1L7TH

Crystal structure analysis of the anti-testosterone fab fragment
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
220
structure length
220
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFTFSRYALSWVRQTADKRLEWVASIVSGGNTYYSGSVKGRFTISRDIARNILYLQMSSLRSEDTAMYYCARAYYGYVGLVHWGQGTLVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an in Vitro Affinity- and Specificity-matured Anti-testosterone Fab in Complex with Testosterone. IMPROVED AFFINITY RESULTS FROM SMALL STRUCTURAL CHANGES WITHIN THE VARIABLE DOMAINS
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords anti-testosterone (light chain)
total genus 47
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2002-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l7tH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1l7tH01
4NYLA 1FZOA 4OBRA 4G7VH 1LEGB 1KTLA 5BV7H 1BVKB 2YS4A 1M7DA 4ODXA 1BQUA 3SEPA 3QCTL 2IBBA 5LJYH 4JAMA 5IHUL 4PP1D 3B9EA 4FQXA 3D48R 4H0IA 1FPTH 4Y16C 1N6QL 4RRPA 1W72B 3MJ9H 2HG5A 3LQAH 2YD5A 1I3VA 2EH7H 4DKDC 5CUSL 2E9IA 3DUUA 5E0QA 5E8DH 3VJ6A 3BKYH 5JW3H 4RFEA 1IGTA 1JPGB 1F2QA 5B39A 5A2FA 2NMSA 3F8UB 4K3EL 4R2GC 3HZMB 4Z7QF 3U6RB 2LAAA 3VCLB 4CW1B 4NKQB 3CFKB 3QZWA 4L3EA 4R26L 3CGTA 4KJPC 3IS0X 1EEYB 4QOKA 2ED9A 5HHXL 1PZ5A 2V7NA 1G6RL 5BVJB 3Q1SL 1LE9B 2ZUWA 1I3RB 4LDLB 5HXMA 1QSFD 2HT4C 1NCCL 4CVXB 5HYEA 3WXVL 3MLZL 1KB9J 3MBED 4BK4A 2NNAA 1B6UA 3N1FC 1PX3A 3VGDA 4DGVL 1C1EH 4E5XB 5KW9L 1T22A 3DX6B 2W9DL 5D93C 1T2JA 3F6IA 5I8OH 4N8VB 1AD9B 3RVVD 4ZUSA 2WUBH 3BH9A 5KSAC 2CDFB 1TITA 2C1PA 3QFJA 3IJSA 4F7MB 2NY1B 3L95A 4MNQE 2AJ3A 3CLEH 3GMOA 5ECJE 1C5DA 4YHLH 5KSBA 4JKPL 2D0HA 2M2DA 5HVFB 3QQ3A 4Z18A 5C08B 2R0WH 3G5YB 1YEIH 1NGZA 4HUUB 3X3GH 2X1XR 4NGHL 1HCVA 1OARL 4Z7WE 2BNRA 3QI9C 2ATKA 3ROOA 4EIZC 1KG0A 2EEDA 4KROB 4MXQC 4AG4L 3E8UH 1F45A 5T1MB 4OZFG 4XPAL 3JTTA 4G8GE 4R4BB 4P46D 4J4PA 4YQXH 5D7SL 2IWGA 1NDGA 1ZA3B 4KPHL 5EWIL 2C26A 3WJJC 1J1XH 3QT2A 2A6KB 5GGVY 5TFSH 4FQHA 5HI3D 4CN6A 3M1BA 4KZEL 2ESVD 2R2EB 3KYMB 2IPUK 5JXEC 2VTFA 3GBLA 1I1YB 2NY6C 4HPYH 1CBVL 2ZJSL 3CFCL 4KK9C 5GZND 4U6YA 2IBGA 4JY5H 4ZTOL 4PJGA 4JRWA 2UY7A 4XCNB 3RZCD 1YQVH 4R4ND 3QCTH 3V0VA 4RGMB 4ODWB 1DQQB 4R96A 4NQEB 5ID1A 5HGBB 5E2VL 4ZPVB 1XH3B 4OSUL 4DCQB 4YGAB 4HBQA 3VH8B 1UJ3C 3BZDA 3FAWA 2D7TL 5HI4D 3MRCB 4ODTL 5IVOA 1T22B 1S8DA 1DBMH 1FLRH 3GFUA 2BVOB 1FHGA 5D1XA 1WTLA 1XF3A 3IFNH 3D0LB 1C5BL 2D31A 1F90L 1MF2H 1F42A 3QDGA 3CU7A 4HKXA 4KXZH 4NQUA 2F53A 2PTTA 4NZDA 4OZHE 1OPGH 3FQXB 3WNLA 1CVSC 1OAQH 4M9PA 1KJVA 3BT2L 5CKGA 1JGUH 5DWUH 1TZHA 2P5WB 3PDOB 4X6CF 1OLZA 3FN3A 1WBZA 1BX2B 1AP2A 4PJBE 3C6LC 1LO4L 2Q86A 5BXFB 5GGSB 2HAZA 1HH9B 1NEZB 3CFEA 1CG9B 4J12A 3VXNA 3WFBL 3GJFK 4ELKB 2VLKB 4S0TD 3BEWA 3C2AL 1NFIA 4JRXB 4WJ5B 4UZGA 3IFOB 3V6FB 3KYOA 5GPRA 3UJTH 1BFVH 1IAMA 4OLZL 4D8PB 1TTFA 2UWEA 3VFGL 5J6GA 4ZOEA 1KBGL 4HZLA 1FZJA 5FV2A 3BZFB 3MCG1 2VQTA 4PJ5A 2ENYA 3KPOA 3HS0B 3SCMB 5HGAA 4ODUB 4XP4L 3SGKA 4PJIB 1QA9A 1CD8A 3VFMA 1HINL 3ARGC 4FFWC 2J8UE 3VFVB 1U8PA 1I9JH 1N5AB 2EEAA 5FUCC 4KQ3H 1EH9A 4MNQA 4HW6A 4OCRL 2Q6WB 3S35X 4HGMA 1YEFH 2QHRH 4ZUVA 1KB5B 3S96A 3OKDB 1EGJA 1I9EA 5DFVC 4N0YH 3W39A 4DK6A 4YFDB 4FTVE 3RKDD 5F9WB 1N4XL 4LQ1A 3QNYA 3H9SD 3LKOB 1NBVL 1YDPA 5DEGB 2A9ML 1Z5LA 2DRUA 3ARUA 4K3HA 4OJFL 3EFDL 5DURD 1D5IH 4NCC1 1BMGA 4WY7H 4PRPE 3UJJH 4OV6F 2AXFA 4N1EA 4QHNB 3H9SA 3SKNA 5BZDA 1IM3B 3QHZL 1YNTB 3TBVB 3CUPA 1K5NB 4G42A 5DJAA 3WKNA 1GOGA 4FXGB 1I3UA 4UIMB 1HYSD 4LK4A 4NQED 3L3HB 4ZQKB 3ZHDA 1TZHB 2P5WA 1U8JA 1ZHBA 3PDOA 4WI6A 3P4NB 5E8NA 1PD6A 3RZCB 2VH5L 4TSCH 2EYRA 3STZA 1W72L 5EZOH 5FKPA 1JJUA 2YZ8A 3ALWA 2ENSA 3IAQA 2V5TA 1QFWH 4X5LA 1LK2A 4Y19D 2E3VA 3V5KA 3EOAA 4NDMA 2ADFH 3L3IA 5E24E 1XF5B 4RMRA 3MLTA 2EZ0D 2WBJA 4PUBL 3BYYA 4X5XB 5AZEH 4Y7MA 2HVKA 4RFNB 3MRBA 2Y07H 3HZKA 1RQ5A 2XWTA 4KJWD 5IR1B 1HHKB 5D8JH 2YD2A 4KWUA 1BGXH 3MGOB 1I7TB 3WNOA 3WJJA 4L4TD 1YEGL 4X4XB 4PGCB 4HJGB 1EHAA 1JHKH 4U1HB 2QSTA 1MHHB 2XXMB 3U30B 3GSRA 4RWHA 4K23L 1E28A 1CICB 1OOAA 2IGFL 4Y4HA 1KJMB 1DTUA 4ZPTA 5D7LB 4MJ4A 3GUTB 5T3XE 2YR3A 3BN3B 3QI9A 1JWMB 4W4NA 1C8PA 3V4UH 2EICA 3ZHLA 4OLWH 4ODHH 3TZVD 1OQXA 4XNMB 2HJKA 5HGHA 1PQZA 1FIGH 5TGBB 1AH1A 3UJIL 5FUZL 2HFTA 4OKDA 4XNXH 4AENA 5J6HA 1T04B 3O0RL 5ACLA 2DJUA 5GS2D 2A9NH 4HUKB 5HI5C 3ARBB 5D7JA 3NCEB 3TVMC 4GS7C 1EAPB 1UXSB 2LABA 4TVSa 1NBZB 3DARA 1S7VA 2FO4A 1YJDL 4JY4B 2YK1L 4YDLC 4PY8I 4KZDH 3QDAA 2HRLA 2AJSH 5EUOE 3PE9A 4ETYA 1YMME 2EIBA 4MQ7B 2OSLB 3L3OB 3V95A 4PIRF 5E99H 3PUCA 2CUMA 5C07E 3G6JA 5KVDH 3UTPD 5HHMB 2ZPKL 3R8BB 1AJ7L 1NLDL 4YDIH 5D1QD 1NL0L 5SWQA 5BOPA 4YO0B 2FEEI 4RDQG 1XF5A 2O26U 5C7XH 1JHTB 2OX5A 2A6DB 4GRMB 4S1SL 5MEQA 4NN6C 5C7XL 5ERWA 3ZE0E 1DDHB 4WEBL 3NABL 4M61A 3GM8A 5TJWK 5EO1B 4ZUSB 4L9LA 35C8L 1JYVA 3W0WE 5C6TL 4H8WL 1WJ3A 2BNUB 3T0ED 4PJCA 1JPSL 1I9RH 4XP4H 5D2NC 1NFDA 1BZ7A 3UPAA 4KZDL 4I2XB 3BQUA 2A38A 1YNTA 1AHWB 3TBVA 3MCLH 4BSVA 1OP3K 1C7SA 3PQYD 3MRHA 4PLJD 2IANA 5CLTA 3UJTL 3KLAA 4NPYB 3QZWB 4CADA 5IFAL 4L4VE 1PJ9A 1H5BB 3L7FB 1G7JA 3X11B 3UP1A 3ESVF 3MLXL 1U8QA 2VAAA 3OGOE 5HGGS 4OFPA 3STLA 4KRLB 4JFEA 1KB5H 1E4KC 2VLJA 5DR5L 2G5BB 4QGYA 1UVQB 1JGUL 3H42L 1EEQA 4I77L 1KYOK 2X6MA 1Q0XL 1FYTB 1SM3H 1YEHL 5JW5A 4HQQH 5JDSB 2ZSWB 4P48A 2WK2A 1A6ZB 4F58L 3F12A 4ORGB 4PG9A 1IBGL 1CXKA 4WHDA 1A1MB 1FSKB 1M7DB 1KLUB 4J2XA 3ZDZE 5FYKL 1RY7B 5TQ2L 3VFRA 1CFNA 4ZXBA 5GS0D 2HLFC 3JUZA 2AEQL 3D3VD 3MRRA 4N8VG 1SJVA 1EO8L 4LQFL 3KPQB 1RULL 4RMSA 1JNHA 3RVWC 4C56E 1MQ8A 5JW5B 3RUGE 4ONHA 1HQRB 3QZWG 5GGSA 1L0YA 1DBAH 4PJ7F 2VLJB 4XCYA 3TIEA 2ORBH 4PJAE 1D7FA 1UQSA 2HT3C 2VR5A 4Z5RB 1YQVL 3GIZH 4NRYB 3F5WB 3DUSB 2D3VA 3ARBD 3ZKMD 1LDSA 2YBRA 3PGFL 4NUGH 2FECL 1PKQE 2MMXA 4WIQA 4XRCA 1FFNB 3UZEA 4NPYA 4F15B 1JYNA 1UA6L 3T0AA 3UTTD 3CFJA 2RJMA 4I48B 3F62A 4BSVB 4ISVB 2IH1B 3MJGX 1MVUA 3THMH 4LMQE 3C5SB 4APQC 4KPHH 2GAZA 1NBYA 5EWIH 1T1ZB 3GK8H 2VDKH 3DV6B 4OJFH 2FECI 4XWOC 5ABDE 1TXKA 3DXAE 1S7WB 2FEDC 4H5SB 5CD5C 4HS3A 4TSAH 4UV7H 1M05B 1X9QA 1IGCH 1A7PL 3N50A 3SGJC 3VA6A 2VDOL 2HVJA 4CMMB 5T3ZD 3WS3A 4UQ2A 1J8HB 1RZJL 1V7NL 3QDJB 3LS5L 4PJ5E 4R90L 1KOAA 2OJEA 5D7KE 3IDNB 4KU1A 1HSBB 4TRPH 2HRPH 3WDHA 1VGEH 3IJHB 1KN2H 5BVPL 3VFWA 4KJPD 3FKUS 5F6HJ 1GPOH 1BZ9A 1JMZA 2J12B 1KCRL 4EXPX 3P0YL 5DJYA 1U8IB 4JFZH 2ZKHL 4JHWL 4JFHE 1RZKL 3D9AH 2N7BA 4NNYB 3X13A 3MBEC 4X8JB 2R1XB 4XCFH 3WXVH 3PV6B 4R4BA 1CGWA 4PGBA 5DA4A 1DQMH 4NQXA 4B7LA 2DI8A 3UO1H 4MS8D 2W9EL 1L4IA 4YHOH 3RJQB 2VLRA 3TH2T 1S9KC 2YA1A 3TN0A 1HHIA 5KSAD 1LO3H 2VDLH 4YE4H 4M6NH 4GBXD 4W6YB 3VXME 4O5LL 3IU3B 4Q6IC 4UQ3B 5C08A 5E9DE 1F97A 5JPMB 4HWBA 1NQBA 2VDQH 4OZIB 2EXWC 5I74C 1GSMA 2ZG2A 4JKLA 4K7PX 5CMAA 1IC7H 1OP5H 3DX7B 5TE4L 1DBBL 3S4SB 1MHHA 1FPTL 4J3UA 5DT1H 1LO3L 4N90D 4LIQL 4GMTL 4HIJB 5KVEL 4ZAKB 1M1SA 2KQNA 4HS6A 1JBJA 3PWPA 2LE9A 5J12C 4U1LB 1FGNL 3HMXA 3UO1L 1EFXD 2XN9E 4F7TB 1DVFC 1T20B 4EQ2A 5IVXF 3LKPA 2HVKB 4LHUA 5D5MF 3U0WH 3D69A 5FYKD 4R4FH 2P1YA 4MZ2A 3D9AL 2VR9A 1FO0A 5DEZA 3K4ZA 3QDHA 4IM8A 1ORQA 5FECB 2Y72A 1U8HA 3CH8A 4Q6YA 5FUOL 3IU4L 4G80B 3SJVA 4KV5E 1CZ8L 4L8SA 3IJHA 4KHXL 4U0RB 4KK9D 5IB1A 5GZNC 2F9BT 1P4IL 4X4MA 2YK1H 1CLZH 4EDWL 5C0ND 3T2PA 1E6JH 4OF3A 3O8XA 5AUMA 1Q9WA 1AO7D 1U8JB 1HOCA 1ZHBB 3PHQB 5D2LE 1CD1A 1F02I 1F8TL 5DJCB 5TDNA 1X44A 2ERJC 3K0WA 5JQ6L 4J1UA 4DN3L 1TTGA 4M03A 5CBAA 4OCLC 2WP3T 4Y1AB 2XA8H 1AO7A 2Y23A 2MCG1 1IM3A 3CX5K 4JRXE 4ZUUB 1AQDA 5D4QA 3TPKA 3UYPA 1M05A 1BLNB 1ZT1B 1EDQA 5BZWB 3GMPB 5ISZE 4FZ8H 2BCKB 3AU1B 2FH6A 4XPAH 3MRQA 2B4CC 2R0KL 4MA1B 2ZG3A 2CR3A 4JO3L 1U8NA 1MFDL 4WW2F 1OAYH 2GAZB 4H1LA 4PRHE 4PRPD 2VZSA 2EDDA 4RBPH 3Q3GB 3WHE1 4LVOB 4IMLB 3GGWB 1UWGH 5KSBE 5INCB 1AKJD 4LVNB 3WL9A 1MCWM 5EOCJ 3QIWB 2NY5C 3ES6A 4N8CL 3HPLB 1GGCL 2NZIA 1OWWA 1HYRC 3IF1A 5IESH 5HDBE 4M1GL 4QXGL 1A3RL 4OCYH 3C6LD 4F3FA 1R5IB 4OI9A 4NQCA 5AZEL 1MCPH 2EDOA 3TNNB 2GJ6E 1TPXB 4G6JL 2B5IC 4N0UE 3JV6B 4OLVH 1YN7A 3IKCA 3HNSH 5IMKB 1AR1C 3PHOA 2VITA 2G75B 3RUGA 4FQCH 3FQRB 1U8LA 3EYOA 4YHZH 3ARDA 3CVHL 1SJEB 3FQUA 1KTKE 3TA3C 2VLKA 1DE4A 1OSZA 3FB6A 1LP9B 3KVQA 2JE8A 1W0WB 3D1MC 2BNQE 4L1HA 1FIEA 5IM7A 4KUZH 1IC1A 1KLUA 2ZUSA 4X6EA 4K7FA 1DQDL 4ZTPL 3PQYB 4P46B 4LVNC 3GMMA 4MAYD 2DQIH 1S9VA 5L2KD 3TWCL 5F93C 5FV1L 3FO9A 1B0RB 5HGDB 1JGDA 5DMGD 1N6VA 2GITA 4GRWB 1T1WA 1UH3A 3L3DB 1ZTXH 5D7IE 1EXUB 3AREA 5DGRA 4Y4KA 3ZTJH 3M8OH 3VG9C 4OB5H 2X89D 3FOLA 5ANME 4AH2B 5GS2H 2MFNA 4BFEA 4P2CG 3SE8H 2UWEF 2EC8A 1VGKA 1P4IH 4HUWB 4HIIA 3D2UB 4CADB 4Y4HC 4GLRI 2RBLA 1I1AD 5DEFB 5D96C 5D9SA 4JRYE 4MA3B 3DWTA 1HYSC 2WWMC 3OKOB 4LGRB 1DQTA 4U05A 3HR6A 1IKNA 4J1UB 3RVUC 4YHIA 3O3AA 3U7AA 1Q72H 4ERSL 3MNWB 4LF3B 4U6YB 4ALAH 4G8FB 1G7HB 2BNUA 4OLZH 1AKJA 3C60A 3P4MB 4L9LB 2NYYD 5CP7B 2W07A 1U3JA 1Z0NA 2FCBA 2IPKB 1BECA 4HDIA 4P2RE 3PV7A 1LO2H 2CSPA 2M8XA 5DK2B 3HR5A 3ME0A 4UB0H 2A6IA 1T2QL 1S5IH 4OD3L 5F9WC 3W0WD 3HZYA 4PJFA 1I7RA 2APVA 1DLFH 1MAML 4DZ8B 5DC4B 3RU8H 1QSVA 5F6IB 2AJUH 2CIKA 3H9ZA 1G9NL 5INDA 4F80A 1FZKA 1KPVB 3RY6C 1CCZA 1TQCB 5DS8B 1UB5A 3UBXB 4OCWL 3WHXB 1MY5A 4WCYL 3ETBF 5FYKU 3WFDH 1Z6JT 2VDMH 3BXNA 4JB9H 2WINB 2X5PA 5J6HB 4KY1H 3EOTL 3OR6B 2Z35B 4Z78B 3R8QA 4RMVA 3NCMA 2VLME 2XACC 1NANH 5HGHB 4IS6A 4POZD 4M48H 4GT7A 5DI8A 2Z31A 3C5ZC 5ELIA 2D7TH 4QTHA 2ICCA 2B7DT 1T6WA 4GMSH 4G8EB 1DUYB 5HI5D 5JOFB 1A3LL 3CU1A 4YDJB 3L5XH 4Y19B 5F3HB 3TVMD 4MHHG 1QR4A 4P2YA 4M7LH 3B5GA 1T80A 3ESUF 4Y4FB 1QFWI 2ZCLL 5EU6B 1I3RA 4RFNC 4PRDA 4JJ5B 1UWEH 5DEFA 4CKVX 4X6DA 5I1DB 4KDWA 1MCNA 4BSWA 2X1PA 3NPZB 4G6ML 3L9RA 5JMRA 4LHUD 1QNZL 1KJ2A 4TVPD 4QOKD 4UV7L 1X6NA 1G9MC 5GGRA 4M93C 2XRAL 3VWJB 3NH7H 2XWTB 5FHAL 3HMWH 2HMIC 5E2WH 3SOBH 4YBLB 4NKMB 1OGTA 4X5XA 4JG1H 4QRTA 4YQXL 1QLFA 1GHFL 3GBMH 2GITB 3TWCH 2A2QT 5I8CA 4U1SA 3V7MA 4WDIB 4Y4KB 2VLRD 1CGVA 5EOQL 5BMFH 3L3KB 4Q0XH 5FGBA 2XTJB 1N3NB 2OK0L 1ZS8A 3QIBD 1JGDB 4I5BA 4U4BA 1A6VH 5KTEH 3S3SA 1N64H 1IGFH 4X4YA 1S7WA 1UH4A 5L2JB 1FL5B 3KS0J 1J1PL 4GUPA 1G7PA 3CXDH 4JO4L 5HY9A 3SDYH 2AQ2A 1YEKL 3BMVA 3OX8A 4LSSL 2E7LC 5EO0B 3VXRB 4PJIE 1J8KA 1JNLH 1CTOA 2Y1VA 3EZJB 5FM4A 5JZ7C 4Y0GA 4H88H 2P5EB 4K9EC 3ZKXB 3RWJA 4XVSH 5IBLD 4JPVH 3ET9F 3L7EB 8CGTA 1K4CA 5E6ID 5D1XC 2I9TA 4YEEA 2VLJE 1PYWA 3EZ8A 4YHPB 3A6BL 4HIHA 1ZA6A 3RVTD 1NCCH 1W0VA 4K2UH 2VZ1A 3DJ9A 5D7JD 1NUGA 1MUJA 3IF1B 5EULV 3EO9L 3HAEA 4O02L 4JRYD 1YEFL 4GRLB 4G8GB 3SDXF 1H8SA 4XXDB 3TBSB 1MPAL 3GJEB 1Y18A 3UTSA 3MV7E 4WFFE 4KQ3L 5JIPA 3HPLA 2GK2A 2A6JB 3ZMRA 3SDAB 4JM2F 2JKXA 3WS6A 4U2YA 5GS0C 2QQKH 4IMLA 2VZUA 2Z4QA 4EN3C 2GJ6A 5TDOA 1AXSA 4HC1A 2PO6C 1SY6H 2CR6A 1A64A 4KK5D 2DYPD 2F8OA 4D8PA 1AGCA 4UDUB 1NMCB 1OF2B 5SWSA 5BS0D 3RWGB 3AU1A 3Q5YA 4JFPA 4RGNB 3O9WB 5JXAH 1ZS8B 1AO7B 2IANE 2X4RB 1IM9D 1BLNA 1ZT1A 1QYGH 2ADJA 1NC4D 3LRSA 3R06A 5I8CB 1J11A 3P9MA 2D7QA 5MI0C 4GAJH 3ARBC 3GMNA 3RFZC 1IC4L 3GSWA 1N59A 4JFEB 1FV1A 3ZKMC 1IC5L 1WBZB 1WZ1H 1ZANL 3IDYB 5IG7A 1IE5A 1FFOB 3STBA 3QULA 1DLHB 5DUBB 2JJTA 4YHKL 4L8SB 5HHPA 2RFXA 1JIBA 5I1CH 4Y2DB 1U8MA 1HHGA 4LLAA 4N8PA 3TCXA 1AQKL 2CJUH 5EZIH 4TPRH 4MA8H 4UB0L 2E6JA 2JELH 1F4AA 5KSAA 2G2RA 5KS9B 3FT4B 5IVZB 1JUFB 5KG9B 1GH7A 3V4PH 1IGYB 4X7TB 3BKCH 3MRIA 3V7AE 1AR2A 12E8L 4YGVB 3CSPA 1MF2L 1NGQL 3OB0H 5JOFA 3CZJA 4OV5B 4PB9H 3NZ8A 4ODTH 4BQ8A 4NM8L 5DDHA 5I1IH 4YHMH 3HCVA 3C8KB 4HPOL 2HT2C 3ZL4H 3MRNB 5FOBA 3CFIC 3NOIA 1VERA 3GEWB 5KANG 3OR6A 3V0AC 5F44A 4U31A 3DX7A 3JV4B 4XBEL 5L7XH 4OZIA 3HLAB 4HWBH 1F4WL 3UC0L 1AHWC 4E9LA 3PF2A 3NFNB 3CK0L 5MEND 4XNXL 5J11C 4PJDE 3UJIH 1RD6A 1X5JA 3QUKA 1N5YL 3KXFD 4H26B 3KWWB 2HLAA 2FB4H 5DDHB 3UX9B 5DHVH 5C07B 4OLWL 4PJCF 4XPBH 3TN0B 3VI4F 4HH8A 3WD5H 1FG9C 2ADGB 3UPRB 4GG8B 2X05A 4JFYA 3H9SE 2ZUXA 3D25B 5IHZA 5IJVA 3OSKA 2XI9A 4YK4C 4URTB 4S2SA 2UZYB 5E5MB 4GBXC 1T7ZA 3ROOB 3H3PL 4YPGA 5CGMA 1JYWA 3OXSB 3DHJA 1BZ9B 1PQZB 4NJ9H 4Y2DA 1S7XB 3BPCA 3OKLA 1OM3H 1HIMH 3VXQA 4OCSH 2GSGA 3T0BA 1JTTA 4X5WB 3ZYOA 5IG7B 3IJYB 5E5MA 4Z7UE 1MFAL 3O3AB 2BMKA 1EGJH 4LAJH 4YHLL 4LP4A 1A4JA 4TSAL 1A8JH 3V5HB 1EMTL 2W60B 4QXGH 4N8VA 4IOFD 4YHNA 2OP4L 3T77A 2X4RA 1IEAB 3QDMB 1X5ZA 4L4VB 5FFLA 4XGZB 2Y36H 1DSFL 5CEZD 3U9PH 5IR1A 1KJ3L 1J9CT 3GZKA 5EH1A 1CGSH 3VA2C 1MJUH 3IB4A 4EDXB 1KENL 1EXUA 2D7NA 3SBWA 3WUWB 1UWGL 25C8L 3OJ2C 4F8QA 3WFEH 3IDXH 2VQUA 5C0NC 1KXTB 2YBRB 4HXBL 1EGJL 2NTFA 2ZUTA 4GRLA 3BPLC 4R0LC 4HK0A 5E8NB 3U4BL 3T0DA 5C09B 1VADA 3W9DA 4OCSL 4FTVA 3EYFB 1A7NL 2BRRH 1W0VB 3P11H 2R2BB 5IMLA 3HMXL 4Y8DC 4EUPB 4FXGA 2LU4A 3PDGA 3BISA 3FB6B 4M1DH 4RAVB 5JPNA 5C0RH 3KPQA 4L8BB 3RUGB 1R3LA 1RI8A 2ZUVA 1NAMA 5BV7L 1JFQL 5J3HD 2X4UA 32C2A 3OKNB 1RIUH 3VG0L 4NYLB 5EUOF 1SM3L 1XF2A 1LQSR 5I1JH 3R4DA 5MEPA 4QKXB 1CDUA 1QP1A 3WIIH 3DRTA 5A2JH 4ZNCD 2OTWA 1VPOH 2ZSWA 3X14A 3U0WL 3EDJA 4OZFH 5K59E 3AB0C 2C3GA 3P2TA 4HUNB 1I8LC 4XBGB 4EVNA 3Q3GA 2FO1A 4PJBA 4XH2A 4R9HA 4EBQL 1QLFB 4X7EC 3KPOB 5ALCH 3SE4C 4RDQF 4YHYC 2DWEA 4PJXB 1Z9SA 5SWZB 1RUPL 4YHML 3VWKC 5D71L 2Z91B 3TA3D 4XNZC 3BP5A 1V5JA 1FORH 4JRYB 4M3JA 4KMLB 4N68A 2IMMA 1WFTA 3VRJA 1ERNA 5F7LB 1OSPL 2ZG1A 5C1MB 3JWDH 2YZ1A 2EYTB 5EUKB 1IEBA 5CZXC 4I1NB 3MLYL 2OS7A 4H8WH 2CPCA 2JELL 1I85C 3NCCB 1WBYB 2DWDB 5F3BB 1BJ1J 4BKLA 4AEHH 4JG0H 4MAYC 3RDTC 3HB3C 4YDJA 2H32B 4NRZB 1MI5E 5FYJD 3BX7C 4I0PD 4WUUA 5AD0B 4ZFOA 15C8L 1EFQA 5DI8B 4PD4J 4F7EB 4JM2C 4IS6B 2OYPA 3TO4C 1FO0B 1TDQA 5GS0L 5DJ8B 1CQKA 1BP3B 2DQDL 4C83A 4ZOCA 5ESAA 1DN0A 3VXMA 3N0PB 1VA9A 2FHBA 4Y4HD 1U95B 1S7TB 3BQUC 1I1AC 1KXQE 4LLMA 1KNOA 4XP6L 2AXGB 4JZJB 5FM5O 5D2NA 4MVBD 2R8SL 4KTEL 3GDBA 2WWMD 4OIIH 2CRZA 2EDEA 2YD6A 3VFNB 5HYJA 5CEZL 4M7KH 4NO5A 5LBSH 3R0MA 2QSQA 2DTML 4OZIE 3CLFL 3PL6D 4TTDD 1CDCA 3VWJD 4NO2A 2VWEC 3FFDA 2WQ8A 3HR5B 1VCAA 3OKKB 3DMMC 2FX9H 4ZYKA 8FABA 1E27B 3OAYK 3VGBA 4KJQD 3SQBA 2VDKL 5F71A 1YQ2A 1G6RB 1QFOA 4XNYH 4UTAH 5FYJU 1WWWX 4Y19E 5IEKB 4LCCA 4NQCE 1JI2A 2EDBA 3W2DH 4K23H 2NR6D 3E1F1 3TYGH 2NY2C 5J9PA 4PGBB 1E28B 2HP4A 3BPNC 3QEGL 4ZPTB 2ORBL 4ZS7H 1R0AH 4U1HA 5EU6A 1FNGA 5TF1L 3M17A 3MUGB 2NX5B 4P49A 4S11A 3FT2A 4NO5B 1KC5L 1CDHA 5FGRA 5LXGH 1A02N 5MENE 3DXAA 3RX5A 4WNQB 5CCKH 3G6JF 1ODAA 3UTTE 1DBAL 4ZFFA 1B4JL 5E8OB 3EO1B 3PWLA 4P9ML 2NW3A 1IGFL 1T7YA 4V2CB 3FOLB 1S7QA 3ZT5A 3U1SL 1H0DA 1XIWA 1EIBA 3PWNA 1UZ8A 2WBJB 5AZ2H 4KGJA 2BHYA 3MV7A 1FO0L 2EDYA 3C5ZD 3RY4A 1PKQA 2F5AH 2ZOKB 3EYQD 3TZVB 4Y5YC 4GXUN 3EDEA 2R9HD 4F37K 5IMOA 1G7LA 1MCSA 1S9VB 1MREL 4XHJC 4YBQC 5D2NB 3BGMB 3WEXB 5C9JA 4NQDB 5IP4A 4HKBA 2P8LA 3NFSL 4K7FB 1OGAE 3D39B 3EHBD 3TGXA 2DI9A 2FX9L 4N0CD 2BSTB 4G42B 4PJGF 4U0QB 5I74B 3N1MC 4WENB 1T83A 5J8OA 1I4FB 4EXKA 2KL6A 4GOSA 2EYTA 1MCCA 5DJAB 3CVHB 4G6MH 2BSSB 4X9HA 5F89B 2DQHL 4W70A 2EE9A 4JDVA 3CK0H 3VRJB 4XP5L 3V79C 3QDJE 4K7PL 5FO9A 2ZCLH 3AFLA 5I75B 4LSQL 2AJZB 5DVKA 5IW6B 3MYZA 1NGYA 4JFHD 3LB6C 1YN7B 3D5OF 2Y9RT 5EBLA 1BBDH 5DK0B 5IFJB 2QSCH 5HJ3B 1GGIL 1QLRA 2MWCA 5CBEA 1KEMH 4YZFF 2X7LB 5IGXH 1UCBL 4KFZC 2Q20A 3OKOA 3VMNA 2DIJA 2NZ9D 2Q6WA 4U6HA 1QUNA 3S3JA 4U7SA 4PJIA 1EVTC 3B3IA 3LHPH 3MZGB 3KXFB 2Z91A 1HE7A 1G0YR 1NFDE 3AXLB 5ACZB 1BVKA 4NBZB 1RV6X 5DHXB 2JCCF 4XAWL 5HDBF 1G84A 3V6OA 5F9OH 4JZNB 3DNKA 1EEZB 3PQYE 2E9JA 2AJXL 1GAFH 4W81A 1WAAA 3T2OA 4KRPC 5E7BA 5L2KB 5E6IC 5D1XD 5IB5B 2O5ZH 3JWDL 5E5RB 1QRNB 1J10A 1UM6H 1IRAY 3RVTC 4NOFA 1AJ7H 1NLDH 4YDIL 2MHAA 3OTTA 1FE8L 2I07A 1CFTA 3QXUA 1HH9A 4BUGA 5LGJA 1P84K 3NTCH 3I9GH 1SEQL 4JHBA 2F5AL 5F9DC 3KPSB 3F7VB 4EI5B 4RQQB 1QKZH 3KG5A 4Z7WF 4O58L 2NXZB 3SHSA 4CBPA 5T33L 1BF2A 1K2DA 1CFVH 1KCVL 1OSZB 1Q72L 4ERSH 3DGGB 3LKQA 3MBXH 1H15B 2J5LC 5EOTA 3WUWA 3X3FL 1EZVX 4TUJB 2PO6D 4P2OA 2G75A 5MHSE 5D1ZB 4GAGL 3ZTNH 5JR1H 2QADC 3GHBH 4KK5C 2FWOB 4ZS6C 2UY6A 4EUPA 2CLVB 3BPOB 1YPZF 2R0ZL 4X7DC 4ZFZB 4HWEL 5J1SC 1F00I 3FB7A 5F6HI 1VADB 4KVCH 1A0QH 1JNNL 5T3XH 4W6WB 1MCBA 4JRXD 5DLML 2N4IA 3FJTA 3EO0A 3KNBA 2M26A 2X9XA 1J1OH 1FRGH 4JFDD 5E1AB 3CPLB 5D8JL 4YHNB 4KXZI 5TPWL 4LEXH 3WO4C 1NCWL 1QSZA 1JHTA 3NMEA 4XCNA 5LCVH 1T3FA 4I4WB 4RWYL 3RAJL 1D6EB 4ODWA 2E9WA 2R0LL 3G08B 1MFBL 4MJ6B 2BRRL 1WAAE 3BP6A 1QLEH 1BGXL 3QUXB 5I9QC 2I60H 4A6YA 3O11A 4LASL 5KOVC 5FA3A 2N56A 5BW7A 3Q6FA 1MCKA 4QHMA 5GSVA 3VRLE 5FO7A 3BP7B 1AGDB 3IDXL 1J1PH 3O6FA 3GSQA 1QBBA 2B1AH 5IBUB 3RWFB 5D1ZC 2YRZA 4MA7L 4EN3B 4M9OA 5D7JB 3QBTB 3ULUH 4XC1L 2X44D 1ZA3A 1MCLA 3P4OA 5KVMC 1I1RA 3UTSE 2ADGA 3VXSB 1Q0YH 3IDGB 4IDJH 2GFBA 3VXSD 2EDFA 3F7QA 1IGJA 2MJWA 3MLRL 5ALBL 1WSST 2IG2H 4ONFH 3VE0B 3LS4H 2I9LB 2CKBA 2GSGB 4NRXB 4I3GA 5IEHA 3FQWA 4ELMB 2ICWJ 1I7ZA 3QUKB 3PGCB 3S8WA 4YUEH 1MAKA 3DBXA 1DANT 3QQ9D 5EC2B 2WWKT 1CXLA 1VENA 1DZBA 4XWGH 4Y5VC 3IJSB 4QEGA 2XWJA 1KIUA 4N0YL 3OR7A 5EU5A 2F58L 1IL1B 4P2QE 1KCKA 5KSUB 4PGCA 4MAUH 1LEIA 3MLZH 5C0JA 5KJRH 4TSBL 5ILTL 4J8RA 4DKEH 2QLVB 3MR9A 1OQOA 1XZ0B 5D6DA 4HLJA 1WWBX 2CDEA 4Z7OE 2F74B 1J0HA 1GL4B 1P4LA 4QNPE 3JZ7A 1R24A 4L3EB 5BVJA 4PTUA 3C09B 2Y5TA 2XTJE 3QEHB 5FKAA 4PJHF 5C71A 3LY6A 5IFHL 2NLJA 4I18B 2AV7A 5DTFA 3VCLA 5EFIA 2H32H 3NACH 3KPRE 5TQ0L 4G6AD 3MRGA 4GW1B 2WSKA 4QY8A 4JGJA 4ZFGL 1ZLWK 3F5WA 2P47B 3BD5A 5C0EA 2YPKA 1OAXH 4O00A 1NGWA 3C9NB 5JUEL 5I1LB 3K8LA 3K80A 3V5DA 2YOCA 1MCOL 3WLBA 3BGFB 3C8DA 3HI5L 3ZHKA 1FNSL 4QCIA 4EN3A 1JV5A 2HG5B 4PYGA 2C5DC 3RNQB 5LWYH 2O5YL 2ZZUT 1WT5C 5TH2B 4FQXB 4Y16B 1ND0A 1JPFA 5I2IA 1HHGB 4X8XA 4RAHA 1NCDH 5FF6B 2XKNA 1DFBL 4E42B 1CQYA 3TT3L 1YYLL 3QULB 4ZFOL 4ZO7A 1CFNB 1ZV5A 3GO1H 1C5CL 3KLHC 1WGOA 3HG1D 1BZQK 3OGCB 1ZHKA 4NWUL 3O3DA 1KB5A 4TN9A 4YX2H 3MREA 4H20H 1II4E 3WS3B 5A16B 2VZVA 4OQTL 5DRZB 3AROA 3CPLA 1HEZB 1IC7L 3QUMH 2AK1L 1K3ZA 1QFUH 4GXUM 5HHVH 3AS2A 5CINL 1A2YA 4FQIL 2YRLA 3ARDD 1T4KA 5GGQH 2OZ4H 1AGCB 4YHKH 4LBEA 3S35H 3I02B 1G1CA 4F7CB 1ZLSH 2P4AB 2W9LA 4MXWL 3B5HA 5E08L 1OAKL 3TYFB 5KN5A 4RCAA 1ZKAA 5TDOB 1CLOH 4MCYB 4PRIE 1INQB 4Z76B 3EDDA 1H5BA 2VLLA 2D0FA 5DSCB 1P5UA 4XHQA 5J3HC 4ELKA 1CGSL 4NC2B 1R3IH 2IAMC 1AGBB 4JFFD 2Q86B 2L7UA 3AUVA 3GSNH 3HNTL 1IGML 1C12A 3VGGA 3BH8B 1JRHI 4JPIB 2P8LB 3O6LL 2IFFL 5E4IA 4Z7WA 1ONQB 4MSWA 2VERN 2I07B 4QXUL 4Y5XC 1QNZH 3QPXH 3PXJA 1DDHA 1RZJH 3MRFB 2HJFB 2CO7B 3VXSE 4FTVD 1CU4H 3EBAA 3BZ4A 4AG4H 2COQA 2W0LA 4HGKC 3QNZB 2V2WA 5E00B 4ZFFB 4K8RD 4F57H 3G6JB 1F2XK 1CIUA 1MI5A 2EKSA 3MXVL 4JDTH 5DA0B 1QD0A 3BIAX 5JA8B 2XZQL 1B2WL 3ARXA 1KIRB 3HNTH 3M17B 4XC3L 4JPVL 4NQVA 3D85B 3T4AA 4QOKE 1N8ZA 3A6CL 4ZXBD 4JB9L 3NCYP 1YY9C 1YEDB 3UYOD 3C2SA 3B4NA 3LEXB 5BRZA 4JM2D 1LNUA 3MNVA 4QRRD 1YEEL 2BNRE 2MQ0A 4ODVL 3QO1A 5BJTA 4X83A 4ZYKB 5GRVK 4XBEH 1H8OA 5FGBC 1F4YH 2HKHH 3P30L 2RQ8A 2OK0H 3MTRA 1D5BB 1NCNA 1WIPA 3TM6A 3QWRA 3VMOA 3KPNA 3BDYL 3FONB 3RTQD 3ARWA 3O4LA 4OZHB 1TJIH 3BQUD 2BNQD 4PBVC 1KTDA 1GHFH 4U6TA 5IJKA 1MHCA 3RZWA 2YPVL 1B6DA 1AXTL 5A43C 4OIAA 4N0UA 4I3SL 4JGUA 2Y06L 3UEZA 1K9TA 2V6HA 3MGOA 4HJ0C 4EBQH 1F8TH 4PTTA 1A5FL 2C7UA 3PL6C 1M7IA 2GTZA 4JY6B 5ESAB 4M61B 5D1QB 4GW5A 3MV7B 2ATPA 3OAZK 4F58H 3L3GA 1FNEB 1U8OB 4YDKH 1P9MA 3QA3A 5H37G 3QRGH 1N26A 2O5YH 2Z92A 1J88A 3DX8B 1X5KA 3QFJB 3ARQA 3V52H 4KK6D 4OI7A 3QHFL 3O45A 1DFBH 5EC1A 5C92A 1KPVA 2OMNA 5ID0A 2E6QA 2ZCKL 4ELMA 1ZWIB 3S3PA 4LRIC 1EV2E 2F54E 4G8FA 4DTGH 2P48B 1MHCB 2WMPA 3GI8L 5ICZB 3EOTH 4YIQB 5DZLA 5DD3H 2VOTA 5J13B 1OCWL 2VXQH 2ED8A 5GZOC 1RHHB 5T1LB 3LN4B 2A0LC 2R29H 4OCWH 3DRQA 4LAQH 3BMWA 4GRWH 1G7QA 4PG2A 3SDDB 2DLIA 3QO1B 5CP7A 1VKXA 3PJSB 1WTGT 4ZTPH 1JPSH 2ICEA 4M62H 4ZSOE 4PJXA 5GSVB 2HKHL 5JTWA 4PPTA 2AJUL 2BP3A 2PR4L 4JCMA 3FFDB 4F2MA 3IETB 3QI9B 3P0VL 2HYMA 2PTUA 2AW2A 1ZT7A 5ACMA 4LLVB 4PRHD 4XHJD 3QCVL 4GKNB 2X4NA 1SJHA 4IRJD 3EJYC 4FQCL 4R7NB 3QIBB 4JAMB 4Z7UA 4X4XA 3EW3B 1UKSA 3S5LA 2EDNA 4WFGE 2X70A 3A6BH 1SEBB 5HGAB 4GO6B 3SCMA 5J1AA 5ENWB 3RTQA 1XGRA 2WV3A 4G9FE 4G3YH 2X4UB 3MRBB 2OR9L 4PJDA 2UWEB 1CK0L 4OM0L 4CJ0A 1F11B 3MYJB 4XWGL 1W0WA 5GRUL 3MLTB 2FLRT 4MXVF 4WV1B 5IUSA 5FAAA 2R69L 3IKKA 7FABL 3ARDB 1I1FA 4UINH 5AAWA 4MCZB 4RX4D 3LB6D 1MCDA 4RAUB 3CX5J 5ITBH 2EDKA 1K8DA 5IW1A 1JF6A 1T0MA 3ULVH 4YPJA 1OD9A 4EI5A 1OM3L 3F7VA 5DD5H 2R56L 3U46B 4C4KO 5EIIB 1JZ5A 5IQ7H 3HE7B 3ULUL 3P3YA 4PJHE 3SPVA 1M6OB 1D5XB 1ZTXL 1MRDH 1KT2A 3GMLB 1IGMH 3WL9B 1T03L 1FSKC 2DLEA 4XVUC 4WW1A 1S9YB 4QRPE 2APWA 3E2HB 3JUYA 1X6LA 1F4XH 2R15A 2DM7A 1RMFL 1R3IL 5SX5H 1CXIA 3QDGB 2IALA 4JZNA 1MFBH 4OFYD 1E6JL 1ADQH 3RAJH 4X4ZA 2BVOA 4BQ6A 3OZ9L 2DKUA 1ZVSA 1TJGL 3MJ7A 1ZGLB 1CICC 4FQQB 1T4KB 3ZE0F 3DROA 3WJLA 5E8PA 5C8JB 4QWWC 1WIOA 3GMPA 5KAQG 5FUOH 2X4NB 3SDXA 2W0FB 4N9OB 3ARFA 3ECBB 3DRTB 1Q9LA 1BHGA 4Y89A 4DJMA 4E41E 1HN1A 1U8KB 4UILH 4K3JL 5LGHH 4UT7H 2AKRA 3U4EA 4OM0H 4A6YL 4PRAA 2QJDA 2DQCL 4U6XB 3U7YH 4AMKL 4QRUA 4X99B 1YMMB 1FL6A 2FEEL 4FN0A 5I6XB 3V6BR 4Y16A 1A9BB 2VDML 1JGVH 2XKNB 4LP5A 2QADD 1MNUL 2GT9B 4JLRA 3OWEA 3PNWB 1OP5K 3U9UA 3QUZA 3HUJB 5B38G 3HC4L 2B4CL 3WLBB 3D3VA 5E56A 4IEFB 4KHTH 3I9GL 4HQQL 2GYSA 3VGEA 4TUOA 2ESVE 3A67H 1A14H 4XVTH 1Q9WB 4GXVL 5C0EB 1T0NB 1RZGA 5FYKE 1IAIL 3FRPG 4LVEA 3KWWA 4FQJL 2YN3A 2NY1C 4NT6B 4FS0A 2G60L 1IQDB 5DMKA 1H9VA 1FJ1A 3FRPA 4KGLA 1P53A 4OZIF 3NACL 1Q9OB 4P3DA 5FYLD 2VXQL 4O2EB 3REWA 4BH8A 4Q74A 5ISZB 5MERB 3ILQC 1E4JA 4KDTC 3VXTA 2JIXA 4JQXC 3CDCA 3V6OE 2GCYA 5J89A 3DX9A 1XZ0A 1ZLVH 1DBJL 1D9KC 5BVPH 3CH1A 3O2DA 2H1PL 4CVZB 5D1ZD 5C0JB 3G5XA 1LEIB 5FGSA 4F7PB 2DIAA 4I3RH 5DURB 3T77B 4WO4A 3S4SA 2IAND 1GIGL 4AEIL 3V52L 1CIDA 2MKWA 3BN9D 1NGPH 1TETH 3VH8A 4D9QD 5F97E 4DCQA 4W4OC 2XQBL 4EI5D 4XP5H 4X8JA 2NXYD 2BFVH 2PETA 1IGCL 5I71C 1W8OA 3PGCA 3SKJL 2FBOJ 4G9DB 3SO3B 4X7FC 1A4KA 5IEKA 1BAFL 3OAUL 3UYRL 4RRPG 5IEHB 3QQ9C 4PJCE 5FB8A 2ZOLB 4U2ZA 2IBZX 8FABB 2UWEE 2EDHA 4B50A 3GSXA 3QQ4B 3QDJA 4HK3J 3D25A 3DURB 5IHZB 4NN6B 3P9MB 2DQIL 1N8ZB 1RIVH 2DQUH 1WLHA 1P7KA 3LEVH 1QBLL 1JNLL 4Z7QE 1FO0H 2EIDA 2J4WH 4FHBD 2LU7A 4LSSH 2DKSA 1YJDH 2W65A 4C57C 3KAAA 3ZYZA 1DQLH 4YXLL 2D2OA 3CXDL 3O6FB 1BFOB 1PW3A 3BUYB 4HS8H 1WITA 2YD9A 2BVUA 4D9LH 4LLMB 4OZGE 1S7TA 4YHOL 5C0GB 3CVHH 5F7MC 1F58H 4U6XA 3G5YA 4A6YB 1VFBA 1YUHB 5HYQA 3BZ4B 3A6CH 3CFJB 4GRLC 2LQRA 2P5WD 1NCAL 1KGCD 1U8KA 3MUHL 4L5FL 4ODSL 2I60L 3GMOB 4PV9B 4XMLL 2BY2A 3V9FA 4L29A 1OD7A 4G6AC 4JG1L 3BKMH 3ARFB 3CDFA 4P5TA 3SDXB 1MEXL 3MBEB 3QDGE 4MXVE 1FN4B 1U6AL 3FMGH 3KXFE 3MA7A 3F7YA 2MQ3A 4MSWB 5D5ME 3VRIB 1FAIL 1JWUA 2FHFA 4MNGE 1IEHA 3E6HB 3DSFL 3DV6A 5C0BE 2I25N 4HMEA 3WBDA 4DVRL 1A6UL 2PKDA 4RGMC 4DFHA 1A7BA 4ZFZA 4K8RH 3RA7H 1VSCA 1T66C 1VFUA 4RZCB 5KS9A 1EEYA 1EERB 1P5VA 4LVHC 1MFDH 3QPXL 4PJGE 2NY5H 4P23B 5GS3A 5EO0A 3VXRA 3X12B 3KLHD 4O9HL 5B38A 2C3WA 2DIBA 2DQEL 1CFVL 5SWZA 4S1DC 5T1LD 2RAMA 1R5VB 5F88A 1UXWB 5DJXB 4M8VA 3DUUB 1MVFA 2FR4B 5EOCH 4X6FA 4O51A 4Y2DC 1LDPL 1T0MB 3KPSD 3ZYJA 4GW4A 5DRNB 4HS8L 2D03L 1P4BH 3PXHA 2MTPA 3JSSA 3EJZC 3HZVA 4KROC 5JIIA 1UVQA 3TJEH 3MUY1 5AG9A 1FE8H 1UWXK 3MV8B 5IWLA 4MB5A 1K8IA 1RIVL 2DQUL 1J0ZA 1U3HB 1ZSDA 1RZ7H 4KI5E 4OLXL 5M7QA 1K3IA 3QUYA 32C2B 5DVOA 2EH8H 3QFDB 1KJ2B 2IAMD 5ANMA 2DJSA 1JPFB 1PDKA 1NBVH 4PV8A 5E2JA 3S5LB 3VFPA 3VXMD 4RISL 3QNXB 1N4XH 3D2UD 3NAAH 1RVFL 3RNQA 1JV5B 1U91B 1OGAD 5JOPE 1BJ8A 4YX2L 3LRHA 4YFLF 4NBXB 5GRXG 4GMTH 4OCRH 1CFSA 2YPLB 5KVDL 2UVEA 1DUYA 5DZOA 5DK0A 3IVKB 2BJML 2VAAB 4LCUA 2VWEE 1ITCA 3H9YA 3GSUA 1HINH 3F7YB 1E6OL 4YHPA 3OBAA 1BVLB 5E1HB 5I17B 4L9DA 3HRZB 5ITFB 1YPZE 2VDQL 1CGTA 4LAQL 5IIEA 1Q0XH 1A9EB 4PTUB 5J11B 2VIRB 2R1YA 4K55A 2BK8A 1L9NA 1J8HD 3I6LE 4D9RD 2IC2A 2Q8AL 4IOSD 1P1ZA 1EJOL 2HWZH 3PABB 3C2AH 2CDEB 3OV6A 5ALCL 3D87B 3T0XA 1Y0LB 4NQDA 43CAA 5DD0L 1INDL 2NY4B 2P7TB 4JQVC 3M8OL 3N1PC 3VG0H 2NY3D 4GJTB 4PLOB 4PJEA 1G7LB 3L3KA 4GXVH 3L5WB 2GKIA 4ACPA 3O4LE 1ZE3C 3SDDD 1U8OA 1JHKL 2D7MA 4R90H 3DXAB 1QVOB 1JRHH 1A7NH 3P4MA 3OKLB 3IAPA 2XY1A 1S7XA 1ZLUK 2JCCE 4R7DA 3FT2B 2R23A 3GRWA 4RA0C 3RTQC 5AG8A 4N9GB 4EUPG 3LN5A 4Z0BL 1BEYL 3ARVA 4L3EE 3QISA 4MHHI 3WFEL 4M6AA 4CUCA 4I0KA 1AC6A 1OTTD 5EZJA 4HJ0D 2NX5D 4PLKD 2CXGA 3QEGH 1AGFA 5DO2D 1VGKB 4HXBH 2PTVA 1PLGH 4MNGB 5I66A 3WNPA 4BA8A 1BQHG 3TYGL 2MKLC 2BRQA 4PJAA 3M07A 3UBXI 5IESL 1QO3A 4BZ2L 4PD4K 3W11C 4KK6C 3IFLL 3GUTA 4I4WA 4PG2C 3MFGB 2DLHA 3UTZB 3QAZC 2AEWA 1YY8B 5I18L 5EBWA 3GIZL 5LQBH 3ORJA 4NZUL 1XMWA 3ARPA 2BNQB 1S78D 4JN1H 1FIGL 1J12A 3MA9H 5CHNA 1B2WH 1RZGB 2DQEH 2A74B 2PCPA 5DJ6A 3MXVH 4GKZB 3QH3A 5IM7B 4Z9KB 4MAYB 3QUZD 4KTEH 4OIIL 2M1KA 5GZOD 4R97B 5FOJA 5C2UB 2C4FT 1VACA 2QHRL 2YN5A 1F3JA 2VE6B 5I15L 1NCWH 5J1TC 2BXYA 1A22B 5D7LE 3LPGA 5DC0A 5JHDD 2DLGA 1FCCA 4OZFA 5F7EL 5ICXB 1RUQH 1I9JL 5DXWA 2HH0L 1DJSA 4XP9L 1MFEH 1GGBH 2Z93B 2RFXB 4FQXD 3ZLQC 4ONGH 2WIIB 2BY1A 3K2UL 2VISB 2PN5A 3F7PC 1AI1L 5CIPB 1FG2A 1I8LA 2WBJC 1KBGH 4UT9L 1A6WH 1T89C 4NRZA 3TBWA 1NCBH 1MEXH 3NCFB 3VW3L 3VD4A 4IRJC 3OL2A 4FMKA 1L0QA 2ICWI 5CJBA 4BK5A 3LDBB 1B90A 3RIAK 5H35B 2CRIA 3WDIA 3NZHH 3MLXH 3HFMH 5TDPA 1BOYA 4PRBA 2CIIB 5DRWA 2DWEB 1HWHB 2DQGL 5B4MC 3NGBB 2IALB 2X1QA 3VD7A 5KVFH 3WDJA 3D18A 2C4XA 4XNQB 1MJ8H 1RUPH 3MLVH 3MV8A 1NFIB 4U6HB 3ZL4L 1U58B 1UM6L 4WUUD 4PBWD 5JIKA 1N5AA 3BSZH 4LRIA 5DRZA 2VDRL 2BJMH 4X6FB 4IJ3C 4GAYA 4TNWK 5I8EB 3RGHA 1VPOL 4HULB 4PR5B 2AK4E 4WW2B 1NGQH 3GI8H 1XT5A 4IRJB 3OHXB 3E6FA 3UTQB 4HHAA 3TBYA 4XMKH 3SKJH 3T65B 3PWPD 4MGXA 3BIBX 4XPGL 3KPRD 4M00A 4UT6H 4Z7VF 1BJMA 3FQRA 2J88L 1TLKA 3G6AA 4L4VD 3RUGF 3PHOB 3CNKA 1GJIA 3RPKA 4HKXB 2VE6A 1UFUA 2Y5EA 1ZANH 4I9WE 5SV3A 4M5YL 2H8PB 4XCEA 2HRPL 3ABZA 1BOGA 3BUTA 1YC7A 3IDJA 3OXRB 5FCSH 1Z3GH 4M7LT 5HY9B 3H9HA 5CZVL 4QWWD 1PG7H 4NC1C 1T89A 4GKSA 4Z7UB 4MX7B 4G5ZH 5C6PB 3QIBA 3MA7B 3BRDA 2AV7B 3DYOA 2ZWLT 3CVIL 4L4TE 4U1JA 4MJ5A 2X9YA 5ADOH 4R3SA 5A3ID 3PP3H 5CILL 2IEPA 3TF7C 1H0DB 1I9IH 3KYKL 3V0VB 1RAMA 4LLWA 1SY6L 3I6KB 3MODL 2LVEA 3G5VA 3V8CA 4WFGD 2Q1EA 3Q6GH 3ULUC 2EIEA 2BVYA 5C0GA 4DN4H 1TIUA 1LD9A 5DWUL 4XGZA 5M95B 3V0WH 2YUVA 4TSBH 5ILTH 3TN0D 4AL8L 3MC0A 1OPGL 1KCLA 3RA7L 4KKCD 5JMOC 2GJJA 4JVUA 2P46B 4H1LG 4P2QA 4Y1AA 4GRWE 1G7MB 2AJVL 3U7WL 2P8MB 2GTWA 1P2CA 4NNXB 1T2XA 3AREC 1JGVL 2BOBA 1CD1B 5DJCA 3ZO0A 4X5WA 2DLTA 3BGAA 3DTXB 4UU9A 4WU5B 3DBXB 1B4JH 2Y07L 4OT1H 3GMQB 5IVXE 4G8EA 1W8NA 2XTJC 5D72L 1YEKH 3BKML 3FOMB 1ZEAH 5C70A 2VMFA 4GSDL 4KKBC 4DUXA 1NCAH 2QKIA 3QUMA 4JDTL 5EU4B 1FL3A 4UIKH 4P3CH 3FN0L 4OF5A 5HVHC 2BZDA 1Q0YL 3OB8A 3L5WA 3I3BA 2JJSC 3AM8C 4R26H 5JLZB 1A6AA 1IGIL 4POUB 4YWGL 4Z95H 3M45A 3VFNA 4WU7B 4WO4B 3WUWG 5FYKH 5TQ2H 3GBML 3TV3H 1FFRA 4H5SA 1XF1A 2NTSP 3G9VA 4DUVA 4KI1A 4UTBL 1UKQA 3BWUC 3UZVB 5SV4A 3BN9C 3CH1B 4Q0XL 3DX9B 1NGZB 2Q3AA 3S36H 2OTUB 1Z9OA 4D0DA 2NXYC 5FA3B 1EHLL 1ZGLP 1DQJB 1QLEL 2CQVA 1S7RA 1MJ7H 3KPPB 3HC3L 1I3GH 4M43L 3BRFA 1H5BC 4IRSC 4JDZA 4L4TA 5LAXA 3ALXA 4LFHD 3TP4A 4X0KB 4JPKL 1GXEA 3SDXE 4JFQA 5IB2A 5TPWH 2AS5M 2IPKA 3UCRA 2PYFA 5T1DL 5FYLH 3DX6A 3VFUA 4OV5A 4XP6H 1LNUB 3MNVB 4KAQH 3HCVB 5DYOB 2QQNL 4UIKL 1CFSB 1A21A 3MOBH 1CWVA 3TIEB 4NQXB 1WCBB 3RI5F 5KVGL 3SDCC 1DUZB 2CLVA 2WANA 1Y6MR 1G0DA 1RPQA 3D6GA 1U8IA 3IFPB 4KY1L 1UWXH 3DGGA 5D2LA 1CK0H 2EE3A 4KMQA 3MRRB 3VFGH 3T1FB 5DUBA 2EIZB 1MSPA 4O58H 2AJVH 4JFFB 1MI5B 2EXYD 3DIFB 3K8KA 3IS1X 2GK0A 2XPGB 5EU7E 4DGVH 4DOHE 3FAXA 4XPHL 1YMMA 4GRLD 3VJ6B 4JFDB 3WFCL 1FFOA 3LV3A 3O8XC 4UQ2B 2JJSA 1XGQB 1MHPH 4JR9H 4OM1H 1IMHC 4YXHL 2YXMA 2JIXD 3X14B 4JVWA 2MHAB 4YFLI 2B0SL 3QG7L 1L0XA 5E8PB 5C8JA 3DETC 2O5ZL 5MEPB 3RY5A 1F13A 3D18B 5TE7L 3PQYA 2NY7H 3WSQL 1OAXL 2YSSA 4HFWB 4P9HC 4ISVA 2EH7L 1WV7T 5TDPB 3J8F7 4ZFGH 1CFQB 1LO0H 1PG7L 4PP2B 1F90H 4XI5D 2BX5A 4RAVA 1FLTX 4NBYB 3KPTA 2XQYK 1LP9E 1WZLA 1TVHB 3FHQA 4XPFL 1QQDA 3DYPA 3V6ZB 3HKFA 2DQCH 4PY7B 3DVGB 5CBEB 3TYFA 3BAEH 4CL7A 2BVQA 3ARFD 3HE7A 4UT7L 4B7IA 5GRWA 1P6FA 4X80L 4HIHB 1TJHL 4OLYH 1IM9A 2DL2A 1CLYH 4W68A 3AS0A 5KVGH 3RWIB 5KSVB 2J6EH 2DYPA 1RHFA 4P2OC 5I76A 1X3DA 5CEZE 1KN4L 1JGLL 4Q7DA 4C58B 4YHYB 5E7FA 3IDIB 4P23D 4MD0B 4JKKA 4MQ7A 3TH3T 1AXTH 1U93B 3QEQA 5CHNB 4L3ED 4I5BB 2ITCA 4P4KB 4F8TA 3GKWL 3MROB 5BO1L 1FYTA 3B9AA 3TZVA 3IDMB 4NC0B 4P59L 2D7OA 3BOVA 4YNYB 5AZ2L 3HI1B 1MI5D 3MJ6A 1NAML 3PWNB 3S9DB 3FN0H 3FO2A 3QDME 3SGEH 2VH5H 4TSCL 2K3TA 1NLBL 2XNAA 2BY3A 1KJ3H 3UAJD 5GGRB 2X4PB 3MRDA 3GKWH 5SX5K 1MCPL 2EIZA 3L9RB 4HAFA 2X4TA 5LXGL 5C0CE 3UPCA 3LKSA 4IDLA 2IANB 1NDMB 1AIFB 4I13B 5FCUL 5IJVB 2NX5A 1TNNA 4LCWB 1M4KA 5EU6E 4HH9B 3I3DA 4OGAD 3BE1L 1MFEL 2ZP0T 3N06B 3LKPB 4LHUB 4PJEE 2R2HB 5H2BB 3U2SB 3ZKND 5FK9A 5CZKA 4QHLA 3P9LA 4PRHA 4Y19A 5F3HA 5IKCB 3TFKD 2AXHA 2GY5A 1HHKA 5I1KH 3ARGB 1OAYL 3V0WL 1BM3H 4JHZA 5KSUA 1H3GA 2GI7A 4OLYL 1N0LA 5FO8A 3HG1B 1PSKL 3MNZA 2R0KH 4QF1A 1DANU 5ISZA 4BH8B 3EYSL 1HKLH 3T0EA 1HI6B 4AQ1B 1MAJA 2MCPH 3WHXA 2V17L 3QPQD 2XT1B 3H3KA 5CSBA 4CNIA 3CLFH 1Q9OA 3UTSD 2R4RL 3C60C 3MV01 3B9DA 1W2KT 2B5IB 4FXKA 3WIFA 4ENED 3VU2A 4J3TA 1RJYA 4XZUB 3ARSA 4WHTB 1CE1L 2V9TA 1NAKL 4AT6A 1N6QH 4EDWH 5MP6H 3CVIH 2E27H 3PABA 2KDGA 2GQHA 1OTTC 1D9KA 3WN5B 1UADC 5E6YA 3CUPB 3WFBH 4HKJB 4OFYA 1UB6B 2VL5A 5DJ8A 5DO2C 1LO5B 2ILLA 4M8QA 3GSQB 4ZAKC 2YC1B 4UI2A 3ULUE 1BD2E 3H7BB 1CLZL 5B8CC 5DJYB 1OTSC 1AD0A 1MIEL 3SKUD 1IZJA 2QQLL 3PL6B 1XIWC 3VFWB 3MRMA 4NM8H 3BHBB 4XMKL 3W11D 3IU4H 1BQLH 3QXDA 15C8H 4NO3B 5GGTA 2YUWA 3E6FB 4OM1L 1DEDA 4AYFA 6FABL 4Y4KC 2Y4SA 4HC1L 2J88H 2YEZA 3HNVL 3GSWB 3DTXA 4UU9B 4WU5A 2AK1H 5FEBA 4ZUVB 1KJMA 4JHAH 2FYYB 3MRKA 3ZDXF 1BQHB 1G7MA 1IVLA 1LP9F 4H20L 4OAWB 5E1AA 1OW0C 1PAMA 1QBMH 2HTLD 4JFPB 3D2UA 2ESVB 2OXGA 3QUZC 4FQLL 1KEGL 3KPLA 3HC0A 1ZT4B 1X4YA 5IB3B 5DFTA 2LTQB 1RK1B 1WZ1L 5BQ7A 3ZKXC 4Y4FC 4CDHA 4G7YL 5C0BB 1N2RA 4DQOL 3MGTA 4I0PB 1M71A 4I48A 5FYJL 2X40A 3SDAA 3ULSA 1JK8B 1RJCA 4O5LH 5CKAA 1B3JA 4MJ2A 3OJDB 4OB5L 4ZTOH 2QEJA 4M6NL 1WISA 2JF1A 4GRWF 4Z8FL 3GJEA 1G7IB 4RQQA 5DJDB 3IXAB 4PJIF 4KK8D 4PJ9D 3KPSA 2W9EH 1NAKH 2YKLL 2CLRB 1UENA 4BH7B 5C2BL 1QPPA 2DKMA 4NM4L 4JPIA 2JK5B 5FGCB 4KZEH 5TFSL 2JLLA 1HZHH 5DJDA 1I1FB 2BDNL 1KCRH 3B8YA 1RUQL 3TV3L 1A6WL 4WWKB 1AI1H 5CD3B 1OHQA 1MLCB 4WO4D 5B4MD 1HWGB 5CSZA 4O02H 5H37H 4NO0B 5GS1A 5ESVB 3QDGD 4OZ4B 5I30L 2F15A 1JTOA 3NAAL 3MOAH 4CVWA 4D9QE 5GRVL 4KJYA 3HTLX 4NQCB 5CJOH 3QXAA 3IXAA 1EUTA 1YNLL 3GK8L 2VQ1A 2H41A 1UM4L 3AMLA 3CMOH 1RURH 2O5XH 3NA9H 4WHYG 1UA6H 4U1SB 3ZKSD 1A1OB 4QRTB 4XNQA 5EU7C 3TJEL 2YD1A 1JWSB 4EDXA 3RIFF 3I3EA 4Q9RH 1TQBB 3HC0B 3KPLB 4ELMF 3MLUL 3VD3A 3GBNL 4Q9BA 4HFUH 3DRQB 3HA0A 1RHHA 4QTIH 2BNRD 3DVNB 3TCLA 1MH5B 3PG2A 4JPWL 4MA7H 3VXNB 4JJ5A 4WUKL 2W60A 1EMTH 4XTRD 4PJ8A 1G9MH 4BSJA 3JTTB 3QUYC 4FZ8L 1XGUB 1CDBA 1JZ2A 5DJ2A 4HLZH 1I1AA 4AIZA 5KZCD 5EB9A 1C08A 5L9DL 1HOCB 3PHQA 3ZTJG 4L1DA 1KTRL 1QFUL 4MYWB 5IMOB 3MRMB 2QL1A 3QJFB 2B1HL 4UUJA 1Y6NR 2D7PA 4WFFD 1CDGA 1EO8H 1UYWH 4LQFH 1T1XB 2Z9TA 5I9QB 3QA3B 1EX0A 1FNEA 3MV9E 5CJQH 5HTSA 4M5YH 1R3JA 4K07A 4E41A 5CWSB 1P4LB 3GMRB 2GTZB 3GM0A 4GG8A 1Z0MA 4HG4K 1UB5B 4Q9CA 3LIZH 3TN0C 4Z7UF 2HT4D 1YC8A 3MR9B 4X80H 4HS6B 4KKCC 4HIJA 4KVCL 1MCRA 4V1DA 2BSRA 2J8HA 4BFGA 3PWPB 1JZ6A 4ZD3H 3LH2H 1Y0LA 2GJZB 5HHOA 2A77L 5FK9B 3ARED 3H0TA 3G5ZA 1XH3A 4D0CB 2VDNL 3HZYB 1P1ZB 1CXFA 2DJ4A 1S5HA 3KPNB 5IMMA 1SYSA 2YRPA 3LOWA 4JFOA 4O2CA 3WFDL 5JIHA 5DQDH 5TE4H 4JFEE 3GB7B 2J5LB 3HG1A 3HUJF 1I1YA 4DW2H 5IROA 1P9MC 3OKMB 2HWZL 3VGAC 3VI4E 1ZAGA 4HPOH 5I1GH 3ARGA 1FDLH 1IGTB 2XG4A 3E3QC 3QI9D 4QRSB 4LCUB 3IVKA 5C6TH 1NKOA 1KEGH 1XCTA 4MXQD 3QG7H 1CS6A 3D3VB 3T3MF 5FYJE 1AY1H 4JO1L 1WUNT 3W5MA 2Q8BL 3IDMA 1E4XH 1RUAH 4GG6B 1E6OH 5HHNB 4PJ9B 5D93B 3TT1L 3P77A 1MHPL 4JR9L 4OQTA 5KG9A 4NQVB 3B8SA 4N0FA 4RISH 1CGUA 1OTUC 4LHQB 5DHVA 4LHUG 3C5ZB 1KNOB 5SWSE 3CC5B 2VL4A 2X4PA 4Q9QH 3LPFA 4D3CL 4PJ8D 3QNZA 1RZ7L 4UNTA 1P6AB 3FFCD 4IRSD 3PWUB 1MWAA 1KV3A 4X9BA 2QTEA 4MJ6A 3U4EB 4AK1A 1N59B 4D94A 2Z8VC 1MIEH 5E70A 2NY3B 1J5OL 4U1IA 3RZCC 3L95B 1J8HA 2OXHA 4R4NC 1GGBL 1UCBH 3LS5H 4K3GA 2ADJB 1B0RA 1KACB 1OAZL 3MV9A 3RVXD 5C0RL 2EDQA 4UOW0 3B9KB 3LZFH 3U0PA 5JA9A 4O51B 1RFDL 2EYRB 4OF0A 4L8CA 3MLRH 5ALBH 5HI4C 4HS3B 1T1ZA 3HMXH 1MWAH 2WBKA 1LWRA 3NN8B 2A9NL 3VI3F 1AXSB 4XAKD 5TE6H 3VFOA 1HSAB 2NQCA 1MVUB 5HBBA 3JTSA 4LKXB 2E7MA 2IPTL 4G6KL 3GSVA 2FBJL 3HZMA 4ODHL 3SPVB 1ORSB 3I85A 4B41A 2ZSVB 3O8XD 2CD0A 4G9FA 1Z5LB 1NGXA 3WYRA 1IM9B 4YH6A 5C0AE 3RBGA 2FSEB 3DUSA 2BVQB 4HJJH 4J7RA 2YD8A 3CDGA 3MLSL 5I0ZA 4LPXA 5B39G 4YAQA 5BS0E 2I9TB 4XMPH 4E0RA 3DSFH 1S9WA 2DF3A 2XA3A 1IFHL 1HEZA 1T6VN 4P3CL 1A1NB 3OGCA 4KKAC 1UM5H 3MYJA 1QA9B 3VFMB 3MGAA 3VGHA 3HS0A 4Z0BH 2YMXH 3SDYL 1DVFB 4WHCA 4HLZG 4HZLB 1B0WA 3VFRB 1UT9A 5J6GB 1SEBA 3QEUB 4LLYB 2J8UB 2BOCA 3BVNA 5GRZA 1U41A 4JPWH 1V8HA 5IB4A 2L0DA 4RMTA 4YAQB 1PX4A 3T2NH 1IT9L 5GJSL 4TOYL 2HKFL 3O3BB 5K9OB 4Q9RL 2YPKB 1XR9B 1DUZA 3H3BC 4FTVB 4EZMA 5GGSY 5GRJH 4X7SH 2JCCA 3GSNB 4QRSA 4QT5B 1U3ZA 5D7LD 5JHDE 5B3JE 5E2WL 3SOBL 5FB8B 3FRUA 5C0DA 2NLJB 4I18A 2Y6SD 5CIPH 2FIKA 3VXRD 3RPIA 2O5XL 3NA9L 4G8IA 3T2QA 1MWAL 4MJIB 4P2OD 4V1DD 4RIRB 4LCWE 4BQ9A 1U8HB 4GH7B 1D5IL 3LSOA 3JTSB 4U3CA 3AAZA 4L4TB 5LAXB 4KRPB 4QHUB 2FJFB 4HF5H 1XR8B 5IW3A 3VFOB 3D69B 4YIQA 1R24B 4KI5D 1WCBA 5L7XL 5HHOB 2R8SH 3S88H 2FX8L 4JM4H 4A2LA 1MRFH 3KPRA 4QRPD 5GGUB 4BFBD 1CZ8H 4I18C 1OLLA 3F7RA 1DBJH 4P4KD 1JN6B 3N1GC 4HUMB 5IK3A 1KPUB 5LKNA 3W81A 2DQDH 3MRPB 4XPFH 4NKOA 4I3RL 3MO1B 1I8MA 2W38A 5D70L 2GEEA 1TTUA 1RZFL 3L3GB 2NY0C 3T0VA 3BWAA 2V2TA 5HVGB 4WCYH 1FGNH 4LSQH 5GGRY 2C7UB 3EYUH 3U36A 1B88A 1LO4H 1T1YB 3HPJA 5C0FB 4U3XA 4NQDE 4WUUE 5D6DC 4KJWC 3KYMA 5DT1L 5BRZE 1EHNA 3CZFB 2ERJB 2X4SB 3KJ4C 4S2SB 5GRYA 1UH2A 1WZMA 3B83A 2W65B 1EAPA 1UXSA 1DLFL 4DZ8A 1HHHA 1RUAL 2G60H 3ZKNC 2VXVL 3QJHA 4MQXC 3X13B 1P7KB 3UZQA 2B0SH 3O3EA 4L3CB 1QYGL 1GOHA 4TNWF 3SCMC 4AENB 1OAQL 5KVFL 1A9BA 2HKFH 4ZO8A 3RL1B 3FB8A 1GOFA 3GMQA 1DBML 4HUUA 4OUOA 3GB7A 3LH2L 2Z8RA 3EDFA 1DQML 4H25A 3LQZA 3BP6B 3VWKB 1C5BH 1SYSB 4N5EC 1S5HB 1KIPA 2F53E 1T3FB 4ENEC 4R3SB 1P7QD 4JFZL 4LSUL 5CCKL 4MA3A 2D9QB 2OQJA 1GGYA 1PG7X 4JFED 5GGUA 2ARJA 4JFFE 2H9GB 2H6PA 2AXGA 1LD9B 1FZMA 3BP4B 4ZS7L 2NNAB 1U95A 3MXWH 1V3MA 2GCYB 5DRXB 2V5YA 3NBNA 1Q9KB 2YXFA 1XGPB 4PJ7E 4DKAA 4OF8A 4JREB 3O9WD 1FAIH 5F7EH 1OTSD 5BW7C 3LKQB 3ZKQD 1U6AH 3FMGL 4APQB 2E7LA 5HSFA 3QSKB 4XRCB 1KF9B 5CJXA 1FJ1B 5HGDA 3WE6B 1FNHA 4LOUD 1XF4B 3RL2A 2AV1A 3RZCA 3T8XB 4FG6C 4U7MA 4LVOC 5J0BA 4MWFA 2MPAH 1NC4A 3F58L 4PGEB 1FP5A 1I1AB 3RY6A 4TNVK 4AIZB 3GSNA 4QT5A 2K1MA 4KDVA 3HI6L 5HYIA 3C5JA 4GAYB 5IHLB 5I18H 5LQBL 3FFCE 3JV5A 2WP3O 4P5MA 3W9EB 3FQUB 4QTIL 3IFLH 4TULH 2XFXA 2NX5E 5DSCA 3PNWA 1V05A 1H3UA 1V3KA 3W5NA 1QRNA 5K9QG 3LKRB 4U1GC 2J8UA 2VLKD 1ZK9A 1INQA 3U9PL 4QO1A 1TPXC 4WY7L 1KPRA 5E6IB 1KIQA 1PLGL 1SY6A 4IRJA 1R5WA 3PIQA 1T7XA 3W39B 7FABH 2XZQH 1TZIB 1U9KA 5C0BD 4PJBB 3K4AA 4XH2B 5EN2B 2AKRB 4PP1C 2HFGH 1QRNE 3OAUH 4UNUA 3B3IB 4F57L 2CMRH 5DK3A 3C6LA 3ES6B 5HHXH 4Z7VA 3QIWA 1QFHA 2VQ1B 2GY7B 1FH5H 4NZRH 3UDWA 5J7CC 1TZIA 4B5EA 1SMAA 3P0VH 3U4AA 5MEOB 3KR3L 4EQ3A 1KPRB 4ODUA 5E6IA 3QXDB 4NO3A 3FN9A 3SJVD 4R2GD 4PRBB 3OKNA 3V6OC 2Q7NA 2HLFD 4NQSB 3ALPA 1G7QB 1DP0A 1CR9H 5FO9B 4C56B 4MB4A 3MJ9L 2PF6A 5CILH 1AQDB 2EKJA 1MFCH 1VACB 1IAKA 5F89A 1PGRB 1TVBB 1AP2B 5I1LA 4Z8FH 4NZTH 1ED3A 1NANI 2QQQA 5IHUH 1G7PB 1Z9MA 1NC4B 4FRWA 2FB4L 4X9IA 4G5ZL 2VZOA 4F33A 3RP1A 5K9JH 5K9QI 1FNLA 1KFAL 1XF4A 3RL2B 1UJ3A 2ICWB 4HK0B 2WW8A 4G7VL 3RVVC 2Q8AH 3T8XA 2AAVA 3NCJH 4MXWH 1YY8A 2A77H 3FQXA 3IRZA 1QEWA 3ZDXE 1VFAA 2Y5TB 2D9CA 3RU8L 3UTZA 1SVZA 5C0IA 3ZE2E 4FQIH 2RCSH 4P57A 4UV4L 2F5BH 1QBML 1JE6A 1F11A 1S7QB 3OF6A 2A73A 1I9RL 1GYAA 5C08E 3BP4A 1CE6A 4YC2C 4APQD 1T83C 1S8DB 1MNUH 4PB9L 5DRXA 3PWPE 5H94B 5D1XB 2KKQA 4XWOD 4I3SH 3ARYA 1T21B 4PRHB 1EK3A 2H9GA 4YDKL 2ARJB 4BJLA 2YPVH 5C0CB 4P46C 1C5CH 3HHRB 3QUYD 1S7VB 2FO4B 1IL1A 3P40A 1NBZA 1RZ8A 3U7YL 1SJHB 1N7ML 1QSEE 2A1WH 2OQJB 3P11L 1U36A 1X5XA 4PRID 1J0JA 5EC2A 4QRRA 2YEZB 1XEDA 4FQ1L 5ESQB 4HCRH 4ODBD 3KHOA 5J9PB 5LWYL 5JXED 3VRLF 4LLUB 1UZ6E 2HA1A 5EDXA 2EYSB 5BJTB 1WC7B 1V3JA 2XNAB 4NJAL 2A6KA 4G6FD 3CCHB 3REVA 1YYMH 3D3VE 1VEMA 3JWOL 5I73B 1LO5A 3S36X 2Y25A 5T1LA 2PW1A 1GGTA 4HV8A 3WFCH 1D9KB 1PVHA 3GSRB 1EZVY 1O5DT 3EUUA 1RZKH 4XC3H 2MCPL 2ATKB 1QSFE 1DL7H 3VW3H 3QIUC 2P43B 4FQ2L 4PJBF 5D7SH 1T1YA 3HPJB 5C0FA 3HE6B 3W0WA 1T7VA 1GZQB 1WT5A 4YR6A 1CI5A 4ONGL 2V2TB 4XP9H 1G9NC 2FJHA 5KSBB 1CYGA 1D6EA 2WWKO 4C83B 4CMMA 1JZ4A 1JPTL 3MJ8A 5IIEB 1JN6A 3Q48A 1YEGH 4HKZA 4MNHB 3STZB 5F1KC 1WBXA 1NKRA 2XV6B 5GISH 2CLZB 2OJZH 4Z7WB 2IFFH 2AQ3A 3BD3A 4LDEB 3I50H 3BD4A 5DJ2B 5DUMH 4M43H 1DVFD 4Y5YB 4NHUA 4HWUA 1H15A 4HGWA 4WI9A 3VG9B 3S36L 1QSEA 5A2IH 1I8KB 3S4SG 1NAMH 1OP9A 4WI4A 2VABA 2ZUQC 3K2MC 4JN2A 4Q2ZB 5I16B 3U6RA 5F9JB 5HHPB 4G8IB 4MCYA 4AH2A 5B39B 1WAAF 1KGCE 4X98A 4OFIA 4F7CA 4XBGA 4LBEB 4O2FA 3OKDA 1A1OA 1AC0A 2WAHA 3F58H 3RVXC 3VXOA 4P59H 1IZKA 3O41A 1I85A 3T4AB 1HDMA 3CDYA 5D7IB 5EO9B 4HMCA 2AI0L 5DFVD 5GGQL 2X4OA 5ANMB 1J18A 3RKDC 5DJXA 4NKDA 4NWUH 3PDDA 3HMWL 4QXTA 4Z7OF 4LLYA 5CINH 5IQ9B 3QEUA 4L8SC 2AGJH 4LCYA 3SKOA 1U3HA 1ZSDB 1T5WA 1BAFH 3QO0A 1JRHL 3BKCL 1F6AB 4WFHE 4XB8A 3ROLB 4CAGA 3TT3H 4OQTH 4KUCD 5DQJB 5B3NA 4U1MB 2HFEA 1CGYA 3QQNA 4S1QH 5JPNB 5IOPB 2VXUL 2VAJA 4MQTB 1R3LB 3MFFB 4HWEH 4PRPB 3G04A 4P5TC 5HDLA 4M7LL 3CXHK 3U83A 5DHYB 3SGJA 2FR4A 4GAGH 1GRWA 3ZTNL 3HAEB 3MPCA 3V5DB 2W92A 5MHSD 2NY0B 3DV4B 1D5MA 3OKEA 4M48L 4ZODA 4X6BA 1FFPA 2CLRA 1C12B 2AJYH 2WM0A 3UTOA 3TESA 3WE6A 2CDGB 3GSVB 5DTFB 4KKAD 4APQA 2NY7L 1CFQA 4LRNL 5CLWA 4WEUD 3ZSSA 1N0XH 1J8HE 1ZVHA 4NN5B 2F54A 3BQUB 3KPMA 2K7QA 2F74A 3QWOA 2B8OT 1BZ7B 3G6JE 1EUUA 1R3HA 1NEZG 1FL5A 1JWUB 2WIMA 2KZWA 3BW9A 4OD2B 2V7HB 3DYMA 5IB3A 1ZT4A 2FJGA 1BFOA 3BUYA 5JORA 3UROR 4LLDA 3MBEA 3FCTB 1A2YB 2VDLL 3QXWA 3RHWK 1PKQB 5ADPH 1EFXB 2YUXA 3EO9H 4NQEA 5ID1B 5HDQH 5A16A 3EFFB 3PWVB 1A4JB 2BHUA 4H25B 1MWAB 1RZFH 5SWQB 2QKIB 5CP3A 3TO2A 2DTSA 2XKSA 3TZVC 3IJYA 1MELA 3CC5A 3FOMA 2DQFB 2AI0H 2AK4A 3EYVA 4NN7B 5EBMB 4FZEL 2CUIA 5FA4A 3DOSA 1FVCB 4QHKI 1QSFA 2AJSL 1KN2L 4MLIA 1ND0B 2X10A 3WKML 5DHVB 1MJJB 4JY4A 1NDGB 3ZDYF 3ULVF 5AWNH 1A7RH 1V7NH 1XCTB 3CFDA 1WWCA 2AEIT 4WI7A 1CU4L 1T04A 2IG2L 4P4KC 5F7DB 4IIQC 3SE8L 4WHTA 1I3GL 2XTLA 5B21A 4U1NB 1A4KB 3KPSE 3U36B 1S7SB 2JB6A 3S5LG 2EDWA 1FQ9C 3ZYIA 5D6CB 4F9PC 4JFQB 1G1YA 2B1AL 3WFZA 2Z35A 3OQ3B 1MHEB 1BD2A 3G08A 3ZDYE 3QHTC 1C5DB 4TVPL 4X7SL 1I8MB 3HLAA 5CAYB 1QR1B 3WV0A 1HILA 1IQWL 5LG1A 5D6CA 5GISL 4HUVB 4TOYH 3LDBC 5HYJB 3JXAA 5DS8A 3KDMB 3UBXA 2BSRB 4LSTH 3SGDI 4MQXD 4ZSOA 3P9LB 1X5FA 4P9MH 2H8PA 3L1OL 1A6AB 3QXTA 3IRPX 1J87A 2DM4A 1A7RL 2A73B 5EU5B 4I2XE 2OZ4L 3S35L 3SCMD 1JUFA 5JHLL 3FT4A 4PLJC 2RB8A 5IVZA 5K93A 1A3LH 4YGVA 5DLMH 5C0IB 3V5KB 3QUMB 5AAMA 3IGAB 4MJIA 3NCBB 1IQDA 5TF1H 3HN3A 5EIVA 1LMKA 1XCQB 2JB5H 2R0ZH 5T33H 5DGQA 4LARL 1DL7L 3L5IA 3UTQA 3RIFK 3WJLC 3GHBL 4POZC 1X4XA 3K1KC 2DD8L 1KLFA 4N5ED 4A2MA 4AL8H 5F6IC 1CDYA 2HFFA 1XR9A 4RGND 3LRSB 3Q1SH 2P8MA 2PYEA 3HI1A 1IEBB 3P4OB 2QHLA 1TVBA 2XICA 4BZ2H 2IH3B 1QBLH 2XZAL 4CMHC 4NO0D 5E2TL 4XP1H 3UJJL 3WSQH 3DROB 4PJ5D 2PR4H 4G6KH 5D7KD 5JOPD 2V7HA 4HUWA 4K71C 5AYUL 2ICES 2QR0A 1FL6B 4P2QD 2IQAB 1CL7I 5LBSL 2CIIA 5DRWB 2HMID 1RSFA 2APBA 4PRAB 5C07D 4DGYL 4M7JL 5B8CB 1N7MH 2A1WL 2YHGA 2A6JA 3DSNA 4NC1E 1S9YA 3LHPL 3PGDA 2ITDB 3N9GH 5DD3L 5L88L 1IAIM 4FG6D 2RGSA 4GG6F 4MA1C 2X42A 4JFXA 3QXAB 3MRJB 1CF8H 1TETL 5IGXL 1I75A 1OAZH 3TO4B 3KS0H 4M6MH 1QLRB 4NRYA 1NC2D 3RWCB 3RX8A 3RBSA 4Z5RA 1P7QB 2VISA 5FYLE 2XOTA 1WZKA 4XCEB 4XCYB 3SE3C 1AXIB 1VB9A 3PWJA 4OFDA 4DKEL 2NXZD 3SDAC 2QSCL 2PXYB 2EDTA 4IRZL 5EOTB 2J7LA 5BS0B 4R4FL 3BEWB 4PGJA 5IBLC 4NP4H 1G9EA 3SQOH 3MLYH 4OLEA 1F6AA 4YZFE 1XGYH 4OZGF 1RUMH 2VLMD 4J3WA 3QIUA 3JV6A 3C5JB 4JO1H 4GKZA 5IQ9A 3O2WL 3QWRD 4PYHA 3TLRA 4LIQH 2FEDD 5CD5D 1R5IA 1U2CA 1MJ8L 3PP4H 4XVJL 1CL7H 4BH7A 5I1EH 3B2VH 3BYTA 4OFVA 3TO4A 5D7JC 3BSZL 1I8IB 5J56B 2X1WL 2DOCA 2CK0H 1RUKH 1LEKB 2P24A 3NIDE 4IHOB 4S0SD 4Y8AA 5E2UL 2C3VA 5E2TH 2ZOKA 1UGNA 4JM2A 4U7KA 1N3NA 4DW2L 3MLVL 4IDJL 3MACL 1FYTE 2AK4D 5IB5A 2PW2A 1OGTB 3NZHL 3ULSB 3U1SH 4KUZL 5DD6A 2YPLD 3MUJA 5IF0A 3EJJX 1IKFL 3BESR 2NW3B 1IGIH 3EO1A 3PWLB 4EN3D 4HEPG 5J1AB 3FTGA 3NCYS 1IAII 4NZRL 2YMXL 4JFFA 1AGFB 4AMKH 4KVNL 3OKYA 3MV11 4HWNA 4BSWB 2ZUYA 4IOIB 3MRQB 4N0FB 2GSIB 4XB7A 5B22A 2BCKA 4GS7B 3SKMA 4XCFL 2HFGL 4OBSA 4PBXA 1TZGH 4OSUH 3FO1B 3UDWC 1A6TA 4XMPL 2X7LA 1FFQA 2PYEB 4UOJA 4MS8C 1WICA 3VXUA 3EKCA 3TPUB 5F96H 4F2MB 4HUXB 3LQZB 3SE4A 5E4EC 4R7DB 3GKZA 3BHBA 5EU3A 4HJJL 3LPWA 2ICEB 3ULVD 1GGCH 3PL6A 1R0AL 4XNYL 4E41D 4HKZB 1CTNA 5EPMA 3FQNB 4P4RA 3VFSA 3M1BB 2EXWD 1EO5A 1FVDA 4G6FB 5DC9B 3E3QE 4Z78A 2W59A 4L3CA 3D39D 4KMTL 4JFOB 1YN6B 3GJFB 4JN1L 4KTYA 3AS3A 3UPRA 1I4FA 5ICZA 4OKVA 2YD3A 4NQTA 5T1MA 5A2LH 3SO5A 5C0AB 5C07A 3E8UL 3OJMB 4BFIB 4XZUA 5I6XC 1UZ6F 5IVNA 4EI6B 3VI3E 1KCUL 4UDTA 1OY3B 1YPZB 4NZUH 1RFDH 2DTMH 1JYXA 2W0PA 1A47A 1X5IA 5JQ6H 2WBWB 5CWSA 3BWAB 4PJFB 1R3JB 4E41B 5L0QC 1A6UH 4DZBB 3G6DL 4GFTB 4HDIB 1T1XA 3NIFE 2ATPB 1YMHA 5EU4A 4DAGL 1AD9A 3MNZB 2V2XB 1YJDC 4PTTB 1KPUA 2XQYG 5IKCA 4PJAF 2ADIB 3ZSTA 4N0RA 3RGVC 5AD0A 4F15C 1GAFL 3BJLA 1C08B 2FZ3A 2OI9C 5IVXA 2R2HA 1TZGL 4XPGH 4AEHL 5E03A 4QHLB 1CXEA 3MNWA 1KTDB 1ZHNA 2F8XC 1MIMH 1LE9A 3QIUD 3FO1A 4QOKB 1NDMA 4HJGA 3AAZB 1L7IH 4LCWA 3CFKA 2AEQH 3HE6C 4ZOAA 4G43B 4ZG1A 3BZEB 4XX1E 3KJ4B 4K3EH 1DBBH 2AK4B 3EYVB