1L7TH

Crystal structure analysis of the anti-testosterone fab fragment
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
220
structure length
220
Chain Sequence
b'EVKLVESGGGLVKPGGSLKLSCAASGFTFSRYALSWVRQTADKRLEWVASIVSGGNTYYSGSVKGRFTISRDIARNILYLQMSSLRSEDTAMYYCARAYYGYVGLVHWGQGTLVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords anti-testosterone (light chain)
publication title Crystal Structure of an in Vitro Affinity- and Specificity-matured Anti-testosterone Fab in Complex with Testosterone. IMPROVED AFFINITY RESULTS FROM SMALL STRUCTURAL CHANGES WITHIN THE VARIABLE DOMAINS
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 47
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2002-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l7tH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l7tH01
2ATKA 5T3XL 4Z7QF 4HFWB 3IDIB 2VLME 3WIHH 2WQRA 1TJGH 4DZ8B 3QXDB 5DJ8B 4RX4D 4QOKB 4OZ4A 4YXLL 5FYJH 1OAZH 4AIXA 2W65B 1J05B 2H6PA 1IEBA 4OZFA 4U05A 5E00A 1LD9B 1NCWL 4XP6H 4KQ4L 3G6JE 5HHOA 1VDGA 3VFPB 5FUZL 1ADQA 1KEGL 2XKNB 4M7JH 1HI6B 3FAWA 3LMJL 3MV8D 2ATKB 3QDMD 3H9HA 2HRPL 4CBPA 3QP3A 5GJSH 4MMZC 3G04B 5CIPA 1NCNA 1A6UL 2APWA 2FJGB 4HIHA 2AXJA 2CD0A 4NJ9H 3VXMD 4OZ4B 5L6YH 2RJMA 1F4YL 2H6PB 4H88H 4X6EA 1IEBB 4BELD 4OZFB 3WUWA 3QUZD 5E00B 4XPAL 4HEPG 5CCKL 1NGQH 1CXFA 5HHOB 3P4NA 4HS8H 1MHCA 1MFBH 3EJZC 2DQTH 4TYUA 1IEAA 2ZUVA 3H9HB 1WZLA 1LO3L 3TVMB 5CIPB 3MNWA 4OCSL 4HIHB 5IFHH 3FN9A 3MUY1 1A0QL 5H35A 3C9NA 3E1F1 2IBBA 2DDQL 2ID5A 2P5EA 4X6EB 4DN3L 2VDRH 3WUWB 3P0GB 3RWEA 4TQEL 4MNGA 3P4NB 3HI5L 3UDWC 4K23H 4W4OA 2FO1A 5FUCC 2P48B 1IEAB 3WNMA 1LP9A 4LHUD 3MNWB 3PHSA 3C5ZD 3B9VA 5JOFB 1A3LL 4PJAE 1MRCH 1MCBA 2PUQT 1HHIA 3C9NB 5F9WC 4NHCH 2JB6B 2P5EB 4YLQT 5JR1L 4UOJA 3RWEB 5BCAA 1T1WA 4MNGB 4CDHA 2AABH 4KXZI 5GXBB 2MSPA 1L9MA 1NCAH 3RVTC 3FN3A 1S3KL 5C6PB 1SEBA 3ZHDA 1QYGH 5JA9A 2F8OA 1RZIA 4JR9H 3AMLA 1LP9B 15C8L 3GJFK 1J12A 4BH7A 3EYVA 1PVHA 5H2BB 1DBKL 3SO3B 4OGXL 4JVPA 2WWMD 1HHIB 4EI5A 1P4LA 1ZVSA 5A2KH 2JCCF 4YHNA 1IARB 4MXWH 3LIZH 1T1WB 3B2UC 4LASL 3TT3H 2EDDA 3B9KC 3I9GL 4KRLB 4LAQH 3OQ3B 4KKAD 2G5RA 4X7DC 4CW1A 3EOYG 4F7PA 5JUEL 1J18A 3I84A 3JWDC 1RZIB 4XWOC 3PL6C 4BH7B 3EYVB 4HEME 5FV1L 3BSZH 4JRWA 3ZTNH 1ZVYA 4TTDC 4XTRC 4C4KO 1I1AD 4EI5B 5T1DH 3ZDYE 4QTHA 1P4LB 1ZVSB 5EUKA 4Y4KD 2R0LH 4YHNB 4ZSOE 1MCSA 5C07E 3U1SL 1RJLA 1Q1JL 3CLEL 4PUBL 4XNXL 4EUPA 1TVDA 1W72B 2B20A 4PFEA 5KJRH 5J13B 4CW1B 4MGXA 1LDPH 4F7PB 3OZ9L 4PGBA 4YNYB 1NC2A 5DMJB 3ULVC 1U8HA 2DL9A 3RKDC 3DO7A 3RIAK 3AS1A 4AM0A 1NCDH 5F7FA 4Z7UA 4QTHB 1BD2E 5EUKB 4IOFC 2H2SD 4QGTA 1SJEA 2OK0H 1A5FL 4XPBH 3WDIA 1RJLB 2UY7A 3H3PL 4U6HA 4EUPB 4ODVL 1FAKT 4LF3A 1A7RH 1FV1A 1T6WA 2QJDA 4PGBB 1NC2B 4NNXB 5C6TH 2CH8A 1U8HB 1KF9B 2AI0H 4IDLA 4K71C 4ODWA 5DHYA 4AM0B 4Z7UB 2VH5H 1SJEB 5GGVY 4BFIA 1MPAL 2XZAL 1NAKL 1BGXH 1CDYA 2R56L 1AC0A 4PJHA 3IDNA 3MV11 1VPOH 2H9GA 4U6HB 2OR9H 4OT1H 4LF3B 3CXDH 1FV1B 1G9MC 4J23A 4HGWA 2CLRA 2V5SA 4CRPA 4WHYG 1K5NA 1U3ZA 2R2EB 3ECBA 3P3YA 3K46A 2CDEA 5DQJB 2G5BB 4ODWB 5E8OA 2HG5A 1D6VH 4C83A 4HKZA 5DHYB 1U3HD 1DBBH 5TE6L 4E41E 1ZLWH 2AJVH 3N1PC 4BFIB 4KZDH 1NGPH 5I1DA 4PJHB 3IDNB 2H9GB 5IQ9B 3P0VH 3CDFA 1QA9A 4XWGH 2QLVB 4GW5A 1RZ8A 1BLNA 2CLRB 4HGWB 4R0LA 3QCUH 4EOWL 5IWLC 5HI4C 2YD6A 4FNLH 4Y5XA 1AO7E 1RU9H 1K5NB 1UZ6E 3ECBB 1CG9A 3TN0D 4LFHD 2HG5B 4C83B 5LG1A 2HT4C 4HKZB 4K07A 3SGKC 4HWEL 3G5ZA 1ZGLA 3PHQA 4LAJH 5H8DA 5JW3H 3TV3L 1AY1L 3BH9A 5LBSL 5I1DB 4GRWE 5F9WB 2EEAA 2UZIH 4HQQH 4DVRH 4K3DL 1QA9B 4RFOH 4GW5B 1ADQL 1BPVA 1S7TA 5CD5D 3WS6C 1N5AA 2WM0A 5T33H 4YDIL 4HK3N 4JFFE 1CG9B 1NFKA 4ZPVA 2RQ8A 3M17A 4FFYL 4OKVA 4FRWA 4BZYA 1YEIL 3G5ZB 3RX7A 5DMKB 1ZGLB 4JFPA 3PHQB 3BH9B 2VLKA 4PJCA 2QQNH 4HMEA 5E1HB 3SKOA 1H3GA 4NRYA 4P4KC 3C8KA 2AEPH 4UTBH 1S7TB 1II4E 1N5AB 1YYML 4NN5C 5ADPL 2P5WE 3CXHK 4ZPVB 2FJFA 3QFJA 4KJWD 3M17B 3CDGA 1Q9OA 2CGRL 3IB4A 3UZQA 5LWYH 3K80A 4ZD3H 2R15A 4JFPB 1FIGL 2VC2H 1BIIB 4BQ8A 4KTDL 4PJCB 4JPWH 5DK3A 3SKOB 1WFTA 4QRTA 2Q7YA 3U83A 4FQCH 3UPCA 4GH7B 1PQZA 1RVFL 2X10A 4LK4A 1NPUA 1JPTH 3GDBA 4L8BA 2AGJH 4NQDD 4H5SA 4JQVA 2PTTA 3CLFH 1O7VA 2DL2A 3WS3B 2AXFA 3QFJB 3QZWA 2MTPA 2IH3B 3CDGB 4P2QD 4G9FA 1EXUB 3KLAA 1VEPA 4C56E 3QULA 3WN5C 3QI9C 5D7IE 3R8QA 3X12A 4KJPD 1MWAH 4NBZB 4F7MA 1MCWM 3CVIH 2FNBA 3T0XA 1UA6L 1HXYA 4FFVC 4QRTB 2Q7YB 3VG0H 4Q74A 2R2BA 1LP9F 4NO0B 4CMHC 4CJ0A 1PQZB 4MJ4A 5HJ3A 3H9SA 3E0GA 1ZLSH 4UILH 4L8BB 2R4RL 1YNLH 4H5SB 2G9HA 2PTTB 4XPGH 3QFDA 5GZOC 2AXFB 3QZWB 1A7NL 1QLRA 4G9FB 1KTDA 3KLAB 1QSEE 3QULB 4X9HA 5HBBA 4MX7A 5I16A 3T77A 2JJWA 3X12B 2R4SL 4M48L 3D0VA 2BOBA 4F7MB 4NOBA 6CGTA 1HXYB 2NXZC 5E2TL 1R24A 5ESQA 1FNEA 4LIQH 4G8GE 1EUTA 4NP4H 1TJHH 2R2BB 3VFSA 4LCCC 3H9SB 2H8PA 4XNYH 5B3JE 4P49A 2G9HB 3ARGA 3QFDB 1B0RB 1QLRB 3UXFA 1KTDB 4UIKL 3B2VH 3QNZA 2IBGA 4WWKC 3NCYS 3T77B 3IRPX 3TBWA 2OMNA 4OLWL 3D0VB 2BOBB 2Z92A 1WWAX 4P23C 3VD4A 5IVZA 1R24B 5ESQB 1FNEB 3RU8L 5FK9A 1DUZA 5L88H 1FJ1A 3IKCA 3VFSB 3D85A 1H3TA 1OL0A 3RHWF 2H8PB 4Q9QL 1J1XL 5T1LD 2BSRA 1D3CA 3ARGB 4H8WH 4JLRA 2NW2A 2LTQC 3DX6A 1VSCA 3A6CL 3QBTB 3HPJA 1YJDL 1OAYL 5M94B 4UAOC 5KS9A 4JRYE 2V5MA 2VLJA 2Z92B 4C55A 1KLGA 4MXQD 4OLUH 4HS6A 2X4QA 2BNRD 5FK9B 1DUZB 1A6AA 1M71A 1KB5A 3D85B 5DD3H 1K6QL 4JPKL 5JQ6L 2XG4A 4U3HA 4XCYA 3BXNA 4ONGH 2BSRB 1MI5E 4Z7UF 5I1EL 4JLRB 3DX6B 1F45A 4RWYL 4NZRL 4QNPF 5DJ0A 4MA8H 4KWUA 5KS9B 2QADC 4HIXL 4D3CL 4WHCA 4POYA 1FDLL 3IFLL 4G6KH 1FPTL 5C2BH 1KLGB 3T65A 4HS6B 2X4QB 2R0ZL 4WI6A 1A47A 1A6AB 1M71B 1KB5B 4KRMB 4QRRE 3EHBD 1VADB 3QXAA 4XCYB 3BXNB 1HINH 5FCUL 3GBNH 1X5AA 2D9CA 3MV9A 2F5BH 5DJ0B 5F70A 4W81A 5B4MC 1CXHA 3CFJA 4PJHF 5CJQL 3SE4C 1DLFL 2UV3A 5JNYA 1GGYA 4B53A 5DFVC 4GXVL 3T65B 3DMMC 4TVPH 4HS3A 4F15C 1Z0MA 3HI6H 1I1CA 1A3RH 5D8JH 3UO1H 3QXAB 4GOSA 3IVKA 1CFVL 4I5BA 4ODTH 1GIGH 5BZWA 4QXUH 3MV9B 5D1QD 1T7ZA 3R06A 5F7LB 3CFJB 5IMKB 3F7RA 5JNYB 2LU4A 1NCBH 5C08A 5F1IB 1MFEL 4XP5H 1JZ8A 1MHEA 3WN5B 4KPHL 4HS3B 3PP4L 2ENSA 5GRWA 4MQ7A 3L3JB 1VACA 1EGJA 5IHBA 4I5BB 4JM4L 4F7EA 3I2CH 3ISWA 3QIUD 5BZWB 2ARWA 1TXKA 5KZCB 1V5JA 4XVSL 4PJ8C 1NQBA 1J1PH 4N5EC 4LPTA 2AQ1A 4XAKD 5D2LA 3CCHA 4K8RC 2CKNA 1B0WA 2CRIA 4OB5L 1NGZB 5F6IB 5C08B 4H0HB 2WQ8A 3SKJL 1MHEB 2PN5A 5JIPA 5F1KC 4JO4H 2EE9A 3RAJH 3P73A 5JPMA 2EH7L 3WNOA 1W2KT 4P23A 4MQ7B 3UZEA 4M1DL 2KL6A 2NXZB 4F7EB 3BPCB 1RIVH 4V1DE 1YEGL 3R8BB 5EU6A 4HK3J 1CICD 5D2LB 2X41A 4PJCF 3CCHB 5C0CD 1G9NH 2GUOB 1JE6A 5K9KA 4B5EA 4IRJC 3A6OA 5D72L 2G60L 2YBRA 4M9OA 3P73B 5JPMB 3VFOB 3E2HC 5ABDE 4P23B 5D70L 4YHYC 1KIUA 3C2AL 3FJTA 3P4OB 4N0FA 4I77H 5CZXD 4EIGB 4MA7H 5EU6B 4PGEA 3GBLA 3L95A 1TETH 3ARXA 4K7PL 1JVKA 3E6FA 4LLVA 2Q20A 4X6CE 5K9KB 3VI4E 1SQ2N 3D2UA 4NQUA 4P2OA 4UAOB 3SGEH 4NO5A 2YBRB 3GZKA 3EDFA 2E3VA 3VJ6B 1KPRA 2IADA 5ANME 5KSBE 4N0FB 5EC1A 1FE8L 3B43A 4J4PC 1GGIH 3L95B 5JPNA 4MLIA 3T0AA 4TRPH 3E6FB 4LLVB 3P30H 3WD5H 1IQWH 2AJXH 3D2UB 4P2OB 5HYFA 5D6DC 2EIZA 2QADB 2VRAA 3O0RH 4MJIA 4NO5B 4F7TA 3GIVA 2APBA 2ZNXA 4R7NA 3PP3K 3QRFM 4NQCA 3QEQD 1KPRB 2IADB 1T5WB 5EOCJ 4XCFH 3K74B 5EC1B 4QXWA 2MQCA 5FGCB 5LAXA 5IMOA 1P84K 4ZFOA 4KK5D 5I73B 1CR9H 5JPNB 1QBLL 1I9IH 4NQEE 4XNQA 2QSCL 1B2WL 3SDYL 2EIZB 5A2IH 4MJIB 5BS0A 3SKUD 4R7NB 4XMPL 4NQCB 3V6FA 1BJ8A 4KY1L 3DURA 4CN1A 3NFSL 4C58B 2CLZA 4C4KT 5HPMA 5LAXB 5IMOB 4NWUH 4ZFOB 2PKDA 4LNVA 4ALAH 1U3JA 3QJHA 1GGCH 4Y4HA 3NOIA 1EJ6A 1K8DA 3ARFD 4XNQB 3QUZC 1VFOA 4WW1A 4XAWH 3UYRH 2DAVA 5BS0B 5AG8A 2BHYA 2OJZH 5DO2D 4NO3A 1ZXQA 4NCC1 1KB5L 3C6LD 1V8HA 4GLRH 4WU5A 3V6FB 1FGVH 3DURB 1DFBL 1BJMA 3CJJA 3ULUD 5HPMB 5KS9F 1RIUL 1XFPA 5GRJL 2X9XA 4BZ2H 5D1XD 1D5ZA 4PGZA 4MB4A 1OAUL 4NUJA 3QJHB 3BJLA 1K8DB 2LV4A 1M7XA 5I6XB 1FBIH 4ZAKD 2CDFA 3QWOA 4WW1B 4LQ1A 4ZUUA 2QSQA 1WZ1L 4O4YL 1AI1H 4JRXE 2OZ4H 5I1KL 4Y4FA 3M07A 4NO3B 4YEFA 1DQML 1BBDH 4MJ5A 4OZIA 3RPIA 1G0YR 5FYKU 4OQTH 3X14A 4Y8DC 1TNNA 3C5ZC 1JPFB 2XZQL 3UPRA 1AXSA 1BVZA 4E42A 4K94L 1D5ZB 1RJZA 4NUJB 4P9HL 5TQ0H 3C60A 2FR4B 2CDFB 2UWEE 3QWOB 4ODSL 5F9OH 1LEGA 4NQXA 4Y4FB 1AQKL 4WHDA 4MJ5B 4KUZL 3QRGL 5C0GA 3RPIB 1YEHL 3X14B 3FQWA 4LSPH 1EFXD 4KKLD 4WTXA 1HIML 2EDHA 2EO9A 2FZ3A 3E2HB 1AXSB 1OGAE 1WQVT 4E42B 2VAAA 4YHYB 2ARJB 1RJZB 4N0RA 2WWMC 4PRIB 4ZXBC 4Z77A 2GSIA 4QRQA 1AD9B 3QAZC 3H6JA 2E9JA 3C60B 1EFQA 1MNUH 3LS4H 3X11A 2DD8L 5MHSD 1N5YH 5AUMA 2X9WA 1LEGB 1V7ML 4NQXB 3QNXA 1JWUA 2ORBH 4KKAC 4M5ZL 1HCVA 4WFED 1A7PH 4A6YA 5C0GB 3B6SA 1EJOL 1I85A 4KHTL 1EGJL 3FQWB 2AAVA 3VI3F 2FZ3B 3ALWA 4P59H 4MZ2A 2H45A 1WZMA 2VAAB 3ARBD 4KU1A 2GJJA 4MSWA 1I1AC 2EDTA 1KIQA 4Z77B 1ZANL 4QRQB 4HF5L 4S10A 3WKML 3O9WA 3DYOA 2RCSL 5T3ZH 4LLMA 5E8DH 3RVWD 4RX4A 5AUMB 3SDAA 3GSQA 3AROA 4JY5L 3QNXB 1FFRA 1JWUB 4RMSA 5TF1L 2XFXA 4AL8H 4GQ9H 1GZQB 3CVHA 3HE6D 4KDVA 1R5VA 2FX8H 5D2LF 4MCZB 4GKZA 3MV8A 4MSWB 3QDMA 1BQLL 4P2CG 1KIQB 5DVKA 2OL3A 3Q6FA 4QHUA 1KN4L 1CDIA 1KFAH 4M6ML 4LLMB 1UEMA 4JKMA 4S1RL 4LRNL 3SPVB 3VXMA 3SDAB 2L7UA 4DEPC 2AS5M 5FYKL 5IW1A 1UCBL 2AJ3A 5F21B 3I3BA 2VDLL 4ZNCD 3CVHB 4R26L 4X0KA 2JIXA 5GGSB 4LCYA 5E9DA 1QSVA 3PGCA 3MV8B 1F4WL 1ITBB 4R8WL 3QDMB 2GJ6A 3E3QC 5KSAA 3BKMH 3N1QC 2OL3B 3Q6FB 4QHUB 3CPLA 3CGTA 2X4SA 1BAFL 1MCLA 4X7SH 4JZJC 3VXMB 4H1LH 2IH1A 5IW1B 3KPSD 4DN4H 2IAMA 2AKRA 1FP5A 2AJ3B 3TYFA 2XZCH 1E4XH 2PYED 4QO1A 3TBTB 4X0KB 1JRHH 2JIXB 3K2UH 1PG7L 2A1WL 5E7BA 4LCYB 1KCRH 5E9DB 4FG6D 3PGCB 4YJZL 2GJ6B 3GMLA 5KSAB 1U3HC 4LHUA 4HLJA 5HVHC 3Q0HA 3CPLB 2X4SB 4FQJL 1A7OL 3BPOB 1LVEA 4JFZL 4OZHA 2XQBH 3HZVA 1EHLH 1A6WL 1CBVL 5DJDA 1A1MA 1A3QA 4LVNC 4RCAA 2IAMB 2AKRB 1JF1B 3TYFB 2YD2A 3KAAA 1KTLA 3FOMA 2D7MA 3FN0L 1U42A 3JV6A 5IESL 3TN0C 1JJUA 1SM3L 4ZFOL 5IKCA 1UACH 3GMLB 1OTTD 2NY5H 2JJTA 4LHUB 5IB4A 4Y1AE 4F8QA 4NM8H 1MRFL 4TNVK 2EICA 3VD3A 4KC3B 4L9DA 5J11C 5DJDB 1H8OA 1A1MB 5KVFL 2GW5A 5IF0A 2OP4L 3VXQB 4OGZA 1KTLB 5KVDH 3FOMB 5MENA 3JV6B 1LE5A 3MLZL 3D3VE 1EHXA 2CQVA 5EOCL 1R5IA 5IB4B 3QDGD 2MOVA 3L7FA 1I1AA 1YC7A 4Y4KA 3QAZB 4L9LA 3ZSTA 5IF0B 1F4HA 4Q97A 5HGGS 1XZ0A 4G9DA 4PLKD 1Q0XL 3BWAA 1LE5B 4HUKB 1FRGL 3AUVA 3U6RB 1IMHC 1DBJL 2EC9T 5LGHL 4YQXL 1IGMH 2CKBH 3L7FB 1CIDA 1I1AB 3LV3A 3MV7E 5EU7E 5BXFA 2DLTA 3VW3H 1EDQA 1J0HA 4Y4KB 3RWFA 3I50H 5ADOH 5C0BD 1E6JH 2ICES 4G9DB 3NZ8A 3V5DA 4IRSD 1WITA 3I85A 3T1FB 2UZXB 3O6KL 3V0AC 2V5YA 3UTTE 4ODHL 3SOBH 1NFIA 2W9EH 5K9QG 1ORQA 1Q72L 4I8DA 4G7YH 2V17L 4P2YA 4Z7QE 2WWKO 3SBWC 3MRMA 1PD6A 3U9PL 5I8EB 1L7IH 3LSOA 3Q5YA 3LV3B 5IBTH 1AE6L 1SMAA 3KPTA 3K81A 4OZIF 1S8DB 2DM2A 3FT3A 4R90H 5EBMA 3V5DB 1H9VA 5I8OH 4DEPB 5J7CC 5IR1A 3ZO0A 1R3JB 3VDBA 1NEZA 3MRMB 4ZOAA 4X6DE 3IJHA 3L9RA 1UGNA 1EZVY 2AK4E 3AAZA 3NTCL 5E08L 4MA1C 3FT3B 1HE7A 5EBMB 4A6YL 4P5KA 3LKNA 3QCTL 5I76A 5AEAA 1CDUA 3O81A 1WGOA 3IAPA 3LAFA 2DQUH 2Y5EA 4D8PA 1YEFH 1NEZB 3OKEA 3V52H 1HKLL 4I13B 4B7IA 3ILQD 2DBLH 2PETA 3A67H 1HHKA 3L9RB 5SWSD 5HVHB 1FZMB 1KXTB 3S36H 5C0AD 3AAZB 3VA2C 5LQBH 3T2PA 1JPST 4DOHE 1YECH 1S7VA 3GSNB 4P5KB 3CVHL 3UP1A 1FORL 1BZ9A 5I76B 3GIZL 4N9OB 4HH8A 1AKJD 4D8PB 3OKEB 3TN0B 2OL3L 1Z5LA 2ESVE 2VR5A 3BKJL 2OQJA 1PZ5A 2Z8RA 4KUCD 5GSRB 3OXRA 3ZKMD 1HHKB 1JHLH 3HNTL 1N64H 5J4MA 3V7MA 1LQSR 2HWZL 4S1SL 5FKAA 1MCHA 3JV5A 1CQKA 2NXYB 4YHKL 5J11B 4OAWA 4Z0XB 1FZKA 32C2A 3UTZA 3NCMA 1BZ9B 3S37X 3TJEH 2R8SH 4WEBH 4XPHL 3KXFD 1LO0L 4KV5E 3SJVD 3CFIC 5TFSL 1RURL 1Z5LB 2OQJB 1PZ5B 5I1GH 1FFOB 1RD6A 5IJKC 3OXRB 2ZKHL 5IQ7H 3CX2A 2JCCE 4ACPA 3M45A 1P4BL 5L2JA 4PYGA 5FKAB 2ENYA 3RHWK 3BVNA 5IMMB 3EHBC 4OAWB 5HGAA 1FZKB 32C2B 3UTZB 2GT9A 5FECA 4YXKL 1LK3H 4JDTH 2OI9C 4H25A 4O2CA 3DLQR 1TITA 2H2PC 4B41A 2QSVA 1K9TA 4LARH 2GIYA 1NAMH 4OUOA 3T0EE 2CUMA 4LCIH 1KACB 3D48R 4JFDD 5CGTA 1A1OA 5L2JB 3ET9F 4JGMA 3BVNB 3BQUD 4NDMA 5HGAB 3Q5OA 3ROLB 2GT9B 5FECB 4LPXA 1PJ9A 4H25B 4O2CB 4QHLB 5D1QC 2BP3A 4NQDB 1LK2A 4OZHF 3HR5A 4P2QB 1JYVA 3MCLH 1JF5A 2XN9A 2AXGA 1NFDE 4TN9A 1F4XH 1DBAL 3K8LA 1A1OB 5IBUB 5CILL 5GGUA 5MP6H 3QPXH 2E7LC 5J9PA 4NDMB 5L8KB 3LS5H 4LPWA 3BESR 4LEXL 4NC2B 4L4VD 3GKWH 2H32A 4UU9A 1YEKL 3GMPA 3SDCD 3D0LA 1FL6A 4GW1A 5E2WH 2APVA 4H26A 5L2KE 3HR5B 1RIHH 1GOFA 5GRYA 2B1HH 4OF3A 4YHIA 1Q8MA 3DETC 1P5UA 3CSPA 2XN9B 4LVOC 2AXGB 5TPWH 3GO1H 4QXGL 4WFGD 5FYJU 5SWZD 1DEEA 4RGNE 4WEUD 3CK0L 2F5AH 2H32B 4UU9B 3GMPB 4MA1B 4Z18A 3RWHB 4XCNA 3D0LB 3IFNH 3OPZL 1FL6B 4GW1B 1OARL 4H26B 4K7PY 2CRZA 3RGHA 4YHIB 5ESVA 1FN4A 3QEHA 5E8PA 3INUL 3PWNB 43CAA 4JY4A 3RBGA 5GS0L 4JHWL 5DQDL 1DEEB 1NC4A 1INDH 5CZXC 1E4JA 3QG6B 4YHOH 1IFHH 4MQSB 3NPZB 1WIUA 4DGVL 1U8QA 1J5OH 2IBZY 4Y5VC 5E5MA 4QOKE 1DSFH 3KWWA 3BX7C 2AQ3A 5D7SH 5ESVB 1FN4B 2Y36L 4F7CB 1OM3H 5E8PB 3UC0H 3UAJD 1CIUA 4X9BA 5ALCH 1A02N 1ZA6B 1E4XI 3HC4H 1SJHA 3FTGA 2VZSA 1NC4B 1ZWIA 2YPLE 5FDWA 1HHHA 1NLBL 1CDGA 3KJ4C 1G7JA 5FCSH 3JV4A 1F3RB 2I60L 2QL1A 1U8QB 4WGWB 3TO2A 2HH0L 5IMLA 3LZFL 3LB6D 5E5MB 2D9QB 1JHKL 3RWIB 1T2QL 1CFBA 3KWWB 4XBEL 3UZVB 3GK8L 4LHJB 1UYWL 2A9NL 3KYNA 3QJFA 3E8UL 4UBDD 1C5CL 1GC1C 2DQDH 1FSKC 3G08A 4WCYL 5ITBL 1SJHB 3FO0H 3FTGB 3UMTA 4UQ3A 3GSNL 1KC5L 3VGEA 3HG1A 5FDWB 1HHHB 1T04A 4KK5C 1G7JB 3JV4B 2CRMA 3U9UA 1TJGL 4HULB 5IMLB 4UB0H 4G43A 2V5TA 4Z7VA 2W59A 2OI9B 5FYJL 2VXTH 4QRPD 4BK4A 2GCYA 1I7RA 1DL7H 3KYNB 4M43H 5D1QA 3QJFB 2HKFL 1VFAB 4XP6L 1MAMH 4U1HA 5E6ZA 1IL1A 3UJJL 3G08B 1FGNL 1E27A 1MCPL 2DTML 5FM5O 4M7JL 4PV8A 4D9QE 3HG1B 3RY6A 4D94A 2QHRL 5GJSL 4QXTA 3V8OA 2X40A 4KGJA 3U9UB 1TDQA 1KJ3H 3V5KB 3QIUA 5EWIH 1IAMA 4G43B 1P4IH 4XGZA 5L6YL 4Z7VB 1WFNA 3ARFC 1T22A 2B8OT 5JW4Q 2GCYB 1I7RB 4UT6L 5D1QB 1FFNA 3K4DA 4U1HB 4YAQA 1KGCE 4MNGE 5DO2C 2BVEA 2IFFH 4HS8L 1MFBL 3IKKA 1KJ2A 3C6LC 5CFHA 4PV8B 3RUGA 5MEPB 2ZUYA 3ULUC 5DS8A 1L0XA 4KVCH 4QXTB 3DX9A 1UB5A 3W39A 1CXKA 5D1XC 4XH2A 3QIUB 2WBKA 5E2JA 1J0ZA 4XGZB 1T22B 1XIWC 4ZAKC 1CICA 4WIQA 5D7LE 2VDRL 1FFNB 4JCMA 3W0WD 3F62A 4YAQB 4M6NH 1JNNH 2O61A 3WXWH 2ZCLH 1WTLA 1L0QA 1EA9C 4LMQE 1KJ2B 3NCBB 1RUAH 4MHHI 4LVOB 2A6JA 3D6GA 3U7YH 3BZ4A 5DS8B 5T5NF 2Z91A 3DX9B 5EB9A 1UB5B 3W39B 4PJ9D 5IW3A 5IFAH 1MRCL 4XH2B 5CJOL 2N7BA 1OW0C 4NHCL 3OAZK 1CICB 3V0WL 3V5HA 5C0CB 4P46D 2O61B 4ZUSA 1NCAL 2VITA 1Y0LA 1Z9MA 4OSUH 4YWGL 4Q9CA 5BV7C 1IAIH 4IBLT 3GSWA 4KKLC 2A6JB 1GSMA 4JR9L 1YN6A 3BZ4B 4ERSL 4WO4C 2Z91B 4I18C 1S9VA 1YY9D 3S34H 5SWQA 2GSGA 3RTQD 3WXVL 5HY9B 1BJ1H 5LGJA 4I1NB 3V6ZA 4N5UA 1UM6L 3WIIH 5C9JA 3CD4A 5C3TA 3V5HB 3S36X 2BOCA 1TFHA 4LPYA 3JTTA 3L3HA 3OG6B 4ZUSB 2VITB 1I8LC 1Y0LB 2X44D 4FQPA 4WI7A 3HMXH 4GKNA 3B4NA 1YN6B 1BVLA 4TOYH 3QEQA 1WAAA 3AY4C 1DQTA 1S9VB 3ARBC 5SWQB 1RUPL 1J0IA 3T08A 2APFA 5SV3A 2DQCL 2GSGB 4PIRF 5ID1A 4ZFGH 5T1DL 5LGJB 3V6ZB 3KJ4B 3MLRL 5BVPL 2R0LL 5F7MC 3RVWC 4RBPH 2B4CC 3CC5A 2KPNA 2BOCB 3JTTB 3L3HB 2ZWLT 3BZDA 5F93C 2HJLA 1C08A 4GKNB 1ZOXA 3HE6C 4KK6D 1Q9LA 1BVLB 4DGIH 3RWCA 3BJ91 3QEQB 4XC3H 5K93A 5DXWA 4PPTA 4KMLB 2KQMA 3CFDA 4LP4A 5ID1B 1NCDL 3MOQA 3WJJA 4U33A 5K9JL 2OK0L 1AP2A 4XPBL 3CC5B 3OAYK 1AXIB 4PJHE 4LSTH 3O4LA 1CD8A 1C7TA 5IEHB 4JM2A 1GJIA 3KDMA 1H3UA 3F7QA 3FHAA 4NQSA 1SVCP 2HJLB 3X17A 2Z31A 1C08B 3WE6A 2D03H 1Q9LB 2XRAL 5CP7A 1HILA 3RWCB 5GS3A 5C6TL 1Y6KR 5H94A 4YHZH 4D0DA 1Z9OA 1CD9B 2KZ1B 3SQBA 3CFDB 2BRRH 1CVSC 4NWTH 1FAIL 2ICEB 2V9TA 3BEWA 5JHLH 5AZEH 1AP2B 3JVGA 2BNQE 4YXHH 1BGXL 3V4VH 3KLDA 3O4LB 2WBJD 2A38A 2C3GA 3KDMB 4NQSB 4ZAKA 3CXDL 1INEL 3VXRA 2E7HA 4S0TD 2Z31B 3WE6B 3EOBA 5TQ2L 5CP7B 1HILB 3C6LB 2WWKT 5H94B 3S35H 4D0DB 2H3NA 1D6VL 4HIJA 2BXZA 5E8EA 3BD5A 3SCMA 2BSTA 3BEWB 5H37G 3QXVA 1XGRA 5D1XB 1JTOA 4HWUA 3WSQH 4BH8A 4GXUN 2ZUWA 1OW0A 3UBXG 4ZAKB 3K3QA 4OCMC 4MB3A 3VXRB 5BRZD 5GZND 5F9AC 3EOBB 4MNHA 3H2WA 1FNGB 4UNUA 4MNQD 3ARYA 4K7FA 3VWKD 1X5GA 1X6NA 2I9LB 1QHPA 2H3NB 1IQDA 4M6OH 2JJVA 4RZCA 1I1FA 5B8CC 5CEZE 4I0CC 1H8NA 3JZ7A 2BSTB 3VXUE 5BV7H 1XGRB 4JGJA 4JANA 5JW3L 2I27N 3N50A 4BH8B 1BZ7A 2UZIL 2EDNA 4HQQL 4RA3A 4LSRL 3WNKA 4LSDA 2X4OA 3FB7A 4O58L 4CU8A 4MNHB 2A74A 2R0KL 2W92A 1SYVA 5T33L 2VXSH 1I8LA 4K7FB 2PO6A 5DD6A 1IQDB 4LKCA 4Z7VF 1J9CT 4GAJH 3OB0K 3QXTA 2V7NA 1AXTH 1I1FB 2FATL 1YEEH 3P9MA 5EIVA 4DUXA 3ULVE 2VN7A 4TSAL 1Q38A 1UT9A 3ARBA 4LPCA 4OM1L 2HTKC 1ZHKA 2F19L 4PRPD 4JANB 2CMRH 2QQNL 1BZ7B 3VFMA 1R3KB 1JTPA 1U8LA 4LCWD 3VH8G 5EU4B 3BP6B 3NIGF 3TM6A 3O6FD 1KJ2L 2AEPL 2X4OB 3DV4A 4PLKC 3ZHLA 2DRUA 1DQLH 1KYOJ 2A74B 2CK0H 4JB9H 1SYVB 4MAYA 4LSQH 2DF3A 4XBPA 5DD6B 3DOSA 1CGWA 4HWBA 4LKCB 5FHAH 3MJGX 4ZTOH 3P9MB 4N8VA 1U6AH 1RZGA 3BUYA 4O2EB 2OM5A 2RFXA 1G0XA 5LWYL 3CZJA 5HDLA 3ARBB 4NGHH 1NGWA 2HFGL 1CFSA 3IT8D 3HI1A 4Y2OA 4JDVA 4JPWL 4JY6A 3VFMB 3RUGF 1U8LB 2VUOA 4I9WE 1I8IA 1BF8A 3VFTB 3DV4B 4FQCL 4H0GA 4BKLA 3UX9B 5IGXL 4BJLA 4IRSC 1GHFH 4FQIL 4MAYB 3DPBA 1MCKA 1NL0L 2Y06H 1JPTL 1MQ8A 4FZ8L 2HKHL 1ETZA 5CHNA 5M7QA 5DMYA 1DZBA 4KQ3L 3QDJE 3HE6B 4X4ME 1KXVC 4CVUA 1RZGB 3BUYB 2RFXB 4RQQA 1WUNT 1NGWB 3ZZ1A 2JTDA 1CFSB 3A6BH 3HI1B 2VLMD 3B83A 3CVIL 4GAFB 4JY6B 4RGOH 1UXWA 2E8ZA 5HHQB 1I8IB 2MCPL 4HKXA 1YDPB 4BKLB 4HGMA 1I9EA 5CBEA 2FX9L 4JFEA 4Y0GA 1ZLSL 5B21A 2R69H 2X1PA 2E7CA 1P53A 1YNLL 1ETZB 2DQIH 5CHNB 5DD0L 5JZ7D 5EIQA 1HYSD 2FD6H 5DUPH 2Y4SA 1IGCH 4LBEA 5EZOH 5CJ8A 3KVQA 5JMOC 3TT1H 5SX4H 4GRWH 1WC7B 4RQQB 3AGVA 4Z7WE 4YBLB 4XNZB 3VGBA 1OP3K 4PGDA 3IETB 5ISZD 1XT5A 3AB0C 1F02I 3TO4D 1UXWB 4LIQL 4HKXB 5DF0A 4NP4L 1TJHL 4WFHD 5CBEB 3QIBC 5GGSY 5JOPD 4XNYL 1GC1L 3MLUH 4Z78A 1YC8A 1UQSA 2PYEB 1RMFH 4LBEB 2ITCA 1OD7A 1T0PB 4J3OC 5GPRA 1CGSH 3DV6A 3ILQC 1MCOH 1R3IH 4APQA 1CGYA 1VGKA 4PGDB 4JQIH 4ODBD 2AJYH 3MBED 1ZHNA 3NAAH 5GGTL 5L88L 5EO1A 2IAND 1WAAF 1EMTL 4UUJB 2C1OA 1IGYA 1CU4H 2DLEA 4Z78B 3PWLB 3QHZH 1UQSB 4PG2A 3T3ME 3SDXA 2ITCB 4WWID 3FT2A 5BO1H 3DV6B 1FHGA 1QEWA 1VGKB 3ZKMC 3MNVA 1TJIH 2FWOA 4P2RA 5IP4A 5EO1B 1OHQA 4RSVA 1YEJH 1HCFX 2C1OB 1IGYB 4OFVA 2XIDA 1G7HA 2NY6D 4WFFE 2R0WH 2X4UA 3NN8A 1S5IH 3IDXL 4HMCA 2Q8AH 1MJUH 2Y07H 4TUJA 4PBXA 3SDXB 1KJMB 4LLAA 3ULUL 4MA8L 3FT2B 1KBGH 4M7KH 5K9QI 5D1ZA 1JGUH 3AS0A 4TVPE 4JM2F 4HW6A 4XMKH 3ES6A 2WV3A 3MNVB 3MLPA 2FWOB 1UKTA 5I8KH 3QA3A 3QIWA 4NKMB 2X89D 2VXQH 4M7LH 1DQDL 4EI6A 1ZMYA 2D4DA 1G7HB 5D5ME 1HINL 4OQTA 4WI4A 3ULUF 3GBNL 2X4UB 3KPOA 3NN8B 1JBJA 4IRSA 4TUJB 5EO9A 4MA3A 3QO1A 1UWEH 2F5BL 4ZUVA 2VAJA 3VI3E 4U7MA 4KKBC 4QLRA 1Z2KA 4JO3H 5DTFA 4D9RD 2EDYA 3T09A 3ES6B 5C08E 5DJ6A 1GOHA 3ARDA 4LPVA 2DQJH 1PFCA 1D6EA 3QIWB 3ZT5A 4HHAA 4EI6B 3Q3GA 4IJ3C 4PJXA 5DJZA 1CN4A 3UO1L 5C0BB 3KPOB 4XP4H 3GJFH 4IRSB 3UTSA 4A2MA 5EO9B 4MA3B 3QO1B 5F6HJ 4ZUVB 2VABA 3BISA 3GKZA 2YS4A 5E1AA 1D5BB 1EHAA 1NCBL 3RY4A 4YPGB 4DK6A 3ARDB 4HC1H 5HHNB 3QSKB 1IEHA 1D6EB 2XPGB 4G6FD 1OPGH 4HHAB 4PJXB 2L4OA 5DJZB 3GNMH 2KUTA 4HBCL 2NTSP 1QG3A 1QQDA 4F9LA 1G6RH 3I2CL 4WUKH 5I30L 3GJEB 1IILE 1D9KD 3SDCC 5FB8A 2R1WA 3UTSB 1J1PL 4WU7A 5B3NA 2XG5A 3D87B 2VABB 3GSOA 3NCCB 5FUOH 5E1AB 4QHKI 1FVEA 5EU5A 2EDJA 3ARED 2AV1A 2Q3ZA 1X3DA 1J7VR 2Z0BA 3NCEB 2W1NA 5IK3A 2LE9A 3RWJA 2VDOH 3P0YH 4PJDA 3U4EA 5C0AA 3M8OH 4OUUA 1QQDB 2E6PA 3VD5A 2NY3D 1RIVL 4XRCA 5DSCB 4YFDB 4WV1C 4HWBL 5FB8B 2R1WB 2AERT 4P3CH 4WU7B 1QFUH 1RUMH 3GSOB 2VDNL 1T20A 4DQOH 1AKJA 5EU5B 3ZDXE 3IFOA 4U1KA 4HKJA 4PJFB 1FLRL 2F53E 3SGJC 5EZJA 1YMME 2IC2A 2HLAA 5CJXA 3RWJB 3S35X 4PJDB 5C0AB 4E41D 4OUUB 4YE4H 4EQ3A 4XRCB 1WFOA 5FGCE 3ARWA 2D7OA 3G5XA 5J6GA 2RAMA 1RZJC 1QO3A 1XF1A 2MPAL 1T20B 1TETL 1FYTE 1EIBA 4FP8H 3KXFA 1AKJB 3SKNA 4OD3H 3SJVA 3IFOB 3UAJC 4U1KB 1UH2A 4H1LA 4MJIE 5H37H 4TSBH 5DMIH 5FM8A 2LU7A 4KROB 4JN2B 2GJZA 5EZJB 2HLAB 6FABL 1JFQL 5I75C 3JUYA 1M05A 4EBQH 4QT5A 2FB4L 5IROC 5J6GB 3V4UL 1NLDH 3LB6C 4ORGA 5F96L 3ZDZE 3W82A 3CSBA 4TRPL 5HGBA 3KXFB 4Q9RH 3SKNB 3O3DA 2NR6D 1IQWL 3L7EA 3WLBA 3SJVB 2XNAB 3LQAC 4UBDC 4H1LB 3O0RL 3PQYD 1F5WA 3QH3A 2VQ1A 4OJFH 4AH2A 2LFGA 3KPNA 4GKOA 5TE4H 4JFDA 3X13A 4Y19E 4U7KA 4GXUM 12E8H 1UM4H 1M05B 1QFWH 3DHJA 4QT5B 1F97A 3BQUA 1UEYA 3AM8A 1CR9L 4Z8FH 1LMKA 3EAKA 4ORGB 3MJ7A 3BAEL 3J8F7 5HGBB 3HA0A 5FO9A 1I9IL 3O3DB 4XP9H 1WT5C 3L7EB 4U1IB 2GTZB 3WLBB 3QH3B 4JDZB 4YBQD 5HI3D 4EKXA 4AH2B 1F6AA 3KPNB 4JFDB 1YPZA 2Z8SA 1NMAL 3BQUB 1JZ4A 4NWUL 2ZOLA 5HHXH 1L9NA 5HHPA 3C09C 4ALAL 5JORA 1GGBH 1MVFA 5HGHA 1GGCL 3B3IA 3SDCA 1U8NA 5T1MA 3BKCH 1QHOA 5DZLA 4MD5B 3CMGA 3UYRL 4EI5D 1ZEAH 2W38A 2V9RA 1F6AB 1KELH 3BIAX 3OSKA 4C56D 2GI7A 1YPZB 3D39E 1UM5H 3OKMA 4EN3D 1KIPA 5JHDE 3SDXF 1X7QB 3TYGH 1SJVA 5SWZA 2ZOLB 4J6RL 5HHPB 2FX7L 2UUDH 4HXBH 5DC9B 1MFDH 3LN9A 1YZZA 1RULL 4PRIE 5E8NA 5JORB 3FO2A 5GGVH 2YK1H 3SDCB 1U8NB 2ICWJ 5T1MB 2EDOA 3V7AE 4F58L 4BFBD 4ZTPH 3T3PF 1AI1L 2NNAA 2CLVA 4OCRH 2F8VA 2P8LB 3CX5J 3NCJL 3F12A 4PBWD 4KJYA 3OKMB 1KIPB 2OLDA 5GRUH 5IVNA 4OQTL 3WHXA 5SWZB 1JF6A 5I74B 2YN5A 5FGBC 4R9HA 1AGFA 2HFEA 3S37L 5TQ0L 1IBGH 4WV1B 4ZUTA 3OKOA 3K4AA 2Q87A 5HYJE 2Z4QA 4X4XA 3V6OC 2QQLH 3QNYB 3RRQA 5F9OL 2ICWA 2NNAB 4MJ2A 2CLVB 3HC3H 2D0GA 3F12B 3MRBA 5DZOA 4P3WA 2WUCH 3PWUA 1JN6A 1SBSL 1WWWX 1YY9C 2JJSC 3QQNA 3H3BC 4AEEA 3RTQC 5SX4I 1QPPA 3P77A 1UC6A 1OT1A 2Z4QB 4X4XB 5FEBA 3EOTH 1N5YL 3DNKA 4PJXF 4QRSA 2ICWB 4MYWB 1QNZH 3AVEA 3V9FA 4PJEE 2BHZA 5D6CA 3WFEH 1KV3A 4IHOA 3PWUB 4JRYD 4D9LH 1XGYL 4FZEH 1JN6B 3U46A 4PLJD 4P59L 2DQFB 3MV8E 3QDME 4FA8A 5C09D 5D7JA 4UTAH 3L5JA 3LY6A 2HVJB 3UYOD 5J3HD 4M62H 1SVZA 5E8DL 1TQCC 2R29H 1OQXA 5DVMA 4NKOB 4QRSB 5D7KD 1U0QA 4Q6IC 4QRPA 2WK2A 5GJTH 1KXQE 5D6CB 2B5IB 1HXMA 1MFCL 3VE0A 3QR2A 1VEOA 4IHOB 4GQ9L 1XF5A 3U46B 3U4BH 3GSXA 4OF5A 2Z9TA 2ERJB 1I9JH 3TGXA 5BOPA 5DQ9A 2VDMH 3TH3T 2J88L 2OX5A 3PWJB 5D7JB 1QVOA 1KFAL 3ZKND 4KKNA 4O51A 1KG0A 4H20H 4GW4A 4PJDF 4QRPB 4FMKA 1HDMA 1ZK9A 3O8XA 1QKZH 1HXMB 2A77H 3VE0B 1S7QA 3IRZA 2C1PA 3GSXB 5DQ9B 3BKML 4OZGA 1QVOB 1A6TA 5SV4A 4J3SA 4O51B 4X7SL 5E99L 2WBJC 4XT1C 4JCLA 3QISA 4GW4B 1HDMB 4R4ND 5HD8D 1KCVH 2YPVH 1S7QB 3W0WA 2XZCL 1E4XL 2VLKD 2A2QT 2WBWB 3CFKA 3ZE2E 2C1PB 1WCQA 4X4YA 3AMKA 3SDDA 3SGDI 3U0PA 2XTJC 4XVJH 1YNTA 4W6WB 4PRDA 5FM4A 4OZGB 3P2TA 4FFZL 3ESVF 1NAMA 4PJ9A 5FGBA 5DURB 1UWGH 2CIKB 3I6KA 2XQBL 1H3VA 1EHLL 1EPFA 1S78D 5GZNC 2NQCA 3W0WB 3V4PH 3VD7A 4P46A 4RISH 3MZTA 4X4YB 1IGFH 3EGSA 3VWKC 3SDDB 3U0PB 1YNTB 1J86A 4PRDB 3CFBB 1UACL 2MHAA 1BOGA 2NY5L 3TZVD 1TPXB 1KPVB 4LP5A 4YGAB 4YZFE 2JJSA 1NAMB 2W0KA 2X7LA 4PJ9B 1OF2A 2BFVH 4JKLA 4V2CB 4D0BA 5CLWA 1T2JA 3I6KB 4R7DA 4G9FD 3S6CA 4O2FB 5E4EC 4HT1H 3MGAA 4PJ7A 4L8DA 1I8KA 2QQKH 3PDDA 4I3SH 4JEGB 4P46B 5KVDL 3EGSB 4X7TA 5FO7A 1WFUA 4NCC2 2V2XA 1WVZA 4FN0A 1INQA 5AZ2H 1MJ7L 5A16A 3H9SD 2MHAB 1BOGB 4UINH 1U36A 2HFFA 4M03A 2X7LB 4D0BB 1JZ5A 3RTQB 3UJIL 5IUSA 1YPZF 1B0GA 3HS0A 4FQ2L 4PJ7B 2HT2D 4L8DB 1I8KB 1G1YA 2G2RA 3NABH 3JWOH 4O02H 2VZ1A 4OM0H 2XACC 3DSFH 4X7TB 3MOBH 5FO7B 2YUVA 4F57L 2V2XB 3IS1X 3TC9A 4QRUA 2W9DH 1YMHA 1INQB 2BX5A 3W2DH 5A16B 3MRNA 3OHXA 4K3GA 2Y9RT 1ZT1B 3ARGD 2ED7A 5IIEA 3TESA 5KTEL 3E3QE 3RZWA 2WUBL 1MREH 3MGTA 3R1GH 3ARQA 3MO1A 1B0GB 2P8MA 1Q0YH 4J3VA 3F7VA 4NM4H 3HLAA 3I50L 4F9PC 5ADOL 1LNUA 2G2RB 2FBJH 2H1PL 5I19H 1OAXH 3BDBA 2V2TA 4QRUB 3JTSA 5KOMC 2F8XC 1YMHB 1BX2A 2CXKA 2W9EL 3UROR 4R4FH 3MRNB 1GH7A 3MRIA 3OHXB 4ENED 4MMXC 4EVNA 2R2HA 4JPVL 4G7YL 1KCKA 4FQ1L 5FA3B 2FO4A 1MFAH 3MRFA 4U0RC 2QKIA 4PY7A 5IIEB 1RZJL 5IBTL 4DKFH 2XKSA 5MEOA 3MGTB 1NCCH 3MO1B 2IJ0C 3OJDA 3F7VB 1M6OA 5J12B 2GTWA 1LNUB 2VLJD 1K3ZA 3UBXI 2WBJA 4N8PA 2Y23A 4TPRH 4XB7A 4N8CH 3QYCA 1XH3A 3JTSB 5JZ7C 2X70A 1HYSC 3W9DA 1ZAGA 1BX2B 4JZNA 3ILPA 5IB3A 5JO5A 4OBRA 3MRIB 4EVNB 2R2HB 5GRZA 3EDJA 3SQOL 1LEIA 2FO4B 3MRFB 3UJTH 1PX3A 3G9VA 4LL9A 2VLRE 3PNWA 3MRJA 3VA6A 2NTFA 3TO4C 3GRWH 5MEOB 1IGJA 1N7MH 3WFDH 3OJDB 1M6OB 2GTWB 3PP3H 5DJCB 4QKXB 3MR9A 2WBJB 4K9EH 2OTWA 3X3FH 3O2DH 4FABL 2W91A 1WWBX 4WENB 1XH3B 5BRZA 3GI9H 1S7XA 2AK1H 4JZNB 4MJ6B 5JO5B 1Q9KA 1JGVL 3ILPB 5IB3B 1KEMH 5F3BA 5D2NC 3VWKA 5ICZA 3NIDF 2EIBA 4OCLC 4HGKC 3DHMA 3LN5A 2DBLL 3MV9D 3PNWB 3MRJB 2NTFB 3L5HA 3MBEC 3ME0A 4M7LT 1IGJB 3S36L 1RUKH 5DT1L 3QPQD 3VGDA 5CMAA 3MR9B 4KI5F 2OTWB 2Q8BL 4KK9D 5TDOA 2ZUUA 1E4WH 5BRZB 1S7XB 4QHNA 5BVJB 1Q9KB 3DUHA 4K3EL 5F3BB 3KHQA 3VWKB 1KUMA 5DFTA 1SY6A 5IOPA 5ICZB 1C12B 2DQGL 5KZCD 4G6ML 3U79A 3LN5B 3OB8A 3VRLE 4FQLH 2NX5A 1HHJB 2BDNH 1XF3A 2WW8A 4PRPA 4OLXL 4NFCA 4KK8D 5CMAB 3RA7H 3T1WA 1PKOA 2NY6C 4IMLA 5TDOB 4LCWA 3O6FA 4HX1A 3TBVB 3TJEL 4WEBL 4HPYH 5IOPB 1ODAA 4NQDE 5I0DA 2J4WH 5HTSA 5I1GL 4P2QE 3S96A 2PTVA 5LVEA 5IQ7L 1S9YA 4HV8B 5FYLD 4M61A 4PRPB 1C7SA 5T3XH 5C7XL 3S8WA 4IIQC 4JN1L 4LCWB 3BN3B 3O6FB 4OZGF 5F44A 4ELMA 1BJ1J 4YXLH 5KG9A 2HRLA 2A6DB 1KSRA 4LARL 1NAML 2O5XH 3U0WL 5EU6D 3S96B 5F3HA 4LCIL 5FUZH 1KEGH 3L3IB 2YUXA 1S9YB 3LMJH 1PEWA 1T1YB 4M61B 2HRPH 3L1OH 4HUXA 2BVUA 3RNQA 4TTGA 1W0YT 2C4FU 1NGYA 4Y16D 3ULSB 3B5GA 4HXAH 1OAQH 4ELMB 4GBXD 4ZPTB 1OQOA 5KG9B 4QHKJ 3L5XL 1KENH 1ND0A 2YWZA 1AC6A 3G6JA 1WEJH 4JFOA 1XCQA 5F3HB 1F4XL 4U0RB 4M1CD 1JMZA 1ZT4A 4HUXB 2ZCHL 3TO4A 3FQXA 4P2OD 3HMXA 3LS5L 1NGYB 5E6IA 3GMOA 4F3FB 5GGQL 1S7UA 3BKYH 1V7NH 3GKWL 1TQBC 1D9KC 3MNZA 4OIAA 4QEGA 1E0OB 1F6FB 3ARVA 5ILTH 3SE9L 4HZLA 4DN3H 4TQEH 1RIHL 2D7TH 3QCVL 5K33A 1ND0B 1U9KA 3G6JB 2B1HL 4JFOB 2VZOA 4PJ7F 3AREC 1XCQB 3HI5H 4XPFL 2VE6A 3GO1L 1VENA 3N9GL 5HYEA 1ZT4B 4YDKH 4PB9H 4MCYB 3FQXB 3TO4B 3VGAB 5I1HH 4OCYH 2BNRE 2NY3C 5E6IB 3GMOB 5F7EH 2F5AL 1S7UB 4RAHA 2IANA 3WCYA 5HDQL 4NQCD 4C57C 1IM9D 3IFNL 4HZLB 5LJYH 4QY8A 3AC0A 4YHLH 3LKSA 2EDLA 5IFJB 2XWBA 4Z95H 5DLML 5D2NB 1I9RL 2VE6B 5E7FA 3HNVH 1R3LA 5GRXG 3AU1A 4ETYA 4L8CA 3MBEB 1DBKH 1ZLUK 5BS0D 3GGWA 4PJAA 1INDL 4ELKB 2IANB 4YHOL 5KSUA 2BC4B 4QY8B 1JPGA 3BGFC 2DQHH 5F9DC 3LKSB 1MIEH 2HJFA 5T1KD 5CKGA 2XWBB 4S2SA 2NCMA 4RMTA 4GSDL 2EYSA 1U93A 4Y4HD 2ARJQ 5ALCL 5JUEH 3MRKA 2XY2A 1R3LB 2ZUXA 1MF2H 5C8JA 3AU1B 1V3KA 4L8CB 3HC4L 4M8VA 3GGWB 4PJAB 4PB0H 2X89A 1I7ZA 5J56B 4DUVA 4HCRH 1KNOA 5KSUB 1FZJA 2XV6B 2AJSH 2NY6B 2I07A 2VERN 1JPGB 4PS4H 4TUKL 4PUBH 2HJFB 1BREA 2V2WA 2NR6C 3BN9D 5I9QB 4P3DB 4S2SB 4OTXL 4XPTL 3TNMA 1U93B 1JTTA 5J06A 3MRKB 5I18H 5C8JB 2QTEA 3BMVA 3FO0L 4IS6B 3C87A 4JKPH 1I7ZB 1C1EL 1AIFA 2QHLA 3PDOA 5EC2A 4URTB 1KNOB 3B9EA 4W4OC 1T0NA 2XA8L 4BFEA 1FZJB 4IEFB 2I07B 1A5FH 3QXWA 5C07A 4XNMA 4UB0L 3KG5A 1PYWA 3S3JA 1S7SA 1ULVA 3SO3C 2VXTL 1MY5A 5HDBE 2ZSWA 4EEEA 3CAFA 4RFNB 4XAKE 3TNMB 2DWEA 2RIKA 5AYQA 3R4DA 1MAML 5IV2A 3FO1A 2X4TA 4YBQC 5HI3C 4A2LA 4JJ5A 1KYOK 3IXTB 2GYSA 2DKUA 4N68A 1N0LA 5IB2A 3L6FB 2AVGA 5BMFH 4JHBA 3X3GL 1AIFB 3PDOB 1T0NB 1A4KA 1BD2A 3TLRA 3F65A 3N0PB 1MPAH 1P69B 4XNMB 1SY6L 5EWIL 4WY7H 5EORH 1P4IL 5ALBH 1S7SB 1NBZA 4DKEL 4RAUA 1FYHB 2ZSWB 3I75A 4NC1C 2DWEB 3F5WB 5C0CE 4EI5C 4X8XA 5IV2B 3OR7A 3FO1B 1RJYA 3QB7C 2X4TB 2I24N 4JJ5B 3AREA 4Z7NE 2AEQH 4Z0BL 5DEZA 1IT9H 5C92A 1ES0A 1T1ZA 2F74A 3WFZA 2E9WA 5IB2B 4G6FB 1S9WA 1WTGT 3FMGH 3STBA 1A4KB 3KPRD 1FFPA 4NOFA 3VFNA 1DANT 1A14H 3UEZA 3RZCA 3HE7A 1NBZB 3VFUA 4L3CA 3O41A 4RAUB 3G9AB 1KN2H 5I8CA 3OR7B 4PJBB 1RJYB 1JNNL 1X5HA 2ZCLL 3O9WD 1KULA 3AREB 1FC2D 2BNUA 1LO5A 3TIEA 1CL7H 1ES0B 1T1ZB 2F74B 5DHVA 3SDAD 3P11L 1S9WB 4WI5A 3RL2A 4CVXA 3TA3A 1QUNA 1FFPB 4E41A 4BQ9A 4GRMA 3VFNB 5IFAL 2NY3B 3UCRA 4OZFH 1AY1H 3LEXA 5LBSH 3RZCB 3TV3H 3HCVA 3HE7B 4POZD 3VFUB 4L3CB 4HUVA 3O41B 1YJDC 5I8CB 2YN3A 1P6FA 1ADQH 4DK3A 5C0RH 2NY2B 4AIOA 4YDIH 2BNUB 1LO5B 3TIEB 4ELMF 4OLVH 1XGTA 5DHVB 1IAIL 5KVEH 3MLYL 1FNSH 2B39A 4FFYH 3VCLA 3RL2B 3TA3B 1WAAE 1T66D 4E41B 1I3RA 3KPLA 5AAMA 2JIXD 3LEXB 3HCVB 3QWQB 2YSSA 5E9DD 4HUVB 5A3ID 2GJ6D 5KSAD 3BGFB 1WZKA 2D0FA 1YYMH 5EUOA 5M95B 1EO7A 1XGTB 3PQYA 3HMXL 4FTVD 2J3SA 4PLJC 5EZIH 4F2MA 4TOYL 2IAMD 1KCUL 5CGMA 3G6JF 2J5LC 1FIGH 1I3RB 3KPLB 2Z8WC 1MHCB 4KTDH 4GRWB 4ZFGL 4Z9KB 2YSSB 3QUYA 5J3HC 5I1CH 3BWUC 3G6DH 4NJAH 1RVFH 2P7TA 5EUOB 3OR6A 5H35B 2DI9A 3PQYB 1JK8A 3DGCR 4F2MB 3DBXA 1WK0A 4NCDA 1LGVA 1F90L 4R0LC 1TTGA 4DGIL 4GG6E 3FAXA 1MJ8L 4Y5XC 5DHXB 3ULUE 4DUWA 3QUYB 1OGTA 3ZKNC 4DKAA 1M7DA 1ZKAA 1BECA 2P7TB 1ZLVK 1RUQH 3FZUD 3OR6B 1RZFH 3TCLA 1RZKH 4OI9A 2D03L 3DBXB 3EJJX 4C56A 5SX5H 1N6QL 4EN3A 5D7IA 5GQBA 5MEND 2R4SH 4M48H 3VXNA 5HXMA 1SEBB 4NWTL 2Y7QA 4XHQA 5E2TH 5JHLL 1W72H 5AZEL 5ACMA 3ZYZA 4YXHL 1PG7W 1W0WA 3V4VL 1M7DB 5TE7L 1TZGH 3IS0X 4R4NC 5HD8C 2FHBA 4GUPA 4PJAF 3BUTA 4LKXA 3T2QA 3MREA 3TCLB 5ICXA 2NMSA 4UIKH 1RHHA 1QSEA 4C56B 1ORSA 3S35L 3H7BA 2YD9A 4HUWA 2ZUQC 4EN3B 3DX8A 5D71H 3VXNB 5CJBA 5FGRA 2Y7QB 4EUPH 4XNUH 3RU8H 1L7TL 3C2SA 4W4NA 2FIRT 3T04D 1S78C 4LKXB 5MHSE 4ZS7H 3MREB 5ICXB 5DVOA 1F42A 3O2VH 4WFEE 1RHHB 1QSEB 2VSDA 4HUWB 5GS0D 3O45A 2FIKA 4LQFL 1BMGA 3DX8B 5C71A 3ZYIA 1DQQA 4JQVC 3HRZA 5E5UB 3BD4A 1FO0H 4OD1L 3EZJB 1U58A 2N4IA 1K6QH 4HC1A 4N8VG 4JPKH 1QR4A 3QXUA 3FQNA 3DVGA 5EH1A 1XAUA 3DO7B 4LLYA 3VMPA 1J8KA 5CEYA 2ZP0T 3ZDYF 4KH2A 1U8JA 4RWYH 4PRNA 4P4RA 1G6RA 3OKKA 3LPGA 4JRYA 1KCSH 2FIKB 1FDLH 3IFLH 1YEEL 1DQQB 1FPTH 2XWJA 2B0SL 3HZKA 2FDBP 1EH9A 1VEMA 4NUGL 5C09A 3RP1A 1U58B 2CMRL 3C08L 1NKRA 4JREB 1JYXA 2HT2C 3DVGB 5LXGL 4L3EE 4U1GB 4LLYB 3H3KA 5FCUH 5CEYB 1ZA3A 3NCYP 1MI5A 1X5LA 1U8JB 4LSQL 4L1HA 1G6RB 3OKKB 4P4RB 5FFLA 2CO7B 2VR4A 2BHUA 4JRYB 1HNGA 4GXVH 1U6AL 3DXAD 2XWJB 3ARGC 5JW4N 4PJBF 4NGHL 2J5LB 1MH5A 4POUB 5C09B 1PDKA 2LAAA 4QRRA 2CDEB 3O6MH 4RAVA 2BY2A 3IDMA 1CFVH 5E8OB 5FYJD 5DD5L 5F89A 1ZA3B 4QCIA 1GHFL 4EIZC 4GAGL 3KPSE 4U1NA 2Y06L 2NXYD 4ENEC 2PYEE 2P43B 5DVNA 1MFEH 1RZ8B 1BLNB 4R0LB 3MOAL 1N2RA 4YC2B 4KPHH 4Y5XB 1MH5B 1SEQH 3A6BL 4NBXB 2DJSA 4FQQA 4QRRB 2FYYA 4HDIA 5F89B 3OGCA 3KYOA 3MCG1 2GK0A 1CGTA 4QCIB 3UBXA 4XVSH 3EZ8A 4U1NB 3VDAA 1Z0NA 2R69L 3JWDH 1HOCA 4XCCL 4Z7OE 5CEZH 2VDPH 5IB5A 1AR2A 2B7DT 4OB5H 5EZOL 8FABA 1A22B 3TT1L 1IZKA 4OQ1A 3FB8A 3KJ6L 5DDHA 1UZ6F 3ALXA 5JW4R 2EH7H 1KIRA 4E0RA 4M8QA 4FQQB 2FYYB 4HDIB 4ZO9A 3V79C 3KYOB 3ETBF 4WI2A 5ETUA 3RGVD 4OKVB 2DMBA 3UBXB 3STZA 1YEGH 2VKWA 4ZNEE 5IVOA 1OLLA 4J3TA 1HOCB 3ULVH 2CR6A 4GRWF 4JAMA 2VLKB 3EW3B 1H8SA 3HN3A 1AGEA 4NRYB 3W9EA 8FABB 5CEXA 3C8KB 4OV6F 1CGSL 3GMQA 2ZUQB 1NCTA 1R3IL 4K94C 4OCXL 5EUOF 3TZVA 5TDNA 4P9HC 1KIRB 4E0RB 4M93C 2AJYL 3FHQA 3QDGE 5ICYA 2FJFB 2VR9A 5F8RC 3QPQC 4Q0XH 5ETUB 2A6IA 3T3PE 4KK9C 3STZB 1Q9OB 1CU4L 3QQ9D 3VH8A 1BFOA 5D7LD 1ZGLM 5L9DH 4JAMB 1FL3A 3WEXA 1W0VA 1AGEB 4ZOBA 1CT8A 5CEXB 3ALPA 3WFBL 5BO1L 3RX5A 1JV5A 1I3VA 2AW2A 4UQ2A 3TZVB 5TDNB 1TJIL 3T0BA 2IWGA 3CX5K 5ICYB 3MXWL 4K2UH 5F6IC 2J12B 4KK8C 5IEKA 2A6IB 1G9MH 2XN9D 1YEJL 3VH8B 1BFOB 1CDCA 2BVYA 4O9HL 4I3RH 3OG4B 2R0WL 5C0BE 2EZ0C 1FL3B 3WEXB 4I4WA 5B39A 1S5IL 3PUCA 2Q8AL 2X4NA 5KSVA 2Y07L 1W0VB 2X09A 4X6CA 1HHGA 1VGEH 2A73A 3BDXA 4DVBA 1IAKA 1KBGL 1CXLA 5HJ3B 1B9ZA 3QUMA 1JV5B 3BGMA 2VSCA 4UQ2B 4XMKL 5I0ZA 3J7HA 1J11A 5ANMA 5I8KL 5HI5D 3RI5K 5IEKB 4FQXA 1BVKA 4MX7B 1JGDA 5I16B 5D7IF 3T0WA 2B2XH 4I4WB 2X4NB 4O5LL 1QBLH 1RSFA 4X6CB 3LEVH 2A73B 3LEYH 3S9DB 4DVBB 1IAKB 4JO3L 3QUMB 4M1GH 3GSUA 1C8PA 5F1SA 3OAZH 3K1KC 2DQJL 1PKQE 4ZODA 4MXVE 4I2XA 4DW2L 4FQXB 1BVKB 3O3UN 1YY8A 1TMCB 3QNZB 5IHUH 1JGDB 1QR1A 3GMNA 4X7FC 4Y16C 5DGRA 1AFVH 3TBWB 4GBXC 5CS7A 2J7LA 5IVZB 3OJVC 4NQEA 2A83A 3VD9A 1NC4D 1FJ1B 3IKCB 4ZOEA 1QBML 1J8HE 4JG0L 3FRPG 3GSUB 3WO3B 5B3JF 1UJ3A 2DMCA 4UV7H 4HC1L 1MIMH 5IW6A 1QZ1A 5CSGA 2NW2B 4PJFE 4I2XB 4M1CC 3MRHA 1DFBH 1JNLL 4XXDA 5EIIA 3HPJB 1YY8B 4P2OC 3ESUF 5SWSE 3GNML 1X5ZA 5KVMC 5GRJH 3PHOA 1DLHA 4PJDE 3WKNA 3GMNB 5C0AE 1HQRA 4X5XA 3U82B 4AT6A 4J3WA 2EDWA 1F00I 3N85H 1G6RL 4FXKA 3NACL 1OAUH 2VLJB 4WUKL 3A0OA 1I75A 4IMKC 4NQEB 2A83B 3CMOH 4RA0C 1HH9A 1WZ1H 4O4YH 5I1KH 5I73C 2IALA 4P48A 1JPSH 5IW6B 4AZ8A 3MRHB 1QFHA 1UH3A 4IDJH 3M1BA 4XXDB 5EIIB 2DLIA 1PAMA 2XZQH 3FFCD 3PHOB 1DLHB 3P0YL 4H1LG 1HQRB 4X5XB 7FABL 4AT6B 4FXKB 2W60A 2BNQD 4LRIA 4EDXA 4X5WA 1NDMA 4P3CL 1TZIA 1YYLH 5DUML 2UYLA 1QFUL 1HH9B 3HG1D 1RUML 1BHGA 4DQOL 3C8HA 2DIBA 4PP2A 1YQ2A 1PEZA 4JRXA 2IALB 1AQKH 2NLJA 3KYKH 1HZHH 4OKDA 3SJVE 4YDVA 1BFVL 4LU5L 1BFTA 1CE1L 3GM8A 3M1BB 1HIMH 1MEXH 5E24E 4M93B 4R6UA 5I1AA 5MERA 4YE4L 2W60B 4WNQA 4WW2A 4EDXB 4X5WB 1LWRA 1N0XL 1NDMB 3EJYC 3S97C 1TZIB 1UKQA 2UWEA 2UYLB 2DM4A 3OXSA 4PP2B 1DE4A 4JRXB 3B2UD 3QG7H 2N1KA 2AJUL 3IVKB 2NY4D 3B9KD 4M5ZH 2J8OA 2C3WA 4YDVB 2KDGA 1AR1C 4Y4HC 5B22A 4JO2L 1EJOH 4TSBL 5DMIL 2PCPA 5I6XC 4HJJH 3R06B 3VXUD 4NZUL 4JFDE 4KGLA 5MERB 5I1AB 3RDTA 1ZANH 5DK2A 4WNQB 3B9AA 4WW2B 3WKMH 3HKFA 4PREA 1WJ3A 2UWEB 4KTEH 3OXSB 3HZYA 4JY5H 3BN9C 1ACZA 1BBJA 1VACB 5TF1H 3VXTA 5CINL 3GEWB 3GHBH 4Y2DA 2NW3A 1CGUA 2VZTA 2IQ9L 4JPIA 2RB8A 4MAUL 3BT2L 4Y4FC 4QF1A 1EHNA 1UM4L 4ONFH 1QFWL 5DK2B 1RK0A 4OLZL 1U8KA 1NUGA 1EEYA 4Z8FL 4L4VE 4PREB 4Y16A 1O7SA 3BO8A 5E70A 4LRNH 3BRFA 2EKSA 3PGFH 4GBXA 5FYKH 4WUUD 1BBJB 5C0EA 1UCBH 1CXIA 4XP9L 3VXTB 2FGWH 4Y2DB 2NW3B 4G42A 3C60C 4R26H 4GMTH 4JPIB 2RGSA 2ED8A 4WFGE 4QF1B 4X6BA 3LDBB 1CFTA 1RK0B 5SWZE 3VU2A 1U8KB 3ZHKA 4Y16B 4AQ1B 3BO8B 1DDHA 5D9SA 2EKSB 2WP3O 4GBXB 3ARSA 5C0EB 4IMKA 4L1DA 2ZCKH 3BDYL 5GISL 2HAZA 4ZO7A 4G42B 1FH5H 3SN6N 3QDJD 4PGEB 2A1WH 1KELL 5EU3A 1J0YA 3HUJE 1UM5L 3U30B 4X6BB 4K3HA 4GT7A 1RQ5A 2VXUL 4JHAH 5CZVH 5JDJA 5JLZA 5DR5H 1CFTB 1D5MA 1OCWL 1I85C 4HXBL 5GGRA 4FQJH 1MFDL 5DA0B 1A7OH 5GGVL 1DDHB 5D9SB 1IM9A 1A6WH 3QUML 3MRDA 1MCNA 2MNUA 4WGVB 4BZ1H 2ZJSH 2IQAA 4ZTPL 4G6JL 3P4MA 3O9WC 3NA4A 5HI4D 3FN0H 4OCRL 5HYQA 2OJEA 3ARPA 2HA1A 3SDAC 4AMKL 5E2VL 4X6CF 5GRUL 3C6SA 1D5MB 4TSCH 2GEEA 1MRFH 3OKLA 5F88A 1XR8A 5GGRB 3MLXH 4F7TB 3GIVB 4POZC 1IM9B 1IBGL 3T4AA 1I3GH 5HYSA 3MRDB 2IQAB 1P7HL 2Q76A 3QUKA 2QQLL 3P4MB 5T1KA 4JKKA 1A64A 5HYQB 4U1LA 2YOCA 4LFHG 5IHZA 3O4LD 4JM2D 4WI9A 3C6SB 1T66C 5F88B 3OKLB 2Z31D 1XR8B 2UVFA 4PJIE 5DJ2A 1YQVL 1GGTA 3U7WH 2FCBA 5BW7A 3DRTA 4K8RH 5A3IC 2L7JA 5KSAC 5FDYA 3QUKB 2CLZB 3EOTL 4K3JL 3GRWA 4F37F 2IMNA 5T1KB 1Q0XH 2FLBT 4DTGH 5C0ND 3BRDA 4U1LB 3BPOC 3H9YA 2WSKA 3WFEL 4Y4HB 5IHZB 2FJHA 4XC1L 2XY1A 4KDTC 1HSBA 1X4ZA 4FZEL 1N3NA 2IAMC 3OWEA 4YQXH 3CSYA 3OV6A 3VXRD 2VWEC 3MLVL 5AYUH 5DJ2B 4UTAL 2YA1A 4X9IA 3OKNA 2C26A 3MA9L 3DRTB 4WU5B 1NUFA 3C5SA 4M62L 1DUYA 4ZMAT 5MEQA 1RY7B 1AJ7L 4UT7L 2R29L 4HZAA 3SCMD 2YA2A 3LPWA 4P9ML 4WI8A 5GJTL 5CWSA 3RVUD 1MAKA 4ODHH 2CUHA 2FJHB 2OR8A 4TVPD 1HSBB 3ZYJA 4DCQA 2EXWD 4GG8A 3CSYB 4ZUUB 1QRND 3QI9D 4JO1L 2VDML 5C1MB 3IU4L 2WAHA 3MV7A 1AE6H 1OWWA 3OKNB 3TEUA 1EUUA 4OZIB 4KXZH 1WF5A 3C5SB 5MEQB 1DUYB 2A6KA 1YN7A 2JJTC 2P44B 4HAFA 4N1EA 4H20L 3UPRB 4YBHA 3O3AA 1OWRM 3FZUC 3HZMA 1QKZL 1I4FA 1K8IA 3ZT6A 3MPCA 3O4OC 2K7PA 3W0WE 1MLCA 2J6EH 5GZOD 3IYLW 2C3VA 4DCQB 4GG8B 3MLWH 3F7PC 1T7WA 2VUYA 5J1AA 2F54E 1QPXA 3EDEA 2PO6D 2C9AA 3KPRA 3L5IA 5GIRA 1GPOL 2A6KB 1YN7B 2MWCA 1EO8L 3K7UA 3DSNA 4HG4J 4TNWF 3UTPD 3HZMB 3ZE0F 1I4FB 1K8IB 1KCVL 1MJJA 2GSIB 1OD9A 4WW2F 3V6OE 4X80L 1H15A 4Y4KC 4IOIA 4L9LC 2C3VB 5FYLL 5ERWA 1CQYA 2AXHA 2H26A 3I3DA 3TBYA 2UWEF 3X11B 1HKLH 5E4IA 5J1AB 4RBPK 2IFGA 1IKNA 4XCEA 4X6DA 4MAYD 1IE5A 3ZTJH 3MXVL 3KPRB 5GIRB 4A6YB 1JI1A 3B6SB 3PJSA 2AK4A 3OJ2C 3LHPL 3GBML 1LO4L 3LOWA 1LEKA 4NNYA 4PJ7E 3HFML 1CF8L 3D18A 1MJJB 4WHTA 3DI2B 5DRXA 3V4PL 1H15B 4IOIB 4RISL 3O9WB 2H2SC 5ERWB 2H26B 1I1RA 3TBYB 5GS0C 2OL3H 2NYYD 3GSQB 3FRUA 4XCEB 4X6DB 1MCWW 2XFXB 4B7LA 4UI2A 2AK4B 1E28A 2BFVL 3IDYB 4KI1A 1IAOA 2JLLA 1R5VB 4YHKH 1LEKB 3EDDA 1CLZL 2CJUL 3RNKA 4NNYB 4X98A 4GKZB 5JTWA 3D18B 4O00A 3IDJA 4WHTB 2E27H 2QQKL 3CFEA 4I3SL 5DRXB 3QQ3A 3MRPA 2W0FA 3QQ4A 4L4TD 5I15L 1LO0H 4U6TA 4M6AA 4UV4H 5CUSH 5AZ2L 1RURH 4FTVA 3FRUB 1C5DA 2ESVA 4LVHB 4JFED 4KDTA 4J1UA 4UINL 1CZ8L 1YMMD 1JNHA 2ZKHH 3PWVA 1N26A 5DRNA 5INCA 1U95A 1SBBA 4DOHB 5TF0A 3BD3A 3VFRA 2P1YA 2P45B 1HWHB 5DGQA 5DUBA 3IDJB 5C0FA 3NABL 4YXKH 3JWOL 4O02L 3QQ3B 1FYTD 3MRPB 3S4SG 1KPUA 1DN0A 3DSFL 2W0FB 1EX0A 3MOBL 4M9PA 2W9DL 4XMLH 3ZT7A 5TJWK 3W2DL 4FTVB 1C5DB 2ESVB 2C7UA 2IH1B 1F3JA 3WFCH 2OCFD 3VXSD 1JNHB 1T7VA 3Q48A 5DRNB 43C9A 5INCB 5HHVH 1U95B 1JZ2A 1X5IA 1MREL 3R1GL 3PGDA 3VFRB 4H0IA 4ONHA 4APQD 5DUBB 3FQRA 2FBJL 3EYSL 2DOCA 1DN0B 1M1SA 5LCVH 1FIEA 3QHTC 4NN7C 2NXYC 2V6HA 4OZHB 3NGBB 2EKJA 3HZVB 4KKCD 2C7UB 5E2UL 3L5WA 2D7QA 4R4FL 4OI7A 1F3JB 3T0EA 1RPQA 3V2AR 5JDSA 4XXCC 2XTJE 1MFAL 5CD5C 3RIFF 4Y19D 5CILH 5DC0A 43C9B 5GS1A 3LD8B 5KVGL 1NCCL 2OTUA 4IRZH 5IKCB 3PGDB 4ONHB 4HUNB 3FQRB 5DWUH 1YEKH 1MUJA 2EEBA 1X5XA 1PX4A 1UKSA 3NBNA 4P2RD 4TPRL 3BE1H 4CAGA 1QSFD 3S7GA 5BRZE 4HCRA 3O4OB 2XXCB 3L5WB 2O26U 4B0MM 4YDLC 1Z9SA 4MNQE 3T0EB 2DLFH 5JDSB 2AEIT 2N7AA 4UT9L 1NFDA 3UJTL 4CADA 3H8NA 1CK0L 4QXGH 3ARUA 1FNFA 1QTYT 5MENB 3KGRA 5GS1B 2C3XA 1DCLA 1CXEA 3GRWL 4X9FA 2OTUB 2YKLH 3K0WA 3WFDL 3ZKXC 5D1ZD 1R5IB 4KJWC 1T21A 4CU6A 5D4QA 3RGVC 3EO9H 2OSLA 3OPZH 4PJ5E 3QIWD 3WJLA 1OARH 1UWXK 35C8H 5L2KA 3TIDA 2V9QA 3SE8H 1KEML 4L9LB 3MBXH 3VWJA 2UZYB 2YHGA 4NZJA 1NFDB 1XZ0B 3INUH 4X83A 4E9LA 5F7DA 4CADB 4F8TA 1EEUA 3BWAB 4JHWH 2KKQA 4JFHD 4LCUA 5KAQG 3QEUA 3FOLA 1T21B 2D7NA 2JELL 2P47B 3ARDD 2OSLB 2BERA 2FEEI 3QQ9C 5HVGB 4DGVH 5AD0A 1IZJA 2MKLC 4KJPC 3PIQA 4MVBD 2JB5H 5BXFB 3TIDB 4K55A 2I5YH 3SGEI 3RWFB 3VWJB 1K4DA 2Y36H 3EKCA 3LCYA 1NBVL 3NZ8B 5F7DB 1G6VK 3UTSD 4XVTH 5T3XE 4FQLL 1D5IL 1LO2L 2BDNL 4LCUB 1CFNA 3QEUB 1NFIB 2LABA 3BPNC 4RGNB 2D7PA 1ORQB 3IJYA 1MHPH 1NEUA 1NLBH 1XCTA 5E5RB 1Z3GL 3RA7L 2I60H 3HAEH 5CP3A 5AD0B 3S3PA 3QXDA 1P7KA 3LSOB 3LZFH 3PIQB 4QOKA 1JHKH 1BIHA 3V8CA 1T2QH 3BP5A 1K4DB 4HLZG 2A9NH 2C3HA 4HPYL 3LVEA 3TFKD 1QLFA 4RMVA 2VZ3A 4W6XB 5ENWA 5L0QC 5DJYA 4JG1H 4UIMA 3PDGA 5IR1B 5ITBH 3DXAA 5I71C 3WIHA 1CFNB 3Q1SH 5HI5C 3GSNH 1KC5H 2ADFL 3IJYB 3D9AL 1J1OH 5T3ZD 2YPLA 1XCTB 3G04A 4AG4L 4U1MA 5HHME 2FJGA 1NSNL 1ZV5A 1P7KB 5I2IA 3S5LG 3CH8A 3IJHB 1PZUB 3BP5B 2EIDA 3DUUA 3H0TA 4V2BA 2HKFH 5DEGA 1QLFB 5ENWB 5HGDA 5DJYB 4G8EA 2O5XL 4UIMB 3UJJH 3MRQA 3LKNB 1FGNH 3DXAB 1MCPH 2DTMH 4XXCA 2QEJA 1JGEA 3E6HA 4KAQL 5FO8A 1KOAA 3FB5A 2YPLB 3L1OL 5ISZE 2QHRH 3TVMA 4NFDA 3WO4C 4U1MB 3MV01 3T2NH 4X6DF 5C70A 5I2IB 5F7KC 4U6VH 4HXAL 1OAQL 3HC0A 4KROD 3QEGL 4MXQC 4WFHE 2O5ZH 3KYAA 1GGUA 2OBGA 5JOPE 3DUUB 4UT6H 4NN7B 2P24A 3H0TB 3MRRA 3NPSB 1W8NA 1L6ZA 4GLRI 5DEGB 1KENL 5HGDB 1S7VB 4G8EB 1WEJL 3MRQB 2HMID 5D2NE 1EV2E 1EEZA 1JGEB 3E6HB 5FO8B 3FB5B 3NA9H 5DD1L 5JOFA 3BKYL 3RGVA 1V7NL 2IANE 3HC0B 4OCWL 1P6AB 1V3JA 2JB6A 5DZNA 1BWWA 5E95B 5ILTL 3ARZA 2NY7H 2P24B 5FKPA 2DWDA 3MRRB 2D7TL 3IAGC 3F58H 1I8MA 1GAFH 4YDLB 2H41A 2VJXA 4S1DD 1EEZB 3THML 4YDKL 3MODH 4PB9L 5I1HL 5H2BA 4OCYL 3ZKXB 5F7EL 2XZZA 4BYHA 5CJOH 3RGVB 1A8JH 2WP3T 3PE9A 4P5TA 5D7LA 1ZTXH 3V0WH 2DN7A 5FKPB 3U36A 2DWDB 4YHLL 3FQUA 5FHBH 5KW9L 1G84A 1QLEH 1I8MB 3WLWD 4Z95L 2A9MH 2YWYA 1FNAA 4YWGH 1MY7A 3HNVL 1J0JA 4LVEA 4ERSH 4LSUL 4KV5F 4CUCA 1DVFA 1NANH 4Q7DA 2XYCA 5DA4A 2IMMA 3WXVH 4ZXBD 5L7XL 1UM6H 4P5TB 5D7LB 4XP1L 3DVIA 3U36B 2DQHL 3RY6C 3WV0A 3FQUB 1MIEL 2VYRE 3LPFA 4ZDHA 2NY4C 1W72A 3V6BR 3QIUC 2BZDA 4D9RE 3WNLA 4JVUA 2HP4A 5IM7A 1MF2L 4YNYA 3OBAA 4RMQA 2H32H 3S88H 1DVFB 1LK2B 3PWPE 2CRYA 4RDQF 3BPNB 1RUPH 5F6HI 4PB0L 2DQCH 2F9BT 2GY7B 4HCRL 2DYPA 5BVPH 3MLRH 3G5VA 2AJSL 5FA4A 2OXGA 4PS4L 1XGQA 5GGUB 1YNKH 5J9PB 4ZDHB 3K2MC 1E6OH 3DYPA 3ZSSA 2IPUG 4U1SA 5EPMA 5F7WC 5IM7B 5L0QB 1CICC 2X1OA 5I18L 4JHZA 4NNXA 3BZEA 3RL1A 3LH2H 5I71B 2VO5A 4LSVH 5EBLA 1P2CA 4JKPL 3TWCL 1I3UA 1NFDF 1OSPH 1RJCA 2DYPB 1EK3A 3U2SA 4NSKA 4PTUA 3G5VB 5K9JH 5FA4B 1TVBA 3OAUH 4AENA 5F7UA 1XGQB 3ZE1F 5GS2H 2IPTL 2KZWA 3F6LA 4AEFA 1FO0A 1PSKH 4NT6A 2D0HA 4ZYKA 4U1SB 4PJBE 5EPMB 4LGPB 4XCNB 1J0KA 4GRLD 2XRAH 2R2EA 3CFCL 3BZEB 3RL1B 1J88A 2G5BA 5DQJA 3W11D 5DRZA 5EBLB 5BMFL 1P2CB 3QEHB 4ODXA 3U2SB 1FAIH 3WO4B 4NSKB 1F58H 4PTUB 43CAB 4N0UA 1IC5L 4JY4B 3VFWA 1TVBB 4AENB 4TNVF 3BRGC 4ZS6D 4WY7L 5EORL 2DM3A 5TDPA 5ALBL 5IQ9A 2R9HD 1FO0B 1S7RA 1JRHI 2OXHA 4NT6B 1INEH 4ZYKB 1OY3B 1BEYH 5TQ2H 1GYAA 2AEQL 3UDWA 1NMBL 2GK2A 1IT9L 5DRZB 5EOQL 1ZS8A 4RMUA 3FMGL 1A21A 1FG2A 4ODXB 3W5MA 3FFCA 2DM7A 4G6AD 4R2GD 4N0UB 3VFWB 3DIFA 5HHOE 2BNQA 1A14L 2EH8L 5TDPB 4X7EC 4KI5D 1S7RB 1KN2L 1ZWIB 5D7JD 2IGFH 3WIHL 3OX8A 3O6LH 3S98A 3TO2B 5D93C 1CGVA 1CL7L 4J3XA 3MACH 4UZGA 2QV2A 2BXYA 4D0CA 1OAZL 1ZS8B 4LDOB 2VLRD 1FG2B 4CGTA 3FFCB 2ITDA 3KHOA 5DMKA 1LDSA 3DIFB 2BNQB 5CSBA 4KDWA 1KT2A 2EIEA 4H8WC 2HYMA 3NH7H 4UQ3B 5KANG 4LSRH 5EA0H 4O58H 1Z9LA 1T04B 2R0KH 3OX8B 3WJJC 5C0RL 4Z6AT 1K3IA 3B9KA 5EUOE 4RGMC 4NJ9L 4OLVL 1OOAA 4JVWA 3PQYE 4P99A 2YPKA 2Q1EA 4JM2C 4D0CB 4OGYH 1I7TA 2P5EE 2FATH 2AJZA 1IRAY 4H88L 3O8XD 1FNSL 5KVEL 4LGSB 1X6LA 4TSAH 2Z31C 3PL6A 5FM5M 3VXUA 4NHUA 1NGQL 2ITDB 4OM1H 3WDHA 2F19H 3VDCA 1BIIA 1IL1B 4YH6A 5A2FA 5CD3A 1KT2B 1E27B 2CXGA 3DYMA 3VXPA 1T0MA 2Y5TA 2DQTL 4NZTH 2NY1D 1DP0A 1KJ2H 1LP9E 5I1JH 2XTLA 4WDIA 2NY4B 3B9KB 3JVGC 2CSPA 4R97C 5C0NC 5IFHL 5DURD 1GZPA 2UUDK 2YPKB 3WS3A 1I7TB 5EZIL 4AQOA 2AJZB 1A7BA 2IH3A 1EXUA 4KJQD 3PL6B 3VXUB 3HPLA 1EVUA 4NHUB 3WNNA 3CH1A 5CD3B 2HFGH 4LLWA 3SDDD 1N6VA 4K23L 3VXPB 1T0MB 2Y5TB 5I1CL 3RUGB 5F7HA 1Y6MR 2BVOA 3G6DL 4NO0A 3B9DA 5IGXH 3SCMC 4NJAL 4UNVA 2WZPD 4FQIH 4WUUA 5ACZA 3RFZC 4WDIB 1NL0H 3RVUC 3MZGB 4FZ8H 2HKHH 1GZPB 4NC1E 5EOTA 4OGAD 4KQ3H 2EXWC 5JXED 1MWAA 5HYIA 3HPLB 2ICWI 3SO5A 2AABL 3CH1B 2KQNA 3JSSA 2COQA 5I1IH 4LLWB 1QYGL 2MCPH 4HLZH 4P5MA 3FT4A 2BVOB 2MMXA 4OCNC 4F37K 4WUUB 5ACZB 2FX9H 4BUHA 5AG9A 1RUQL 5DD0H 1YA5A 1RZFL 5EOTB 1RZKL 1B0RA 4AEHH 3QDJA 4X4MA 4MXWL 1MWAB 3LIZL 1K2DA 1DBMH 1UFUA 3BP7A 4K71B 5FGSA 3TT3L 4YO0A 2PO6C 1CD1A 4LAQL 4UOW0 3L3OA 5D96C 4P5MB 1W72L 3FT4B 3GSWB 4I0KA 4YGVA 4ZO8A 3T8XA 1VHPA 1X44A 3GI8H 1TZGL 1LE9A 2X4PA 3BSZL 4U7SA