1L7TH

Crystal structure analysis of the anti-testosterone fab fragment
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
220
structure length
220
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFTFSRYALSWVRQTADKRLEWVASIVSGGNTYYSGSVKGRFTISRDIARNILYLQMSSLRSEDTAMYYCARAYYGYVGLVHWGQGTLVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an in Vitro Affinity- and Specificity-matured Anti-testosterone Fab in Complex with Testosterone. IMPROVED AFFINITY RESULTS FROM SMALL STRUCTURAL CHANGES WITHIN THE VARIABLE DOMAINS
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords anti-testosterone (light chain)
total genus 47
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2002-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l7tH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l7tH01
5JHLL 2FYYA 1FNGB 2IPTH 4FZ8L 1YMMD 4JRXE 1FGVH 4KTDH 4UV7L 5IVOA 4BUHA 4HGWB 1FQ9C 4G6JL 4S0TD 2DQEH 3I2CL 2FEDD 1CFTA 4GG6F 5HVHB 1AP2A 2OSLB 3B2VH 4KUZL 2KZ1B 2RQ8A 4Q9RH 1ZT4A 4XVTL 1CQKA 1L4IA 3OJVC 1LDPH 2AJXL 3JTTA 2HLAA 2HRLA 1IBGL 1MCWW 4Q0XL 4P2OC 5F9JB 2PXYA 3HS0A 1MAML 4KXZI 2EXYD 4QRRB 4LSPH 2Z35B 2PXYD 2OR9H 1BFVL 1C5DA 2EDEA 4I3RL 4C54A 5DRZA 5CWSA 3Q5YA 3WUWG 2BZDA 2HT2C 4PJEA 2EYSA 3NPZB 4UAOC 4HIIB 2FX9L 2F53E 1HKLH 2WIMA 5FUOH 1MWAL 1BLNB 5J11B 1TVHB 1AO7A 3AGVA 4EI5B 3DX9B 2FEEL 5F96L 4KC3B 1JNLL 3QXDA 2G60L 4DVRL 2Q76B 2HRPL 4UBDC 1KTLB 3INUH 4V1DE 4X5XB 3UAJC 1ZLWH 4MAYC 1O7VA 4U1GB 4YK4C 1IILE 1FBIL 1G9ML 4OGAC 1I7RB 5T3XL 1BECA 4GKSB 2I07A 2DQEL 2IC2A 2B4CH 3DBXA 3H8NA 5CINL 1BQHG 3WBDA 2HLAB 2EKJA 2X89D 4PJFF 4X6EB 5C6TL 4PJ5A 2IQ9L 1WT5C 3X12A 3NH7L 2A6DB 3CDGB 2DAVA 1A6WL 3GKWH 3IDMB 4R4NC 2FIRT 3TA3D 1Y6NR 5HPMB 4LVHB 1YN7A 4HCRA 3O41A 3WJLC 1AY1L 1PSKH 3BESR 5H35A 2AV1A 1UCTA 1NC2A 3LDBC 2D7MA 4I3RH 1OQOA 3S98A 2EKSB 2VKXA 2R15A 1ZVSB 2D4DA 2X1XR 3T0ED 2AK4E 3S5LG 3VXSA 3HE6D 2AGJH 2XZCH 1MHCA 1W0VA 4MX7A 4FXKA 5E24E 1J0IA 1EMTH 2X9YA 1YMMA 1BWMA 4PRAA 3KLHD 3R0NA 3BZFA 1N26A 5GRJL 2VLJA 1N7MH 4XCCL 4XPBL 3PWPB 2CLVB 3STBA 1LWRA 3RKDC 5TGBA 5E00A 3ROLA 4JY4B 3SDAB 3VG9B 1OGAB 1OTUC 1EERB 5T3XH 5IB2B 3LB6D 4Z78A 4OM1H 3IFNL 3GMPB 4FFWD 4UIMB 1Y6KR 4HLZH 4J2XA 3QZWA 1CN4A 4LU5H 4NN6C 2HT3C 1Q0YL 5F9DC 3WFDL 2Z8SA 1X5AA 5JOFA 4R0LB 1PBYA 4LHUB 4OF0A 1AGBB 4AG4H 3O3EB 2EDNA 2HKHL 4HUXA 3SGJA 5JIPA 4NQTA 1BZ9B 1JF5A 4QXTA 2BNQA 2WWKT 4ZUUA 4CU8A 3TCXA 3C60B 4Z5RA 1KJ3L 1IGFL 3EO1B 4E5XA 4X4ME 3ULUD 4NDMA 3W2DH 1IQWH 1OAYL 4IOSD 2YBRA 2BXZA 3TH4T 4K8RC 1FV1B 1NGWA 3MLYL 2YA0A 3Q6GL 1INQB 3UTSE 3M17B 3ESVF 2WSKA 4HIHB 2CO7B 4MNQD 1KEMH 4K3JL 2QQKH 1PG7L 4P9MH 5TDPB 1JUFA 3RL1B 1Y6MR 5C8JA 3MA9H 1JF6A 4YE4H 3CJJA 1KGCE 4OZ4A 5E8NB 2GJ6A 2UWEB 1TVDA 1T2XA 3LEYL 2EDJA 1V3JA 2XY2A 3BDXA 1KPUA 3MBXH 3ZTJH 4TPRL 5D5MB 1XF5B 3ARWA 1CFVL 1F45A 3JV4B 3F58L 4NQDB 3FQXB 3SDXA 4UB0H 1U92B 4G6AD 2F5AL 2FJHB 3TJEL 1F6AA 5EWIL 3RHWK 5CEZD 4PJEE 3QDHA 4PRIA 4BQ9A 2P8MA 3LS5L 4QHNB 4YFDB 3OKNA 1S7UB 3O3UN 4OF6A 1RZJC 4R7NB 2NX5A 3QCVH 1JGVL 4M62L 3FRPG 4NQXB 3C60D 4XCEB 3TT1H 4JFPB 4MNQE 3DX9A 4QOKB 4NKDA 5EUOB 4NPYB 4S1SH 2BNQB 3CFJA 2FYYB 2EIDA 5TE4H 3U0WL 1I1RA 3ARBA 3L5IA 3RVWD 1ZSDA 1U8QB 3G5XA 1X44A 3EW3B 2IADB 3PGCA 3CFBA 5E0QA 3VXMA 4IM8A 2H1PL 3O2DL 3HCVA 1J18A 1U3HD 3QWOA 4TOYH 1WCQA 1U8LB 4AEIL 4H1LA 1KYOJ 3RFZC 3D3VA 4PLJD 2DB8A 1ZLSH 3DVFA 1KPVB 1OPGL 2DBLH 4P4KB 1TETL 1A9BB 4P57B 2CK0L 3OKNB 4KKAC 3LMJH 4DQOL 1T03L 2H32A 4LCCC 4Q9CA 5I9QC 3CXHJ 3O3BA 3C5ZB 5DC4B 4MNHA 5D6DA 2LFGA 2DQTL 4QXGH 3ZTNL 3MGOA 5C09A 1MNUH 4E9LA 1E6JL 3SY0B 2G75B 1HDMB 4W4NA 4CVWA 1QSFD 3OKOA 5CSBA 3VXSB 5HSFA 1U8PA 5I16B 2R39A 2CK2A 3TFKC 1HOCA 4PJAE 43CAB 1M7XA 5F96H 5BRZA 4PRIE 5GJSH 1OB1A 1E0OB 3QUXC 4OJFL 3T2PA 3GSWB 4KMLB 1XGUA 1LE9A 4XNMB 3QQNA 5F6HJ 1Q9OA 4QHLB 4KDVA 5DMGD 1E28B 3GJFA 2VR9A 5C0AE 4PLOB 3QO1B 4LSRH 3S34L 5JIKA 4H1LB 3ELAT 4H0GA 4NFCA 4I18B 1J9CT 1BM3H 3ARGC 3QHTC 1GZQA 2AKRB 1NCAH 2ESVA 3PP3H 1ACYL 1DUZB 3DUSA 3BPLC 3DO3A 2GITB 1G7HB 4Y4KA 2V9QA 1QLFA 4HUWB 5I74B 1X5IA 3ZKXC 3IFNH 4NQDD 4Y5YA 3KPRA 4N90E 1DBMH 4PRNB 4X6CF 5I0DA 1MHHA 5KVFL 4FTVA 4ZTOH 3P30L 1KPVA 3IT8D 3FO1B 3QIBC 1WAAF 5EO9B 5D7JA 3T3MF 2BSRB 1FV1A 3GSQB 3P4OA 1L6ZA 2EO1A 3BT2L 4GO6B 4BSJA 3O4LE 1UWGL 4S1DC 5HBBA 12E8H 1P7QD 3MRJA 5JOPD 1P2CA 5D1ZB 4O2EA 1KTDA 5SWQA 4NRZA 1ND0A 43CAA 4C83B 1H15B 2DOCA 4RNRA 2J1KA 4LNVA 1SHMA 4U1GC 1QQDA 2XZAH 1KIPB 4LFHD 2P44B 2ZCKH 2RIKA 3WNNA 5IEHB 3VFNB 4XRCB 4PR5B 1A1NA 4P46D 5FYLH 2OL3L 4HKJA 1TTUA 2VLME 4YO0A 4U3XA 1P7KB 4N1CA 1JPSH 4YDIL 1NANI 1NGXB 2ZUWA 4KI5D 1G9MC 1FH5L 4RZCA 5F9JA 1JGLH 5GRVK 3CUPB 5IVXA 4NUJA 5BQ7A 4S1RH 3SDDD 1NBYA 2AK4A 3BKCL 3RWEB 3SDDA 2VAAA 3V0WH 1HWGB 4WV1A 3JVGC 3K3QA 4XAWL 5D2NC 1X3DA 1OWWA 2GSIA 3KXFD 3WNMA 4K7FA 3EYSH 3ORJA 5TDPA 2QQQA 5EULV 4FP8H 4ZS7L 3O6FA 1BEYH 4YDLB 3KJ6H 4TOYL 5CUSH 5GSVB 4K23L 4LP4A 4YX2H 5I1DB 3IDIB 1V3KA 2YK1L 3B9KA 1YEFL 5DVMA 3SDCA 1VFAB 3RY4A 4POZD 5L7XL 1A6VH 1JHKL 2WBWB 1YEGL 3QPXH 5SWSB 1I9IH 1RUKL 2YXFA 4M00A 4Z0BH 4ZAKA 3DO7A 3RGVB 1DQQB 4UV4H 1B2WH 2PO6A 3HA0A 1HYSD 4RMTA 4NQSA 4BH8B 4Q6IB 1S7QB 2CRMA 2OYPA 3M1BB 5BOZG 1P4LA 2JKXA 4WGVB 4OSUH 3CVHH 3QB7C 4LCUA 2XWTA 5CBEB 2UWEE 5IFHL 3U0PB 3PWJB 4WV1B 4KKBC 4JFED 3O4OB 1MI5E 3B2UD 4MA8L 1GJIA 5ABDE 1T0NA 4PGBB 5I1HH 3VI3E 5LG1A 1U8JB 4LPTA 3K4AA 1W72B 4UNVA 4EN3A 1P7QB 5CP7B 1D5XB 5IHUH 1BIIA 4KHXL 4NUJB 3MNWB 1LE9B 4EVNB 1HI6A 4WHTA 4QHMB 3MRLA 3EO9L 3R06B 2YEZA 3MV8B 4M5ZL 3U1SH 3MFFA 4PGZA 4XPTH 1T1WA 1IJ9A 3F7YA 1TENA 5FDWA 4YDLC 1KV3A 5TF0A 4ZPVB 1AIFB 1OAXL 5E94A 1UZ8B 1S3KH 4XPGL 1MELA 1NBQA 2DQJL 1MCRA 2D9QB 4OLZL 1K4DB 4WWID 3MRCB 1EGJA 4HUWA 5HXMA 2X5PA 1KCRH 1NCTA 2F54E 4R2GD 3ECBB 2ICCA 1FAIL 2CMRH 2VJXA 3QG7H 4NYLB 5C0FB 2OXHA 4J4PD 4JHBA 4QXTB 3ZKQD 2IPUG 4HQQH 2H8PB 4APQB 2R2CA 4I77H 5I1AB 4N8VG 4XCFH 1SVCP 2BJML 1HKFA 2Q8AH 4MJ4A 4OLZH 2X40A 2D03H 4PJGE 1F11A 4LPYA 4KMTL 1DVFD 4LLWA 4N0UE 5FYKD 5GS3A 2G9HA 3SE9L 1DDHB 4OKVB 2EYRB 3VXQA 1DSFH 3QCUL 5BXFA 4ELMB 1DP0A 5EIQA 4F37K 3R4DA 4OAWB 3ILQD 4MD4A 1LO5B 4N0YL 3Q2CA 1K4DA 3PIQB 3HRZB 5ENWA 3VDCA 3UJTH 3RWCA 4KV5F 4U1HB 3RWDB 5H37H 1IEBB 4YDJA 6FABL 1ROWA 5AZEL 4TUJA 1EXUA 3QUZB 4NZRL 4A6YL 4LLMA 1A3QA 4BFGA 2Q7YA 3C5ZD 2XWBB 3QG7L 2W60B 4YHPA 3UO1H 4BJLA 1WEJH 4MA7L 2X4RB 3PV6B 3UC0H 4HWEH 3VW3H 4Y4HC 4KUCF 3WIHA 3F7PC 4Z7UB 4M3KB 5C6TH 5EU5A 3ZHKA 4L9DA 4NJ9H 4N0CD 5IFHH 4KJWC 3VFOB 5C2UB 2R0KL 4IDJH 1HZHH 1KULA 2A9NL 2QV2A 4XBGA 4IMLB 2NZIA 3GIZH 2WLZA 3ZYIA 2HVJB 4OFYA 2KDGA 2HLFC 5HHPB 1LP9E 4OF8A 3GHBH 1PZUB 4Y5XB 2NTFA 5DQJA 1FNLA 2WWMD 4P9HL 1QBLL 4X9IA 3TYGH 3V2AR 5E4EC 4HLJA 4HFWB 4IRSC 4HWZB 1X4ZA 3ZE1F 3DUHA 4NNXA 2E7LC 2XTJE 4I4WB 3KLSA 4GMSL 4KAQH 1QPXA 4OGXH 3DNKA 4JHWL 3KPRE 1T1YA 4ONHA 3VI3F 5BOPA 4XAKD 4D9RE 2Q3ZA 4YHPB 1PKQB 5C0DB 4RFOH 3TV3L 4ZDHA 3E2HC 1NCBH 1T7WA 2P4AB 1E4WL 1A02N 1CFBA 2XQBH 3VI4F 1U3YA 2DTML 2XN9B 3VE0A 4HPYH 5BS0E 4YH6A 4G8IA 5IHZA 1SBSH 3P77A 3VFOA 4ELMF 1S7XB 5JW5B 1EXUB 3ROOB 5I74C 5DK0B 5DK2A 3ZKXB 4QRTB 1B0RA 5F7LB 2HJKA 3QIWA 1D6VL 1V3LA 2WQRA 3VWKD 4KRPB 1HZHL 4ODTL 3CZJA 4PS4L 4YHLH 5GHWL 3PWUA 4EQ2A 2Y36H 1IAKB 1WFUA 4R8WH 3SJVB 3WL9A 1OB1B 1H0DA 4NQCD 4M7LT 5D72H 4P9HC 2X4NA 5DYOA 1OLLA 4HAFA 3OB0K 2BNRB 3GMQB 4HK0A 4P2QA 4PJCB 5DURD 4WUUD 4OBSA 1FVEB 3B2VL 1OAKH 2HG5A 3C09C 4TSAH 1S9YB 1PDKA 2R9HD 3CX2A 4N0UA 3GB7B 1NMCB 1FDLL 4IHOB 1AD9A 1C1EH 5T1LA 4HAGA 1CFSA 3PJSA 3SQOL 4HFWA 3GSNB 5DFVD 2HFGH 2BRRL 4OIAA 1EO7A 4ZUUB 3VGGA 4XH2B 4PY7A 1QLFB 5D7KE 5DD3L 2P8PA 25C8L 3EJYD 4XWGH 4QRRA 3BH9B 3TPKA 4WVRA 3QXAA 4U6XA 5JW4Q 4MA1C 1FFPA 1U91A 2F54D 3GEWB 3X13B 1EHAA 3GSRA 4HUVB 5DHYA 2VDKL 3X11B 5I0ZA 1DANT 3VD7A 4PJHB 3O8XA 5HD8D 1ACZA 4TULH 5IVNA 3OHXA 5C0BB 5J13C 4PJCA 4WHTB 1ES0A 3KPQB 1T80A 2DL9A 3MJ9L 4OFDA 2NY5H 1N4XL 4ZPTA 4ZO8A 2HN7A 3QAZC 5IB3B 2EH8H 4MD5A 3CSPA 4M48H 5BS0D 4LRIA 1L7IH 3ARZA 3QI9C 3CNKA 4ENED 3DYMA 2NX5E 2B5IC 4L4TE 4KJPD 2LTQC 3W11C 2X4UA 1RZKH 4EBQL 5E4EB 4P3DA 2CDGA 1FG2B 3DMMB 1J0HA 4BFBD 1CLYL 3LEVH 3JVGA 3ECBA 4FA8A 1QFWH 1CGSH 2XKNA 4JFYA 3T8XB 4PGDA 3BVNA 3GMOA 1WWCA 1JWUB 3T65A 5JPMA 2A74B 2BNQD 4GKNA 5JZ7C 2EO9A 1B6DA 1JFQL 2CIKB 1HHGB 3IDJB 5MERB 1KB9J 4JFFB 4HZAA 5HHXL 1CFTB 1LHZA 3H42H 4NQUA 3MSPA 4PJEF 5EO0B 4APQD 1ZLVH 2MKLC 4Z8FH 5EWIH 1EO8L 4FTVE 3QEQA 3FN9A 2J5LC 1WBYA 3TCLA 2ITDA 1WC7B 3MRFA 3PV7A 5DT1H 3NN8B 4HK3J 2IH3A 5GISL 2VITB 2DLIA 3LV3B 5GS1C 1T5WA 2FHBA 2QEJA 4P5KA 5F21B 2Y5EA 1LK3L 4FMFA 1NFDB 3VCLB 3NIFF 4GXVH 2OP4L 1L0QA 2WIIA 3DROA 4ODXB 1IL1A 3RBGA 4PJFE 4X7DC 4R3SB 3TZVC 3GMMA 3JTSA 4NQSB 5DJ8B 3CFEB 4ODVL 4JANA 4NUGL 3QG6B 3QIBA 1NGZA 1Y0LA 5HI3D 2YPKB 1OP3H 2BC4A 5IESH 5C0RL 1RFDL 4HEME 4BH7A 1IZKA 4MA7H 5MHSE 2R2BB 4IS6B 1J1PH 1XF3B 2OL3B 2GCYB 1W72H 3FFCD 2FGWL 4QRUA 2NXZB 4L8SA 5HGHB 2A83B 3VDBA 1A7QH 1G7MA 4RGNB 3GMRB 3O2WH 3MRFB 3C5SB 4OB5H 1MSPA 2IH3B 1K6QL 3T2NL 4G80A 1WITA 4U1MA 5IB1A 4NNPH 4JFFD 3GMQA 3C5JB 5B39G 2FSEB 4ZFZB 1AGEB 4J6RH 3GSXA 4LCYB 1RUMH 1OTTC 4WFHD 2OZ4L 3MRGB 4JFFA 1EHLL 4ODSL 1ZT1B 5C71A 1Q94B 3CDYA 4ZMAT 2PYEB 4X80L 3S7GA 1QR1B 3FQRA 1K3IA 5FHBL 1Z5LA 2APBA 1I3RA 3JWNC 3IKCB 3L1OH 1MQKH 2C3VA 1MH5B 5B38A 5J8OA 1A6VL 5K33A 3MREB 2VN7A 3LY6A 5DD0H 4IRJD 4BH7B 1MFCH 3S36L 2BOBB 4M61A 1WFNA 3VA2C 1CDBA 1EEQA 4YGVA 1NKRA 3DVGA 4GG6E 4XBEH 3BPNB 4R4FL 3FB6B 2QQLL 5L88L 3QQ3A 2I60H 1I8IB 4PJ8A 5DT1L 3V5DB 2VAJA 3KPSB 2VLKE 3AAZB 4APQA 4OZIF 4LSUL 4TNWK 5HGDB 4M93C 4ZYKA 3VWKB 3LSOA 4GG8B 4OT1H 3STLA 3UDWC 4OB5L 1UB5B 5TH2A 5KZCB 5DO2C 4HMCA 1EEYB 4HW6A 2HN7B 3HUJE 2CUMA 4MXVE 2H2SC 5DS8B 4OKVA 5I1EH 2VXSL 5L9DL 4R0LA 2IQ9H 3SDYH 1FL5A 2ZSVA 1CD1A 2BHZA 2JB6A 4P46B 4FABH 4MZ2A 1C5CH 4XVSL 3ARDC 3HCVB 5M95B 1QFWL 4YNYA 3MOAH 5HY9A 1G7LA 4YGVB 1MHEB 3L3KA 3V6BR 2OI9B 4JN1H 4ZFFA 4L3EA 3BGAA 5J12C 1MCKA 3UX9B 1SJEA 4MAUL 4R26L 5EORH 3VFMA 3WN5B 2ZUYA 4FQLH 4EIGB 2B4CC 3EOAA 5CUSL 4AMKH 2KH2B 5TDOB 3S4SB 5HPMA 2XZCL 3GSNL 2FJFB 4QRSB 3P0GB 3FQNB 3LSOB 3ARUA 4PB0L 5E2WL 3N1FC 1J0JA 2WINB 4I5BB 5LAXB 2P46B 5K9OB 3SPVB 3MUY1 1QLRA 5CEXB 4N5EC 2YD3A 1MWAH 2P42B 2UVEA 3MR9B 1ZVSA 4HKBA 1IGJB 1EFXB 4G43A 3MMEA 2APWA 3QIUD 3RPIB 5L8JB 1RZKC 4X4YB 1OAUL 2IFFH 5I8EB 3PWPD 4PJ8B 2VRAA 4TVSa 3CVHL 3NPSC 1Q9LA 4AZ8A 3DI2B 1A7BA 4LLQA 4BQCA 3T4AA 2QSCH 5HHMB 2H32H 3HB3C 4NCC2 1M7IA 5DUML 2Z4QA 2VC2H 3JBG7 4KKLD 1DBAL 2NXYC 3E1F1 4L3EB 4U0QB 4TRPL 3SO3B 1KXVC 1I7TB 2E9WA 3AB0B 3JV0A 1RURH 3EDEA 3QAZB 4KROD 4LCIL 4RX4A 1RUML 3MRRA 4MJID 1A6ZA 1IARB 2R1WA 3FQTB 4MDJA 4RX4D 2OR8A 5DRZB 5FOBA 2IPTL 3MLXH 5CLTA 4R3SA 3UJIL 3NFSH 1MAKA 1T89A 5J11C 5TQ0H 2R23B 2UZIH 3K2UH 4XCYA 5HJ3B 2DQUH 1BEYL 3V4UL 5GGVY 1B9ZA 4I3SH 2A0LD 3LN5B 4JFEE 4JJ5B 5TPWL 3OPZL 3QNYA 4X7FC 5IROA 4LBEA 4NZTH 3GBML 1IAOB 3OGCB 5FAAA 1CE1L 1QLEH 4BKLB 1S7VB 1MRFL 3LQMA 1ITCA 5ILTH 1SYVB 5CWSB 3KDMA 1VADA 2A6JB 4JN1L 5GZOD 1A0QH 4U1MB 5IB1B 2UVFA 3KVQA 3U4BH 4KROC 1ZEAL 1BVLA 1KT2A 1KGCD 4RCAA 2CR6A 2XG5A 4HIXH 3VU2A 1MUJA 2NXYD 1KCKA 1M71B 3QWRA 5DJ0B 4YR6A 3U9UB 3RWFB 2DD8H 2GJ6D 1IC1A 2HFGL 3FQUA 4LLQB 4QRRD 1FYTB 2P1YA 2JCCF 3QG6A 3QIBB 2A6KB 3QIUC 1VFBA 5B3JE 4LRNL 4X99B 4LSUH 1AD0A 4GJTB 3HE6A 3VFVA 4MJ6A 3V6OE 2VZVA 3QO0A 1BQHB 1TITA 2ADJB 1WTLA 5SWZB 4YFLF 4I0KA 4NO3B 3VRJA 5IT2H 3IETB 2AAVA 3KPLB 5HGBB 5K9QG 3MC0A 3RRQA 1Z2KA 1IGYB 1TJIL 2VR5A 5BXFB 4QLRA 5JW4M 1KACB 2QADC 4U1LA 5ICXB 5TDNA 1G6RA 2VMFA 4YHOH 3ARDD 4A6YB 2HTLC 1YMMB 1G7QA 4P23B 3HRZA 2VUYA 3RWDA 3BKJL 3ARFA 1NUFA 1J10A 2H2SD 3UYPA 1LVEA 2G75A 4UI2A 1OF2A 1CFVH 5IB2A 4UMGA 4H20L 1ZA3A 5DO2D 3FO1A 1WV7T 3X3GH 2P49B 2QBWA 2WWKO 3GJEA 4KVNH 1HSAB 3HI5H 4BH8A 4KPHL 3O2WL 3MRDA 3T8XA 4I9WE 4OD2A 5EBLA 4OD3H 3ZE0F 1OAQL 3DRTA 5F3HB 1JFQH 3KPOA 3IETA 3KPLA 4KTYA 4POUB 5JOFB 3TZVB 2NXZD 1BLNA 3WIFB 3QDJA 2G5BB 2EDTA 5I1KH 5C09D 3IU3A 5DTFB 3SOBH 1DEDA 3VXNA 1LNUA 4DK3A 2IBZX 3RL2B 1NCWH 2XI9A 3HE6B 4QRQB 4N1EA 4IRJC 4G6JH 1K8IA 3HMXH 3MV8D 3UBXA 5E2VH 1CIDA 4Z18A 1RZJH 4WU7A 3A6BH 2JIXD 3QHFH 2GITA 4OQTH 1XF5A 2IG2L 4WUKH 1SYSA 2I9TB 2ICWB 3RIFF 4U7KA 3QDJE 3GMNB 4G7YL 3CX5J 4L5FL 5CJQH 4HDIB 2R29H 4JVWA 3D1MC 4RGMB 1MIEH 4F57L 2D0FA 5C2BH 5FUCE 3NGBC 4ONOA 5D7JB 5JXED 4ODVH 3QHFL 4OQTL 5F3HA 2R23A 4XCYB 4C55A 4JFHD 3L3JB 3LKQA 1W72L 2FGWH 1U36A 5TJWK 1FIEA 4NQDA 1MFNA 5EUOA 5I1GH 1D6EA 1NAKH 4E41D 4QKXB 3PDOB 4FTVD 2YS4A 4OGYH 2ADGA 5HI3C 5D1ZD 1ETZB 1XH3B 3EYVA 1I3UA 1F90H 1MLBB 4P3WA 4NSKA 5GGTL 2AJZA 3MRBB 3BEVA 4LLWB 2J2ZA 3LN9A 3GBNH 4Y2DB 5HHME 5MEQA 4PRPE 2CXKA 3EZ8A 1CBVL 4I3SL 5CFHA 3HI5L 1GC1L 4RGNC 1EO8H 4NNYA 3VXNB 2D7OA 4IIQC 4UQ3B 4D0BB 1KUMA 4FMKA 1OARH 5TE4L 3U0WH 4IRJA 4IJ3B 3VXRA 1CLZL 2DLEA 3RI5K 4WU7B 2R0WL 1NUGA 1FAKT 4OLVL 3B9DA 5AG9A 1J0ZA 1BZ9A 1YN6B 5ERWB 5MENA 3WHXB 4XC1L 3VFTB 1VFMA 3TT3L 5GGRA 3TWCL 4WEMB 1DEEA 4RWHA 3K4DA 4NJ9L 2HFTA 3WO3B 4L8BB 3G08B 3MV8A 4M1CC 2AJYH 5C08E 4MWFA 4AH2B 2YRLA 3L3JA 4P23C 3RVUC 3WFEL 2DQGH 2BVUA 4NNYB 4R7DB 2AJVL 3VGHA 1BVZA 4LRNH 4RFEA 5TE7L 5HHPA 4WWKD 1DBJL 4Q58C 4NP4L 1OGAE 2EICA 2ESVB 1RZFL 4KAQL 3F7RA 4ENEC 4KRLB 4L3ED 4JPVH 3OAZH 2R2HA 3ZDZE 3BN9D 2BSSB 1ZE3C 4U1KB 1L0XA 3MLUL 1P5VA 2MSPA 3WHXA 4K8RH 5IOPB 2RR3A 4K3GA 1VFBB 1AR2A 5L6YL 1CE1H 4FRWA 5EZJB 3DV4B 3RKPA 3SKNA 4R6UA 1MJJA 2AJUH 5HHNB 3UP1A 3ZTNH 2FX7L 3DURB 4MWFB 4AH2A 4LSTL 3QIUA 1CK0H 1Q1JH 3HMXA 3QXWA 1KBGL 2Z31D 3SPVA 1A1MA 4PRBB 1QSZA 2NY0D 5EFIB 3UMTA 1J8KA 5EC1B 5KAQF 3N06B 1RK1A 1N6UA 4JKMA 3QUYB 2IANE 1JWMA 2AVGA 3BEWB 1P7QA 4LSQL 5AWNH 4NZJA 1Q1JL 1BIIB 3DHJA 4K94L 1CYGA 1A6PA 1GZPA 2VLKA 3I3DA 4JN2A 1N5AA 3VXUA 1I9RL 1KB5H 2R9HC 32C2B 2AV7A 1KFAH 5KSVA 2CKNA 5IW6A 3MO1A 3QFDB 2V17L 4G8EA 4N0UB 1JNJA 4HIJB 3JZ7A 3STZB 2N1KA 3MNVB 3WJJC 1ZWIA 3C2SA 3D85A 1KLFA 3EDKA 3WS6A 3PDDA 4PJBE 2FR4A 4L3EE 5EUOE 4ERSH 3O41B 1DQMH 4F33B 4U1JB 1N2RA 1U8NA 1R24A 3H9HA 3U82B 5MHSD 3VWKC 3QCVL 5KVGL 3GHEL 2BFVL 2R8SL 3P4MB 1I75A 1AJ7L 1HQRA 3T77A 4L8SB 4L4VA 1QFHA 5CEYA 1NGYB 4N9OB 1BFTA 3HC3H 2Z8WC 2A38A 2Q1EA 3PGFH 2ZJSL 2X44D 3W39B 2VNCA 3GBNL 4QRPA 3AFLA 3MRNA 4OI9A 1ZKAA 4FG6C 5J6GB 4UILL 5DJCA 3KPNA 2NZ9C 4P4RB 1CVRA 5HYEA 1YPZB 1P4BL 5J1TC 1KPRA 5JPNA 2YMXH 4PJXE 5D9SB 1VENA 3WXWH 4DGVL 1R3LA 3ZKMC 3P4NA 1XR9B 1IQDB 2HH0H 5I2IB 3SDXF 5LGHL 3EFDL 4NBZB 1F97A 5GGUA 3ULVH 5HDQH 2YA2A 1GGBH 3UTSA 5T1DL 2CK0H 4MD4B 1YDPB 1RJZA 2GFBA 4WW2C 1TMCB 4JB9L 3UO1L 4DGYL 2D31B 4JLRA 4HWEL 2SEBB 5MENB 3DXAD 4UB0L 2GY7B 1KC5H 5F7NC 3UPAA 1U8OB 4N0CC 1IGMH 1PVHA 5TQ2H 2PW2A 2O5XH 2WW8A 4QRPB 3QUMA 2WMPA 3A6BL 1WQVT 3EJZC 1XH3A 4LDEB 4GKNB 1CG9A 5K9JL 5SX4H 4AG4L 5T1KA 3FFCA 5GRZA 1PZ5B 5DZOA 4G8FA 1BAFH 2IFGA 4NBYB 1G0YR 5BJTB 3P4NB 5L2JB 4Z7WB 4X80H 5H94B 1WIOA 1RD6A 3QR2A 3ARQA 4KUZH 1MY7A 5JNYA 2I9LB 2BDNL 1A6UL 5JA8B 5FYLL 2N7AA 2NY3C 3BUYA 2W07A 4NT6B 4Y4FA 5DFTA 5K9JH 1U3HB 1JGDB 5FXCH 4ONFH 2OP4H 4GXVL 4G5ZL 4JGUA 1NUNB 4Y2DC 3EYUL 4UTBL 3HRPA 1VSCA 3A0OA 4KVNL 4Y19B 4NYLA 5C0FA 4O2FB 5DJAA 2X9WA 3WNOA 5EO1B 5IJVB 1WVZA 4LF3B 3QDJD 1W8OA 2GHWB 3CFEA 1LEGB 1EJ6A 3ETBF 3OKMB 2IF7A 5AZ2H 2NY4C 3C8KB 2AJ3A 3QQ9D 3TLRA 1UCBH 5ANMB 3WIFA 4BQ6A 4AJ0A 1FNSL 2F9BT 2ATKB 5IJKC 4LLVB 4LKCB 5E2TH 3AS3A 4R2GC 3I3BA 2OTWB 3GSUA 3GSVA 1J12A 3RY6C 3RWIB 3T4AB 2CGRL 2DQHH 3FO9A 3NABH 3HE7A 1K8IB 3Q6FB 3LEVL 4JO1H 4OLWH 2JLLA 4M62H 2DQCL 4UT7L 1FG2A 4LHQB 3RQ3A 2UZYB 3NZ8A 2P7TB 3IJHB 4TUJB 4V1DA 4KKCD 1VFAA 2EIEA 2H26A 4N8VB 3U7AA 3P9LA 1BJ8A 2PYEA 4HUMB 1FFPB 1U91B 4RISH 1XGYL 3SKJH 2F5AH 5D6CB 2A74A 1KG0B 3FN0H 3SKNB 2Q3AA 1Q0YH 1P4LB 5F7FA 2K3TA 4F9LC 1MJJB 4P3CH 1N59B 2ZUUA 4X4ZA 3R8BB 4PG9A 3X14B 1U58B 3B3IB 4PLKC 4DGYH 2X4OA 1C7TA 3NACL 4TULL 3M8OL 1W0VB 3MA9L 2FX7H 2XNAA 4MX7B 3U30C 4KKBD 3PXHA 1KCUL 3WYRA 5EFIA 2DKUA 4TVPD 1XGQA 3O4LB 1YJDL 5DLMH 4ELME 3MV9D 5GIRA 3Q5OA 1J8HB 1FG9C 1GOGA 3TO4D 3MJ8A 3QNXA 4EVNA 1UXWA 1LILA 4KGJA 4FNLH 3P0VH 1VEMA 1WZLA 2BCKA 3THML 1U3ZA 1SMOA 3PL6C 4UOJA 1L7TL 1PLGL 1UC6A 5SV4A 5DHVB 3UTPE 4K7PX 5BS0A 1WWAX 4HKZB 4D8PA 1ZT4B 4QRRE 1JWUA 1HEZB 1KC5L 3PWVA 1X5ZA 2OL3A 4JQIL 4G8IB 5IHZB 5EBWA 2JJSC 4ETQA 2F74B 3DMMD 2XFXA 5CBAB 3RX7A 4E41E 4JPWL 3MROA 3DMMA 4WI7A 4Q7DA 2BY3A 1ZEAH 1CXKA 2BNUB 3OTTA 3H3KA 1I85A 3FT3B 5CJOH 3DMMC 3EFDH 4HXAH 1B3JA 1GGUA 1NGWB 1KCUH 5EPMB 5HGBA 2VITA 1LP9A 1JIBA 5DMIH 1AQKH 4KI5C 1ZT1A 2VXVL 4X7SL 1UQSB 5FM4A 3LKPB 5TF1H 3UTZA 5DQ9B 1G6VK 3WS3B 2XQBL 4M7ZB 1CCZA 4P46C 4Y5VB 1R3LB 3FN0L 4NQCA 2F53D 3PL6D 4U6YA 4U7SA 3RDTC 4OZFH 2VSDA 4N9GB 4H0HB 2H3NA 3MOBL 3RA7H 3RUGA 2PF6A 3TO4C 1X6NA 3FMGL 3KWWA 3MYJB 5ENWB 1CLCA 1GOFA 1TZIB 1Z9SA 3O0RH 1AKJA 1QQDB 4TSCH 1AXSA 12E8L 2C4FT 5KJRH 3WIIH 4GLRH 4GKZA 4PJ5D 5AD0B 3WLWD 3MX0A 1OAKL 1SEBA 1NL0L 3EYQD 4DOHB 2MCG1 3U9PL 2Q7YB 4HC1L 4OLVH 1H3VA 4OM0L 5FA4B 4FQ1H 4QCIA 4OIIL 4KRPC 2GUOA 3STLB 4G9FA 4LLUB 4OF7A 4Y16A 3CZFA 1CR9L 3BRFA 4JQVA 4TUOB 5L9DH 3OX8A 4D3CH 3DTXB 1A14L 2E7BA 1BM3L 1S7VA 4NQCB 3NACH 1AP2B 3NA9H 3INUL 3MZTA 4X7CC 3UBXB 4X6CA 3LKNB 3RWIA 4OD1L 3MRKB 1F3DJ 4JREC 1CICB 1BFOA 4ZFFB 2VISA 1DBKH 1PW3A 4NRXB 2NY2B 1FSKC 4UNUA 4N8VA 1E6OH 5AZEH 3BD5A 3GRWH 1FCGA 4G5ZH 1F3DH 3OXSA 3CU7A 4F58H 5IB5A 1FL3B 2CUIA 1D6VH 3ARFD 1FVCA 4MD5B 2WP3T 3VG0H 3M8OH 3OR7A 3ZDXF 4CN6A 1MH5A 4BZ1L 3O3EA 5B38B 3TA3B 2VZTA 1NCCL 3K8KA 3MUGB 1DE4B 3ULSB 4QT5B 1G1CA 2YC1B 3G6AB 4IDJL 1QRKA 5AZ2L 4YZFF 5H37G 3P3YA 3UYRL 5M7QA 2I07B 3IDYB 4RISL 5ACMA 1FL5B 2YOCA 4Y2DD 4N0RA 4MB5A 4G8GD 3FT2A 5ID0A 4W6XB 1BFOB 1Q9OB 3C2AH 5L0QC 4Y16B 1TQBB 3KR3H 5I75C 3D2UA 4PJFB 2E7LA 2M2DA 3S8WA 2B5IB 1PGRB 2NY3D 1OSZA 4OLWL 1FZJA 3QCUH 4IRJB 2VLRD 4CN4A 1YN7B 5D70L 4JFHE 5T1DH 3FB7B 4LU5L 3VXRB 1FL3A 3NPSB 3RX5A 3D9AH 4GOSA 4PJAF 4OCLC 2GJ6B 2UWEA 5EIVA 5BS0B 5DLML 4ORGA 3GRWA 1RUKH 2WV3A 5E8OB 2Q86A 3D69B 4JJ5A 3KYKH 1FZKA 4JANB 4K3JH 1QNZL 3BMVA 1FN4B 5I73B 1C16A 3VXTA 1F4WH 4UNTA 3BDYL 4C56B 3BAEH 4G9FD 4S1QL 3E8UL 1CI5A 1SBSL 5GRJH 2D31A 2QQNL 4S2SB 2DRUA 4G6KL 4HKXA 5HYJA 3KJ6L 3OAYK 3NCBB 1RULH 2WIIB 4OZGA 4NIKB 5H2BA 2GAZB 1FZMB 3G5YA 3ILPA 3KPOB 1TXKA 5JO5B 3WN5C 5IKCB 1CT8B 5AAMA 2XIDA 3OR6B 1AHWC 3C6LD 4HBQA 4IOFC 4P2YA 2AABL 3QDAA 3QXUA 4PGCA 5LXGL 3WUWA 1NAMH 4M4PA 4LVOC 1AGEA 3OAZK 5D1ZA 4NQEE 2X70B 1EZVX 4Y5VA 4H8WH 5I8OL 3CPLA 5IMOB 3ZKMD 5E6IB 3SDCC 3FQTA 4LQFH 4OSUL 2VDQH 2ZG2A 1D5IL 3KYMA 1UYWH 4GG6B 4QY8B 3U79A 5JR1H 3TT1L 1MF2L 4X7TA 4FG6D 5GRXG 4Q9QH 3QPQD 5AAWA 3FRUB 5J7CC 3QEGH 4X5WA 4Z5RB 1IQWL 1OAYH 2XRAH 4LBEB 3VFRA 3SHSA 4U05A 1R3IH 1T2JA 4NQEA 5C9KA 3VXRD 1NEZB 1I1AC 4OTXH 3AU1B 4KZEL 3HG1D 3HNSH 2FB4H 3QRFM 2J8UF 4PGCB 4YHML 2Z91B 3DOSA 4G8GB 2AJ3B 1AI1H 4XP5L 4X0KA 3ULUF 5C8JB 3QT2A 3HHRB 2RAMA 4X7EC 4F7TA 3BEWA 2PW1A 5FUZL 3AC0A 3H7LA 1WBYB 3RUGF 1UXSB 4ERSL 5E8DL 4OIIH 2FIKB 1YYLH 2P8LA 3KNBB 1KLUB 3MO1B 4HGKC 4ODWB 4Z9KB 2VTFA 3EDJA 2B1AH 4W6YB 1QRNB 4JEGB 4M7KL 4FFWC 2X89A 3RTQD 2CDFA 3MZGB 1CGSL 2D03L 3B8YA 4KROB 4TSCL 5C0GB 1YEKH 4BFIA 4PTUB 1F3JA 5HYJD 5GS0L 1RJLA 3SKMB 2N4IA 4X6BA 3AY4A 3R1GL 2DIJA 4LPXA 3NFSL 4P4KD 5LCVL 2BVOA 4Y4KD 1HXYB 4BZ2L 4WO4D 1LO3L 1AGBA 2YUZA 4L1DA 1NC2D 2DDQL 3P0YL 1HINL 4XVJL 5FYJH 5C0EA 5IUSA 3B6SB 2YXMA 1I4FA 1UZ6F 1A4JB 5HGHA 3HZVB 3WFDH 4PGEA 2ZUSA 4OCYL 4M6OL 2BSRA 4L8BA 1U8IB 4NQCE 2WBJD 1ZT7A 3OL2A 4NCC1 4UDUB 3AU1A 3M45A 5E8PB 1S9WA 3IVKB 1P84K 2JJUA 4NO0D 5BRZE 5E7FA 2YEZB 3NH7H 3CLFH 4DN4L 1TIUA 1DN2A 3E6HB 3WL9B 4ZS6D 1N6QL 2VDPH 3T2QA 4WWKC 4X9GA 3S4SG 1JZ4A 2A6DA 1MCFA 5C0GA 5E94B 4I48A 1Q94A 5GPRA 1YEJL 2YUWA 2WBKA 5EBMB 4P23D 3MODH 1OY3B 2DWEA 1Z5LB 1PY4A 4ODUB 4M1CD 2ZJSH 4H25B 4P23A 2JJTA 3QDJB 1K85A 3CFKB 3UAJD 5E5UB 5C0EB 3ZO0A 3DVGB 4XVUD 1AHWB 5KVDL 3IDXL 3P11L 1F6AB 3EYVB 2DN7A 4PLNC 4HWNA 1HSAA 4P9HH 4I1NB 4LASL 3NVQA 3L3DB 3UBXI 2BY0A 3IDMA 4Y88A 2ZZUT 4AEHH 4KWUA 2MNUA 3QBTB 5I6XB 1S7WB 3RWEA 1UADC 5C92A 3C8HA 1T89C 2ATPA 3U6RA 4L1HA 3BPNC 3JSSA 4R7NA 4O02H 4P2RD 2JIXB 3LHPL 5IF0B 3I6GB 1QA9B 1ORSA 5LGHH 4WTZG 3BDYH 4X6DB 1S8DA 3B43A 1I7UA 3CPLB 2VDRL 4K7PL 4WDIB 5IMOA 1A2YA 3SBWA 5DJ6B 4Q9QL 2C5DC 3MBEC 3FTGB 4ZTPH 2DTMH 4ODUA 2MWCA 3V5HA 1WLHA 3CFCH 4ORGB 1HINH 4XVJH 5FYJL 3KLDA 5CCKL 3I50L 4CUCA 5D1ZC 5F71A 1MCSA 1X6LA 3ZKSD 3GMNA 1Z0MA 5ETUA 3HLAA 5HGAB 1P9MC 3REWB 1L9NA 2Y1VA 43C9B 3B9EA 4XT1C 4B0MM 3UJIH 1BGXH 3W9DB 1FO0L 2LAAA 2MMXA 4U1SA 2ITCA 4OFKA 1F6FB 1MAMH 1D5ZA 4Z0XA 1CGUA 4LL9A 5DQDL 1INQA 1P1ZA 4JPWH 3BKYL 1P4IL 3WEXB 4GBXA 2ZUXA 3CZFB 1QLRB 2R0ZL 5CEXA 1YY9D 1T03H 4XWOC 4YZFE 3EYOA 5EUKB 4DW2H 5ACLA 2A9NH 4TNVK 3L5XH 2CIKA 1WUNT 5ACZA 1TETH 4OLUL 2WAHA 2FD6H 4C83A 1KIQA 1WT5A 3O2DA 4D9LL 1MWAB 2NTFB 5I1JL 3QFJE 4RWYL 1RUQH 3JWOC 3KYMB 1OM3H 1BX2B 5DRXB 1TLKA 2CIIA 4MCYA 2W9DL 3K2MC 4MA3B 1RJYB 1WISA 2E5EA 3OF6D 5ICYA 1UJ3B 2AJZB 5IOPA 4KK9D 4X8JB 5ESVB 4HKJB 4YHMH 4KJYA 3M17A 5BV7H 4QTHA 2EZ0D 3VDAA 1P6AB 2C4XA 5HDOA 1ZHBA 2R29L 5E6IC 3F6IA 4YHNA 3U2SA 5D7IF 2PCPA 1R5WA 1JTTA 5F88A 4YXHH 4NZDA 4AIZB 2NXZC 4JVPA 2IAMB 5C7XH 4F7PA 1CZ8L 1C7SA 1SM3L 3SN6N 3FO0L 4JRYB 1LK2A 3I6KB 4LDLB 4XNQB 4J4PA 1FIGH 2DI8A 4G8GA 1MLCA 5D7KD 4NGHL 3D25B 4MXQD 2VDQL 3FCTB 4QHUA 4HT1H 2QR0A 4W70A 1U6AL 2OCFD 2GSGA 4MQ7B 4ONGH 3G5XB 4OLEA 5IHUL 3DRTB 1OGAA 2G2RA 2HTLD 3OGOE 4Z78B 2R4RL 2A73B 3WFBL 5JNYB 1OGAD 1TCRA 3KYOA 3VXSE 3MCG1 4LLAA 2QADD 1CS6A 2J6EH 4NKDB 3G04B 2VWEC 3VRLE 3LD8C 4U6VL 1M71A 1R5WB 2J88L 2X7LB 3HNSL 3T4YA 1R0AH 4MCZA 4DJMA 3IS0X 1YEDA 1NLDL 3I75A 1FLRL 3DURA 4Q97A 4R9HA 2AXGB 2J12B 3OB8A 2NY1D 1J7VR 2VLLA 1KB5A 3QA3B 3VXMB 1A6AA 3CLFL 3LPFA 1FP5A 5D1XB 4KK8D 4PRID 3MQIA 4NUGH 4C56A 3SCMC 3HI6H 1JNHB 2DKSA 3PHSA 3DVNA 4JQVC 5BV7B 5CP7A 3L3HA 3U36B 1F2XK 1J88A 1DUYA 1FO0H 2IAMD 1D9KA 1RK0A 1FLRH 3OHXB 4FQPA 2D7TH 2GAZA 4URTB 1QFWI 1XR9A 2F54A 3GI8H 4Z7OE 1FVDB 4NN6B 4ZXBA 2NY2C 4HLZG 3LKRA 4U6YB 3VWJD 3MGTA 5KVDH 1MCNA 1NC4A 2HFFA 4N0FB 4PP1C 4LGSB 1LEIA 1CGYA 2NY6D 3OKYA 1UM4H 3BWAB 3GI9H 3QUYC 3JV5A 2DJ4A 4XCCH 3T08A 2IQAA 3MJ9A 3MODL 2CKBA 3I02A 5B22A 4X4XB 1NGQL 2YN3A 3WHE1 2QADB 4EXKA 1JTOA 2YKLH 4GQ9H 1BD2D 3MLUH 1QVOB 4Q9RL 3GJEB 3LZFH 3L3HB 2W91A 5I1IH 3BVNB 3FAXA 1IZJA 1BD2A 4ZDHB 2I25N 1KNOA 1JGEB 5K9KA 1UM4L 2A0LC 2NY0B 5E70A 3F5WB 3MRNB 2HJFA 4YX2L 1YQ2A 3IDXH 3KPNB 5T3ZE 2DQUL 4PJ8C 1NFIB 1VACB 2A6IB 1XR8B 4PJCE 1QZ1A 2V6HA 5CCKH 3VFWA 1T7VA 4RMSA 5LAXA 1S7TB 3LDBB 1IM3B 3T77B 5FYKU 5I2IA 4DCQB 2YPLA 2C3XA 1KTDB 1OCWH 3HPLA 1LEIB 1YUHA 1LO4H 2ICWJ 2E27L 4YHOL 2FBOJ 3MLZH 3P73A 3DJ9A 3HB3D 3QNZB 5IFAL 3NAAH 3GMLB 3QI9A 3ULUL 4OZIA 1HH6B 1D5MA 4S1RL 1UH3A 2GTZA 2VZUA 1JPSL 2F53A 3PL6A 4YDIH 2P5WB 1S5HB 3L5XL 3FO2B 4YDVB 4Q6YA 2XY1A 1FFRA 4JG0L 1IGIH 1T1WB 4R96B 4Z7VA 1FLTX 5DZLA 1UB6B 4R90L 5CEZH 4OKDA 5CJXA 2V17H 4HJGB 1IMHC 4JRYE 3CUPA 2PR4L 1OWRM 4GAGH 3EOTH 1Z9MA 3SGEH 4P59L 2J88H 2Y6SC 4NO2A 1NCBL 1GHFL 2PO6D 3ZT7A 2ARJQ 3QUML 1VFUA 1FRGH 1JRHH 1AXTL 5D7JD 1U8HA 4DEPC 4G42A 4GMTH 1RUPH 5I15H 3E0GA 2FX8L 3RWGB 5J89A 2WBJA 4ZSOE 4I2XA 4D0DA 4PR5A 2HRPH 1DBKL 2NW3A 1PEZA 5D1XC 1GGYA 4WJ5A 5IVXE 3WO4C 1U8PB 5I16A 3TN0C 1A4KA 2HMID 4JGJA 3FCTA 4QHUB 3CSYA 3N85H 5AYUH 1ETZA 2R69L 3CVIL 1Z9OA 4H5SB 1W0WB 1ZGLB 3N50A 2F5BH 3L3IB 1IFHL 5E6YA 4XZUB 1ZXQA 5F3BA 5T5NG 3UTQB 1QEWA 1U8KA 5E8EA 4M7LL 4R8WL 1NBYB 1RUPL 2G2RB 4HHAA 4ZO6A 4GAYA 5DGQA 5I15L 4QHLA 4MA3A 4JFOB 5DZNA 4XXDA 1T1YB 3G6JB 4JY4A 3SDAA 1ZMYA 1KELL 1TJIH 3T0AA 1G6RL 3I2CH 3ULUH 4Q2ZB 4HS3B 2DQFB 5BW7A 3SDAD 4DK6A 4WW2F 3RZWA 3L7EA 1JCKA 4HX1B 5I18H 1UKSA 3OKDA 1YEDB 4JG0H 3SGDI 1KENH 3KWWB 3MYJA 3CCHA 4DUWA 3WNPA 3HC0B 1HWHB 1T0MB 3U30B 1YN6A 3DIFB 4I2XB 3P11H 4ODHH 3QIWC 5IFJB 4O4YL 3ARVA 4F7MA 1HXMB 4MS8D 3FT4B 4EI5C 4LK4A 2UUDH 4NRYA 4AEIH 5C86A 4O58L 5JTWA 5J12B 3K1KC 1E27B 2VDNL 4PYHA 4JFEB 1YNTA 1W0WA 2H1PH 2ERJC 3O2DH 4M8QB 1ZGLA 1I1AA 1IGML 5FYJE 2Q6WA 4QRPD 5F7YC 5T3XD 3MCKB 1RZ8A 2DLHA 4YJZL 1CU4H 2ADJA 2BOCA 3GM0A 3OX8B 5CKAA 4OZHA 3IJSA 2C1OA 4U1JA 3E6FA 5CBEA 1A1OA 5CMAA 3P2TA 2X70A 2VYRE 2XG4A 4JRYD 2ENYA 4K71B 4KZDH 3MLRH 1CFQB 1KJ2A 4F3FA 4X6DA 4DZ8A 5J3HD 1T6VN 2V7HA 4YPGB 4L9LB 5K9QI 3G5ZA 5JHDD 3HFML 3ES6B 2NTSP 4M5YH 1CZ8H 4QNPF 1PFCA 1LO4L 4UT9L 2BJMH 4FQXC 3SE4C 2HWZH 2VLRA 5F1NB 5DJYA 2NR6C 2PTVA 1ZVHA 4HQQL 1IKNC 5CHNA 4I13B 2XTJB 1F5WA 3WN5A 1R3JB 3QQ4A 1U8OA 4JE4B 3MFFB 4ACPA 1JHTA 3V0AC 4F57H 1YNKH 4HXBH 4HUUB 1YEIL 1MAJA 5F7HA 5C0DA 1R3HA 1LD9A 5GGQL 3B83A 2A9ML 4YDKH 3MV11 3OWEA 4KKNA 3CCHB 1SQ2N 4L29A 1YDPA 2GFBB 5KS9E 3O81A 1GGBL 3SDDB 3R0MA 1GGCL 3GNMH 4GRWE 5DJ2B 2R1XB 2GCYA 4M9PA 3TZVA 4HS8H 3RJDA 4UZGA 1EAJA 1DLHB 5JQ6H 3NFNB 4F7EA 4E41B 4JY5L 1XF1A 1DANU 3G5ZB 3TVMC 4EUPA 4I18C 3VMOA 4H88H 4Z7UF 3U4EA 4PJBF 1FGVL 4KTDL 4UV7H 1EBAA 4K3HA 1BJMA 5JOEA 4RIRB 3RTQB 3HE7C 4KQ4H 4LSSH 4QHKI 1IEBA 4YDJB 5KSVB 1I7TA 2CKBB 4XNXH 1H9VA 4KJYB 3QFDA 2VDNH 2DI7A 4AT6A 4YK4B 1MCPH 2ICEA 3GMOB 5FF6A 1YMME 1CQYA 1MJ7H 4GRMB 2V7HB 1INDH 1OLZA 2AV1B 3IJYA 3O4OC 4DTGH 5JZ7D 2QL1A 1XF4A 1MCBA 3I6LD 2FH6A 1OTSD 1QKZH 1U42A 5IVZB 2X2YA 4LCWD 1IT9L 4ISVA 2IALB 3GGWB 5E1HB 4OCRH 4ZODA 5FO8B 3DHMA 1A47A 3IB4A 5DEFA 5MP6L 3HFMH 4JRYA 4FFYL 5DD5H 1MLCB 5GS2H 2J3SA 3DRQB 4KJPC 5HHOE 2BK8A 1E4JA 4FFVC 3SJVD 2EDBA 2B7DT 5INDA 4QNPE 5E5MB 3NIGF 4FQIL 1S78D 4MDIA 4P2RE 3RIFK 3P9MB 5TE6L 4P5TA 5DR5L 3KPQA 5IB5B 4R97C 5F7MC 1ZOXA 3O0RL 4M43H 4XAWH 3SKOA 5SX5K 1WZ1H 5FDWB 2ATKA 3NTCL 1XF2A 2WANA 4HX1A 4OT1L 4MAYB 4UQ3A 5HYQA 4H25A 4JREB 4LEXL 5D1QC 4YFLI 1S9VA 4ZS7H 2FZ3B 2EE2A 2XXMB 1D5BB 1JRHI 3H3PL 1CGWA 4M48L 3TBVA 4M1GH 4XCNA 1OQXA 3AXLB 4X99A 1XT5A 1FJ1A 5KSAC 4H1LH 3EJYC 5IW1B 3OAUH 5GHWH 1SEBB 2VDPL 1JNHA 1NDGA 4AEFA 3OXRB 3C5SA 2XN9E 4Q9BA 1S7WA 5DFVC 3TP4A 2E7HA 3CC5A 5MEOA 3KLAB 1U93A 1CG9B 3RNKA 3V4PH 3WXVH 5D7LE 2L0DA 4QGYA 4QWWC 1UKQA 4JHZA 4NBXB 1PD6A 5H8DA 4TUOA 4BSVA 3BP5B 5E95B 5DJ6A 5GGSY 3T0EE 2F58L 5F1IA 2VDML 5DURB 4HH9B 4IOIA 3SE8L 3ZSSA 3QEHA 3SQOH 3KPPB 4KI5F 1FFOA 3WD5H 5J1SC 4M6ML 3SGDH 4GRWF 4OIBA 2ZUQB 2IMMA 3QUMH 5F8QC 1IC5L 5KS9F 3IFPB 4LOUC 4GMTL 4X6EA 5HHXH 4XMPH 1X5YA 4C58B 3MRMA 3V7MA 1QRNA 5IMLA 4O02L 4OZGB 4MJIE 3QUXA 2VDKH 1CXLA 2P8MB 1I1YB 2C7UB 4F37F 1I85C 3BWUC 5F1SA 2MCPL 4D8PB 3DGGB 1MFEH 5BO1H 4JFDB 3TWCH 3K1DA 4WUUE 1UB5A 4X6CE 3ZDYF 4B50A 4NKQB 5GXBB 4K9EH 1PQZA 1XR8A 3V52H 3ULSA 4FXKB 3Q1SL 2GW5A 3WSQH 4PD4K 4PJXF 1GVIA 2O5YH 2VDOH 1BBJB 3GSUB 2AJVH 3QEHB 1XCTB 3WDJA 4HXBL 3V6FB 3KG5A 4G6ML 1VADB 2A6JA 3QUYA 4LAQH 5DQJB 2W9LA 3QDGE 5ID0B 3QEQD 1MHEA 2R4SH 3L3KB 3ZYJA 1A7OH 2VLRE 4O51A 4FQLL 3MRMB 4HDIA 3WD5L 4N8PA 4AL8H 1UM5L 1NEUA 5TF1L 3Q1SH 3NIDE 3JWDC 5KSBB 1CBVH 32C2A 1F4WL 1RURL 4YR6B 5DJ0A 3U9UA 5IW6B 5B39A 1A3LH 2DIAA 1LDPL 4PGDB 1QFWM 4PJXB 5LJYH 5F89B 5JW4N 5GGTA 4GQ9L 4Y4HD 4BZYA 3TESA 3V6ZB 2DYPD 3LKQB 1D9KC 4PP2A 4Z7QE 1JZ7A 3L5HA 5C0AA 2EC8A 5DD5L 3TYFA 1XIWB 2DM7A 2D7QA 3UXFA 2VIRB 2GIYA 4HK3N 4FZ8H 2ZNWA 4Y16D 3FB5A 5C07B 1UWXH 1SJHB 2YD4A 4F7CB 4OD3L 1NAML 2JCCA 4A6YH 1UWEH 4OUUB 1TJHL 3MA7A 3HUJA 4QOKD 6FABH 3C09B 3QULA 1FZMA 3G5YB 4XHQA 5DR5H 4QYOA 3UC0L 3CU1A 2VISB 1J1XL 2VLJD 4J3UA 1P69B 3TBTA 3W5NA 1N5YH 3ILQC 3M07A 3ZSTA 3MNWA 2JF1A 5KS9B 2ORBH 1URLA 1S5IH 4LVNB 1A2YB 1T21A 1EAPA 5FOBB 1HQ4B 4LVOB 4AT6B 2D0GA 3OXSB 5HYQB 1BP3B 1DVFC 3GIZL 2H9GA 2EEAA 4GG6A 5IJKA 4Z7WE 2VL5B 2AP2A 3D3VE 5D2LB 4XPTL 2FHFA 4PJIE 1X4YA 1X5KA 2OMBA 3I3EA 3OAUL 5J57B 5CGMA 1YY8B 2CLRB 2DLTA 3RP1A 3TYFB 4PJ7E 4PY7B 5IVZA 4JM2C 1SMAA 4PRNA 5D7LB 4CMMA 4J4PC 4JKWA 2VQUA 4GW5B 5SWZE 4ESKA 4MD0B 4AEEA 4OV5B 5E8PA 3IVKA 1NJ9B 3G5VA 5CS7A 3LQZA 4PJBB 5EPMA 2CD0A 2CH8A 1NCDL 1FL6A 4I2XE 3R8QA 1QP1A 3TNNA 3QUMB 5TE7H 1YMHB 2EKSA 2ZP0T 2YPKA 2P24A 1A6TB 1CXFA 1JNNH 5C0CB 4G3YL 3KPSD 4PJ9C 1J8HE 3P9MA 3ALPA 1MCPL 1MWAA 2HA1A 2V5SA 3GKWL 4RGMC 5H94A 3RVVC 1CF8H 2AJSL 3LH2L 4XGZA 2CGRH 2DQHL 3B4NA 1CIUA 3S5LB 1JPGB 4D0CA 3ZTJG 4PS4H 4YHLL 3ULVL 2CRZA 3BZ4B 3I02B 3SDXE 1JBJA 2FZ3A 3LKOB 3ARXA 1AKJB 4KUCD 3LVEA 3QPXL 2IBZY 3A6CH 3NCYP 2F8OA 2OK0L 5LKNA 3LS5H 4MJ6B 3ZT6A 1RZKL 4EBQH 5FKPA 4XP4H 2ADIA 1BQHA 1J05A 3MRGA 2ZOKA 2QTEA 5GGQH 4PREA 1G7PA 3MRHA 4J1UA 2GJZA 1X4XA 2O61A 4LPVA 3CH8A 1CT8A 4KZEH 2RBLA 1FZKB 1V3MA 3ABZA 5FK9A 1KBGH 4JDZB 4LVHC 4MA8H 3ZE1E 3EYFB 5D96C 2YUVA 4S1QH 1D6EB 3C60A 2BFVH 4ZO9A 3WJLA 3HI1A 4PUBH 4POZC 3D18A 4FQQB 4Z77B 2H2PD 4X4MA 2BX5A 3QNZA 3RWJA 4Z7OF 5J06A 1S9WB 2MCPH 1YEJH 1E28A 3SO5A 1KCSL 3MRQA 5D7SL 3CFKA 1CGVA 2NYYC 4PV8B 2GK0A 3EHBD 4U0RC 5SWSA 4ELKB 4D0BA 1NFDA 4HJGA 3WXWL 4WO4B 4V2BA 2DTSA 5HHMD 4HGWA 1C5DB 3MRHB 4J1UB 1P1ZB 3PF2A 4JPIB 4MJIA 1EV2E 5D5MF 3GMMB 4CJ0A 4G6MH 4LAQL 1KB5B 3SDDC 4WI3A 4X98A 5C3TA 3NMEA 4I0PC 1NKOA 3RVXC 1OHQA 1ORSB 3W0WD 5EU4A 3NFPA 5ESAA 2A6KA 1L7IL 3VFSB 1EFXA 5A1AA 1T5XB 4YHYB 5I18L 2XNAB 3V0WL 2VN4A 4CADB 4GAJH 3HR6A 3WLBA 1I8KB 3X3FL 4GFTB 5GZNC 3VH8B 2XA3A 5C0IA 4N68A 3FQWA 4XC1H 2D7PA 4LCIH 1AGDA 2HTKC 3L9RB 4DGVH 4R90H 5I66B 1OSZB 3NCJL 1MI5B 5DD3H 4X0KB 3HR5A 3OKDB 5IQ7L 1ZANL 3QUKB 4JCMA 5F72S 1CGTA 3F65A 4Z0XB 2DS4A 5TPWH 4HJJL 2B20A 3SKJL 2IQAB 5MENE 1P6FA 4NQVB 3RU8H 2JJVA 3V6ZA 4JKKA 4ZAKD 2Y5TB 3HUJF 5IM7B 4YC2B 4NRYB 1DL7L 3S34H 4S10A 5EZJA 3AXLA 5HYJB 1ZA3B 1SY6A 4RZCB 3C87A 1I1FB 1K5NB 1A9BA 2EYTB 3LS4L 1QRNE 4WO4A 2I26N 1PX4A 1U8IA 5ISZB 2YD2A 4PRAB 3AAZA 4Y5YC 3RAJH 4I9WD 1FFNB 4HV8A 5FUCC 2QQLH 3WFZA 5CD5D 4JG1H 4I0PB 5HGDA 4OZHB 3HUJB 4DUXA 4HUVA 3IFLH 5KW9H 1YQVH 1UJ3A 5BZWB 3CC5B 3F7QA 3S96A 1G6RH 5KSAB 1UVQB 4GH7B 2DQDL 5L7XH 5J9PB 4X8XA 4FFYH 1JGUH 1JWSA 2H6PB 1P9MA 3LHPH 5IWLC 5DEZA 3MV01 3QEGL 4K7FB 2WUCH 3NA4A 5C1MB 3RZCB 5DS8A 5SWSD 3CFJB 4N8CL 4WGWB 2LQRA 5CILL 1HHIB 4AIZA 4DZBB 3Q3GA 1TVBA 4HS6B 5AEAA 4F7PB 4XX1E 3EYSL 4IRZH 3VH8A 1A6AB 2OM5A 1JNLH 5I1EL 5JDJA 4WTXA 2VLJB 2EDRA 2AK1L 4YNYB 2VO5A 4L4JA 3VXPB 1FNAA 3SDCB 3GSOA 5FCUH 3I6KA 3TPUA 3TO2B 2RCSL 3PWLA 5HI4D 5GS0H 3H7BB 4E5XB 3GI8L 1XGTB 1I1YA 3M1BA 3CDCA 4H1LG 4YXLH 4GSDL 3AROA 4RMQA 4LPUA 1G7HA 4Y4KB 1WBXB 3G6DH 4P2OB 2Z91A 4RA0C 1TVHA 1P4IH 3T1WA 1T66C 1A4KB 4Y8AA 3GIVA 3GDBA 4JM2D 1U2HA 4AQOA 1D3CA 3VFVB 2AI0H 4A6YA 2C26A 5FHAL 5ISZA 3UZVB 2YD6A 4U3HA 1PAMA 1A7OL 3LN4B 4LSQH 2UWEF 1RIVH 1QO3B 5DJDA 2VQ1A 1G1YA 5ALBL 1E4WH 5A16A 2ARJB 3WIHL 2JIXA 1EGJH 4ZOBA 1YNKL 4BK5A 1DZBA 1JP5A 5E9DA 2LU3A 5GGTH 3REWA 1ZLSL 3G9AB 4GUPA 2ZCLH 2CJUH 5E9DD 3CMOL 4U2ZA 4WU5B 1PLGH 3RL1A 2OQJA 2R1YA 1S7UA 1OAXH 2UY6A 5FV2A 3SE3C 1NUDA 1V7ML 3DIFA 5IBTH 5D7SH 5KN5A 1REIA 1NMAL 3JV4A 3LKRB 5E03A 4QOKA 4C56D 1A21A 3HPLB 5E2UL 1LNUB 4Y16C 4NZUH 3LKSB 4G6AC 4JFEA 4M8QA 4PJ7A 5T1MA 1K2DA 1U2CA 5HTSA 3MNZB 3U36A 3D39B 3MV8E 1D9KD 1MIEL 3AY4C 1IKFH 5DA0B 1N5AB 3EKCA 3VXUB 3IAQA 5E5MA 5CZXC 3OF6A 4F9PA 1KJ3H 4MMZC 2AABH 4PJGA 1LK3H 1L7TH 3ME0A 2DMBA 1MCCA 4YQXH 1TNMA 1MHPL 5DWUH 5SWSE 4BK4A 3IF1A 1ZWIB 4TUKL 5ECJE 2PTTA 3LRSB 3SBWC 1VKXA 15C8L 1U3HA 4RFNC 1G9NH 4MYWB 5CILH 5GZND 2B0SL 5A2JH 1NBZA 4K8RD 4Z8FL 1MCOH 5JDSB 5DUBB 1LQSR 2E7MA 4CL7A 1OP9A 2XRAL 4HUXB 4LLMB 1AFVL 1DN0B 3L1OL 4D2NA 1QR4A 5FM8A 3D3VB 3CFDA 2XQYK 3C9NB 3RVXD 1JK8B 2ED9A 4NJAL 5DA4A 1G9NL 3X11A 3AS2A 4JM2A 4PJDF 5FECB 3CXHK 4U6TA 2GSGB 1R5VA 1QTYT 2B0SH 3O8XB 4I0PA 1F3RB 3OKMA 3KPSA 1F58L 3S96B 5IVXF 4YXLL 3ARTA 1JHLL 3BPCB 3F58H 4G3YH 1WAAE 2HT3D 4PJHF 4CW1B 4XPHL 5IB3A 1AGCB 5B8CC 1WF5A 2QHLA 1RVFL 1JUFB 2NYYD 5LWYH 3V6OC 3GSVB 4LP5A 4JZJA 1CD0A 4WWKA 5KZCD 1T04A 2RHEA 2GK2A 3RKDD 4TSAL 4NGHH 4JGMA 4MQ7A 4NM8H 1MCEA 4MLIA 1AXSB 4F80A 2H2PC 4HT1L 8FABA 3QUZD 2JB6B 3KLHC 5E2TL 4X7TB 2OL3H 1X5XA 2J4WH 4Y2OA 1DLFH 1UJ3C 4GSDH 3VFTA 1VHPA 3TVMA 2W1NA 3EAKA 3AREA 5C08D 3G04A 3T0EC 4L8SC 4ZUTB 5KVMC 5INCA 5HHOD 3MLVH 1I1FA 4RMVA 1T3FA 4QWWD 3UTQA 5BVJB 4XMKH 1UM5H 3HMWH 1H3GA 1IFHH 1Z6JT 3I84A 4XCEA 3O45A 2MQ0A 1EMTL 5KSAA 3TA3C 4R4ND 5FK9B 1IEAB 3I6LE 4HPYL 4QRTA 3QEUB 1J1OL 3NA9L 2NW3B 5KSAD 3BXNA 4GS7B 3U7YL 4WTWA 5F6HI 5FV1L 3CFDB 3LEYH 1SBBA 3D0VA 3O8XD 1H8NA 1T04B 4OFYD 2VXUH 2CIIB 3LQAC 2PW1B 5DRWA 5TGBB 5F9OL 3CFCL 3S37L 2Q20A 1IAIH 4GAYB 4PRPA 2BSTB 1YPZE 2FLRT 1F4XH 4YWGH 5JORA 3BUTA 1PY9A 4H26B 4JFFE 3VCLA 4UBDD 1IQDA 1I3GH 2CLZA 4M1DL 5D71L 3DPBA 1S78C 2CPCA 3UDWA 3MBEB 2XZAL 4DGIL 1FORH 2L7UA 5DJ8A 5BQ7B 3TBSA 1ZLUH 2BC4B 2HT2D 2YMXL 1K4CB 4NFDA 4L8DA 5IHBA 5KN5B 5AWNL 5CBAA 3AS0A 3LQAH 2SEBA 3NFNA 5TQ0L 3PDOA 4P2OD 5C9JB 1F4YH 4WHYH 2ADGB 1IAOA 3OGCA 1FORL 5MEOB 2X4RA 4JQXC 3PP4H 5BRZD 1E27A 3H9SE 1G7JB 5C0NC 1BZ7A 3BOVA 5DRWB 1T2QL 4PJFA 1FYHB 4YAQB 1U95A 2X4SA 5DRNA 1WWWX 1XGYH 4AIOA 3CH1A 1R3IL 1ES0B 3T04D 1QHPA 5D1QB 2FEDC 2YPLE 5DJDB 4HG4K 1G0DA 4WEUD 1T7YA 1OL0A 3NZHL 1PKQA 1CFNA 4ZFGL 1JZ6A 3IFOB 5D6CA 3AM8A 3P30H 3UTTD 2GSIB 4M7JL 4MXWL 2A2QT 1EVTC 3ARED 1SY6L 4I48B 3UTTA 4OAWA 1TZHB 1UYWL 3TIEA 3TEUA 4HZLA 5FO9A 2CRIA 1U8HB 2B2XL 1A7PL 1BD2E 3HC3L 3TV3H 2R0KH 2XKSA 4IMKA 3ULUE 3MACL 2C7UA 1ZGLM 4O2FA 3LQAL 3MJ7A 5EIIB 1RIUL 3RIAF 4FZEL 1JYVA 1EK3A 1WZMA 3STZA 3L3IA 4QXWA 2YD8A 4HG4J 1WK0A 1T1ZB 3EOTL 3GUTA 5FKAB 5KANI 3IDJA 2NY5L 3SCMB 4M7KH 1QFUL 2BNRD 1I3GL 2WUCL 3G6JA 1EEYA 4X7SH 5CIPB 2RJMA 4JFQB 4PJGB 5ALCH 1HHKA 3I9GH 5CINH 4XGZB 3EFFA 1B0GB 1BQLL 4WFED 5C0BD 4RRPA 1LDSA 2NR6D 4R4BA 2Q8BH 4LLVA 1I7ZA 3QEQB 4RAVA 4L4TA 3UEZA 2DL2A 5I1IL 4F15B 2PKDA 3AS1A 4HZLB 5FO9B 1NLDH 3RNQB 1G7LB 8FABB 4Y4FD 4PJ5B 2BSSA 3DETC 5IEHA 1UACH 3MUJA 3GGWA 3WE6A 4PB0H 5L2KE 2DWDB 4V1DB 1S9YA 1UFUA 2E3VA 1U41A 4MHHI 5EIIA 1RVFH 3HAEG 4HS3A 4OTXL 4KY1H 4PYGA 4JFZL 1JV5A 3LPGA 1WFOA 5EA0H 4XBEL 1DBBH 1MJ8L 1YECH 2FBJH 3ESUF 1JZ5A 3ULVE 1AO7B 3MRCA 4CDHA 3T0VA 4DKAA 4J23A 3BPCA 3MMEB 3O6KH 5ISZD 1FIGL 2AQ3A 1DLFL 2ZSWA 5I1LA 3WS6C 1BOYA 1EFQA 4CVUA 4DFIA 2VUOA 1MCHA 1UXSA 5JHDA 1GGIL 5E8DH 5DQDH 1PYWA 1NL0H 4MB4A 4AM0B 3PWUB 2ESVE 1AQDB 4NKMA 2BOCB 3OV6A 3SJVA 3L3OA 2X9XA 3RWHB 1NCUA 5CKGA 4X6DE 5EZOH 3SDAC 3X12B 3X3GL 4LQFL 3FB7A 3IU4L 2W92A 1T4KB 1J1OH 3F62A 4NHUB 3CK0L 3DARA 5GRUL 4KHTH 4KTEH 4UT9H 3PWVB 5T33L 3BSZL 2HWZL 4JO4H 4ETQB 3TN0D 4LKXB 1ZHLA 2ZSWB 3HI6L 1BBJA 2VABA 3HZVA 2EIZA 4MQSB 5GRVL 4BKLA 5KVGH 3QEUA 4JO1L 1IAII 3LIZH 2AEQL 5T1MB 4F9LA 4O51B 4DAGH 5JPMB 3HE7B 3Q6FA 2PO6C 1U3JA 5JA9A 3ALWA 3RZCD 1XZ0B 2I27N 1GH7A 3MV9A 3L3OB 1YPZA 4ODSH 3RVTD 2ARWA 4F58L 1BVLB 1CF8L 3TO4A 5D1QA 5GJTL 1ODAA 1FNGA 3BEVB 4LAJH 4WUUB 4YDKL 4BSVB 2ADFH 4IBLT 3WS3A 2EEDA 5MEQB 1ZK9A 3ISWA 2MKWA 4HCRH 5FO7B 2K1MA 4FFVD 4C59B 1ZTXH 2YD1A 4O58H 5I75B 3WCYA 4PJIA 3WIHH 3MLXL 2YD9A 3TIEB 4Q74A 2X7LA 3T4YB 3V79C 3LV3A 3HMWL 1KOAA 2BMKB 4YUEL 2YC1A 4BELD 1U58A 3B3IA 5FM5M 3RWHA 1IC4L 1JL8A 3B9AA 4L8DB 4JB9H 1HXMA 1KB9K 2XN9D 4P3DB 1YNLL 1SJVA 2DM3A 1VPOH 4RWYH 3FO0H 4ZFGH 1FZOA 3EGSA 1V7MH 4UINH 1LP9F 4PJ8D 2VB5A 4YHKL 2WINA 1C12A 1RAMA 3IJSB 2JCCE 2QJDA 1AO7D 1BQSA 3NCFB 4QRUB 3FL7A 1KTKE 5IR1B 2C3HA 3D0LB 4U1LB 3EFFB 2GT9A 3O3AB 3HE7D 4R4BB 5A43C 2AGJL 5CZKA 1RIUH 3OKKA 4XI5D 4OZIE 1P2CB 4X6CB 3O6FB 2PYED 2XXCB 2OR7A 3IXTA 2VSCA 3QUYD 3VXTB 4LQ1A 3UTTB 3PIQA 3TVMD 4ODBD 4TTDC 4D3CL 2APXA 4U1HA 3T3PF 4DUVA 3WE6B 3SJVE 1WFTA 3MV7B 1R5IA 3FB6A 2VIRA 2RFXA 2VZ3A 3KGRA 3ULVF 4ZNEE 5CEZL 3BH9A 1IGIL 3H9YA 1UA6H 3LQZB 4NHCL 4DKEL 3BKYH 1JPFB 4EN3C 3WO4B 4W6WB 3SDYL 5CP3A 3UTTE 1GGTA 1GRWA 4NWTH 4WENB 4K94H 2Y4SA 2M26A 3GFUA 4ZOEA 5KSUB 4OV6F 1F4HA 1MFEL 5BO1L 5MP6H 5FDYA 3BZEA 3KXFE 3SCMA 2IAND 1WIUA 4EUPH 5GGVH 3SCMD 4EI6B 1C8PA 1VGKB 2ZSVB 1WJ3A 4DWHA 2DD8L 5F9WB 1IKNA 4FQXD 1MEXL 2NY1C 4WW2A 4EUPB 1X5GA 2DDQH 3FO9B 3PWPA 1RIHH 4FN0A 3ARGA 2VR4A 5FGSA 1MJ7L 1QOKA 4U0RB 4P0DA 3E6HA 5J3HC 5I71B 3TIDA 1U9KA 4YBHA 1QRND 3P40A 3H2WA 2B1AL 2OMNA 1JTPA 2EH7H 3F7YB 2P5WA 2VWEE 1B0WA 5JW3L 3VD3A 1CD1B 5IP4A 1Z3GL 4CVXA 4ORZC 1KYOK 3O3BB 2YD7A 1QYGH 3W81A 3RGVD 3T3ME 3GBMH 3NIFE 4YIQB 3CXDL 2DJSA 3LIZL 3DECA 4EI5D 2OS7A 4MS8C 3GBLA 3QIWD 4QXGL 4OI7A 4RMRA 3BQUD 1C1EL 4DVRH 3O11B 1YNLH 4OCYH 3OSKA 4A2LA 4JFDD 4PJEB 4FQ2H 1NDMA 3NN8A 1EGJL 4KHTL 4U1NB 3DGGA 4Y2DA 2J8UA 3PE9A 5D8JH 2PETA 3U46A 2R56H 4K94C 5J6GA 1S8DB 5C0CD 4XXCC 5E6ID 4G7YH 2Q76A 3R1GH 4IIQA 3V52L 1KIRA 4KV5E 4X5XA 4MAUH 4R26H 5M94B 2AXFB 1YA5A 2WLYA 4OZGE 2X4PB 4ZUVA 4ODXA 5E08H 3V5HB 4QTIL 4NWUH 2DKMA 5GGUB 2YRPA 3NABL 2DM4A 5GS0D 1S7SA 4ETYA 3N1QC 4TNWF 3FONA 1QKZL 4ZOAA 3TIDB 1NGXA 3MLWH 2XFXB 5AG8A 4YHIB 1J0YA 1FJ1B 5DSCA 1TTFA 4QRPE 1K3ZA 1M4KA 3W9EA 3DX8A 4XWOD 2YD5A 1IAMA 2W38A 1MHPH 5D7JC 1BFVH 2LU7A 5I76B 3KR3L 1IL1B 3GSQA 4IMKC 2Y6SD 3RBSA 3WMSA 4P99A 1QSVA 3CD4A 3E2HB 4EOWH 2FJFA 4QRSA 3C08H 4Z7UA 4YE4L 3MCKA 3QNYB 4FHBD 3DYOA 3DLQR 1GL4B 4WFGD 5BMFH 3K8LA 2FO1A 1WAAA 3PQYE 2HFFB 4N0FA 1UGNA 3E8UH 1LE5B 5GSVA 1WTGT 1QBLH 1QBAA 3TYGL 3V0VA 1HHKB 3BJ91 2HVJA 4Y7MA 4NKIH 2HJLA 4CN1A 3LH2H 5JIIA 4UU9A 4LIQH 1KEGH 3JTTB 3VFNA 3LCYA 5EU6A 4HWUA 2X4UB 3MBED 1UCBL 1V8HA 3S37X 1HILA 4OF3A 3RWCB 4ODWA 3U7YH 3VJ6A 4GW5A 1N64L 5JUEL 1U8MA 4JQXA 5ELIA 2CDEB 1T7XA 1KTRL 1JPFA 1OAZL 4KFZC 3GM8A 3UCRA 5HDBF 4LF3A 4LHUA 2Y07L 5D2LA 3D39E 3WHE0 1FN4A 5IMKA 3BZEB 3QDME 1YEEH 4FZEH 4FS0A 1N64H 5D6DC 1UWEL 4XVUC 5JXAL 3VFGL 4MGXA 1NJ9A 3P73B 2IMNA 4QHMA 4AQ1B 1MFBH 1NCNA 2DQIL 1BFSA 3CLEH 2NY6C 4OGYL 5ID1B 4ZFOB 5IMMB 2Y7QB 5IV2A 4X6FB 4ZSOB 4NQVA 4AM0A 2MJWA 4D94A 4HS8L 4M5YL 2EDHA 2Y5TA 1E6JH 1HILB 3H7BA 4YDVA 3IAGC 5KSBA 2NY2D 5JXAH 1VPOL 4I4WA 1KELH 5IWLA 1ZAGA 4ZS6C 1M05A 3GK8H 3C08L 4MNGE 3PXJA 2P43B 1HYRC 2CRYA 3TN0A 1DFBH 3HNVL 4OLXL 4QY8A 4DKDC 2LAGB 4GBXC 4J6RL 1JPTH 1L0YA 3FQNA 4G42B 2IEPA 1Q0XL 2CKBH 2WBJC 1UWXK 3PJSB 3QYCA 5J6HB 3N85L 4PG2A 5AYUL 3SDXB 4NPYA 4UT6H 1J1XH 4X5WB 2DYPB 5TQ2L 3PHOA 3S36X 4PG2C 5HVWA 4XP4L 1LGVA 1U8JA 1RIVL 3QFJD 4F7CA 2X6MA 5KOVC 2UYLB 1D9KB 4EN3B 4OUUA 3O2VH 2Q87A 3ZDYE 1AY1H 1PSKL 4Y4KC 3G08A 2B1HH 3QO0B 3RWJB 5CGTA 1EEUA 4FQ1L 4XAKE 4D9RD 1NCWL 1QYGL 5ICZA 1H5BB 3ZKNC 1M7DA 5D9SA 4P5MB 2M8XA 3MV9B 4TYUA 5KS9A 2BDNH 5IF0A 4V2CB 4HF5H 5D71H 4ZFZA 1E4XL 4MLSA 4OM0H 5DVOA 5FM5O 3MXWL 2IPKB 4MDIB 3QXDB 4WTZA 2C3GA 1I9RH 3UTSB 1A6ZB 3QHZL 4N1HB 1RZ7L 3FQRB 4KGLA 5HPOA 2RCSH 2X4TA 4JRXB 3GB7A 1RHFA 1YEEL 3EO0B 4PJ9A 5IB4A 4WV1C 2ZCHH 2QHRL 4MXQC 3BI9X 3MRQB 3MJ6A 2YSSA 1UWGH 3FT4A 4YO0B 2IPUK 2R8SH 2ZKHL 4POYA 5KANG 5INCB 3I50H 5EOTA 2Q7NA 1VGEL 3QWQB 4AENA 4F8QA 3MRBA 1S9KC 1XCQA 4MDJB 1B2WL 2J6EA 4CJ1A 4DN4H 3FQWB 4FXLA 3X13A 5T1KB 2MHAA 3T65B 4YHZL 2X10A 3EOBB 3EOYG 2PNDA 3KLAA 2ARJA 1N3NA 4P2OA 4UQ2A 3WIIL 2VXQL 3GO1H 1I1AD 1UKTA 4LGPB 4E0RA 3FFDB 3JV6B 2EYRA 4OZFG 1ADQH 4ELMA 3VFPA 35C8H 3SO3C 1UH2A 4XVTH 3AB0C 1TCMA 4WI5A 5F7EH 1B6UA 4PJAA 1KJMA 4F2MA 4M7LH 1FNHA 1MLBA 4WCYL 1OP5H 5GSRA 2FBJL 5A2KH 4WFFD 2RGSA 7FABL 4ZNCD 1S7SB 2ESVD 3SDCD 3IFPA 2OR9L 5E9DB 2BVPA 1TTGA 1K5NA 1B88A 3UTSD 4QO1A 4H8WC 2XWBA 4HWBH 4FNLL 4PRHD 1ZHNA 3T2OA 5IQ7H 3IDGB 3T0XA 4KU1A 4ZTOL 3C6LC 3KPRD 5F88B 4UUJA 3RWFA 3JTSB 1RZGA 4HF5L 3DXAA 2NQCA 3IKKA 2AEPH 2OI9C 5DK2B 2FL5B 1M1SA 4NFBA 1MREH 1MVFA 3GI9L 1JHKH 2EEBA 1BIHA 4JQIH 3GRWL 5GGRB 2PTTB 3LRSA 4GAJL 3X3FH 5EOTB 2HAZA 2KBGA 5D5ME 2Z9TA 5HVHC 1H3TA 4F2MB 3EO1A 3EZJB 5FGBA 2YKLL 2X4NB 5DYOB 3DWTA 3MLZL 1CXHA 4HHAB 1VFOA 1HI6B 2W0FA 4JAMB 1N5YL 4EIZC 1UVQA 3V4VL 1N3NB 1P7KA 3WDHA 1JMXA 5ANME 3V9FA 4R2GB 1W8NA 5LBSH 5SX4I 3CVHB 4IHOA 1DFBL 3HNVH 3U48A 5EOQH 4ZD3H 1UEMA 4JO3H 1AQKL 4CU7A 4PB9L 3F8UB 4LLYB 4Z7VE 4RNRB 2EE9A 4GAGL 4HS6A 1G7QB 1T83C 2WNGA 3KPMB 5L6YH 2BVOB 3BQUA 1FPTH 1P5UA 1TJGH 4CBPA 3OR7B 2BOBA 3AVEA 3QJHA 1ORQA 2W65A 1IE5A 2HJKB 2AK4D 3HZYA 5DJXB 3HLAB 5HGAA 2XA8L 1G9NC 3IAPA 4J3SA 5IESL 1EA9C 4LARH 4CADA 4G7VL 1BREA 4NM4H 4PGJA 3SEPA 5FKAA 1IGFH 2KKQA 3LAFA 3DYPA 1U8QA 4JPKH 1HH6A 1T20B 3TH3T 3LPWA 3CFBB 1QO3A 4B7IA 3ARFC 3QO1A 4X8JA 5EU7E 4JRWA 2BHYA 3NTCH 4TTGA 4N5UA 4P5TB 1FVEA 5I66A 4WHCA 2VL4A 1B0GA 1AC6A 5I8CA 4XTRD 2CXGA 5ACZB 3TNMA 3QDMD 3GIVB 4NC0B 3QWRD 2QHRH 2PCPB 5EBMA 2C9AA 4XNYH 3DUSB 4WUKL 3S9DB 4ZUVB 1A5FL 2OSLA 1J11A 4XNZC 4NC1E 4YEEA 3PWJA 2CR3A 1HQRB 3S97C 2VQ1B 2KZWA 3O9WD 3KHOA 1C16B 5JW4R 3FOLA 2O5ZH 1AHWA 1E4XH 3QXAB 5C08B 3QH3A 1QBML 4WO4C 4HMDA 4UT6L 4X83A 4P4KC 3WNKA 5DMKA 5GRYA 5JR1L 1T20A 1HHGA 1WGOA 2OQJB 2R1YB 3MLTA 4BYHA 4HD9A 3OKLA 4MNGB 1R0AL 3O2VL 4I5BA 5DJ2A 3K80A 2A6IA 2DMKA 4LMQI 4Q2ZA 4XHJC 5IBLC 3RTQC 1IGCL 1RU9H 2W65B 4PB9H 3UJTL 1HDMA 3WLWC 5F1IB 4WFGE 5C09E 5FHAH 3T1FA 1F90L 5JHDB 1A7PH 1VCAA 4PJAB 5EU6D 5I8EA 3MBEA 5GS1A 1B4RA 5I30L 4O4YH 3MXWH 3NGBB 3TBSB 1ONQB 3MV7D 1T0MA 3N0PB 4OFPA 4R0LC 4TRPH 1A1NB 5D5MA 1LO0H 3EDDA 5IMLB 4XXCA 3SOBL 3LKOA 3FRUA 4X9BA 1SEQH 4CMHC 3N1GC 5I8CB 4QTIH 1DQDH 3VGAC 1MHHB 1B4JH 1HSBA 5IVXB 3K8MA 2R0LL 4MB3A 1CLYH 4WI2A 4Z95H 3VXME 1NGZB 3VRIB 4JO4L 5EC2A 3VFMB 5D2NB 3E6FB 1ZV5A 2ORBL 2IANB 2XTJC 3VXUE 1E4XI 5MERA 4GBXB 4NKOB 2F8XC 2VLLB 3QA3A 5I9QB 5CIPH 2ZWLT 1MIML 4C57C 4RAVB 1K6QH 3BUYB 3V8CA 4KK6D 1LO5A 3C8DA 3QPQC 3WUZA 3BJLA 5ESQB 5GS2D 4LARL 3MRPA 3BRDA 1KEML 3BZFB 3QDMB 4N0YH 3MLSH 3VGEA 4XZUA 2CLVA 1NMCC 4GW4A 3DV6A 4G8FB 5DI8B 4ZFOA 3QUZA 2V2XB 4P5TD 4XP1H 5CJ5A 1RMFL 4Y5VC 5LGKA 1OAQH 4GRLB 4IOFD 1OP5K 4DVBB 5JXEA 2XYCA 5E99H 1JGDA 2HJFB 3UZQA 5E2JA 4NRZB 2GJ6E 1T6WA 5BVJA 2YUXA 5FYJU 4HWBL 4GAFB 2YK1H 4PRHB 5ADPH 2E27H 5C0AB 1LEKA 3U4AA 5JQHC 3C5ZA 5IFAH 2NX5D 2W9EH 3GJFH 1OOAA 1AI1L 4JFQA 4GQPH 4E42B 3W0WE 5EC1A 3NCEB 5F44A 3GMRA 3LS4H