5FCUL

Crystal structure of the inner domain of clade a/e hiv-1 gp120 in complex with the adcc-potent rhesus macaque antibody jr4
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
212
structure length
212
Chain Sequence
SVLTQPPSVSAAPGQKVTISCSGSSSNIGRSYVSWYQQVPGAAPKLLIYDTNKRPSGVSDRFSGSKSGSSASLAITGLQTGDEADYYCGAWDGSLNVHIFGSGTKLTVLGQPKASPLVTLFPPSSEELQANKATLVCLISDFYPGVVKVAWKADGNSVNTGVETTTPSKQSNNKYAASSYLSLTSDQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords clade A/E 93TH057 HIV-1 gp120 core
publication title Paring Down HIV Env: Design and Crystal Structure of a Stabilized Inner Domain of HIV-1 gp120 Displaying a Major ADCC Target of the A32 Region.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 46
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2015-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fcuL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fcuL01
3FB5B 4PJFF 1RUKH 1KGCD 2HVJA 3ZTJH 3U4AA 2VWEC 1L0YA 3FFCA 3IXAB 4IRSA 4YHYB 1A8JH 2F53D 4JFYA 4OCYH 4XMKH 5F7DA 5KBNC 1IM9B 3FRUA 1I9RH 4GAJL 2ZP0T 1EEYB 3HR5B 4MXVE 2OXHA 4NYLA 3MA7B 3ALXA 4Y5XB 5T3XE 3TO4A 1XF3A 3TJHC 5C0FA 1GGUA 3FQXB 1ZT1B 4F7CB 3LDBB 5SWSA 4G9FA 3V0VB 3FO0H 1IQDA 1MH5A 4X83A 1IGTA 3L3IB 3EJZC 5E8PA 4Y5VA 5TDNB 2CGRH 3UO1H 5IG7A 1QSED 3GI8L 2H41A 3MLZL 3PL6D 5FO8A 1VERA 4YC2B 5FYKL 4N0UE 4LAQH 4YR6B 5L2KA 1MEXH 4Y2DC 2NY3D 4I1NB 3F5WB 3G5ZB 3LY6A 4MQTB 4R96A 4UIMA 4KHXH 3G5XB 1SEBA 2OL3B 3VFGH 3FQTA 2BP3A 1SBBA 4ODTH 3H7LA 1SHMA 4JPIB 4FFVC 4L9LC 1XCQA 1FP5A 4MA8L 3SBWC 4FHBD 3U0PB 2VQ1B 1BQLH 3WIHH 5EO1A 5IBLD 4WNQA 1INQB 3ULVF 1FFPA 2CD0A 3ARTA 2HG5A 3IETA 1KIQA 2VLRB 1U58A 3ARSA 5GSVA 3HE7D 1UJ3C 2DQJL 4LPVA 1JTTA 1FZMA 3P4OA 2C3XA 3WEXA 3WHE0 1EMTH 5DFTA 1GZPB 2EDDA 3BMVA 3P3YA 4WFED 1KOAA 5BZDB 5JZ7D 4BH7B 5FUCC 1MFDH 5DA4A 4UT7L 1NAKH 2HFEA 4M1CD 4PJ5D 4Z7VB 2X9WA 4K23L 5CEZD 2BOCA 2K1MA 4ZUSA 4X8XA 3B9EA 4F9LA 2ADIB 1J05A 1YMMD 5ISZA 1ZANL 4KY1L 4JDVA 2BY0A 4PJXF 3BZ4B 3I6LE 2Q76A 3VW3L 4X80H 1LEIA 5DJ2A 4LSTL 4JZOB 4U6XB 3ARPA 3O81A 2J6EA 2X4UA 1HEZA 4P3CH 1I9JH 4HCRL 4NQSA 5EB9A 2Z31D 4I0PD 1VFUA 4YWGL 1JNLL 3AY4C 4F15B 3S96A 1D3CA 5M95B 1P4IH 2XACC 3S97C 3OGCA 3OV6A 5F6HI 1OY3B 2Q7YB 5DC0A 1XR9A 2FBJH 1T80A 1U8LB 2PO6A 3CFBA 1ADQL 4H8WH 4MXWL 4PRPD 1XIWD 4H1LH 2X70B 5K9OB 5IFJA 1O0VA 1B0RB 4KGJA 3LH2L 1XGYH 3FO2B 4LP4A 3U30C 4NHCH 3L7EB 4EN3C 1W0VA 3KLAA 5L7XH 5T1LD 4ZTPH 2PYEA 1OAKL 4KK9D 3X3GH 4OGYH 3V95A 5L88L 1MHEB 3A0OA 4HGKC 4HT1L 4U0RB 5A3ID 5ENWA 2V9RA 4M62H 3SE4C 4Y19E 3BD4A 4HH9B 3JWOL 4HKZB 2EDJA 3S5LG 3ZTNL 1T7ZA 1RUML 1HKLL 2APWA 2FYYA 3BZDA 5CIPH 5GRJH 2C4FT 4LVEA 1Q72L 4NN6C 4ZPVB 3OJVC 2D03L 5I1CH 4L8DB 1EK3A 1QR4A 5EZLA 4D9RD 3CCHB 3PWVB 3QUYA 4KQ3H 1FBIH 1Q94B 5JXAL 5LXGH 1KYOJ 1EX0A 4OZ4A 2YR3A 4FQXC 5HYQB 5I1HL 1CL7I 1XF4B 2PNDA 2JIXD 1A3RL 2AQ2A 3NN8B 3P73A 1MUJB 2DYPB 4MCYB 4QRRA 3KHQA 4XT1C 1DQJA 4ZFFA 5F71A 5TE7H 5ADOH 4XH2A 4PG2A 5J13C 1EFQA 1WICA 3T08A 2P8PB 4Y0GA 5CJ5A 1X5GA 4EQ3A 4ZMAT 2DKUA 3NBNA 5B38B 5E56A 2IANA 4LLWB 4LIQL 4G6FD 4BK4A 3OR7B 4PUBL 1E4JA 4P5TA 1I9IL 1T5XB 2CMRH 4J4PD 4P48A 3WNOA 2E6JA 2K9UA 4OBSA 4PJGB 1D5XA 4JG1L 1UZ8B 3VGHA 4I18A 1QOKA 15C8H 1T2XA 3RWGB 4NFDA 5KVFL 5FOBA 3CVHL 4GAYB 5I6XB 4FTVD 4P99A 3CPLA 3DX8A 1JGVH 5FXCH 5LCVH 4E0RA 3ROLB 3S8WA 1H5BB 3KXFA 1ONQA 3BEVB 2X4RB 3GMQB 1BX2B 1ZGLP 4CUCA 4XZUA 1UFUA 5T3ZE 1RHHB 4RBPK 4MJ2A 2A6IA 2YK1H 4HJ0C 4MJ6B 4JM2B 1M7DB 2PKDA 3D87B 3MZTA 1IFHH 3O3EA 3NIDE 5L8JB 2V6HA 4FQCH 5MI0B 3OKDB 1EH9A 4JE4B 2CXKA 4NO3B 3MRCA 3GSNB 3QFJB 2EDNA 5D1XC 3EHBC 3NAAH 3IS0X 3LKOB 3TBTB 2IADB 1AKJA 5DD5L 1NCCH 1S7XB 3HPLA 1JMZA 3MOAH 4HX1B 1BIIA 4HIHA 1HK6A 1M7IA 1CDCA 3JVGA 4XI5D 4P23D 1AO7A 1EEZB 5FB8B 1FGVL 5I1LB 4QOKA 5L2JA 2Y1VA 4CMHC 3HLAA 4KKAC 3MV01 4JQXC 1BFVH 5C92A 3BXNB 1A14H 5F1NB 1J1PL 2IALB 3VH8A 4E41D 5I1JL 1ZHLA 5J7CC 5EOQL 5CP7A 2Z93B 4J2XA 1PZUB 2YBRA 35C8L 2F19H 1J5OL 4O4YH 4Y8AA 4M6NL 4OQTL 3TJEH 1IM9D 3BP6B 2W65B 2CKBA 5ESVB 2I07A 3MCKB 4P9HH 4QRPD 5HDQL 3V7AG 3E8UH 2CRYA 3LS5L 2EO1A 3DGGB 1CFTA 2Q86B 5D7LE 1FFQA 3X14A 3VFVA 4P2CG 5DMIH 1MFAL 1V05A 4K7PL 5HHOE 2VH5H 1YECL 1GRWA 3V0AC 2V9TA 1VEPA 1KBGL 2ZCLL 3UPRB 1TIUA 4LARL 2DB8A 5JW4R 1QLRA 4NNPH 4JM2C 1DLFL 2R1YB 1T7WA 1BECA 2Y5TA 3KS0J 3HMXL 3ULVH 2EDYA 2FNBA 2GFBB 3F8UB 4JFDA 2Z35A 1UZ6E 3KPSB 3LZFL 1ZLSH 4Y16D 4OT1L 4BM7A 3QG7L 5MI0C 3MLRH 2CO7B 1KXVC 4KI5F 3T77A 5E2UL 4CGTA 3TA3B 1SJEA 4KV5E 4PGEB 2GJ6E 1O7VA 3N9GH 1YEGH 3OZ9L 4JVPA 4HPOH 5EBWB 4ZDHB 4Y2DA 1T22A 4OFYA 2D0HA 1KPRA 3MGOA 3ZE2F 1FLRH 1UCTA 1QBMH 4QWWC 3NZHL 1UG9A 5IB2A 4DGIH 4OZGB 2VLRD 4J1UB 1G9MC 3DBXB 4GKSA 2WIMA 1YNTA 2AJZB 3FQUA 2ZJSH 3OB0K 5D6CA 4L9LA 4GMSL 2PCPB 4TRPH 3JTSB 3SBWA 1FNLA 5H94A 3E6FB 2LFGA 3RWFB 1F02I 2VQUA 4U31A 3ZHKA 3BGMA 4FRWA 3W0WE 5CJOL 2AJVL 3BOVA 4C4KO 3VD4A 3VXMA 4U2YA 5IVNA 1OCWL 3T65B 3I75A 2A1WL 1JHLL 3T0ED 1DDHA 1G1YA 3HC3H 1YYMH 4YPGB 3D9AH 3ZZ1A 3R1GL 2J88L 1P6FA 4LK4A 2IMMA 4QCIB 1JWUB 1NGYB 3IF1A 4Y4FD 3RBGA 5B39A 1A2YA 3WFZA 1R3KB 4YHML 1IAOB 5C2UB 3JXAA 4GAFB 3RAJL 4XNQA 1NLBL 1VADB 1WC7A 1X5XA 1W72L 3QWRD 4MS8C 1YEDA 3QDME 3MLYL 4DVBA 5DJDB 4MDJB 4IRJB 4KKNA 3GI9H 4YFLI 1BREA 3TC9A 3VFOB 5IWLC 3TNNA 4QXGL 2BXYA 4J12A 1X4YA 1Z0MA 4I2XB 4NO5B 3OMZA 3MRLA 2NYYC 4GKZA 5ABDE 4NN5C 4NSKA 4OUUB 5AD0B 2YWZA 2XYCA 1HSAB 1LE5B 1RY7B 5FKAA 2E27L 3AY4A 1K3IA 1I9EA 3HI6H 3O2WL 2JK5B 1IGCH 4NT6A 4AT6A 1TTFA 5D2NC 3BKYL 4JFFD 5EUOA 1RFDL 2JCCF 3CFDB 5IM7A 1N0LA 4CMMA 4K3HA 3F7VA 3LD8B 1AFVH 1HHJA 1OTSD 3DROB 1RZJH 1ZHNA 4X9BA 3SDAD 5BS0B 5A2FA 1HXMA 1ORQA 3TT1L 1QA9B 4NC2B 3VXNA 3J7HA 4B41A 1VKXA 2HTKD 1G9EA 5E6ID 5HY9B 4MB4A 5JO5B 2ZG1A 1ROWA 1QUNA 1UM6L 4TUOA 3RY6A 3U36A 1QBAA 4PGZA 4FA8A 2NR6C 4NKDB 5JIKA 3TBYB 5T1KB 2FZ3A 4PJFE 3U7AA 5DEFB 1SBSL 5HDLA 1OTTD 3SE4A 1S7VA 4HUNB 4BSWA 3ULUC 1EJ6A 5TQ2H 4XC3L 3GMOB 3QUXB 1PZ5A 1DUZB 5IFHL 1R5IA 5EU6D 5ICZB 3H3BC 2MHAA 3GIZL 4L1HA 4ZUTA 1XCTA 3I84A 3LPGA 4L4VA 4ONHB 2DYPD 4MAUL 4Z95H 1IGYB 4N0FA 1GOGA 1I3RA 4FQXA 4ODXB 5IW6A 4P57B 5GGQH 3WIFA 4ZO9A 3MJ6A 4ZXBB 5D2LA 4PRIB 5JIHA 2KKQA 4HIIA 4LEOB 4D9QD 1A7QL 4OCSH 3UAJD 2BVOA 4G7VH 2OI9B 1CDBA 1NCAH 2HJFA 3WNMA 2XKUA 5DT1L 5EC2B 3QJHA 2LE9A 2BJML 3KYNA 5E8OB 1MQ8A 4CJ0A 1AXTL 4ZPTA 4N5UA 4CN4A 3PWNA 3BDBA 3FQRA 2EDRA 5DJ6B 4LSPL 5GS0D 4XMLL 4C59B 3LD8C 1TJIH 3BWAA 3MJ7B 3HE6A 4HK0A 2IPKA 2IBGA 3O6LL 1YPZB 4IOIA 1YUHA 5IHBA 5KS9A 3P0VH 4XCYB 4PJ8C 2ZNWA 2P8LB 4YUEL 1LO5A 1Z9LA 3V7MA 2XNAA 4F3FB 1DBBL 4M6OH 4EUPB 3A6CH 1I85C 1OM3H 3F7PC 2OJZH 1EJOH 2EC8A 3I3BA 1EAJA 4LASL 4DEPC 5IIEA 4PJAB 4UDTA 5IMOB 4RISH 5HYFA 4M7KL 1A7PH 3FO1A 1RU9H 1L6ZA 4DAGH 4IJ3C 3TBVB 4PJXE 3EDFA 1BM3H 4PP2A 1K3ZA 5C0BB 2XN9A 2O5XH 4P4RB 1CU4L 1T04B 3QFJD 4YPJA 5E2TL 4ZYKA 2FCBA 4G9FE 1FGNL 3UP1A 4XBEL 2CR6A 5EC1B 1WBYB 3NCYP 2HKHL 4H20L 2ESVB 5E1AA 4S1RL 3VE0A 3DSFH 2R0LL 4CNIB 2VXTH 4HWEL 1C12A 3HRZA 3QIBB 1FIGL 1TZHA 3ZKMC 5J11B 4LCIL 5I1AA 1E6OH 2SEBA 5F9WB 3ZHDA 5HVWA 3LKSA 5FHBH 1VDGA 2MCPH 1Z6JT 2CUIA 1MWAL 1IJ9A 1CFVL 4S10A 4Z7OF 4QHMA 4O58H 4JQXA 4BQBA 1CGUA 1MAMH 1MY5A 3EFFB 4HLJA 2YUVA 4ZFGL 4GLRI 5I2IA 5ID1A 3TWCL 1EGJL 3MJ8B 4OF3A 2H3NB 3QDGD 4AM0B 5B21A 2JB6A 2ZUYA 2BHYA 1A6VH 4PJHB 5TF1H 2VDRH 3IKKA 1QFUL 4HUXA 2K3TA 2ZOKA 3KPNB 5F88A 3K2UL 2VL5A 4N1HB 3NCFB 4WHYH 2PN5A 4G43A 5IB3B 4WCYH 2BNQE 1JGUH 5MENA 3ET9F 4UQ3B 5DWUL 3VWKB 1WISA 3KPSD 2FD6H 1FL3A 3MLXL 5C7XL 1G0YR 5HI5C 1XH3B 1N5YL 1BVZA 2CLRA 4RMSA 2DQIH 3V79C 4KHTL 2B4CH 3O4LB 4TNWF 1D6VH 3OKEB 4PREB 1KEGH 1M4KA 4XCEB 3MSPA 3TA3D 4AEIL 3N50A 2E7LC 4HWBH 1O5DT 4NQDD 5MP6L 3FZUC 1TQBB 2V7NB 2APVA 2JB5L 4K2UL 2GK0A 1TFHA 1BGXL 3DYOA 2EIZB 4ELKA 3MXWH 1GGYA 1CTOA 3TPKA 5C0NC 4X4ME 4Z9KB 4LCCB 4NBZB 5CGMA 4UQ2B 4NKIH 4LF3B 5TPWH 3RWCA 1CBVL 1U8HA 1U8NB 1QPPA 1S5IH 5D96C 4HF5H 2QADC 3OBAA 4LNRB 1CLYH 5C07A 2FH6A 3CLFL 5F89A 1I1YA 12E8L 1M7XA 2E6QA 4PBVC 3MV7D 1LO3L 5FYLD 1OSZA 5SWQB 2AJUH 3FT4B 4NWTL 4YFLF 1S7RB 5DHVH 4ONOA 2DQUL 3TZVB 1JRHI 2A0LC 3DV4B 4LPXA 3RU8H 4JO2H 4HMEA 3IXTB 4P4KC 5F3HA 4M1DH 5IESH 1UT9A 5H2BB 1RZKL 1MCDA 4PRNB 1IGML 3GMPB 4PRAA 4UNVA 4IRJD 2QHLA 4OF5A 2AI0L 3WXWH 2WAHA 3S9DB 1QFWI 1TETH 3STBA 1F8TL 3MFGB 3RKDD 4GS7B 5J9PB 1OP3H 1X5IA 3QBTB 4JN1L 4ZSOB 3O45A 3QWOB 4I0CC 4MX7A 1FZKA 4LSUH 1RULH 3D0VA 1ZHBA 2XKSA 3VGGA 4LLUA 3KPLA 5C71A 1ZEAL 1M1SA 5IWLA 4UV7H 2GCYA 5D7JC 4A6YB 1CL7H 2W1NA 3MACH 1HOCA 5DD3H 4OGAD 2VLMD 4NQED 1GGTA 1ES0B 1EA9C 1FSKC 2MCG1 2YPLB 2ZG3A 3S5LB 4DKDC 3U4BL 5BS0D 1F4XH 5I0ZA 4PJ9B 5DRXB 3HS0B 4A2MA 4KK5D 5EBMB 3RWJA 3HI1B 2XTJC 5D2NA 3G5YA 4M7ZB 4NQVA 3ARDC 4B0MM 1A4KA 5I8CA 4FN0A 3QIWA 5T1KD 3KLSA 5I15L 1KNOA 3HCVB 5DTFA 3T4YA 4C55A 1TZGL 1BVLB 2AS5M 4O00A 2GT9B 3QUXD 4ZFZB 3TH4T 3WDIA 3BKJL 5EU4A 4MD5A 3VRLF 1UYWL 1P7QA 1HWGB 1JZ3A 2X41A 1H15A 2W0KA 1MRCH 4K7FA 4ZUVB 3TNMB 2DMCA 2UZXB 1OP5H 1F3JA 3MGAA 5ALBL 1N5AA 3KXFE 4PJBA 4YXHH 1NANI 1HILA 3TIEA 4EXKA 2CIKA 4IMLA 3DMMC 2R1XA 3Q6GL 4X7SL 4XWGL 2PW1A 5BCAA 1DZBA 4ZXBD 4PRID 4GKOA 1EV2E 1TVDA 2I9LA 5J12B 5JDSA 4KI5E 3FQWB 1OAUL 4GG6B 4WV1B 3Q48A 3EYOB 2R29L 5C0AB 3VGDA 3MLSH 4YBLB 1CFSA 4XGZA 2QSQA 3ZE2E 5F7LB 3QRFM 1JGEB 5GHWL 3N1MC 2VXSL 5FYJL 2YPKB 1AO7E 2EDFA 5GGSY 5I16A 1NSNH 4A2LA 1AXSB 4QOKE 3C60A 1UC6A 3TBWA 2QSCH 1T89A 4ZG1A 4PGDA 1PGRB 3DJ9A 4X4YA 3BAEH 3D3VA 2VLKB 3HB3D 5EDXA 1N0XH 1CICB 1N4XH 1BLNA 1U8QB 2HFFB 4OSUH 4X9HA 5BZWA 3WIIH 4G8FA 5J1AB 5KANI 1D5BB 2D2OA 2UY6A 3DX6A 3PHOB 1F3DJ 4G6KH 1EBAA 4KRPB 4PB0L 4PJEF 1MIEH 3QXTA 2FX8L 1FO0H 5IK3A 4N5ED 4PJ8A 4X7DC 5BVJB 5K59F 4O9HL 4FQ2H 5I1KH 1T21A 1K8DB 4O51B 4S2SA 2BSED 4N0CC 1S9YA 2CJUL 3B2UD 2G5BA 1UQSB 1I85A 3GSQB 3DUSA 4WHTB 5TE4L 5J3HC 5TDPB 4Q9RL 4F2MA 5C0BD 1MIML 1BEYL 1G7PA 3KNBA 4OLVH 5IT2L 3KG5A 2EDWA 1NAMA 4NN7B 4LKCB 2HLAA 5IQ9B 1KELH 5E6ZA 2ESVD 4WHYG 1NCBH 2NY4B 3DRQB 1U8IB 4PJDA 1P1ZA 4DN4L 2G2RA 4JFDE 5HGBA 3QIBD 4H25A 4GOSA 5DYOB 1C7TA 4F7MA 3QI9C 3SJVB 2WWMC 4HFUH 3SDYH 1U92B 1L7IL 25C8H 2HKFL 1PBYA 5HVHC 2FHCA 3MRNA 2JCCE 5CMAA 3ZDXE 3L3KB 3GSRA 1NL0H 1QSFA 3ARZA 5FF6B 5ETUB 2H32B 2W59A 1VPOL 5IROC 2R4SL 4TVPE 1CE1L 3QEGL 1HH9B 1CFNB 4EDWL 4ORZC 5C0CA 3QG6B 3UBXI 4FABH 4MQXC 1FAIL 1FJ1A 3O3AB 4RAHA 4WTZG 3BP5B 3EW3B 4YIQA 3DWTA 5B4MD 3PGCA 2G75B 5KVGH 1J86A 2MQCA 4UAOC 1CICC 1Z9OA 5KAQG 2OQJB 3G04A 3V8OA 5F8RC 3NPSC 5JIPA 2HT4D 3NCJH 3GHBH 1MI5E 3JV6A 3AS3A 3ILPB 5EZJA 4HS8L 3LB6D 2OP4L 3QO1B 3VWKD 5D5MA 1KPUB 1ZVYA 3BPOC 4LLDB 1M6OA 3OF6D 4I8DA 2NNAB 2WQ8A 3MNZA 1GH7A 1G7JA 3H9ZA 1IGJB 5SV4A 5HYSG 1HQ4B 1A6TA 2UZIH 2MTPA 1DBKL 2LAGB 3O9WA 4XCFL 3GB7A 4Y88A 2BVUA 4K55A 1BQHG 3P77A 2W9DL 4H1LB 3DI3B 1VENA 3ME0A 3LPFA 4F7EA 3CX2A 4OCNC 2E7LA 3QIUB 1B2WH 1S7WB 2VDQH 1T6VN 4X7TB 1FQ9C 2DMBA 3QXDB 3VD9A 1XGRA 3D0LB 4X99B 5C0GA 4HIJB 3R06A 4G6ML 5SWZA 4Q0XH 1Q9WB 1BAFL 1DR9A 1I8IB 1INEL 3NGBC 2M1KA 3HNVL 1KCRH 3C6LC 3VCLB 3GMRA 1FYTB 4P9ML 1YN7B 2E7MA 3SPVA 1KG0B 1KT2A 3BYYA 3TZVD 4RIRA 4L8BB 3A67H 3CZFA 3U0TA 3VXUB 3FB7A 4HK3J 5L8LB 2I5YH 4JY4A 4U0QB 4OV5B 1W0WB 1ZSDA 4XTRC 3HI5L 5DRZA 4JAMA 3LV3B 5TDOA 4GW4B 3T0BA 1H3VA 4P4KA 4U49A 5CZVL 5T1MB 1CTNA 5LAXB 1A9EA 3GGWB 1MLBA 4RFNB 1T1XA 5IW1B 4ZUWA 4HIEA 1GPOL 1I8KA 2HFGL 1MF2L 1AQDA 4AEFA 1Y0LA 1ERNA 2XY1A 2ZCKL 5DMYA 2NW3A 4IDJH 4YXKL 1RZFH 3LOWA 4K3DL 3RHWF 2BC4B 4TUJA 4R26L 2GITB 3VGAB 2A6DB 2NPLX 2AAVA 5HHQB 3L3GA 2YPLD 4XP5H 2IG2H 3MOBH 4PJ9D 2X4OA 1GZQA 2WBKA 1H8SA 4KKBC 3KJ4C 3QRGH 5D2LE 1R3IL 3DUHA 4RMTA 4XNZB 5EBLB 3VRIA 3BP4A 2P5EA 4GRWF 4HGWA 5T3XL 2APXA 3L3HA 4Z7WB 1MFEL 3MLTB 3UJTH 1PG7X 4BQ9A 3PWPA 1H3TA 1QO3A 4TSCL 1X5AA 1P2CA 4KKCC 4Q2ZA 3MRJB 4HFWB 2ICCA 4DGYH 3ARDA 5E2VH 3VXSA 3WHE1 3OJDB 2VDNH 1ZWIB 5DQ9B 3WHXB 3FB8B 4WFGD 2BHUA 3N1QC 1CE6B 2C1OB 2WBJB 2RBLA 1JZ8A 2YD6A 2GW5A 3KHOA 2BVEA 1WZ1H 4YHIB 1JBJA 4AIZB 3O2VH 4UIKH 5BW7C 3C6SA 2DLHA 4KH2A 1KJ2H 4KK6D 1JE6A 4G9DA 2OZ4L 3HKFA 4XI5C 1G7LB 3MBXH 32C2A 3QH3A 4PRBA 3LKPB 2YZ8A 1PDKA 1JF1B 1CD0A 1IEBB 1C5CH 2FEDD 1VGEL 4RFNC 4QF1B 3RZWA 5D9SB 2X89A 5I76A 3LQAL 1A3LH 1SYVA 4KUZH 3IKCB 2XN9E 2QTEA 4ZD3H 3DMMA 1QHPA 4IS6A 3U79A 4TPRH 5C0AD 4KMQA 2NX5A 4R6UA 5BV7L 4LDOB 1KIPB 4MJIA 2ENYA 4RBPH 2EDHA 4QHKJ 1RUPL 4BZ2H 1V3KA 1IC5H 5EU7C 1NFIA 2NCMA 4YK4B 1MCJA 1FDLH 4PBWD 5I74B 1C16B 5E4EC 3BZEB 2VLKD 4RWYL 5C70A 1ACYH 4XVUC 2EC9U 4NPYA 1L9MA 4K8RH 4OAWB 4EEEA 2E6PA 4KRPD 4NKOB 1KEMH 2IF7A 4LOUD 3R0MA 4WWKC 4JKWA 5LVEA 5AAMA 1DSFH 3QUKA 2VLLB 1NBVH 1PD6A 3HFMH 1JYXA 1H3WM 4OM1L 2Y6SC 2OYPA 1CLOH 4JVWA 1E4KC 1ZHKA 4GLRH 1ZGLM 1U2CA 3WFDH 4XHJD 5JMOC 2UYLB 3VFRA 3P40A 4I5BB 4EDXB 3EYVA 3D39B 4HZLB 5HGHA 3EYUH 4JPVL 2OMNA 1ORSA 2R2BA 2BHZA 1C5BH 1G7HA 1EPFA 2FECL 2DDQH 5ADPH 4BJLA 1YMHB 4OF6A 3T1FA 3HC4L 2X1OA 3HNSL 5GIRB 1MFCH 2NY4D 4GXVH 4IM8A 3STZA 4MA7L 1DBML 1T4KB 2Y9RT 6CGTA 1NKOA 3CMGA 1NGPH 3U46A 2B39A 3SJVD 4JZNA 2NY7L 3CGTA 2UY7A 4XNYL 3GMLB 1YNLL 5AZEH 3ZHLA 3PDGA 3V5DA 1ZT4B 2VR4A 4ZTOH 4OZFG 5E99H 4PGBA 3OAUL 2YRPA 3UTOA 3CFIC 3QEQA 3VGEA 5D1QB 4EI6A 3QI9A 4NRXA 4POZC 2MSPA 3VDCA 3VXOA 1H0DA 2IQ9H 3GRWH 1OGTB 2GJZB 3LS4H 1N59B 2DIJA 2MPAH 4N9GB 3QFDB 4X9GA 4JPKL 3A6BH 1XT5A 5IROA 5DK2A 3HAEA 2DKMA 1KTDA 3HZKB 2EZ0D 3OPZH 4WUUE 5GJTH 1U95A 3GUTB 3VG9B 4DQOH 1RUKL 2VUOA 4QNPF 4M4PA 1NEZA 4AQOA 4KKLD 4XMKL 4OCYL 1CVRA 4P5KB 4ELMA 4WEBH 5C07E 4NCC1 3IT8D 4JFXA 1I9RL 4P5MB 1J88A 3VRLE 1AJ7L 3LEYL 4QHKI 3ZL4L 5FK9A 1N8ZA 2VXUL 3OB0H 2Z31A 3HUJB 4I0PA 1P7KB 2XA3A 4HEPG 5DJCB 3BN3B 3PJSA 1FZOB 4NP4H 1TZIA 4GUPB 1MHPL 1H3PH 4JFQB 2RCSH 3FO0L 2W0FB 4X6DB 1JRHH 4KTDH 1T03H 4GRLB 3UTZA 4K9EL 2V7HB 4OQ1A 1F2QA 5DQDL 4CDHA 2CGRL 4O2CB 5DJAA 1OD9A 1RV6X 5C0DB 3SDAC 2XI9A 4J3XA 4OZHF 3O3BB 2ZUQC 3BIKA 4NO2B 3UX9B 3EO1B 3QIUD 5E6IC 1QFWH 2DKSA 2RFXA 4GKNA 1P84K 4YX2H 4HUWB 4KHXL 1RSFA 4QTHB 2FIKA 3RIAK 2NY5H 4RMVA 3VFGL 4ODTL 3CVHA 4Z6AT 1YEEH 3BQUB 1NDMB 5CBEA 5T3ZL 1HHIA 2IAMB 1S7SA 4PJ7A 2ZUUA 4Q6YA 4X8JB 1BQLL 5IB4B 1ZT7A 2XZQL 2BNRE 4LVNB 1V7NH 2Y25A 1FYTD 2EDLA 5FDWA 4HJGB 2IGFH 4PBXA 5I17B 1T1WB 4JRXB 4WW1B 4Z8FH 1NGXA 5JPNA 3Q1SH 1G1CA 1N3NA 1TCRA 1TJGH 5F1OB 1BBJB 5D2NE 5HHPB 1A22B 3IFPB 2CDFB 3FTGB 4X6BA 3VXUD 1WBZA 1U41A 2WIIB 2X4SA 4HKXA 3C5JA 3MUGA 4PJEE 3C6LA 5FGBC 4G6AC 1A21A 5K59E 3C8HA 1KCLA 4FQLH 1HXYA 1WWAX 5IB1B 1UB6B 4MD4A 3NFSL 5JHDB 2VDKH 3R4DA 1Y6KR 2HH0L 5KSBB 2F58H 1BJMA 2C1PB 1AD0B 3CSBA 3G6JA 5FECA 3I9GH 2UWEF 4X80L 1BFOA 3OKKA 5F7KC 5I0DA 1I9JL 3REWB 2LU4A 1UM5H 1MRFH 2ADGA 3BZFB 3M8OH 4PJBE 5T1DH 4NJAH 1P4IL 4ACPA 1O7SA 1WTLA 4D0CB 1NANH 2NY6C 3TESA 4M6AA 1NC4A 5LGJB 4UUJB 5BMFH 4NBYB 4XP6L 2YN5A 3I02A 2D9CA 1FAKT 3MODH 4N8VG 1XGYL 3QUML 4NHCL 1HKFA 1QFOA 5JUEL 5L7XL 3W82A 5C86A 2VB5A 4ZTPL 3VFNB 4F37F 1HIML 4PJ7F 4Z7UB 5DVLA 2BSSA 4LVNC 3TVMB 5J06A 2V2XA 5C08B 4XPGH 2ZNXA 3DURA 3NIGE 4ALAL 3E0GA 1NMBH 2WBJD 3ETBF 5F3BA 4XPHH 1E27B 5FV2A 3HMXA 4PS4H 4HG4J 3D3VE 5CAYB 4F33A 4ODWA 3LSOA 2Q20A 5GRJL 3K46A 3WFHB 7FABH 1VGKA 4P2OC 2AXGA 4RCAA 3P9LA 4X5WB 3N85L 3CLEH 1DQDH 3HMWH 4KQ3L 2VQTA 5E6YA 5J0BA 2AKRA 5LXGL 1LO2H 2HJKA 1TITA 1AE6H 1E4XL 1G9NL 5BW7A 4HKBB 4LHUA 5GSRB 2NLJA 4YDLB 3WD5H 2R2CA 5KW9H 4MVBC 4XMPH 4PPTA 3M17B 5TE7L 4Y1AB 3PHQB 4LKXA 5ESAB 5HHMD 1DE4B 4M1GH 4ZQKA 4Y2OA 3RL1B 1AR1D 3QAZB 4JO3L 1OWWA 3BGAA 3OKNA 3FT3A 3GHEH 1RZKC 3IXAA 1ZV5A 2CMRL 5DGQA 2YD2A 3S37H 1RJLA 4PY7A 1GGCL 4BQ8A 3BYTA 4NQCE 4QRPA 5D70L 4U6VH 5F7YC 3CFEB 1QSFE 4Y5XA 3H0TA 1MQKH 1WSST 3EDJA 1P9MC 1MFBL 1W72A 5C0CE 4YDKL 3FQXA 4CVZA 4XB8A 4WY7H 3VJ6B 2CPCA 2PXYC 3SDDC 3AREB 2J7LA 2LVCA 2CUHA 1JGVL 4I4WB 4WWKA 1D5ZB 3D39D 2VL4A 2A83A 3FN0H 1JF5A 3QQNA 4MJ5A 2YA0A 1S3KH 2G9HB 2AEPL 2F15A 3TBSA 3MRFB 1OHQA 2PR4H 4Y16A 5E70A 3RY4A 2YK1L 1E4KA 43CAB 4R90H 5HD8C 3EYFB 1X5KA 3SY0B 1CR9H 1IFHL 3DTXA 1SY6L 4K3JH 4FQCL 3BDXA 3CFKA 3V6OC 2VLJA 2J8UF 3H9HB 3EFDH 3O8XB 1NCNA 5K9JH 4L3CA 3NAAL 2P44B 3S4SA 3VA2C 1FG2A 1VFBB 2H2SC 1NCCL 1ZGLA 2VLRA 3MOAL 3QCVH 5IVZA 3IDIB 4WTWA 5D1QD 4MB5A 3QHZH 4LSRL 1IGIH 1DN2A 3CFCH 3T2OA 3X13B 4UB0L 1DANT 5HGAB 3V9FA 5JW4M 4GRWE 1KF9B 1YDPA 1BFVL 3BE1H 4W70A 4Z78B 1A14L 3B9KB 3RL2B 2P5WA 3T0EA 5T5NF 2J12B 3LEXA 4EI5B 5C09B 2P7TA 3CVIH 2AK4E 5CS7A 5F9OH 4S1QH 4XXCC 4TNVF 2F19L 4WFFE 4O4YL 5HHNB 5GRVL 2VABB 4Y4FA 3MCLH 4KJYB 4UT9L 1PG7W 1KIUA 5DHVB 3VFSB 4P9HL 1JN6A 1A1NB 4IMKC 3E8UL 3GJEA 5BQ7B 1KLUB 1EEQA 3LVEA 3OQ3B 1ZKAA 1VSCA 3NA9L 1BQHB 5FM4A 2VISA 2R39A 2VH5L 5HTSA 3EGSB 4GRLD 3C5ZB 2QLVB 3P4NB 4MXQD 3L3OA 3O11B 4NNPL 2EDQA 3L7FA 3O6KH 4J3VA 1N6UA 3ULVL 3PWLA 1XZ0A 3EO9H 1ZLSL 1MVUB 3OHXB 3PGFH 5D7IB 4EIGB 1PKOA 2F54B 3MLRL 3OR6A 5KOVC 4JFFA 3MRKB 1QPXA 1ZA3B 5I1DB 1A7RL 1TMCB 3N9GL 1BD2B 1Q0YH 1YEGL 2QKIB 3SDAA 4P59H 3BQUD 5DRNB 2R56H 4ISVB 4HPOL 3BO8A 5E8DH 4DK3A 2IAMD 4HUVB 5E6IA 5DFWH 1FLRL 1FORH 5KSUB 1QBML 3RI5F 4WW2C 5DLMH 1HZHH 5AYUL 3RIFK 4JRXD 4G8GB 3MUZ1 3DXAE 3H7BA 2KUTA 2P5EE 3IU3B 4YHPA 1D9KB 1LE9B 1A6UH 1ZS8A 3RUGB 3FOMA 1MJJA 4GO6B 4FMFA 3T1WA 2BCKB 3WUZA 2ICWA 3PWPE 4RX4D 3CNKA 1DVFC 4Z7VF 3RVVC 5EU6A 2HMIC 5DUML 2XQYG 1DEEA 2XTJE 3D9AL 3CFJB 4U1MB 5JHDD 5DMKB 5EU5A 3VXSE 5IVXB 3NN8A 5IVOA 2E7BA 3VWJB 5FGBA 3MV9D 1KXTB 4EXPX 1K85A 5ITBL 3DECA 1J7VR 3L95B 1PX3A 2Q8AH 3FB6A 4PV9B 1U8MA 3C09C 3OKOA 3OWEA 1CGTA 2X4PA 2EC9T 3IDNB 2YD4A 3GI9L 1A0QH 1HDMB 1MWAA 3X12A 1BF2A 5EFIB 2I60H 5F7MC 5DJYB 1CDYA 3WO4B 1G7QB 3IFNH 3QPXH 1YEHH 4ZFOL 1AGDB 1EGJA 5GQBA 2R0WL 4L1DA 4YHNB 3HI6L 1FVCA 1GAFL 3RWGA 4PRDB 2YKLH 3ARGB 1V7MH 1N6QH 5F8QC 3SQOH 4O2FB 4L4TA 2OTUB 4OM0L 3RPIB 4MJIE 2QQLH 4NQTA 3TVMD 2VNCA 1D5MA 5C08D 4M8VA 5IEKB 2D9QB 3ROLA 5JNYA 1J1XH 5TFSH 1PSKH 1HI6A 3BPNC 4P2RB 3QPQD 2OSLA 1PY9A 4J6RH 1KGCE 1XGTB 4DCQA 2C4XA 2F53E 1JZ4A 3ROOB 1T1ZA 1R0AL 1AD9A 4M6MH 4KRMB 5FKPB 5TQ2L 1V3MA 4ORGB 4XVJH 4RGMB 1X4ZA 4LLAA 4MZ3A 4NZDA 5I73B 2ERJC 1E6JL 1KB5B 1FFRA 3MJ9L 4IRZH 3VFTA 3T8XA 4P2OA 3QNYB 5EPMA 5K9KA 3QCUH 3CUPA 1U3ZA 5DRWA 1F00I 5E24E 5SV3A 2FWOA 4OLWH 5T5FL 4PRHB 1QSEE 1I7RA 1EEZA 3LAFA 5I1LA 2VITB 2UV3A 5GGTH 3UDWC 2LV4A 2DJ4A 4Y1AD 3WKNA 4JVUA 4MZ2A 2A77H 5GGQL 3BXNA 4OZHE 1KCUH 1T1YA 4Y4KC 1QZ1A 3PDDA 1EO8L 1ZAGA 4K7PX 5JQ6H 4WGWB 3ALWA 5DJ0B 4PJGF 2OJEA 2R9HD 4MNQD 5I75B 3IDMB 1IM3A 3ARGC 2HT4C 1H8NA 2DM7A 3QDGA 3OL2A 2ADFL 5F1IB 3EJJX 3PIQA 4OKDA 4XB7A 3QB7C 4OFPA 1ED3B 4YQXH 1CFQB 1DL7L 2OR7A 4Z76B 2VUYA 1KIRB 4WFEE 2E9BA 3QP3A 1L0XA 1S9XB 4QEGA 4U6HB 2APTA 3VI3F 4HKJA 1DN0B 4OCWH 1NPUA 1AGBA 1QEWB 4WU5B 3CSYA 3CXDH 4UT6L 4FZ8L 5B8CC 4JM2F 3IU4H 1SYSA 4PJ5E 1EJOL 1IAIL 5CEZE 3GSXA 2GTWB 1V3JA 5TE6H 2IBZY 3MGTB 1JPGB 1YMME 4MDIA 4RISL 2VDLH 2EDBA 4GMTH 5I73C 1A7PL 2FDBP 2A6JB 5B3JF 1RU9L 1I3GH 2F8OA 1BM3L 4OLXH 4NQDA 2UWEE 1NGZA 2O5XL 3O8XD 4OZFB 4QY8B 4HXAH 5LGHL 1J8HA 1MELA 5HPMB 2FB4L 1EHXA 1HQRB 4BUGA 3CC5B 1JFQH 4KDTC 3HR6A 3VRJA 4OZGA 4S0SD 2FEEI 4Q9CA 2C5DC 5EU3B 2DTMH 4K3GA 5GRUH 4LIQE 3WNPA 3V6OA 4NCC2 4U1LA 2YUZA 4PRPE 4Z5RB 3V5HB 3ECBA 4MNGB 4Q6IB 3E6FA 3DSFL 2Z91A 1BZ7B 2XWJB 4EOWH 4P2QB 1FYHB 4P3DB 4JJ5A 3NCCB 3B9KD 3L5XH 1E6OL 2H8PB 3QXVA 1WLHA 3L5WB 1TQCB 3H3PL 4YDJA 2MCPL 5C09D 3LRSA 2CK0H 4EVNB 2YMXH 3MV7A 4KTYA 2AXFA 2OTWA 4XNXH 4NHUA 4O58L 3MA9L 3X3FH 1EHNA 2C7UB 1KJMA 3LKNB 4PJ7E 5A40E 1J1OH 1WZLA 4OLZH 3GSVB 2DI9A 1IAOA 3FCTA 3SDCC 4XCNA 2M8XA 1S9WB 4RFOL 3LQAC 1XGQB 2OL3H 2VDRL 3KPQA 3TN0B 4OD2B 4OKVB 1NCTA 4H26B 2GY5A 5IBTH 4D9RE 3C2AL 5BV7C 5IP4A 3C5ZD 3SCMB 4MA3B 2DQFB 2PETA 3PWJA 5CEXA 1BZQK 4IMKA 1A6AA 4WCYL 5AD0A 3W39B 1LE5A 1JGUL 2P4AB 3HG1B 1A02N 2FD6L 4UDUB 5D1ZC 5BRZB 4NUJB 3AB0B 2B4CL 2DWEA 2DLGA 2FL5A 1KEGL 3CFDA 4NQEA 4L29B 4Q9QL 1BD2D 3GMNB 3V0WL 5HVFB 4NKMA 2O5YH 4O2EB 1J0HA 5E7FA 4OZGF 5KVMC 5HY9A 5JO5A 2E7HA 1E28B 2ATKA 3MXWL 3C9NA 4HPYH 1KPVA 4CDGC 5JW4N 3CH1B 4WEMB 4WJ5A 1OB1A 4MNHB 4WVRA 5T1KA 5DDHA 4PB9H 5DEFA 4NRZA 2NXZC 4NKIL 1D9KD 1EFXA 5TPWL 5KSAD 3OTTA 1I7UB 1TQCC 3R0NA 3Q5YA 3B3IB 2Z8VC 3CDCA 3FOLA 5EZIL 5CUSH 1JP5A 4WW2A 4GRMA 4KFZC 4HF5L 2LTQB 1JV5A 3L3JB 4AH2B 1CLYL 1LK2A 4KK6C 3JTTB 1A9BA 4BSVA 2GUOB 2H26B 4FTVE 4K07A 3FHQA 1DFBH 1MHHB 1B9ZA 4DZ8B 4DKAA 4LCUA 2AJUL 4R2GD 3VWJD 3WLBB 1ZVSB 4WRLA 4HZAA 3MRIA 4C56B 1C1EH 4XPTH 4M1DL 2BOBB 5IESL 3WJJC 2Y36L 4OZIA 3G6DH 4LHQB 2NY1D 5DD0L 4ZXBA 2A73A 1OF2A 3VH8G 2BY2A 3EDDA 4LQ1A 1ND0B 3WXWL 1OTUC 3KPPA 5F6IB 2V17H 1MREL 3U7WL 4MQ7B 1QVOB 3BH9A 4N8VB 5KN5B 4LSUL 5ACLA 2J8UE 4G42A 4RAVA 3EJYD 1CG9B 2BFVH 2ZCHH 1B6UA 3PABB 5DJXA 4UV7L 4QXWA 1LWRA 4LVOB 5IMMA 4YO0B 4ODSH 1N2RA 3MACL 3MV11 4X6FA 3U6RA 5BJTA 4ERSL 1T7YA 5JW3H 2NY0B 5H37H 1CGYA 1LP9A 4W6WB 5GS3A 3ARBC 3L6FA 4OLEA 1CK0H 3IDJB 2GAZA 1F4XL 3AAZB 3QSKB 8FABA 1G6RB 3MV8D 1K8IB 4E41E 4P2RD 4C54A 4YBQD 1T2QL 2ARJA 4FG6D 2A9NH 4AEHH 4MA1C 1S8DB 4K9EC 2H6PA 5DVMA 1A7NH 3HN3A 4R3SB 1JZ6A 3HRPA 3VDBA 1FH5H 4QRPE 1QNZL 3UPAA 2ID5A 2G5RA 2X44D 2A38A 2N7BA 4R4ND 4R0LB 2R8SH 5ALCH 5GS1C 4PJIA 1AI1H 3ZDYE 4U1NA 2DWDB 5HHOB 3IDUA 1MRCL 4ZODA 1WT5A 3DO7B 3D1MC 3P0YH 4PRHD 3CU7A 4JFPA 1FL6A 3V52L 1F4YH 1IEAA 3VU2A 4CN6A 3CX5K 3IDGA 5F6IC 5FYKU 1SMAA 3VFUA 3DO3A 4FQ1H 2DI7A 5EOTB 4BFGA 4C83A 1HYSC 3UJJH 1ZLVK 1Q9KB 3SEPA 1JPST 3F7YB 5J6HA 2H2PD 2GJ6B 3UDWA 4I3RL 4FFWC 3VA6A 3GKWL 4HDIA 1DLHB 3BH8B 1RURL 2O26U 3MOQA 5GRWA 5B39G 1A1OA 3DUUA 3DX7B 3PWUB 3MLSL 3Q6FB 5ILTH 4LU5H 4KJWC 2HJLB 1YEFH 2VLRE 4Y4KA 3GBNH 4UTBL 1YPZF 2Q6WB 5EO0B 4M7LH 5H35B 4UNTA 5LKNA 5JXED 5CJXC 3H9SD 1UXWA 5CSGA 2QSCL 3GSNH 1YEIL 3BISA 4E42B 5CD5C 2D0GA 3BAEL 4X5LA 3K1DA 4KI1A 1N0XL 1N4XL 4XNMA 2P24A 3WIIL 1IKFH 3T0EE 4Z77B 4G6KL 3IYLW 3OJ2C 3VWKA 4N0YH 1JGLH 4Z7VE 5IOPA 1MIEL 4PJAF 2F5BH 5JOPD 4I13B 2QR0B 3P30H 1U6AL 1FO0L 2VZSA 3KWWB 4FQ2L 4WU7A 2KQMA 5I1KL 1FV1B 4HQQL 3PV7A 2GI7A 3BVNA 4XP1H 5LWYH 5B8CA 3NOIA 4X6CB 3IVKB 1R5VA 1PG7H 2DLEA 4HC1L 2YPVH 4M02A 1F6LL 2XPGB 4MGXA 3QQ4B 3FAWA 3W9EA 1EHAA 1UKSA 1HHHB 1R3JA 2BSRA 4ZUUB 4CADA 3L5IA 4TQEH 2HT2D 5F9DC 4LCCA 1NCBL 3MRMA 4QTIH 2HTLC 3O0RL 5FO7B 3WFBL 5ITFA 4BKLB 4P2QD 1NGQH 4RFEB 1NMCC 4KDTA 4V1DA 1RK0A 2RB8A 1JWSB 5IW3A 3MC0A 1T0MA 4JFFE 4GW1B 25C8L 5ANMA 4DGVH 4D0DA 4N0UA 2CDGA 4C57C 1UWGH 5F9AC 3FQNB 4RA3A 3KYOB 2EE6A 5EO9B 1NL0L 4I3GA 4M9PA 4KGLA 2ZPKL 4MSWB 2PTVA 4OD1H 1KJVA 4PJHF 3C08L 1NFDB 5DMJB 5D7KD 3LMJH 2GTZB 3BP7B 3LCYA 1G9NC 2KQNA 4PIRF 3E6HB 3OJMB 3V5KA 2PUQT 4U6YA 5KVGL 2OZ4A 4M9OA 1CXEA 3SDXB 1F90H 1EHLL 4U1JA 4Y5YC 3TN0D 5C6PB 4NCDA 1P5UA 3UTTD 2YEZB 4ZAKD 4FNLH 3SCMD 3AUVA 1T7XA 3NCJL 4HV8A 1A7OH 4QRQA 3EO0B 5EU6E 4GBXB 3AXLA 3D85B 3HG1D 3I50H 4D8PB 4N68A 3BW9A 1X3DA 1IGFH 2R2EA 3DGCR 3ES6B 3HZMB 5BRZD 4R7NB 4GW5B 4BZ1H 3LHPH 3STLB 1RZ8B 2AVGA 4O02H 1OT2A 4QLRA 1Y6MR 5CZXC 4F58H 1EVTC 4UBDD 4ENED 1P4BH 4QHUB 4RWHA 3HS0A 5DJZB 5DUPL 1XFPA 1AR2A 3HI1A 1KLFA 1JPSL 2HWZH 4D9QE 3SKJL 1SJHB 3NFPB 3B6SA 1QBLL 3HCVA 3DX9A 3SE9H 1XGPB 3QNZB 1U91A 4PJGE 4TSAH 2R23B 1BVLA 5MERA 3QUZB 2Y07H 3DIFA 2R1WA 3MNWB 3HPJA 3P9WB 3MUY1 3L3DB 3TCLA 2C3VA 1R3LA 1I1FB 2EYSB 2X4TA 5E95B 1NBYB 1MRDL 1MHCB 2DQEH 2CDEA 1KCRL 1S9VA 1T66C 3D5OF 5L8KB 4NRYB 1AGEB 5GS2H 1CLZL 2FATH 1QLEH 4PP1C 3L9RB 4Y7MA 1G7IB 1FN4B 4C56D 1YZZA 2VRAA 4EZMA 3A67L 2QHRL 3GSOA 5DXWA 4KROC 4XXDB 5KG9B 4NFBA 4WI7A 3RGVB 5CEYA 3QCTL 3MNVA 2HVJB 5HHVH 2Q8BH 2IPUK 5F1SA 4Y19A 5EH1A 3FFCB 2BK8A 4JFYB 5F7DB 3IDXH 1LMKA 1JIBA 4S11A 5B3JE 1S78C 1U3HD 1Q0XH 1SMOA 4NYLB 4WI4A 4KVNH 3WJJA 3QFJE 2L7JA 1ZTXH 3TO4B 1EO5A 1XF3B 4YGAB 1EVUA 5C0FB 4UOJA 4PTTA 1KJ3H 1QQDA 3S7GA 5SWSB 4G9FB 1IQDB 4OTXH 1G0DA 1MH5B 4APQC 3DETC 1QLFA 1IGTB 2YPKA 4U4BA 2VE6A 5ID0A 5F9JB 2JKXA 1NAMH 5E8PB 4OJFL 2NY0D 4L3EB 4Y5VB 5IG7B 1CZ8L 4RGNB 2A74A 3ZYIA 3EYSL 4XP5L 4G80B 1MCPH 3MOBL 4XNUH 5FO8B 4BH8A 2YD1A 3BGFC 5L2KB 3QXAA 3QRGL 3IJHA 1D5BA 2ZSVB 3JV4B 2DQGH 4HUUA 5HI4C 4R96B 4K8RD 3UJTL 1RJCA 3BEWB 1SEBB 2RGSA 5BVJA 3ARBA 1S5HA 3MREB 1LDPH 3FQTB 4J8RA 3RP1A 3RDTC 1VFAB 1K8DA 1XCQB 2ATPA 3MLUH 1FNSH 4LPUA 5CP3A 3RTQC 4X0KA 3ULVC 3QDGE 1B0GA 4KTEH 4LNVA 5DHYA 5EO1B 3K4DA 3MXVH 4W68A 4LCYA 4WNQB 1WQVT 3CMOH 1FFNB 2HG5B 3IETB 1A4JA 1KIQB 1U58B 5GSVB 3OG6B 3RWDA 1NLDH 1FVEA 1FZMB 1MVFA 3P4OB 5MEOA 1WITA 3WEXB 1WEJL 1WZ1L 4WWID 5SX4I 1A6WH 3DRQA 1U8IA 4UI2A 4PR5A 5HDBF 4UIKL 3ABZA 4UNUA 3LRHA 2FGWL 5GZNC 2X10A 3KPSE 5GS1A 2O93L 4IRSC 1KJ2L 3E3QE 2HFEB 5GZOD 3SJVA 4UU9A 1IZJA 2BOCB 2V5RA 4ZUSB 1W0YT 5JDJA 4GG6F 1MJUH 1C5CL 1NQBA 1J05B 4S1DD 1F45A 5ISZB 4MAYC 3TO4C 4EUPH 5I71C 2Q76B 5FF6A 1AXIB 2H9GA 4NQDE 4KUZL 1LEIB 5DJ2B 2XQBH 4ZD3L 2CIIA 2X4UB 3QG6A 1HEZB 4JY5H 4NQSB 3BRFA 4TVSa 2WWKO 1FCGA 1WV7T 3MRDA 3S96B 4OZGE 4D94A 3OGCB 1IL1A 2G75A 1XR9B 2PO6B 2VIRA 2D31A 3CFBB 1MNUL 1IC5L 3W11D 5IJVB 1KB9K 1FDLL 4M8QA 5IFJB 3IDYB 3IAQA 1HCVA 3KPOA 1H9VA 5L9DH 5B22A 4K8RL 1OPGL 4ZNEE 4Y4HC 1W0VB 3KLAB 5CKGA 1KEML 1OGAA 1YQ2A 3GSUA 2X4NA 3MV7E 4ETQB 2NNAA 2PYEB 5FYLE 3QDJB 4S0TD 1DSFL 3PGDA 5CJQH 3RZCC 2B0SL 1NBVL 1IGJA 3MO1A 1CLOL 3EOYG 5ENWB 2RIKA 1C08A 3WFDL 2FSEA 3BD5A 1KUMA 2FYYB 1SEQH 2DQTL 2IFFH 4NM4L 4Z7NE 3EYUL 4IBLT 3BWUC 3K8LA 3GBLA 3WLWC 2AV7A 5JW5B 1C5BL 2DBJA 3IFLH 4G6JH 2VMFA 5KSVA 5ADPL 3EZJB 5EZLB 3QIUA 1X5LA 5D7LA 3QUYB 5FO9A 4GXVL 3U7YL 3ARUA 2NTSP 4R4FH 1MCLA 5FA4A 1FFOB 5I30L 4P46C 1RPQA 4FXGA 4I3SH 1G84A 2Z0BA 2H45A 5EORL 1M71A 2ADJA 5D93B 3MRRA 2R15A 1L4IA 2QQQA 3QA3A 4JN2A 2VLME 2B2XL 4G5ZH 3B5HA 3P73B 4NQEE 3TGXA 2FO1A 3MMEA 1SJXA 2J5LB 4QRRB 1DQJB 5BS0E 1YN7A 2ORBH 1AY1H 5EIIA 3FAXA 4JANA 3LN5A 3U82B 5E99L 1BVKA 2EKJA 4XH2B 5C0IA 4MCZA 1JZ5A 5CIPA 5JOFA 2N56A 4UV4H 3GJFA 3UTSB 3VXUA 4AEEA 3GRWL 1JHTA 1MCFA 2IANB 2MPAL 4R97C 3IDYC 5DFVD 4P5TB 3NZ8A 3OX8A 2ICWI 2ZG2A 1WAAF 5FCUL 3QZWA 4KJQC 4DQOL 3VFMA 1CDJA 4G8IA 4TTDC 1D5XB 3CIQA 4NO0A 2B5IC 3O3UN 4URTB 4V2CB 3BX7C 4U7KA 3D85D 4L5FH 2O61A 4Y5YA 3G5VB 1F6AA 5FOBB 3VI4E 3CPLB 3DX8B 1BPVA 5J89A 5AWNL 3ZMRA 3KXFB 3GI8H 1ONQB 2RCSL 3RVUD 4KTDL 5E5MA 1T03L 5TGBB 4OZIE 4XZUB 2AERT 5FYKH 1IAIM 2NXYB 2A6IB 5C0JA 4PRIE 2AABH 3UJIL 4PJCA 4M7JH 4Z7WA 2BRRH 5EG6C 3O3EB 1FZJA 3QDMA 4QGYA 5KVEH 3BKMH 2MMXA 2IJ0C 3L1OH 3V4PL 4MA8H 4YX2L 3MRCB 5E9DD 3DPBA 2AEQH 5I19H 5FUOH 1AKJB 1TLKA 1YEEL 1ZWIA 3WHXA 3HPLB 3SE8H 1YPZE 4KQ4H 5DJ8B 2HRPH 1BIIB 4HIHB 1M7IB 2C1OA 4CW1A 2Y06H 5F72S 1AO7B 3ARYA 1V7NL 4QOKB 5L2JB 4NZTH 2EXWD 3HLAB 3T3ME 3ULSA 4Z8FL 3Q1SL 4KRNA 4NNXA 3ZSSA 1A6ZA 1TJGL 4A6YH 4UT7H 2ZUSA 1ZHLB 5CP7B 1KCVL 5F1KC 3RGVD 1SY6A 4PJAE 1E0OB 2YBRB 2C9AA 4LRIA 1LEKA 4NM8H 3FFCD 4I18C 2V2WA 1ZANH 4KY1H 5ACZA 4U1GB 4I9WD 2CKBB 3D25A 3VW3H 2YD8A 5I66A 5C0BE 3WE6A 4PJFA 2I07B 4LSTH 4CKVX 1KC5L 2CO6B 4HCRH 5E00A 3KDMA 4OCRH 1CFTB 5A2KH 4UILH 1JNLH 3X14B 5DA0B 3VFVB 4JHZA 5CJBA 3F12A 5SWSD 1N64L 5TQ0L 1S7QA 3KYMA 2ESVE 3RVTD 1UM5L 2NXYC 4Z0BL 1ADQH 2J4WH 1QBBA 4L3ED 4NJAL 1QLRB 4RGND 5CJ8A 4WUKH 3O6FC 2NY2C 2XZCH 2Y5TB 4JFDB 4KI5C 5L2KD 2B20A 4U1HB 4Z7WF 5BMFL 4H0IA 4APQA 4PLNC 3GK8L 4J3UA 2BY1A 2YOCA 3DLQR 4M93C 3T77B 1AGFA 1SJEB 3MODL 3SGJC 2VZVA 1JZ2A 5J1TC 4HT1H 4Y2DB 1T22B 1KPRB 3MGOB 4PJHE 2UYLA 4HLZG 3ZTNH 1RUMH 5IB2B 2B4CC 4GKSB 3D39A 1TPXC 1YNTB 3FQUB 4WGVB 3RDTA 1NMBL 4PGCA 5D6CB 4L9LB 3EOAA 1Q72H 5JQHC 4EBQH 5H94B 4LRNH 3TFKD 4KZEL 4XPHL 2D03H 5JTWA 4J3WA 4PS4L 5IJKC 3MUJA 1NBZA 3BGMB 3SKOA 3HAEH 4RDQG 5CGTA 3VXMB 7FABL 4I0KA 2R0ZH 2F74A 3I75B 1UJ3B 5J56B 1DDHB 4KPHH 1DQDL 3HMWL 5DMGC 4OLUH 5F6HJ 3QQ9D 3P11H 5ISZD 3GMLA 1L6XA 3IF1B 5B39B 1A2YB 1MLCA 5KTEL 3WD5L 2KPNA 4LLQA 4XNQB 5BO1H 1CXLA 2EYTA 4PLJC 5KW9L 3IJSB 1YEDB 5K93A 4DVBB 4PJXA 1Y18A 4MAYA 4PY8I 3BPLC 3PDOA 3TNNB 3NCBB 5GXBB 4M1GL 2PO6D 1ZLWK 3MRLB 1JK8A 2CLZA 3SKMA 4NSKB 4FQIH 1Z2KA 4IEFB 5FKAB 3VMNA 4K94L 3DARA 2XFXA 4OFVA 3PG2A 4V1DE 3GHEL 4ZNCD 3DV6A 4NT6B 4AT6B 5ANME 1I7TA 3RJQB 5EUOB 1OAZH 4ETYA 4U6VL 5KVFH 3CVHH 2NW2A 2PYED 3QDJD 4CMMB 3Q3GB 2V5SA 3F7VB 1MQKL 4YGVA 1HHJB 4LLYA 1PEZA 1ZHNB 2B8OT 1HXMB 5DJCA 1ORQB 3MRPA 3H2WA 3VXNB 4WY7L 1VKXB 3A6OA 3D69A 3U30B 1Z5LA 4FXKA 1EZVY 4GRLA 3QULA 1H3UA 3QEUB 4TUOB 4Y4HA 4EN3B 4LSSH 4JR9L 3U36B 5CFHA 4RQQA 3RZCA 3FN0L 4FQPA 1K4DA 2H32H 2FZ3B 2VZTA 4ZS6C 2W9EH 1K4CA 2QSVA 1S7VB 4NO2A 1LQSR 4D2NA 4BSWB 4ZFOA 4YHKL 3QUYD 3WXVL 2VC2H 4HJJH 1JUFA 1PZ5B 4QTHA 1CR9L 1X7QA 3F58L 1FG9C 1R5IB 1U2HA 1J0ZA 4K3JL 3WFEH 1XAUA 1XR8A 5DD5H 2HT3D 4LFHG 2VZ3A 1XGUA 4NN6B 3SKUD 2MHAB 1INDH 2BNQA 4ZUTB 1KCSL 2N4IA 2P42B 4L4VB 2NTFB 1GYAA 1HSBA 1MCWM 1X6NA 1NCDL 4QRRD 5IFAH 3QXWA 4P46A 3QCVL 1NDGA 4N0FB 3REVA 1T1WA 4F7TA 4FQXB 5IW6B 4JQVC 2HFTA 4YNYA 5D2LB 3JWDL 4PLKD 3UTSD 4HIIB 2IAND 4OF8A 3ZYZA 2BVOB 3CDYA 1F11B 5F7HA 2HJFB 4P5TD 1Y6NR 3QJHB 3KYNB 4M6NH 4OQTH 2BNUA 5J13B 1IBGH 3PWNB 4X4MA 4KJPD 3FQRB 1UB6A 2NY1C 5F9OL 3MJ9A 4S1QL 3MJGX 3I3DA 2DJSA 5HDQH 1PJ9A 3MV9A 3BWAB 4WFGE 2PTTA 3MCLL 5FM5M 5E0QA 3HE6B 4HK0B 2IPKB 1HE7A 1UKTA 4IOIB 4QHLB 1YUHB 3HUJF 3UYRH 5KS9B 3REWA 2ITCA 1KBGH 3RY6C 4GAGL 1LO5B 4X6DF 4LARH 2XNAB 4QRTA 1CGSL 4CRPA 3L5HA 2W91A 4RSVA 5C0RL 1DLFH 4D0CA 3B9DA 2VAAB 1DQQA 2JTDA 3M1BA 4OT1H 2X1QA 1CS6A 1OOAA 3VGBA 4IOFC 4UDTB 4LPYA 5IIEB 3OGOE 3EO9L 5E2UH 5E8EA 2OR8A 3PGFL 3FO1B 1CD1A 2OS7A 4YBQC 3OZ9H 1I8LA 2X7LB 5C0AE 4HD9A 2XN9B 3WDHA 4JG0L 5C9JA 4ZYKB 4P59L 3UYPA 1QRNB 1F6FB 2V5YA 5E8DL 5CEZL 3TPUB 4LCWD 2AQ3A 5FYJU 5E1AB 2VDPL 3VE0B 5DLML 4R4BA 1C12B 3HRZB 1HZHL 5D1XB 3I3EA 2VLKE 1SVCP 1OW0C 1TZHB 2AJVH 5I1AB 2SEBB 1OCWH 3LKSB 3VD5A 2A1WH 5C0EB 1M05A 4V2BA 4QHMB 2J88H 4CMHB 1LDSA 4EQ2A 4X7CC 5GGRB 2AW2A 4XX1G 3HE6C 5D7SH 5I2IB 5KVDH 5ID1B 1TVBA 4KK8C 5KSBF 2Z8RA 4YJZL 3OKMA 5DEGB 2JB6B 1W72H 1UA6H 3MLYH 4WI3A 4AJ0A 2H2PC 4HUXB 3MZGB 4LHJB 1ZA6A 2ZOKB 5F88B 2AXJA 5HYJD 3CD4A 4QXGH 2VL5B 2DIAA 3CH8A 3TV3H 2R4RL 3BPCA 1NC2D 4ZOCA 2J3SA 2PW2A 3HAEG 4XCCH 3RVWC 5SX4H 1A0QL 3RWEA 5TF0A 3TJHD 5MENB 3BN9C 3SJVE 3O2DH 1FL3B 1WFOA 5IMKA 1K2DA 4MNQA 1NEZG 4FQHA 1FNEA 3RKPA 2CLRB 3VFPA 1JCKA 3EJZD 1RFDH 1YEHL 3C5SA 3TF7C 3V7AE 3O6FA 1OQXA 3UTPD 4HBCL 2YKLL 1N6QL 3SQOL 4Z7UF 3TT1H 1I1AC 5FUZH 2DQCL 4OFYD 1LEGB 1RVFL 5CD3A 2Q1EA 1DTUA 2GK0B 3FFDA 4ELKB 2D7NA 2DBLH 1J1XL 5TFSL 3OSKA 3S36H 2NZ9C 1DP0A 3SGJA 4FFVD 2Q87A 1SBSH 5F7WC 4J6RL 2MFNA 1VESA 3ILQC 3BHBA 3RWCB 1WAAE 1U8HB 2DD8L 3ESVF 1QFPA 3VXMD 3SY0A 2DIBA 2X1WL 2GYSA 2N7AA 3HHRB 4M6ML 5DD1L 2WP3T 3K4ZA 4WTXA 1OGAE 3L5JA 5F89B 1I1YB 4XVJL 3O8XA 3T0WA 3HA0A 5IJKA 4CVXA 5JPMA 1OSZB 2ZKHH 4RNRA 4MAUH 4IRZL 4GQ9H 3EKCA 2DQDH 2IEPA 5CBAA 3MRGA 5EN2A 2FO4A 3IDIA 5F3HB 5EZOL 4JFZH 1ETZB 4OLWL 3S3JA 3IFOB 4Z0XA 4PRAB 5GGTL 5HGAA 3GKZA 2A77L 1A7QH 1S7UA 4Z78A 3SKNA 5JW4Q 4JJHA 4ZO8A 5DT1H 3W2DH 3JBG7 2EE2A 5CGYD 2ED7A 3O45B 4NQUA 1KN2H 3GJFK 2EXYC 1VHPA 1FZKB 4MX7B 1RI8A 2AJ3A 2A9MH 2X4QB 3MRBA 3D0VB 1ZHBB 4YDVA 5JQ6L 4FZEH 4LLUB 3KPLB 4LSPH 4M61A 3RGHA 5HHNA 4BQ6A 3HC0A 3RWHA 1AQKH 4KJYA 1AHWC 4HXBH 1G7MA 1HOCB 2VXVL 3VXRA 1JPTL 4NN5B 2Q3ZA 4PV8A 3MBEC 5HJ3A 1J0IA 2APFA 5D71H 3X11A 1I3VA 1DBBH 3H3KA 2JCCA 4GG8A 3RWJB 3VXUE 5D2NB 4EN3D 1A4KB 2CUMA 5C6WH 2WLZA 5I8CB 4OCWL 5HPOA 1SM3H 4LASH 1U8OA 3DOSA 4ENEC 1KNOB 5DTFB 3IU4L 3T4YB 5D7IA 5TE6L 2FGZA 4M5ZL 3EOBB 4GMTL 3D2UA 1CU4H 5EU4B 5IHLB 5E2TH 1L9NA 5CWSB 4OLXL 4JO4H 1KV3A 1MI5A 4U1SB 4XBEH 1P7QB 4DUWA 3T0AA 3TP4A 1H15B 3OXRA 3PV6A 4K7FB 4L4VD 1F3JB 3DVGA 1N5AB 1JFQL 2JELH 4EIZC 3GNMH 3ORJA 4PJBB 1HILB 2IQAA 3VDAA 1FIGH 3ARFC 4FQXD 3TIEB 2CIKB 5E94A 4HGMA 5KAQF 2R1XB 4PJCE 2PW1B 2VOTA 1TJHH 2HLFD 1D9KA 4EOWL 4KDVA 5KSAA 3IGAA 4Z7WE 2I9LB 5EULV 2BCKA 2KBGA 2EYRA 2MWCA 4FFZL 5DZLA 2IC2A 4NDMA 1BIHA 2BVPA 4JQVA 2KDGA 5IR1A 2YMXL 1TDQA 1CFSB 4XGZB 4LHUG 3MQIA 3X3FL 3VWJA 1RJZA 1Z3GH 3VXPA 1J1OL 5A16A 4JQIH 4OLZL 4Z7QF 1QFUH 4QXTA 5DZNA 2FECI 5I16B 1HNGA 4WO4C 4KMTH 1YY8A 3K2UH 3TBWB 5F7EL 2LVEA 4PGDB 2OL3L 4X4YB 4XPAH 5BZWB 1L7TH 1BLNB 3QIWC 1X44A 5IBTL 2PTUA 1CDHA 3DX6B 1CGVA 3MLXH 3LKRA 5C7XH 4NZUL 1BWWA 4X6EA 5IK3B 3I85A 4PJ8B 5DJYA 5D7IF 2XG5A 1T21B 2R2HA 3ZO0A 3CSPA 4S2SB 3S34H 5H8DA 3T2QA 1S9YB 3LIZL 1OQOA 4YHNA 2G5BB 3V4UL 5DO2C 1R5WA 2O5ZH 2WANA 4RAUA 3DUSB 1DBAL 3MLVL 4JZJA 5MP6H 5GRVK 4HJ0D 1B88A 3KNBB 1G7PB 2B1AL 3GBMH 4K2UH 4DEPB 2DL2A 3V6FA 1BGXH 1NAMB 2HVKA 1J12A 5HHME 5IEKA 2O5YL 1J18A 2JLLA 3Q5OA 1QRND 5F7UA 2F9BT 2DLFH 2HLAB 3MV8A 4IJ3B 5T33H 4P2RA 4LBEB 4PGJA 4PG9A 2VR5A 4PJDB 1DUYA 1P1ZB 4HPYL 2G2RB 5MEQA 1W8NA 5D1XD 5HGBB 3EHBD 1FNGA 3RX7A 1CBVH 4H25B 4QRSA 3RUGF 2XQYK 1FO0A 1Q9OA 4PB9L 4X98A 5IHUH 4F7MB 1U8KA 2XOTA 2LABA 3MPCA 3W81A 3CLFH 4LMQE 2Z4QA 5CUSL 12E8H 3V4VH 3MRNB 4X7EC 5CMAB 1LO3H 3GSRB 1QSFB 4KKAD 1OW0A 4HC1A 3K8KA 5IVXF 2GIYA 5C0CB 3FO9A 3S4SG 5JMRA 3KLHC 3GM0A 3QQ3B 1C8PA 1FJ1B 2XG4A 3C60C 1T89C 3D39E 4YIQB 1RZKH 4HAGA 3PGCB 1YY9D 3ULVE 5DS8A 2XICA 5ESQA 1B4RA 4TN9A 4YZFF 1F8TH 3G04B 1V8HA 3V6BR 4JN1H 3U2SA 3WMSA 3JV6B 4AQ1B 4CU7A 2IPTL 5EZJB 5HGDA 5MEND 2V17L 1UEMA 2HN7B 5D5MB 1ZEAH 1M6OB 3MNZB 2W60A 2V2TA 4JDZA 1G7JB 3BUYA 1A6TB 5AAWA 4JM2D 1NCWL 2ZCHL 3IAPA 2WBWB 3O9WB 3O41A 4ODSL 3GB7B 3EDKA 3N06B 5JW3L 4Z76A 1IC7L 3H9SA 2F5AL 1CF8H 5JA8B 2D4DA 1CK0L 3AU1A 4NC1E 3G9AB 2UUDK 4F7EB 4KUCF 4LLMA 1ZLUK 3BSZL 3RFZC 1I1AA 2GTWA 5C2BL 1XGRB 4W4OC 5C0GB 3R06B 5SWZB 1KSRA 4D3CL 4QWWD 1A7NL 1F58H 4I77L 3BKJH 1FH5L 1HINH 2DQHH 1UYWH 3BKCL 2Y72A 5D4QA 1I7ZA 4HHAA 4CU8A 3GMRB 1JGDA 2I27N 5ALCL 2R8SL 1T7VA 1AI1L 4W4NA 3SPVB 1BJ1H 4HWZA 5ALBH 5D72H 1KT2B 4X6DE 4NQXA 4RIRB 5I8OL 5D96B 2QADB 3CZFB 1CXFA 4ZOEA 5GS0L 3FB7B 5K33A 4JY4B 4NZRH 4RZCA 4P2QA 1ZSDB 2WLYA 5DRZB 4JPWH 4DOHE 5TDOB 1AGCA 5FGCB 4P4KB 4E5XB 2R29H 4MS8D 1SVZA 3RA7H 3K81A 1WCBB 1MLBB 3FONA 1T1XB 4ZUWB 4HIEB 3C8KB 1I8KB 3O9WC 5GHWH 1Y0LB 5IB5A 1GXEA 2NW3B 5ILTL 2NYYD 4LU5L 4XP4L 5ACMA 3OAZH 2DLIA 4TUJB 2VXQL 4JRXE 2WSKA 3L3GB 5JLZA 2X4OB 1GZQB 4KC3B 1LILA 2FHBA 3UTTA 3VRIB 4ZAKA 4WHDA 3P2TA 3GSNL 5D7JB 3BP4B 1AHWA 2P5EB 4HGWB 4LSDA 4UZGA 5LQBL 4ODVL 3L3HB 3EZ8A 3TYGH 2FX8H 1FSKB 3VD7A 3MBEA 1IKFL 3RVUC 3MROA 3PWPB 3WFCH 1QO3B 1E4XI 1UCBH 1JGLL 4UDUA 4KZDL 3VXTA 1P2CB 4Q2ZB 2CJUH 2F5BL 3E2HC 5JHDE 3P30L 5TE4H 4TULL 2XTJB 3MV9E 3ARDB 3VXSB 5HYEA 2NR6D 3IJYA 4WUUA 4L29A 4PD4J 4DVRL 3GZKA 4XP1L 3WN5C 5LWYL 3K3QA 1P7QD 1MJ8L 2EH8L 3PP4H 5HHXL 3ULUD 3FT2A 1NGWA 3G6AA 2ZOLA 5HBBA 4X4ZA 3P9MA 4DN4H 1X5ZA 2FHFA 5L0QC 2BVQA 3AM8C 4WI8A 3UEZA 3U9PL 3C6SB 3DVIA 4TQEL 5I1EH 4G9DB 5DSCB 4QTIL 32C2B 3QH3B 3P4MA 3B9AA 4PRBB 4GSDL 1HN1A 3ZKNC 1FC1A 2PYFA 4M4RA 3FMGH 5FHAL 4AH2A 5I76B 1SYVB 3ARFA 5FGSA 2R4SH 2W9LA 3JTTA 3QEGH 4DGVL 3DMMB 3WBDA 3WDJA 1TXKA 2H26A 3T04D 4Z7UE 2NX5B 5C08E 4XAWH 3LRGA 4MJIB 1ZVSA 2DAVA 5ECJE 4XRCA 1S7TA 5GRZA 4XHQA 5IF0A 4C56A 4P3WA 4LP5A 5GS2D 2IPUG 2DOCA 5D6DC 4F7PA 5I8KL 1NFIB 5A1AA 1KJ2A 1RZ7H 1CVSC 5E8NB 4L8SC 1QG3A 4H88H 2BNRA 2XRAH 2EH7H 2JJSC 4NPYB 1R3HA 4FNLL 3J8F7 3GMMA 4TTGA 1U3HA 2HP4A 5CCKL 4WO4A 4MMZC 4I48A 1OWRM 2D7QA 4PJ8D 1ZE3C 3I50L 1I8MA 5MEPA 1IGFL 1HYRC 3NH7L 4PJEA 1DBKH 4K94C 1ZHKB 4BFIA 3LHPL 4BZ1L 4YO0A 4XCFH 4CL7A 3NPZB 2A6KA 3VFRB 2R69L 4F58L 3EYVB 4OI8A 3KPTA 5HGHB 4Y1AE 3DVNA 1ORSB 2R2BB 3MLWL 1G7HB 4MWFA 5M94B 4FP8H 5I8EA 2F8XC 3T1FB 3LKQA 5FYLL 4Q58C 3QNXA 1MCEA 3STZB 2VDOH 3OAYK 4G6MH 1S8DA 5GGSA 4MNQE 3U46B 5EUKB 2BERA 3SE9L 1INEH 4JZNB 4TSAL 5B3NA 3WS3A 5CHNA 3EYQC 2EE3A 3HNVH 2GSGA 3V5DB 4J3OC 3H8NA 4PGBB 3ZKMD 3QEQB 4EI6B 3QI9B 2DQEL 2MKLC 1LK3H 3VXOB 1H0DB 3QQ9C 4LDEB 3SGKC 5HVHB 1QLEL 1IC4L 2V9QA 5FA3A 5DK2B 1K5NA 3HAEB 1A5FH 1KTDB 1CIUA 3K8MA 2BY3A 1U95B 4O5LL 2WMPA 5C6TL 1F4AA 2Q8BL 1NEZB 1CYGA 4WDIA 4X7FC 4ELMB 1WWWX 4YHZL 3JWDC 4JFXB 4UAOB 1BHGA 3BH8A 4BSJA 4D0BA 2FX9L 3WUWA 5FOJA 1ZTXL 3LEVL 5FK9B 1N8ZB 2ZCKH 3NPSB 3MR9A 2Y5EA 3PWUA 3HZYB 4I0PB 1KJ3L 1RK1A 1B6DA 3PJSB 3UTQA 1TZIB 2MQ3A 3PL6C 3GRWA 3UTZB 5HI5D 2AK1H 3BPOB 2NY3C 1UH2A 4LLVA 5DJAB 1R24A 5T3XH 1KB5H 1RUQH 1MCPL 4XNUL 1MAJA 4HS3A 5LGKA 4IIQC 4QHNA 3BIKB 3K74B 2BMKA 4JM4H 2RFXB 4M03A 5C09E 2DQGL 4TSCH 2VKXA 3FZUD 2XKNA 5FV1L 1IQWH 2FIKB 5IBLC 5SWZD 4G3YL 3CVHB 5E1HB 5C0ND 1FNSL 3JWOC 3TLRA 4BA8A 5CBEB 1HHIB 1SJVA 1S7SB 3HE7C 5CSZA 5IBUG 3WO3B 4KTEL 3BT2H 3VXRE 4YAQA 3IVKA 3VFWA 1ZT7B 3GEWB 4U7MA 1V5JA 4Z7QE 3GFUA 5FDWB 4W4OA 4HUKB 2WW8A 3B4NA 5JZ7C 4C58B 4NQCA 1ZLWH 7CGTA 1NGXB 1PVHA 5JPNB 1N7ML 1N3NB 1TCRB 3NGBB 2QADD 1HHHA 4X6BB 4M1CC 2OZ4H 1GGIH 1UACL 1WBZB 4HKXB 2X4SB 4PFEA 3C5JB 3MUGB 3C6LB 3CK0H 4GH7B 1UZ6F 4U1IB 3DHJA 1RZIA 4RFEA 4GJTB 1KTRL 1T0NA 5D7IE 2A0LD 1VGEH 1HXYB 2QSTA 4FS0A 4MD4B 4P4KD 3VMPA 4KV5F 5I9QB 5DD6B 3RWIA 1OAQH 5BXFA 1T3FA 1BD2E 3OB8A 2Z31C 1T83C 3QR2A 3G6JB 4I0PC 4KRLB 1EUUA 2ZUXA 3RJDA 5BV7H 5FECB 1BFOB 3QT2A 4DFHA 4G8EA 1YYLH 1RUPH 4JY5L 4POYA 1T5WA 1B90A 2RHEA 5JR1L 2ADGB 3VGFA 3E6HA 3ZKXC 1XIWC 2GK2A 3O4LD 2I9TA 2FEEL 4G7YH 5IHZB 5HYIA 5IEHA 1NC4B 4HS6A 4OZFH 3RUGE 3TCXA 5D7JD 4QRUA 2P5ED 1B4JL 3S35H 3TO2A 2ICEA 4CJ1A 4YLQT 3I02B 4JY6A 1YJDH 4KK9C 5GPRA 2OX5A 5F21B 5DQJA 4OM1H 3V2AR 5A3IC 1CT8A 1QSZA 3KJ4B 1RJYA 4XPFH 1RZ8A 2EEBA 4J3TA 2BSSB 3ARDD 4H5SA 2C3HA 4X6CF 2V2XB 3DURB 3TYFB 1VEOA 2AK4A 4JPVH 3QHTC 3AS2A 5F3BB 3HC4H 5FYKD 4F33B 4ODWB 4YZFE 3LSOB 4UINH 5DVOA 1YC8A 5D8JH 1DBMH 3NFPA 3IFLL 1U8PA 1A1MA 1VGKB 4G6JL 2AXGB 3WN5A 4DTGL 3P9LB 1FC2D 1Z9SA 4ONFL 3OKLA 4R4FL 2NY7H 5ICXA 2AKRB 5I9QC 3CZJA 5E9DA 1DQTA 3PNWA 4NNYA 1YNLH 2AJYH 1GGBL 1KYOK 3L3DA 2X89D 3ALPA 4LHUB 3AM8A 5AG9A 3U4EA 3OAUH 4G5ZL 4CU6A 3AGVA 1UM4L 3DMMD 2DICA 1DANU 3NVQA 4P2YA 3G08A 2NX5D 4NOBA 2ORBL 1AY1L 4RMUA 1EERB 1NFDF 3MV8E 4LKXB 4P2RE 4DWHA 4ZQKB 3DHMA 4X5XA 1OAXL 1IAII 2P47B 4BYHA 4L8CA 4J4PC 3SDXF 2YN3A 1EO7A 2WUBL 3OKNB 3FT3B 4LVHB 4DW2H 5AYQA 1RJLB 5MHSD 4MB3A 4WI6A 4PY7B 4L3AA 3DRTB 5D6DA 4QRPB 1AJ7H 3DXAA 3H0TB 3LEYH 3ZL4H 1J87A 5CP3H 2VXUH 5E4EB 4L8SA 4L5FL 2JE8A 1W72B 4CVZB 1MHPH 1LHZA 4N8CH 2ENSA 1RIUL 2JJSA 3ZT7A 1D7FA 4Z7OE 1TENA 1X6LA 4PRHE 4K9EH 5F9JA 3U0WH 4L3EA 4FFYH 4WWKB 5DQDH 4F8QA 2A83B 4NUGL 4MJ5B 4G80A 1TTGA 4N0CD 3TBSB 4YXLL 1FRGH 4Y16B 4OFIA 4TNWK 2AABL 1YEKH 2D7TH 2D7MA 5J3HD 2ZSVA 3JV4A 1C5DA 4M7JL 3GSWA 3EIFA 2BRRL 2P8MA 5J4MA 3BEWA 5TJWK 3DTXB 3MREA 5KVEL 3BKML 3CFKB 1VFAA 2VLJB 4JB9H 3L1OL 5T3ZH 2Z92A 2BSTA 4U3XA 4WENB 1E4WL 4L3CB 1FVDA 1RIVL 2XZQH 4P23C 2AEQL 4JFHD 5FUOL 4BQCA 3S4SB 5I19L 1FG2B 1AP2A 1JNHA 5ICYA 1FFNA 1ZGLB 5GGVL 3V6ZA 3UBXA 3SE8L 5IVZB 4KQ4L 2HRPL 4NKQB 3QEQD 3H9SE 1JYWA 3QI9D 2Y06L 4XVSH 2WWMD 1UB5A 3T2NH 3PP3K 4NZTL 5FM5O 2HRLA 1YDPB 1T0PB 1J0KA 4LVHC 4A6YL 6FABH 4YHYC 2P5WB 3T0EB 5JOPE 3LEXB 2P7TB 2K7QA 3IB4A 4MQXD 2FJHB 3NFSH 3SOBL 4Y5XC 4NM8L 3SGKA 1G6RH 2YHGA 3AFLA 3MRHA 2HH0H 2W07A 2V5MA 3VG0L 4Y4FB 1HHGA 1OL0A 1U8JA 1FIEA 3WSQL 2FH8A 1CICD 2F53A 3LDBC 3N1PC 4WI9A 5I1GH 4OD3H 1JN6B 1VFOA 2DTSA 3RNKA 5CGYC 3GJEB 2GSIA 4OCRL 2M26A 1WBXA 4UILL 1WFUA 4BFEA 2VISB 3BESR 1Q9LB 1UADC 5IMLA 2EO9A 3O3DA 3CDGA 3SN6N 4MNGE 4YC2C 2VO5A 4Y16C 3P0GB 2J4WL 3L3OB 5IJVA 3MFFA 3L7FB 4P2QE 2YD3A 4XP6H 4WUKL 3PWLB 2XZCL 1GCFA 1XZ0B 1ZK9A 5DK3A 5GGUA 1QSEA 4OF0A 3VXQA 3QUMH 3PL6A 5CINL 3GO1L 3AVEA 3OR6B 5JUEH 4JFFB 2J1KA 3NCYS 4JGJA 1EIBA 4ETQA 5F44A 3QDJA 1HIMH 4OZHA 3SDAB 4J3SA 2ILLA 1UKQA 2ZUVA 3BO8B 4IIQA 5D7KE 1YQVH 2ZUQB 3BFOA 4ALAH 5E6IB 4NWUL 3LQZA 2LAAA 2M2DA 3T4AA 1AIFA 5JORA 3NACH 3UTTE 5JW5A 3H7BB 4EBQL 1H3XA 3GJFH 4LRNL 2EKSB 4YHPB 1QR1A 3HE7A 3T0EC 1ZS8B 3FOMB 3NA4A 2YXFA 3N85H 1MJJB 4FQJH 4DZBA 5IV2A 3C6LD 2ICWB 3HG1E 3SHSA 1FFOA 2R0ZL 2RR3A 5EU6B 5BRZE 4KPHL 4Y4FC 5E5UB 1E4XH 1G9NH 3RNQA 1FNHA 2AJXL 1XF2A 1DEEB 1X5JA 4JHAH 2AEIT 2XA8L 2HLFC 2D3VA 4OLUL 5EU5B 3LN4B 3I6GA 5FDYA 3P11L 4DK6A 4CBPA 4PJ5A 1IE5A 2AV1A 4XBGA 2J2ZA 5F7FA 4F15C 3QEHB 1KACB 4UTAH 5IKCB 4XTRD 1YMMA 3DYPA 3FB6B 5BO1L 2DJUA 1U8MB 3OKOB 1EEUA 2X4PB 2CRIA 5F93C 3NABH 3UTSA 4JO3H 2JJUA 2UWEA 2CQVA 1T83A 3NFNA 5J6GA 4R8WH 2YC1A 2ZSWB 4GT7A 1MWAB 3X12B 5DK0A 2DM2A 3B8YA 1NC4D 4KWUA 2IWGA 4FQIL 1CN4A 1GGCH 3D18B 5D70H 4OB5H 2WUCH 4PRPA 1XIWA 5LBSH 3UO1L 4H0HB 1FVCB 1OTSC 4UMGA 3IRPX 4RMWA 4U0RC 1MFBH 2R0KH 1TVHB 4YDKH 2NY6B 4LAQL 3G5VA 1MEXL 4L4TB 1OAZL 4KKBD 1FL5A 1KLGB 2HTKC 2JJTC 1VACA 1U0QA 5INDA 1MCWW 1D5MB 5T1LA 5JNYB 4C56E 2E7CA 4L4JA 1LO0H 1HI6B 4JFOA 5TGBA 2AEPH 2OSLB 4LSSL 4KKCD 1OTTC 4M48H 5JIIA 3WIHL 1ACZA 4DCQB 1NJ9A 3ZTJG 1JWMA 2W9EL 1T1ZB 1AD9B 2IH3A 1SY6H 2XWBA 2VC2L 4HJJL 4ESKA 1EMTL 3WFEL 1MFDL 5CLTA 4LSQH 5ERWA 4QT5A 4WEUD 3VFTB 2UVFA 4QYOA 5INCA 4LHUD 3T8XB 1INDL 1JYNA 4P2OB 5DJ8A 4LCWA 1NAKL 3KPRB 5EPMB 5K9KB 3CUPB 4ODUA 5DRWB 3I6KA 2FWOB 4LSRH 1I7RB 2JIXA 3E1F1 5IFAL 4UB0H 5DI8A 3TH3T 1GL4B 3U83A 5C1MB 3UAJC 2CLVA 2HAZA 3RRQA 4MD0A 5HI3D 8CGTA 4P3CL 1T1YB 2BZDA 1PX4A 4XBPB 1PKQA 5EWIH 5GS0C 1YY9C 2OJEB 5GISH 4OGXH 1RD6A 2FBJL 1IM3B 1IBGL 4UT9H 2GEEA 1WIPA 2ITDA 4H8WL 2IH1A 3QDGB 4J4PA 1CLCA 2CKNA 5I6XC 3PIQB 1RAMA 4NOFA 4XWOD 3NA9H 2DS4A 1H5BC 3HZVA 4XVUD 3UYRL 4HK3N 5GGTA 5HYJA 1NC2A 1EXUA 3K80A 1LNUA 1VB9A 3OG4B 4HKJB 4WWKD 1VA9A 4FTVA 1AGBB 5TH2A 3GIVA 3X3GL 4OCLC 3CSYB 4OGYL 1I4FA 1SYSB 2Y6SD 4X4XB 2Y7QA 3BRGC 3QJFA 3GSXB 4M62L 4U1HA 2PXYB 3ESUF 1IAKB 2RJMA 2YA1A 3SDDB 4MDIB 1PLGH 1A7RH 1D6EA 1UVQB 4QGTA 2VLJD 1OSPH 2FJGA 4NQDB 5I1CL 1NGZB 5EOCJ 1J8HB 1FBIL 2B1HH 2WQRA 3MRQA 1U93B 1UXSA 3VRJB 5AYUH 2J8UA 1FNFA 3MYJA 4U1LB 2YWYA 3FRPA 3ECBB 3WKMH 1YN6A 2Z91B 4H1LG 1F5WA 4OIBA 4P23A 1DQLH 1GVIA 1QACA 4RGOH 4JJ5B 2X6MA 1P4LA 1WWBX 2P5WD 1UJ3A 2CR3A 5ADOL 2GQHA 5DUMH 2AXHA 4YDJB 4POZD 3LRSB 4E41A 3MV7B 2AXFB 2OTWB 4LPWA 4NHUB 1LD9A 2EIBA 4U7SA 3F62A 3FB5A 1KJMB 1A6PA 5D7SL 4X6CE 5ITBH 5KVDL 2HA1A