1L7TH

Crystal structure analysis of the anti-testosterone fab fragment
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
220
structure length
220
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFTFSRYALSWVRQTADKRLEWVASIVSGGNTYYSGSVKGRFTISRDIARNILYLQMSSLRSEDTAMYYCARAYYGYVGLVHWGQGTLVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords anti-testosterone (light chain)
publication title Crystal Structure of an in Vitro Affinity- and Specificity-matured Anti-testosterone Fab in Complex with Testosterone. IMPROVED AFFINITY RESULTS FROM SMALL STRUCTURAL CHANGES WITHIN THE VARIABLE DOMAINS
pubmed doi rcsb
source organism Mus musculus
total genus 47
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2002-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l7tH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l7tH01
5ILTL 3GUTB 1BQLH 2ITCA 3DV6B 5CSBA 2WBJC 4ELMB 1U8OA 3IJYA 1YQVH 4R4FL 2WMPA 3G6DH 4YXHH 1DBJH 1YEFH 3BE1L 1KFAH 5SWSE 4HX1A 3MUJA 3O6ML 3SKUD 5B8CB 2VXSL 2X4NB 3ZE2F 2AV1A 4LHUD 2JIXD 2MCG1 2OYPA 5CWSA 4BQ6A 1MLCB 1AGCA 2BDNH 2OTPA 3G5VA 3G5XB 4Y5XC 3ROOA 5IQ7H 3MRJB 4NNPL 4KROC 4XP9L 1CE6B 4LCUB 4QHNA 4PJAB 4MB3A 2B7DT 3RPKA 4YHIA 5HYSG 3VFVA 2J8UA 2IAND 1QRKA 2PW1B 3NCEB 3RY5A 1JK8B 1BJ1H 3GIZH 2VITB 5SX4H 3ZE0E 1E0OB 5ALBH 1DUZB 5FO9A 5MI0C 4QRUA 2I9LA 5IBUB 1ZOXA 2CIKB 3FB7B 3MACH 4R3SB 5IVOA 1ZT7B 5I30L 2IBZY 6CGTA 2P5EA 2BCKA 2ADFH 3NTCL 5C07E 5C0DB 2XICA 3C09C 4PRPD 4ODVL 4ZUSA 4JHWL 2J5LC 4WUUB 1T5WA 1S7UA 3RY4A 4JFFB 3TBSA 3E8UL 5T1KA 3MV9E 4CADA 4K3JH 1JIBA 2NY2D 2O26U 3CCHA 1PKQE 3D2UB 1JL8A 2EEAA 2CLVA 3KYKL 4H5SB 4P3CL 3M07A 5B38G 2YD7A 5CIPH 4A6YL 4JKPH 4BUGA 4P23C 2H3NB 2R2EA 1QFOA 1LO3L 2BXYA 1FAKT 4IRSD 3EOAB 3MCKB 1RZGA 5HHPB 3G6JE 2R69H 4W4NA 1CL7L 1R3KA 1ZS8A 2CR6A 1BZQK 5FUZH 2B1HH 4N0UA 2IG2L 4JM4L 2FGZA 1NAKH 4KKLC 4PB9L 5DK3A 4X5XB 4OIIL 3PHQA 5CD5C 1HHIA 1IBGL 3VFNA 3WO4C 2BNQB 4ONGH 3BGFB 5EU7E 2XG4A 4AEHH 4ZFOA 3MBEC 3MOAH 1KG0B 2VDPH 3SDAA 3LZFL 1ETZB 4LSPL 1ES0A 1S5IH 1P6AB 4MA8L 3O9WB 2PW2A 3RWFA 2IANE 1RJZB 3CC5A 4S1QL 1U8PB 5F7YC 3BKYL 1J11A 4LLQB 1A9BB 5EO9A 4ZSOE 4Z78B 3DO7A 4U1MA 3MLTA 2EEBA 3M17A 1YNLH 2OI9B 3CFJB 5TH2B 3GMPB 3V6OA 1P4BL 4WI5A 2CLZB 1KF9B 4BSWB 1AIFB 3RGVD 3BPNB 1UQSA 1R6VA 2E7MA 2OQJA 4MZ3A 4JZNB 3MRMB 4PRPE 2AV7A 2OL3A 3QI9D 1ZANH 4LCWB 1EJ6A 7CGTA 2K1MA 3BSZL 4DTGH 1V7NL 5FHBH 3GB7A 1FLRL 3CGTA 4NBXB 4P2OD 4QO1A 3P9LB 1ONQB 4G9DA 3VFWB 4JVWA 2NLJA 4YLQT 1XGYL 3NA9L 4HPOL 1MRDH 3QO1A 5B3NA 2BRRH 4CL7A 4PG2C 5CS7A 1SJVA 5FF6B 1L0YA 4X7SH 3S98A 2NYYD 5D6DA 5GGVH 3SDXF 2X70B 2NX5E 5T5FL 5FM4A 1TZHA 3STBA 3UJTL 2GI7A 4ELKB 2R0LH 2FHBA 5T1LD 2VUYA 2W60B 1MPAH 3QP3A 1IKFH 3HC0A 5LGHL 1GGCL 4J3SA 2NY3B 2EDJA 4ZXBC 3MOBH 1CQYA 1SHMA 2BVUA 4WDIB 2R1WA 1KB5H 4PGEB 4ONOA 5HDQH 3BUYA 4F58L 5J12B 1EX0A 5C0CE 4GBXA 4MD5B 3RX5A 4HIHA 3A6BH 3CMOH 3FO1A 4Z7WF 3CZJA 1GC1H 3I02B 3VXTA 2UYLB 1DLHB 4MB5A 3EHBC 1PFCA 3H2WA 3BT2H 4PRBB 3V0AC 4EUPG 1UJTA 5TPWL 3O41A 3GO1L 3BEVB 4IHOB 5C9JA 2H2PD 1ND0B 5IB2A 2W0PA 2WIIA 3D6GA 3CVHH 2FHFA 4ISVB 1IEBB 2EKSB 1K6QH 3RWGA 1H9VA 1RU9L 3BQUA 4MAUH 5E6IB 1KN4L 4G8GD 4NKDB 3L3OA 3TPUB 5I73C 2V9RA 3SEPA 5KJRL 3LQAL 4LARL 2R2BA 3FCTA 1RULL 2CLRB 2FB4H 4IOFC 3IXAB 4JKKA 3QIWB 3UEZA 3FFCB 3OKEB 2F8XC 2A9ML 3EZ8A 1OAYH 3K4ZA 2Y5TA 2QQLH 3WKMH 5I15H 3QH3B 5KW9H 2OCFD 1BIIB 1FZOA 4LCCA 4M62H 2Q20A 1O0VA 2DLTA 4DGIL 4DQOH 4PP2A 4LSQH 4MQXC 3ARGA 5CBAA 1BFVL 1X44A 3ARBD 1I9IL 4QHMA 4RIRB 1DUYB 4TVPH 1QPXA 2O5ZH 4ONHB 2OMNA 2BNUB 2R23B 4PJIE 2VC2H 3Q1SL 1BZ7A 1JPSL 5GRVK 3HI5L 2Y07L 4PGBA 1TJGH 4KQ3L 3FO2A 1M6OB 3ETBF 1AXTL 1J88A 1C5BL 4CN6A 4QNPE 2XY1A 4JFEB 2CIIA 2VL5A 3QRGH 4PS4L 5L2JA 3S9DB 1KIRB 2VZUA 1Q0YH 3ULSA 1JPFB 3HC4H 5KSBF 3B83A 5D1QC 3P40A 4YAQB 4O2FA 4JG1L 4XBEL 4EDXB 3VW3H 5D7JA 4MX7B 4FQ1L 3HFMH 3QQ9D 4YDLB 2V2WA 3MNWA 1AKJB 5CINL 2EH8L 1DQQA 1E4XI 4Z8FH 4GRWE 4GG8B 1RMFH 1QSVA 3FQWA 4MJ5A 5J6GA 3OGCB 5HI4C 1A4KA 4Y2DC 5I8CB 2BJML 3ULVH 2X4QB 3FQUA 4OV6F 1YMHA 3ULVD 4X6DA 3I6GB 4DK6A 1DLFL 5JQHC 4G8GE 3LB6C 3ZHLA 1J10A 3E6HA 3C60D 5FGRA 1HILA 3GJFA 1OB1A 4JRYA 1SBBA 2E7HA 2JJSC 3DETC 3C8DA 4XX1G 4NZDA 1TETH 4HKBB 1D3CA 3AXLB 4MDIA 4BK5A 5IQ9A 4H88H 5A43C 3P9WB 1J1XH 3BDBA 3ZYOA 2LU4A 3VMOA 2RQ8A 4HEPG 4GMSL 4NZRL 4NJAH 4I0PB 5IMKA 3VFRB 2E8YA 1AO7A 1LDPL 4ERSL 2EIZA 2P45B 5IFJA 3ES6B 4JPVL 4OGYL 1EEYB 2YD3A 4WW1B 2NW3A 2F19H 2Y06L 4HULB 1D5ZB 1MLBA 1KB9K 2F8OA 2GSIA 4M1GH 4ZAKC 1P2CB 1G6RH 1OAZH 3E6FB 5IP4A 3F12A 3QRFM 5J11C 3I3EA 2C3GA 4NQSB 4PJEB 3G6JF 5KS9B 4JGUA 1FZMA 1RK0A 4YPGA 3QUXB 2WW8A 3MRHB 4R96A 2C1OA 4XMPH 2AK4D 3EDDA 2Y6SD 3KWWA 4EUPB 3IDNA 3HC3H 1HKLL 1IQDA 1L0QA 4OGXH 1IVLA 4NQEB 2BNRD 3LRSA 4UQ2B 2IBBA 2XN9D 4KGLA 4UZGA 1F90H 4C57C 3MNZB 1F4YL 3BPCA 5GISH 5JO5A 1H5BB 2MPAH 3X12A 3DUUB 4HIJB 4RISH 4CMHB 2AEQH 1GGIH 4HJJH 1HWHB 2DTSA 2V9TA 3U6RA 2VH5L 1V7MH 3BRGC 2VR5A 2HFEA 1BFSA 1GAFL 4M6OL 3ROLB 4RMSA 4PGCB 4GAJL 5BV7B 2HKHL 2WUCH 4OZIA 5HJ3A 5TE7L 5F1NB 3QO0A 3RDTB 4KK9D 2WSKA 2YUVA 2B4CC 3RWDB 4KZDH 4JFZH 2VLKB 2E8ZA 3BIAX 5JPMA 5AD0B 4I3SH 2QBWA 4KKAC 2IF7A 3VXPA 3DMMD 1UH3A 2E9IA 1XGUB 3KYMA 3IDUA 2FYYB 3ARDB 2VZ3A 3MLRH 4ONFL 3UTZB 4NQDD 4YEFA 2ZUVA 3LEYL 3QHZL 5CKAA 5BOZG 2Q1EA 4KDWA 1T5XA 3TN0C 1BX2A 4UILL 3ULUH 5HPOA 3HR6A 1XGQA 3ULUD 1F4AA 5BXFA 3BRDA 4WIQA 1RUKH 5TGBA 3GKWH 1NSNH 4WNQA 5FIEA 5IF0A 4XPTH 3GK8H 5GS0H 3LIZH 1Q72H 4YHPA 4M43H 4PRHA 3CFCH 4U6VH 4F37K 4N0FB 3OAZK 3L3HB 1JNLH 1C16B 1IL1B 1LNUA 5KVEH 2F74A 3MRCB 43CAB 1U8QA 2BNRE 3VXSB 3QHTC 1BQLL 2GT9A 2H32H 4KUCD 1YY8B 3BIBX 4NQXB 1IEAA 1ZAGA 1AGDA 3L5JA 3T65A 1WZMA 2KKQA 4H20H 3WNKA 4Y1AE 4YXHL 3T3PE 3B9KC 4PLOB 5C0JA 2VL4A 4X7EC 1C7SA 4I48B 2HLAB 43C9B 2GAZB 2BVYA 4XWGL 3LKRA 3TZVD 3OJDA 1DQDL 3H3KA 4ZTOH 2QHRL 5GPRA 3F6IA 3CFEB 4HIXH 4ODSL 4RFOH 3SDDA 4J8RB 5C0GA 3K3QA 3ZDYE 3BH8B 5E08L 1TFHA 4QRSB 3OAYK 3TNNA 3OR7A 2NQCA 5IHBA 5HGGS 5L88L 2OS7A 4GH7B 1ZHKA 1R5VA 5C8JA 4EIZC 5L2KA 1PZUB 4WGVB 4QXTA 1J1OL 1AJ7L 4HS8H 3T0EB 1N64L 5KVDH 4LKCA 5JDSB 2ADJB 4L9LC 4HCRL 1ZV5A 4PBVC 1CGUA 1S3KL 1F42A 3IJSA 4NQDE 4OF8A 3V4VL 4ZS7L 1A5FL 4XCEA 1T4KB 4OFYD 5L9DH 4MNHA 1NANH 5DZLA 4M8QA 1LDSA 3KG5A 3ARFA 3ULUE 4LVNB 2AXFB 2P24A 2QLVB 5JOPD 3D0LB 4P46B 1ZVSB 1QSED 3F62A 3VXRB 2V2TA 1H0DA 1QSFA 1T21B 1NAMB 4WTWA 4AT6A 4MMXC 4GO6B 5K9KA 1UH4A 3O4OC 2HT3C 3RTQC 3HTLX 4XCFL 3IJHA 1FYTD 5IKCB 1HEZB 4PJ5B 4GRLB 1WZ1L 5B39B 5FUCC 2R2CA 3K74B 4I0KA 1XF5B 4U7KA 5B22A 4PY8J 4MZ2A 6FABH 5FO8B 1CICB 1TTGA 1IAOA 5FUZL 3QUYC 2X4OA 4XNXL 5JIIA 4ZUWB 3X13B 3NFNA 1X4YA 2FEEL 3X3GH 2L0DA 4I4WA 5J1AB 3GSNH 5ADOL 4GRWF 5DJ2B 1AGEA 4RX4A 3NH7H 4AEHL 2VDNL 1GJIA 1IJ9A 1UZ8A 4F3FB 1RAMA 1LEKA 1MCNA 4OCWL 3BESR 1S5IL 2FR4A 4HG4K 3F5WA 3U4EB 5ISZB 4Z0BH 3WIHH 1CVSC 1DQML 2X7LB 1D7FA 4FG6C 3VFSA 1B0WA 4JY5H 4F7PA 3PWPB 2X09A 5T1MB 1IQWH 3SKNA 5DZOA 4O58L 3MGOA 3MV8B 1BWWA 4Y16A 3O9WC 4P59H 4WTZG 2ZCLL 4K55A 4LKXA 1UM6H 4AG4H 4OZHA 1A0QH 3NACH 5BCAA 5DD1L 3BD4A 3EO0A 5ENWA 3CU7A 4JZJC 1P9MA 3V6ZA 3PDDA 4N0CC 5DMGD 3LV3A 1S7SA 3TJHD 5I1IL 1CIUA 3D39A 3EOYG 3UZEA 1B0RB 1KLGB 1KCSL 5TE6H 1XFPA 3NZ8B 2R9HD 4S1RL 5KSAA 5I1JL 1FYTE 4G8FA 5F9OL 1D5MA 4EOWH 1KLUA 4XRCB 1BOYA 2WBWB 1CXLA 3NFPA 2AXHA 3MV7D 2NW2B 3SDXA 3QJHB 1LO5B 5D1ZD 2Y36L 1NKRA 5D7IE 4PB0H 3EFDL 5J0BA 1A4JA 1P84K 1IAKB 3WSQH 1P7QB 5I75C 1VESA 2LAGB 2YSSA 4YDKH 5FUOL 4GKOA 1FFNA 1YEIH 3DIFA 4P5TB 4QHLA 4RFNB 3QA3A 2DQFA 1QOKA 1BVZA 3IKCA 3LRGA 4F9LC 1S9YB 3F7VA 4WY7L 1A6AB 4YXKH 3SCMA 1F8TH 4YE4H 2WUBL 2YWZA 3QNZB 4MQ7A 5TDOB 1ZGLA 5CMAA 3ZYIA 4Y5VB 3P0YL 4Z7WA 4XP1L 4OM0H 2LVEA 4FQQA 4U05A 1YMMB 4NQVB 4IDJH 2X4PA 5J12C 2P7TA 3MJ9H 4PJCB 2PR4L 3ARWA 4GW4B 1BF2A 4E0RB 4QKXB 1MRCL 3PABA 2XWTB 4QWWC 5IW6B 5JW5B 4YX2L 4P4KA 5GGSA 4K8RD 5IBTH 4DFHA 1I85A 1UEMA 4OLEA 4HBCH 4J1UA 3UPCA 3SE3C 4XCYB 1UWGL 1U6AH 2KQNA 2FO1A 4D3CH 2GCYB 4TQEL 1Z0NA 5DDHB 5J1SC 4QEGA 3LH2H 5KW9L 4K3GA 4QRTA 1N5AA 4L3CB 1MI5B 4Y4KB 3S4SG 2XIDA 3HE6D 1WJ3A 1QLEH 3MV7E 5BS0B 2IMMA 5FGBA 1OW0C 3IDGA 1PLGL 1DE4B 4NM8L 4R4BB 3KXFD 4LSRH 3EJZC 3KPPB 1FGNL 2QADD 4C59B 4M5YL 4XNYL 3O8XD 2FECI 2ILLA 3LS4H 1A3LH 5DJ6B 5DC4B 3DX9A 4ZFFA 2E27H 3MJ8A 4YEEA 4AH2A 1UXWB 3PIQB 5D7KD 5HDBE 3P0VH 1RI8A 3U4AA 3TM6A 5KSBA 2WZPD 4ZOBA 3VWJC 3T3PF 5SWSA 4M6MH 1JPTH 5E8NB 4RFEB 1CFQB 3HPLA 1OP3K 1OPGH 3KLAB 3QUMH 5EDXA 2DIAA 3G5YB 2PO6C 4NN7B 3ZMRA 3ZDYF 5FA4A 1RMFL 1WGOA 2GFBB 4Q9RH 5FK9B 4AIOA 4WWKA 1JZ6A 3C5ZC 4BH7B 2Q6WA 3RIFK 4F37F 4FQHB 4FFYL 4R90L 2ZUQC 3LY6A 3BWUC 4GS7B 5IFAH 2AEWA 1Z5LB 4NP4H 1NPUA 4KVNL 3U46A 5GS2H 1QFPA 3RWCB 4I2XB 1KELH 2R15A 3TT1H 3ARVA 2W0FA 2Z31A 4PR5A 3W2DH 4J3OC 3FFDA 2GSGA 5JNYA 1PX4A 5C07A 4WUUD 1ZWIB 5EIQA 3GSRB 4EJ1C 4EI5B 3BDYL 2OR9L 3QWRD 3MV9A 3D2UD 2V5TA 2D31B 2XZQH 3KXFE 4Y5YB 3VD5A 4WI6A 1PKQA 4P57B 4W4OA 1JJUA 4ZPVB 4Z7OE 1NBYB 1DQJA 1T22A 3HZVB 1VKXB 2F19L 4JFQA 4ZOAA 3UAJD 1HK6A 5L6YL 1DL7H 2H8PB 4KUCF 4OD1L 3T4YA 5IOPB 4CMMB 3L3IA 2W59A 3MFGB 5D7KE 1BVLB 4L8DA 3T8XB 2BRQA 4DVRH 3G6JA 2BY2A 2CO7B 4U1NB 4XP6L 2A6JA 1PG7W 3QPXL 3LHPL 4LHUA 4JFPA 2Q87A 1HHHB 1M7DB 1DEEA 1QEWB 3HC3L 5JIKA 2BNQD 1LO0H 3ZKXC 2O61A 1N6VA 3TO4B 1AY1H 1KPUA 2FL5B 3FKUS 4RMWA 4WV1C 4NZTH 5J6HB 4KXZH 2OJZL 2H6PB 5GISL 4IMKC 3C8HA 2APXA 1E6OH 5MP6H 2VDLH 4S10A 5L0QB 2YK1H 2IANA 3BVNB 4K2UH 1BZ9A 5KG9A 3AC0A 4ZSOA 5H8DA 5SX5K 4HCRA 1I4FA 2BSTA 3V52H 4CMHC 5EZIH 5CJQH 3G5ZA 3O6LH 1E4KA 3LKPB 2AJ3B 3PF2A 4K07A 1VERA 5C09B 4LF3B 4WUUE 3LKOA 4MB4A 4PRPA 4JFFE 1A1OB 4FXKB 3PUCA 5FUCE 3W0WB 2X4SA 5JW4M 4V2CB 4HZLA 4U2ZA 1PVHA 5BJTB 4G9FB 5C0IA 4UT9L 3JVGA 5DI8A 5HGAA 4HKZA 3MLRL 4G43A 1UACH 5I1GH 3E3QC 4F15B 3U0WH 1T3FB 4M48L 4LIQH 4WEBL 3B2UC 3ULUL 3IFLL 4XNQB 5EO0A 2HFTA 4TRPL 3RP1A 1LEIA 4FQXA 4YZFE 2DM2A 5F7UA 3ARDC 3GSQA 3QIUB 2NX5A 5EU3A 3VJ6B 4IRSA 4YHYB 2PETA 4NQUA 5F3BB 1XR9B 4NC1E 2J6EH 4F2MA 1XZ0A 4NQCB 4AL8H 5D7IF 2NZ9D 3VFOA 4XVJH 2NY3D 4LLVA 1AHWB 3WEXB 3MXVL 1A7QH 3RU8H 5JHLL 3UDWC 5HI5C 1BFOB 4FFVC 1LHZA 5I19L 2BNQE 5E8EA 4YNYA 2G2RB 3TBYB 5J13B 4TSAL 2J4WL 2HVJA 3OKDA 4WEUD 2HT4C 4D0CB 5F1IB 2PTTB 1GRWA 3T09A 2X6MA 5EWIL 5C0CA 1JF1B 3DJ9A 1CR9H 5CP7A 3AROA 4L4TB 1FVDB 3TEUA 4U31A 3RJQB 5HYQA 2RCSL 1RK1A 5FO7A 3PP3H 3L3KA 5I1KH 3EYVB 4WO4C 5K9JL 1A6TA 3L9RB 2BHYA 1J0IA 4Z9KB 3L5WB 2FWOA 2MQCA 1T1YB 2ZOLA 3OF6A 1RFDH 4CVWA 4PBWD 4M02A 2FJFA 4AEFA 5KSVB 2C3WA 5E6ID 5DJAB 4LCWE 2FBJH 4PV8B 3QI9A 4ZD3H 1AP2A 3QDAA 5HHVL 4FQIH 3KPMA 3DUHA 5CGTA 4C4KO 3NGBB 3QIWD 2HJKB 3FFCD 4JR9L 5A40E 5KVDL 4TUKH 4PJ8A 1G7PB 1P7KB 5DJCB 1CG9B 4F9PA 2DLEA 4MD4A 5HGDA 5F1OB 4XP5L 1ZA6B 1N2RB 4LCYA 3AB0C 4NCC2 5CP3H 1S9WA 2IMNA 5J3HD 5DD3L 4BM7A 3G6AB 3PV6A 25C8L 3RZCC 1PY9A 3BGAA 3UTQB 2DICA 1U3ZA 1T1XA 2LQRA 1RZ7H 1T89C 1G7QA 2I07A 3EUUA 4MQSB 4EEEA 4NKOA 1Q9WB 4PJIA 5T1LA 4M3JA 5J7CC 4LLUA 3SE4A 3GMQA 4HHAA 1C5CH 2QQNH 2BOCA 2CXGA 1BPVA 1QPPA 1JNHA 4JANA 5DO2D 4KDTC 1KJMA 2ADIB 4Y19B 4JFED 5CJXA 2QKIB 3QQ3B 3GSOB 1GZPB 5HDBF 1C1EL 4KK5C 1N6UA 4JFYB 2PYFA 4JO2L 5FYLH 5FYLD 1HI6A 1EBPA 3FO0H 1YEKL 4LQFL 1UB5B 2BMKA 3WIFA 1PQZB 3EYSH 1N3NA 2QTEA 1AKJD 4FQCH 5J9PB 3VCLA 3RWHA 3TIEA 3QQNA 1A7RH 4ZNEE 4Q6IA 5DQDH 2A83A 2X41A 2AJUH 5FKAB 1CICC 1QP1A 4KV5E 1YPZF 4CU7A 2A6DA 1S8DA 1WBZA 4G8GA 3T2NL 4X7TA 3PWJA 4TSBL 3QEQB 3FFCE 2E5EA 2IAMB 1PKOA 4XGZB 5IJVB 2FH6A 1OSZA 4EVNB 2Z8SA 4NO0B 2VDKL 4RGMB 1BBDL 4K94H 2OTWA 2PTVA 1VFMA 5EC1A 3RGHA 1KIPA 4I0PD 2ZCHL 3GMLA 5F7EH 1INEH 3UZQA 4L8SA 3ARBA 2LVCA 5FDWB 2OSLA 3FQRB 4Y7MA 2VO5A 1GPOL 3CX5K 3F7YA 5ACMA 3LSOA 2A6KA 4NO3B 4Z7OF 2CDGA 2NPLX 4YQXH 4J3TA 4MXQD 4LDLB 4Y5XA 4JFEE 1CWVA 2ZUUA 1L7TL 2HN7A 1VPOL 3W9DA 3QUXD 4MCZB 5BQ7A 5JUEH 5ICZA 4F8QA 1FZKA 3RVXC 1Y6NR 3VGDA 1U8MA 1YN6B 3V0VB 1F45A 4U33A 1DN2A 1E4JA 5DMJB 2EC9U 4NQED 1WFNA 1QLRB 3RUGB 5HGBA 1D5IL 1RZKC 1T7WA 1QLFB 1I9JL 3DVIA 2IH1A 5ID1A 4KVCH 5C92A 1QFWI 4FQPA 2ERJC 3LMJL 5TQ2L 1FG2B 5D7LB 1TJHH 3VGHA 1TVDA 4NJ9H 1AGBB 3H0TB 4OFVA 3VFPB 5I16B 3L3DA 2EYSB 3AU1B 2NXYB 5I66B 5C70A 5D70H 3C60A 4RFNC 1H3PL 4KAQL 1G9MC 4P49A 1FC1A 3VFUB 2R56H 4QXUH 3IGAA 5LWYL 2P8MB 3OAUL 4QRRB 3RDTD 5C86A 1MNUL 3Q3GB 1MHEA 3QFDB 1C12B 2VLKD 2Y4SA 4U1SB 3BH9A 2XPGA 4JN1L 4G6FB 5F89B 4LDEB 3ARDD 2VDOL 1XR8B 2R1YA 4K8RL 4TNWK 3ZKMC 5DRZA 1Y0LB 1DVFB 1YNKH 3UROR 4F7EA 4P5MB 5I1AB 3KHQA 3S36X 4YUEL 2OTUB 1WK0A 4UUJB 1PSKL 4NKIL 1FFOB 4LSVL 2EEDA 3N85H 5DJ0A 5GIRA 3HNVL 4K3EH 2YUWA 5KS9E 4KHTL 2Z8VC 5AUMA 3MRFB 5IBLD 3ZL4H 1KCVL 1Z9OA 2DQEH 2VAAA 3MBEA 1B4JL 4Y4FB 1E28B 4GOSA 2ZJSL 3MQIA 5A2FA 3O11A 1RURH 2X40A 1EHLL 4RMQA 1UYWH 4NQEE 3HAEH 4DKEL 3SBWA 3SOBL 2BNRA 3AREC 5DVMA 3OKMB 5E2WL 2RR3A 3A6CH 1HXYB 2BVPB 5IT2L 3DV4A 5I17B 1HOCB 5FM8A 1T80A 4LBEA 1OHQA 3OR6A 2GTWB 4KJWD 4Y1AA 1YEEL 2FX8H 4XT1C 1ED3B 3R0NA 3OXRB 1XGRA 2L7UA 1BEYH 2WAHA 2HJLA 3QXUA 2Z35A 1S9XB 1F3DJ 1NGPH 4QXGH 1G9EA 2GEEA 5JLZB 5D6CB 3O6FC 4HMEA 1IGJA 1JI1A 3Q6FB 3EDKA 4O9HH 1C08A 1XF4A 4MXWH 1YUHA 1ODAA 1A02N 3CUPB 3WNOA 3T0ED 5HHQB 1K2DA 3LD8C 2A2QT 2YMXH 2FGWH 4M61B 3DMMA 4AENB 2W9DH 2FZ3B 5FXCH 4XAWL 1JZ4A 1YYMH 3I6KB 4G6JL 1WLHA 2YOCA 1QSZA 4ODUB 2Y9RT 3E1F1 2FO4B 3ILQD 4NQDA 2C4XA 3WHXA 4UV4L 3TT1L 2XFXB 1ADQH 4N9GB 1XF2B 2FX9H 2ZNWA 4Z5RA 1LWRA 4JDVA 4D8PA 3X11B 5E0QA 5DT1H 4XBPB 3O45A 1L7IL 4ZXBA 1Q38A 4P46D 3NZHL 4M8VA 3VXRD 4X9GA 1IGFH 3L6FB 3DUSB 4QHUA 3Q48A 4XI5D 2AJZA 1NAMH 2JB5L 1ITBB 4TPRH 2C4FT 5C0ND 5DD5H 3QR2A 5EOQL 2BVOA 2KQMA 1B0GA 4Y89A 3VXSE 5LGJA 4U1KB 2DM7A 4JAMA 4MGXA 3ALXA 3MRPB 5IK3B 3QIBC 2MMXA 4GRLD 5SWQA 2CPCA 4EI5C 3ARTA 3BHBB 5IVXB 1WBYB 4MSWA 3RKDD 4CUCA 3RWJB 3TYGH 1DL7L 1JV5B 4N9OB 1CDGA 4Y5YC 5AZ2H 4QYOB 3VD7A 4WVRA 5E00A 4JFXB 3WHE1 3BRFA 3BX7C 2FATH 1IAIH 4GUPA 4XX1E 2VDQL 2APBA 3ZKQD 2Z91A 2WQRA 5BZWB 2CO6B 3K8MA 3TZVA 4X6EA 4X80L 3O2DL 3DRQB 4XNUL 5E4IA 4NZTL 3FTGB 4KV5F 4DGYH 4F33B 5ICXB 3FT4A 3SO3C 1EERB 2XA3A 3CJJA 4CW1B 5ETUA 3T0EE 5ISZD 1EZVY 3HE7B 2P8PA 1KCUL 2VWEC 3UTPD 1RZ8B 4UDTB 4Z0XB 3EJJX 3PWPD 3N50A 4DZBA 4JQIL 1IILE 4E9LA 3THMH 5DQ9B 1ZTXH 1NGZB 3ARXA 1RUQH 2ITDA 3MV8D 4RAVB 5KTEH 4OFYA 4UT7H 2HA1A 3MJ7A 4ODBD 3IFNH 4M6NH 4LEXH 1IAMA 5FCUL 3NIFE 4DVBB 1O5DT 4K9EL 3VXRE 4JPWL 2GYSA 3PGFH 1F2QA 4CKVX 5T3ZD 4U1IB 4WI9A 3RVXD 5EO1A 5CSZA 3IDIB 4KJYB 4DKFH 1JGUH 1CDCA 3L5XH 4Q0XH 4F7CA 1TLKA 1KJ2H 2G5BA 2ESVD 3NCCB 4EI6A 4PJ5E 4HUVA 1FYTA 1NGXB 3L7EA 3GBML 3VGAB 2BVQB 4HT1L 4L4VB 3GI8L 3EOBA 3LDBB 4LMQI 2VDML 2UY6A 2C1PA 1TCRB 3AAZB 4Y2DA 3V2AR 5D7IA 1YEJH 1P7QD 3KPOB 3VRIB 1CL7I 4P5TD 2DQJL 3RU8L 3ZT6A 4ODXB 3GMMB 1I1CA 2IPUK 4YHYC 2JJSA 1URLA 3GSWB 4EKXA 1K8DA 1U9KA 1MFNA 2O5YH 5KBNC 4HGWB 3DTXB 3UBXA 1VFAB 1QHPA 1N8ZB 3EYFA 2I9TB 5EA0L 1AHWC 2H45A 1G1YA 3BXNA 1OAXL 4HKJA 3SKMA 4OCYH 1UGNA 5J8OA 2J7LA 3PWPE 1G7JB 4KRNA 5JORB 3MNVA 1IM9D 4XAKD 3GNML 3MV8E 2PXYB 3REVB 1FNFA 3NIGF 4U3XA 3WS6C 5KANI 1S5HB 3SDCB 4B41A 3FQTB 1FNSH 2WWKT 3E2HB 1OTTC 3KPNB 3GZKA 1F3JB 4WCYL 2ATPB 2NMSA 3MLYL 5C9KA 1DDHA 1NMBL 1TJIH 1WTGT 1VADB 1WBXA 5CUSL 4GKNB 5DK0B 4ZTPL 2NY0C 5T3ZE 1F58H 2QJDA 4LEOB 1U42A 1BM3L 1E6JH 4K7FA 4KUZL 1JBJA 5DJ8A 4KQ4L 3UPAA 2DB8A 3S3JA 2DM4A 5FKPB 3MCLL 3C8KB 4PRDA 5JPNA 2ICWI 3TESA 4HPYH 4HC1L 2MFNA 1MI5D 4NN5C 4Y4KD 2PN5A 1HINL 3IVKA 3JV4B 4CGTA 5BS0D 1X5GA 1AD0B 1CLOH 4HIIA 3OAZH 4HXAL 4P2QB 4PUBL 2E6PA 3MV7A 3WFBH 2BHZA 2H9GA 2N7AA 1B2WL 5ID0A 1U91A 1DBKL 4G80B 1IGMH 1MWAH 5D1ZA 1EAPA 4AIZA 2QV2A 4XZUA 3IDYC 4LLYA 3FO9A 3VWKB 2PCPA 4LLMA 4MJ6A 3U9PL 4UU9B 1K4DA 5T3XE 4ZYKB 3KJ6H 3TCLA 2WLYA 3V7MA 4NFCA 2A73B 5IFHL 4ENED 3MLPA 1MHHA 1T20B 3WE6B 3D0VB 3HB3C 5CZVH 1NFDB 4KC3B 2JJTC 5GSVA 3P4MB 1SBSH 1SEQH 2YD2A 3TA3C 4FFZH 4QF1A 2EH7H 1YMME 3ECBA 3CSYA 3G9VA 5JXAL 1RZFL 3B9AA 3O2WH 2CGRH 3QUKB 4DW2H 1CVRA 3OAYH 5C08D 4PJCE 5HYFA 1IGCL 4RAHA 2BSSA 2ED9A 2IQ9H 3CX2A 1U92A 3LKSB 1G7IA 3RKPA 4BFGA 3BKCL 1IC4H 2DQGH 5CSGA 3TN0A 5IHZA 5LKNA 4HFWB 1OGTB 4CVZA 1A2YA 4HF5H 1JTPA 1UJ3A 3L7FA 4DZ8B 5T33H 4RNRB 5EOCL 3OJMB 5I1LA 1I1AB 3VXQB 4G8IB 4ODTL 1SQ2N 4JO3H 2BFVH 2HYMA 4HLZH 4PRIB 2CD0A 2LTQC 1D9KC 1KPVB 5EBLA 1KN2H 4RWYH 5IIEA 2DI8A 3DROB 4FA8A 1MI5E 1XCQB 1FSKB 4K71C 5DJXB 4XP4L 4U6YB 1SMOA 4EI5D 4JLRA 3WFCL 5BS0E 1GOGA 1NL0H 1RIUH 3HE6A 2EICA 4OGAD 3MGTB 3ESVF 1INEL 4LLDB 1JZ5A 2CRYA 3TYFA 1KCRH 4JY6B 5FOBA 1JPGB 3SGJA 4NRYA 2WWMC 4RGMC 1JFQH 5ICYA 4O4YL 4HUMB 4DJMA 2GTZB 4MA3B 3DV6A 2XZCH 1UENA 5ECJE 4Z7UB 5I1HL 2LAAA 3O3AB 4NDMB 4FQLL 3N1GC 5ALCL 2BZDA 5EN2A 5AZEL 3SPVB 4IMLA 1KC5L 1TQCB 5GGVY 5B8CA 2X4NA 4JDTL 3JWDC 5LG1A 4YBHA 4WRLA 2DF3A 3BYYA 4X9IA 3U83A 5CJOH 5H37H 3FRPG 3G5XA 3TO4D 1T1WB 3MRJA 3U79A 3KAAA 3TBWB 1F4WH 2ICWB 1CE6A 4MWFB 4M7LT 5MEQB 4GQ9L 1X5KA 3PNWA 3EKCA 5EZOL 4X9HA 4HKXB 1S78D 2PW1A 3DX8B 5I9QC 3C5JB 3DECA 4LSSH 1JK8A 2VXVL 2VITA 3NCYS 3JTTA 3WLWD 5BV7L 1RVFL 2XNAB 1DUZA 1IC5H 4I2XE 1UCBL 2CIKA 3FB7A 3NA4A 2RIKA 4R3SA 3PGCA 3U9UB 1K85A 3TH3T 1ZT7A 2E3VA 4HQQL 5ADPH 3MRNB 3UO1H 5C09D 3DURB 4JHAL 2XTJB 3RWIB 1BLNB 1MIEL 4XPGL 3NIFF 3V4UH 2CR3A 4WUUA 3W0WD 1U93B 4JFFA 4UQ3B 5MHSD 5J4MA 2FD6L 2WINB 4G9FD 3HUJB 1OM3L 5D8JL 4JN2B 1A64A 1X5ZA 4OLVL 4WHTB 3U1SL 3QWRA 3UX9B 3W39A 3D2UA 4YDVB 3L5IA 4M4PA 4HUUB 4QT5B 3GRWH 2YPVL 3QCVL 3TJEH 1A6PA 5EU6B 5HD8D 5TQ0L 5E8DL 3KLHC 1E4XL 1RZJC 4H1LB 2H3NA 1IFHH 3BN3B 3CK0L 3MOQA 1KBGH 1NCWL 3QEGH 4FNLL 3V8CA 3VD3A 3QIUD 4XMKL 2XZAH 3EOAA 3MRIB 3MCKA 2DQUL 5HHPA 4NQCD 4R0LB 5I76A 1MREL 1KNOA 4YR6B 3MBXL 4X5XA 5GJTL 2R0ZL 3P73B 1GOFA 1MCCA 3P2TA 4YHOL 2EDWA 3EO9H 3OKLB 2BNQA 1FIGH 3MLVH 4GKZA 1VGEH 3JV6A 3O2DA 1X7QB 3HZMB 1FGVL 1KG0A 4Y4FC 3T1FB 1ETZA 4XC1H 3FL7A 5E94B 1EGJA 3O9WA 3WN5B 1RJZA 4L4TD 4AM0B 4B50A 5H35B 1F4XL 1LO4L 1VB9A 1GCFA 3MLZL 4LLQA 1A9BA 2FX8L 2YN5A 4NRZB 4IBLT 4TTDD 3R8BB 4Z78A 1AQKL 3CFJA 5TH2A 2CDEB 3GMPA 2W65B 1U3JA 3V6OC 2CLZA 4O2CA 2DKMA 4BSWA 3DX6B 4IS6A 4UIMB 5C09E 1SJHB 1T6VN 2WBKA 4JZNA 5TDPB 4HSQA 3MRMA 1EUUA 2APVA 4LCWA 3W0WE 1FORL 5ITBL 3CFDA 3QDHA 5MHSE 1UM5H 4LOUC 2GUOB 4FZEL 4G9FE 1KYOK 4OCLC 1KOAA 5DFVC 1LE9B 4JE4B 3P9LA 4K23H 1ONQA 3G04B 3VFWA 1UCTA 1RJCA 3M8OH 5TE4H 4AK1A 2UZIL 5FF6A 3LN5B 3MODH 4KK6C 5E70A 4AMKH 3IAGC 5D6DC 2X70A 4EDWH 5DSCB 1J5OL 3L3GB 2NY5C 4ELKA 4NQCE 5D2NC 4XWOC 1CCZA 4KMLB 2W60A 3U36B 1NFIB 3LQZB 4YHNA 5C1MB 1ZHNB 3PDGA 1KCLA 3MXWH 4NCDA 4WDIA 5EUKB 5HYSA 3SGEH 4PGEA 3FT3B 1INDH 2Y23A 1Q9LA 2VLMD 3GBNL 1F6FB 1ZT4B 4MD5A 2OR7A 2SEBB 1G7HB 1HSAB 4U6HB 1CIDA 4DN3H 1F02I 3I02A 1QFWM 4L4TE 2UYLA 1DLHA 2EYTB 5DR5H 3KPRB 1OP3H 3CD4A 5I8OL 1IAIL 1JTTA 2NY7L 4PRBA 2G75B 2YD6A 3GIVB 1RIHL 4R2GC 4XPAH 1NDMB 2AXJA 4PJCF 5EU4B 1CGWA 4ZNEA 3SE3A 1NC2B 3BEVA 4IHOA 5T1DH 1GSMA 1ND0A 4CBPA 3NPZB 4LAQL 4ISVA 1JHKH 1IEBA 2HRPH 3BQUC 3TT3H 3VFGH 4NKDA 1M05A 3TPUA 1D6VH 3QEQD 1CFSA 2IAMD 1OY3B 2CLRA 5B38A 3IXAA 3FFCA 4LASH 4P3WA 5LQBL 3OKEA 4MS8C 4Z95L 3OXSB 1PGRB 1NLDH 2NY1C 3THML 2Z4QB 1FO0L 1TPXC 1WWBX 4HWBL 3QH3A 4YO0B 1YQ2A 5HI3D 4HC1A 5SX4I 2D03H 3ZHDA 1RIVL 4PV9B 3IFNL 4L3EB 3IU4H 3DWTA 2EXWC 2XZZA 5EBWB 1CD9B 3NFSH 1U8JB 4RIRA 1DUYA 4X6CF 2CKBL 1JGEB 2BNUA 2R23A 1OAQH 3BN9D 4G6AD 1UEYA 5T3ZL 4PJGB 3ILPB 2YC1A 5IJKA 2DKUA 1CGYA 3UYPA 4NC0B 2BOBB 1M6OA 1K8IB 1EMTH 2HH0H 4Y19E 1GH7A 1Z6JT 4G6MH 4WUKL 5GJSL 5INCB 5HDOA 4ZUUA 2UV3A 4JFEA 1KIRA 4CVUA 1JPFA 5BO1L 2VLME 1J0JA 4YFLI 3HNSH 4YAQA 5BVPL 4EDXA 2Z8WC 4UAOC 4M93B 1KTKE 2W9EL 5EULV 5AYQA 4P0DA 4MX7A 5D7JC 3R0MA 1GGBH 3I2CL 4LHQB 2IPKB 3WNPA 1AKJA 3L3JB 3ZZ1A 5T3XL 2NXZB 3LDBC 2FRGP 1H15B 4GG8A 2A0LC 1S7RB 3OGCA 5D7LD 2BHUA 1F3DH 3JUYA 4ODWB 1MF2L 2FEEI 1EJOL 1HYSD 3I6GA 5IB3B 4N5ED 1UM4H 2NXYD 5SX5H 2FNBA 5E6YA 1KTDB 3F6LA 3QFJB 3QEQE 4ZS6C 3OV6A 4N90E 4JFDB 4OCRL 5I6XC 3SE9L 5C6PB 1Q94B 4QRRD 4HKBA 3AXLA 2DL9A 1CXHA 1JGVL 2F5AH 3ARSA 3L1OH 3KJ4B 5B3JE 5EZJB 1PYWB 1KENH 4G6FD 3VE0B 1RUPL 1CT8B 4OQTL 3VFRA 2DBLH 3I50L 3B9EA 2EC8A 3V0WH 1OARH 2GITB 3ES6A 2X2YA 1DVFD 2DMKA 3ET9F 4Q74A 5TDNA 4OV5B 3D18B 1EEYA 4YHML 5AWNH 4RGNC 4WW1A 3ZDZF 1FPTL 3D85B 3MPCA 1D5ZA 5JQ6L 3JWOH 5L8JB 1P2CA 1AI1L 4NO2B 3E6FA 4RGOH 4UDUB 2ZG1A 4YDIH 3LKNA 4NQSA 3MR9B 3WIIH 4WV1A 4L4JA 4Y4FD 5DZNA 2V6HA 1MCQA 3VG9C 3QUXA 5I18L 3MRHA 4I8DA 3I85A 4EUPA 3VXOB 3HI1B 2HG5B 3RUGE 1Y6KR 2R0WL 4NQEA 4D94A 2EXYD 4JHBA 4UQ2A 4DUWA 1KULA 2LU3A 3S34H 3QNXA 3FQNB 3U7WH 4Z76B 3MNZA 1OF2B 5DD0H 3KJ6L 2G9HA 1H5BA 3DUUA 4JM2D 4OBRA 2ZZUT 3OJ2C 3QULA 1LD9B 3S36H 4EN3B 4CN4A 1F11B 3CNKA 2NTSP 1CYGA 3R1GH 1P4IH 2EDKA 4NKQB 3ROLA 1ERNA 2V7NA 4LU5H 1RJYA 3TV3H 4PGCA 4FQJH 3S88L 1LILA 4I3RL 1CZ8H 4QRRE 5F1NA 1D5XB 2NNAB 1XH3B 4QOKB 3HZYB 5B21A 5C71A 3RDTA 5C0EB 4XPBH 1TZIA 1Q9OB 3RWDA 2AJYH 5AD0A 1SY6L 4PJ7B 5CIPB 3FN9A 4P2YA 4TUOB 1XGUA 1VEOA 2FYYA 3ARDA 4PRAA 4LSUH 1FL3B 1T2QH 3WDHA 2WLZA 4JO3L 1U8HB 3EO1B 4R9HA 1MRFH 3QZWG 3O2VL 3TBTB 2AQ1A 3UDWA 2R8SH 3HKFA 1R0AL 1VFUA 1QR1B 3C6LB 5F8QC 1BWMA 3QDGA 3W9EB 3U0PB 4D9RD 4N0FA 4J4PD 3CVIL 4U0RB 3MO1B 3L3HA 1OAKH 1PAMA 1N4XL 3SE8H 5DHVH 3ZT5A 2LV4A 43CAA 1TMCB 1P69B 3VXSA 4UT6H 1I3UA 4Y4HB 3MV01 4FP8L 1FE8H 4WO4A 1YY8A 1XF3B 1Z3GL 4NQXA 2Z93B 3WHE0 2NR6C 3NABH 2PUQT 1MHCB 2MQ3A 4XVTL 3WD5L 2DYPA 4HFUH 3OL2A 2IADB 4I48A 4JRWA 4L8CB 1G7MB 4YHLL 1EBAA 1F2XK 3F65A 4OJFH 5CJOL 3ZDXF 1MJ7L 1WICA 1FL5B 3CFEA 4O00A 3SGKA 4J8RA 4MS8D 1F4WL 3BH8A 4OFKA 3PWUA 4HD9A 4QRSA 4MDJB 2BC4B 5ESVB 4PJ9C 4GFTB 3HE7D 3IFPB 1AR1D 4P2RB 3MYJB 3KLSA 3T0EA 1MELA 5JDSA 5AAWA 3O4LE 2XKNB 1T89A 1IC5L 1HZHH 3K46A 5ACZB 3UTTB 1YECL 1A7NH 5C0RL 1PG7H 5ADPL 2Z8RA 3ARFC 3CFIC 1LK2B 3MCG1 2H1PH 4KDTA 1TNMA 3D0LA 4P46A 1ZVSA 4D9LH 1CDIA 2J8OA 3VXRA 4NSKA 5GS1C 1NGQH 4P9HH 3CDGB 5EZLB 4D9RE 3PL6C 3QQ4B 4CJ1A 2QSVA 3TFKC 1KIQB 1T21A 1KB5B 5IHUH 4JREC 1FFPB 2W07A 4QTHA 3I3BA 5IVXE 5IKCA 3RVWC 1HEZA 1PD6A 4L4VD 4PJ5A 4GRLA 1SEBB 5B39A 1GHFH 2QQQA 3OG4B 1XF5A 3BD3A 2MCPL 2NY4C 1MCWM 4GG6E 5FO8A 2F53B 3FAXA 1CICA 1CGVA 1MCOL 3SKJH 1BGXL 4O51B 5CZKA 1X5YA 2MSPA 5IESL 5IMOB 3CVHB 4NFBA 3X13A 2EE9A 4UV7L 4ZS6D 5D96C 1FBIH 2AV1B 1A3RH 1A1NB 5J1AA 5LAXA 5ELIA 5CWSB 2Q7YB 5DJ2A 1AGCB 1YN7B 5DJYB 3O6KH 1TXKA 2VLLB 4FZ8H 1M1SA 1V3JA 1CK0L 3DVNB 4QHNB 1MCWW 1OP5H 3U4BH 5DMYA 1CFVL 5E1HB 3U4EA 4UTBL 9CGTA 1FDLL 2HTLC 3LQAC 5F9WC 3B5GA 2X7LA 5K9QG 4KRMB 3RBGA 1HH6A 1QTYT 1LK3L 1P6FA 5F7MC 4TSCL 2FBOJ 2VSCA 1Z0MA 3QZWB 2PXYD 1HIML 4KKBD 1LE5A 3SDCD 3TBVA 4DEPB 3GJFK 5MENB 1TVBB 1U3HB 1FO0A 2DLFL 3MV8A 4HWBA 1CLCA 3TPKA 2ZUTA 1QFUL 1M7IB 4Y16C 5B3JF 1HWGB 3MRQB 1FLTX 2YHGA 2C4FU 5GZOC 2CMRL 1ZE3C 2MOVA 1IZKA 3H42H 3JWNC 3P11L 4ZUSB 5D7SL 4BH8B 5K9QI 2CKBA 5BMFH 1ZLSL 1JNNH 1J1PH 2W91A 3TBSB 3WFZA 2HTKC 3N06B 3MLWH 4KK8C 1B0RA 1KLGA 3RHWF 5TE4L 1MFCH 2ZWLT 2YS4A 5FCSH 3NZ8A 2YKLL 3K2UH 4ODHL 1T04B 1U0QA 4PJXB 3MODL 5KVFH 4P2QD 2WNGA 4M7LH 5HVHC 1TVHB 2NW2A 4UBDD 1MCJA 2Q3AA 1LO5A 2EDTA 3F7RA 3MJGX 5DUPL 3D3VA 3VWKD 1PZ5A 3PWNB 1I3GL 1IAKA 4X8JB 1R3LB 3MLUL 4QRQA 4F7MB 4P5TA 5A2KH 2XA8H 4S1SH 2VXTL 3I3DA 3OBAA 1S9YA 5AYUL 2QQKL 4PLJD 2FIRT 4GXVH 4MD0B 3SCMC 3ZTJH 5F6IB 4Q9QL 5TDOA 5CJ5A 1KEML 1SM3H 3DSNA 3CZFB 4Y5VA 5I8KH 4X6BB 2DWEB 4RDQF 4WJ5B 3SDAB 4NCC1 3IDMB 3FB5B 3GHBH 4KKCC 4OI7A 1U8KB 1ZVYA 4RRPA 1YMMA 4NQVA 1BQSA 1WZKA 4M1DL 3CXDH 5EO9B 3DO7B 3MLTB 4PJCA 4NHCL 4GW4A 2Q8BH 4E0RA 2XWTA 2YZ1A 5DVNA 3CFBB 5IW6A 5JW5A 4OQTA 3EYUH 5SV3A 2OL3B 1I1AD 4E41A 1ZLWH 4M7ZC 3WUZA 4X8XA 1G6RB 4XTRC 3PWLA 3QCUH 4XCYA 2GCYA 3GMOB 5DDHA 4OCSL 4YHZH 1SJEB 4GJTB 4L3CA 1MI5A 4Y4KA 2D03L 3ARUA 1B88A 4P2QE 1YEGH 3BKJH 3Q6GL 3QEUA 5BS0A 2XN9B 2NR6D 1NANI 4L5FL 3D87B 1T7YA 4MA1C 4R4BA 3KPPA 3OB0H 4HAGA 3EZJB 3MRBB 4BZ1L 3MLXH 1LQSR 3UC0H 5DJ6A 4WW2B 4GLRH 5DMKB 1J9CT 3IAPA 3RAJL 5FYKD 1UXWA 2DTMH 3PIQA 4NT6A 4MLSA 4U1JB 5D1XB 1NFDE 1FNEB 4R4NC 3BWAB 5F6HI 4FABH 2XXMB 3T04D 3MUHL 1MAKA 3MC0A 3HNSL 1RHHB 5CCKH 5E8NA 5CGYC 2VNCA 4GBXB 4ZFZA 3FMGH 4RFEA 2BX5A 4HIHB 5IR1B 3KPLB 2DQCL 3KLAA 2YRZA 1RUAH 2CRIA 5D5MB 3F58H 5FYJD 1WZLA 3G5YA 4S1DD 4WTZA 1QYGH 5DLML 1U8LA 4OLUL 1HNFA 4E42B 4HK3J 1RD6A 4OLZH 2GFBA 1I7RB 5FK9A 3HR5B 1LO2L 1JWSB 4NPYB 4Q6YA 1JHLH 3CFKB 4WWKC 3UMTA 1J7VR 2IQAA 1SY6A 2WIIB 4FQHA 1RZIA 1IT9L 2GJ6B 1CD1B 2GK0B 2GY7B 4JY4B 1GVIA 3RWCA 4UB0H 3V5HB 4I2XA 2VQ1B 4PRIE 1VACB 3NAAL 4KMQA 3UJJH 2R2BB 4XPHH 2Z31C 2XTJD 1A7PH 3NPSC 4NN6C 5JXED 1CF8H 1SVCP 2VB5A 3GSRA 1IKNA 4FN0A 5KZCB 3QAZB 4EI5A 4X98A 2VTFA 2Y5EA 4O5LL 1S7TB 2D31A 5JR1L 4PP2B 2H32B 2JCCB 4Y5YA 2X42A 3PHSA 1MOEA 4P57A 4Z7NE 5EU6D 4OT1H 1VFBB 4W4OC 4ZPVA 4I0CC 2G5RA 4Y8AA 3N9GL 1NBYA 5HHMB 3AUVA 3HZVA 1W0WA 5IVXF 1VKXA 3QXWA 4N1EA 4WENB 2D9CA 1JNJA 4KY1H 4MA7L 5FYKE 4OD3L 5IOPA 3FO2B 4Z7UE 1QQDB 4S0SD 1BVLA 5D4QA 3EAKA 1AC6A 5DWUL 4PGDB 3T8XA 3LS5L 4GG6F 4U1NA 1WITA 1S7XB 3RVTD 5C6WH 1QBMH 1DBBL 1E27B 2C7UB 3C5SB 1M7DA 4AQ1B 4HWNA 1KACB 1QEWA 2HTLD 5DD6B 5TF1L 3TO4A 2FL5A 2IBGA 2FX7H 3FB6B 4PPTA 5FYJE 5J6HA 2ARJB 1MVUB 4LCIL 3DVFA 2H6PA 3VFTB 4OLYL 1CE1H 5DUML 4NZUH 1DQQB 2AABL 1R24B 1QKZL 4MJ5B 2C26A 4Z77B 3BVNA 3WDIA 4OUOA 3BPOC 4X6DB 4YWGH 1MY5A 2EDRA 2ZCKH 5DGRA 2YZ8A 1G9MH 3E6HB 4M7KH 1HILB 4PYGA 3GJFB 2HTKD 3MUGB 1FRGH 4BZ2L 4EBQH 5GHWL 3LKPA 1E4KC 2XTJE 2AJ3A 5E2VH 2RJMA 4IM8A 4LF3A 4NHUB 5EUOB 1TZGL 2D7TL 4JB9H 1XGPA 4O2EA 1A1OA 4R8WH 4FXKA 2I60L 4XC3L 3W0WA 3HUJE 2ZKHH 4M1CD 1ZVHA 2DDQL 5SWZE 5BJTA 2DLIA 2NY5L 2CKNA 3MRGB 3JVGC 4AEIH 5F93C 2NY2C 1AO7B 3PDOB 4YJZL 1U95A 5EU6E 1T3FA 3DLQR 4JRXA 4G7YH 1WCQA 1FVCB 2ORBH 3VGFA 5IMLB 1RHFA 5JA9A 1MHPH 1ZHLA 2NW3B 1NCDL 4XVSL 2BSRB 2EDNA 2Q8AH 5F3BA 1A6WL 3MREB 2WP3T 4NQCA 3HI6H 3GSNB 3FOLB 3JV0A 1AHWA 3P4NB 1ZSDB 3UXFA 3BP7B 4R96B 1BFOA 3R06B 1SYVA 4G3YH 1DBAL 2AKRB 2F58H 2G2RA 5C0BB 5A1AA 1WV7T 3WV0A 5FECB 4D0CA 4G5ZH 4MCYB 3TH4T 4J3UA 5ESAB 2PTTA 4HJ0D 3WS6A 1JN6B 5FEBA 1JF1A 5DEFB 3KPRD 1W0YT 3AS1A 4L4TA 1FVDA 3LVEA 5CEZD 1IE5A 3MA9L 1UWEH 4PGJA 2VN4A 1JWUA 4GSDL 3EYVA 1KJVA 1KEGH 1BAFL 1Q9KB 1QRNB 1DBMH 1NC2D 5LBSL 3L5WA 4LRIC 1T1YA 1NEZB 2UWEB 1IEHA 1F00I 3PP4H 4BSVB 5HJ3B 3RGVC 4OF7A 4GW5A 5KSVA 4EIGB 5DJAA 5IBUG 5GXBB 1X5JA 2XXCB 3QI9C 3Q5YA 3UJIL 5LCVL 4H25A 4HXBH 5CILL 1YYLL 1TCMA 4I18B 2HJKA 1X4ZA 4P2OC 2X4TB 3W11D 1G7PA 2LE9A 3UYRL 1P7KA 5DJCA 1CG9A 4H0IA 4KRPB 3BEWB 3A67H 5HHNB 4N1HB 2E7CA 1DSFH 3RVVD 4L3ED 5ERWB 1ZA6A 1N2RA 4HH8A 4LVHB 4J3VA 5C2BL 3C08H 5GGTA 1UXSB 4V1DB 2NYYC 5E4EC 2KUTA 5EIVA 3UTQA 5BXFB 2A77H 4R4ND 5TGBB 1MFEL 3OPZL 4P9HL 3HRZA 4MAYD 3GFUA 3X3FL 2VISB 2MHAB 5FA3B 1HHGB 3SQOL 4NOFA 2ADIA 4Y19A 3NOIA 1NCCH 3QQ3A 3GSOA 4CN1A 1GZPA 3C2AL 4OZIF 1U8QB 2DJUA 5CLWA 3C9NB 4JFYA 4TTGA 4M7JH 4YK4C 4DWHA 1A6VL 3WFDH 1CLZL 2VZTA 2E6JA 3KPRE 1AGDB 1NLBL 4KI5D 3D5OF 3RX7A 1PQZA 5I1CH 5CEZE 3STLB 1CDBA 1GC1C 2DQDH 2B2XL 5I74B 5J9PA 5C0JB 5ESQB 4XXDB 2P5WB 2H26B 1CXEA 2NXZD 1WFTA 5JIHA 2JELL 3I9GH 3V4PL 5HXMA 2VJXA 2ZUYA 1A3RL 1WFUA 4Q6IC 3VXUB 3OJDB 4BFEA 5FKAA 1NDGB 4R7DB 3WXWH 2X9WA 4DUXA 3SDDB 1N7ML 3BAEL 2H2PC 5C0GB 4HS3B 4OM1L 5E56A 2JB6B 1GZQB 3QFJD 2G60H 3TNNB 5EORH 4KXZI 3BFOA 3QEQA 2HKFL 3H3PH 4JFDD 4XPFH 2QR0B 1R5VB 2IAMA 4XGZA 5IJVA 2X1PA 2HT2D 1FL6B 4EVNA 4NO0A 4NUGH 5E5MB 1YY9D 3EGSB 3QSKB 3SJVB 4L3EE 4ZFGH 2ARWA 5TFSH 4UINH 1BQHB 4L8SC 3ARBC 4PJGE 3UYOD 1X5XA 5FDWA 1IGTB 1VDGA 3BMWA 1FH5H 3EFFB 1U3HC 5F9AC 1EV2E 2F5BL 1H3WM 4Z7NF 2V2TB 1CU4L 2DQHH 3D85D 1H0DB 4N8CH 4UIKL 4NO3A 2WWKO 4R97B 1NFKA 1A6UH 1OCWL 1ZHBA 3BGMB 2EDLA 4K3HA 5E8OB 3QUMB 2YUZA 4LPWA 3SGDI 1Q1JH 4X4ZA 1IGIH 3RIAF 1QD0A 4OSUL 1YN6A 3ALWA 3V0VA 2RHEA 4Z18A 4YHKL 1FAIL 5D72L 3GSVA 1HHJB 3B2VL 1QLRA 3RUGA 5LXGH 3VG0L 2V17L 4JO1H 3QQ9C 3V6FB 5MEPB 2PF6A 3ZHKA 4U6XA 1N5YL 2D7OA 3O0RH 4AZ8A 3HMXL 1L0XA 4GAFB 1EO8H 2AJXH 4EN3D 1FG2A 4JG0L 3MRRB 1BVKB 1AGBA 3H0TA 4KTDL 3VFPA 3QFJE 5I16A 1SM3L 1KV3A 3ULVC 4OLXH 4I1NB 3LCYA 5I66A 5KVGL 1LEKB 3K81A 4JFDE 4MXVF 2VAJA 3C60C 3E0GA 2FR4B 3VFUA 3F5WB 4QOKD 5I2IB 1KXQE 2EDBA 2P8MA 4QRRA 4F7PB 2O5XL 1GOHA 3Q3GA 4QCIB 3QFDA 1C12A 4U1SA 1PW3A 1AD9B 3ARPA 5L7XL 3LPGA 1MQKL 4NIKB 3DVGB 2YPKB 4FQ2H 2XKSA 5F89A 2ICWJ 3K8LA 3ARRA 1XR8A 4C56B 3O3UN 3EYUL 1NCNA 2W0LA 3HS0B 1I7ZA 1RUMH 2YXMA 4ZNCD 4J3WA 4P5MA 5I1AA 1S7SB 2OTUA 2VLJA 4UUJA 4UNTA 4DAGH 4YHZL 5FAAA 1FFOA 1JWMB 2X4UB 3C6LD 3U30B 4NKMA 4W6YB 2W1NA 2MNUA 5KAQG 1MFBH 3QHFH 3DARA 4R26L 1CLYL 3MRFA 4M9PA 5D71H 1A6ZB 1NCAH 3KR3L 3MROB 4Y4FA 2FJHB 3S5LG 1E28A 3MLSH 3WCYA 4XVUD 2Y6SC 4HW6A 4UOJA 3SBWC 4LVOC 4Y4HD 5HDLA 3OKMA 4NFDA 5FYKL 4PREB 1ZT1B 3RL1B 3UPRB 1HXYA 2BVPA 4UTAL 1I9RH 2X89D 3RNKB 1PEZA 5I17A 3HN3A 1HOCA 2PNDA 5F88B 4QHLB 1GYAA 1LP9B 2AK1H 5CJ8A 4TYUA 4FABL 3D9AL 4Y0GA 4IRZL 1KTLB 3NCJL 1ED3A 5CCKL 2GJJA 3OXRA 4OZHF 2VR9A 4GXUM 2OP4L 1XIWB 3UZVB 2DAVA 4Z7WB 2D0HA 4Z7QE 4OZFH 2DI9A 4OTXH 4QOKE 5F7DA 12E8L 1RJLB 5FYJL 4BA8A 5JLZA 5AAMA 4GMTL 1XAUA 5D6CA 5GRUH 2DM3A 3LEVH 1MIMH 1E4WH 4YBQD 3Q6FA 4ZOCA 2P7TB 2DQIH 4KK9C 4L8BB 4PJ7E 3PV7A 4P2RD 2O93L 4U3HA 3CUPA 1X5LA 1CDUA 5HHQA 35C8H 3LAFA 3PABB 4M61A 4AENA 3CMGA 2AGJH 3DMMC 2OXGA 3I6KA 5DYOB 5FGCB 4P4KB 3JV5A 1MFDL 5D2NA 2FO4A 3O4LA 4PLKD 3UTTD 1N6QH 3HMWH 4NQTA 2XFXA 3IDXL 4N9GA 4KMTH 1WEJH 3S37L 3X11A 4XBPA 4X5LA 3ULUC 3DBXA 1FP5A 5K9OB 1BJ8A 2UZYB 2ICEB 3L6FA 3DUSA 3WDJA 4QRTB 2OZ4H 3RY6A 1CXIA 1X5IA 4J4PA 3SY0A 5EB9A 3WO3B 2K9UA 5IEHA 3GI9L 1FC2D 2IGFL 3IDGB 4U1KA 2V5MA 3MRPA 5IK3A 1V3LA 2R4RH 2H2SD 5IVXA 5CAYB 1WBYA 2VE6B 3RWJA 4JPKL 2FIKB 4FFWD 4FXGA 2F53D 2EC9T 3MJ8B 2JK5A 4GW1B 4GG6A 4JFXA 4U1GC 3QG7L 3TWCL 1YEHH 3O3EA 1NBVH 5KSBB 1W72A 3JWDH 1BIHA 5BZWA 1UA6H 1JPST 1I1FA 5IHLB 3TZVC 1HNGA 4C83B 3DRQA 1NCUA 4XXCC 2KPNA 4X4ME 1JGLL 3PXHA 4F33A 2EDDA 5I1EH 3O3DB 5FB8B 4P2RE 4CW1A 2DQTL 1L6XA 3HE7A 4PG9B 5BZDA 4JHZA 4OGZA 4RA0C 4J7RA 4UDTA 4Z0XA 4IRJB 2Q6WB 4NC2B 4TVPD 1NGZA 1DTUA 3UTTE 5MEND 1U3HD 1A14L 4RAVA 1R3IL 2QSCL 5D9SB 3PQYB 4LFHG 3B5TA 5I71B 4DVBA 2A1WL 2I5YH 4P5KA 2EDHA 3S5LB 1DFBL 1AFVL 4OKVA 4GAGH 5C0AB 2APFA 3GHEH 3ZT7A 4PJGF 4U1IA 3U7YH 3IDIA 4KJYA 4OBSA 3T08A 4AEIL 1Q0XL 3CLFH 1W8NA 5DTFB 2IC2A 3QWQB 4NGHL 3FZUD 2CJUH 1KGCD 1T83A 1CBVL 2IWGA 1RZJH 4G7YL 5JW3H 2C3VB 4OZ4B 1NGXA 2BVQA 3LQMA 4H8WL 1T22B 1HH9B 4O02L 2OK0L 1TQBC 2F53E 5IG7B 2JJUA 4QTIL 2HFGL 2DMCA 1HXMB 4HZAA 4AIXA 4PFEA 3BP6B 1TCRA 4HS6B 3AAZA 1JMXA 5A2JH 3KPOA 3VRIA 3CLEL 3MFFB 1MCEA 4JEGB 2A6JB 3JTSB 4HMDA 1AE6H 3ZE0F 3GMMA 4ORGB 3GSWA 4G6KH 1DEEB 1EFXB 1SYSA 4PP1D 3BZEB 2KBGA 4HGWA 3DTXA 2GIYA 1VFAA 1N8ZA 2XRAH 2VXQH 4HIEB 4HWEH 2I9TA 3SDAD 1P1ZA 2CXKA 1S9VA 3V5DB 4UMGA 5CEZL 1T0NB 2VXUL 1G7JA 3EJYD 4XB8A 2IFFH 5JORA 4APQB 4NWTH 1BZ9B 1S7QB 4TVPE 5MENE 3TNMB 4OCXL 4OB5L 1S5HA 3SDCA 4WI7A 3FQTA 3KPNA 1IC7H 5DHYB 1F3JA 2DJ4A 2ATPA 4MJIB 2OL3H 3BW9A 1NUFA 1NKOA 2P49B 1JRHL 2P46B 5DRXA 5GRJL 5HYEA 5DK2A 4HXBL 3ZTNH 5DK0A 4GKNA 2HWZH 4LEOA 2CK0H 5I8EB 3INUH 5DMGC 2QL1A 4HZLB 1LEGB 5E9DB 5FKPA 3TJHC 3V7AE 3A67L 1ORQA 1ZEAH 1KGCE 1RY7B 3LN4A 3OZ9H 4G43B 1KJ3H 4PJXE 5EC2B 3JV4A 2R9HC 4XBGB 4F57H 3A6OA 1AD0A 4I18C 4P2QA 4IIQB 4G80A 2J88L 4FQXB 1QHOA 1CGSH 2R0KH 5D1ZC 3T2QA 1YJDL 2NX5B 5EU3B 5B39G 1H8OA 3S35X 1K3IA 3VWKA 1H3XA 2DIJA 3ULVE 1N0XH 3SDYL 1DCLA 1D6EB 3ORJA 5EPMB 1F4HA 1OGAB 4UU9A 2DKSA 4ZYKA 1P4LB 5D1XD 1NGYA 3WE6A 2JE8A 3HMXA 2ZPKH 1EHAA 2FJGB 4M7JL 1KT2A 4QRPB 1PBYA 3P4MA 4GBXD 4HDIA 3OKDB 4OLWH 2FEDD 4FMKA 4M3KB 1MAMH 1NC4B 1PX3A 5C0CB 1CN4A 2M8XA 1DZBA 5F7NC 4MHHG 5JW4N 3QUKA 2PYEB 5HYQB 2AEPH 4LRNL 3FN0L 3L3KB 1IAII 1TITA 3LKSA 5IB1B 3T3ME 4BJLA 4HFWA 4PJ7F 4A6YA 1OGTA 3BKMH 4YFLF 2ZOLB 3DRTB 2FDBP 4BKLB 2GJ6D 5EBGA 3HA0A 1UJ3C 4DZ8A 4RNRA 5F9DC 4XMLH 3EBAA 1I1AA 4K8RC 2D3VA 3VXQA 3CSBA 4MHHI 4G8IA 5GS0D 4JO4H 4PRIA 3QUZB 4J6RH 4WTXA 1KPVA 5GGUB 4JPIB 2AK4E 3DROA 4EXKA 2FSEB 1XCQA 5DJXA 3WL9B 5KZCD 4U6YA 3HNTL 4ZFGL 4LPVA 2XN9E 3HAEB 1T2JA 4XNZB 4JJHA 3HE6C 3KPSB 3MGTA 4UINL 1W8OA 4LLDA 3RNQB 5DMIH 3G08B 1FCCA 2ARJQ 2AS5M 1JPGA 2AJVH 3SGJC 3P0GB 1YQVL 2EYRB 3G6DL 1T1XB 5ITFB 1DBJL 1YEFL 2I07B 2YPLB 1KFAL 2QADC 5HHMD 3RJDA 3O8XC 3RQ3A 3EDFA 4R7NB 1MJUH 3VGEA 4MA3A 5F3HB 1Z9LA 3H9HB 2A38A 2BDNL 5CBEA 2Q86B 3CPLB 4Z7UA 3B8SA 3O3AA 5IQ7L 1KJMB 1IRAY 1EIBA 4K7PH 3SPVA 1OTUD 2HJFB 1MUJB 4AEEA 1Q1JL 4WGWB 4PJ9A 3R4DA 5B8CC 4U7SA 2P8LA 5IUSA 1T1WA 2YN3A 4HH9B 5D5ME 4K3DH 4UI2A 5FHAH 2BMKB 4IOSD 3TBWA 1I3VA 2ICWA 1OAUH 1N3NB 4ZO6A 3U48A 3GIZL 4MWFA 4X0KB 5E99H 5ALBL 4RRPG 5MEQA 3QCTH 4I77H 1NCBH 3MACL 3D25A 3J8F7 4HKXA 3DX8A 3P30H 2GJ6E 5DHXB 2ADFL 1HHKB 2A6DB 2XNAA 2D7NA 1N0LA 5GS1A 4RMTA 3GJFH 3GJEB 3PL6A 3U9UA 3PWJB 4ZOEA 4PJIF 3DSFH 4K3JL 32C2B 3FRUB 3MRNA 5CJBA 3DURA 2OXHA 1TENA 1T0MB 1I8MB 4DN4H 1BLNA 2VDRH 5JXEA 2IPTH 5D2LB 3IF1B 1U93A 1IC1A 4JKPL 4NNYB 2DBJA 4UQ3A 4DGVH 1Z2KA 2JJVA 2WINA 3HUJA 4QNPF 1KIPB 1NUDA 4JN2A 1WC7B 5SWZA 2JCCE 4WHTA 2HLFD 1AO7D 4YDVA 2WBJB 2R69L 4QT5A 4P3DB 1RUML 4M5ZH 4U1HB 5HHME 5EU6A 4GKSB 3T0VA 2B1HL 4H1LA 2D2OA 2OSLB 4KPHH 1NAKL 4JKMA 4X83A 3UAJC 3MRIA 4AY0A 3VU2A 4ONGL 4R4FH 3OKYA 4YR6A 4KROB 4NC1C 5H94A 3BE1H 3MOAL 5CD3B 2VDPL 3O6MH 3PGDB 2VKWA 4HUXB 5ICZB 2VXSH 1UWXH 1F6AB 3OKLA 4PTTB 3VDCA 5C0BD 1F5WA 2WK2A 3LPWA 3QJFB 3BGFC 1X7QA 3HZMA 1X9QA 4XP9H 1YNLL 3T1FA 5MI0B 5BVJA 1WUNT 4L3AA 5H35A 2F54B 3QDJB 3STZB 4X6DE 5JOPE 3DX7A 1ZANL 1QRND 3C09B 1QSEE 2OI9C 2VZSA 2CDEA 2J5LB 1VGKB 4DTGL 2ZSVB 2W65A 3UTOA 5FHBL 3RL2B 3DX6A 1X3DA 4JCLA 4OTXL 3JBG7 4UIMA 5L8LB 2D7PA 1SJHA 3BPNC 4WWID 5EUOE 2X1OA 5TDPA 1I1YB 3CU1A 1MRDL 4WU5B 3NTCH 1FJ1B 2BRRL 4ODVH 4JHWH 5MEOB 1C8PA 3GMRA 1KJ2B 3BH9B 4BZYA 2GUOA 2ESVB 4K9EC 4X7SL 5A16B 1LE9A 3IFOB 4P23B 3V5KB 2LU7A 5GGVL 3E8UH 3G04A 4Q2ZB 4KRPD 1HCFX 5MERA 5DRZB 2E9BA 4M9OA 2R0LL 3CSPA 4P3CH 1C5DA 4URTB 1MPAL 4V1DD 1IKFL 1DR9A 4KMTL 1R3JB 2OJEB 5DSCA 3MOBL 1LO3H 3L3GA 1CI5A 3RVUD 3OQ3B 3FHAA 4EXPX 5F1SA 1KB5L 4BQ9A 1CL7H 5HDQL 3U36A 1NFIA 3FRPA 3LQZA 2NZ9C 2IG2H 3ULVF 3A6BL 2NY3C 4PB9H 3CMOL 4OIIH 4OCNC 1ZHNA 1GC1L 3AMKA 3H7BB 5C0BE 3ZKSD 1BD2B 1IBGH 3OKKB 5EUKA 1NBZB 4JGJA 3BT2L 5CZXD 3RA7H 3FT3A 4KJPD 1ZT4A 3BO8B 2SEBA 1IM9B 1G7HA 1HSAA 4U6HA 3LZFH 4LSPH 4JFHD 2YR3A 2EYTA 4MA8H 3KPRA 3CVHL 4S1QH 2P5WD 1K6QL 4MAUL 3BKYH 2CRMA 4Y1AB 2G75A 1QRNE 3GIVA 1W0VA 1NDMA 5INDB 4TNVF 1XGRB 3VXUD 1CQKA 2R2HB 2UWEE 5EU4A 1NC2A 1P4BH 2FB4L 3SDDD 2IALB 2UZXB 4YFEA 3RI5F 4NBYB 1EAJA 1OAYL 5E6IC 2QQLL 4IOIB 3WKML 5I15L 4YC2B 5ANMB 5SV4A 4M62L 5HSFA 3BSZH 2ATKB 1V7NH 3SO5A 4EZMA 4DQOL 1WVZA 1FLRH 3IU3B 3QIWC 4LSQL 5DFTA 3OXSA 4TVPL 5F7LB 1N59B 2Z4QA 2O5ZL 1ZLVK 1HDMB 1XGYH 3NA9H 4HPOH 3SJVD 4WI8A 4YO0A 4KTYA 2VC2L 1MWAB 3QXAB 3VI4E 4PV9A 4V1DE 3WHXB 5EBWA 1TJGL 4TN9A 5J3HC 3JXAA 1U8JA 1IGYB 3RPIA 1JGEA 3O45B 3RWEA 3ISWA 3UJTH 1T2XA 2XQBH 4PJGA 3QRGL 3ILPA 1EDQA 4JJ5B 3FHQA 1Q0YL 1P5UA 5IJKC 3HC4L 2BOBA 3OGOE 5LGHH 1K8IA 1GGCH 3K7UA 3VMNA 3VW3L 5DO2C 4X99B 1VCAA 5LGJB 3HFML 3C87A 4F8TA 1J0HA 4XHQA 4F58H 3KYOB 5C08B 4Z8FL 4W81A 3KDMB 4JFHE 3N1MC 1JUFB 3AM8A 4NNXB 4N0RA 5E00B 3ULVL 2P5WE 3OB8A 4AJ0A 5D5MF 4YDLC 3L3JA 4KDVA 3ZE2E 4NYLB 4C4KT 5TPWH 2VZVA 3CDYA 1H15A 3VXUE 1S7RA 1YDPB 5GS2D 4JQVC 4IJ3B 3GO1H 4ODWA 1J12A 1TETL 2VXQL 4RA3A 5IB3A 2I25N 4NZJA 3ULUF 4H88L 1RU9H 1KTDA 3QFJA 1J1XL 5KJRH 3LQAH 3PJSB 3MTRA 4NJAL 2F15A 3K4DA 4JFDA 4LARH 1CDYA 1Q94A 1RULH 2P8PB 2JKXA 4NWTL 4DZBB 3SJVE 2A9MH 3GGWB 5EZJA 1PYWA 1KPRB 3ME0A 4FOMA 5E2TH 2ITDB 1AQDB 1R5WB 3VE0A 1CT8A 3MYZA 4K94C 4I0PC 4DGIH 4C56D 4ELME 4CNIB 4M1GL 3FT2B 1EFQA 1G6RL 1OAZL 1BFVH 2JCCF 2YA2A 1MCSA 3AGVA 4OV5A 3Q1SH 1JPSH 2XWBB 3D85A 3HI5H 5D1QB 2Y07H 4X4XB 4XMPL 5CSZB 4KQ3H 2JIXA 1I8KB 4NO2A 4UDUA 1AXTH 4MXQC 4OGXL 3TO2B 1C5BH 4EI6B 4PJAE 4WI4A 1F90L 4HJGB 2D9QB 3QUXC 2MPAL 2OBGA 2UVEA 4RISL 1MCHA 4JG1H 4XBEH 2AEQL 1GGIL 3HI1A 2HG5A 3VXOA 4HJJL 5F71A 4MVBD 3OG6B 4Y2DB 1V7ML 4FQ1H 3FQNA 3RRQA 4Z76A 1CFTB 1OF2A 5CINH 3MRLA 3B8YA 2GK2A 1H5BC 4OAWB 2EH8H 4QY8B 1LD9A 2WUCL 1YC8A 3SQBA 3WYRA 8CGTA 4EN3A 1F11A 4C54A 1TTFA 3UBXB 4BK4A 2DWDB 1DLFH 1XIWD 3SGEI 4KZDL 4JFZL 5BV7C 4I3SL 1X4XA 4HKJB 3M1BB 3NVQA 4PJBB 5ABDE 1D5XA 2W92A 2NNAA 1XH3A 4QOKA 3HZYA 3AMLA 2QHLA 3B3IB 3IAQA 5C0EA 3RDTC 1Q9OA 3MNVB 4X5WA 3VMPA 1CGTA 4PJ7A 1JP5A 5CIPA 2R4SH 4NZRH 4GMSH 4TUOA 4C56E 2FHCA 5K59E 1QACA 2QSTA 1G0DA 1RUKL 4P4KD 3GKWL 1NSNL 2R29H 4D0BB 1LDPH 4ZAKB 4ERSH 4XPTL 3GK8L 5GS0L 3LIZL 1Q72L 4L29B 4YGVA 4M43L 4OGYH 1UVQB 1U8HA 3CFCL 4U6VL 3EO1A 2XY2A 1JHTA 1JNLL 3RX8A 2A6IB 5KVEL 5JPNB 1QR1A 1G7LA 3W9EA 5HY9B 2ID5A 5IBLC 3MO1A 3QNYB 1EO5A 5EIIB 3X14A 4ORZC 5ID0B 1P5VA 5F6HJ 4H20L 1EAPB 3WBDA 4XZUB 5IW3A 4Y4HA 1XF3A 2Z0BA 1T66D 3B4NA 2BY1A 2Z93A 1K4DB 1I8LC 1F4YH 4ZTOL 3TCLB 1MHCA 1LP9E 2X89A 4LRIA 4ZG1A 2ZOKA 4HIXL 4RFOL 5IB5B 3RGVA 2VH5H 2IADA 4KJWC 3WJLA 1G7MA 1GAFH 2DLHA 3BP4B 3H9SB 3LPFA 4NM4H 2EIBA 3B5HA 4LL9A 1FL5A 4GAJH 4QF1B 2HKHH 4HS8L 3SGKC 3ECBB 4P2OA 3IDJB 4RDQG 1WWCA 5TE7H 1MCFA 4MDJA 1HQ4B 2BC4A 3AFLA 3KPQB 3S7GA 5ESVA 4X4MA 4LLWB 3FAWA 5L9DL 4Z7VB 1FV1B 1NCBL 4LIQE 2GQHA 3P9MB 4P2RA 3MYJA 2YXFA 3TN0B 5FYKU 1UG9A 3QYCA 4IRJD 3T0EC 5FGCE 5E03A 1YPZB 2XKNA 4ONFH 3LEYH 5EFIB 3ILQC 5AG8A 2I24N 3QHZH 1UKSA 3PQYD 4POYA 3VI4F 3ARYA 4UILH 4LVNC 1A9EB 5B4MD 3WMSA 3T0AA 2BERA 4P46C 1NGWB 1DN0B 5GZND 5C0AD 3CDGA 5FYJU 5EZLA 3T4AB 4XI5C 3QQ4A 4ZUTA 1KIQA 4WU7B 1KB5A 3QG6B 4J23A 5C0NC 2OMBA 6FABL 5FOBB 4NRYB 3TVMB 3B9KB 4GRLC 4CU8A 5E8PB 1NBQA 3RKDC 1FNGB 3X3GL 2F53A 3GSNL 1HSBB 2AAVA 3IB4A 4O51A 5KSBE 3NH7L 4RMUA 1FCGA 5EN2B 5IMOA 3QEHB 3CVHA 4IMLB 4D2NA 1MH5B 5IVZA 4ETQB 4XWGH 1A1NA 1EFXD 1DQDH 2Q7YA 1OWRM 1YN7A 2QHRH 4Z0BL 5DJYA 3WIHL 2VLLA 4ODSH 4JY5L 3DVNA 4L9LB 5E08H 1IQWL 2WP3O 2WV3A 4MNGB 1IAIM 5L88H 3PNWB 4P59L 2XV6B 4NUJB 1J1OH 2ZP0T 1UM6L 1AJ7H 4APQD 4P4RB 4AG4L 1N64H 1A0QL 3QZWA 4HCRH 3NACL 1S3KH 3JTTB 3V4VH 5MENA 1TVBA 1U3HA 1A5FH 4ZS7H 2YEZB 1I7TA 3PQYE 1M7IA 3PGCB 3MRQA 4MJID 5F97E 3NCBB 1YC7A 2XWJB 3O3BB 5TE6L 3O4OB 4ELMF 3WJJC 4LVEA 4BH8A 3RTQB 5C0AE 1VFOA 1G9NH 3GEWB 4EOWL 3ZSSA 1G84A 4U2YA 5E9DD 5FYLE 3WUWB 5HHXH 1K4CB 1K9TA 15C8H 2V5RA 3FONB 3QXDA 3W39B 1T04A 2UUDH 4PB0L 3PWVB 2ZSWB 4PJXA 4S2SB 4XCFH 3WSQL 5CHNB 3QUYB 1TIUA 1TVHA 1WZ1H 4YDKL 4PJAF 4FQXD 1YEIL 2D4FA 1BOGB 2NX5D 1QR4A 3TCXA 5F72S 3CH8A 3HHRB 3PWNA 4MJ4A 5D93B 3L95A 4X8JA 2GY5A 4YXKL 5I76B 1F8TL 2Z92B 1KNOB 1OGAD 4YE4L 4W68A 1R3LA 4F7MA 1JZ2A 4XNXH 1OP5K 1V8HA 4P5TC 4OM0L 5ADOH 2ADGB 4IDJL 4WI3A 4Y8DC 3RA7L 4MD0A 4GKZB 4QRPD 3JV6B 1FFRA 3MJ9L 1NC4D 2VDNH 3CZFA 4X6BA 5C0CD 2DWEA 4Y5VC 4WJ5A 4OCWH 3IDMA 3FB5A 3WNNA 3N1PC 1U8KA 2X44D 5KSUA 2PYED 1DQMH 1TNNA 4N68A 3UCRA 4LFHD 5IBTL 1ORSB 3LRHA 3S35H 4HBCL 5JOFB 2ZUSA 3REWB 1T1ZB 1H8SA 4JZJB 1U6AL 4O58H 4O2CB 4MJIE 4D3CL 3OF6D 1HQRB 4IS6B 4DKAA 3CFBA 2ZCLH 5DQJA 5BRZB 2YD1A 5K59F 1HYRC 3LH2L 4YZFF 4PJEE 5HVGB 1G6RA 5DD1H 3CFDB 3QUZD 1BJMA 1QLEL 5E9DE 3PXJA 3WFHB 1Y18B 3GMOA 4PJ8D 5I1IH 1SJEA 2WANA 3L5HA 5JZ7D 1NJ9B 2AK4A 1KCSH 4LSRL 4CVXA 4ALAH 4YC2C 4HBQA 4S1RH 4Y4KC 5I1JH 2F9BT 3MA7A 3LS4L 1A3LL 3KPSD 3TP4A 5F9OH 2KH2B 2XN9A 5I75B 5IW1A 4N5UA 2AXGB 4IDLA 2E27L 3P4LA 4JM2B 2HFFB 3P0VL 2Y36H 2YPLD 2XQBL 3MRBA 3EFDH 1OGAE 3VRJB 1II4E 5HHOB 4M6ML 4WW2A 5DMKA 1JPTL 4YHNB 5DVLA 1G0XA 5FUOH 3WS3B 4U1JA 5D1XA 1FNEA 3BWAA 4ENEC 1OPGL 1LP9F 3QUML 4QRPE 2AW2A 1KTRL 4MMZC 4WY7H 4HK3N 5HYSB 1RHHA 2WUBH 2VLKE 2YBRA 1Q9LB 5FGSA 1IARB 3HG1B 4Q9RL 3P0YH 5IR1A 3KPLA 4XP1H 2H41A 5D5MA 2PYEE 5IFAL 4NN7C 4NP4L 4E42A 4GRWH 1I7RA 1ZLWK 3FQXB 1KELL 3HR5A 2PR4H 1JWSA 1JZ7A 4NPYA 1I3RB 3CFKA 1MRCH 3W2DL 3AY4A 2GJ6A 1CD1A 3I75A 3D48R 2EECA 5DA4A 2GK0A 3P77B 4YX2H 1SJXA 4GS7C 4POZD 4JY4A 1M05B 3V5HA 2VIRB 1VSCA 1VACA 2VQ1A 4IJ3C 1CFSB 2EZ0D 5B38B 1UWGH 2XZQL 4TQEH 4YDJB 7FABH 5DHVB 3OB0K 5E2TL 1GXEA 1IKNC 4RQQB 3D69A 3KPSE 4EQ3A 1S7TA 4OGAC 2WBJD 2H32A 2JCCA 5HGHB 4HAFA 1U58B 1PLGH 5F70A 2YPLE 4NM8H 4DVRL 1A7OH 1VFBA 4U6TA 1FGNH 5CEYA 4M5YH 4XNYH 2CDFB 4QGTA 5IB4A 2YC1B 3VWJB 1CFNB 2A74B 4PD4K 1PG7X 2EIDA 2VLRB 1QQDA 4PJDB 1LO0L 4PGDA 3EYQC 1AY1L 4KROD 4XXCA 4ZUUB 1FG9C 2NTFB 2Y7QB 3K80A 1S7XA 4JDZA 1E27A 2PO6B 2C7UA 3C5SA 4BFIB 1E6OL 3KYNA 5MP6L 2VDLL 3VD4A 3FB8B 2YK1L 5DD6A 2YA0A 4K2UL 3C5ZB 3KGRA 3TO4C 3ZTJG 3FB6A 2ARJA 1MVUA 4DK3A 1S7VB 2ZUQB 3VFTA 4YPJA 3V52L 4PTUB 1AGFA 1S7WB 1R24A 5EZIL 5CJQL 2DOCA 2F54D 4Z77A 5L0QC 3QDJD 3O6LL 2XOTA 1O7VA 1IM3B 4V2BA 2AI0H 1S78C 5F9JB 3OKOB 3BP5B 4FFYH 4PY7B 4R90H 1V05A 2RAMA 3BZ4B 3WLWC 1QSEA 1ZA3A 4KVNH 4X4YB 5EOTB 3MUGA 5GRZA 1J0YA 1EK3A 3NN8B 2XTLA 4OI9A 4TOYH 5KAQF 4EQ2A 1FVEA 4X9FA 4NHUA 5EUOA 5D2LE 1UACL 1D5BB 3IS0X 5I1GL 3U0WL 4YXLH 4LIQL 3HPJB 4P23D 2R4SL 2MKLC 2D4DA 2Z9TA 5DJDA 3BDYH 3MRGA 1OWWA 2OR9H 1INQB 2R29L 3PDOA 4F15C 2J6EL 4AL8L 1FVCA 4ZPTA 4XVJL 4PYHA 2YA1A 3LEXB 5TDNB 5HD8C 5IMLA 4KKLD 1A7QL 5CD5D 2BSRA 5DXWA 5L6YH 3QIUC 1MEXH 2YD5A 4OD1H 4F80A 5HVWA 4PIRF 3ZKXB 3MREA 3GSNA 3FOLA 4FHBD 3LKNB 5KANG 3VXMB 4WV1B 3MBED 4KU1A 4XP6H 3P4NA 1ZSDA 3BP7A 4ZDHB 3R06A 3QPXH 3LHPH 5ISZE 1BD2D 1F3RB 2AKRA 1CR9L 3UTPE 3MRDA 5C0BA 4G7VH 5I0ZA 1HN1A 5J13C 3WIHA 1RV6X 5FECA 1A7BA 4M00A 5I1KL 3QNXB 4MCYA 4JQXC 5ESAA 2OJZH 1JN6A 2G9HB 4CDHA 2HVKB 4GLRI 5DEFA 4GQPH 2F54E 3DNKA 3QDJE 3QULB 1RFDL 3P4OB 4RZCA 4Y1AD 4WHYG 2FBJL 2K7PA 2CUHA 4ZD3L 1Q9KA 4TTDC 1QRNA 3EYOB 1OQOA 2V7NB 4FQIL 4NM4L 1RJYB 5T5NG 3GSUA 1X6NA 1NEZA 2UWEA 1U3YA 4TUKL 4BSVA 5JIPA 1XCTA 4RMRA 3T77B 4LHJB 2ESVE 3OKNB 1TZIB