5FCUL

Crystal structure of the inner domain of clade a/e hiv-1 gp120 in complex with the adcc-potent rhesus macaque antibody jr4
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
212
structure length
212
Chain Sequence
SVLTQPPSVSAAPGQKVTISCSGSSSNIGRSYVSWYQQVPGAAPKLLIYDTNKRPSGVSDRFSGSKSGSSASLAITGLQTGDEADYYCGAWDGSLNVHIFGSGTKLTVLGQPKASPLVTLFPPSSEELQANKATLVCLISDFYPGVVKVAWKADGNSVNTGVETTTPSKQSNNKYAASSYLSLTSDQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Paring Down HIV Env: Design and Crystal Structure of a Stabilized Inner Domain of HIV-1 gp120 Displaying a Major ADCC Target of the A32 Region.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords clade A/E 93TH057 HIV-1 gp120 core
total genus 46
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2015-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fcuL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fcuL01
5F1OB 1F4YH 3L1OL 4HLZG 2OQJB 4K23L 2IAND 1WZ1L 4NT6B 2CJUH 5IMMA 1A4KA 2BX5A 3WHE0 1VGKB 5K93A 1MPAH 3TPUA 3TBYA 2RBLA 2CRZA 2FCBA 3SDCA 3LRHA 2YMXL 4LKCB 1FP5A 4LEOB 4RFEA 3MRDA 2VDRL 1G7HA 1WZ1H 1OM3H 1RY7B 1LE9A 1NMBH 5BO1H 2CRYA 3QFJA 3KS0J 2GYSA 4D94A 1CZ8L 4HXAH 2DWEB 4AMKL 2NY1C 3GMRA 1EV2E 4RBPH 1Y18A 3ARBA 4GXUM 2PW1B 4X6BA 1BBJB 4HLJA 4KV5E 2LTQB 3V8OA 3OWEA 3VH8B 4GAGL 2NTSP 3UYOD 2W0FA 4KPHH 4NJ9L 3ZKXC 1GC1C 5F7DA 4ISVA 1PW3A 5CMAA 1X3DA 3PL6D 3KYOA 4UINH 4MVBD 4M48L 3IAGC 3Q5OA 5DEZA 5IB1A 1S9XA 1AQDB 4YWGL 5IHZB 5B22A 1VFUA 4JFYB 2NZ9C 1FN4A 4OI7A 1M71B 3MNVB 3ZL4L 2IH1B 3PV6A 4ONGL 1MCPL 1ERNA 5TDPA 4IRSC 1WUNT 2VXQH 5DGQA 3IFPB 3BWAB 3BJ91 4O58H 1Z6JT 1I1YB 3KLAA 2VAJA 3FKUS 2R1WA 2FSEA 1I7ZB 1I1AA 3EGSB 1A7QH 1GZPA 4JKMA 1AGDB 5ABDE 4E0RB 4LIQL 5HY9B 1CF8L 5E5UB 2WBJA 4OZ4A 2MQ3A 2J8UA 3U0PB 3V5HB 2PUQT 3S88L 4G6JH 1J1XL 3QEUA 1RJYA 5CSZA 1IE5A 3QJHB 4N9GA 5D2LF 5TDPB 4FQIH 1B9ZA 1VGEL 5GGSY 3MV9A 3VGGA 4CVXB 2YD8A 4CN6A 2ERJB 3VXTB 1ND0B 3PWUB 4OD1L 2G9HB 1U8QB 1T04A 3V6FB 2R0KL 5GRYA 4DKAA 2DBLL 4MCZB 1JYVA 5BS0B 1B3JA 3FO0L 3T8XB 2YPLE 5J1AA 4UIMA 4OZFA 4L29B 1A6UL 4YBQD 1T1WA 3JV0A 2FL5A 3GKZA 1OCWH 4QY8B 5L7XH 3LZFH 3WCYA 5JOPE 4MXWL 3ULUE 2OSLA 4LCWA 2KUTA 1LK2A 5CCKL 2D0HA 4GG6B 3QFJB 1PX3A 5FCUH 3L6FA 1ACZA 4NQDA 2ARJA 4JRYE 1KIRB 4N8VA 2PTUA 4TN9A 1DQJB 1OTUC 5EU6A 2AK4E 5K33A 3L5HA 1JGLH 3ABZA 2VLMD 2DYPD 3KWWB 1D5BA 4JREB 3VFGL 2VXTL 4WCYH 3B6SA 3UJIH 1F13A 5DJ8B 4TUKH 3A6CL 5SWQA 1A7QL 3HLAA 1QO3A 2DLHA 4F7MA 4X80H 1L7TL 1P5UA 3LKPA 4PJBE 3P40A 4Z7QF 4QHLA 4UTAH 1Y0LB 3H42H 2WWKT 4UAOB 5DVKA 5ICXB 4QXTA 3RI5K 1QLEH 2DLFH 3QI9A 4HX1A 4M6ML 5AZ2H 1FNEA 3VFSB 5TE7H 5IKCB 4NO3B 3DRQB 4ZO8A 4OLUH 2ENYA 3D85A 2EDYA 1YQ2A 3BPLC 4HT1H 5IB5B 1MHPH 2NY0C 4LCUA 1MHPL 1IM9A 3VJ6A 1EVUA 2VR4A 1QLRA 2BVOA 3MRGA 4F58L 1OSZB 5T1MB 5A2FA 1HSAA 3IXTB 2P5WA 5GSVB 3EOAA 5KSBE 6CGTA 3JWNC 2JCCE 2D4FA 3SDXE 4CVWA 3BQUB 3L5XL 4YK4C 2HJLA 3B3IB 1HOCA 2EIEA 1RUAH 2ICEA 3HUJF 1XR8A 1AP2A 4MAYD 4JDTH 3FT4A 2FGWH 1DE4B 1ETZB 1FO0L 4NKOA 5E8NB 1NEZA 1Q94B 1CFBA 4F9LA 4DAGH 4QT5B 1HHJB 1N5AB 2V2XB 5JUEL 4GRLA 1QG3A 3GFUA 3T0VA 3F5WA 4DW2H 5I16A 4OCYH 3PGCA 4WI5A 2DKUA 3ARVA 4GRMA 5JZ7C 4XCCL 2B20A 5B39G 2NW3A 5CINH 4E41D 2X89A 5E00B 9CGTA 5EBGA 3BAEH 3L3IA 4NZDA 4IOFC 2AEPH 2UUDK 1QSFE 4P3CH 3ARFC 4KRPB 5C08A 4KDTA 3F7VA 1JZ6A 1CS6A 3ZMRA 4BM7A 3K74B 1VFBA 2XZZA 1ZGLB 3CLEH 4MYWB 5L9DL 3C6LC 4RGOH 1QVOB 5KANG 4NO0B 2BC4A 2DTSA 1MJ8H 1JZ3A 3QEQD 4F7PB 4QHUB 3U6RA 4P5MA 1CTOA 2CRIA 1EFXD 5E4EB 4XI5C 1XGYH 3FCTA 2K7PA 2UY6A 1YMHB 5JDJA 4HH8A 4IBLT 3MO1A 1G7PB 3HE6D 4G6MH 1T5WB 3EAKA 2ZJSL 3T08A 1K5NA 3H9SD 4LF3A 1U3JA 1LK3H 4FQJL 1H15B 5D1ZD 2HJKB 1P4BH 4Z76B 4HGMA 4D9LH 1I4FB 1A9BA 4XCCH 4HJJL 4J1UA 2RB8A 3QPXL 3QDJA 5I1AB 4K23H 4NBYB 1KCRH 5FYJH 1JYWA 4UMGA 2H2SD 3SQOL 1MFDL 1F3DJ 4WY7H 3V6ZB 3DUHA 4OFYA 3INUL 2GTZA 2DQIL 4TTDC 3W9EA 4DFIA 1X5ZA 2FJFA 5EPMA 5C0CA 1IKFL 2DQEL 1JZ7A 1NFIA 3ARRA 3S98A 5ESQA 4WO4B 3RY4A 4Z7VF 3LD8B 5E99H 4GRWF 4OLWH 5H8DA 3GGWA 4F57H 2V6HA 5IROA 5HGBB 4OD3H 4UV7H 2VLRE 3LDBC 3OGCB 3B9KB 3GUTA 4LPTA 3TZVA 3VFMA 1XGRB 4RSVA 2VLKA 3MA9H 5L88L 2EXWD 1S9YA 4U6VH 2QADC 1XF2A 3ARTA 2AV1A 4JPWL 3VXRA 2HVJA 1ETZA 4R8WH 1DE4A 2HRPL 3F7QA 2FBJH 3P9LA 4V1DE 1LEKA 4GQ9L 2RCSL 3QZWG 2D7NA 3B3IA 3DYPA 2Z4QB 2E5EA 4C56D 2UUDH 2D7TH 3FO9B 2G2RA 1DANU 4FQQA 2I60H 4L8SB 1TNNA 1KJMB 4HBCH 5E99L 2W0KA 4JVPA 4JY4B 3B5GA 3EJZC 3PWJB 4OFVA 4IM8A 4JDVB 1MLBB 2XV6B 4UOW0 4YGVA 4JFHD 4JKPL 5IVXF 5CD3B 2VDNH 1KLGB 4G8GD 3BQUC 4XBPB 1OP5K 5HGDB 4I3RL 4G7YH 5EU3A 2NY6B 4I4WA 3FB6A 5IF0B 4K7PX 1QEWA 3BJLA 2EDRA 2YS4A 4PJGF 1FAIL 3I2CH 3WHE1 4X9HA 1H3PL 4UILL 3QWOA 4Q6IA 2YRZA 4Y5XB 2YRLA 3IAQA 2VC2H 3AU1B 4CU7A 1TCRB 1KPRA 4FQ2H 2X7LA 1YJDH 3VXMD 3S3SA 4HPOL 2HFGL 1UZ8B 4JFPB 4YHKL 2M8XA 2RHEA 2ATKA 3HLAB 4KROC 3NCFB 3P30L 4OLVH 4X99A 4LVNC 4XMKH 5I8OH 5TF1H 4OZGA 4PRHA 3CFKA 4MD4A 4ZXBB 4RMWA 4JLRA 1MJ8L 2HAZA 32C2B 3QUMB 4RGNE 2NXZD 3WUWB 4X7TB 5H35A 1TPXC 1GL4B 4ZAKA 1P7QB 4PBVC 3OX8B 2J12B 4RGMB 3KPQB 3KLSA 4MVBC 4H8WC 4PBXA 2GT9A 5DUBA 1R0AH 3AAZB 1NCAH 2NZ9D 4HHAB 1EHLH 1AGFB 3TV3L 3ZTJG 1EA9C 4Y5YA 3TIEA 3WD5L 3ULVC 5I8KH 5DMIL 2BMKB 3SGEH 2O5YH 5ETUA 4MXQD 4CN4A 3QNXB 4NQUA 2VIRB 3AY4A 3AUVA 4JN1H 2HN7B 3OR7B 4D0DB 2AJSL 1BVLB 3B43A 3IRZA 4U7SA 4MWFA 3TNMA 3VXUE 5DRXA 2F8XC 1B2WH 4U05A 4YLQT 4D0CB 3P4MA 3QB7C 2W59A 4BQCA 5GJTL 1BFTA 1DEEB 4I9WE 4JO3H 2V5SA 3AREB 4H0IA 4QXGH 3EYQC 1MCJA 3HFMH 4UT9L 3OMZA 1IVLA 3QJFB 3GIVB 2E9IA 4JE4B 1MEXH 3GZKA 3RTQB 4IRJC 1KCLA 2EDDA 3CLFH 3ZKQD 2KQMA 3QQ3A 1BF2A 3DPBA 3FQWA 1T0MB 3GSUB 2EDOA 4LEXL 3SDCC 3KJ6H 3KDMA 3CCHA 2OZ4L 4WHTB 1NFIB 1DN2A 2YOCA 4TOYL 3O4OC 1CL7L 1HI6A 1MWAH 1XEDA 2CLRA 5ID1A 1VACA 1B90A 3T0XA 4Q2ZA 4XMLL 5C08B 3P9MB 3HI6H 1PX4A 3M45A 4N1HB 5C07E 1FQ9C 1KCSH 4A2MA 3PE9A 5EO9B 1AGCA 2X4RB 5IG7B 4X5XB 3GNML 4HGWA 4XNUL 1MCPH 2CIKB 1Z2KA 3T2NL 4RFNB 1VEPA 4G8FB 4B50A 2XZAH 1U93A 2YA1A 5EN2B 1ITCA 2JELH 3WFHA 4LQFL 3WIIH 1P4IH 3L3JA 1CL7H 5HVHC 5JW4N 2Y6SC 4ISVB 4NN5C 1KIPB 4YUEH 1KXTB 2NMSA 1JUFA 4POUB 3O6KH 4EEEA 5JTWA 1SBSL 1OPGH 3J8F7 5E24E 1J11A 4GAGH 2PW1A 4HFUL 3QDMD 2HN7A 4W6YB 5I1JL 5FCUL 1IL1A 3GSVA 3EDKA 4WW2F 4I48A 1MWAB 1E4JA 3W82A 4HSQA 1FG9C 3KNBB 4HKBB 3ARBD 1DBBL 1CE6B 3EHBC 5AD0B 4PJ7F 5IB5A 3QPQC 2EYSB 4JFQA 5CBAA 4M6NH 1GHFH 4PRIA 4Z9KB 4M9PA 3IDGA 3GJFB 3GSNB 4JO4H 2Q1EA 3N1MC 3TPUB 1X4ZA 5E6ID 1ZLSL 2AJZB 4P5TB 1A6UH 1FRGL 5J6HA 4LSPH 5FHAH 4XMPH 4QT5A 2A77H 2OQJA 2J6EL 2JLLA 1FL6A 1K4DB 4WU7B 2CLVA 1KENH 5IFJA 1FZOA 1QBBA 4RIRA 2X70A 1VEOA 3WLWD 3QUZC 5CGYC 2O61B 2GIYA 4LCYA 4OZFH 1F8TL 3RA7L 3FN0L 4D0BA 5SX4H 3VG0H 2IAMA 3KYMB 4RISL 4DGVL 3WNKA 4S1RL 4MA8L 4J4PD 5GRVL 4ZSOB 1ZVHA 3QUYB 1G0DA 2X4UB 2QHRL 3L3OB 4PRID 1NMCC 4L4VB 4R26H 4K2UH 2OI9B 5DTFB 3SCMB 3MLSL 4H5SB 2FZ3B 5J1SC 2QSCL 2EDXA 4RMRA 2HP4A 3GMLB 4OZHE 1UYWL 5F7NC 2OZ4A 3MRBB 4D8PA 1BAFH 2NY3C 4P2RE 5K9JL 4N0CD 3VXPA 3TCLA 1FNSL 1VKXB 1EO7A 1MFCL 5HGAA 2VN7A 3MMEA 3HNTL 5H37G 4PJCE 2BSED 2FIRT 5C9JB 1V7NL 3PJSB 3QDGB 5F1IB 5A16A 5D9SA 4ODXA 1LD9B 3SKUD 3BGAA 5BXFB 3QHFL 3QIBA 3KAAA 4IOFD 4U0QB 1GPOL 1FL3A 3HNSL 3ARFD 2DQDH 1KB5A 4O2CA 5C0JA 1CTNA 2DRUA 3IS0X 4NZUL 4WUUD 4LVOB 3Q0HA 3O4LA 4S1SH 1IC7H 1NAKH 3NIGF 3D1MC 4F33B 3C6LD 1S9YB 5JQ6H 3BFOA 4XH2B 3U4EA 1TJGH 4OJFH 3TBSA 5HHQA 4WGVB 4PJHE 5HHXL 5C0CE 4XI5D 4YHZH 2R4SH 1NAKL 3Q1SL 1MCBA 4M7JL 5D7LB 4ZYKB 2J8UB 1EX0A 5JQ6L 1MHCB 3VI3F 2XWBB 2JELL 4I0PD 1Q0YL 4NWUL 1F8TH 3RA7H 2JB5L 1BZQK 1IGTB 1WK0A 4PJBF 2IQ9H 2EECA 3P0YH 1H8SA 1V7ML 4P59L 5IHUL 1T4KB 1WIPA 4WFGE 2XZCH 2FL5B 4M8QA 1TJIL 4NFBA 4X7CC 3QDGD 1CFNA 5I9QB 3PABB 1YEJL 3MYJB 2ZOLA 3BRGC 2AK4A 2AJUH 5I74B 4JCMA 5KN5A 3TO4C 3BE1L 3A6CH 3D18A 3MV01 3GJEB 1NGXB 2WUBH 1P4LB 1T03L 5HI5D 4WEMB 1KPVA 1MCIA 2Q7YA 4AENB 2E7MA 5CZKA 3KYOB 2AI0H 4F37K 3JWOC 1MCEA 1UT9A 1KCRL 5FYJL 5IVXA 5F9JA 4PYHA 4XZUA 1WBZB 3C60A 1A6TB 5GGRB 2QADD 4LSVH 4RAVB 1K3ZA 4LDLB 1N0XH 2ZJSH 5FV1L 3GI8H 2BK8A 1I3UA 2J2ZA 1WAAE 1QRNE 2N56A 3AMLA 4ODVH 4ODVL 5E08L 1PG7L 2JK5B 1CGSL 4LASH 4PJAF 3MRQA 2XACC 3MBEC 3DIFA 4QRUA 2OJZL 3B9KD 4HC1H 4APQB 5DD6B 1H8OA 5EUKB 4JO2L 3MRRB 3BQUD 2X41A 5DGRA 3MNVA 4EDXB 1WBXA 5I8OL 4YNYA 4P4KC 2IGFL 5DJYA 3NFSH 2HH0H 4KY1L 4OV6F 4C4KO 2NY5L 5CEYB 5BCAA 3QUXA 3FT3B 4JFEE 4OCWH 4AYFA 4A6YL 5D6CB 4Z7OE 1FYTE 3T4AA 2HLAB 4P2CG 2WUCL 4XTRC 4PJHF 1OTTC 5KZCD 2D0GA 1YECL 5DEFB 2ZZUT 4HAGA 4F7TA 4EI5A 2AGJL 5T1MA 5BQ7A 5HDOA 1T83C 3DVNB 4KROD 15C8H 3WDIA 5DVMA 3BEVA 2ZCHL 4G9FB 5J56B 1S9WA 1AJ7L 5DVLA 3O4LE 1UB5A 2HMID 4HBCL 3FZUC 2JCCF 5KSVB 3V7MA 3GBMH 1X5FA 1BWWA 1NDGA 5IVZB 1M7IA 2QV2A 1EVTC 1IJ9A 2DS4A 5MP6H 3OKDA 4I13B 2VDML 4C56A 4P2RD 4NKDB 5HDLA 2PN5A 2ITDA 5MEQA 2YC1B 3VXRD 4AZ8A 1RK1A 1RFDL 5MP6L 3VD9A 1EHNA 2VLKD 3ZE0F 1QFPA 4YNYB 4U1SB 2FWOA 4XGZB 5ITBH 3LEXB 3PQYB 4WWKA 1D5BB 3HNVL 4M02A 4NP4H 4L4TB 1DEDA 2N1KA 4PRDA 4LFHG 4F9LC 1I85A 5IT2L 3IVKA 2L4OA 4PS4H 1DQJA 1T20B 5EUOE 4OLXL 4JRXE 4P23D 3INUH 1HXMB 3UO1L 5L0QB 2J4WH 3QT2A 4HKZA 5KSBA 3RWCA 2JCCA 1M05B 4ZQKA 4ZOCA 1TPXB 3BW9B 2O5XH 1UWEH 2W38A 5IB2A 1TTFA 2EO9A 3O3BA 5F96H 2BSSB 3DV4B 1BFOA 1CGSH 3C9NA 3OXSA 2EDJA 5C0BE 3D0LA 1AD9A 1KNOA 4ZUWA 3LPFA 2DQFB 5D6DC 5LQBL 1S5HA 3LPWA 5F7EH 3EYSH 3ZDZF 4XPGH 3QIBB 4NKDA 4OFDA 4LKXB 4MMZC 1RURL 3BN9D 1P6AB 1QKZL 2BZDA 3SQOH 1OARL 2A9NH 3CFCH 1IQWH 1OD7A 4HW6A 4GQPH 3V6BR 5KSBF 3PABA 3MLZH 4NHUA 3VG0L 3HPLA 1QSFA 4F7CB 4TUOB 3BYYA 2COQA 1J1PH 1WAAF 4FQ1L 1S9VB 3HCVB 3TBWB 1KLUB 3P77B 5EDXA 4MJ4A 1B6UA 4U2YA 3PV7A 4BQ8A 2NY6D 4EDWH 4FFZH 3BEVB 4MDIB 3KYNA 4DN3L 1HK6A 1IGTA 3V0WH 4U31A 1UXSB 5L6YL 4WW1A 1W0WA 4GKOA 4XP6H 4ZFOB 3BSZL 1N7ML 3ZDYE 3KXFA 5C3LD 5SWZE 1B0RA 1D3CA 4HZLA 4M93C 5J8OA 5E8EB 1G7JA 3VE0A 3CSYA 1OAYL 1DQLL 1X5HA 2Z31C 3TBSB 5FGRA 4P46A 2AXFA 3ARBC 3EHBD 4YHLH 5DQ9B 3QPQD 1DLHB 1TZHA 3FHAA 4LL9A 3VMOA 3P0VH 1IGCL 2IALB 2F8OA 3SE4A 3FFCB 3QIWB 3MLUL 3WFDH 1MVUB 3S34L 1CR9L 5E6IC 4RRPA 4Z7UF 4H1LB 2AJXH 2YA2A 2YUVA 3ARQA 1P7QD 4UDUA 3VDAA 4FQXD 5C9JA 3T0EC 1FAIH 3WLWC 3QUZD 5CGYD 4IJ3C 1J1OL 5EC1B 2PO6A 1RFDH 5BQ7B 2FATH 4IIQB 4GKSA 5E2JA 1FFRA 1RZ7L 1T22B 3QDHA 3BYTA 3ZT5A 1HXMA 5DEFA 5FYKH 1F6LL 1NAML 4NQTA 1SYSB 4TSBH 5J3HD 2GK0B 3KJ6L 1DBKL 3MJGX 1SM3L 2HLAA 1NH6A 3MRHA 4O9HH 5DK0B 1JNNH 4JHAH 4LKCA 5JR1L 2A0LD 3H3BC 3CZFA 4U1JB 5I30L 5ESAA 1QLEL 4M6MH 3L3JB 2OLDA 4R3SB 4XC1H 3C6SA 4HIHA 2CKBA 3BIKB 5LWYL 5GS1B 1VGKA 5IFHL 4AEHL 2LV4A 1M4KA 3DSFL 3C87A 1XF5A 3T1WA 1U8OB 4XNQA 4GAYA 3FRUA 3MGTA 4TULH 1IEBA 4XCFH 3O2VL 1QQDA 5GJTH 4OD2A 1KOAA 1GOGA 1LQSR 1MRCH 3BHBB 3MRFB 2QBWA 1R24B 1F4HA 2K1MA 5EIIB 1D7FA 2X5PA 4X5XA 5LWYH 1AGCB 2X4RA 3W81A 1LVEA 3FFCD 2WM0A 5IFJB 3WKNA 4PJBB 1ZEAH 2YMXH 5AYUH 1T7YA 3HMXA 1HINL 3W9DA 4FTVA 1FZKA 4ZS6C 3C5SB 4HF5L 2WINA 1T4KA 1P4IL 1Q9KA 3EYUH 4U1LA 3TPKA 2LU3A 1HZHL 4QLRA 1AD0A 5HSFA 2QSQA 1NBQA 3QUZB 5IIEA 2X1QA 5C09A 5F3BA 2R2EB 2VLLA 4LLWB 3O6FA 4ZAKD 3BN3B 5JOFA 2KH2B 4WV1C 2NX5A 1FO0H 4OLYH 3TJEH 5KS9A 1QYGL 4M1GL 5L7XL 3BZEB 4CDHA 1B2WL 3ARGA 1HILA 2ZOKA 1VHPA 3EO0B 3BO8B 2BHZA 3BKCH 4KTEH 1GSMA 4UV4L 2A1WL 4UV4H 1OGAD 3OKEA 2DL9A 4RNRA 2GY7B 3AS2A 1LO4H 5DA4A 1CG9A 2F5AL 4TTGA 3T4AB 4U1MA 1CFSB 1UWXH 4AEFA 4WUUB 2XTJD 3A67L 4LNRB 3RHWF 5CJ5A 3S3PA 3VXMB 5FDWA 2BJMH 1R3IL 1GGIL 3D9AH 2HT2C 4Z78B 5FHAL 2Q76A 1OL0A 2IC2A 3GMQB 3LN4A 1A1OB 1A7BA 1GXEA 4ZO7A 2VQTA 2IG2L 2VIRA 1JFQH 2HKHH 4WHYH 5A16B 5CBEA 3QULB 3QXDA 3MRRA 4NCDA 3NGBC 4CVZA 3I6KA 1RUQL 3SDAC 2ED8A 3OKMA 4NYLA 3SDYL 4LVOC 3RVWC 3BUYA 3DETC 3SDYH 4OM1L 1CL7I 4CMMA 5B8CB 5C0EB 4PJIA 1NGWA 2DDQL 3MXWH 3T09A 1AGBA 1Q9OB 3JZ7A 2BHYA 1NKOA 1XMWA 4XNUH 4FXKA 2FO4A 1LP9A 2Q8BL 4WUKL 5FIEA 5I0ZA 3V4VH 4ODWB 4HJGB 4JPVL 1ODAA 3SKMB 3QRGL 3ILPA 3CFKB 4MD4B 3GSUA 4RDQG 4OZGB 4LQFH 3EJYC 5JXEA 4QHMB 4H1LG 5ACLA 3E8UL 1PQZA 3N1QC 4KJPD 4K3JL 1I7TB 4PJ5A 3LN9A 4LPVA 1G6RH 4H25A 3MRJB 1N8ZA 4PTUA 2I27N 4G9DB 2VR5A 4NJAH 4JFOA 3ARED 5FHBL 3O6LL 4Y89A 1A3LH 1DQTA 1Q9WB 2GJ6A 4H20L 4PJDB 4Y5XA 4GG8B 4AK1A 6FABH 3HG1D 2J6EA 5I66A 5IWLA 3FHQA 2XA3A 2N7BA 2QADB 1RIUH 4LARL 1CFNB 2Y9RT 4PJEE 5EC2B 5IQ7H 2A6IA 1ZGLP 3G04B 1FFOA 3LKNA 2DKSA 4HS3A 4M6NL 4OFYD 4W6XB 4YFEA 3L95B 4KUZH 4YDVA 1BREA 3GK8L 1W72H 3QFJD 5E5RB 2CMRH 3WYRA 3TIEB 5IESL 5T3ZE 5HDQL 3IJHB 3LKQA 1YNKH 1G9NL 1GIGH 3IFOB 4S1QL 4POZD 1G7QB 5F7MC 4JFDB 1XH3B 3TBTA 1B4RA 3V0VB 5D1ZA 2XN9A 1OTTD 5F1NA 1OW0C 5I1IH 3RL2B 4KKCC 3C8KA 4QOKB 1QACA 3TA3D 1CLZL 3QDME 3ZKND 3PIQB 2C4XA 5DR5L 2Z8SA 4ZXBA 1JHTB 3DX7B 1XF2B 3CX2A 3NFPA 1E28A 2DQJL 4NKQB 2HMIC 4KU1A 3FZUD 1JHLH 3MUJA 3RWGA 3SDAA 2P4AB 4JRYA 2ZUQB 4WW2C 2WP3O 1RHHB 3OGCA 2VUYA 1IFHH 3QFDB 5GGSB 2X09A 4KKNA 2Z8RA 2VL5B 2I9LB 4PJGB 5BW7A 5D9SB 1HYSC 1UH2A 2XG4A 1UCBH 2L7UA 3FOMA 2KZWA 2J5LB 4RWHA 5E1AA 2XXMB 4EQ3A 1U42A 5IMLB 1VENA 2Q7NA 2CMRL 4OGZA 4JJ5B 3D5OF 2W60B 1NEZG 4RCAA 5FGBA 3LN5B 4P2OB 1DFBL 1N6QL 3IGAB 2BVUA 4KKLC 1DDHB 1KENL 3RBGA 3GSWA 4JFDD 3ULSA 2VDLH 4YZFE 4R7NA 2UVFA 3SE9H 1TVDA 1RIUL 4YGVB 3MXVH 5CP7B 1BQLH 1JPTH 4A6YH 1SJHA 1N59B 2BVTA 1K8IA 1AXTL 4Y4HB 4FZEH 5HHME 4QWWD 2V9TA 3ZTJH 1L6ZA 3NGBB 2GJ6D 4D9QD 4U7KA 1RZJL 5KVDL 4Q9RH 4LRNL 2B5IC 5D7JC 3RPIB 1MFDH 4M7ZB 3LRSA 4WY7L 1DQLH 5F89B 3SPVA 4PGBA 5HHOA 1PKQE 3D39D 5JHDD 3TFKD 3MBEB 4RIRB 1CDIA 1F00I 2BDNL 2AV1B 4OGXL 4OT1L 3OQ3B 2P5WD 4KQ3H 4B5EA 2EYTB 3X13A 4JN2A 3OHXA 1VFBB 4DEPC 5AEAA 3ZE2E 1H3WM 4XP4H 3RBSA 4X5LA 2VDLL 2BOCA 1NGWB 3ZYOA 2BMKA 4PRIB 4P2YA 4EDWL 3WFEH 5ID1B 3FFDA 3UBXB 5IHLB 2P5EB 3EW3B 1R5VA 4M7LL 5F1KC 4EN3A 1CE6A 5AD0A 1A1NB 3BN9C 4F9PC 5EPMB 5H2BB 4LSSH 4HS8L 1RIHL 5D5ME 3V7AE 4JM2A 1OAXH 1PG7W 1KPUB 5D1QB 3WS3A 2DKMA 1QSEA 1GAFL 3QG7H 4Z8FH 1LE5A 3G5XA 2VXUH 2UWEF 4JRYD 5C8JA 1ED3A 4Z76A 2R0WL 4PRHB 5DI8A 4HS6B 3UJJL 2R0LH 1G7LB 1AP2B 4W4NA 3HZMB 3RWHB 4LDEB 3TV3H 1P2CA 3ARFB 4KRPC 3VWKB 4ONHA 3SGKC 1T5WA 1WWCA 2PO6C 4P3DA 3JSSA 3T0EA 4NNYA 3VFVA 5DJ6B 4AY0A 1M7XA 1I7UB 5CEXA 1EAPB 3GBNL 3B4NA 1MJUL 5CGTA 1OLZA 5TQ0H 3FMGH 5CIPB 1E4WL 2Z31D 2R23B 3VWJB 1LNUA 2ESVB 3NABL 3F12B 4JQXC 2FECI 1DQQA 2YPLD 2CUHA 4HHAA 3U1SH 4LSQL 4PJ9B 1B4JL 4XXDB 4LLWA 4ALAL 3LSOB 3QCUH 1CICC 2FB4L 4ODTH 5DJDB 3C5SA 5CKGA 3MNWA 2HJFA 4F2MB 1PG7X 2CR6A 2HFEA 2FECL 2VAAB 1QFUL 3NFNB 4P9HH 5GIRA 1IGFH 4YPGA 5T3XE 1FJ1A 4GMTL 4FQXC 2A6KB 3EOTL 3T0ED 3OAYH 35C8L 4TRPL 3RNKB 1BZ7A 1P1ZA 3S36H 3OKNB 2LU7A 1NGPH 1UZ8A 1F90L 1IEBB 1A5FH 1JN6B 4QF1B 3SJVA 5INDB 1CFTA 3G6JF 2CKBB 3BIKA 4HIHB 5C0RL 2VDOH 1ZLUK 2A0LC 3KR3L 1T6VN 1HIMH 1TCMA 1YNTA 4I2XE 1NC2D 3LEYL 4GO6B 1BLNB 5TE6L 5FDYA 5IEHA 5EU4B 3SE8H 5H94A 4JJ5A 1ORQA 1SEQH 4XWOC 1PY4A 5ETUB 5HGDA 4QRTB 3MLXH 3JWDC 4Z5RA 3FT2A 3GIZL 1LO3H 2GTZB 4PLNC 4YO0B 1W2KT 3DX6A 4OQTH 5EU5A 5I71C 5HHOE 4F3FA 5KW9L 4RGND 1GGBL 5HYJE 1YPZE 2NQCA 4LCCA 3EO1B 4FFVD 4L3ED 5LAXA 5EO0A 1S7UB 2K3TA 4NO3A 1NBYA 2IPUG 3OV6A 3BGMB 3PWPE 3S34H 3D39A 2Y5EA 5HHOD 3PP3H 2E9JA 3MRMA 5EB9A 3FB5A 1Y0LA 2FX9H 2ICWI 3CMOH 3HC4H 4LPWA 5DK2A 2BNQB 4IIQC 4NQVB 2JB6B 3CJJA 1Y6MR 4QXGL 5D8JH 1SY6H 5F21B 4TVPE 4OAWA 3QJHA 4O51B 3VXSA 3C2SA 5T5FH 4NGHH 4JO4L 1RVFH 3WEXB 4MNQA 5DMYA 1KCVL 3WN5B 3TVMC 2AJSH 2EYRB 2FO4B 3DUUB 4YX2H 3QEQE 3ARGD 1I1AB 3EGSA 3N1PC 1FNGA 1EGJL 2DQDL 3V6ZA 1OAKH 1A5FL 3WD5H 4BKLA 4FQHA 4KROB 4Q9QL 3HCVA 1LO0H 2V9RA 3ETBF 4OF0A 5C9KA 2D0FA 1YEDB 4YDJB 5EFIB 3FN9A 2NW3B 4PR5A 4LCCC 1WBYA 2ARWA 3T0EE 5IP4A 3NN8A 4JY4A 4LSPL 1UH4A 4PJCB 4JFOB 2YN3A 2IBBA 3SDAD 1N5AA 2V2XA 4X6EA 4LIQH 1KIQA 1RURH 4JO3L 1GHFL 1UC6A 3SDDA 3I50H 5EUOF 3IDUA 1I9EA 3ORJA 1G0YR 2PYFB 3IETB 3QRFM 2H1PL 4M5YH 4RFOL 1K2DB 4MJ5A 4XC1L 4Z0BL 2C3XA 1U8QA 2DM3A 4AEIH 3JWDL 4U1MB 5I2IB 1QVOA 4MA8H 3S36X 3VFUB 5E2UL 5E9DE 3NAAL 4ZD3H 4NZTH 1C5BL 4HWBH 3EJYD 2B0SH 1X9QA 4X6DF 4XRCB 4HKZB 4EN3D 5KSBB 1IAOB 4PJEF 3X17A 3EO0A 2EE6A 1J86A 2YSSA 4WENB 5FYJU 5CS7A 3V5HA 3U0PA 1VFAB 4YR6A 5D7JA 3NCJH 1A1MA 2YD1A 5HDQH 4JAMA 3V2AR 1ZTXL 4OGAC 3BP5A 4RFEB 5IIEB 3GDBA 5KOMC 5HI3C 2G5BB 2V2WB 4FQXA 2FSEB 2VN4A 2FR4B 2J8HA 4GW1A 4OJFL 2I9TA 1A4KB 2ZKHL 4LHJB 1KCVH 5IMMB 4LGPB 4LLUA 4P9ML 5JR1H 1CF8H 2IPUK 4ZUVA 5DD3H 5B39B 1MIML 1FVCA 4NJAL 3HAEB 3CPLA 5ALBH 4B7IA 5GRZA 4MNHB 5CEZL 3C5ZA 2F53A 1XCQB 1IZKA 4DJMA 4HCRA 5SWSB 4FZEL 5AG8A 5CEZD 3K80A 2DL2A 1S7XA 1MNUL 1P5VA 2WQRA 2C1OB 5BW7C 4NQSB 1G7MB 1IEAA 3LS4L 1KTLB 2B0SL 2D4DA 1FNSH 4AEEA 1MI5D 3QR2A 1F3DH 5HVFB 1T21A 1D9KA 4WI3A 4OT1H 5T3ZH 3B2VL 4WW2A 2VJXA 5HJ3A 4WFHE 1N7MH 4M62H 2DICA 4OCRH 5C09B 5F3BB 5K9KB 4K3HA 3ILQD 4ZFOL 4QYOA 4M5YL 4PJAE 3GMNA 1JI2A 2OSLB 3LV3B 1RZ8A 3MLSH 2ADIA 4GBXA 3NCBB 3VXQB 4ZUSA 1NCUA 2V9QA 4QXUH 5E00A 1DR9A 2P46B 5A40E 3WFZA 4U4BA 2D7OA 4OB5H 1KEML 1IGJA 3ME0A 4UUJB 3ZL4H 1Z5LB 2IG2H 5JOPD 4XHJD 5HHNB 1YEFL 3T3PF 3QFDA 2XT1B 1OF2A 2GI7A 3BP7A 4NKIH 25C8L 3F65A 4M48H 2Q86A 1IKNC 3IU4L 3QSKB 1Q94A 5CCKH 2UWEB 3H0TA 2BJML 5A2KH 5ITFA 3MV7D 3V4UL 5ESAB 1M7DA 3FOLA 4G7VL 4LDOB 4X4ME 4YK4B 3CFEA 2ITCB 4JO2H 3C8KB 1R3JA 4QOKA 5CFHA 3N85L 3ULUF 4QWWC 2ILLA 3N50A 4OLYL 3TJEL 3U2SB 5DEGB 2GAZB 4KI5F 2XPGB 3MSPA 2BY3A 5D72H 4ZFOA 1TFHA 4ZOEA 1OSZA 1KCUH 3CLEL 1KCUL 4WDIB 5D7SL 2KDGA 4P23A 4YDKL 5J0BA 4MDIA 2NY4C 3L95A 1XF4B 4JKLA 2EZ0D 4APQD 4K94L 4HMEA 5E8DH 1OPGL 5HVHB 1ZT4B 5FCSH 1G0XA 1Q9LA 1PJ9A 3HPLB 1Y6NR 4HWEL 5E6ZA 2IMNA 5TFSL 1LO5B 1IAIH 2R8SL 4HCRL 1F5WA 1NMCB 3RU8H 4UI2A 1KPVB 4HIIB 2MQCA 2XTJE 2HKFL 3IU4H 4ORZC 4RMSA 1NCWL 4Y2DB 4K3JH 3G5ZB 3MV9B 4OGYH 1EMTH 5TDOB 4CVXA 4DOHE 3FRPA 4YFLI 1ZHLB 1IILE 2VLME 5CJQL 4P2RA 4MXWH 3H8NA 5D5MF 2EKJA 5A43C 4M8QB 4E41E 2VXVL 1KYOJ 1RMFH 1I3GL 3N9GL 1BWMA 3WNPA 5CUSL 1IGIL 5C0DB 2X1XR 3RVUC 1AGDA 4RWYL 2V5MA 3G5VB 5DLML 5IMOA 3U7YL 5D7LD 4JFFD 2X4QA 1QOKA 3SN6N 2DQUH 3RWCB 5C0NC 1VFMA 5J7CC 1E0OB 1TVBA 4M3KB 4MLIA 5E8PB 4PUBL 4TUOA 3TNNA 4XP9H 1UG9A 4Y16D 4KV5F 4EI5D 3GRWL 4G43A 1I8MB 4XPAL 3S37L 3LKOA 2VWEE 2R2BA 1YUHA 1MELA 1QRKA 3CC5A 2XNAA 2V2TA 4X4XB 5A2LH 5IHZA 5IB1B 4RZCB 4FP8H 5JXAL 5D7SH 5M7QA 5ANME 1AY1H 2BSTB 4X80L 2HH0L 1FL3B 2B1HH 5IGXH 4UUJA 2FHBA 4Y1AD 1TZGL 2VR9A 5F6HI 4QHKI 3BW9A 5EOCL 3VH8A 3DVFA 4S0TD 3ALXA 3PWVB 3OAZH 2I5YH 3KXFD 2R1YB 5KAQG 1YEHH 3MLVH 1FORH 2P7TA 3QEUB 4Y4HC 3WIFB 3QEHA 4ELMA 3TF7C 5E08H 1KELL 1UB5B 4OZ4B 5DMIH 5HYJA 4KC3B 1AIFA 4PLKD 4QRPB 3HHRB 4G9FA 3IVKB 5C0GB 3L9RB 3GI9L 1CIUA 2ATPA 1LP9E 3PWPA 4HIEA 3BXNB 3QBTB 2VDKH 2L7JA 5I1EH 4FQCH 2C1OA 3Q3GA 2CDEA 4CNIB 2FH6A 2FJHA 4IEFB 1ZT1B 4ZFGH 3HZVB 4UDTA 4XB8A 1IM3B 5LCVL 5L8JB 3WL9A 2J4WL 4IHOB 1Q38A 4ODTL 3N06B 4V1DB 2VDKL 1FLRL 3DHMA 3IJYB 4PP2A 5EBLA 2SEBB 4NOBA 1CZ8H 4HXAL 1OAQL 3U1SL 3ZTNL 4EVNB 1S9XB 5CINL 4KMLB 3IDYB 4RGNC 4F7EB 2PYED 3FB7A 3LCYA 1EEYB 4FFVC 5EOQH 1YEJH 3U30C 1KF9B 4K71C 5D1QC 1C5CL 1Z5LA 1C5CH 2IAMC 3QZWA 1AKJA 3ZHDA 1NGYA 4PREB 1G9NH 1GIGL 4S1QH 3JV4B 4ZFZB 2HTKC 5F8RC 3UYRH 3SE4C 4CN1A 4ELMF 3SOBL 1NQBA 3KPRB 1KTDB 3IF1B 5DUPL 2R0WH 2HT4C 5I74C 2DD8L 3WDJA 5DJXA 4OZIA 5DJXB 5HTSA 4LLVA 4H88H 4F7TB 2CH8A 4N68A 3O8XB 4P4RA 3W39B 2FGWL 3M17B 2EC8A 4O02H 4YXHH 2LVEA 1C1EH 1FGNH 3QDMA 3OXRA 4WWKD 3MLWH 2VXQL 4ZO6A 5DUML 3MLWL 4YHPB 3ARGC 2HG5B 3I6GB 3KPOA 2J3SA 4PJ9C 4WV1A 5F8QC 3HMWH 4MB4A 2H32H 3FO2B 3OAZK 4QHKJ 5IFAL 1E4KA 1YMMB 2FBJL 1VADB 1MCWM 4M9OA 4LOUC 1OP3H 4ZO9A 4NUJB 4UT6H 2LQRA 5BZWB 5HHNA 2D7PA 1IC1A 4NZTL 2OTUB 4U1KB 2DQHH 4NM4H 2PETA 4HZLB 1PZ5B 5IVNA 5DD0L 4DKFL 2IWGA 3DHJA 4N8CL 3KHQA 1ZANH 4HS8H 2JK5A 4NKMA 2Z91B 2PCPA 3OPZH 1AXSB 2H32B 5FFLA 3NPSC 4Y4FD 5C0DA 4WHTA 5HPMA 4MA7L 4ODUB 3O3UN 5HYFA 1D9KB 4V2CB 4KUCD 5MEPB 2EEBA 2OZ4H 1JBJA 3PNWA 5IVXB 4Y2OA 1IEAB 3QQ3B 2QKIA 1WIOA 1KB9J 1OARH 4QRQA 2R1XB 4HULB 3H7LA 1IT9L 3QJFA 3AXLA 2GKIA 3BSZH 5TGBB 2OS7A 4U1HA 4X8JA 5AWNH 3ET9F 1RZGA 3X3GH 4KVCL 3MR9B 1CFVH 5DRNA 4WTXA 3TP4A 3VD3A 3X3FL 2CSPA 5ADOL 4PGCB 4YX2L 4KRLB 1JF6A 1NGZA 4X6CB 2BSTA 4YC2C 4ZUVB 3I02B 5I71B 5EA0L 5DSCA 2O5XL 4PJXF 4Z77B 3I85A 3DURB 5E6IA 3MLZL 3P9WB 2V2TB 4PJAA 4YO0A 2BCKA 1GJIA 1IMHC 4YIQB 4LLDB 4ZDHB 1OLLA 3UTZA 5ESVA 2NY7H 3U36B 4MAUL 4PR5B 2IANE 3SKOA 5FB8A 2R0KH 4PB9L 3KHOA 4EUPH 1XIWA 4NC1E 5E9DD 2VYRE 1MCKA 4G9FD 3MJ6A 4X9GA 1F42A 1CYGA 3NCMA 3OX8A 5T1KD 2Y36H 4LCIL 1R5WB 4EOWL 4GSDL 4HPOH 1XZ0A 4L8BA 4G6AD 3EYUL 3ZYJA 4MQTB 2X4QB 4DWHA 2EYRA 3CZJA 3F7PC 1GGBH 3AY4C 4NNPH 4J3SA 2YWZA 1X7QA 1YY8A 3A6OA 3SJVB 4XC3H 5D2NC 4PJIE 4Y5VA 2DLGA 4TPRL 4K7PL 4TSAH 3P4OA 3PG2A 3DROB 3MUZ1 1BVKA 3F58H 2IBZX 1W72L 4J7RA 1LHZA 4OZIE 3HB3C 3W0WB 4I3RH 1LD9A 4URTB 3VWKD 5HHXH 4C56B 4HIIA 5I1HH 43C9B 4AL8H 2VLJA 3T04D 5B3JF 2X9YA 3AM8A 3JWOH 4D2NA 4PJ5E 4O9HL 3H3PH 3ES6B 2H9GA 2JB5H 3MLTB 3TYFA 3LSOA 4NM8L 4PJEB 4FQHB 2YPLB 3D48R 1HHKB 1PD6A 4KVNH 2DOCA 5HGHA 3MLPA 1V3MA 5GGTH 3WV0A 1MIMH 1WFNA 4Z7VE 1JTOA 2JJWA 1YN6A 1D6VH 2X4UA 4H26A 1G6RA 2GCYA 4GAJH 4L8SA 2Q8BH 1J0YA 5DD1H 3BMVA 5F7KC 2D7MA 1JTPA 4JFDE 2VLJD 3U7AA 1J87A 4RBPK 4ORGB 2VITB 3VWKA 5KANI 1I75A 3MACL 5JA8B 3C6LA 4AL8L 3ULVF 1IC4L 1LEKB 1HQ4B 1DBJH 4LVEA 5DI8B 5FKAB 3TO2A 5ISZB 2NY4D 5J12C 1JRHH 3NACH 5EN2A 3DUSB 3EFFB 2O5ZH 3QNYA 4TUKL 1KJ2B 2MFNA 1NBYB 4PJ8D 3B9KA 4L4VE 1J0JA 1MFCH 4JM4L 1HCFX 5TPWL 1D5MB 2VXSH 4EN3B 3MJ9H 1CU4H 2R2HB 5E4IA 3VXQA 1CGTA 2B5IB 5D7JB 4NN7B 4P0DA 4XWGL 3V4UH 1MWAA 2Q8AL 2DJSA 4XCEB 1F2QA 2EDTA 4U0RB 2PW2A 2FGZA 3C60D 3WKMH 2HWZL 5BMFH 1OGTA 3P73B 4G3YH 4M1DH 4I3SH 5C07A 5I2IA 4OI9A 1OGAB 4Z7OF 1RZFL 5ILTH 1U8PB 3F7RA 1JNJA 4ZMAT 3RPIA 4XBGB 4G7VH 1GOFA 2EEDA 1CFTB 1FL5B 3FONA 1ZHKB 3GMPB 3QUKA 4P3CL 4BK5A 2BHUA 3VWJC 4TSBL 4M1GH 4IJ3B 1EHAA 5T3XD 1P4LA 2JJUA 3O9WC 1FFNA 2GJJA 4LVHC 4EI5C 1N2RA 1MJJB 1ZWIB 2NLJA 4HIXL 1FVCB 1ADQL 1RQ5A 4PJ7E 4XWGH 2RJMA 4F37F 2APWA 1SBBA 2H2PC 3V95A 1KULA 2XZCL 2QQKH 5DO2D 3QEQA 1SJVA 5JIKA 2OL3L 2X4SB 1WEJH 4WUKH 1ZLWH 5IUSA 2PW2B 5D1XB 1XGTA 3BKYL 2OMNA 2FR4A 1HDMB 5E1AB 3QQNA 3NIFE 2EH7H 2GFBB 1R3HB 2Y23A 3M1BA 2AJUL 4OUUB 4L5FH 4PRIE 4AG4L 3KDMB 2C1PB 2EICA 4K7FA 5D2NA 1EHXA 4PRBA 5BS0E 2DQCL 5DVOA 4IRSB 4ESKA 3L5XH 1TJGL 3I9GL 5JW5A 4HWZB 2Z35B 5DRZA 3BD4A 1T1ZA 1DFBH 1FYTA 3TBVA 2Y72A 4OF6A 1E28B 4OQ1A 1T5XB 2ZWLT 5ICZB 3K4ZA 4PLKC 1INQB 3TO2B 1MFAH 1FFPB 3CVHA 4L1DA 1CK0H 1DLFH 1CK0L 1EDQA 2VZUA 1ZHNA 2FD6H 4Z7WF 5K9QI 4AH2B 2I5YL 4MWFB 2J88L 1TQBB 1CD1A 3EOAB 3DX6B 5I6XB 4X4YA 3IFOA 1DTUA 4GRLC 5BV7B 5I8EB 3MRGB 4Z5RB 1AJ7H 5FF6A 1WIUA 2NR6C 5DUPH 1RJZB 5DUBB 2P5EA 2E6QA 1F90H 3ZYIA 2YK1H 3RFZC 1KC5H 4ZAKB 1NLDH 4U49A 4X98B 1IQDB 3JXAA 1HQRB 4HIJB 4S2SA 1JNLH 1JPGB 4HUKB 1HH9B 3SE9L 3GSQA 2IAMD 1BQHA 3H2WA 5JO5B 1KJMA 2NPLX 3VU2A 2G75A 2DMBA 3U9UA 4BJLA 3DX8A 4NQEA 1JN6A 1YA5A 3CXDL 4QF1A 3WEXA 1T89C 2VL5A 1A22B 3SKNB 3ARYA 3H9SA 5CKAA 1OAQH 4WI8A 5HYQB 3SY0A 4XVJH 4WVRA 2FB4H 2O61A 1QHOA 5DJ8A 1AXTH 5BS0D 1B0WA 1I1AC 1KPRB 1S7RB 1WWBX 2VLRB 4P2QA 3CFDB 1UB6B 3PIQA 5ILTL 3DXAE 4FOMA 2EXYD 1LEGB 4HC1L 1E4WH 5L9DH 2HYMA 4NZJA 1XZ0B 4HUVB 4PJ9D 2Y7QB 3TN0B 1J5OL 1MCQA 1UADC 4I4WB 5D2LE 4BSWA 5HXMA 1GH7A 3SDXB 1MI5B 5CBAB 3TT3H 2ZUTA 1G7QA 4WHCA 2LVCA 1HNGA 4UB0H 2OK0H 4LOUD 4OUUA 1PG7H 4LASL 1R3HA 4U6HB 1VSCA 4BSVB 4Y5VC 4WI4A 2P45B 3PWJA 3RZCB 3WUWG 1XGTB 2E8YA 3B9DA 4DUXA 2F54A 5CEXB 5CLWA 3QXTA 1H3UA 3VI4F 2ORBL 1EIBA 1QBAA 1Q8MA 2AEQH 3VGHA 2XQYG 1A7OL 4ELKA 2HFFA 2E27L 1YPZB 1CLCA 5I15H 4K3DL 2J1KA 5CZVH 4MLSA 4Y4FC 3VI3E 3MFFA 5JXAH 1AR1D 2YK1L 2WWKO 3GIZH 4OCXH 1OWWA 4FQ2L 3IU3A 1T1ZB 4PJFB 5AAWA 5JW4Q 3UCRA 1AHWC 2W9EL 3OZ9H 4W70A 5F96L 3D0VA 3O2WH 3RNKA 3LKSA 5DD0H 4DKFH 2C3VA 4CUCA 3FMGL 1HHGA 4NRXA 3T0AA 3QAZB 3ULVE 1V7MH 1XH3A 1QRNA 5EH1A 1H3PH 3VG9B 2X4TA 1A64A 4C83A 1RZ7H 5L2JB 2FJFB 3P11H 4UT6L 4UTBH 4I0KA 1CDHA 2ZSWA 5FO9B 4YHYC 1LO3L 4JY5H 5F9WB 2ZSVA 1YZZA 2N4IA 5FUCE 4NFCA 1DSFL 4RGNB 3UJJH 5L2KA 2H8PA 2APVA 2R15A 1A7NH 3W9DB 3HRZA 5F7FA 3MBXH 3CK0H 2VRAA 4LPYA 3EKCA 4ETQA 2HJKA 1IGMH 3DBXA 1QLFA 3L3DA 1NCDL 1LDPL 4DKDC 5C0BB 4M43L 3RWDA 2CXGA 1I8IA 1UM6L 1I3RA 2P8LA 4MNGA 4Y88A 2DQTL 1EPFA 1G7PA 4KK9D 1M1SA 1N6QH 3TH3T 5E8NA 4FS0A 4U1IB 4RAHA 3UBXI 1JZ2A 3B9AA 2GHWB 5ISZA 3WLBB 3LD8C 1JNHA 1MF2L 3O8XC 2BP3A 4U1JA 4YHPA 3ILPB 1HINH 5IEKB 2NY1B 1QBLH 2DYPA 3MA9L 1A6VL 3RZWA 4DVRH 3H9HB 4Y19A 4U3CA 5EOQL 1MH5B 4FMKA 3TNMB 5ACMA 3HKFA 1G9ML 2YHGA 3VGFA 3O8XA 3P3YA 2BVPB 1ZLVH 5T1KA 3BO8A 3JUYA 5C0AB 3T1FA 1EUTA 4J12A 3IJSB 1XGQA 3ROOA 3U0TB 1HHKA 3LKRA 3QPXH 1YYLL 1RUKL 5BZDA 4H1LH 2BNRB 5SV3A 3RAJH 2BRRH 1HEZB 3CXHJ 3ES6A 1NJ9B 1P7KB 3OG4B 4MS8C 3C5JA 4KMTL 4KMTH 3WUZA 4HG4J 5H35B 2R0ZH 4KHXH 2ID5A 5EA0H 4G8IB 3V5KA 1MFBH 5F1SA 5D96B 3TIDB 3G9VA 5KG9A 4Z78A 1KXQE 1AO7B 5ACZB 4LSSL 4YQXH 5JHLH 2A73A 1S78D 5FGBC 1TETH 4YQXL 2E6JA 5JHLL 3UC0H 4HDIB 1R0AL 1TTGA 3LMJL 5JIHA 5B38B 4I3GA 4CADA 4XCYB 5FOJA 3MCLH 4Y5VB 4HFWB 4JGUA 5EZLA 3LZFL 5SWSE 4ODBD 4NGHL 1RD6A 2FHFA 3B6SB 3DGGB 3H3PL 3IDMB 2G75B 2ZUSA 3Q3GB 2GSGA 2ICCA 3QWOB 1U3ZA 4LHQB 4R2GB 2BSRB 4U2ZA 4WHYG 5IBTL 1WV7T 3GSOB 3GBML 5TF1L 4L8BB 1YEGH 4OFPA 3RY5A 2OJEB 3HI1B 3VXRE 2P44B 3MLXL 3MRNA 4OLXH 5ALBL 3FB6B 5DFVD 4U6YB 4U1LB 3R8BB 2FX8H 1UEMA 3HAEH 4PJ8C 5F71A 4ZXBC 3TWCL 4DZ8A 2PO6B 2R9HC 4QRPD 4ACPA 1JPSH 2W9DL 5ENWB 4YIQA 1X5IA 2APBA 1PEWA 5J57B 1JZ5A 4DK3A 4PJBA 4KK6C 4I2XA 3X12B 3FQXB 4YUEL 1NAMH 3MROB 2CDFA 4K8RC 4HUXA 3QYCA 4GSDH 2Y07L 3WIIL 1MCWW 2VZ3A 5K9JH 3U83A 3UC0L 3BPCA 4XNQB 1INQA 3GBLA 1JPFB 4R96B 1U8OA 5DD5L 4HJ0C 4HQQL 3DMMA 5DD3L 1YUHB 2VLKB 4LMQI 1QSVA 1TLKA 3MACH 5DJZA 1MVFA 5E2UH 4BYHA 2Z35A 4HWZA 2EDHA 2ERJC 4KTEL 1Q9OA 3RDTA 4R2GD 1H5BC 2X4PB 4NQDB 2GK0A 4IMLA 3B2UD 4NZUH 2VZVA 4MNGE 2Z8WC 1NSNL 4PRAA 4S1SL 1ZTXH 1DVFD 4NHCH 4AMKH 3OSKA 5EZIL 4CVZB 3O41A 4P4KB 1QFWH 1INDL 5GGQL 3QDJD 3H3KA 4HF5H 2H2PD 4ZSOE 2E3VA 3BIAX 1UXWB 5GS0H 4CGTA 3MV8B 4WU5A 1TIUA 5DO2C 4PY7B 2BY0A 3IFPA 4R4BB 1WAAA 3OBAA 4AEIL 2DBJA 3IKCA 2JF1A 5KVGH 4HK3J 1ZHLA 3IS1X 3HNTH 5DHYB 4DN4H 4PJDA 4Q9QH 5B8CC 2HTLD 4CBPA 1JHLL 5DJAA 2H1PH 4KDTC 4M5ZH 4XNYL 4Y1AE 3MO1B 1JCKA 2OTPA 3OKDB 1J1PL 5HHPA 3EOBB 3G5YA 4ZPTA 1FNLA 3ALWA 3T4YA 4GKZB 2FEEL 3D3VB 3LOWA 3OKEB 1JGEA 1NDGB 1BFOB 4DN4L 1MQKH 4MAUH 5C08E 1RJYB 4KKBD 5CSZB 3DNKA 5J1TC 3DO3A 3DO7A 4PV8B 3SGEI 4KJQC 1R3LA 3KJ4B 1MCOL 2BXZA 1JGLL 4PBWD 4M1CD 4YFDB 5KS9B 1ONQA 3EYFB 1N4XH 1G7IA 5EZOH 4R0LB 4UQ3A 1E4XL 1ES0A 4LCWD 5CJOL 5DS8B 5IK3B 5A1AA 1RK0B 4NQXA 5TE4H 3ARPA 3U2SA 4LLYB 3OKMB 4PJXA 3TZVC 4R4NC 1D5MA 1J1XH 3CFEB 4P5TD 4GRLD 3A6BH 1A7RL 3SDCB 3X11A 1TNMA 1BQUA 3HG1A 4AG4H 1S8DB 3LN4B 4HXBH 1WVZA 4MB5A 2AEIT 1KCSL 2I07A 1J0ZA 1A3RL 3FN0H 3Q5TA 5BVJA 4YFLF 2EDEA 4JY6A 1KJ2L 2KQNA 2YC1A 3IYLW 5KTEH 5CMAB 3RTQD 1ORSA 2A77L 4PRPA 4J6RH 5LVEA 3MGOA 3QI9C 1MCDA 2K9UA 3MREB 2ADIB 3B83A 4PYGA 1JE6A 4GW5A 5J9PB 3QWQB 5GGTL 4FFWC 5B4MD 3O2WL 1XR9B 1QFOA 3CFIC 3PGFH 4AIZA 1NLBL 1HILB 5IW1B 1EXUB 1I1AD 4XP1H 4PUBH 1MCCA 2PXYB 5JOEA 1BHGA 4WEBH 1Z0MA 4TUJB 4LCWE 5CUSH 3C60B 1ZE3C 3ZLQC 1A3RH 3D85B 3MTRA 3DVNA 3WSQL 1JHKL 3MRIB 2ZG3A 3UROR 2VZOA 5IKCA 1A3QA 3QUYC 1LO4L 5DQJA 2AQ1A 4U1SA 4XGZA 2AXGB 2QSVA 2J5LC 3NCEB 1L0YA 5D1XC 4EVNA 2GSIB 4GQ9H 2CRMA 3NIFF 5T1LD 3UAJC 1EMTL 1UJ3C 2QQNL 3CSYB 3K46A 2KL6A 2GSIA 3RU8L 3BWUC 2EDLA 4QRRB 4U7MA 2I07B 1Q0XH 3HZVA 4UDTB 2LFGA 3QUML 5I19L 4YBHA 1WC7B 3CDCA 1U8LB 1J8HB 5TE7L 1N6UA 3T0DA 3TN0D 3MRIA 2KZ1B 4U6XA 4TNVF 1CD8A 3MA7B 2OTWB 4R7DA 4APQA 4OLWL 2RAMA 4HWNA 1AR1C 4FA8A 4KXZH 1AFVL 2XY1A 4M7ZC 5IW1A 5AZEL 3EYSL 5AZEH 5C0AA 3VGEA 3SGJA 3OG6B 3UPRB 2P7TB 1T7WA 1FE8H 5LGHH 2F8VA 4Z7UA 3HNVH 3MREA 4NP4L 2E27H 3WJLC 4UOW1 1P4BL 1NDMB 1BJMA 1WBZA 4KGLA 3P4LA 4MD5A 3DURA 3AGVA 1HXYA 4YEEA 2ZP0T 3GJFH 3GSNH 2QHLA 4PJHB 5CJOH 3NFSL 2AJYH 5J1AB 3FFCA 1A2YB 1K8DA 1KTKE 3TJHC 3G6AA 3QO0A 3UO1H 4GLRH 2Q7YB 2OR8A 4Y2DA 4Q0XH 4KZDL 4ZS7H 3FQXA 1MFAL 1P9MC 3TT3L 1GAFH 1BMGA 3CD4A 4U1HB 4PJCA 1I8IB 3QH3A 3X14B 2G5RA 3VDBA 3RWFB 3O3EB 3WIHL 1IGIH 4L9DA 1QFHA 1YEHL 1IGYB 2V17H 3BZ4A 3RX5A 5C1MB 1OAXL 3QXUA 1IC7L 4G3YL 1RV6X 4FXLA 4ODUA 4BKLB 2ZSVB 5F7WC 5HI4D 2H6PA 4L9LB 5FYJE 3RKDC 1W0WB 1U92B 4G42B 5MEOB 5DZOA 4ZUUA 4Y2DC 5F70A 5F9OH 4EQ2A 4Y4KD 4CU6A 4WDIA 4QHNA 5EOTB 4NCC1 3MZTA 3RUGA 2G60L 4S0SD 4PTTA 4KQ3L 4PJCF 4NHUB 3V8CA 3P4NB 3I9GH 4XBGA 3VFWA 3G6DL 4JRXB 2HFTA 4LSUL 1K4CB 3WNNA 1IZJA 2W9DH 4GJTB 3GJEA 4LKXA 4KK8D 1ZA3A 5ITFB 2DWDA 3IDNA 1F6FB 3V0WL 3LAFA 4Q9RL 2DQEH 4BH7B 3I75B 4LRNH 2AK4B 3QXVA 5JHDB 3REWA 1A21A 5KSUB 3QHZH 3EUUA 1Z9LA 4DGYL 1WSST 1WTGT 4H0GA 1YEIL 5DD5H 1T0NA 5DHVH 5GHWL 3KPNA 3F6IA 5T5NG 1CT8A 3O3AA 1UM4H 1IQWL 1WT5C 5C0RH 4OIIH 3PXJA 1NUGA 5FGSA 3WFBL 5JNYB 1BOYA 1I9RL 2DWEA 1FCGA 1MHHA 3KLDA 5F9OL 1UJ3A 3QO1A 1J18A 3SDXA 2OK0L 2AJVH 2WQ8A 1JV5A 4S1DD 5F72S 2X4PA 5C92A 2OMBA 1RI8A 2R0ZL 4FTVE 4OIBA 1T21B 1QR4A 4CDGC 5DLMH 1ZEAL 5D6CA 3MGAA 1YNTB 2W9EH 1KTLA 4BZYA 4BZ1L 3QUYA 4H88L 1IFHL 2VLRA 4P2QB 3DGGA 3IAPA 1B0GA 3MLYL 2NZIA 1CDCA 3KGRA 4E5XB 5D7KD 1RUKH 2YD6A 4DCQB 4L3AA 4CADB 4K3DH 2NXYC 4LSTH 4NN7C 2CXKA 4FNLL 1QLFB 3T77B 4G9FE 3DBXB 2LU4A 3MROA 4V1DA 2UZIH 5BV7L 1S7VB 3RKPA 4Q6YA 3DX8B 4QRUB 2IJ0C 3ZKSD 1YDPB 2DQHL 1JK8A 3GBNH 2R56H 2AXGA 5DQJB 3NZ8B 2HFEB 1HH9A 3CK0L 2VC2L 1ZAGA 2H8PB 4K8RD 4LLMB 3LV3A 2FLBT 5CILL 1KGCD 1OY3B 4F57L 1L9MA 3VXPB 2H41A 5EORL 1HEZA 4P57A 3VH8G 3O2VH 4QYOB 4NHCL 3L9RA 3LH2H 2CLRB 3WFBH 5J13C 1INDH 1DP0A 3FFCE 3P11L 4ZFFB 1PSKH 4JHWH 3CCHB 5FUCC 1JRHL 2ZCKL 3MJ9A 2VLJE 4NUGH 5HYJB 3IJSA 3IDYC 1MCSA 3KPSB 1FIEA 4XZUB 1EH9A 3BH8A 3GO1H 4I48B 1VERA 5I8CA 1KCKA 3WHXA 1XR9A 4XRCA 3HR5A 3AB0C 3IDMA 1EJOL 4NNYB 3VFVB 4Y1AA 1KJVB 5A3IC 4XP5H 1UJTA 3IU3B 3CVHH 4HLZH 3VXSD 4LPUA 1KT2A 4CJ0A 5KN5B 4LAQL 1HHIA 1CFVL 4FXGB 2BFVL 4XAWL 1BJ1H 4X7FC 2PYFA 4N8VG 4PJ5D 2ZOLB 5FM5O 3W0WD 5HVWA 4UT7L 2CLVB 5F6IC 3L5WB 3FQTA 1FL6B 1K4DA 4NRYB 4BUHA 3T0WA 5JXED 4LLUB 3TIDA 1T6WA 2FX9L 4TSAL 2DQGL 1KPUA 2YPVL 3EZ8A 5D1QA 3WS3B 4WTWA 3C2AH 3E6FB 3RUGE 3IDGB 4ZTOL 5D2LA 2FLRT 3QDAA 5DD6A 4AT6B 5BZDB 1CBVH 1CN4A 1CGXA 4MJIA 5MENA 3QA3A 4N8PA 2H45A 1R3IH 1ZLUH 3UBXA 4Y19E 4OZFG 2GFBA 1HHHA 1L7TH 1TJHL 4NRZA 4HEME 1OQOA 5HHMD 4HFUH 4WO4D 1WQVT 2B4CC 3ZT6A 2AABL 3KPTA 5D1XA 4BUGA 5IBTH 5TH2A 3JV5A 4DZBB 1HI6B 5CZVL 3D25B 1G7IB 1JFQL 1UB6A 2JJSA 4NNPL 1U2CA 4JHZA 2X6MA 2EDKA 4X7SH 3H6JA 4DN3H 1N2RB 5M95B 3VXSB 4XVTH 4YWGH 3D0VB 1NFDB 1FNFA 2CLZB 3RTQA 1I1FA 1YEKL 1KJ2H 1CD0A 1LEIB 2IQAB 1P53A 4R4ND 4Y4HA 4FG6C 4NQCA 4OZHF 3S7GA 5DUMH 4P5TC 5JO5A 4NOFA 5DHYA 2NY3B 3MYJA 3PQYD 5HGAB 4PJ7B 4XP5L 1P7HL 5EFIA 1J0KA 4NJ9H 1A6WL 2R2CA 1N64L 1QTYT 2N7AA 4OCSL 3P0VL 5FK9A 5I1HL 2BY2A 1HE7A 5TF0A 3RZCA 2HLFD 5F3HA 1JWUA 5TE4L 4J3WA 4MSWB 1QYGH 1GGYA 3Q48A 4U6HA 1RUML 1Q1JH 1A7PL 3U9PH 1F11B 2FX7L 1KIUA 1FZJA 3TN0A 3T2OA 1NAMB 3IXAA 4FFWD 1RZKC 5DURD 5AYUL 5E2VL 1RUMH 3EYVB 4PJFA 3D2UB 1XGUB 3FTGA 3U9PL 4MA7H 5ICZA 1FGVH 3D39E 3MFFB 4RX4A 1C08A 1CQKA 3UTTD 3EOYG 5FKAA 2XOTA 5KAQF 2OR7A 4KXZI 5BJTA 3EYVA 3L3HA 3TZVB 4D0CA 1KB5B 4O2CB 3T2QA 4POYA 3VXOA 2CDGB 5SWZA 3RGVD 5GRUL 1BQSA 5IJVB 1X5YA 4NQEB 4M93B 3AU1A 1NC2B 5D1XD 3WKML 4ODSH 4WO4A 5GIRB 1PLGL 3MUHL 1JGUL 4H26B 5FHBH 3QDGA 5L8LB 2KBGA 2APFA 1IGCH 5KVFH 1A6PA 4QTHA 4F8TA 1DLFL 4AQ1B 5K9KA 5EU4A 1BVZA 4WGWB 2FJGB 1S7SB 5HYSG 4RA0C 1IAIL 1P7QA 2VERN 5F6IB 4XBPA 3TN0C 4D9RE 3GSOA 1SJEB 1OW0A 2OM5A 5CIPA 1T3FB 4GW4A 4IDLA 4GMSH 1N5YH 4O4YL 5DC4B 3PGDA 4ZSOA 5KSAD 4HZAA 1TZIA 5DURB 4KHTL 1BX2B 5T1LB 4E42B 3BEWB 3QAZC 5CWSA 1FL5A 1ZHNB 3ESUF 3ZT7A 2X1OA 4HDIA 3C5ZB 3QIUD 4MNHA 2OBGA 3P4OB 2X4NA 3BISA 1BM3H 3Q6GH 3DTXB 2NW2A 5EG6C 1AO7A 3RDTC 1QSEE 1ED3B 1LP9B 2A74A 5GGUA 3UZQA 4Y5XC 2I9TB 1HKFA 1IQDA 4GW1B 5F7YC 3A6BL 5ECJE 1MLCB 4G6ML 2BNRA 1E6OL 2C1PA 4NSKA 3VFRA 1XIWB 3HC3L 4WUUE 2CUIA 1MIEH 5DXWA 2ESVA 3IDIA 3ZZ1A 4LLDA 5CLTA 3ULUH 4GRWE 1D6EB 1QSFD 2RR3A 3GSVB 2MMXA 1IL1B 3P0GB 1RZFH 2JJSC 4OV5B 4MCYB 3MOBH 3X13B 1I9IH 1MCHA 1I3GH 3ARDA 2QR0A 5E5MA 3BDYH 5HI4C 5FO7B 4JG1L 1IKFH 2Q8AH 3DTXA 5AUMB 4PGCA 3MODH 1HHIB 1F58L 2CUMA 4M8VA 2VLRD 4MJ6B 3G5XB 1A6ZB 1YECH 4HCRH 3CXDH 1UA6H 1I1RA 1E6OH 3AFLA 3UTSA 3FO1B 3D69A 1U8IA 4JM2B 2P47B 5HD8C 2JKXA 5HGBA 4HGWB 1T7ZA 1U8PA 2B8OT 4K7FB 4GOSA 3BZEA 5FO8B 1K9TA 2EDQA 3S96B 4KK8C 3VFNB 4ZFFA 3V0AC 5FYKE 5T5NF 3HRZB 1Q0YH 3HRPA 2NY2B 4YDKH 5J12B 2PXYD 4R4FH 1T03H 3BDYL 3AC0A 3MRLB 1RHFA 5K9QG 2DLIA 3MNZB 5GISL 2W1NA 5FA4B 3BESR 4JFXA 4PB0L 3QDJB 1FNHA 1CLZH 1YDPA 4MA1C 1LK3L 4FQJH 3O2DH 1Q0XL 4PJGA 1FBIH 4PJDE 3LKPB 3T77A 2J88H 3WIHA 3DMMD 2AV7B 2F15A 2YKLL 3V52L 4OD2B 1YNKL 1BEYH 5CWSB 5J89A 5T1LA 1F4XL 2C7UA 4E42A 1MIEL 4JY5L 5ISZD 3FONB 3QUKB 1JHTA 3DX7A 3PGDB 4MQSB 3RJQB 1XGUA 1W8OA 5CSBA 1X5AA 4K94C 3P4MB 5D2NE 1UCBL 4PG2A 4XP4L 1UEYA 4GUPB 1CXIA 1BFVL 2DM2A 2HVKA 4PRHE 4YHML 1QEWB 3MLRH 1C7SA 5IVXE 3RNQB 1N3NA 4FHBD 2CK2A 4P4RB 3THML 3W39A 4EI6A 3OR7A 4QOKE 5DDHB 1YC7A 1HSAB 3IXTA 5IMLA 4ONOA 5EC1A 1WCBA 4MHHG 4MSWA 5AG9A 4R8WL 2XWTA 1GGCL 3EBAA 3HN3A 4Y16B 5DT1H 4PRNB 3MLRL 1KFAH 5FK9B 5IR1B 4HV8A 5IJVA 5DWUH 3LEYH 3GHEL 2H9GB 4PV9A 3RX8A 5I66B 1MVUA 2JIXD 1CE1H 3MYZA 1NGZB 2MSPA 4IS6B 1TDQA 3VFSA 4CMHC 3TYGH 4KDWA 5DHVA 2OI9C 1T2QL 3NFPB 1U6AH 4JLRB 1UWGH 4QHLB 3WNLA 4Z7WB 3RHWK 2NY0D 2A6JA 2D31B 3V5DA 2EE3A 4HAFA 4BQ6A 1N8ZB 5F6HJ 2AJYL 4M7JH 2C7UB 1CXKA 4BELD 1N0XL 3LS5L 2WIIB 2AV7A 2NY1D 2XI9A 3GMOB 3UBXG 3P4NA 1DQDL 2XN9E 4ORGA 1FLRH 1IAIM 3E0GA 3BQUA 1NC4D 1RZKH 1BX2A 5LJYH 5EBMA 1IM3A 1CGVA 3WMSA 1AI1H 5A3ID 5F1NB 4NZRL 3HR6A 1AI1L 4JCLA 1F11A 4K8RL 5HPMB 3LQAH 2AJ3A 2Z93B 1GZPB 1AH1A 4JHWL 4NKMB 4Z7NF 5K9OA 2F54D 1F4WL 5JIIA 1WF5A 3HAEG 1AFVH 3HS0A 2X9WA 4OQTA 4PJIB 4QGYA 2HRPH 1IARB 4P46C 5LQBH 4R97B 2I25N 4OLVL 1C5DA 1INEL 1IAMA 2YPKB 4JQIL 5I18L 4XX1E 3S96A 3VA2C 1WZKA 1X6LA 5MENB 3IRPX 2VMFA 1KLGA 3RWEB 3RWFA 1SYVA 1D5IH 3W0WE 1D5XB 4X7SL 4Y19D 5TQ2H 3LVEA 1VADA 1MRCL 3R0NA 1KUMA 4N1EA 5EOCH 5DSCB 2Q76B 3KJ4C 1K3IA 1NMAH 1YMHA 3LIZL 4PJ5B 1KNOB 4ZUWB 2HG5A 3KPOB 4X6CA 4EXPX 4FABH 1EEUA 4QHMA 2AK4D 5T1DH 1DBMH 3PWUA 2VKXA 1T5XA 3EO9L 5IV2A 5EWIH 2A2QT 4I77L 1CBVL 3M17A 4NN6C 3VRJA 5DRZB 4P9MH 4MGXA 2VLKE 1MAJA 3GI9H 2QKIB 1MY5A 1P9MA 5FYKL 1J8HD 1AGBB 5I1LB 5I1CL 5I8CB 3HUJE 2ARJB 4Q9CA 2IBZY 3V6OE 5E56A 2P24B 3OJMB 1DVFA 1DSFH 4OIIL 4I0PA 5AWNL 3TO4B 5F93C 4NSKB 3O9WA 5DMKB 3U36A 4X9IA 4NNXA 2Z91A 5IMOB 1S7TA 2CO6B 3CSBA 4W81A 3QXDB 1AHWB 2LABA 5DJCA 3TBYB 4LAJH 1QP1A 1EEYA 5E7BA 4YBQC 1LDPH 3FB7B 2A74B 2GQHA 2RFXB 3QEQB 4LHUG 1KB9K 3F7YB 5EBWA 1U8HB 3PWNA 2VH5H 1NEZB 3EO9H 2HLFC 1SM3H 1P69B 2AAVA 4TTDD 4G6FB 1SY6L 5IW3A 4QGTA 1YN7B 5KS9F 2FH8A 4Y1AB 2AEQL 1ROWA 1U58B 1N59A 4JJHA 5DHXB 1OTUD 1T3FA 2ADJB 2AK1L 1QD0A 5F7DB 2AK1H 2CJUL 3BP6B 4PJIF 1PAMA 3JTTA 5DK0A 3MCLL 4QRPA 4CKVX 4LCUB 3GSXA 1G84A 1FVEA 1UM5H 2XFXB 4EKXA 1OGTB 4DK6A 1SQ2N 3S3JA 2QQLH 3BPNC 1Q1JL 1AXSA 3MFGB 4Y4FB 4G80B 3O45B 3F7VB 4O58L 1WJ3A 2EC9T 1U8NA 3S6CA 5F9DC 4YEFA 5DEGA 4KRNA 5ICXA 4KAQH 3PXHA 2VZ1A 1J12A 2OXGA 5B3NA 2DIAA 4QCIB 4G5ZH 3N85H 3OB0K 3SBWA 1QKZH 1EAJA 3KXFE 2CDGA 5SWZB 2MCG1 4JY6B 3RWGB 2B7DT 4M5ZL 5J6GB 3M8OH 4BH7A 2F74A 1RUPH 1NCCH 1F6AB 4X4XA 4XAWH 1OAKL 1OAUH 3KWWA 4OD1H 3FT4B 1SBSH 2FEDC 5TDNA 2XN9D 3OXRB 4XX1G 1EFXA 5E8EA 2W0FB 1KEMH 2FX7H 1LWRA 1ZT1A 3PDDA 2VQ1B 5E8PA 5L8KB 4KAQL 4FQLH 5IESH 1O5DT 5IK3A 4MZ3A 1ZSDB 3GO1L 2J8OA 3BRDA 3PWPB 3B8YA 3KPRA 4QO1A 1LE9B 3KPNB 4IRJB 1JWUB 3RDTD 3I50L 2OL3A 1ONQB 3C09C 1FFOB 3LKNB 4OCRL 2YD9A 3NVQA 1CU4L 1PZUB 3BZ4B 4OIAA 1CGYA 4I18A 1G7MA 1SMOA 4HKJA 4PJ7A 1MCLA 3VCLB 4WFFE 3S88H 2EDNA 5JPMB 3KYAA 5D70L 3L7FB 4TVPH 3ZYZA 4PJ8A 4YHNB 3D18B 4MMXC 5IBUG 4WEUD 4W68A 3MRKA 1QUNA 3DV6A 4L3CA 4H25B 3OKLB 3ULVD 5B39A 1YEFH 4L9LC 3W2DL 2YKLH 3T3ME 3V52H 3QXAA 4FZ8L 1S5IL 1JJUA 3O6ML 4RZCA 3C08H 3T2NH 1B0RB 3SKMA 3VMPA 1GYAA 4LRIC 4JZJB 2Z92B 1M05A 3IDJB 4LU5L 3H42L 1U8KA 3ZKMD 1I1CA 1U8MB 2DF3A 3GKWH 5I1DA 5F7HA 4LVHB 2R4RL 3CFJA 2EDFA 1KLUA 2OP4H 3EYQD 5B8CA 2YSSB 5D70H 5DMGD 4GG6A 4LSRL 4WI9A 3BPOC 3HE6C 4IRJD 3RDTB 1CCZA 2OL3H 5I1LA 1UWXK 4KJWD 5HD8D 2AKRB 2WLYA 1QRND 3VXNA 4TOYH 1J88A 4AT6A 5F97E 4P3WA 4IMKC 3NCYS 5A2JH 5D1ZC 2Z0BA 4L4TA 4W4OC 1PKQA 2MNUA 1FN4B 4ZOBA 4LSRH 1O7VA 3MUGB 3D2UD 2H2SC 3I02A 4JQVA 2FX8L 1ZVYA 3LY6A 1EEQA 5D72L 4LU5H 3DV6B 4L3CB 1GZQB 1Z9SA 3V6FA 4O4YH 4OCSH 3D3VD 1CXFA 4PJ8B 3NZHL 4KJYB 4YHNA 1AGEA 1OP5H 4X8JB 3VGAB 3MUY1 4G5ZL 5FEBA 3K1DA 4K2UL 4Y8DC 2YWYA 3MRPB 2R2BB 4YHMH 1SYVB 3VCLA 3M07A 4J2XA 1KJ3L 5CJQH 3O6LH 4XPFL 5KSVA 1PKOA 3BH8B 4XAKD 5GPRA 4KI5E 1JGDB 5HBBA 5IM7B 5DYOA 3R0MA 4EUPB 5HJ3B 5K9OB 3ZHKA 2Z93A 3QIBC 5D7IE 1ZSDA 2EH8L 4HWEH 1I1YA 4N0UE 4C59B 3NPZB 1KYOK 4ETYA 5BV7C 1U2HA 1HYRC 3MLVL 4PLJD 3QXAB 2E7LC 1ORSB 5JORB 3DXAA 4RGOL 4OSUL 3WSQH 2NNAA 3HAEA 4OGXH 1ZS8B 2P8PB 3G5ZA 5TDOA 2OP4L 1M71A 3LS5H 1XIWC 2K7QA 1ZT7B 5DJYB 2F74B 5JIPA 1NGQH 1B0GB 3BGFC 3HG1B 5GRWA 1A2YA 4G6KL 1OF2B 5JHDE 4IOSD 3REVB 5JA9A 1OT2A 1G9NC 3MXVL 5IR1A 3BP5B 3MRHB 5C7XH 3DWTA 5GS1C 2P48B 4IRJA 1GOHA 1VFAA 4MB3A 4NBZB 5DT1L 3WS6A 2AEWA 2J7LA 3RVVC 5LXGH 1RZJH 5KVDH 4Y4FA 4ZNCD 5I1CH 4DGIL 1TVHB 3T0BA 1MFEL 3RNQA 1DN0B 3ROLB 5IEHB 3TA3B 2YUZA 3MV7E 1FVEB 2XFXA 4J4PC 3THMH 2DQCH 1AE6H 1WZLA 2NTFB 3MV8D 4GKNA 2NXZC 3QZWB 1FV1B 3AMKA 4HKXA 4NCC2 4L3EB 1BZ9A 2D7TL 5BOPA 5ERWA 3UDWC 4OGYL 3VXUB 3BT2L 1S7XB 5I76B 5HHPB 4P46D 4NIKB 1YN7A 4Y5YC 5J6GA 1N6VA 1S8DA 2NY4B 4X6EB 4KZDH 4N0CC 5E03A 2P8LB 2SEBA 4LHUB 5GRJH 4YGAB 2C26A 1K4CA 2R69H 1O7SA 1U95A 3HUJA 3QEGL 3RI5F 4MXQC 4XCNA 4OD3L 4UV7L 1BIIB 5L2KE 5EBWB 4R4BA 1NFDF 3NFNA 4U33A 3F7YA 4JANA 2CKBH 4JFFB 1T1XA 3UTSE 1CVSC 1RZ8B 5DJDA 1B88A 1BECA 2B2XH 4QHNB 5EOTA 2ZSWB 5FO9A 3S4SA 2YBRA 4PGEA 4XNXL 1KG0A 4R0LA 1IRAY 4L5FL 1BBDH 1U92A 4G42A 4B7LA 5KBNC 4PJ9A 2EIZB 2PXYA 4N5EC 5DC0A 1DJSA 4ENED 4YAQB 5CEZE 4OLZL 1T89A 2WBKA 3KPPA 1T0MA 3DO7B 3UYPA 4O51A 2FIKA 1ADQA 1AXIB 4J4PA 4GW5B 1DQDH 1ADQH 3FAWA 5F9AC 4EJ1C 5IHBA 3SDCD 3K0WA 3X14A 5DQDH 5CSGA 3CUPA 2CQVA 4JVUA 2BNQA 4OCWL 2F53B 3OB8A 3RX7A 2FRGP 1XF1A 3ZDZE 1DUYB 3QO0B 5FM8A 1E27B 4JKWA 3IETA 4UB0L 3BGMA 3VI4E 4U1GB 3MOQA 5JMRA 4PY7A 4P5KA 4F3FB 4Z7UE 5IJKC 2YD7A 2W9LA 1W0VA 1AHWA 1BP3B 2G5BA 4P9HC 2B1HL 1PGRB 3TCLB 5IMKA 2UZYB 1G6VK 1YYLH 3LB6C 3TO4D 5J11B 3ZDXF 4G8EB 4U6TA 1EZVY 1T2QH 2GT9B 5B38G 1YEEH 4Y4KB 1WLHA 3NCYP 3BKML 4DFHA 3VFOA 3MRNB 2P5EE 4LFHD 1I9JH 2E7LA 1FNGB 1KBGL 4E41A 3GI8L 1S3KH 3S5LG 4WFED 2Y6SD 2X1WL 1U91B 3I2CL 4I18C 4P99A 1JPFA 1FYHB 4R96A 2X2YA 1MUJB 2NW2B 43CAA 4OCLC 5KW9H 4J8RB 1S3KL 4TSCL 2R0LL 3OKNA 1P1ZB 5SV4A 5C0JB 2WIIA 3OJDA 3UTPD 3QQ9C 2IFFH 3SKNA 1UGNA 1YPZF 3MOAH 1UM6H 2LAAA 3QIUA 3RVXD 4F80A 2Q6WA 1UH3A 5I1JH 5I30H 4PLOB 3NOIA 2YXMA 1RZKL 4HBQA 2F5AH 5FYLE 1WBYB 5KSAA 1KLFA 4TNWK 1FGNL 4LCCB 3MOAL 1TITA 4MA3A 4XNZB 4Q0XL 2DD8H 4HV8B 3LN5A 5D6DA 3CH1B 2RGSA 1RJZA 1EZVX 4QTHB 3HC4L 4UTBL 1NMBL 2C4FU 3OJVC 5J06A 4AJ0A 3KNBA 1NCNA 1NMAL 3FT2B 5CIPH 4L4VA 3DUUA 3SCMA 3VWJA 3T1FB 2FEDD 4JB9L 3DRTA 3MJ7B 1MWAL 4PRAB 1I8LA 1NFKA 4PJGE 3WN5C 3FL7A 1IGFL 2ZUWA 1CFQA 2I9LA 1S9KC 1BFSA 1U41A 4HFWA 3RP1A 3SBWC 1OAZL 2GUOA 1OP9A 2BDNH 4GMTH 2F54E 2AJXL 2ITCA 1MHEA 2DYPB 3OZ9L 4FMFA 1DANT 2BRRL 3FT3A 4HQQH 5FYLH 5BO1L 4DVBA 1A0QL 1KGCE 1FZOB 3G08B 4KK5D 4JDZB 4OKDA 3PL6B 4RDQF 4K3EH 1FYTB 2NY3D 2MHAA 4EDXA 3D39B 3LQAL 1MQ8A 3IXAB 5JW3L 3VFGH 1J0HA 5ELIA 4HPYL 3JVGC 3WBDA 5IG7A 4ZTOH 2OCFD 3BZDA 4JKKA 3FB8A 1UACL 3LHPL 4I2XB 3X12A 3PWPD 4JFXB 3QCVL 5C0CB 5FA4A 4I5BB 3S35X 4RMUA 4X0KA 5SX4I 3V79C 1HDMA 2BNUA 3X3GL 4EXKA 1OSPL 2J8UE 1EBPA 5HYJD 2ENSA 2J6EH 4UOJA 2OR9H 4UQ3B 3EZJB 3OHXB 3TYGL 4JRWA 4U3HA 4XXDA 4GUPA 3GSXB 3RZCD 1CLYL 4JM4H 3GB7B 5GHWH 1CLYH 1BD2B 3UZEA 3NTCH 2R23A 5HHOB 7CGTA 2ADJA 1UZ6E 5T33H 3DGCR 4IRZH 4NWTL 2EIDA 4QOKD 3ZKMC 2DIJA 3D3VA 1U58A 2WLZA 1TTUA 3UTTB 4PRHD 3OKOA 3K1KC 5GJSL 4P23C 1A0QH 4Z7VB 5DMGC 3KPMA 4XHQA 3NPSB 1I1FB 3HI6L 4QEGA 3FCTB 2CLZA 4LSQH 1DBBH 4I0PC 1XCQA 2V7HB 4K9EL 1W72A 4KJWC 4NQCD 2DBLH 4HMCA 1SJHB 3HZMA 3RWHA 3MV9D 3O11B 5EO9A 2JIXA 4L4TD 3ARDB 1G9MH 1QSEB 5E70A 4GAJL 3D25A 2MPAH 3QNXA 3D87B 4LNVA 5DJCB 1MNUH 2P42B 4FNLH 5FECA 1BJ8A 3KG5A 2BY1A 1HSBA 1IKNA 2ICWA 3QQ4B 4QRSB 2BERA 1JYNA 1U3YA 3AAZA 3VD7A 3MV8E 4XPBH 5CEZH 4X6DA 1QRNB 4Z6AT 3RPKA 2PR4H 4M03A 5HI5C 4OZIF 2VH5L 4BSWB 2DTML 5D7LA 3P2TA 5FA3A 3FQWB 1N26A 1L6XA 4GMSL 1N5YL 2Q20A 3K81A 4JN2B 4FZ8H 2MOVA 3T0EB 3VFUA 3SE3C 2CGRL 2PR4L 1A6ZA 4AQOA 3HPJA 1P2CB 3ARFA 1FGVL 1XT5A 2NY6C 3NCJL 1R5IA 4ERSH 4PGZA 4NM8H 3UPCA 2WIMA 3QIBD 5KVFL 2LTQC 3CDFA 1D9KC 1LE5B 3H9SB 2IPTL 4PLJC 4PG9A 3U7YH 5D1ZB 3MBED 3B9KC 4ODXB 2P5WB 4ODSL 3O2DL 1D6EA 3TWCH 3IT8D 4GAFB 3UX9B 3MMEB 1PVHA 5E9DA 3ULSB 2R29H 4DZ8B 1NUFA 1XIWD 1S7SA 1UQSA 3VDCA 3O6FB 5JOFB 3BIBX 3G04A 4WTZA 4P4KD 4P2OA 8CGTA 3CX5J 5LBSL 1Z3GL 5MHSD 1PBYA 3HI1A 4YC2B 3OAYK 4ZTPL 4UQ2A 3UZVB 3DI3B 4I5BA 2R29L 3QI9B 1RZJC 4HX1B 4MXVE 4JDVA 5FOBA 2BSRA 3MOBL 4O2EB 2GSGB 3IDXH 3D6GA 4M6OL 1U9KA 4L8SC 1NBVH 4G9DA 3EDEA 2UYLA 4XTRD 5SX5H 3G9AB 1OAUL 2IANA 4R90L 2C3VB 2X4NB 1I7TA 1UYWH 3RVVD 2BNQD 4ONFH 1QO3B 3M8OL 1FCCA 1KN2H 2IH3B 1VFOA 5J3HC 5C6TL 2VABA 1UCTA 5GZND 1L0QA 4X8XA 1VPOL 1K8IB 4M7LT 4JG1H 3RGVB 3TBVB 3FTGB 4R3SA 3NTCL 1BQHB 4GW4B 3JV6A 4G8IA 3V5KB 5IQ9B 5T33L 1A6AB 2Q3ZA 1II4E 4R7NB 2ADFL 5EU6B 1L4IA 1NAMA 4OB5L 3DX9A 2DM4A 3ZSTA 1MREH 5D2NB 3TEUA 4M7KL 1VCAA 3V0VA 2ESVD 3TBTB 1CDJA 3NZHH 1UJ3B 3T65A 1E4XH