5FCUL

Crystal structure of the inner domain of clade a/e hiv-1 gp120 in complex with the adcc-potent rhesus macaque antibody jr4
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
212
structure length
212
Chain Sequence
SVLTQPPSVSAAPGQKVTISCSGSSSNIGRSYVSWYQQVPGAAPKLLIYDTNKRPSGVSDRFSGSKSGSSASLAITGLQTGDEADYYCGAWDGSLNVHIFGSGTKLTVLGQPKASPLVTLFPPSSEELQANKATLVCLISDFYPGVVKVAWKADGNSVNTGVETTTPSKQSNNKYAASSYLSLTSDQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords clade A/E 93TH057 HIV-1 gp120 core
publication title Paring Down HIV Env: Design and Crystal Structure of a Stabilized Inner Domain of HIV-1 gp120 Displaying a Major ADCC Target of the A32 Region.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 46
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2015-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fcuL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fcuL01
1MY7A 1YDPB 3QQNA 1BOGA 4OZ4A 4MJ2A 2ADFH 5I75C 3EYVA 1XT5A 2DWEB 2GUOB 4KROD 4ZUUB 4HT1H 4OF0A 1KCVL 4QOKB 4Z18A 1P7KB 2P43B 3UTZB 3WS6C 4A6YA 1EPFA 3JV0A 4UQ3B 2G5RA 5LWYL 3VGAC 1P5UA 4PB9H 2ILLA 5E1AB 1J87A 2ENYA 2FIRT 5EUOF 1A3RH 3FQRA 3P4MB 3W82A 2GJ6B 3WCYA 5HHOA 1MRFH 3FZUC 2IBGA 3RTQB 5C0EB 2F54E 2I60H 1T21A 3W11D 3WKNA 4KKLC 2XZCH 3EHBC 5FIEA 5DD6B 1CDUA 1RZGA 5SWSE 4PJ7A 1ZLWK 1JTPA 3K0WA 2B0SH 3F7PC 5IT2L 2OI9B 4U6YA 3D3VA 1TETH 1Y0LA 3D0VA 5F1NB 3LZFH 1A7NH 2AXFB 5DEFB 1O5DT 1HWGB 1EEUA 4U6TA 1R0AH 4DUXA 3MXWL 3RI5F 2B7DT 4ENED 1CGUA 5FDYA 4DVBB 1MCLA 2HKHH 3DPBA 3QI9C 1NMCB 3LDBB 3QP3A 4YXHH 1YYLH 5EWIL 1T1WA 2DOCA 1CD1B 1MH5A 1QTYT 3EJJX 1HQ4B 3DGGB 4F7MB 1E6JH 2DB8A 3MRDA 2K7PA 2FCBA 3N1PC 4JKPL 5DQ9B 5E6ZA 3QDMA 4XVSL 1K2DA 2V6HA 4WUUB 1U8IB 3U46B 3VE0B 3OB0K 5IBTH 5L7XL 1ZA3B 1H8NA 4PJHF 2PYFA 4YFLI 4X4XA 5D1QA 4PTTB 4NUJB 1KELH 3VXNB 3ARWA 2P7TA 2JELL 1WWBX 1A4KB 4F2MB 2DYPD 2HFTA 2JF1A 4NQTA 4P9HC 3AFLA 1EEZB 3AY4C 5TQ2L 3BP7B 1ZT1B 4MDJB 1K3ZA 3QIBC 4EI5D 3RIAK 5CUSL 3MXVL 5HGBB 2FHBA 3VGAB 2R0LH 4M6NL 1ZHBB 4JO4L 1S7QB 2R4SL 5LBSL 5C0AB 1N0XH 3FFDB 5IMMA 5HYIA 3HNVH 2BXYA 1V3KA 2ZUSA 3CXHJ 3RVVD 1IEBA 5HI3C 2ESVD 3B9KC 4RFEA 1UWGH 4KPHH 4M7LL 1MLCB 4E9LA 1T04A 1Q72H 1QQDB 2X4NB 3EOBA 1JBJA 4AIZA 3O45B 3QIUD 5GS3A 5ID0A 3JV4B 3F6IA 2UZXB 3I6LD 3R06A 2XT1B 4PY7B 1OSPH 3C60D 4P0DA 1JNLL 2XNAA 3GSNL 3FB6A 1CGSL 5I15H 4Z7VE 5BZDA 3WFZA 1I4FB 2DQHL 1N59A 3MNZA 2IAMB 1CGWA 1OQOA 5KTEL 4NQDB 3GJEB 4HS8H 1JVKA 2HH0H 4XPFL 1OM3L 2J3SA 4ZFGH 1M7IB 4QTHA 5F9DC 1CDBA 2G60H 3ARZA 1I9RH 3QXDB 2L7JA 4WGVB 5LGJA 1G0YR 2GTWA 4PJ9D 1F4WH 4LPUA 2AEQL 2HT4C 1B0GA 1BFVH 2VITA 4JHWH 3DO7B 3WHXB 3AM8C 4BH8A 2V5YA 3PHOA 2CUHA 2DYPA 1KGCD 2GTZB 4FQHB 1XR9B 1KTKE 4MQTB 1MCSA 4FQ1L 3RBSA 4M7KH 3WN5C 5J06A 4QCIB 1CBVL 2E9JA 1FYTA 2OX5A 4FMKA 2RFXA 3CZFB 2BNUA 3IJHB 1CXHA 4LL9A 8FABA 1R24B 2XTJC 3LCYA 3O4LE 2R9HC 3TA3B 4NOBA 2X4TA 4LASH 5E2UL 4XMKL 5IJKA 3VW3L 4MA7H 1A0QL 2YZ8A 4M61B 4JPVL 4JR9H 2XKNB 4HKXB 4YWGL 5FYKE 2GAZA 3MX0A 2CDEB 4PRIB 5DRZA 1F90H 1H3PH 2LABA 5ALCH 4OI7A 1BF8A 4P2QD 3B9KB 1A6AA 5EO9A 5B38B 4JQVC 5EBMA 3BH9B 1T03H 1SYSB 3WJLA 1LILA 3QO1A 5FXCH 3O2VL 4PRHD 1DLHA 3QFJD 1KUMA 1J12A 5DGRA 1CFSB 3MFGB 3QUXD 3BYYA 2CJUL 4OF6A 4LEOB 2DKUA 2NLJA 4J6RH 5CSZA 5HDQH 3ZE1F 3O3AB 4G9FD 4CL7A 5DJCA 5JW3L 3D39B 4I0PC 5DK0B 4PG9A 5L8KB 5E1HB 1XGRB 1LMKA 2VERN 3NIGF 3CZJA 4CRPA 3S8WA 5EU6B 2AJXL 5B8CC 4GKNA 5DK2A 4M8VA 4GKZA 1L7TL 3NN8A 4Z7OE 3MREB 3X11A 3R0NA 1J0JA 4D9RE 3ABZA 2AP2A 1YJDH 1ZOXA 4U6VL 2XFXB 2ORBL 1T5WA 1FHGA 2JE8A 1QLEH 3V0WH 1NDMA 1HNGA 4K71B 2IFFL 1D5XB 2VDQL 4XNXH 4Q9RH 1NBZA 1WT5A 3W0WB 1CLOL 4FTVE 5DFWH 4ZPVA 3CFJB 1ZS8B 2W1NA 5TQ0L 4UIKL 4LLQA 1UJTA 2A6JB 2F54D 3UEZA 3ZE2E 3C8KA 5T1MB 1MCBA 4B7LA 4JFXB 4LSTL 3QBTB 3QEUB 2G9HB 3X13A 5SWSD 4M6OH 4PRPD 3MBED 5D7LA 1U8OB 2FBJL 1NC2B 1IILE 5DSCB 4G9FA 4IJ3C 4L5FH 1W0VB 2DQEL 2A83A 2Y7QA 1UCBL 2VQTA 3T65A 4L3AA 1EHAA 3U2SB 1A2YB 1GC1C 1F4YL 4QXUH 4K7PX 3A67L 3VWJB 2CGRL 4UNVA 5GRUL 1EHLH 1NBVH 5GGQH 3QA3A 4G3YL 3MCKB 4YHKL 5AAWA 4BA8A 3TCXA 1S9YA 4PP2A 4ERSL 4TNWF 3TF7C 1U8JB 1JHKH 1HZHL 3C5JA 2CK0H 1SVZA 3QWRA 3HPJA 4NJ9H 4P2RE 2FB4L 4H5SA 3HG1D 4F15C 1G9NL 5TE4L 2UZIL 1DANT 3FFCB 1JYWA 2FJFB 1AI1L 2F54A 3V4VL 2KBGA 2O5XL 3BAEL 4IDLA 2NMSA 4Y5XB 4HJJL 2HFGH 4HMEA 3SDAC 1BBDL 1HKLL 4CDHA 2F8VA 4EXPX 5SWSA 35C8L 3C6LC 3MBEA 4KJWD 4TUKL 5HGHA 4TTGA 2A9NL 1YQVH 1YPZE 5ENWB 2QKIB 5IHUH 2OZ4A 5B39A 3KWWB 1A6UH 5GSVA 3B83A 2AK1H 1A6TA 5FHBL 3VD9A 1NFIA 2I26N 32C2A 4KRPD 1OP5K 3UP1A 3TIDA 5I1AA 3ARQA 4JDVA 4YDIL 2MCPL 1MCIA 5JOFB 5LWYH 3WKML 4U1SB 4MA1C 1F5WA 3SKJH 2IMMA 5IFHL 3BISA 4IJ3B 3IKCA 4XB8A 1D3CA 4LDLB 5GQBA 5DJAB 4K55A 4Y19D 4KKCD 4P2CG 1JN6B 5HHQA 3HRZB 1DQLL 5EO0A 3TNNA 2OBGA 3B6SB 4QGYA 4IRSC 5IIEA 5DVLA 2D9QB 2R15A 4Y8AA 1MCPL 3BKML 1BQHB 1BX2A 5GJSL 1L9NA 2VTFA 3LN5B 3RVXD 3MXWH 2VLKE 1JIBA 2NY3D 4FMFA 1KIQB 1LD9A 5FYKU 1MELA 4JZOB 3V7AE 1JF6A 2G2RA 2OJEA 5EWIH 1ERNA 3AXLA 5HYSG 3K2UH 1F97A 3QFDA 5GS2H 4NKIL 4XI5C 4EN3C 4JFHE 5A2JH 2VXUH 4HIIB 4ZD3L 4RRPA 3IDMA 5L2KB 2EC9U 4KQ3H 4LHUA 3SDAB 1FNSL 5K9QI 5FYKD 2YXFA 2MPAH 4P59L 3IRZA 1R3IH 1NUFA 1MQKH 1OW0C 2WWKO 3L3HB 2HN7A 4WHDA 3P4OB 4OZGB 1FG9C 4JO3L 4Z7VA 4KTYA 2X4OA 4WHCA 2H1PL 4K8RC 5C6PB 2DM3A 3C8DA 1C08A 1QFWM 3MV8D 4Z7QE 5TQ2H 5ESAB 3S9DB 4HHAB 4CVZB 2Z8SA 1EAJA 1K3IA 4YHIA 3MXVH 3ZDYE 4OFIA 1AE6L 2ARJQ 2D0FA 2FWOB 5C8JB 1P7HL 4M6NH 2R4SH 3SQBA 1U58B 4NO5B 5LAXB 1QVOB 1VPOH 3JVGC 5CKAA 5HD8C 1JPFA 2NXZD 4ODBD 3L3KA 5C08B 5IMOB 4JM2B 4LQFL 1IM3B 4OCMC 5BV7H 3UTSD 1XZ0B 5FKPA 1ZT4A 5B21A 1I8IB 4IMKC 4FXLA 1MFBH 1JNLH 3O4LA 1CGSH 3TPUB 5LQBL 4X6FB 1DE4A 3MOAH 1HHGA 3GHEH 5H37H 2EDJA 2X4UA 3VXUE 1OM3H 1JGDB 5H94B 4X9HA 5IG7A 2IBZY 4IRZL 4MNQE 2P47B 4XCFH 5FK9B 3O8XD 3G6AA 2AEQH 5T3XH 3AAZB 4MA8L 5I1KL 4EN3B 4MAYA 2NTFB 3L6FA 5ICXA 4L4TB 4DGIL 3FMGL 4AMKH 3MMEA 1NEZA 1CBVH 4PJ5D 1G9EA 2A9ML 4GG8B 4MNHA 1U8PA 3LEYH 4KDTC 3SJVD 5IEKA 5K9KA 4L3CB 4HWEL 4JEGB 1RUQL 4HAFA 1HHHA 5IBUG 2X70B 2GI7A 3KNBB 4Z95L 3D85B 3I2CH 4OD2B 5IFAL 2X42A 5DJ6A 5E2UH 1DR9A 1R3JA 3V5KB 1G6RB 4DJMA 4TSCL 4OSUH 4XVJH 1J7VR 5B39G 4ZYKB 3CUPB 4L8SC 2E9BA 3GO1H 1OAQL 3ULUE 4XVUD 1B6UA 4NUGL 3EOAA 5TH2B 2EIDA 1PX3A 3V95A 1A9BB 1Q0YH 2X1PA 3FCTA 1WQVT 1BP3B 4XBPB 3OXSA 4FRWA 4M7ZC 4N0FB 5CMAA 4JDTL 3QULB 4JFOB 2C3VA 4MZ2A 4LVOB 1MFEL 4J2XA 3E8UL 1Q9OA 4V1DB 4WDIA 2RAMA 2CJUH 1F3RB 4FTVA 2W9DL 3T2OA 4W4OA 3JWNC 2VUOA 2R0WH 2Y07L 3CIQA 4QXTB 5IB4A 4KFZC 5IVXF 3V8CA 5DYOB 5LCVL 1TPXB 4GAFB 4AENA 1SQ2N 2Z4QB 5DO2C 2H9GB 5J13C 2AJXH 4LLAA 4DN4L 3DUUA 4S1RL 3HPLA 1H9VA 3OGCB 2KUTA 5TF0A 2MHAA 4ZOBA 4OGZA 1JPTL 4U6VH 2ORBH 1OB1B 1NCCH 3V4UL 5I19H 1XF5A 1YECH 4G6FD 2X5PA 1J10A 4UTAL 4HUMB 4RRPG 5DT1L 1CLOH 1JHTB 5J9PB 3QPQD 4TSAL 4IIQB 2NY4B 3OAYK 1G7PB 3PWUB 4P4RB 4UIKH 5MEOB 4W6XB 1F42A 4MQ7B 2F5BL 1EH9A 3F7VA 4HXBL 1M7DA 4LSTH 2ZZUT 4L8SB 5AG9A 1PKQB 2GCYA 2PO6A 4LF3B 4P2RA 3I9GH 2ZNXA 2YOCA 4PJEE 4F7PB 3DX7A 3LPFA 4N8PA 3OHXB 3VXSB 5TDPA 3LQAH 4M7ZB 5BVJB 5C0DB 3BFOA 1FPTH 1UCBH 5HYQB 4IRJD 1H3GA 2AQ2A 2FO1A 3O41B 5KJRL 1U3HD 1A7PL 1F4YH 1KPVA 3FB8A 2PKDA 4XH2B 3OKOA 1BD2D 1JK8B 2CGRH 1YPZA 5CZKA 2EEDA 5KSBB 3WL9A 5GRUH 1J86A 4NDMA 4NO0B 5C86A 5K9JH 3G5XB 3KPSB 5C0JB 2VISA 5CBEB 1IVLA 2QTEA 4YHKH 1RUML 4X8JB 1JPGB 4ERSH 1DZBA 4KRMB 4CVUA 1MFAL 5DMIL 1F6LL 2NY1C 3SGDI 5D6CA 2C1PA 5HVHB 5J13B 3QG7L 3P0VH 3LHPL 5HDBF 3TNMB 2JIXB 1EGJH 1ZVSB 3PNWB 2FB4H 5F9JB 3IDNB 5F8RC 5TE4H 1K8DA 2QJDA 3SDDA 2Q76B 5TDNB 4U3HA 1IL1B 3SGKA 3CVHH 1UB6A 1YEDB 2VLRD 3BHBA 4GSDL 3U36B 2O5XH 3BAEH 1G9MC 2OZ4L 4JFZL 1QUNA 1U93A 5GZND 4C56D 1HKLH 3FT2B 4XZUB 3P11L 3V9FA 3X3GH 35C8H 3E6FB 5GS2D 5KW9L 4QYOB 2LU4A 2NQCA 1ODAA 4WV1C 1NEZG 1QSFD 1I8LC 1A1NB 2NY5C 2P24B 1N3NA 3V79C 2KH2B 1FZOA 1EFXB 3BEWB 4LU5L 5EBWA 5FHBH 2NXYC 2VLKA 4OAWA 5FO9B 1BPVA 2F5AL 4AEEA 2YPKB 3F7YA 4IRJA 2I25N 1U3HA 2MCPH 3LMJL 4JAMB 2DWDA 4PGEB 3LEXB 5E2JA 1LEGA 1CICD 4FP8H 2NY2C 4GBXD 4PJIE 4JFDB 3WKMH 5EN2B 2E8YA 5H2BB 4Z7WB 1N26A 2YPLD 4Z7UB 3OPZH 3ARGD 2HRPL 4RQQB 4Y5VC 5GGVL 5H8DA 3VXUD 1KJ2A 5J6HB 3ZL4L 4K94L 4RZCB 4LGSB 3L95A 3MLTB 4I4WB 4MNQD 4OGXL 4FXKA 2FJHA 5TGBA 3RWCA 5EO1B 4XXDA 4ZAKD 1I8KB 4XHJC 2X05A 2OXHA 4Q0XH 5AUMA 3ARBD 1RJLB 1OVZA 1TQCB 3UZQA 4LP5A 5MI0B 3MA7A 3KYAA 4M7JL 1RUAL 4G8IA 2NY1B 3B43A 3FT4B 2BOBB 5KN5B 3W39B 2HFEA 1TZHB 3O6FD 2APVA 2XWTA 5T5NG 1MHEA 1REIA 3MLRH 5IM7B 4GXUN 3MNWA 4NRXA 3WUWG 2B4CH 3HFML 1MI5E 4NKIH 1PW3A 2YKLL 1EX0A 3FRUA 1LE5B 5IESH 3MJ9A 3KPTA 3NIFF 3MV7B 4OLEA 4S2SB 4DEPB 4UT7L 1FNSH 1I1FB 5CCKH 5D2NC 4FHBD 2ICWJ 3MUGA 4P59H 5T3XD 1LE9A 1T22B 5CJQL 1CICA 4CN6A 3ULUD 4IHOA 4GBXA 2IPTL 3PWLB 4MWFA 4EEEA 4WV1B 3CXHK 4JO3H 4ZPTB 3G04B 5C0BB 5C0ND 5C0FA 5FGSA 3U0PB 4G8FB 3CMOH 4LSPL 5AD0A 2NXYB 2VB5A 1EIBA 4ORZC 3VXUA 5KSAA 2YPVL 4MNQA 4OZIE 1I3VA 1A6VL 3PJSB 5JDJA 5IMLA 4L8CB 1AD9A 2GJZA 3PDGA 3OR7A 3GHBL 4RCAA 1S7SB 5BZWB 3LQZB 4PV9B 1JZ2A 2YRLA 2OP4L 3GMNB 3VXMB 3ARBA 5I8EB 2E7HA 5TE6L 5FYJE 4M4RA 2D7PA 4NKOB 5FHAL 3VMNA 3QCUL 2M8XA 4DCQA 4QHLB 5EU7C 3QQ3A 2VZ3A 5EU5B 1TCMA 1G7MB 3RJQB 5ISZB 5CHNB 4GJTB 1J5OH 3BZEA 3K7UA 4R6UA 1OF2A 1UENA 4MS8D 1CN4A 5GXBB 2V2TA 3IGAA 5LQBH 3A6BL 4FQXD 2P5WB 1MVUA 1C5DA 2DD8H 4LPTA 5F7LB 2Z91A 1JTTA 3STZA 3MRNA 4HKZB 3GSRB 3UTPD 1UM5L 4Y4HB 1C5CL 4JRYE 5T5NF 4QHMA 1U8QB 5D2LE 3MCLL 1CLCA 5JLZB 4J1UA 4NN7C 4KJQC 1FNAA 5E03A 5I1KH 4KY1L 3L7FA 4UOW1 1NSNH 5GGRA 2OL3A 4RAUB 2D0HA 5EC2B 3DURB 1GL4B 3MJ7A 1I1AD 4KRNA 5GRVK 3IDGA 3FMGH 5KSUB 4XP4H 5D2NB 3LY6A 1K9TA 1EVTC 4UZGA 1D6VH 3DRTA 4HWEH 4QOKE 5I8OH 1N2RB 1RUQH 4JRXE 1I8MB 2VSDA 3OKMA 3V6OE 4MVBC 1ZLWH 4JZJA 4XC1L 3WIHH 3DX6A 3VWKA 4PS4L 1S7WB 1T20B 4XP9L 4AL8L 2GJ6E 1OTUC 3FKUS 2WIMA 3DRQA 3KPOB 4FFWD 3OKDB 4Y4FD 2H2PC 2VDKL 1KLUA 5J1TC 3UZEA 4GKSA 1T5XB 4PJAF 5JIKA 1U95B 1OAQH 4M5ZL 3VCLA 3H9YA 1X5JA 2BHYA 4MZ3A 4FQXA 1A64A 2A77L 3V7AG 3LSOA 2DS4A 3TZVC 1RHHB 3VFWB 1RULH 3SE4C 1FL6B 2HTKC 4JDTH 4CDGC 4Q97A 1KIUA 3NCJH 4PGDA 4HUWB 3OB0H 4HUUA 4HS6A 2Y6SC 4Y4KD 5DHVB 4DZBA 5JQ6H 1F8TH 5D5MF 2LTQC 3SPVA 1NGXB 4NKDB 2W9DH 1PEZA 3ZKNC 2DICA 5CLTA 5HPMA 3C5ZC 3UTQB 3PGDA 1CFQA 1IAKA 2BSSB 5D7KE 4C83B 2CUMA 3T1FA 4RAHA 4WFHE 5LCVH 4WUUE 1KCSH 2HJKB 1P4LB 2ADJB 1KC5L 2YRPA 4NN7B 4P23D 1H15A 4S1RH 1QSVA 5GS0H 4PJEA 2GK0B 5ALBL 3MV11 4PJ8C 1FL5A 3LV3A 1T0PB 5JR1H 3DETD 5T1LD 5CJXC 4PBXA 4PGBA 3L3DA 1MSPA 1JRHI 3P9MB 4L29A 5HYFA 4HWUA 3MQIA 3RWIB 3HNSL 4UTAH 5E5MA 5F89B 3RKPA 5I1LA 5JHDB 5E94B 1ORSB 1FIEA 5C0AE 4L1DA 1TZIB 3QWOB 5ETUA 4S0TD 4AM0A 2F5BH 2IALB 1TVHA 4XPGL 4HCRA 5ESVA 4GS7C 4JANA 4Y4KA 1AGFB 5JZ7C 3EYQC 1S9VA 3PL6B 1E4KA 3GMQA 1S8DB 3G6DL 1AKJD 2JK5B 5IJVA 4FG6C 3BKYH 4IDJL 3TZVB 3PWPB 4LK4A 3DSFL 4H25B 1SJEA 3T4YA 3O6LH 5DI8B 3RVUC 1OGAB 3D0LA 4LPVA 4NQDE 4MJ6A 5KJRH 4CJ0A 3MV9B 5C09D 4E42B 4P23A 4XCEA 5B4MC 1F2XK 5BXFB 5E5RB 2HJLB 2LTQB 1OTTD 2WANA 3QJHB 2FH6A 4YR6B 3KAAA 3UJIL 5E6ID 4HLJA 3T3PE 3C5ZB 5T1LA 3QQ4B 4POYA 4AIOA 5FM8A 1UXWB 1R3HB 3HAEB 4XCYB 4HEPG 3DYPA 1BMGA 1RVFL 5HYJB 4KI5E 2OS7A 3Q3GB 5GGUA 1HSAA 4JFPA 3RY6A 3HS0A 3CK0H 4DQOL 1HILB 3TT1L 43CAA 4PJIA 3DI2B 5DRWB 4AEHL 2K9UA 3G6JF 4QRSB 3L9RB 3MRHB 1E6OH 3ULSA 2NW3B 3QIWD 4GSDH 4JFZH 3QXWA 3MRQA 4AZ8A 3I75B 3Q6FA 3QHFL 4MHHI 3P11H 1MCQA 3TBWB 4OT1H 5CEXA 3VXRB 2VL5B 5EUKA 1MIML 5IW6B 1U8MB 4F8QA 1AKJA 1DEEB 1QBBA 1RI8A 1ZSDA 4JG1H 4PRIE 2XKUA 2YSSA 4DGYL 3ELAT 3HZYA 1A1MB 5E8EA 3BN3B 4KVCL 5HJ3A 2RIKA 5C9JA 1XR8A 2F5AH 4UUJB 4JPKL 5D8JH 2DI7A 2Z31D 3OJMB 1YY8A 4GS7B 5FGRA 4H20L 4G6AC 5E99L 3K4DA 3MJGX 5IB5B 3ROLA 3LMJH 3ARFC 3RBGA 1MCWM 1J0KA 1KJ2L 4G7YH 3GSOB 2RHEA 5D7SH 1WIUA 2YXMA 3S37L 3TFKC 1V8HA 2ZUXA 5E6IA 4BZ1L 4LMQE 4YEEA 2A74A 4TUJB 4PLKD 4JRYD 3UO1H 5GGVH 4QTIL 3D39E 1Q9WB 3S4SA 1CG9B 3RNKB 1WBYB 2WLYA 3H0TA 2J12B 5DS8B 4JGUA 2P8MB 3D2UD 3MNVB 3PP4L 1IGTB 4RISL 5EU6E 3ULVC 3GUTB 1T2QL 1EHNA 3FT3B 1JHLH 1NC4B 1WZ1L 1XGUB 4Z0XA 3VU2A 1KCKA 2MNUA 4LCUB 4M7JH 1FVEA 2FECI 3EO1B 5C0IB 4YBLC 3C2AL 2V2XB 5KG9A 4NQCB 1QBML 4YDVB 2ZOLB 5ELIA 4JRXD 3HFMH 1EBPA 2YKLH 2AKRA 3I3EA 3PGCA 1UVQB 2Q7YB 3ZYZA 1GGBL 4X4ME 4D0BA 4K3EL 1YUHA 3JXAA 5CIPH 5AG8A 1X44A 1BECA 2ZUTA 3LB6D 4K7FB 2WP3O 3DMMC 3DARA 3IT8D 2YD5A 3ZKMD 1SJHA 2ICEB 1YN7A 2E8ZA 1I85C 3AS0A 2BCKB 2IPTH 3FQUA 5I8CB 1S78D 5ANME 1NFKA 3UBXA 4LSPH 1CD0A 1BZQK 4JRYA 3B9DA 1L4IA 5EOTA 5T1KD 4NRZA 1KG0A 3DBXB 5D2LA 2HVJB 1F3DJ 2RB8A 5BW7C 3MLYH 3IJYB 4UT6H 5KZCB 2OP4H 2GHWB 5MERB 1VKXB 3D18A 5TE6H 1T2JA 5FHAH 3QCUH 4WUUD 2DWEA 1I7RB 2GUOA 3HE6D 3U4AA 3MRFB 7FABL 3QUYC 1KCUH 4ZUUA 4G80B 4QOKA 1P7KA 3UTZA 4JRXA 5CJ8A 4HJ0C 3V6OA 1MWAH 1LGVA 3T2NH 4UQ3A 3WS3B 3A6BH 1U92B 4HPYL 1E28B 4MAUL 5MP6H 4YAQA 5AZEL 4CMMA 3FFCE 2IQ9H 3P4MA 2GJ6A 3RUGA 2HLFC 4YBLB 3U9PL 2OL3L 1QZ1A 2O93L 3RTQA 3UJTL 5C0EA 1OP5H 1NUGA 2FNBA 4L3EB 4OJFL 3CGTA 5DD6A 4MDIB 2EE9A 2P5EB 3FHQA 5GGSY 3RZCD 2E6PA 1PY4A 3OKEB 4NOFA 4N8CH 1MFDH 1BVLB 2A2QT 4K9EH 5C0AD 1SJXA 5F1NA 2OTPA 2AXFA 5DEFA 2IEPA 2A73B 2XQYK 1KXVC 3RHWK 4F57L 3DMMB 5EUOB 4HWZB 5L2JB 2WBJC 5GS0D 1AY1L 1UH2A 4QWWD 1BJ1H 3ALXA 1WFNA 2J88L 1UA6L 1CD1A 4YFLF 1HQ4A 3DOSA 4F7MA 2VQ1B 1XGTB 2MQ0A 2V5SA 5DQ9A 4AL8H 3IXAB 5BRZD 4E41D 2IAMD 4WUUA 3HE6A 5GISH 4I2XA 2OYPA 3KPRD 3VE0A 2H32H 1ZA3A 4UILH 4JHBA 4M5ZH 3Q5TA 2XWBB 3V52H 3LRSB 1SEBB 2CXGA 1ZK9A 2A77H 4PTTA 4NUJA 1OAUH 4G43B 1NQBA 3CVIL 4YHOL 1A6PA 4F3FA 5F7UA 3PXJA 4WI8A 3X3FL 3NAAH 4F2MA 4WEBL 4BFIB 4KI5D 3NPSC 3HRPA 2CK2A 3QUYB 1EEZA 4I3GA 2R1XB 3VD3A 4E5XA 3BP7A 1ZT1A 2OTWB 4MDJA 4ODVL 4U1HB 2VXVL 3FN9A 1H3WM 1LK2B 4G9DA 2DKMA 3GSWA 5HGBA 3RZCA 4PYGA 4QT5B 1ZHLB 4OD3L 4OZFB 1S7QA 1CGXA 5C0AA 3FFDA 2YD6A 4U49A 4PJHB 3IYLW 3TA3D 1MLCA 3KXFD 1CE1L 2Q3AA 5KVFL 3GIVB 1QQDA 3HB3C 2X4NA 5L2KE 3CLFH 5JORB 3O45A 2ED7A 3Q1SL 3GBNL 3JV4A 1XGQB 4EOWL 3CFKB 1HEZB 2WIIA 4ZFFB 4JHZA 4PRID 4PY7A 2JJSA 4MXQD 4Y8DC 4LPXA 2QEJA 5MHSE 3ZYOA 3NCBB 4OZGE 3UPRB 1FQ9C 4R0LB 1I4FA 1IGFL 1P69B 5C2BH 2VDNL 1MCCA 2IAMA 1RJYB 4YQXL 5JW4Q 4NQDA 3GJEA 1RJZB 1W72B 1M7IA 4BQ6A 5BS0D 3QXDA 4GLRI 4HCRL 4JY6B 4JB9L 4LRNH 1QKZL 1JZ4A 4L1HA 3DO7A 3WHXA 4D9LL 3BPOC 2GTZA 3IFNL 3D39D 3VXQB 4NC0B 4FQHA 3KHOA 3UCRA 4Z77B 3RX8A 5C08E 4AK1A 4XPBH 1V5JA 2NY0B 4DWHA 3G6DH 3CZFA 3IJHA 2ZG2A 1HHKB 1R24A 3KHQA 3NFSL 4GRLC 4PLNC 3TM6A 4X83A 1RZFH 5GRVL 3TA3A 2MWCA 4CKVX 1HXYB 1MJ8L 3ES6B 5MENB 1RD6A 5ESQB 2DIBA 2APBA 1LO2L 3I6KB 4ZTPL 3MZGB 1P6FA 4AJ0A 5FCUL 2XKNA 4HKXA 4O2EB 2VDOL 4PRIA 5FM5O 3LS4L 5C07D 1YNKL 5B38A 2BDNL 2ADGB 2EXWD 4L4TE 5BVPL 2CLRB 3U9UB 3HR5B 2UUDK 3BH9A 3JV5A 1F3JB 2HT3C 4H0IA 4CADB 3QEGH 4DQOH 3K81A 4XNMB 4AEHH 1FNLA 1EBAA 4U1IB 1R3LA 2AV7B 4DUWA 1EO8L 4LEOA 4O4YH 1C12A 4B53A 1AXTL 3IKKA 4G6KL 1LO4L 5DEGB 3D39A 2P49B 5EU3A 5DK0A 5IEHB 3DXAD 1XGRA 3AREB 3TYGH 1KT2B 2OR7A 4R96B 1IC5L 3MLVL 1MIMH 4CJ1A 5FB8B 1BIIB 5EU6A 2DQIH 2EE3A 4HWBH 4DGYH 2YC1B 2OMNA 3BPOB 3MREA 3TVMC 1FRGL 4G7VH 3WNPA 6FABL 3GRWA 1OD7A 4JM4L 1G7QB 1QRNE 1CL7I 1WFTA 2ZOKA 1D5XA 3KS0J 5FGCB 3O4OB 1J0IA 4V1DE 4GRLB 3IF1B 3P9WB 3IDJB 2PNDA 2AQ3A 2D3VA 4M93B 4K3DH 5IHLB 2FL5B 2ATKA 5K59E 2A6JA 4RGND 4PGZA 2GW5A 1JFQL 3QEUA 1TMCB 2G9HA 5ANMA 2VE6B 5DQDH 4LARL 2WK2A 4RISH 1U8OA 1T2QH 1MNUL 3MLWL 2R39A 1KB9K 1WZ1H 1X4YA 5DSCA 3M8OH 4KROC 3OAYH 3OJVC 4JFYB 4JPWL 12E8L 4JRWA 2COQA 4KMTH 4UNTA 1W0VA 1R5IB 3P77B 1OP3K 3C2AH 4RMTA 3IXTB 4RFNC 3RUGF 3MCG1 5DJ8B 1XGPB 4CUCA 1C1EH 1AGBB 3FAWA 5FYJL 1QBMH 3HZMB 3L1OL 4YO0B 5D1QC 4P2OD 3U2SA 3HZKA 5KANI 3VWJA 1GGBH 5CIPA 4K3EH 1GAFL 4WFFE 3MCKA 1KXTB 5ABDE 1ONQA 2X4PA 4X98B 2HA1A 1U8JA 4IMLB 1KIRA 2EE6A 2EDEA 4M1GL 2R29L 3T8XB 4BUGA 4ELMF 1PKQE 4U05A 2CO6B 4WVRA 5F96L 2ARJB 3TVMB 5H35B 5TFSH 1T21B 3FFCA 5K9QG 3KDMB 1IEAB 4ENEC 2ENSA 2FJFA 1ZGLP 2K3TA 4MLIA 2APXA 4NFDA 4N8VG 4K7PL 4WI7A 4O9HL 4Y5XA 5CEZH 3T1WA 4M1CD 5E2WH 4PGCB 5GRJL 3D0VB 2JJTA 2PTTB 4LCWD 3MO1A 3MRKA 4OBRA 5ENWA 2QKIA 5KSBE 4NCC1 2PCPB 4OM0L 3KWWA 4U1KB 3PDOB 1SBSH 5JW4R 4ZXBD 3WSQL 1NCAL 2VLLB 5JUEL 7FABH 1X5IA 3UYPA 4OLWL 4HPYH 3Q6GL 4U1SA 3TN0D 4KROB 1VFBA 5AZEH 3VRLE 4EI5C 3U9PH 3IDYC 4RFNB 2BK8A 5ILTL 3UJTH 2FGWL 4AEIL 5DJAA 3TBVB 3CFCH 4OJFH 4RWHA 1JN6A 2EO1A 5HBBA 4YGVB 2VIRA 3B6SA 3PV7A 3FRPA 5D1ZD 5IJKC 3QIUC 1BQHA 2HYMA 5KS9E 3QEQD 1CR9H 2E6QA 5I8KL 4F57H 3LN5A 1UWEL 5HHXL 1EZVY 4FS0A 3C60C 1AY1H 2AJYH 4JM2D 2X4SB 4JZOA 2WINB 5F88B 4RMWA 4M62L 4LCWA 5HDOA 2VAAB 1UA6H 4PJGE 1D6EB 2GSGB 2MFNA 4I3RH 3JWDC 4Z7WE 1CK0L 1T1XB 2UYLB 4Z7UE 4YGAB 4HUVB 4R7NB 2CPCA 3DUSB 3LIZL 4HIIA 3S35H 2XI9A 3O11B 4XMPL 4ZXBA 2NCMA 2ZKHL 5L2KA 4H1LH 4KI5F 5E9DD 2XNAB 2AXGB 3FB6B 2EH8H 3HKFA 5JO5B 2D7MA 4WUKH 4LKCB 4NJAL 3NFPA 4FA8A 3TN0A 2Z35A 1C7TA 4OZGA 3CVIH 3X3FH 4GO6B 4WEBH 3BZ4B 1WUNT 3U1SL 1B0GB 4HHAA 1EUTA 5BOZG 9CGTA 2BNRE 5SX5K 1G7JB 1X5HA 2FWOA 4LCCA 5C8JA 4WU7B 1EO7A 1U58A 4NO5A 4X6CF 5DVMA 1QVOA 1AXSB 2LE9A 1XFPA 1DQMH 3UJJH 4EI5B 2V5MA 4LQ1A 1RK0B 1CE1H 5KVFH 4KUCF 2YD2A 3MV7E 4PJFF 2MOVA 5C08A 4NKQB 3WFDH 5IMOA 4JM2A 5CGYC 2YD7A 3Q1SH 2WM0A 1IM3A 4OLVL 1WT5C 3T04D 1XZ0A 5JDSA 2ESVB 3B4NA 1I8IA 2X4TB 5AYUL 3B2UD 3MUHL 5ADPH 2LQRA 3SOBH 4XP6L 3CDCA 5D1XD 5C0BE 3TPUA 3QIUB 4X6FA 1IGFH 2AEWA 3FJTA 2VDNH 4YQXH 2GAZB 3HI6H 2IWGA 3QUMB 4WRLA 1JGDA 3C60B 5H94A 1JGUL 1FE8H 3H9HB 4K07A 3ZDZE 1A6AB 5FK9A 1QRND 2ZPKL 1GOGA 3WNKA 4AQ1B 3AAZA 4JB9H 2VABB 1QKZH 4V1DD 3BQUB 1YEJL 4EN3A 5EA0L 1F58L 2K1MA 3QXVA 2NTFA 3VXME 2Q8AL 4OLXL 1DLHB 5SX4H 4L4TA 4PJ9B 3T08A 4KK9C 5DD5L 5CSZB 1ZV5A 4GG8A 4P9HL 4N5ED 4BSWB 5EZLB 3I50H 1NUDA 5ISZE 1RV6X 4ZDHB 1QPXA 2PTUA 2R69H 5HYSB 3KNBA 3O6ML 3D85A 2P5WE 4OD2A 5CSBA 4CW1B 4MA3B 3NIDF 5I16A 2WBWB 3MRPB 3V5KA 1G6RA 4LSUL 2WZPD 4ZTPH 1J1PL 5IUSA 2A6IB 5FCUH 1RU9L 4ZYKA 3TJEL 2C3GA 3RY4A 2XICA 1CTNA 3GKZA 1YC7A 3LS4H 1QFWI 3N1GC 4POZC 5TH2A 5GHWH 3KYOB 1YNKH 3NTCL 1A9BA 4WFFD 1NDMB 2BDNH 2DL9A 1AGEA 2DQTH 4G5ZL 4EQ3A 3IDUA 4XBPA 1DTUA 2XWJA 5BVPH 3NMEA 3H3PL 4N0FA 1CLYL 1IFHL 4P2YA 3MBEC 3QULA 2CMRL 4JFOA 4P2QB 5F9OH 1QRNA 4ZPVB 3F7QA 4LHQB 4IMKA 3TT3H 5L6YL 1AFVL 1TJGH 3TP4A 2VNCA 2IBBA 3OQ3B 4V1DA 3SKOB 4UV4L 1AXTH 2QQKH 4G6KH 5DR5L 1LO4H 4QXTA 4PRHB 1TJIL 3X13B 2QR0A 3QFJB 5DYOA 3QUXB 1NPUA 4X7CC 3FRPG 4TPRL 1CF8L 4KGJA 2Z4QA 1IC5H 3MLVH 4HWBA 1BQHG 2H9GA 4F7EB 1YEGL 4I77L 3OGCA 1DL7H 2ICWI 3GKWH 3T65B 4J7RA 2PYEE 3V0VB 4UDUB 3JSSA 4HG4K 2DQFB 1FNHA 4M7LT 1OB1A 4HZAA 3QDGB 3EAKA 2EDNA 4JM4H 4KU1A 3R1GL 3NH7L 2QHRL 5IVXB 3UDWC 4K94C 1FGVL 3AMKA 2V9RA 1ETZB 1JHTA 2YS4A 5J9PA 2GSIB 5C7XL 3V6BR 4I18C 1FV1B 4IIQA 3PWUA 3U0WH 3T0VA 5CEZD 3EDKA 4JKKA 4KJWC 2X7LA 4Q58C 4LARH 1PKQA 4LF3A 1VDGA 5IBUB 3RWEB 2F54B 4F7PA 1FNGA 3U48A 4LNRB 3AS3A 4Y0GA 5KBNC 4KRPC 4JPWH 3OHXA 3G9VA 4PRPB 5C0DA 4BSJA 5HYQA 5HGHB 2X40A 4QKXB 4OLYH 3L1OH 3GNML 5EPMB 1JK8A 4PJBF 5JHDE 5KSBA 3AU1B 4NO0A 5C0JA 3V6FA 4KKCC 2DM7A 5CBEA 3WXWL 5I76B 3HA0A 1JPGA 3VFSB 4EXKA 5KVGH 3LN4B 2E7MA 3K4AA 1MRCH 4WNQB 3VA6A 1GIGL 1TIUA 4HH8A 4TQEL 3TNMA 3JTSB 1ZVSA 2PUQT 3PNWA 3T0AA 5F9JA 3IDNA 3FHAA 4U1GC 5I1EH 4GLRH 3MA9L 1IL1A 1KOAA 3VA2C 1YEDA 3PWPE 3U36A 5J4MA 1J9CT 2YUXA 1BQSA 1OGAE 3HG1B 4MB3A 4O9HH 3DX8B 4OB5L 2BNRD 3FT2A 3CSYB 4XZUA 5GRJH 3E6FA 1V7NL 3QZWA 4X6BB 3P4NA 3IU4H 5DJ2B 4BQ9A 2W60A 3JUYA 4QYOA 4I18B 4X5XB 4OM0H 5GS1C 2P24A 1A1NA 1LD9B 1EFXA 3BEWA 4UB0H 4XPHH 5KS9A 2OJEB 3WSQH 4RGOL 1QG3A 5GGTA 3LH2H 5HYJE 2YPKA 4U3XA 1KV3A 3QFDB 3QISA 3RAJL 3UC0H 5FO7B 1FGNL 4JAMA 4PGEA 3LEXA 4PJGA 3RGVD 1U2CA 3VXPB 5EN2A 4D8PB 4KRPB 1GC1L 2BSTB 2B2XL 4Z7WA 5C0BD 4Z7UA 4MJID 3EYUL 1NMAL 5ILTH 4YPGA 5DUPL 3WJJA 1M6OB 4RQQA 1ZWIB 3N1MC 4OLZH 3RWDB 4RZCA 1ZHNB 3MLTA 1MRDH 1A14H 1MCWW 2XA8L 1UYWL 1ZGLB 1M7XA 1EV2E 2D7QA 2KZWA 1HI6B 4Y19B 2NXZC 1A1OB 4NZRH 5EO1A 1UZ6E 1I8KA 5F7EH 1O7VA 2R0ZL 1RJLA 3ARDB 4RAVB 1DANU 5E70A 1U91B 2QSCL 1NCTA 3P73A 4UI2A 1I3RB 3FT4A 3N9GL 2BOBA 5DD1L 2BNRA 5KN5A 1JNJA 3W39A 2D31B 4N0UB 5E6YA 5IM7A 3FO1B 2XRAL 1OP9A 1Z9LA 4EUPA 1JPFB 3WMSA 4M48L 2NY3B 2EDYA 2OR9H 5F6IC 5FUOH 1IBGL 1LE5A 1CK0H 2DLFL 5HHMB 2NZ9C 2XZQL 2YA1A 3LIZH 1RK1B 1GOHA 4R90L 4XCCL 4XMPH 4OUOA 5FKPB 3MV7A 4Y4HD 3KYKL 3O8XC 4S2SA 1BVKA 1I1FA 1I9JL 1T22A 1T0NB 5C6WH 3SY0B 4W4OC 1DE4B 1DBJL 3RGVA 4NJAH 5IHZA 4D3CH 1IKFL 4WV1A 4ZPTA 3N50A 5GS1B 3G04A 5C0BA 1CL7H 3F65A 3REVA 3U0PA 4G8FA 2N1KA 4LAQL 3KVQA 2AGJH 3L3OB 4W6YB 3U1SH 4K3JL 1NLBH 4M02A 3LVEA 3MYZA 3PJSA 4L8CA 4Z0BL 3GEWB 3GMOB 3MR9B 3MV8B 4HLZH 5BZWA 3LQZA 1P4BL 2MSPA 1S5IL 4DGVL 3VXMA 1MUJB 1INDL 3S36L 5I8EA 4LCYB 1TXKA 4NKOA 1WIOA 5FEBA 2Y36H 4XVUC 4APQD 5EU5A 1G7MA 4JG0L 5ISZA 5CHNA 4J3WA 1OLLA 1U8NA 4QNPE 1U3YA 2IPUG 4XP6H 1J8KA 3H42L 2P5WA 4OCRL 4X7TB 2PYED 1RFDL 3UTSB 1A7RH 4Y4HA 1JGUH 1I1YB 2R8SH 3PWVB 1U8QA 2B8OT 3RNQB 5JLZA 2CR3A 1FFOB 2ZPKH 3EBAA 3VGHA 5CJOL 3MSPA 1N0LA 3UROR 3ORJA 4S0SD 5EA0H 1F58H 5EC2A 3DURA 3TPKA 1U36A 1YN6B 4B0MM 3LEVH 4OLXH 3O8XB 3QDHA 1URLA 5F3HB 2VR9A 5KSUA 4K8RL 5FYLE 1UQSB 5DD0L 1JI1A 1H8SA 1KNOB 3AVEA 4JPIB 4P9HH 4ALAH 3I02B 1N2RA 4LGRB 1G6RL 2AAVA 2ARWA 4L8DA 3WUWB 4KUZL 3O6MH 4KJYB 4DN3H 4PJ5B 3SCMD 4AENB 1S7WA 2WBKA 3Q0HA 1FFNB 2J8HA 5E08L 4ISVB 3SJVB 2VZ1A 3DI3B 5E24E 3QZWG 3OKDA 4FQLL 1IKNA 1SY6L 4L3EE 3QPQC 1T5XA 1XGYL 4ZFOA 2Z8VC 1B4JL 5JHDD 2P5EE 3PP3K 5HGAB 2PYEA 3NTCH 1BZ9B 4M1DH 1RHHA 1KTDB 4PRBB 2E7CA 5EBLB 3VFWA 1FL6A 4TRPL 3VFOB 3H3PH 1IFHH 5JIHA 4HZLB 4HUWA 5ICZB 5EUOE 5CILH 5J3HD 4O58H 2YEZB 3U7WH 1EJOL 1S9WB 1CGVA 3PL6D 5C0RL 4OUUA 1NGXA 4NKDA 4J3UA 3F7VB 4P3CL 4Y5YC 2CKBH 4PJAB 1FAIH 5DR5H 3OJ2C 4IRJC 4UAOB 3UTQA 3PWPD 1G1YA 2BSSA 4C83A 1U3HC 4X7EC 4IBLT 5BMFL 3GBLA 4TPRH 2HJKA 1P4LA 1L6XA 2ADJA 1KCRL 4HUNB 2FDBP 1GOFA 1IAOA 5TDPB 2X6MA 3CDFA 2O5YL 2WQ8A 3A6OA 5D96B 4YDKH 2F19H 2DTML 3SDCD 5DF0A 2XZZA 2QADC 4JO1H 1S7UA 4KK8D 4RFOL 3SCMA 4MHHG 5D5MB 2DKSA 3VRLF 1YEIL 5DJDB 4EUPG 4MSWB 5KSVB 1PEWA 3RFZC 2D4DA 1X5ZA 2Q7NA 4RSVA 3NH7H 4XP1L 4CMHC 3RWIA 2OK0H 3KYMB 5F89A 4H1LG 1FGVH 2MJWA 2P8LB 5JHDA 4K23L 4OQTH 2K7QA 1ORSA 2FX9L 4KKAC 2WUBL 5GZNC 5D6CB 4B5EA 4G6FB 4GG6F 4PJHE 1TZIA 3QWOA 3GIZL 4KHTL 2IALA 3VRIB 5KS9F 1VEOA 3MODL 1AO7E 2VDRH 4WI3A 3K74B 1AGFA 4XXCA 3PL6A 5KVMC 3TBSB 3L5XL 1JV5A 3GSUB 4UBDD 2JK5A 3V6ZB 4PJGF 2NR6D 1WCQA 5A2LH 1INEL 3TZVA 1JZ8A 1EK3A 3PWPA 5IB2B 2A0LD 3C6SB 1TQBC 4H25A 4JHAL 5DI8A 3DHMA 1OGAA 2HKFL 1CICC 4K3HA 4GBXC 3HMWL 7CGTA 4WTZA 4E42A 4Y1AD 1P9MA 2P8PB 1FZOB 2HJLA 5EBWB 4PP1D 2E7LA 2Z0BA 4Y5YB 3QJHA 2H3NA 5DJZA 4R2GD 5KSAC 3OZ9H 3QQ4A 4ODTL 3WXWH 3ZTJG 1U3HB 3JWOH 1MAML 3TO4D 2QQLL 1UXWA 1R3HA 2ZWLT 3HAEA 2DWDB 2YHGA 4XCYA 1BIHA 4M8QB 1BD2B 1IC7H 5D70L 1KLFA 1RUKL 3Q3GA 2FH8A 5DTFB 3WNLA 3OKKB 1HILA 1U8KB 3ARBC 5DRWA 4FXGB 4QRSA 3L9RA 3MRHA 5DDHB 3ETBF 5BV7C 3MLXL 3MA9H 4WO4B 1JCKA 2NW3A 5D72L 3BSZL 2UUDH 4M43L 1PGRB 5MENE 1WFOA 4CMHB 2PR4L 4ONFL 3TBWA 3VGEA 4LSRL 1L9MA 3B8SA 2VL5A 1V7NH 4OFYA 5GGTL 5I0DA 2BJML 2VLRB 1U8MA 3MA7B 2DI9A 1DEEA 4C56B 1A47A 1A1MA 1ZTXH 3C09C 4RGOH 3ZKSD 2ZP0T 3G6JB 4UUJA 1HQRB 3ULUC 5IB5A 2EYRB 4FZ8L 3RAJH 5EORL 1QSFB 1FGNH 5C0NC 4NN6C 5I9QB 4CVXA 2EH7L 3F58H 1PBYA 3GSOA 1N7MH 1GC1H 2B2XH 4NC1E 2ZNWA 4N0YH 1NMAH 3TO4A 1LE9B 1TQBB 3KPPB 1QFWH 4TUJA 5DUPH 1DQDH 2DQUL 1UB5A 3ILQD 1CICB 1Q9WA 4GBXB 1JYXA 2D9CA 3VXTA 1Q9LB 4XNQB 1CG9A 4ODHL 2J4WL 3RNKA 4YEFA 1WBYA 2VSCA 2YPLB 3MTRA 1P84K 4R8WH 3VWKC 1GGCH 3ARGB 5DS8A 2WMPA 1S7RA 1QR1A 3BE1L 3MNVA 1IGTA 3QHZL 4NQED 4XPAH 5GGRY 3S3JA 3GUTA 3FT3A 4NZTL 1NC4A 4LKXA 1XGUA 4PTUB 4P3WA 3RI5K 4NWTL 4LCUA 4Y16B 5FYLD 3EO1A 4MLSA 2V2XA 4MS8C 3BD3A 4LLUB 3ZE1E 4ZAKB 3WLWC 1G9ML 4FQXC 3QI9D 4YDVA 2ZOLA 1ZEAL 5T33L 1RJCA 3EJYC 1C5BH 3WLBB 3QNXB 4K2UL 5DZOA 4YXKL 5BV7B 1NGQL 1AJ7L 5FGCE 4DCQB 3QQ3B 5KVEL 2ITCB 3NIGE 3O6FB 43C9B 4XCCH 4DFHA 4YFDB 3KYKH 1OP3H 2NY5L 4PY8J 4ODSH 1OF2B 4K7FA 4L3ED 4TOYL 1I9JH 2F58L 4TNVF 1C5DB 2D7OA 1BEYL 2ICEA 2QSTA 3F7RA 1DBJH 1I1AC 1S3KH 5I8CA 4NWUL 1H0DB 4RNRA 4WI6A 2EDRA 4FQCH 2EIZB 4X99A 2LAAA 3ZTNL 5ICYA 4QHMB 1CZ8L 4MD4B 4M5YH 1A22B 3L7FB 4H8WC 3BGFC 1FVDB 5IR1B 2HVJA 1DBMH 4Z0BH 2M26A 3IJYA 2CDFB 3D87B 3JTTB 2P42B 2B1HH 4FFWC 3AB0C 4ONHB 3CC5B 5MERA 3S36H 3CDYA 1IARB 4MCYB 2CDGB 1I7RA 5INDB 1IAIL 3MRFA 4G80A 3N85L 2MKLC 5DLML 4X7DC 3MUZ1 3WS3A 5I2IB 1U92A 1E28A 2EKSB 4OCRH 1RFDH 4L8BB 5TF1L 4DVRL 5K33A 4Y4KC 2EZ0C 3MRBB 3FOMB 4L3EA 1E4KC 4TVPE 4Z5RA 1QA9B 5I66B 3FB7B 5E4EB 4PLJD 4MDIA 3I3DA 4ODXB 1P4IH 1KN2H 3HAEG 2P5EA 4X6EB 2FO4A 1AP2B 1ZAGA 3OKEA 1BVLA 1F11A 4I3SH 1PYWB 3L3IB 4HD9A 1VENA 5E0QA 3RIFF 4HUUB 3IS1X 4YIQB 1DLFL 1HYRC 4DKEH 4DZBB 4P23C 5I1JL 2A73A 5DD3L 1AO7D 5DD0H 5EUOA 1UG9A 2GEEA 4HWZA 5L2JA 4I0KA 1I1AB 1KEGL 3PG2A 3DETC 4NQSA 4XGZB 1IAKB 4FQPA 2DQGL 3EOTL 3BRDA 3IAPA 4ZS6D 2XTJD 2HTLD 5E08H 1RZJH 1XGTA 4QRPD 1OD9A 4I48B 4XCNA 3IXAA 1H15B 1T7XA 4Z7NF 3BGFB 4FQLH 2XV6B 1MFCH 4GMSL 1SY6H 4MD5B 1KPRB 4BQCA 4WFGE 5BW7A 1XGYH 1B4JH 2Z9TA 4X6DF 2XWBA 4PGBB 5EZIL 1G7HB 5C71A 5I18L 3LRSA 1SEBA 4J3XA 4OLUH 1FYHB 4Y4FB 4W6WB 3K8LA 4G43A 5KVDH 1KPUB 3BO8A 1D5IL 4TRPH 2ZUYA 5D93C 15C8L 4BFIA 3QUYA 3V0AC 2R1XA 1FLTX 4XBEL 4U1HA 4DAGL 1EJOH 1LK2A 2NY7L 2X1QA 5ETUB 4HQQH 4P3CH 5GZOD 1JF5A 1ZHLA 3P30L 4OZFA 4W70A 1J1OH 1IGJB 5IKCA 2Y06H 4PJHA 4Y4KB 4I5BA 4BZ2L 3MLUH 2J6EL 2HJFB 3QNZB 4UIMB 3WFBH 5L8JB 1BFOB 4JVUA 2DL2A 1AO7A 3GIVA 2J8OA 1OTTC 2HP4A 1FIGL 1XF2B 3P40A 5E6IC 1XGQA 2CLZB 1HEZA 2DTMH 2Y1VA 4ZFFA 3HC4H 5FF6B 4H0HB 4MJ6B 5JW4N 4CVWA 3TBYB 3UPRA 4OBSA 1FL3A 2R4RL 3LKNB 4P23B 1YEIH 4R0LA 1RJYA 1RJZA 1T0MB 2KKQA 3BD5A 1SHMA 1W72A 4GRMB 4XP1H 4XTRD 5JXED 5T1LB 2DBLL 5ECJE 1T66C 1DFBH 3MRCB 5AYQA 4JY6A 2HT2D 1NCDL 3KLSA 1XH3B 2WUBH 4JFPB 2FEDD 3FTGB 3GIZH 4KHTH 4KKBD 43CAB 2B4CC 1HHIB 3VXQA 2AI0L 3QO0A 1BM3L 2ZCKL 3RWGA 5ITBH 2W9EH 4Z77A 1KEMH 3CVHB 2QSVA 1VADB 3ARED 2BY1A 3HC0B 4NZJA 2AJVH 3EUUA 4NN5C 1HXMB 1ZMYA 2P45B 2UWEF 2ESVE 3CCHB 1RZKC 5C0CD 1INEH 1HHKA 5B22A 4CBPA 5E2VL 1EEYB 5D93B 3PE9A 3ESUF 4YZFF 3CXDL 1HXYA 4HBCL 2YWYA 3ES6A 1YEKL 5TPWL 3I6LE 4ZUWB 5HI5C 5MENA 5ESQA 3HMWH 3I6KA 2IQAB 1A6WH 2QQNL 2YA0A 4O2EA 1E4WL 2ZJSL 5E8EB 4DKFH 1RMFL 3MOBL 2BRRH 5B3JF 5DFVD 5C09B 5AWNL 2QQLH 5F44A 2FZ3A 1N4XL 5I6XB 3IDXL 2ADGA 1QSZA 5KANG 3W9EB 1WV7T 2CLRA 3U9UA 3HR5A 5E6IB 3BKCH 2BY0A 3HNTH 5JXEA 1F3JA 4CADA 4YDJB 3MYJB 4BFGA 4P49A 4GAGH 4KTEH 4OCSL 2YZ1A 4XNMA 1AGCB 3OV6A 1FNFA 4U1IA 1LQSR 1PG7X 2HWZL 1BLNB 1GVIA 1MAKA 3MLXH 3PQYB 4HW6A 2E6JA 2VXTH 1TLKA 3PWNB 5DEGA 3FB5B 3DVFA 2D7TH 4M43H 3V6OC 5IEHA 3FQTB 2PR4H 4X0KB 3AREA 4LSRH 4O2CB 1KT2A 4R96A 1JPSL 3QIWB 4XRCB 1BIIA 3C6LD 3OX8B 3U7YH 5CJ5A 3B5TA 4QNPF 1NBQA 3RTQC 1QACA 1MF2L 3LB6C 2PW2B 4K7PY 3ME0A 4F9LA 3GMRB 5JXAH 2WW8A 3DVGB 5DC4B 1OAXL 4F37F 2IH3B 4FZ8H 2V7NB 5F7KC 1CXFA 3PGCB 1XMWA 4NN5B 2EH7H 4P2QE 3S6CA 1G7QA 1H3UA 1I3GL 5T3ZL 5J12B 4BYHA 2Z31B 3L3GA 2BP3A 4GRLA 3IF1A 3IDJA 5F7NC 1SJHB 4NZUH 3J7HA 2FL5A 4PRHE 3QFJE 1NMCC 3LDBC 4ODHH 2J4WH 4TVPD 2ZCHL 1CXLA 2EDDA 2BFVH 2VE6A 4OM1H 3BE1H 3QHZH 1IGIL 4PD4K 1CFNB 4FFZH 3HE6C 4NNPL 3O0RH 4JFYA 1HH9B 2AJZA 4NWTH 3BZFB 1R5IA 2R2HB 3BVNA 1MREL 2XZAH 3P77A 3D2UB 3IXTA 1P1ZA 1SEQH 1XGPA 3OAZK 4OZFG 5DJ8A 5I1IL 2YD8A 1A21A 1G9MH 3QDGE 4Y89A 3ILPB 1QHOA 4YO0A 3BD4A 5T33H 4S1SL 3D18B 2OSLA 1AGDB 5IVXE 4ZFZB 4YXKH 2PN5A 1P2CB 3T4AB 1NGQH 1H3TA 5KVEH 4X9BA 5DUML 1PDKA 2FD6H 1YMMD 4HKJA 5D4QA 2VR5A 4JRXB 4NCDA 2NY5H 1FZJB 3GJFH 1DUYB 3ZT6A 4X98A 4IMLA 1UC6A 1VGKB 3RZCC 4NM4L 1OARH 2F58H 4YAQB 1BEYH 4WFGD 4LCIL 3T8XA 4CMMB 1B3JA 1ADQA 2ZCLL 3RUGB 1LO0L 4HIXH 2ARJA 3TVMA 5H35A 3T2QA 1CZ8H 3KDMA 1IEAA 5GS0C 2FEEL 2XXMB 1F3DH 2C7UB 1QNZH 4QWWC 5BQ7B 4PRPE 3MRIA 2C4FT 4ODWB 2JJSC 1YNLH 4PGCA 5SV3A 3HUJF 4XAWL 2PTTA 5JMOC 4YPJA 1M05B 5T1KB 1B0RB 2IAMC 2I07B 1NAML 4OCXH 2PCPA 4U1KA 1KB5L 3ULVL 4ELMB 4HC1H 1KN4L 2UZYB 3GBML 3PDOA 4BUHA 5HSFA 3O2DA 1E4XL 2VLLA 4MYWB 3U30C 5I73C 3N85H 3IB4A 3O2WH 3T0EE 4AIXA 3O9WB 5A2KH 3HE6B 4KI5C 4I2XB 3RX7A 3WFHA 4KK6D 3WV0A 4FFVD 1F13A 4DVRH 3BH8B 4F33B 4U4BA 3KLDA 5F97E 3TBVA 1FO0H 3HG1E 1FH5L 3RDTD 5DRNB 1LDSA 1CLZL 1YMHB 4F3FB 3CSGA 4YGVA 4OCWL 3TA3C 1IT9L 1B90A 4E5XB 2FGZA 4EVNA 2JKXA 1A3LL 1CQKA 5HDBE 1N5AB 4Q9QL 2NX5D 4G9DB 3GSWB 3HMXH 5I1JH 1T3FB 3RZCB 2ZSWB 2HVKB 4I9WD 4XNYL 4R4BB 4MXQC 1KEGH 2X4SA 1UH3A 2WINA 5F88A 3CDGB 2DQGH 2VAAA 1NANI 3MRGA 1D6EA 1CWVA 2GSGA 5EIIB 5E00B 5CP3H 1T1XA 2UYLA 4R97C 4HUVA 4R7NA 3DUSA 3MRLB 4XP5L 3O11A 4PG2A 2WIIB 4GMSH 1VB9A 1NGWB 2DJSA 2AXGA 3EO9L 3TH4T 1FBIH 4IM8A 2FIKB 3KJ4C 1PQZB 3BPNC 3TIEB 5JO5A 5BRZB 4E41B 3GDBA 1S5HA 4LKCA 4WHYG 3BQUD 3BGMB 4Y19E 3KPRB 1UFUA 2JTDA 3T77B 3BZ4A 5KOVC 1W0WA 3U30B 5I73B 5J57B 4XBEH 4N8VB 4DAGH 1MEXL 3DVNB 1UM6H 4KJPD 1G7JA 2NY7H 3BPCB 1XIWD 1JWMB 2P1YA 4N0UE 4WU7A 3P30H 4IOIB 2AW2A 1AXSA 1TITA 4EI5A 3ZMRA 4BZ2H 1RK0A 2J6EH 5ADOH 5HHME 4OD1L 1EMTL 5I1CH 3SKUD 4K71C 3GI9H 2GT9B 2X4QA 3EDFA 3GMLB 1KSRA 4HAGA 3DJ9A 4TULL 1WISA 2ESVA 3VG0H 5FO8B 5EULV 3KXFB 5EZJB 1W72L 2EDBA 4HXAH 1XCQB 5LGKA 3QIUA 4O5LL 2Z93B 1Z9SA 4HK3N 1H5BC 1JZ6A 4KTDH 1N64H 4X6CB 3QUMA 5E7BA 3C60A 1VHPA 4X9GA 3H9HA 4UTBL 2DBLH 4KWUA 1HIML 2Q87A 1CDGA 1R6VA 4WY7L 4YBHA 3NIFE 4PJFB 5I1HH 2VABA 3UYRL 3BQUA 4W4NA 1WEJH 1NL0H 2IG2L 2VR4A 3MV8E 2JCCF 4K3GA 4R97B 4S1DD 5BS0B 5I30L 1OQXA 1WAAF 2AI0H 1BM3H 4PJ9A 3FN3A 4Q2ZB 1R3LB 3TGXA 5L88H 3VWJC 3PGFH 1DVFD 2QBWA 3KJ4B 1RIHL 1RZ7L 3BPNB 1C12B 4NFCA 4BSWA 5EZLA 5M7QA 1XIWA 1YEHL 4ZDHA 4F7TB 5EU3B 5HYSA 5FV1L 3O6KL 2IADB 4ZTOL 4XPTH 4CW1A 4MA3A 3CXDH 5F71A 4OKVB 3WD5L 1X5LA 4HBCH 3UTSE 4ZUSB 1LP9F 3RPIB 3MRPA 1FDLL 4S1QH 3QYCA 1J1XL 3QDGD 2A6IA 4X80L 4WJ5A 4KZDL 3TWCL 1E4WH 1RMFH 4XMLH 1NFDF 5FV2A 3S5LG 4RGNC 4J3SA 5AWNH 3KYOA 3VMPA 3S34H 1N4XH 3IDXH 4Y5XC 4F80A 4LSVH 2YMXH 2ZOKB 1PVHA 2JJTC 3M1BB 4D9QE 5C07B 1HHJA 3P9LB 4P2QA 1F02I 3JUZA 1AR2A 3G5VB 1MJUL 5JMRA 1RIVH 3HLAA 2ATKB 2HWZH 4HKBB 4GAJH 3SKOA 1D5ZB 1H5BB 3KYNB 4PJ5E 2YD4A 4PRHA 1L7IL 2BVEA 3QFJA 5ANMB 5T1DL 3SJVE 3QUXA 4YUEL 5F93C 1M4KA 3BIAX 3NGBC 1DVFA 1JPSH 2V2WA 4OCLC 3PABB 4F7EA 4OFVA 1GHFL 3FQWB 3NZHH 3DXAB 2BNQD 3V0VA 3F8UB 3R0MA 4UDUA 1OAXH 3VI3F 4FFYL 1QYGL 2DQFA 3HZKB 2O5ZH 3QDGA 1ZLUK 4M3KB 4B50A 2IAND 3T0ED 3KS0H 5CIPB 5DA0B 5IVXA 4RX4D 5T3ZH 2NY2D 3ZDXF 3GZKA 4MQXC 1ONQB 2X4PB 1ETZA 2GSIA 1FV1A 1KIRB 4PJAE 3OR6B 4JO2L 4P5MB 4M1CC 1NGZB 2OJZL 5AZ2L 1Z9OA 4OZHE 1DN0A 1LDPH 2ZCHH 4JN2A 1VGEH 4XAKD 1IGIH 1T7YA 2HMID 2APTA 3W9DA 2UY7A 2BOCB 3RWEA 4RGNB 4DZ8B 4LNRA 4ZXBC 4OF5A 5DJ0B 4X9FA 2EYTB 1MREH 5D5ME 2KZ1B 1FC2D 4PRPA 4AEFA 3WFCL 3MO1B 4ZMAT 5BOPA 2VH5L 3MRKB 3VGFA 2ZG3A 5I1IH 2W38A 2CXKA 3TN0C 4KZEH 2AXJA 4A6YL 3HI5L 5EPMA 1LVEA 1RURL 5LVEA 1KBGL 2D2OA 3AU1A 1IQWL 1DN2A 3GJFA 1MWAB 1KCVH 1MOEA 3AS2A 3BP6B 4P2OB 1FAKT 5I76A 5CZVL 1FJ1B 3VFSA 3U0TB 5IK3B 3LN4A 1AD0B 3PHSA 4HGWB 4LCCC 3NGBB 3GB7A 4WNQA 3T0EA 1IM9D 1V7ML 1VFBB 2ZCLH 1LO0H 3JTSA 4CAGA 1BWWA 2Y9RT 3T0DA 1HWHB 4MB5A 1Q1JL 4GXVL 3QDAA 3R8QA 1VESA 3ARDD 4JM2C 4PJBB 4YHYB 2H26A 3JBG7 2VIRB 1F00I 5EDXA 5A3ID 4UT9L 3HG1A 5EZOL 1QBLL 4P3DB 1DBBL 3DX8A 3T3ME 2C4XA 5IT2H 4F7CB 3CSYA 2BERA 3UDWA 3S98A 1R5VA 3O2DL 2VUYA 4X6BA 2BZDA 5DJ2A 4I18A 2RBLA 1NAMH 4YHNB 4X5XA 1GXEA 1KTLB 2FLBT 3OGOE 1KB5H 3ULVH 4Z9KB 3SE8L 5HHMD 3GBMH 2HFFB 3MGOB 1D7FA 3QDJE 4LCWB 1JI2A 4IOFD 3DIFA 2H8PB 1BD2E 4Q9BA 5FO7A 4JKPH 4XVSH 3VXPA 4ZXBB 4D8PA 2EECA 3CJJA 4PYHA 2H32B 2BSTA 3FO0L 3ZKXC 5C2UB 5FKAB 3DTXA 4NBYB 5L7XH 3EFDL 4N0CD 3BEVB 4MGXA 1M6OA 1GPOL 1ZWIA 5TDOB 3NFPB 3RWDA 3TN0B 1FH5H 1MAJA 1U42A 2Z35B 1ZHNA 1QFUL 2W65B 5C92A 1OGTA 2JELH 1ZGLA 4KJQD 1CI5A 5F6HI 2AEPL 5DVOA 2VLRE 5D7IF 1HI6A 1IT9H 1BBJA 4Y19A 1UGNA 1A1OA 4C56E 3SDXE 5IQ7L 2W0LA 3ARDA 4RAVA 5CUSH 3BDYL 1U91A 3CH1A 3RVWD 4X8XA 4LCCB 2HRLA 3QSKB 4JREC 1I3RA 3G6JE 4JO4H 5LBSH 3B2UC 5D1ZB 5DVKA 1QSFE 2DQCL 3WIFB 2D31A 4N0UA 3CH8A 4M7LH 3FO1A 1AQKL 3QEQB 2PETA 1ITCA 4TSBL 4JJ5B 1RK1A 3CFDA 2WWKT 3LD8B 5JDSB 5LG1A 2FSEB 4PRDB 4LVOC 1CT8B 1BAFL 5KOMC 3GSNH 4ZUTA 2JJWA 1T1ZB 2YPLE 1T0NA 2DQHH 3SY0A 2CRYA 5KTEH 4NPYB 1TVBB 2E7BA 2EDKA 5GS1A 4XPFH 3IVKB 5E9DB 3VI4F 2OLDA 3FQNB 3V4PL 3E6HB 1TPXC 4LVNC 4N5EC 3L3OA 4HH9B 1FFPB 4D9QD 1ZLVK 4C54A 5IVZB 1DUZA 1FZKA 1YEEL 4HSQA 1GGTA 2FRGP 1BQLL 3IETB 2Y5TB 1BGXL 3GMOA 4HGMA 3ZKXB 3MR9A 3MV8A 2XY1A 1VEPA 4NGHL 1FFQA 4FQ1H 5EFIB 3B2VL 1MUJA 2ZUQC 4YBQD 1HDMB 2BMKB 3B9EA 4LCYA 4QHUB 3RVTD 1NCNA 5HHVL 4ONGL 4EDXA 2FX8L 4OIIL 1VACB 3NCFB 4G8GD 3EFFB 1NGPL 3LKRB 5J6GB 3QUML 4NP4L 4IIQC 3VFGL 5I16B 2NY4C 4JVWA 3KLHD 4XMKH 5AEAA 3VW3H 4HS3B 1A0QH 1CD9B 5JIPA 4PJ8D 4X7TA 4JPVH 3UTSA 4YWGH 4U0RC 5T3XE 4JREB 2J1KA 3JWDL 4N90E 1I1YA 3PWVA 3W5MA 5D1XB 1HIMH 1MCOL 1KYOK 3RNQA 4LBEB 1FFOA 1AGEB 3UYRH 2XWJB 2IG2H 3PHQB 4GW4B 1A5FL 3U4EB 4PJXF 4ZO8A 5I30H 2DJUA 5L9DL 1YN6A 3O2VH 4FZEL 1DEDA 4Q9CA 4Q7DA 1QRNB 1IJ9A 3O8XA 4TN9A 3CPLB 4XWOC 2NYYC 5F3HA 5DWUL 4IEFB 1UQSA 4GUPB 3BKJL 1RIHH 1RZ7H 1KNOA 5E8DL 4JPIA 3EGSB 5FCSH 4HUXB 5JW3H 3I02A 3NCEB 3EYQD 3QRGL 4JJHA 2QHLA 2QR0B 3O6KH 3VH8G 3WUWA 2Y4SA 1GRWA 4TYUA 4ZTOH 4KJYA 4AY0A 3H9SD 4LIQL 4PJ5A 3MACL 4LVNB 1FFNA 3WD5H 3ZHKA 5M94B 4ISVA 3SJVA 1MHHB 4AYFA 1INQA 3VFNB 5HVHC 3T09A 1SYVB 1L7TH 4PREB 3TWCH 4V2BA 1KTRL 5B4MD 3INUL 5F7HA 1GGIL 3UTPE 2GITA 3ZSTA 5DMJB 3RL1B 5HGAA 5CBAB 2ZUQB 1BZ9A 4PRBA 1KTDA 5EBLA 3F6LA 4WHTB 4OQ1A 3VFOA 2IFFH 2VDQH 2MQCA 2XY2A 4HZLA 1A3QA 5ICZA 2R1WB 4GW5B 1RZIB 4JGMA 1JNHB 2YEZA 1NCWL 5TQ0H 1S9WA 1PSKL 3OG6B 4UOJA 3CFEB 1AC6A 2X7LB 4PJAA 3X14B 5GPRA 3UMTA 5JOEA 4U0RB 1L7IH 4ACPA 3P2TA 1B4RA 3RP1A 5J0BA 4OZHA 2HAZA 4QO1A 2OTUB 2FBJH 1FNGB 4M9OA 5CAYB 2VDLL 2DQEH 1LO5B 4PY8I 4HFWB 4Z8FL 3WJJC 3OL2A 2XG5A 1NANH 5D5MA 4NCC2 5BJTB 1N6QL 3QDJD 5DJDA 1IZJA 4PGJA 3A67H 4MSWA 5KSVA 5FUZL 4I0CC 4OI9A 3V6FB 3OKNA 2RCSL 2AABL 4G3YH 3IAGC 3KYMA 2C3HA 4PJCE 2P8LA 5DRXA 2EYSB 1TQCC 5IGXL 1EXUB 5IBLD 5MI0C 3EZ8A 1HZHH 1S7TB 1DBAL 4KMQA 4WO4D 2EDFA 5JHLL 3A6CL 1WBXB 4GRWH 4U1LA 4QRRD 4NC2B 2OJZH 2XIDA 4TTDD 3VRIA 3GSQA 1G9NH 2UZIH 4P46D 3QCVL 4F9PA 1AI1H 3TBSA 3V4VH 3GSUA 3V6ZA 4HJJH 1J11A 1BBDH 1W8OA 4DEPC 5IB2A 3C6SA 2LFGA 3WFCH 4HT1L 2DF3A 1J05B 4TUKH 1UM4L 3QZWB 2VH5H 4GXUM 2A9NH 3P4NB 5GJTL 2W60B 3RGVC 1WBZA 1CYGA 4GG6B 3SKNB 1H3XA 5LKNA 4A6YH 1WCBB 4IS6B 2P8PA 1RURH 3KPQB 1A3RL 5KS9B 1PLGL 4Y5YA 5EU4B 1IQWH 1MRFL 3L5WB 3ALPA 3T2PA 2I60L 4YDIH 2DI8A 1GZQB 2XZCL 1QSED 3QDJA 1HKFA 4M8QA 4PJGB 5IV2A 1BD2A 5F9AC 1YC8A 1N5YL 5DTFA 1V7MH 2KQMA 2YD9A 5IFHH 1BZ7B 5FAAA 3ET9F 5DZNA 4JE4B 3OKKA 3IFLL 1U8KA 5J1SC 1WZKA 4YPGB 5DMGD 3D25B 4FXGA 3SN6N 4YXLL 3H7BB 4GXVH 4Y7MA 1A7NL 1NCUA 5DDHA 1R0AL 1FSKC 1CDYA 4WO4A 4ONOA 4MCZB 3WFEL 1DQLH 2HKHL 4Y16D 4UT9H 1JUFB 1RY7B 4YXHL 1U0QA 3BIBX 1G84A 1MCPH 3BKMH 5E7FA 5FGBA 3VFVA 5GJSH 2VLRA 1E6JL 3P73B 4D94A 4Y4HC 4P99A 4C56A 3SDXA 2BNRB 4N1CA 3SE8H 1HK6A 5C09E 4JY5L 4YNYA 5SWQB 5IBTL 3G6JA 2W0PA 1HQRA 1YQ2A 3EJZD 4WU5B 4EUPB 2R23B 2EYRA 4JFQB 1HOCA 1QSFA 4LAJH 5IHBA 4NT6A 4ZD3H 1YYML 3ARPA 1KB9J 4H1LB 2GKIA 5L0QB 2ZSVB 4WW2F 1BVKB 1S7XB 3WYRA 3REWA 5ACZB 3OKYA 3PQYE 4YHML 2VZTA 3KPPA 1U3ZA 5GRYA 1ZXQA 1GPOH 2HLFD 4N9GB 3RGVB 4NHCL 2VKXA 4N90D 5IHZB 1Q9LA 1IEHA 1QFUH 4XNQA 4Y88A 2XOTA 4U6HB 1UKSA 2R0LL 3REVB 2YPLA 2H1PH 3ECBB 4MJIB 2MCG1 3ARGA 3SGJA 4UMGA 3HNVL 4WWKD 5F1IB 4WEUD 1ROWA 4OV5B 4Y2OA 1MPAL 1UWGL 1MCHA 3EDDA 3IFPB 3MC0A 4KPHL 4U0QB 1Q72L 3BDYH 1IKNC 3HZVB 1AE6H 4PTUA 3PIQB 4Y16A 3H3BC 5CZXD 4LLUA 2WBJD 4ZAKA 1OSPL 3QEHB 2ID5A 4LP4A 4ZOAA 3WLBA 5I15L 3QNXA 1QLFB 1FSKB 2VN4A 2BSED 4HS8L 4LQFH 2ITCA 2Q86B 3O6FA 3ROOB 43C9A 2HH0L 2GIYA 3EIFA 4ZFGL 1EFQA 2G60L 5EOCJ 3E0GA 1U8NB 4WTXA 5GGSA 1F4WL 5FYKL 2NY6B 4U7MA 1BFVL 4JY4A 4JHWL 4P5KB 4NKMB 1H0DA 1F4XL 1IAMA 2EIZA 4Y2DD 3V4PH 1JNNL 4CU6A 4JFED 3FN0L 4IRZH 4XBGB 4MD4A 3CD4A 1X6NA 1P5VA 4MA8H 1YZZA 1RIUL 1A4JB 1YEEH 1FVDA 5IR1A 5F72S 3QNYB 4OCNC 2L4OA 1HINL 3SCMC 4DGIH 3JV6B 4HFUL 2CDFA 5F9WC 1MVFA 3JTTA 4LASL 1OWRM 5HYEA 4ONHA 2A9MH 3CC5A 4MA7L 4NQXB 4MCYA 3O3EB 4ONGH 4JR9L 2CDGA 5FA3B 4L8DB 2CRZA 5INDA 3D5OF 4Z95H 1NGPH 1F90L 5IFAH 1H3PL 5ALCL 4HIHA 2FLRT 4G8EB 3ZLQC 4U1NB 3RUGE 5I2IA 4TSCH 2EKSA 5SWZD 4APQB 4L8BA 1IAIM 1NCBL 3JWDH 5J3HC 1R3KB 4ZFOB 4XXCC 3MRBA 3PL6C 4MXWL 4NUGH 3FOMA 4OZHF 4M00A 5I66A 1QA9A 3FB7A 3ARSA 2PYEB 4ODXA 1S9XB 3GI8L 4J6RL 5IWLA 3VFUB 1LEKB 4EJ1C 2BSRB 4X6EA 3BRGC 3O3DB 1AP2A 4Y2DA 1PYWA 3L3IA 5D6DA 4FZEH 4YIQA 1E4JA 1MFEH 4ELME 3G5ZB 3E8UH 1P9MC 5DWUH 1K4DB 4OUUB 3FO9A 2E7LC 3BKJH 5E8DH 1AC0A 3SDCC 4UOW0 4DFIA 2Z92B 1J88A 1I1AA 2Y07H 4KK8C 4N1HB 3QRGH 4XGZA 1YJDL 2KDGA 1T1YB 5FM5M 2L7UA 4LIQH 2PW1B 4I2XE 5DC0A 4I48A 2H41A 1PX4A 1IAOB 1QLEL 4EKXA 4DN4H 4D0CA 1WSST 4MD5A 1KPRA 1S7UB 3AS1A 4XNXL 2ZUVA 3SCMB 3INUH 1JPTH 4NFBA 1GGIH 3RWFB 2R2EB 5F9WB 1V3LA 1G7HA 2VWEE 3LRHA 3BP5B 1MHCB 4Y4FA 3V4UH 1XAUA 1KPUA 4DTGL 1U6AL 3SE3A 4BKLB 5DT1H 3PXHA 4TSAH 3HE7D 4UBDC 3T3MF 1NCWH 4PJCA 2Q6WB 3UX9B 4L9LB 1Q9KB 5FA4A 4L5FL 4HXBH 2CUIA 5E56A 3MOQA 5IMKB 3BUYB 1IGJA 3D48R 5D7JD 1GZPB 4X6DB 2HJFA 3BXNB 3QNZA 4P57B 4UIMA 1BFOA 4DOHB 1JV5B 2BVUA 4C57C 1XF2A 3HI1B 1WC7B 1MCEA 2VDLH 4BSVA 1EHLL 2CLZA 1T4KB 3TO4C 1NBVL 5GGQL 5MEPB 4Z8FH 5BRZE 4E41E 5FF6A 5J11C 3DYOA 1Z5LB 1FCGA 5HHOD 4ZO6A 1IGML 4QF1A 3TBYA 1WJ3A 3KGRA 3KPRE 3THML 1KJVB 3LKNA 1A7PH 3MGAA 3O3UN 3VMOA 4GOSA 4UV7L 2X9YA 1T0MA 5FUZH 3SDCB 1DDHB 1Q0XL 2H3NB 5DJZB 3K3QA 4GRMA 1GCFA 1G7IB 2B39A 3SO3B 1RUMH 1WZLA 4QRUA 3MRCA 1CGYA 3D3VD 1CTOA 4H26B 4W81A 1OPGL 5IGXH 3KPLB 5F7MC 4U7SA 1MFAH 1DBAH 5DMIH 1XH3A 3ULVF 2D4FA 3PQYD 4MB4A 5JOPE 1EGJA 5H37G 2VKWA 3A6CH 3QG7H 5JHLH 3SDXF 3FTGA 3LHPH 5HI4D 2HFGL 1HHIA 1H3VA 1RHFA 4NYLA 3HE7A 1MY5A 3CVHA 1ZVYA 1GSMA 4HMDA 1YQVL 1VADA 3KJ6L 4BFEA 3QCVH 3HC0A 4PJDF 4EI6A 1X4XA 1HXMA 4MXVF 3CCHA 1A6UL 2OZ4H 3ARXA 3KXFE 3QDMD 5IOPB 1BJMA 2AK1L 5D7JA 1EEYA 1P7QD 1DBKL 4YDLC 5EC1B 1UM4H 2CRIA 3F5WB 5KW9H 5GJTH 2V9QA 4X6CE 4ZUWA 2IQAA 1FFRA 1AIFB 5D1QD 3SKJL 2VLME 4AT6A 2BXZA 4LU5H 1PLGH 3MRRB 4PJFE 4EBQL 3ILQC 1NBYB 1CFVL 5F7WC 3P0YL 2GK2A 2J8UF 5C09A 4CVXB 2UWEB 4Y1AB 1YNTB 1KULA 5BS0E 3S35X 3WDHA 1N5YH 3OB8A 2IC2A 2C26A 3W9EA 4R2GB 4P5TD 4YDJA 3MYJA 3IFLH 1B0WA 3TO4B 1CDHA 2HRPH 3C87A 5J11B 1DP0A 1UB5B 1AGCA 4YXLH 3BN9D 2Y23A 1BLNA 3ZL4H 3VXTB 3GSVB 1KIPA 4K94H 4R7DB 3PQYA 4OGXH 3NCYS 1WICA 3D69B 3KR3L 5D9SB 4HG4J 3WFEH 1OAYL 3PWNA 3FB5A 1CU4L 1S7RB 3BMWA 3MZTA 1QR1B 1UKQA 3FQTA 4X0KA 3K2UL 3MFFA 4LKXB 4O2CA 1OHQA 3QIWA 5FDWB 4XRCA 3OX8A 2IH1B 3QPXL 1RUAH 2VXUL 1YY9D 5CS7A 5ERWB 1P7QA 3DVIA 1QO3B 2PW2A 3MJ9L 4KQ3L 4JY5H 1UEYA 3GMRA 3DVGA 1BVZA 2MPAL 3ZE0F 1R3IL 2IH3A 2V7NA 1MQKL 1PG7L 3P4LA 5C07E 3VFPA 3LRGA 3NIDE 3CSPA 1N6UA 5HGDB 1YYMH 5I75B 3TCLA 2Z31A 2W91A 4UT7H 3VFTB 4X5WB 4YHMH 4M6ML 2DQDL 1KENL 2BX5A 4YDLB 4KDWA 5CJQH 2D0GA 4NHCH 3BMVA 1FYTD 4HMCA 4RNRB 2I9TB 1ZLUH 4P5TA 4X99B 5SX4I 5ICYB 3BDXA 1VPOL 2E5EA 1MPAH 1QFOA 2ED8A 1CFNA 2YPVH 1A7BA 1A6VH 4J3TA 1HH9A 3DXAE 3U83A 3BZFA 3GHBH 3QHTC 2R2HA 3OXRA 5BV7L 3B5GA 3D2UA 4NQEB 2NW2B 3F62A 2AERT 1MFBL 3ILPA 2AJUL 3O9WD 1AGDA 1D9KD 4PBVC 1T7WA 4ZFZA 5IF0B 1Q8MA 1P2CA 3MOAL 3T4AA 3S97C 2WP3T 3GHEL 1OY3B 4NHUB 4RWYL 4MJ4A 2G5BB 3VRJB 3QI9B 4PLJC 5EOQL 1FZJA 4KV5F 4LLWB 1DUYA 4XCFL 1EUUA 2DM4A 5FYKH 1ND0B 1VGKA 2YN5A 3GGWB 5T3XL 2X1WL 3NBNA 1AR1D 1OT2A 3ULUL 1VFUA 2BVYA 3SGEI 1UM5H 1B2WL 1C5CH 1F4XH 2B1AL 2GJJA 4R4ND 5TJWK 3BRFA 1JNNH 4RGNE 3FN0H 3X17A 4Z5RB 4AMKL 3MCLH 4S10A 4OFDA 3K8KA 1T83A 2C7UA 5BQ7A 4KY1H 4NQUA 3M17B 1WTGT 3LEYL 1RIUH 2FO4B 4OIAA 1A9EA 3G9AB 4LPCA 4ODWA 1F11B 1FVCA 4BZYA 3QR2A 2CLVB 4ZS6C 5BO1L 1HINH 1VSCA 2HTLC 3I2CL 3C08L 1FCCA 4HFUH 1GYAA 4R0LC 1M05A 2LV4A 1B0RA 5T1KA 5A16B 5K93A 1CFTA 2I07A 3QIBB 4JN1L 3QT2A 4JQXA 4ELMA 3WIHA 4OSUL 3TESA 4NQSB 4XVJL 1RZ8B 2MMXA 4XC1H 3GO1L 4NQVB 1X5GA 4PS4H 5CGYD 4WI5A 5F7FA 3GMMB 3H3KA 4XP9H 3O9WA 1D9KA 4XCNB 1R5WB 1NDGB 4PJCF 1Q0YL 2VDKH 1NCBH 3HUJB 2NY0C 3BH8A 4F33A 5TE7L 1L0QA 4PJBE 4MXWH 4KI1A 5GZOC 5D7LD 5DRNA 1UJ3A 3GI8H 2H2SD 2MQ3A 1YMHA 3M07A 3BO8B 2APFA 2R0WL 5GSRB 4M9PA 1NGYA 5GIRB 5JOPD 3BIKA 3NCCB 2FJGA 1N5AA 4ZOCA 4MMXC 1T3FA 2CKBB 4LGPB 2DIJA 2ZSWA 4LCWE 4KK9D 5GRXG 2HVKA 4R4BA 1CDIA 3JWOC 5IKCB 4H8WL 4BQBA 2YUZA 3CDGA 4I5BB 3AUVA 1AO7B 4PRNA 5EIIA 1KC5H 5CD5D 2V7HB 5E00A 3WN5B 1NCCL 4GRWF 5I19L 4XTRC 5JXEC 3MRLA 1YECL 3DUHA 3QWRD 1NGWA 5ALBH 1DQJB 1Z6JT 2HT2C 2XTJB 4NC1C 3MLSL 5FUCC 2FIKA 2VLMD 4QRPB 3UBXI 5IW1B 3LPWA 1FL3B 1PQZA 1EAPB 3TIEA 2FEDC 4KUCD 5BRZA 4E41A 4DUVA 4KKBC 3LKQB 1DQTA 2RR3A 4POZD 4DTGH 3BGMA 1U6AH 3KPRA 5EIQA 3HNSH 3T77A 2BY2A 3AREC 1W2KT 3RL2B 2YUWA 4NRYB 1Y6NR 4N8VA 5CJBA 4WW1B 2D7NA 3DVNA 3I9GL 4NNYB 2B5IC 4JVPA 5IROC 3S7GA 3BI9X 3BPCA 1JWMA 4LSQL 3BWUC 4F9LC 4JFFE 5DJYB 3LQAL 4IOIA 4XPGH 3QO0B 4M03A 3QEQE 3MROB 2SEBB 3RWGB 4N1EA 1FPTL 2W0KA 1NUNB 4HIEB 1GGUA 2JJVA 2E3VA 2I9LB 2KPNA 1ZLVH 3UZVB 4IDJH 2GT9A 3F12B 4KKNA 3O4OC 1TDQA 3GMLA 4PJ7F 5DFVC 5K9JL 1E27B 2AV1B 3DSFH 4R9HA 4HDIA 5FO8A 4I0PB 5EZJA 3KXFA 4M93C 4MNGB 1IGMH 5I1DB 1XCQA 1BHGA 1CFBA 3THMH 2Z93A 3H2WA 3DX9B 5E9DE 3CX2A 2AQ1A 4X6CA 4UV7H 5B8CB 4KVNL 1Q0XH 2R1YA 1SMOA 3FO2B 3P0VL 4KHXL 3UJIH 2X1XR 1EGJL 2VXQL 5CKGA 1KFAL 1BQUA 4CNIB 1PJ9A 4GW1A 3WXVL 2FZ3B 4PJFA 1OPGH 3K1KC 1RVFH 5HDLA 1L0XA 3CVHL 5IVNA 5BS0A 1EDQA 3TT1H 3OBAA 3X3GL 4PR5B 3DYMA 4Q2ZA 3STLB 5EH1A 3KJ6H 4M4PA 1I1CA 4PPTA 4F7TA 4O2FB 1EERB 3U6RA 2VDPL 3RY5A 2IADA 3QHFH 1DBKH 4LHUD