Q6GL 5AUMB 4CUCA 4RX4D 2JCCF 2BNUA 2B4CC 4O02H 2IJ0C 5HHXL 3VG9B 1F00I 1I9EA 3RVXC 1HYRC 3FQUB 2FEDC 2WW8A 3NH7L 4F3FB 1GH7A 4JQXA 2J5LB 2KQMA 3RGVD 2VB5A 4A6YA 2HA1A 1DQDL 2ATKB 4ZFFB 2FB4L 3WFZA 4JO1H 3QUKB 1BVLA 1EH9A 3F7VB 3M8OL 5F9DC 3VRJB 4IRJB 3IJHA 1JGDA 2JKXA 1BJ1H 2JB6B 3CSYB 4OKDA 1SQ2N 1MCDA 5DLML 3O0RL 2H26A 3S98A 5DJ0B 3SJVA 3DRTA 3VJ6B 3F5WB 1X44A 4XBPB 2BVTA 4L1HA 4YJZL 2F19L 2UWEA 5FUZH 3AS0A 3MSPA 1X4ZA 4PD4K 4OD1H 3F65A 2HJFA 2HKFL 1QR1A 3WXWL 2V7NB 4TSCL 1XGQB 3MROB 1HOCB 3SBWA 2FZ3A 3TBWA 1GPOL 4NO5A 1FV1B 1IQDB 1AQKH 3CFDB 2D7MA 4PGJA 1A5FL 3BQUB 3X3GH 4S0SD 4KVNL 3O41B 1A1NA 2X1XR 1QSFD 1F4XL 3P2TA 2NY7H 2YPKB 5DGQA 1I3VA 4RZCA 5F7EL 2BFVH 3MLZH 3CVHA 2R2EB 5GRUL 3UTQB 4ESKA 3MUZ1 4JCMA 2D4FA 3VXSA 1A9EB 4YZFF 4MB4A 3PGCA 3W11C 4LCYA 4LASH 4NBXB 1UM4L 2DQJH 1H8OA 2BHZA 1W0VA 4C56D 5IFHL 3HS0A 3HE7B 2DQFA 1UYWH 2P8PA 1AC6A 1ROWA 4D9QD 2IF7A 2VYRE 3MRHB 3ZKMC 4PJCA 5CSGA 4N0UE 1CXIA 5I0ZA 1SVCP 3FB5B 5KVEH 4PJ5B 2KZ1B 1ZLSL 2VLKB 4P4RA 3O6LH 5KSBB 4LLWB 5EUOB 1SEQL 4H0HB 4HLJA 3CC5B 4UB0H 2UY6A 4XP5L 4OFYA 1JL8A 1CDCA 5IHZB 4FQJL 3S3SA 2D0FA 3U7YH 2XWBB 1WAAA 2YBRA 5T33H 7FABL 3U9UA 2FEDD 2GKIA 2F74B 4BA8A 5SWSE 4U0RB 4JHAL 5HDQL 4ZFGL 4K7FB 3QPXH 1OHQA 3QZWG 5IFJB 4FTVA 1NLDL 1HKLH 1R3HB 1WICA 2IPKA 3E0GA 5HI3C 3LS5H 4TPRH 3RY5A 5KSVA 2IMMA 3MRBA 4ZO6A 4XCCL 1D5MA 3V6OE 4YO0B 1SVZA 1KENL 2E6PA 1F58H 1HINH 5F9OH 4Z78B 3MV8B 1L7TH 1CXKA 3SKUD 5I1IH 3GJEA 3TN0B 2X4QB 3ZO0A 4Y4HC 3SGEH 2WSKA 2OI9B 3H3BC 1RIUH 4R4FH 1TPXC 1IARB 5D5MB 4YDJA 3VFWA 3IFOA 4M93B 5IB1A 3WNLA 4P9HH 5CINH 3FO2A 3VFNA 3G08B 4ZQKA 2V17H 5F9JA 4GW1A 3FT2B 4P5TA 4EOWH 2XYCA 3THML 3LN5A 4ZFOA 1Z9OA 3OKKA 3X14B 4PV8A 4IJ3C 5T3XL 3MFFB 4QHKJ 4KPHL 3RVVC 2AVGA 3X12A 4BUGA 4FMFA 4Y5YA 1FFPA 3RL2A 3VXRB 2W60B 4PRID 5IVXF 2NX5D 2QSVA 4XPTL 5FM5M 1WCBA 2P44B 3W11D 3JUZA 1JPGB 5JA9A 43CAA 1C5BH 3L3GA 2QQNL 4P4KA 5MEPB 5C0EA 2IQAB 1FP5A 1AHWC 5DFTA 2HLAA 3BVNB 4W4NA 5HPMA 5JDJA 2QQLH 4JO2H 5DDHA 3IJYA 1LE5B 1FZMB 4S1RH 1KTKE 3V5DA 3ZKMD 1INQA 2CDFB 4O4YH 5TQ0L 3VXOA 1UM6L 2B2XH 2DYPB 4J8RB 5DK2A 4TUOB 1DZBA 5E0QA 1R3KB 4Z7WA 2VDRH 5SWZA 3T3ME 2OR7A 1OCWL 1EX0A 3SKOB 4XC1L 2JLLA 2DKUA 1AY1L 3ARQA 2ZUVA 3CJJA 4DUVA 2OZ4L 3WUWB 4HWEH 4JFPB 5BV7C 3SDYH 3BGMA 3RZCC 5ICYA 4FQ1L 3KS0H 5GSRB 3GMLA 1B0RB 3PHQA 2P5ED 3QIUC 3QCUL 1FNGA 3HNVL 3SKNA 2VLMD 4YR6B 1QFWH 3OV6A 5HI3D 2DM3A 3G5XA 3WHE0 4LCCB 4K8RC 3TZVB 2FH6A 2HT4C 5FA3A 4TVPE 4AIOA 4KJYA 3FO1A 1T0MB 3TJEH 3Q1SH 1YY8B 3U1SL 4LSQL 1NAKL 1UXSA 1CBVH 4NQTA 1RK1B 1CGTA 4Y4HD 3SCMA 4NC0B 3RVTC 3U6RA 1J8HA 2A83A 3LHPL 5E4IA 5EZIH 5EU3A 4LPWA 1OSZB 2CKBA 5SX4H 3GJFK 3MQIA 1IL1A 2FBOJ 1NC2A 1ONQB 2LE9A 2YN5A 4ODVH 1PVHA 2BSSA 3DBXA 1JHKL 1P5UA 1B0GB 3JWOH 3UTSB 5J56B 1FLTX 1OP3H 3QHZL 3O4LB 1SY6L 3F58H 1N4XH 5MEND 3RY4A 3O11A 1U95B 4R6UA 2O5ZH 4OKVB 3LEVL 5GISL 5ID1B 2IAMC 4K7PL 1IC4H 3I6GA 3IFLL 4HKBA 4TSBL 2P8LB 43C9B 3DGGB 4UQ3A 5IW1A 1MJ7H 1ZS8B 2DDQL 5IW6B 5FKPA 2VE6A 1MH5A 4B50A 3VCLA 3ZSSA 3EOTL 3FMGH 4LSVH 4ZPTA 1CWVA 4OLXH 4N0FA 3ULUH 3C08H 3T65B 3F8UB 5TE6L 3EFDH 4LLQA 2EDHA 3VFOB 2WP3O 3FZUC 1UZ8A 1BECA 1Z9MA 4R9HA 5D70H 4KMQA 4U49A 2F58L 1W72H 3IFNH 1MCBA 2PXYC 32C2B 3C09C 1BQLL 4JFDE 3VWKC 4D9RD 3BPOB 1F3RB 4ZUSA 3IDUA 3P0YL 4YFLI 1MRDL 2X7LA 3SGDI 5E7BA 1X5HA 3VDCA 3GI8L 4D3CL 3CH1B 4YDLB 4JFFA 1CFNB 3AREC 1TETL 3PWUB 4OF0A 5KSUB 2CDEB 3HR5A 3FO9B 2X89D 2DLEA 4V1DE 1ZV5A 1KJ2L 3RZCD 3KPSD 4EEEA 3FT4B 2LU3A 1J1OL 3O2WL 2B1HH 4ZSOE 3QIUD 1KGCE 4HCRA 1ZLWH 2DI9A 3NIDF 4G8EB 4NZJA 3LN4A 3QFDA 5F97E 3P9LB 3CSBA 5FYKU 2RGSA 1I3RB 4BZYA 1HHJB 4K8RD 2ICES 4HWBH 5KBNC 4LVHB 4CVZB 2HT4D 1IC5H 3D0LB 3QG6B 3OKLA 3DIFA 1U92A 4N90D 4CVUA 3GSQB 1KGCD 3WXVH 4DCQA 3RVTD 2BVPA 3TO4A 3ARWA 1ZHNB 1U8JB 4HV8A 5BS0E 5GGSA 3UJJH 1MUJA 5JHDE 4XP9H 3NZ8A 1KN4H 4WW2B 4HC1L 1BJ8A 1V8HA 2ZCHH 1U8IB 5H37G 4GKOA 4F33B 4HH9A 4XNQB 3AAZB 1T7ZA 2C4FU 3LB6C 4Y8DC 4M8QA 1KIRB 2G5BA 4IIQC 1KJ2B 2DRUA 2A1WH 4P2OC 3FB6B 2X05A 2Y06L 5H2BB 2H32H 3CU1A 4LDOB 4RNRB 1FIGL 2IAMD 4XPAL 4CGTA 4F15B 2P5WE 5KSAA 2AJYH 1BM3L 1QNZH 3WS6A 3K46A 2Y4SA 4BSVA 3ZYIA 1M7XA 4N5EC 5JW3L 1KNOA 3IDNB 1MFAH 3ARFA 4BQ9A 1FDLH 3P11H 5IMKA 4B5EA 4LAQH 4M7JH 4X6EA 3ARSA 3BSZH 4JFEE 3EJZC 3T2NL 1NMCB 2FX9L 1CD9B 4R96B 1BOGB 2ARWA 1MHCA 4ODXA 4CKVX 4DQOL 4YFEA 2EH8H 3GRWA 4LBEA 1ND0B 4HIJA 3RKDC 4WHDA 2KPNA 1NBYB 4ZS6C 4MA3B 3FZUD 1FAIL 4KROC 5F89B 5B22A 4NT6B 2XN9E 5DUPL 5BVJA 2HJKA 4M48H 2I9LB 4FQ2H 1DQLL 5F8RC 1P5VA 3B9VA 4IEFB 3MGOB 2FX8H 3JWOC 2FJHA 5KVGH 1DLHA 2GTWB 1IGYB 2PXYD 1ORSA 3VWKD 5JPMA 5FDYA 3SE3A 1A3LH 4OFDA 1V3JA 3CDFA 4RFEA 4P4KC 5E1AA 2Z91A 1T0NB 1MY7A 3RX7A 3V4PH 1R3IL 3ARED 1L0QA 4ODHH 3PF2A 2V9RA 1Q0XL 2JK5B 3PWJA 1VFUA 1EUTA 3H7BA 4OLWH 1MHPH 5FGCB 1LNUB 3QIBA 1VFAA 2FATH 2EH7L 3RA7H 1JZ7A 4YIQA 2MFNA 1BQHG 1I1YB 5JW4N 5MP6H 3CFCH 4M7KH 3L3KA 5GJSL 2WBKA 4OFYD 4KDWA 4OLYH 5C9JA 3CXDH 2BNRA 2J8UB 1MCPL 4OUUB 4N8CL 4ZODA 4S11A 4JZOA 2KZWA 3FB8B 3VFSB 5BMFH 4K9EL 5IB2B 1LEKB 4RSVA 3VDBA 2WM0A 3OG6B 5EU7E 3DUSA 1MFDL 1WIOA 1QRNB 3D9AH 1TVHB 1LDPL 2WIIA 1G0XA 3ARDB 4RWYH 5I8EB 5GGUB 1VKXA 2DQTL 1OAUL 4OF5A 1V3LA 3LB6D 5HBBA 1EHLH 2XFXB 1IM9B 3H42L 4R8WH 1FNSL 5J8OA 4TQEL 2J6EH 2XV6B 1E27A 4P2OD 1HHHB 2W0KA 4LHUD 2HVKA 1A6VL 3BHBA 5I19L 4DEPB 1PG7W 4L1DA 3EDFA 3MRFA 3TIEB 4M62H 5K59F 5I75C 5LXGL 1PSKL 1KIPB 1KCUH 1WBZA 2AEQL 1V7NL 4DKFH 4I5BB 4N5ED 4P5MA 4M4RA 4Y4KB 5E8EB 3MJ8A 5CZXC 1IJ9A 3MA9H 1QFUH 5KVDL 3MJ7B 4JHZA 4QEGA 3MLSH 4HDIA 3EJZD 4XCNA 5DD5H 3BDYH 3PNWA 2D0HA 2AEPH 2W65B 4R26L 2D9CA 4MA1C 4MD4A 1A6UL 3ZTNL 3H2WA 3RKDD 2GI7A 4ZS6D 4EDWL 5E9DB 5D6CB 3FRPA 2X2YA 5DJYB 1KBGL 4HW6A 3REVA 4KROD 3QUYA 2YPLA 4OTXH 4JKWA 4HK3J 2CUMA 4OZHA 2BNQD 4XMPL 3LPFA 1PZ5A 1BP3B 5ICXA 2W0LA 3RGHA 5ETUB 3IRPX 4P4KD 4XNZC 2N4IA 4PG2A 4Y4FA 2OJEA 4HKJB 4LLUB 2VZ3A 3D48R 3RPKA 3QCTL 5AUMA 1MCOH 1F11B 4U1LB 5I73B 3ULUE 3H3PL 5CHNB 5GIRB 2WIMA 3OAZK 4WJ5A 1U91B 4M7ZC 3FQUA 4F3FA 2YWYA 2E7MA 3JBG7 3HG1B 5K9JL 3FONB 5ALBH 3TPUB 2XZZA 4DFHA 4X4ZA 4X80H 1P7HL 1YMHA 2ATKA 3FQXA 1F4YL 4U7SA 5SWZD 2FR4B 1SHMA 5CJOL 1QG3A 1VPOL 3BKCH 1V3KA 1C1EH 3AB0C 4JANB 1H8NA 1I8KB 3WIHA 5GPRA 2OL3B 5DRWB 3FQTA 4RIRB 5D7JC 1A8JH 1CN4A 4IRJA 4PJ7E 2XKNB 3GSNA 1LHZA 4Z7VF 1HSBB 3L5IA 4F2MB 3M07A 2JB6A 3CSYA 5DJ0A 4RDQF 1CD0A 3VD4A 1A6ZB 1RHHA 1U8KA 3VJ6A 3F5WA 4XBPA 5T1LB 4QOKD 4PY8I 1GC1L 2KL6A 1HXYB 3F7YB 4UQ2A 4X9GA 2W0FB 2DLGA 1J5OL 1FJ1B 3LRGA 2M26A 1GZQA 1JNHB 1YQVH 4FQIL 4H26A 4L4TD 1AIFB 3QI9A 1GOGA 4Y2DB 1J05B 2V7NA 1XGQA 1U8OB 3MROA 5CJQL 1HOCA 1FV1A 5J1SC 2VDKH 3M1BB 4LNRB 1IQDA 4PG9B 1SMAA 1NCNA 4N0RA 3Q5YA 3O41A 1G7LB 3G5ZB 3MJGX 5DHYB 4CN6A 1PBYA 3MRJA 4X5LA 5C0FA 5CZXD 2R2EA 4PRDA 3UTQA 3FT3A 2X4OB 1A9EA 2A38A 2FEEI 3T4AB 5L2KE 1QSEB 1YZZA 2X40A 3MRGB 1H3PL 1N0XL 5KSAC 1EO7A 4P46B 2I60H 3GJFH 1MAMH 3HC4L 3OZ9L 5CIPB 1JGUL 4DVRH 3PQYB 3KWWB 4WI3A 5C08E 4X0KB 4ZUWB 1LMKA 4NHCL 1C16B 1DQMH 4WY7L 3EGSB 1ZE3C 3FB5A 4NWTL 4PJ5A 1KC5H 3DYMA 5GGRY 2VLLB 4M3JA 4WHYH 2VLKA 4GXVL 3NCBB 5DZLA 3HZKA 1S7RB 3QH3B 5EUOA 3RHWF 3KPRB 1V3MA 3VXUE 3MLUH 1KF9B 1RZFH 3O81A 4CU7A 2Z31B 1HWHB 4Y1AE 1C7TA 3BUYB 3RHWK 1JPTL 4PJHB 3EJJX 4JO4L 5L9DH 3ETBF 3HLAB 1RY7B 4R3SB 5DZOA 1RZKL 1ADQH 2XWBA 5JQ6H 2JJWA 3RJQB 4OJFH 4PJ9B 2G60H 4NQEB 4JAMB 1M7DB 5GSVA 3BAEL 2F74A 1KN2H 3SE3C 2JIXD 1HI6B 3C6SB 5DMYA 5IFJA 1T89C 5EOQH 1A6TB 1AGFA 1E4WH 1IFHL 1IGML 1CGUA 4F80A 2GJ6D 4YO0A 5E2VL 4Z78A 5F1OB 5D7JD 5F7HA 3AU1B 3MV8A 1CLYL 4EJ1C 3BWUC 3TN0A 2X4QA 2J8HA 4PJFB 3QRFM 4YNYB 1ZMYA 5IGXL 5B4MC 1LD9B 3ARYA 1S78C 2OMNA 1J1XH 5D5MA 1NGXB 2OSLB 5JW4Q 4YZFE 1F4HA 4WV1C 4UTAH 2BZDA 3MCLL 1JV5B 3G08A 5EO1B 1ULVA 4KAQH 2DJUA 3FT2A 5E6IA 1P4IL 3MFFA 1J10A 1BAFL 2VXQL 3MACH 1CVRA 4Q6IB 2BOCB 1J0KA 4MQTB 1LEIA 2BHUA 5DTFB 1FCGA 4KZDH 2WNGA 3W5NA 5ACLA 3VXRA 2W60A 4HAFA 1NEZB 3HZVB 3V4VL 4NZUH 4BYHA 1YY9C 4MJIE 1TJGH 2ZUWA 4ODWA 3RWIB 3MO1B 4LRIA 5B3JE 3WDIA 5MEPA 5KSAD 15C8L 3MV01 4KK8C 2IQAA 1Z9SA 2FYYB 3BVNA 1BZ7B 5JXEC 3GSWB 4XVTH 2XOTA 1LE5A 1FZMA 1VACB 4I2XB 3OAYK 3TYGL 2ENYA 1ZEAH 3JV6B 2CDFA 3N1FC 5KAQG 4PJCF 1RUAL 2ICWJ 3O3BB 3LEYH 1B90A 2D31B 2NXZC 3MBXL 3T0VA 2DYPA 1MREH 1K4CB 4J8RA 4JKLA 4Z0XB 1J0JA 2ATPB 2H45A 4TUOA 1PYWB 1R3KA 4BELD 2BSED 2G75B 3SKOA 1JYNA 3MLYL 1PGRB 4JFPA 1WAAF 3EDEA 2WINB 3O6KL 2ZUTA 5C86A 5GSRA 4ZTOL 1B0RA 3P0VL 1SBBA 1ZGLP 3WFBH 4KQ4H 4UT9L 2GYSA 1PG7H 4O51B 5C0BE 1TTGA 4PG2C 4Y4FC 3G6JE 1IC7H 4M1GH 2VXVL 4JM2B 1XEDA 4S1QH 4LCCA 1ITCA 3TZVA 3SDAC 4TVPL 1HH6A 3WCYA 3DX6B 4GMTH 2J4WL 3WO3B 5C0AB 1T22B 1T0MA 3ARUA 5GZNC 4D9LH 1YY8A 3RU8H 1S7TB 3GHEH 3L7FA 5D1QC 5E2WL 4UDUB 4PJXF 4O02L 1QHOA 1X5IA 4HUMB 5ILTH 5B4MD 2CRIA 4JDZA 1OSZA 5IVXE 1S78D 4LQFH 1EUUA 2EDWA 5KG9B 3QQ3B 2VDML 4G6KL 2IFFL 2YOCA 4MNHA 3UTSA 2BNRD 2IANB 1XAUA 4UT6H 3O4LA 1KT2A 2PO6C 4FABL 5IK3B 3EO9L 1F90L 5EBMB 4OKVA 4JRYE 5GXBB 2NZIA 3LSOB 2DBLH 3T2PA 1NFDB 4DAGH 2A9ML 3DGGA 3TT1L 4BQBA 4J23A 1NMBL 1JHTB 1IC1A 4LKCA 1DUYA 3KLAB 4JDTL 1VGEH 2F5BL 4PB0H 3M17B 5I16A 1ZS8A 2VN7A 5IW6A 3KS0J 5DJCA 1YY9D 5IJKC 3QI9C 5HDBF 5F88B 5HHME 4U6HB 4JN1L 2B0SH 3ECBA 3T65A 5LVEA 4KK8D 2HMIC 4LHJB 2FWOA 2LVEA 1JBJA 3DX7B 3VFOA 5JXED 4KWUA 4QO1A 4ZXBB 1TJHH 3D2UB 3JSSA 1DJSA 1KCRH 2NY7L 1MAKA 3TYFB 2I5YL 3LDBB 1RZGB 2NXZD 4X6CB 4YFDB 2X4RB 1D5IL 3QXAB 5IFAL 32C2A 2KBGA 4K7PY 3K4ZA 5D7KD 4OCWH 8CGTA 5I1LB 4PV9B 5DD3L 3QYCA 4K94C 4Z7WF 2F54E 3CH1A 2R0LL 5IMMB 3U2SB 3HUJF 1DLFL 4FS0A 1E4XI 1CFNA 1NBQA 5J11B 5KSUA 2CDEA 3FO9A 4GRLB 4MNQB 4NO3B 1EMTH 3FT4A 4OM1L 2DQIH 1FYTB 4WHCA 3MYJB 3PJSB 3KXFE 3SKJH 2VLRE 4LEXH 3U7WH 4ELMF 4Y4FD 4MNGE 5KAQF 1YEGH 4U1KB 2XRAL 4Z7QF 4PBWD 2VH5L 3SDAD 1U3ZA 2DI7A 4GAGL 1KCKA 3WHXB 4QNPE 4POZC 3MXWH 3D0LA 3QG6A 3DSFL 5GZND 5EN2A 3GSQA 4M1CC 3U7YL 5F1KC 5D1QD 1XR9A 3F6LA 3DWTA 4U0RC 3OJDB 3KXFD 2CMRL 3P0GB 4FN0A 3HPLB 5F71A 2AJUH 3HAEB 2VISA 1YNKL 3R06B 4F33A 1U8IA 2UYLA 1A21A 2UUDK 4XNQA 3AAZA 3K4AA 4S1DC 3NA4A 1KIRA 4N1EA 2PO6D 1JGLH 3GMMB 4TPRL 5CZKA 1WTLA 2APFA 3TN0C 2QADC 3QDGD 3O3DB 4PFEA 1L7TL 4FZ8L 1VFOA 3LH2L 5DJ8B 3AY4A 4GOSA 2OCFD 2AJSH 1HYSC 5TDOB 1EFXD 3IDNA 5IBTH 1G7PA 1PFCA 1TNMA 3QI9D 4QTHB 3RY6C 3Q0HA 4OZ4A 3GBMH 1LO3H 1OWRM 3V6ZB 5E6IC 1AE6L 2K9UA 5F3HB 5AWNH 3NN8B 4R96A 3RWFB 1XCTB 3VGHA 2V17L 5EBLB 2HMID 2XNAA 2QJDA 4D2NA 1ND0A 4X6DB 3O6ML 1NBYA 1JWUA 4YX2H 4MA3A 5FYJL 5F89A 3I02B 1P7QB 1R0AL 1HNFA 4L9LB 3LKPB 4RMSA 2ARJB 2I9LA 2VKWA 4Y5XA 3MGOA 2VDNH 4WNQB 2XQBL 2GTWA 1IGYA 4OLZH 2FD6L 2FCBA 4N68A 4LRIC 5GS0C 1RAMA 1MCWM 4Y5VB 1UA6L 1T0NA 5J12C 3W0WD 3CFEB 4XP4H 4WO4B 5I1JH 3ILQC 1GXEA 3V8OA 2JK5A 5I74C 3P40A 1DN0B 3V6FB 4HJJH 2FSEB 5MERA 3NACH 1LNUA 1F42A 3U4BH 5FM4A 3TBSB 2VDLL 3SGDH 3TNNB 1I1YA 1A4KB 3CZJA 5FB8B 4XXCA 3CMGA 1OGAB 3BJ91 2H1PH 4Z7UB 3QNXA 2CIKA 3GI9L 4IOIB 5DSCB 1FGNL 1D5XB 1U8LB 1WISA 2J8UA 4OUUA 4POZD 1QKZH 5FCUH 4LCWA 1A4JB 1R5WB 5BW7A 3BKML 3ROOB 4M1CD 1KJMA 2QSCL 4GT7A 3VFSA 1AGBB 2COQA 1TCRB 1QSVA 5IB2A 3QDHA 1LEKA 1A14H 4HWEL 5K9QI 3IXAA 2V5YA 5DUML 1OM3L 2K1MA 1QRNA 2VXUH 1TVHA 3ARDA 1BFOB 4I0CC 5I8EA 4PJBB 3ZYOA 2IBGA 1D6EB 2CLRA 4PD4J 2WV3A 3BD4A 2XIDA 3PWLA 5JHLL 2AAVA 1MCSA 2XFXA 2I26N 4S1DD 2AV7B 4GXUN 3AGVA 4CDHA 3VG0H 5EWIL 1HHHA 3FRPG 2QADD 3BGFB 3GGWB 3TJEL 3TIEA 3RDTC 4Q97A 4RFNC 3UTTD 3QUMH 1KIPA 2OR8A 1A7NL 3N1GC 4I5BA 1UACH 2W92A 1HYSD 5DI8B 2A9NH 3V79C 4Y4KA 1H0DB 4UDTA 4G8GB 4PTUB 4P9ML 3H9HA 4GKSB 5C8JB 2E6QA 4Z8FH 3MJ7A 4JY4B 5IKCB 5ENWB 5E6ID 5DQ9B 2E9IA 2W65A 3UZVB 4B7LA 1XIWB 1UEYA 3OR7A 4GG8A 3QIWC 5E4EB 2P1YA 2O5ZL 4NN7B 5D7LE 1JF5A 5E94B 3OKNB 5D6CA 5E9DA 5HGAA 5DJYA 5C1MB 1IC4L 1AD9B 4KUZL 4DVBA 4KDTA 4KKLD 5HHQB 2BY2A 1WITA 4U1JB 3OB8A 4QYOB 1PZUB 4JPKH 1GHFH 3QWQB 5ABDE 3SE8L 3RNKB 5FV1L 3SDDB 2OXHA 5GS0D 5ETUA 1LO0L 4DGYH 2UZXB 4IOSD 4LLUA 3UO1L 3KPQB 1F11A 4J2XA 4QY8B 5JOFB 1KLGA 5GIRA 3ILQD 3L3IB 1F2XK 5FK9B 4HMDA 3UYRH 1OOAA 1U91A 2NY0D 1F4WL 1QPPA 2XTLA 4U31A 4Q9QH 1IZKA 2F8OA 4XPFL 2MNUA 1EEQA 3CVHH 4JQIL 3T2QA 1HZHH 5A3IC 5TDNB 3FONA 5T3ZL 3EYQC 1W72L 5AYUH 3C6LB 5CILH 3MBEC 5EU6E 5DFVC 1J7VR 2Y5TB 5CJXC 5L6YH 1M05B 3OAYH 1LK3L 4FFYH 4JANA 1YC8A 1I8KA 2OL3A 2QHRH 3BISA 3OXSB 3B3IA 1HSBA 5E99H 4F2MA 4LPCA 4FXKB 2W0PA 4UOW1 1A6ZA 4Z77B 2OP4L 1C5CH 1HXYA 2F9BT 3VW3L 3F7YA 3JTSA 2W0FA 4CJ1A 3TVMA 1FJ1A 2EKJA 1JNHA 2FJGB 1ZTXH 1AIFA 4Y2DA 4R2GC 1J05A 3QUXC 4XX1G 2P7TB 3DUUB 1IC5L 1U8OA 2AJZB 1NKRA 4L4VD 2BRRH 3M1BA 3UJIH 3WSQL 4LNRA 4PRPE 2ZKHH 3RDTD 5HGDB 4U6XA 1R5IB 1MRFL 3VMOA 4O5LH 1FLRH 1SJEB 5D8JL 3WFHB 5C71A 5DURD 1G7LA 3G5ZA 4HS8L 3FFCD 1UCTA 1I1AC 3CD4A 3KYNA 5E2UH 1AXSB 1VCAA 3UJTH 2JB5H 2ZCHL 4MMXC 1OAKH 2UY7A 2X4OA 4E0RA 4X8JA 1UJ3A 3C8KA 1F8TH 2D7PA 4LGPB 1F02I 2VITA 4LLVB 2HFFB 1QSEA 3MRGA 4GFTB 2A1WL 4P46A 3QIWD 3T0BA 4NUJB 2CDGA 4WI8A 3VFUB 5CIPA 5I8KH 1C5DB 1A6WL 3KWWA 3HFMH 4X0KA 4ZUWA 4OGXL 1K3ZA 1JIBA 1Y0LB 2PKDA 3GKWH 3O4OC 1C16A 3RPIB 1RIHL 3EGSA 5MI0C 4GG6A 2VLLA 4MA7L 5TQ2H 3G9AB 1S7RA 3QH3A 4LSPH 3KPRA 4U1MB 1Q9OB 3HZYA 3ZKQD 5GRYA 4CU8A 2Z31A 4Z95H 4UV4L 3BUYA 2EDTA 4PJHA 5C3LD 1DSFH 2ZP0T 1WEJH 1YMMB 4Z7VE 1MI5B 3HLAA 3VU2A 4WWID 4RAUB 1MLBB 2OQJA 4PJ9A 4Y5XC 3MLTA 4NQEA 5I8OL 4JAMA 1M7DA 1RZ7L 3OTTA 4WFGE 5A3ID 3B4NA 4M48L 3NZHH 4MJ5B 4X7FC 3EYQD 3SDXA 1X5ZA 3WFDL 4LVOC 4P2QB 4BH8B 1KB5H 2ITDB 5E8DL 5KVGL 1EV2E 3MBED 5DFVD 4G42B 1HHIB 1A6TA 4BZ1L 3MR9B 4JJ5A 3LIZH 1I7UB 2ADJB 4E42A 1YA5A 5HVHC 2Y36L 5JNYA 1N0LA 3D39E 5FUOL 1LK2A 3WD5H 4OQTL 1HCVA 1OT2A 4YNYA 4G3YH 4HKXB 5A2JH 1U8MB 5C0GB 2XQYK 4NN5B 5DJ2A 1ZA6B 1LD9A 4FQHB 4FNLH 3IDGB 3VWJB 4U6YB 1MVUA 1A3RL 1I8LC 1S7WA 3CDCA 1NGXA 2OSLA 3L9RA 3O3EB 5AD0A 4AQOA 5MP6L 5IEHA 3S35L 4OSUH 3E6HB 5EO1A 4R2GD 3QUXD 4L3EE 3CXDL 4BSJA 4PJGF 1NCWL 1G6RH 5HJ3B 2X09A 3CCHB 2X4SB 4LLYB 4CBPA 4Q6IA 2AK4D 2BOCA 4HG4J 3WE6B 4YDVB 1DBMH 5IQ7H 1I1AD 1MIEH 2OJZH 3H9SB 1NEZA 2F53A 4QHUB 1F6AB 4XAWH 5T1KD 1SBSH 4AENA 5DK0B 3QHFL 3GKZA 4M61B 3RWIA 3MO1A 3IGAB 5C09B 4U7MA 2J6EL 1FRGL 2D3VA 2QEJA 3BWAB 3KDMB 1CI5A 3J7HA 3ZE0F 1TLKA 3SDCC 1S7VA 2X41A 6FABH 4M62L 4JKMA 1GZPA 1VACA 4I2XA 3QSKB 1TZIB 3BE1H 5FYKD 2XG5A 5C6WH 3JV6A 3O3BA 2EO9A 2D31A 1ETZB 3GSUB 4BH7B 3ULVF 1OT1A 4KJPC 3QUZB 3BT2H 5KSBF 3GO1H 4QHLB 5ISZA 1UQSB 5EUOF 4Z0XA 2ATPA 3ZYZA 2NY2B 1MFNA 3DURA 2AEPL 2G75A 5DF0A 2X5PA 1IEBA 3DXAD 4FOMA 4ERSL 2BXYA 3NFSH 4KDTC 1PKQE 4QTIH 3DHJA 3NIFE 3SJVE 4I18C 1KEGL 5MHSD 3FQNB 3KAAA 1FORH 4YBQC 3UTPE 5C07D 5K9OB 5J6GB 4O51A 1NAMB 1PX3A 1FE8H 2MKLC 5EFIB 5IB3A 1T2JA 3JZ7A 4JM2A 3A6BH 5DQJB 3DX6A 5KS9F 5C0AA 3U30C 1NSNH 1T22A 1MCOL 1N3NA 1XGYL 1S7TA 4F7EA 2AI0L 5C2BL 4DKEL 2GJZB 3L6FB 2O5YL 2DIAA 2ZUXA 3QDJB 4M6ML 5BVPH 3KLDA 3BRFA 2YD4A 5KG9A 3QQ3A 3VXSE 1ZOXA 1N64L 1M71A 3P4OB 2IANA 2VR5A 1AP2B 2CGRH 3EYVB 4X80L 4LCWD 1XGRB 5FGBA 4YXLL 3JV5A 3LKSB 3EFFB 2CD0A 4LARH 3BKCL 4LGRB 3LSOA 4J3UA 1NFIA 4MB3A 5JA8B 4K3DH 5HYJA 3L7EB 3EO0B 2VIRB 1NFDA 4KHXH 3S36H 3B9AA 3BEVB 1BF8A 4H88H 4PJCE 1QBLH 3QQNA 4W70A 1JHTA 2WLYA 1U58B 1YPZB 3KLAA 1U8HB 1S9VB 3TVMC 3M17A 1M1SA 5E6YA 3NCJH 4N9OB 4EI5B 3S3PA 5F88A 4NRYB 4U6HA 4F58H 2ESVE 1WAAE 3SDCD 2VDKL 5ESQB 3DX7A 3QR2A 2VQTA 3D85D 4E41D 1L7IL 4ZXBA 2AKRB 1EGJA 4Y16A 5FA4B 1RZGA 2XTJE 1UJ3C 4X6CA 2X4RA 4KY1H 4KJPD 1S3KH 1BGXH 2NTFB 5I1LA 4NQCE 4O58L 3MC0A 4EVNB 3BPCB 3MOAH 4N8PA 3U2SA 4OCNC 4LFHG 3TP4A 4PJXE 3CLFL 4GRLA 4MNQA 3KR3H 1HIML 4NO3A 3WNNA 3TA3B 4MVBC 1UCBL 3DRQB 2HT2C 3GSOB 4X9HA 2R1YB 4YBQD 1FYTA 4WU5B 5IMOB 3PJSA 4NQCD 2DQHH 2L4OA 5FYLH 4Q0XH 2IQ9H 4U1KA 2CRMA 3W2DL 1XGPA 3QHTC 4JRXB 3WHXA 4HWNA 4KRPB 3WKNA 4NP4H 5KZCD 4K07A 5L9DL 1BREA 5JQ6L 1ADQL 3DO7A 3QCVH 3OJDA 4OJFL 1DP0A 3HPLA 4XPBL 4CADB 1DQJB 3HAEA 5IVOA 1T03L 3R06A 5FEBA 4L29B 5HDBE 2E6JA 2DD8L 3S88L 5ITFB 3I75A 4AEHH 3DNKA 4DGVL 5DHVB 3GMMA 4XI5C 3C5SA 2O61A 5D1XB 4K3EL 1I85C 1K4DB 3O3DA 2R8SL 3VXMB 5DJ8A 2ZSVB 3WNOA 4XXDB 2B1AH 2HRPL 1OARH 1WBXB 2OTPA 2R2CA 3PHOB 5TDOA 3TVMD 3PABB 2NY6B 1Y6MR 3NFNA 3V6ZA 5D1ZB 4UTAL 3GSXB 4NQDB 4Z7WE 1A1OB 5F3HA 4MAUH 3HUJE 3NN8A 3RWFA 4N0YL 1XCTA 3BP6B 2HRLA 1FFNB 1KACB 2X1OA 4X6DA 3WFEL 2UZYB 3G9VA 3HPJB 3MACL 4A2MA 4OZGF 1IQWL 2EC9T 1P7QA 3I02A 4QRPB 5IVNA 3LKPA 2ARJA 4HXAH 4QRRB 2CLVB 3GSVB 4WNQA 1TQCC 4MDJA 1BWMA 4AEEA 2R0WH 4Z7QE 1G7JB 3MLWL 4U1SA 5TF1L 3WLBA 4BZ2H 4Y5VA 4ACPA 4M7LH 3RL1B 1N26A 2ZG2A 3CFEA 5DMIH 5FCSH 4WO4A 2UZIL 3BESR 4JKPL 4UT7H 3RGVB 1DN0A 1YEFH 5KVFL 4JZNB 1X4XA 1J0IA 1J8HE 3QWOB 4KTDL 4MVBD 2HT2D 1UWEL 1YJDH 5JOEA 3EKCA 3TBSA 1NCCL 1ZEAL 3TNNA 4JQVC 1XF3A 3WJLA 3LEYL 4DUWA 3BDXA 2C1OB 1E4XH 4AEFA 1OGAA 4LP5A 1BBJB 3FN0H 3MYZA 4KMLB 1PG7X 4IOIA 1S5HB 4OLVL 5DSCA 1CICC 5JO5A 5IM7B 1A4JA 3BPNC 1R5WA 1MQKH 3ROOA 4YDKH 3UMTA 2ZJSL 1AKJA 5C7XL 1W0WB 4LNVA 1AGBA 1TCRA 5I15H 3FCTA 3HTLX 3VFTB 2VSCA 3MRMB 1BFOA 1GVIA 4HPOL 1D6EA 4WW2F 2FO4B 3MMEB 3V4UH 3WUZA 1HHKB 3MTRA 5JW4M 2E8YA 3GK8H 2AV7A 1IC7L 4JFZL 4M43H 4RA0C 5JUEL 5EIIB 4XI5D 2D7TH 2BRQA 5I6XB 4JN2B 3U46B 4GMTL 1QSFB 1JF6A 3QWRA 4KUCF 4UIMA 1S9XB 1YNLH 3GGWA 4FFVC 5HYFA 2CK0L 5DEFB 5I1CL 2F8XC 3RU8L 3GHEL 3X3FH 1LE9B 1D7FA 4WEBL 2J3SA 5A2FA 1H0DA 5FO8B 4G8GA 4LQFL 4GKSA 4OB5L 1INEL 5C8JA 4OZFB 4JHBA 5FGBC 3TNMB 4JY4A 3PDDA 5IKCA 2BVOA 1NCDL 1UB5B 5DQ9A 2LTQC 4C56B 1NL0H 1XIWA 1TFHA 3DX8A 5HI4C 1EVTC 1KB9K 4YDIH 5ACMA 1WCQA