2F6AA

Collagen adhesin and collagen complex structure
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
303
structure length
303
Chain Sequence
GSARDISSTNVTDLTVSPSKIEDGGKTTVKMTFDDKNGKIQNGDMIKVAWPTSGTVKIEGYSKTVPLTVKGEQVGQAVITPDGATITFNDKVEKLSDVSGFAEFEVQGRNLTQTNTSDDKVATITSGNKSTNVTVHKSEAGTSSVFYYKTGDMLPEDTTHVRWFLNINNEKSYVSKDITIKDQIQGGQQLDLSTLNINVTGTHSNYYSGQSAITDFEKAFPGSKITVDNTKNTIDVTIPQGYGSYNSFSINYKTKITNEQQKEFVNNSQAWYQEHGKEEVNGKSFNHTVHNINANAGIEGTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/structural protein
molecule keywords Collagen adhesin
publication title A 'Collagen Hug' model for Staphylococcus aureus CNA binding to collagen.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 64
structure length 303
sequence length 303
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05737 Collagen_bind Collagen binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2f6aA02
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2f6aA01
3IRPX 4B5ZA 3KPTA 4HSQA 3UXFA 2X9ZA 3OPUA 4OFQA 2WOYA 3IRZA 3IS1X 4MBRA 2WQSA 2X9XA 3PG2A 4LEEA 4LE8A 4MBOA 3HR6A 2VR3A 3HTLX 3QE5A 3AT0A 4JDZA 4P0DA 1R17A 4F27A 1R19A 4UZGA 2OKMA 2XTLA 4JDZB 3ASWA 4B60A 2X9YA 4F1ZA 2Y7NA 2WZAA 2RALA 4IGBC 2Y7MA 5CFAA 3RKPA 3QDHA 1N67A 4LEBA 2X9WA 1AMXA 4IGBD 5DZAA 3V10A 2Y1VA 2Z1PA 2Y7OA 2F68X 3RPKA 2YLHA 4Z1PA 5CF3A 2F6AA 3PF2A 3IS0X 4F24A 4IGBA 5IHWA 4F20A 2Y7LA 4JE0A 5DZ9A 4Z23A 4IGBB 3AU0A
chains in the Genus database with same CATH superfamily
3PWJA 3IRPX 3UABA 1AGDB 3NCYP 4J8QA 1BAFL 5FA4A 3RL2A 3TEYA 2PO6D 5I1EH 4HCGA 5E1QA 4FNSA 4MQSB 6PCYA 2WV3A 4YXLH 5DJXB 1OQXA 1BD2A 1OAKH 1TTAA 1DUZB 1MCNA 4PJ8C 3MV11 4OFDA 4XN5A 2MQ0A 3UMTA 3MACH 5FF6B 3W0WB 5LGJA 3UC2A 1AGBB 2Y7QB 4XI5D 3BIKA 1FE8H 5E70A 3C8HA 3TT1L 5TDNB 1QRNB 2FJGB 2F19L 1DLHB 1BPLB 4B9PA 1IGYA 3BW9A 3BIAX 4N3UA 3S96A 3QXDB 4R4BB 1DP0A 2PN5A 1FL6A 4U0QB 4YFDB 4PGEA 3FRPG 3EYUL 2HMID 4PYGA 3D4YA 2GBAA 4MJIA 4P99A 2V2XA 1V3MA 4BK4A 4F8QA 1XD0A 3ZE0F 4F93B 4OLWL 5E8DL 4M1GL 1Z0NA 4NQUA 5FA3B 5IG7B 5IFJA 1BQ5A 4KXDA 1YN6A 2BJMH 4KQ4H 3RDTA 3GIVA 3MLPA 1KY7A 5JHMA 2EYTA 1K8DB 2AK4B 1NGYB 1TOXA 2FNWA 4I2XA 5TE6H 4PRHA 1Y07A 2F5AL 2J71A 1QBLL 2F54A 2RMNA 3QPXL 5HGBA 1NBCA 1ZWIA 3QIUA 4W9HC 5FUCC 3UJJH 5FGSA 5C6PB 1Z3RA 2CALA 5E2UL 1P7QD 3UP6A 3RVWD 2GIMA 3C09C 3VI4B 5IMMA 4ZMOA 1JN6B 1KXVC 4OF3A 1HDMB 4H44C 4QRTB 4PJ6A 4R7DB 3V52L 2O72A 3HS0B 5B8CB 1BA9A 2CCLA 1KBGL 1DVQA 3MSPA 3HE6D 4GRWH 4M7KH 3QNYB 4AH2A 4KJYB 5F44A 5HHVL 4J6IA 3VYPA 1ED3A 4RWHA 4Z7UF 5I1CL 2IJ0C 3FW6A 3PNWB 3TBTA 3BPOB 2WUBH 4JO2H 4H0GA 4ERSL 2X4OB 3TFKC 3GMQA 4CDHA 5KZCD 5L88L 1GGYA 3CC5A 2B14A 2NUPA 5HY9A 1A3ZA 5A7EA 1UGNA 2BS9A 2AS5M 2ZP8A 3WS6A 5F89B 2VDOH 3O6MH 1J8KA 3L5XH 2XTLA 1GOHA 1CICC 3GXFA 5FGBC 3GI8L 3T0BA 5HYIA 4FNTA 4H0IA 4JK0D 4HS8L 3NSDA 3LS4H 5T3ZD 1YEJH 2F74B 4WFED 2JJTC 4IBLT 1F3DH 4N0CD 4F7CB 2SEBB 5TDPA 4Y5XB 1DZ0A 1LP9B 4AL8L 1CU4L 1M9SA 5E7FA 2WSPA 5J5EA 3G5YB 3IMBA 4HJJH 3WJJA 4HOWA 3LQAH 4HSQA 2VM4A 2XN9A 3NDZE 4MKTA 1DEEB 3GTNA 3V8OA 1IC5H 1KB5L 3I6GA 3APDA 1MFBH 4WY7H 2OBGA 1NM9A 2ZWNA 2ICES 2VDPL 2IOOA 4L48A 3PAYA 1Q9WA 4ANKA 3B1UA 2WYHA 3DVGA 1CLOL 1CXEA 2FAUA 1V7ML 2F53E 3EBIA 1VZGA 2CWRA 3HBGA 3NH7L 2HKFL 3ECWA 2EDNA 4RSVA 2VC2L 3HMXL 4MXWH 3NESA 1A1NB 2YRBA 3ULVL 2CMRH 3F7KA 4LPWA 3CIQA 4JO3H 5DU7A 2Y69B 1EUTA 2KZ1B 3CVCA 3LZFL 2W59A 5F7EH 5ISZB 1BQUA 2EIBA 3H42L 4I3RH 3WBDA 2Y7SA 1YEIL 3PFQA 4JY6A 4WWKB 2IV9A 4Y7MA 2MCAA 2ZKXA 2APSA 4L37A 3VU2A 4DCQA 2G3XA 2O5XL 3JWOH 3PJSA 1DQVA 4P0DA 3BKJL 3ULSA 4E9VA 3HI5H 2JKIS 1WICA 2WGNB 2GPZA 4FQHA 4E41B 1A65A 2CJTA 5KVEH 4IRJC 5TFSL 5FB8B 2WW8A 1F6FB 5E2TL 3DJSA 1HXMB 3D2UA 1B90A 3FO1B 3U7WL 1CC3A 4I3SL 4NSKB 3KPSE 3RTQA 3UTSD 3N6YA 4JGNA 5HGDB 1HOCA 3FCUB 5BJTA 3TA3D 3M86A 5BOZG 1MHHB 4X5RA 4CJ0A 2HLAB 5A7BA 2DM2A 3ZKMC 3V4VH 5FFOA 2C1PA 5DSCA 2VISA 5EB9A 3U79A 3WNKA 4ACPA 1F6LL 1UJ3A 1HQRB 5IMKA 2CCWA 1JPSH 4M8VA 1T03H 2ESVE 3BDYL 3FO2A 1HH9B 3O8XB 2AQ2A 3U9PL 3CBRA 4ETQB 4F58L 3HG1D 4NIKB 2CR3A 4C57C 1KXTB 3MAWA 4ZO9A 1FFQA 1URZA 2VUYA 1L5GB 4QHLB 1SDAB 3NCYS 1A6VH 1NBZB 3NAAL 5JOEA 1DYZA 1HOEA 3U48A 2DY2A 4TUJA 4XMLL 5F3HB 2J12B 4IHOB 2FT7A 2IAND 1OP5H 3VRJA 3LKRA 2P45B 5DHVB 2BHUA 2IALB 3RHWF 3UBXI 1F3DJ 2VLRD 3BH9A 4GIPD 4I48A 4NQED 2PWGA 3FB8A 3UO1L 2P80A 3MRBB 4IGBD 1CLYL 4PV9A 3IGKA 4FG6D 1SF3A 4XPHL 3OJ2C 1DANT 2GTZA 4LPYA 1BOYA 3PCYA 4BUQA 2A77H 2L0DA 4R8WL 4H8WL 3S3SA 3D5OF 3CH1B 2DWTA 2G3NA 2H8PA 4N0RA 2A2QT 3SE6A 5K1NA 1X6NA 4P57A 3V0IA 3S7GA 3SPVB 3WHXA 4JPSA 3T4AA 4JN1H 4NO0B 2QKIC 4MX7A 4BGLA 2JQMA 3K6OA 3WGVB 1GHFH 1E28A 5I9QC 2K70A 4WRLA 4YPJA 5IY5B 5HD8C 2ZP0T 1DL7L 4HPOL 1HHJA 2AEQL 3ARFA 1A6AB 3GLAA 4BZ2H 2YPVH 4F7TB 5KS9F 4WI6A 1QHOA 3FXIC 2EDMA 1AQKH 4AT6A 3VA6A 2E59A 3GWJA 1FPTH 4UNUA 1WFJA 3DRTA 1OW0A 1T89A 3NIGF 1YECH 4GG6E 5JXAH 2N3JA 1ZEAH 4OV5B 5JO5B 2TAAA 2APTA 4OI9A 2DL2A 1CMOA 1ET7A 1FL5A 5ALBH 3UBXG 4EN3D 5A2BA 4ZXBA 4OCMC 5I24A 3FJTA 4WFFD 1EO5A 4X98A 3OXSB 3OHMB 4FA7B 4G8FB 1PL3A 5ADOH 4MWFA 2UV3A 2EXYD 1J05A 1FGNH 4LPCA 3MFFA 1BZ9A 1SEQH 2JCCA 2NNCA 4A6YL 2VL5A 4S0TD 5L7XL 2X4QB 1L9TA 3DETD 3L9RA 5E1AB 5EZOH 5IVXF 3TYGL 3QP3A 4DFIA 1D5ZB 3JV4B 1A7OL 1OTTC 2DLEA 1M7UA 5D1QD 3QAZB 2BWQA 4OKDA 3IXAA 1TVBB 2FT6A 3SE9L 2B39A 3TIEB 3CJJA 2DQJH 5BRZD 2VMFA 2XETA 2E27H 3QPQC 1FNHA 3KPRA 3WU1A 4NKOB 3ZJAA 2PF6A 3GTVA 3C6EA 4AIZB 3K71B 1RUPH 3CFTA 3R4RA 4PJCB 1LEGB 3ARGB 1XMWA 4QLWA 4UDTB 1JGEB 3VWKA 3LEYL 3N41B 3QEGH 3QUYC 1PKQB 1JP5A 2WVTA 5GISL 4RFNC 4K3DH 3GBEA 5JXEA 5DA4A 2D73A 3L7EB 4P5TB 2A4ZA 3NZHH 2AK1L 4U1GB 1OQOA 4Z7NE 4LDEB 3FPYA 1BQRA 1YSOA 5I8OH 1SOSA 1QFUH 5HHMB 3HG2A 5EF3A 1L7IL 3MFGB 2CK0L 4JRYE 5MENE 2EEFA 3MX0B 1ZHLB 4OSUH 1KZYA 5IBTL 5DQJA 3GIZL 1WZLA 3WTYA 2YMXL 4Y4FC 1D7CA 1C08B 2HSIA 2VLKA 2NDGA 3N9GH 4PB0L 3MBEA 5J1AB 1MFDL 4OQTH 4NKDB 5CIPH 2MNUA 4QHUB 1WIPA 4NI3A 1N3NB 1HIML 4N4YB 4NKIH 1OGAB 1TYEB 2A6IA 2PO6C 2QBWA 4U3SB 4W6YB 3MV8A 5IOKA 4PRBB 3WAJA 3ZDZB 5DMIL 3PPEA 1ACXA 3NSJA 3NJXA 3PV6A 1MSPA 4HLZG 2EKSB 4FF9A 3TBSA 4LF3A 1CE1H 4OCYL 3L2MA 3GBNH 4Q0XH 5FLVA 1QBAA 2YPKA 3KVPA 5F3BA 1WBXB 4HG4K 4XI5C 5KAQG 1OP3H 2WK2A 3RWEB 4E2OA 1ZANH 4OUUA 2BOCA 4QRQB 1KOAA 2QLVB 2EH7L 1MRCH 4R26L 5TPWH 4W9FC 5J4MA 4NPKA 2WVSA 4IKNA 4GP5B 4K23H 2WVVA 3FPXA 1EAPB 4P23A 4ELMB 2DJMA 1AIFB 4NM8L 1IGFL 4G6KH 2HMIC 3T6QC 2WZPA 3B2PA 4KNTA 3M7OA 4MZ3A 2NRDA 3M8OL 2VDKB 4IMLA 2EDQA 2MOGA 2J8UE 4PY8I 2O61B 2A9MH 1A9BB 1MVFA 4E9WA 2DQUH 3Q48A 2Z92B 2NDFA 4WJ5A 1YNKH 3FHAA 4U1HA 4FNRA 3TESA 3DX2A 3O6FA 1RD6A 5B39A 1AXSB 4B50A 3FB7A 3VI3F 4WK2B 3GEWB 3D69A 1IAIL 2P7TA 1LE5B 2YD6A 3KL5A 5DVLA 4WHTA 5A43C 3K72B 1XGYH 2OV0A 4G9DA 4LLVB 5AAWA 3LSOB 2FWOB 4BBWA 2ED8A 3RVWC 4HS6B 2R2CA 4U6XA 2VN4A 4IOSA 3AFLA 2OJZL 4LNVA 4OJCA 4OLZL 2AJYL 1QSEA 1PZBA 1DBJH 1M56B 2GSIB 5DK3A 3U46A 1CK0H 5CN2A 3HE6C 1AAJA 2W95A 3ZE1E 5CLZA 3FU8A 1XH3B 1AGEB 4LL9A 1EHLH 5KN5B 4AM0Q 1NLDH 1Y6KR 2LU4A 2ETWA 5LAXA 1D5BA 4FN0A 4KXAA 1IAIM 4PY7A 4XO8A 4WU5B 3THML 3RZCA 4G42B 3SDCD 2TSAA 2PCPB 3QWOB 4MNHB 4JFFE 3RKPA 3S4SG 2O30A 2Y07H 4N0CC 3L3IB 4XCEA 4PJ9B 4BE5A 3VXRA 4W4NA 2IFGA 3BXNA 2C1OA 4ADJA 3O2WL 3OJMB 3B2XA 1KB5A 3ME0A 2PXYD 3EO0A 3CVBA 2QQNH 3H9SD 1K4DB 1NFKA 3L7FB 4JQIL 2J1WA 1X5KA 2C4FT 2W0KA 3DRQA 5TE4H 3MROB 3N55A 5C2BH 2R59A 5E94A 4XX1G 4KNQA 4FDWA 1X5IA 1UYWL 2XRAL 3FFCB 3GO1L 3VFPA 2ED7A 2QTVA 1M71A 1DLFL 3WV0A 5E4EC 2BSSA 4MASA 4G9FD 3O9WD 3CX5K 1J8HD 4PB9L 4EI5B 3T3PE 1NSNL 4PRPA 3RWCB 3TH4T 1IJNA 2CO3A 5HYFA 2M1KA 5CN1A 4A2GA 1OZTG 1K9TA 5SWZB 1Z2KA 4X0NA 3B9KA 3PJLA 4WDIB 2Z4QB 3MGOB 4CDGC 3DGCR 3IAQA 2CO7B 3HNSL 1EVUA 1ZGLM 4L4JA 1I3GL 5F1IA 4U2YA 3CFBB 1XF2A 3BT2H 2UY6B 4OLEA 4UB0L 3FB5B 3X3FH 5L4MA 1NOLA 2LABA 3TL5A 3FO9A 4Z7OB 2BRRH 2K0RA 3S97C 1JZIA 5CSZB 2ZQKA 3F5WA 4GAGL 3TA3C 1RLWA 3K8KA 4FTVB 5AAMA 3MNZB 3QXVA 4DGIL 5ENWA 3I9IA 2CO2A 1D2PA 1CDHA 4JKMA 4OLUH 5DJDA 3GMNA 5DYOB 5BO0D 3UYRL 2HYMA 1E3FA 2VE6B 4CUCA 1IM9A 4LVNC 3T0AA 2W9LA 5EIQA 5EO9B 1ZSDB 5DDHA 2BSRA 3MGTA 3KXFB 4NERA 2OP4H 3HZVA 1TQWA 2E4TA 5GQBA 1QUNB 1D7FA 3X11B 4UTAA 3U6RA 1HWHB 1ND0A 3FT2B 3J7HA 1KIRB 4NQDA 3TWCL 3S37L 4OIIL 3DV6A 3KYNB 1BD2E 2YAHA 5DEGA 1AZRA 5EORH 4DN3H 2FLBT 1ESOA 3NJFA 3MUUA 4ZTPH 3LKQB 4FFWD 4DPAX 1P2CA 3FO0H 1H0DB 3P3TA 4YHNA 2AQPA 1QRKA 1DQDL 2Z7UA 3DSNB 2ZUWA 3IFLL 4IGBC 4F57L 3DUSA 5IIEA 4J3BA 1E90A 3FOLA 4FG6C 3VQMA 3MV7B 2IADA 3FBKA 1MJJA 2X1PA 3F2LA 5E8NB 2R83A 1BFVL 3IKKA 1KV3A 2OX5B 1YY8B 4NT6A 3NIFE 3UPAA 1X9LA 1A6UH 3VYNA 2R4RH 2GI0A 5FYJE 4UIMA 2OTWA 4L4TE 3E3QC 1ONQA 2C7UA 2K4WA 1HINL 2V4LA 4L4VA 4EJ1C 4MJIE 5E5MA 1QBML 2Q3AA 4I77H 2Z9TA 3C6LA 3GSNH 5DWUH 2HRLA 1GYCA 5LVEA 4X5XB 1Z6JT 3MRLB 3QFJB 1F13A 3GJFA 6PAZA 2ITDA 1U8LB 1IKNC 4N2IA 3OKNB 4I2XE 1M6OB 4PRHE 5AUMB 3QJUB 2WBWB 3TOPA 4FRWA 5CJXC 2O5ZL 1XGRB 5EU6B 3UZQB 1G6RL 1QZ1A 4ODVH 4YVUA 2WXGA 4TPRL 1XF5A 5FHAL 5IFHH 3G6DH 5J56B 2NY7H 5AVQB 3FN9A 1NKGA 4EN3C 4TSCH 3BSHA 4D3CL 3QG7H 1JPTL 2P8LB 4LGPB 1BXXA 1YMHB 3ARUA 4KITB 2QQQA 5E8EA 3VM7A 4BSWB 3HR5B 4NN5C 5F7LB 2H6PB 4XVJL 4A6YA 4BFGA 2EXYC 2V33A 2ADGA 3TF7C 3CCHB 5D5MB 5F7DB 4E9XA 5KYXA 2F18A 2GYSA 3F7VA 1RUML 3CSTA 4AYMC 4DVBA 3DETC 4NDMB 5JUEL 4YQXL 1CIDA 4A2HA 1RERA 2ENSA 2ITCB 3WS3B 1X5LA 4KO9A 4MVBC 5D1QC 2J4WL 3OAYH 2DWDB 1ZS8A 3MODL 1IGTA 5FGRA 2FX7H 2MJWA 4UZGA 2BIHA 3KPLA 5ECJE 2HPTA 5F6IB 1GZHA 3FT3B 2JK5B 3BYYA 4PR5A 5BV7H 4LLWA 2B0SH 3SE3A 1MW3A 2WBJD 2QVFB 4OGQC 1ZLVH 2ZICA 1EXGA 4XMKL 4K94H 1CFSA 2R2HB 4NC1E 4I18A 4K3HA 4IEFA 1OB1B 5C3TA 3LOWA 2R56H 4JPVL 4OCXH 5GJTL 1CURA 1SQ2N 5ADPL 2G5BA 2AKRA 4LLMA 4LCWD 1XEDA 3OV6A 4Z18A 4YE4H 4WW2A 5JHLH 1KELL 2BNQA 4ALAL 4P05A 5GS0D 1WF5A 2VTFA 2OL3L 2E46A 5BMFL 4HAGA 4QRSB 2ENPA 2WXIA 4U49A 3C12A 4GAYA 5JORA 1CE6A 1NC4B 3S34H 2AXFB 3C5ZA 4Y4HA 3LEVH 2MKWA 3N42B 1WCBB 4JM2D 1YHPA 5IZ7A 3CHSA 1QW8A 1KTJA 2AJSL 3T2PA 4B0MM 2HVJA 1K85A 4L8DA 1BZDA 1JL8A 1SYVA 2YARA 1A5FL 2MHAA 1ZKAA 2YGVA 1RU9L 3IU3B 2XWBA 5K9JL 2X2IA 2YSTA 4F9LC 4JFDB 1LGVA 5DC2A 2OSLA 2E56A 1SYSA 1G7JA 3GJEA 1V10A 4XP4L 4LIQL 4G83A 1XGQB 4PGDA 3UDWC 4R7LA 1G84A 4JREB 4EKXA 5H4YA 1QLEB 3ARDD 3EJSA 3BEVA 2K3HA 4QCIB 3S5ZA 1HAWA 3LAFA 2ZCZA 1R3LB 3K2KA 4DEPC 4UU9B 3HE7B 4LSPL 3KW8A 5IUCA 5D1ZC 4QTIH 3NUKA 4ODHL 2OMWA 5D7JD 1KGUA 3BT0A 2LLGA 4ONHA 2WQSA 2B20A 4BFEA 5C07D 3WUZA 5IHUH 3CAFA 3VTTA 4OAWA 5KSUB 4JL1A 4F27A 1MKFA 3HEIB 4ZMQA 1A25A 4N3TA 2V37A 2NY5H 2XCMC 3BKCH 5LKNA 3JT0A 4ZBJA 4RX4D 5HGGS 4HWZB 4KGLA 4S2SA 4L1DA 1P6AB 4AQEB 4Q6KA 4X4XB 2L7QA 4Y1TA 4ZUTB 2QELA 4JE4B 5CHNA 3DGDA 1FIEA 3R0MA 4PJBA 4MNQA 2CPCA 4J2XA 1R5VA 1E4WH 1JHTA 4IBQA 4LCCC 1JPST 3ATEA 4WUUD 1W0WB 3DX6B 1G7IB 3PP3K 1C5DA 4X5LA 4G7YL 2D3VA 4KHTL 4YWGH 4ZTEA 3OGCB 2GUOA 3T0EA 4RZKA 1ANUA 4PCKA 4XZUB 1T1XA 4TLUA 5D7LD 1JZ3A 2D3JA 2H26B 5C0DA 4PW9A 1HHGB 1AZNA 2OMUA 3KYMA 4RGMB 3ARWA 4GJTB 4QPEA 1TJMA 3HAEH 4UQ2B 1P5UB 2DDQL 4JZJB 4DQAA 2Q7YB 2X0UA 3EBAA 3ATAA 4IIQC 1DBBH 2IV8A 4KRPB 2PW2A 3SBWC 3ZHDA 2BVEA 2X4PB 2R2EB 2I60L 3LPWA 5D7SL 4FZEH 2FR4B 3P9WB 5HXMA 5K9KA 3COOA 2UZYB 4FCAA 3Q5TA 3VMOA 5HYQB 5IB3A 3O41A 4HZ1A 5DUMH 3SDCC 2CNZA 2YC1B 1DANU 2GK0B 3WY2A 4P2QA 4C56D 1F56A 2NTSP 1NICA 5C6WH 5CP3H 5E5UB 1ZIAA 4XN1A 2FH6A 5ALCL 4LRNH 4JKKA 5FGCE 3PGFH 4GO8A 1MY5A 4PJGA 4R4FL 2PXYC 2NPLX 3G6AB 1NDGB 5DHXB 1W72H 3EIFA 4GW4A 2X4SB 3UAJA 4JFED 1YO4A 1HL4A 3QRGH 5KYWA 4HPYH 5DC4B 3CPLA 1CXKA 3O2VH 1KJVA 4LAJH 1NL0H 4JFYA 5FFLA 3MRIB 1BJMA 2XTJB 3JWNC 5F97E 4ZMNA 1JI2A 1ZHNA 3W9EA 5A16B 3K0YA 5I74B 3MC0A 1S7VB 4BH8B 3UGEA 4PJ5B 3EJYD 25C8H 2APFA 3CDYA 4XAWH 2HG0A 5BS0A 3CQQA 2H2SD 3O9WC 2JB5L 4R9HA 4RAHA 4LPXA 4HQQH 2TSBA 2X3CA 3EW3B 5EIVA 4MSWA 2H9GB 1B4JH 4XBPB 2DI7A 4Q9QH 4EZKA 3UMNA 2Z31B 1J7VR 3X12B 1OVZA 4G82A 3KPRE 1XGUB 2Y06L 2OMVB 1PSKL 1K2DA 3ESOA 4JG0L 5DLMH 1JGVH 2YHGA 4ZW7A 4B7IA 3C75A 2DBLH 4FJ6A 3MV9D 3VX1A 1QSFE 2AQQA 4AMKH 1P84K 3F7PC 4HJ1A 1GTNA 4LCUB 4IRZH 5IR1A 2PCXA 1KY6A 2WLZA 4MD5A 4O5LL 3TYFA 5J12C 3D12B 3FAXA 3TN0B 4AKQA 1MHEA 1Z66A 4JO8A 4YE0A 1HX0A 1TU2A 4ZQTA 5L8LB 5I6XB 4GRWB 5C08B 1T4WA 3LVTA 1KENL 4CA4A 3GK8H 3C08L 3PRZA 5C7XL 2DQIL 3ARQA 3FQRA 3T8XA 3IJSA 2VLKE 1OXYA 3CDCA 5DD5L 4EVNA 1R17A 3WDJA 2AJ3B 3GSUA 3Q01A 4H2AA 4HV8A 4G6JL 4U05A 2VDOB 5CXPA 4K8RH 4MAYA 2BNRD 1AJ7H 3V0VA 3WO4B 4QJ5B 5KJRL 1WCQA 2LR4A 3ATBA 3MV8E 5EV7A 1IQWH 4BGDA 2OSXA 5EEWA 3P4LA 5B3SB 2DLIA 2LTQB 5BXFB 4PRIB 2CDFA 4RBPH 3QH3B 4BK5A 2XWXA 5DMGD 4B96A 1JRHL 4Z7QF 3U30B 2IFFH 2JLPA 2V7NA 4FFWC 4LDCA 2O6DA 4ZT1A 4WEUD 1BVOA 4NPYA 4P46D 4NZTH 1T21B 3FSVA 3QDGA 4KWUA 1IEHA 2YXFA 1T5KA 4ANWA 1SOKA 2AV1A 5FEBA 3QXWA 3OLGA 4K7PL 1S7RB 2OYMA 3WOVA 1ADQH 1D9KD 1HNGA 3BWAB 1LO0H 3MBWB 4YNYA 1P53A 2CLRA 2C9QA 3OAUH 5J3HD 4UT7L 5KVFL 3FFOA 4HJGA 5JW5B 2P5EE 4I0PB 2YQBA 2D0HA 3RWHB 4NUGL 3O3BB 3VFSB 2B08A 2BSEA 4XN4A 4KNUA 4PW4A 3WDHA 5IHZB 1FH5L 2XNAB 3QO1A 1UWXH 2FX8L 2HTKD 1AD0B 2CPUA 4D9QD 5D7KD 2ZTBA 3VD4A 1HSBB 1R3HB 3IE4A 1DFBL 2MKLC 3ULUH 4WCYL 1JV2A 3MJ7A 5A1AA 5DTFB 1G9MH 3EJQA 1Z0MA 1LNUB 2E9JA 2JJVA 1G6RA 2ERJB 4AK1A 1C5CH 2EJ1A 2W5PA 1C16B 2KS0A 4HHAA 4OTXH 1IAKB 2EDYA 1Y7VA 5J1SC 4HKXA 2AP2A 2R1WA 1LDPL 3ZDYE 1QSEE 5C0FB 5AB0A 1TCRB 1RVFL 3BWZA 3BGFB 5HHOA 3LV3A 5T3ZE 4U1SB 4UM8B 4KPHL 3DVNA 4F9PC 2WWNA 4XOAA 1MHPH 1FC2D 1NJ9A 3V4VB 5CJOL 4CAGA 4CN1A 4JDEA 2EDOA 3NJKA 4LEBA 1IFHL 4ZRGA 3V10A 4EDXB 3UX9B 2VZ3A 1KJ2A 4RNRA 3WL9B 2N56A 5FOBB 4GRLA 2I9TB 4N85A 5H94A 3WY4A 4V2CB 2QQLH 1NC2A 4Q6IB 1BFSA 3K74B 2UZXA 1NEZA 1V7NL 1AACA 3P73A 5IJKC 4XMPH 3QQDB 1GR7A 3ZT6A 1J1OH 3VXRE 4TUUA 2FEEI 4RWYH 1JAEA 4E9QA 4YSQA 5I16B 1CFVL 5IJVA 5IB4A 1R0AH 3O4OC 1MUJA 4MDIB 3X3GL 1KF9B 2WBJC 2LV4A 1SHWA 4PJHA 3UZEC 3UAAA 4E0RA 1JNHB 1DR9A 4DZBA 2CO6B 3RIAF 1X5MA 2R0LH 3T8VA 3M07A 4DVRH 3BX7C 4Q9RL 2ZCHH 4QO1A 1XD1A 1FH2A 3W39A 1XCXA 3UYPA 1VFMA 2CBPA 1FV1A 5FHBH 2CH8A 3ZTEA 5GS0C 1RLBA 3P0VL 4PS4L 2G0LA 4GXVL 4MMZA 2JFCA 2J1KA 4WHYH 5AOKA 5T1DH 2OZ4L 2YMOA 4U1IB 2WN2A 3MUY1 4X8JA 2NY0D 2X28A 5FYKU 4FFYL 1KPUA 5JQIB 3ASNB 2BMKB 4JM2C 3CN2A 2ESVD 1HFUA 2VMEA 3LHPL 3FU0A 5DS8A 2V0AA 2C4FU 2VWEC 3QZLA 4X8GA 1NA8A 3CDZA 3VWJB 1I8MA 4BQ8A 4X6CA 4S11A 2UXVA 3M17A 1O9WA 4XVSH 4TVPL 5FYLL 2CBTA 1R5WB 3JWNG 4GKNB 2DWEA 1TNNA 1I31A 4HP5A 2EH8L 3GHEH 1PCXA 1INDH 2X70A 3ULAB 3WFBH 1TXKA 3CSYB 2FJSA 2R4SL 4A2EA 5I5MA 1BQLH 1NIBA 1E6OH 4RVBA 2O93L 1T04B 4ZAKB 3PWVB 5GS1A 5CEYA 1F4XH 3ESVF 1WA1X 3ABKB 1DUYA 1MREL 4UM9B 1U8QB 2A9BA 3FHQA 4Z7VA 3TONA 4RFEA 5CINL 5D7JC 1TITA 3FBQA 1UOKA 2WNGA 2IPTL 2EC8A 5SV4A 1U8MB 1BVKA 1PIFA 2XQYA 5IHHA 1BG9A 1BQHG 1UGKA 2RHEA 3ZGHA 4AVHA 1D6VH 4M48L 5AEAA 4RMRA 4KH2A 3QJXA 4ABUA 5JA8B 3U7YL 1FRGL 4EI5D 1DVUA 4NQCA 3AU1A 2KYIA 2GEQA 5CP7B 3UPRA 3X14A 1EHKB 2NR6D 3P4NB 1YEKL 3HRPA 4GXFA 4NQVA 4IRSB 4Z76A 3RQ3A 3O0LA 3VNZA 3ZHFA 4TLKA 4PJ7B 2HRPL 3LNFA 1NGQH 3NABL 3HUJF 5DR5H 2EC9T 3L5WA 3MNMA 1PZ2A 7CGTA 2OSWA 3N1GC 5HJ3B 1ZA6A 5EOCH 2PABA 2VQ1A 4NZRH 1S9WB 5FCUL 5IQ9B 4L4VE 3HI1B 3I02A 1L3WA 2HH0L 3BD3A 4R96A 1PY4A 3RI5F 1C1EL 3TO4B 3P4MB 3CMOL 3WXVH 2KDGA 2XLLA 1BW8A 4KTDH 3QEHA 3MKGA 5T5FL 4BWUA 5FV1L 1ZOXA 3EHBB 1JVKA 4EUPA 4MAUL 1HK6A 1E27A 3A4FA 3GRWH 3RHWK 2H41A 1CFTA 1QRNA 2VDNH 4JHUA 5B7MA 1BREA 5CIPB 1UB5A 1OPOA 2WWOA 5ANMA 1BMWA 4J2QA 1SVCP 3F7YB 3ETBJ 3L95A 5JDJA 3DMMD 3KBHE 3M1BA 4XNDA 1Z5LB 3C60D 4JG5A 3L8QA 1EJOL 4ZMTA 4Z7UE 4W9DC 4HVBA 3RUGB 4M9PA 1U3HB 3RJDA 2PCFB 3IVKA 2E9GA 4N20A 5ABZA 2VDKL 1NCWL 5IG7A 3A4DA 3ZTJG 5K1JA 4OB5L 5ACZA 3QCUL 3SBRA 1JFQL 5AFAA 2AK4A 2VUOA 4ICXA 3TS8A 4HFWB 5JIQA 4BCXA 1S9KC 4Y19D 1N10A 1EGJL 5BQDA 1FO0B 3NACH 2NY4D 2MFNA 5F1NA 3U25A 5J7CC 3MJ8B 3D39E 2PUQT 2Y1YA 1MCRA 4KQ3L 4Z7NB 3IMSA 4X7TB 1NFDA 4ZPTB 3LKNB 3TJPA 4M1DL 3TV8A 2Y24A 4K3JH 3PXHA 1JN6A 3ROOB 4YSPA 2VQ4A 5ANHA 1GGCL 2FZ3B 2H2SC 5DZAA 4NO5A 1RJLB 3DX7B 2MTAA 1BCIA 1QLFA 2D4DA 1ZLUH 4YBQD 3GMOB 4G1MB 3S2AA 2VLJE 4PBVC 2B15A 4TQ8A 3BSZH 5MEND 3FQTB 4JGJA 2ZUYA 5F71A 1HCYA 5HHNB 2P8PB 3W3BA 4TSBL 3RYMA 4U1KB 4ZUWB 3Q05A 3DYPA 5IW3A 1L9MA 2HJLA 4XO3A 5I66B 4HKJB 5F3FA 1Q9KB 3B5TA 3CXDH 4FQJH 3E8UH 1S7SB 2DQMA 2X1OA 3ARBD 2H47C 1XAKA 4JDTH 2YBRA 4ZFOB 5L2KD 4F7CA 1QKZL 3STBA 4DUXA 4DERA 2BNQE 2A38A 3VA2C 3DOSB 1ZRUA 4MQ7B 3TBYA 3V7MA 4R97B 1MAML 5CEZL 1MI5B 3N1PC 3GNML 2FL5A 2AXJA 3BFQG 2ZKHL 2ZWSA 3VE0B 1ETA1 4ZOCA 1ACCA 4OJYA 4QRRA 3UTTE 1LE5A 3D09A 2V2TB 3MREA 4EI6B 2OKMA 3FB6B 4LDOB 1NCAH 5FKPB 2IQAB 4ZX3A 4LSTL 1QFWH 1W15A 4P4RA 2ZF9A 3OKLA 1E6JH 5ISZA 4TOYH 3B34A 5DMGC 2OMXA 4OZFA 3SB3A 4WEBH 1FIGH 4JFHE 2ODHA 4JL2A 4P46C 4F7PA 5B38B 3VMPA 1AP2A 1YAZA 5DD0L 1T5WA 4LCYA 4M43H 3LKOA 5FYJH 1KGIA 5FB8A 3BZEB 3B3BA 3G3LA 1GZQA 1XCTA 4Z78B 1FFOB 1XSOA 3ARGC 3MRDB 5GZOA 3MZTA 1XHHA 4JN2A 2Q8AL 3H7LA 4MCZA 5J3HC 4G2AA 3C9NB 1YEDA 5JW3H 2DN7A 4K73A 2O26U 4QHMB 1E4JA 1TETH 4GSDH 5KSBB 3S88H 1B9KA 1S5HA 4XNYL 4W9GC 4K7FB 5T3XD 2F7IA 2YKLH 5BUGA 2PW1A 4Q9CA 5ESVA 2HTKC 5FYKD 1P1VA 4PJIB 1ZLSH 4E9RA 1HQRA 1S9XA 2XT1B 3OR7A 5CGBA 3EGXA 4L8SA 1KCUL 3G5VA 3NCJH 3PWPD 4PJBE 4MNQE 5ES4B 5AD0A 1OAQH 1JDDA 2Y3NA 2WB1A 3DBSA 3UC0L 5T1KD 1CR9L 2OYLA 4YO0B 2NQCA 3VDAA 3DX8A 2WUCL 4TXVB 2BVPB 1TQCC 3D0LB 4M7JL 1H3PH 1Q0YL 4HG4J 5EOQL 1L0YA 4X6FB 4XNZB 4NEHB 1KEMH 4X0KA 2MSPA 3EADA 2EXWC 2HP4A 1MLCB 5KS9E 5I0ZA 1BMGA 5D2NB 2OCCB 2UXTA 1FORL 2ZOTA 5K39A 4XPFH 3VD9A 1CLCA 2QL1A 1AQMA 1KZQA 3GEFA 3QR2A 5AOLA 7PCYA 1AE6L 5EUKA 1UTDA 3GMLA 2HPOA 4HF5H 4BSVB 5TQ0L 3MA9H 4X4YB 2Y23A 4P2QE 3BP6A 6FABL 1YUHA 3KBPA 3G6JB 4YDVB 1BM3L 1A4BA 4OLVL 3LMJH 4UV7H 3TCTA 3ATFA 3PE9A 1I9RH 1EWHA 4H26A 2HJFB 4CADB 1KGYE 3WXWH 4J8RA 3ET9F 1OAUH 3D87B 2W65B 4NO0A 2R7EA 3EZ8A 1KLGB 4NI6A 3EUDA 3AS1A 4I0CC 2DD8H 2IH8A 1CD9B 3SDAA 2EQDA 1YYLL 3I85A 3ZO0A 3U36A 5MEQB 4HJ0C 2DM3A 2L7EA 1ZT1A 2BOLA 5IEKB 4ECNA 3GUTA 1U8PA 4HX1B 4IKJA 5AYQA 5JO5A 1ZVYA 3QEQE 4PJFB 3U9UB 4XNAA 4CSSA 3ZKXC 2ZCKL 1XF3B 1NZRA 4JRXA 4OZGB 5SWSD 4I89A 1GIGH 3CPUA 4FFYA 3GSNB 5CBAA 1WH0A 1A7PH 4OUOA 1B0WA 2NY0C 2OMNA 4WV1C 2R0WL 1FGVH 4G8GB 4L2LA 4DP5X 4YSCA 1E7UA 1YJDL 2QGBA 4P06A 3U1SL 1E4XL 4FQLL 1KJMB 1YMMB 2BY2A 2ZOKA 5HI5D 1WO2A 1Z9SB 3VD0A 4MGXA 3VFUB 2ZOLA 1JGUL 3B5HA 4PJ8A 1GSKA 5B7FA 3DK2A 4B5ZA 3D4CA 4HSAC 2X2UA 4XO5A 4OGYH 2JI2A 1TVBA 4JFZH 1N0LB 4M6ML 1KFAL 3K80A 2DI8A 1LEIA 3PHQB 5ACLA 5GSRB 1FG2B 4MZIA 4PWKA 1BWMA 2Z4TA 1ITBB 5F7AA 2X89A 3KWWB 4N6RB 1OCWH 3BESR 2J43A 3AJ7A 3MRJB 4FL4B 1CT8B 3QFDA 4OR1A 2UWEF 4W68A 3IDUA 4UQBA 4MNGE 3F64A 2K6YA 3OR6B 3SKNB 3W9DA 4PU2A 3ZBMA 4YDKH 3I75A 1ZJAA 3UBXA 3HC3H 3ZHNA 2CRIA 4HCRL 5CWSB 3O4LA 1PKQA 2IDTA 5L4IA 2OLDA 4EEEA 4Z8FL 1PZUB 4LSVL 3AY4C 1UOVA 4P5TA 4V1DB 5IOPB 4OZIF 1RHHB 3AAZA 5LQBH 2YWYA 3LHAA 1W8OA 5TD4A 1JZHA 5IK3B 2EXSA 5GRWA 3KM2A 4EI5C 3SGDI 4JG9A 3K46A 3QQ4B 4NN6C 1KBWA 4P59L 4KTEH 3SYOA 1T0NB 2Q2LA 5AVRB 4CKVX 1G5AA 1VPOH 4M5ZL 2UYLA 3KLHD 1C08A 4V33A 3BH8B 2NR6C 3RIKA 2XN1A 2NCMA 4NKDA 3QDGE 5E9DA 5EUOF 3QJTB 1XZ0B 1KXVA 1NCUA 1MWOA 3LD8C 4GMSH 3P30L 1U8CB 1RP9A 5DJ0B 2FH8A 1BOGB 3WKMH 1YN7B 2NNAB 1OP9A 2G75B 1NEUA 2V5SA 5DD3H 3EFDL 4FABL 1A4KA 4R0LC 3LKPA 3VI3E 3FCSA 4QWWD 1AYOA 4GPVA 1WBXA 3IDXH 2GBUA 3SCMB 2VXUL 3MRMA 1CICA 5FGBA 3OF6A 2CJUH 1TMCB 3RWEA 3WIHL 5G5DB 2ZYRA 1LE9B 4GOSA 4BSJA 3RVTD 5IESL 1F58H 2JJTA 2C4XA 5INCB 3BCDA 3CFJA 2E9WA 4L5FL 3ROLB 1UXSA 2QV4A 2CUMA 5D9SA 3DMMC 2HFEB 5D55A 2OXGB 3C60C 4HK3N 3TIDB 1QEXA 2P26A 1USZA 1HL9A 2XZAH 2Q9OA 1B3JA 3CX2A 3GC3A 5C0IA 1XX9C 5HHOE 4ES8A 4NZDA 3NYKA 2Z92A 1B0GB 1LWRA 4G6MH 4ZMPA 1CGWA 5DZNA 5JMOC 2CDEB 4XGZB 1DBKL 1MCWM 4UQDA 1XF4B 2OSYA 4G43B 1RI8A 1LK3L 3KLQA 3PS6A 2GCYB 4NO2B 4EKJA 4BCYA 4LVHC 5FUOL 5AW6B 3APFA 4Z0XB 1MCJA 4FERA 4JAMB 4POYA 2VB5A 2YAFA 3AZUA 1PX8A 3R1GL 4PCSA 1BEXA 3SE4C 4YUEL 32C2B 1ZV9A 1W80A 3GM8A 1MXGA 3MOBH 5E6ZA 2BVYA 4MJJA 4O51A 3QULA 1QWHA 1EMTH 1GC1H 4YBQC 1XH3A 1AGEA 1E5ZA 4O2FA 1DBAH 4FJZA 4GS7B 5GHWL 3TO2B 5I8CB 1Q0XH 3V4PL 1W2KT 1RZJL 4IRJA 1EZLA 4TF4A 4PJHE 4R7XA 3FQYA 3MRGA 1JF1A 4N2GA 5BPPA 5K9OA 4MB4A 1E2WA 1ZLWH 2E7CA 2JIXB 4XAKD 3DBXA 5H35A 2VDQL 3EF4A 5HYJA 3ARBC 3DDGA 4FQXD 4QAMB 2XFXB 3QUML 2B16A 3HB3D 4NUPA 3L3IA 3N44F 1O6SB 2V2WB 4K55A 1CN4A 4UQIM 2DJUA 2WLLA 3TNMB 4KKQA 5ID1A 2H5UA 2FSDA 1ZD6A 1WV7T 5HHXH 4YXLL 1VFBA 1M2OA 1WK0A 2X88A 1UWGH 4X9YA 3HAEB 1OAKL 3A6CL 5T1MB 4BZYA 4GUOA 1K72A 1K4DA 2JJUA 1MCBA 1GYAA 3MACL 3MI6A 2ZXWB 2Q7NA 5ICYB 4N2LA 5IVOA 3GDCA 2K6WA 2CUHA 2IDQA 3FFCA 3CXHJ 3OKEB 4DP0X 4QKXB 2OXHA 4ODUA 4QRFA 4WSJA 4UUJB 5E8PB 4X6CE 5L0QC 5ESQB 1UQSA 4NXKA 5F9JA 2DMBA 1R47A 4UMGA 1T0OA 2FHFA 3GXNA 2P5WD 2AITA 2CGZA 2MQ3A 4NOBA 3SY6A 3TC9A 3TT1H 3POCA 1TTGA 3U83A 1ZV5A 3HJEA 3VFVB 2K9FB 15C8H 2F53B 4L9LB 4A7UA 4WNJA 3D4GA 1W72B 1A1OB 2OW7A 3JTTA 3B7UX 1KCVH 5LG6A 4HUVA 3SOBL 5CM1A 4FC3E 5GXBB 3OAZK 1LL1A 2H7WA 2Z8WC 3UJJL 4Y2DD 4LBEA 4UNIA 3TNNB 3MRHB 4PJAA 1KJ3L 2BY1A 2QKIA 3W57A 3TGXA 3MNZA 1ITCA 2WNXA 1AQDB 2A6JA 2F5AH 3BSGA 1NBVL 1QBLH 4NQCE 1RURL 4UANA 3RL1B 3K0WA 3ZR5A 4TNEA 1JNLL 2VDLL 5BVJB 2Z64C 5E2UH 3VQ1C 4MD4B 2WUBL 4JO2L 4JDZA 4JFTA 4BH7B 3GSVB 2MCMA 3V52H 5AYUL 3KPSB 3LQZA 1KBGH 1RZ7L 1MG2C 4JFOB 5DRZA 3QG6A 2VDOL 3B56A 3O6ML 3L5XL 3EKCA 2BSTA 1P7HL 5H2BB 3LS4L 1T1WB 1YEJL 3FT2A 3PF2A 3SQBA 4UOW0 4D9RD 2ED6A 4P9HC 4XRCB 4C55A 1H3VA 2J2ZB 1FDLL 1CDYA 3F3HA 4NYLB 1IBZA 4N90E 5MHSD 5EDSA 2QVMA 5IMOB 3FQUB 2F8OA 1NCIA 3DHPA 3GI8H 1RCYA 1H0DA 2X2YA 3UPCA 2IVFC 5D2LA 2I9LA 1IC5L 2H1PH 1MFBL 3EGSB 4LOFA 5SX5H 4JZOB 3MV7A 3BKYH 5E8NA 4K0OA 2NUTA 5ANME 1YY8A 3UGUA 2YKKA 3QZNA 4BQCA 3FN3A 2WTRB 4MXWL 2BHZA 2CUIA 2EC9U 3F01A 1FZJB 3ZDWA 1KB5H 2CMRL 2FECI 3FTGA 2VDPH 3IDIA 1NUGA 5I17B 1CZ8L 3VUAA 5F7EL 3FSZA 1V7MH 4X5XA 4XN2A 4I3RL 3QFJA 4KXBA 5IKCB 1L9QA 3IKCA 3WUWA 5DA0B 3ULVH 3JWOL 3HLAB 3QUYA 2VJ8A 1JGDB 5AUMA 3TBBA 2GSGB 2Y1VA 3LZFH 4KX9A 1NFDE 1WPCA 3CFDB 5EU4A 5D7IB 4JEGB 4HUWA 4ZO7A 2O5XH 1DVXA 2CLZB 2X6BA 1UFUA 1PF3A 2K8MA 2W81C 5LBSA 3L3DA 4R2GD 3MMEB 4FI7A 2DH2A 4YR6A 4Y4FA 2PYEA 3RG1C 3VXUE 4C83B 3CN4A 3SGKC 3L2NA 1YMHA 5GRYA 3BUDA 4DPRA 2AEOA 4BSWA 3AC0A 3U7WH 5CGMA 4I3SH 2QT6A 5AVYB 2H6PA 2VW6A 3BUQA 4G7RB 5JLZA 2PO6A 1U8JA 2EINB 2H6OA 4WFGE 4N2NA 3BOVA 1T03L 5HI5C 1KGCE 3P40A 2JB6B 1FVDA 3B9VA 3CE1A 1RIVL 2VIRA 4P4KD 3L9YA 2EDDA 4M6OH 2VLME 3C8KA 1EXUB 2P1YA 5EU5A 4J1UB 4GBXD 4RGND 4OU3A 2OTUA 3H2QA 3BDYH 1WAPA 3QJHB 4NWUH 4OCSH 3LN5A 3HZMB 4F58H 2YD5A 1TKWA 1E8ZA 2C3VA 2KZBA 1C8PA 4QRRE 1OB1A 1EX0A 3VFNA 5JMRA 4TVSa 3TBWA 2AJZA 4HCRA 2EVIA 1FZOA 3BFWA 4JFXB 2CO1A 4UTAH 1DQQB 4FP8H 3EOAB 1JXDA 1BF8A 3DTXB 4YSRA 2A77L 4BZ1A 4DNLA 1YEHL 4GUQA 1TZGL 2IH3B 2ZKWA 5HGAB 1YUKB 5KYYA 4QRSA 3QIWD 1MRDH 3UO1H 3WHE0 1CLYH 5LGKA 4WWNA 4XPHH 2YOAA 1P4LA 3SY0A 3KLHC 2PPDA 2SODB 3DIVA 4H8WH 1P84J 1T20A 1U8NA 3WLWD 2ADIA 3E9TA 3CFKB 3EFOB 4ZUVB 1OOWA 1AKJB 2YPVL 3KWVA 4DN4L 5CEXB 5TQ2H 2APVA 3B6SA 3FNKA 3HE6A 3IM1A 3GSXA 3CU1A 2CHNA 1TO4A 3E8VA 5ABAA 4ODSH 3SGEH 1YQ2A 4OM1H 5IVZB 4XCYB 1JPEA 4JRYB 1T1YA 2WLYA 1MF2H 1YECL 4A38A 2NQDA 4WK4B 3GJFH 5JXAL 1AHWA 1ZEAL 1DL7H 2JKLA 4HPOH 4PTTB 4YC2B 3UACA 1WISA 2X4RB 3EYQD 5L2JB 3L4ZA 2DQHL 5KBPA 2C5DC 2XDHA 2PR4L 1L9RA 4QWWC 5ALBL 2WOBA 1FNGB 3WIHA 4QY8A 1H5BB 5KWYC 1OHZA 4JFQA 2F68X 3QUKA 2VZUA 2F6AA 3P77A 3HE7A 5E5LA 4AEHH 5E4OA 2KQNA 3OC8A 2VN6A 4HXAL 1VHPA 1SEQL 1WZKA 3DJRA 4G7SB 5KSUA 1F6AB 3NK3A 3P9MB 4DUWA 4M6AA 4L05A 3BD5A 4HIEB 4JFSA 5EZOL 2DQTH 4HH9B 4YDIH 3TH3T 5K33A 2OJEB 4AQEA 1BBJB 5EOTB 3MLVL 4LLUA 4JS7A 1MAKA 4A6YH 3U30C 4NC0B 1SHMA 2GY7B 4A7SA 1DO5A 3CD4A 2DQJL 5EZPA 3LQAC 1IAMA 1SDYA 5DK2A 2E27L 3PDGA 3GRGA 2LLLA 1U91A 1QACA 5KSAB 1QNZL 3P0YH 1A7OH 2XVBA 5BNXD 5DO2D 3T0XA 4J28A 5GRUL 4TLSA 5INDB 1B2YA 4FE9A 2F8XC 2DTML 2C3HA 5MEPB 5HHPB 1AH1A 1LEKB 3S5LA 1KTLB 2J8UB 2H3XC 3VI4F 4K3DL 5F96L 1HKFA 1M6UA 3V5KB 3EXLA 5DJ2A 4Z7WA 5EF0A 4A37A 4UAOB 1BP3B 1P5UA 5TH2B 4OZHF 3V4PA 3KDPB 4FOMA 4HYTB 1WAAF 4PVLA 3T1FB 1QFUL 5I8OL 2YLHA 4R7NB 4P2OD 4XVUD 1D5XB 1QMUA 1N0XH 3LEYH 4PWFA 1ADWA 5C0ND 5GISH 3TCLB 4F20A 3NRQA 1TSRA 4Y5YB 2A9NH 3D85B 1SBBA 3N9GL 2AK1H 1BFOB 5IM7B 3SN6N 3DX3A 3MLUL 3MV01 3UTSA 4MJ4A 5HYQA 5TTRA 3CDGA 3QUMA 3HN8A 4OD3H 3DIFB 3NFPB 4FG2A 5EHFA 3TA3A 2WINB 3QI9D 4HDIA 3HB3C 5F2FA 4NKIL 4NNXB 3GIZH 3HRZC 4P2YA 4I4WA 4PB0H 1W91A 3WTTA 1XBDA 3NPSC 1QYGH 1ERNA 1J0HA 1LP9F 4JRXE 4IS6B 1CE1L 1M7DB 4Z3GA 1E4HA 1CGYA 1HIMH 3Q1SL 4XP9L 2X4SA 4F3FB 3CMGA 3ZYJA 3HG1A 4HGKC 1J18A 1E5CA 5DMIH 2Y72A 3KS0J 1N5AA 2J6EL 2VT0A 5CUSL 3PQYD 1FO0L 2ZG2A 4JFFB 2VDNB 3W38A 1MFUA 2YLKA 2RBLA 3F00A 5A16A 2IGTA 3VFWA 2DQ6A 1S7VA 3ILPA 3TJEH 2O6CA 3L45A 2PYFB 3ASWA 3RIAK 4PJ5A 2JTYA 1U0QA 4TTGA 4NHUA 3KL0A 4K23L 2PWDA 4G6KL 1SNRA 3CSPA 1SUHA 2VLRA 1QAWA 4JJ5A 4NQEA 2N7SA 2NLJB 4XBPA 4R6UA 2Z31A 1PIGA 3AT9A 2OMTB 4IGBA 2EH7H 3V55A 1HCZA 2CBOA 4U3CA 2K4AA 2WTPA 2DQUL 3BQVA 1DO6A 2NXZD 1I7TA 3EDDA 1BECA 2P47B 4LLDB 5DVMA 4KK8D 3MXVL 4OIFA 3FRUA 2KHAA 4UZUA 3PAVA 3M8OH 3VXMD 2ENYA 2D03H 1R33A 4J3OF 3T3PB 1I9JH 4PWHA 1OE1A 4Y2DC 2UX7A 4CVZB 1JWMA 1BX2A 2EKJA 2O1AA 1NGXA 1A8JH 1G7MA 4P4KB 4BDVB 2HUHA 2ICEB 4LQFL 1IAIH 1JVOA 2CK2A 1CK0L 2G2RA 3RIFF 5EBGA 1IKNA 3NFNB 5FLUA 3SZKC 4Q8BA 4BELD 4YMPA 2W9DL 4NNPL 2Q3XA 5CJXA 1NLDL 4KTGA 5FUCE 4P9MH 5E9DE 2IMMA 2XBZA 3DNKA 4ZPVB 2J25A 4AQ1C 4JY5L 5EULV 4WO4B 5BUAA 4RA3A 1GMIA 2GIXA 4IW4C 1X6LA 4XPTL 4NO3B 2Q0ZX 1P7KB 1ZVSA 5FECA 4DZ8B 3ESUF 5EF2A 3VGAB 4EN3A 1ZE3C 3NP4A 4YAQA 5E4AA 3X1NA 4GG8A 5I1KL 1HE7A 1IV8A 4APQB 4MQXD 1OK8A 1COBA 3N1FC 1CLZL 2EVJA 3KLKA 5C7ZA 5B21A 1OCOB 3GKZA 4FXKC 4PWEA 3PWJB 4NJAL 3PG2A 3UEZA 4X6DF 3OMZA 4LEEA 4Z0BH 2JI1A 3GMMB 1ZGLP 3VM5A 5C86A 3RL2B 1HYRC 3ES6A 4MA1C 3ALWA 3INOA 1FN4A 1S7RA 4UQ9A 4UNVA 4M3HA 2BOBA 3ELAT 4M7LL 3BWAA 4A2LA 2P8MA 1HNFA 3SE8H 1BBDH 5D1QA 4I0PA 1BD2B 3RWHA 5D4IA 1KGXA 1X7QB 2XKSA 1MEXH 2XNAA 5LGJB 1PCSA 3MRKB 4XC1L 2BIMA 3OB0H 3D25B 2A74C 3JWDL 3BIKB 4J27A 4PSRA 1AD0A 3RI5K 2BP3A 1JZGA 2WZ5A 3U4KA 4L18A 2VR8A 2FIKA 5I23A 1IGYB 3BW9B 5DMJB 3S96B 3X1EA 1DLFH 3ESPA 5BUPA 5HYSG 4FMVA 3ZHLA 2Q86A 2YGNA 1TZIA 4JZNB 3CVHB 1LK2A 2D9CA 3NIFB 1FL6B 4PB9H 4PGEB 2VMDA 1TJGL 1U21A 4L4TB 1C16A 3IMRA 4NUMA 4IOIB 4MJIB 1EIBA 5GS0L 1IAKA 2V2XB 3QC5X 3X3FL 2B4CL 3CLEL 2YAEA 3REWB 3KYAA 3I3BA 1KTDA 3IFOA 1UJTA 4P2RD 5IFJB 4R2GC 4LCIL 2AV7B 4KRNA 3RDTB 1GKEA 4TKWA 4U1LA 4R90H 3GIVB 4UM8A 2EYTB 3HNSH 1I3GH 2OK0H 3IDNA 1XB8A 4I2XB 2FEJA 4PRHB 4UB0H 3P9LA 5E03A 3EHBC 5I6KA 5HGBB 3U4EA 1ZWIB 4OLUL 3QIUB 4WWOA 4E5XG 3CH8A 3N3EA 4P04A 2L7UA 4GAGH 2JTDA 3L3OC 4B53A 5IMMB 5FOBA 3BVNA 5HYJE 5D6DA 3QYNA 1TDQA 3EH5B 3H2WA 1GOFA 1F0LA 2XICA 4HIQA 4P4KC 2E0PA 4AH2B 3OSVA 3WTXA 3BGAA 1S3KH 3DARA 3GSRA 2OP4L 1ED3B 4ONGH 4RSYA 5LBVA 3UDWA 4GBXC 4BWTA 4Y5VC 3QDJD 4RGNC 3TBTB 4Y9FA 4ONFL 3TBCA 4QLRA 1UCTA 5JHBA 4YDZA 3GMQB 3CC5B 4MDIA 2NUPB 5EORL 1W8NA 4DN3L 2DQEH 3V6OA 1ORQA 4LCVA 2OMYB 3P3UA 2BIPA 3BQUB 2CO6A 3EO1A 1RPQA 2XBDA 1DDHA 2P44B 4PJCF 3RVUD 4AC4A 4OIIH 4L3CA 1YLBB 5TDPB 5EMYA 2EDXA 4IOFD 1KIQA 4N5ED 4RH4A 2D7QA 3IPEA 4LFHG 1U3ZA 4DO4A 1S7XA 4QJ3B 1VESA 1A6UL 3H53A 2KLSA 3QIWC 3S35L 4W9JC 3IFLH 1X4ZA 1AI1H 4F57H 3I6GB 3Q2CA 4BV1A 2ZAHA 2QADD 4MMYA 4X6EA 5DWUL 3DVGB 1I7RA 1BFVH 4LCCA 3BIBX 3SSGA 1UADC 1M2VA 4QXWA 3WLWC 3U6XS 3V0HA 3V5DA 3S3BB 2Z1PA 1FAKT 3FSOA 4I9WD 3TT3L 5KW9H 4JMXA 3EJCA 5I75B 3CZSA 2I5YH 3SYCA 3P2BA 3TVMB 1U3YA 3K6NA 1K3IA 4CC1A 4D0DA 4YL9A 4IDJL 4PJAE 4JY6B 4F80A 4IIQA 4DCQB 1R5IA 4L37B 4PRAA 5IFHL 3CSYA 4XX1E 3PJSB 1PW3A 3EYQC 3SBWA 2J6WA 2M26A 2B3RA 5IBUG 2BERA 3ULSB 1A6ZA 5MP6L 4XPAL 4TSCL 3PWVA 3A24A 2DLTA 1HCFX 2O5ZH 4FQHB 3T3MB 2NX5D 3QG7L 4W1TA 4Y4KB 1G6RH 4D2NA 3IEAA 3WSQL 4AQAA 1SHSA 1ZT7A 3SDCA 4AYID 1RUQL 2WMPB 3D2UB 3HUJE 5JDSA 1WE5A 4KKRA 4U6TA 1NPUA 5FHAH 3RTQB 3UTQB 1I53A 5F6HJ 5BJTB 1U8MA 3EOBB 1DQMH 2EVHA 2NW3A 4ZFZA 3V0JA 4D3CH 2ZXQA 3P54A 4OKVA 1KYAA 4ELMF 8PAZA 2PXYA 3NG5A 3IE9A 2XOTA 3GSOB 5DSCB 2VISB 1UD8A 4XVJH 3H9SA 3WENA 1UJ3B 5B1CA 1S7WA 2FLRT 4PSPA 1E5BA 1KJ2H 1RUMH 5D2LE 3FO2B 4YQXH 5DD6A 2B0SL 1BVLA 2FRGP 1MIEL 2Z7ZA 1CXIA 5DO2C 2BO0A 1IGCL 3MODH 1RQ5A 3O9WA 1J8HA 4TUJB 2AI0L 4U31A 1EK3A 3GHPA 3RGVD 3LKRB 4UNTA 4KZDL 1LHZA 1OF0A 4YE4L 4WK0B 3HI1A 5JHLL 2M83A 5E1IA 4OCNC 2IF7A 4XMKH 3T71A 4I48B 4G1EA 2AMGA 1XL4A 2C3GA 3O2DH 1N6VA 2VO8A 3FB8B 4P2OC 1FI8C 3H7BA 4PV9B 4XVUC 5C0NC 5ADPH 4L8CA 3S34L 2GTZB 1E2VA 3I6LD 3PWUB 1CDIA 5I19H 1E2ZA 1KELH 3UBGA 3D50A 3U1QA 2C9UA 4JVPA 4FZ8L 5BMFH 1Y0LA 1BWWA 3PUUA 2H8PB 4XCFL 3W82A 3QI9C 3WCYA 1Z5LA 1CI3M 2EE2A 3RX7A 3F12B 3NCBB 1FYHB 4KUCF 3WHXB 3T4AB 2FHCA 3RUGA 1U3HA 1ZY9A 4MX7B 2PYEE 3UROR 3LX9A 5B1BB 2AJSH 4FNLL 2CBMA 1G1YA 2F5BL 3ARFB 3UEQA 2X87A 3K91A 1A5FH 4BHUI 2J6EA 3VCLA 1VIWA 1FO0A 3HPLA 1RZIA 2NY6B 5K9JH 4AT6B 4ZZFA 1JD9A 3NJJA 5JIMA 3Q8BA 2J20A 4NS0A 3N0PB 2QLYA 3DRTB 3GZKA 1PY9A 35C8H 3D9AH 3F83A 4X7CC 4XP4H 1NMAH 1EEUA 4K8RD 2FZ3A 5FGCB 5IHUL 4ZXBB 2DIJA 2HX9A 2NY5L 3PDOA 3BKCL 4X98B 1I9IL 2YUVA 4MWFB 5C71A 1GAFL 4DQOL 4H1LA 3C2AL 1J05B 2NXZC 2JSFA 4N8PA 3AROA 3MFFB 1BZ9B 1Q9KA 4KK8C 2VL5B 3A6OA 1SN0A 3BGMA 3QUZD 3L9RB 2IAMB 2IPKA 1UEYA 1OZUA 3LRHA 4FQ2L 4AG4L 3O3AA 4G6FB 1X9QA 3IXAB 2BZ7A 1MLBA 3EJJX 1WJ3A 1FHNA 4Z7OF 2AHIA 1KPRA 4M62H 3ZYZA 4MQ7A 4CC0A 1SLUA 4AX3A 3KPRB 4H8HA 4HCFA 4K71C 2P48B 2EE6A 1A0QL 1TUPA 1QSFB 3KYKH 3VWKB 5JPMC 4EI6A 1DBBL 3H9HA 3ULUD 5FKPA 4XBEH 2C3WA 4FZEL 4XNMA 1UOLA 1M9WA 4KO5A 2DDQH 3S3PA 1ETB1 2BHFA 1I8LC 4F92B 4F9PA 1PLBA 2ODIA 3B7YA 4EUPH 3OKMA 1IM3B 1HH6A 5DQJB 4MQXC 5D7SH 4JY4A 3BAEH 4GFXA 2VLKB 1I3VA 3CSGA 1E9OA 4LRNL 3SEPA 3MBEB 3MA7B 1OAYH 1L6PA 5FW6A 4PWGA 1AHMA 1T22B 2LU3A 3L3HA 2GTQA 2A6DA 3IS1X 1A7RH 4XXDA 3VRLF 3DIDA 3FQWA 5F8RC 1T5XA 6TAAA 2A6IB 1NUDA 4HPYL 3MV8B 1A9EA 1FFOA 1R19A 1UA6L 4KDVA 4L5FE 1TVDA 3O2VL 4WFEE 4CW1A 1NL0L 1NPJA 3PV6B 4TNVF 1J0ZA 3TBSB 3UBHA 1AR1B 4LF3B 5K59E 1MQ8A 1YVLA 2WXLA 4R4FH 4QHMA 2B3IA 2YPKB 1NIAA 5C0BD 3B1TA 2VH5L 4GXUM 2WBJA 5F3BB 4NGHH 4KBPA 3EFFB 3UZEA 3QDMD 1OF2A 2ZPKL 4PJIA 2BOCB 2YBGA 3LIZA 4Q9QL 4QNPE 2EYRA 4HIJB 5BV7C 4DP2X 5I73C 2BIQA 4LCWA 1IKOP 4FEIA 2WVVB 4P23B 4HGMA 1JGVL 3J27A 5LN4A 2P5EB 1IEBA 2V5MA 3F62A 2EDEA 3IF1A 1MELA 4GAJH 5FYJU 1I4FB 1CGSH 4N68A 4IRZL 2PNDA 4IMLB 2QMJA 1H6EA 5I8EB 1CO1A 4N8CL 1PSKH 3EYFB 5I1DB 5IHWA 1QG3A 4OVUA 1UKTA 4WJ5B 4X6FA 4U1HB 2MEJB 3O6FB 5B39B 4JM2A 2J21A 4JHZA 4AE1A 5DVKA 2R9HD 3FB7B 3TEWA 1NANI 1CGXA 4J7RA 3D69B 1MLCA 2P7TB 4WHTB 3D3VD 4UQAA 5E6YA 3U82B 4Q97A 1J1XH 3ZY7A 1U8OA 2NYZA 3ARSA 3VU1A 1CI5A 2JKRM 3UTSE 1LD9B 4N2CA 3VFRA 5B38G 5D5MF 1WFOA 4ZSOA 1QSEB 3ZDYB 4QKTA 1PYWA 4E9LA 1KENH 3U46B 2E76C 5C7XH 2DQIH 1QHQA 3ZL2A 1CS6A 4K9EC 3GUFA 3E38A 5CMAB 1IQWL 3NDYE 3ARDA 5JHDD 3KCWA 1KCLA 4OLXL 5G4OA 2AVFA 2K1MA 2HRHA 2W65A 1PJ9A 1D5BB 5B22A 2ZP9A 5LAXB 4G6JH 4JQXA 1KLGA 4PY7B 1W0VA 2IFFL 1AXTL 4W9LC 5KJRH 1OCCB 2GJRA 1WT5C 3K3QA 5D7JA 3HG1E 5EIIB 5C07A 5MEQA 3H0TA 1F5WA 4Y88A 4AZUA 3RLSA 3RVUC 2XPGA 1H8LA 4XCEB 2VABA 4N5EC 4RX4A 4YJZL 2XWJA 2IANE 4HS3A 4OZFH 1IBBA 1LO0L 1NUNB 3VXRB 4AOFA 3BXNB 1BSIA 2DIBA 3OAUL 2X3BA 3K4DA 1XF3A 3ME0B 1KB5B 2BH0A 4MS6A 4OIAA 4OZGA 4AJWA 5HP5A 2VLRE 2VDPB 3EDJA 4N1CA 4NQEE 1U9KA 4O4YH 3TZVD 2UWEE 2QADC 4GAFB 5FFGA 3QYCA 1B0RA 3DRQB 4C8XA 2HT4D 1A8ZA 4MRCA 5E94B 2KBGA 1JZEA 5KVFH 3N42F 4B41A 1KJMA 1U58B 4ZYKB 4NUGH 2DV6A 4XMTA 1M71B 5D7LA 1G9ML 2Y5EA 3F6IA 3OMAB 2XACC 3IJYA 1FH5H 3E3QE 5I5JA 1AVAA 3NGBB 4BA0A 2A4CA 2XG5A 1AO7D 3RB5A 2V9RA 4K3EH 1J88A 4APXA 1F1GA 1N4XH 1WZMA 2MCPH 5CCGE 4BXSV 4WCYH 1VFUA 3AG4B 4N90D 4MXVE 1FG2A 1UT1A 5CBEA 1DVFB 1KN4L 3RVVD 5HHQA 2HLEB 2Z0BA 1CT8A 5EF1A 3LKSA 1F02I 5F1IB 1XF2B 2XFGB 4JKPH 4C56A 4EIGB 2JLLA 3EG9A 5AW1B 1LDPH 3FO9B 5DZLA 3PXJA 4QHKI 5E6UB 1UURA 1T83C 4V1DA 4KPHH 1CTMA 1RHHA 1F2QA 1KIUB 4O58L 4CBPA 3HBQA 1UB6A 1GW6A 5CJOH 5IK3A 1FP5A 5ENWB 1CGTA 4JHWL 4UF7C 3QQ4A 2IDSA 4WFFE 4XMPL 5CJQL 4JFEA 4QOKD 5DJDB 1T0NA 1RZKL 3GMNB 5LWYL 1NGZA 2AEPL 2R0ZL 3BH8A 3OD3A 4FFZA 1IM9B 3VG0H 1R0AL 4UOJA 3LEXB 1IAOA 5MEOA 1AOZA 1DJHA 3WLBB 2APXA 1XIWD 5DDHB 1JFHA 2BSRB 3MGTB 1V7NH 4HIPA 4XWOD 2Y7NA 3HZVB 1CDGA 2IGLA 4NJ9L 2R0LL 5D1QE 4DVRL 3U6RB 2DWYA 3L9EA 5E24E 5BO1H 1MCOL 3RGVC 3DV6B 2PPFA 3X3GH 5AENA 3UGXA 1Q8MA 3ZT5A 3DX1A 5BRZE 3QYMA 5FHBL 1P2CB 5AB9A 3VXUD 4GW5B 3ETTA 3LZNA 5LXVA 4Q9RH 3SCMA 3DUSB 3VSTA 5IIEB 3MV9A 5F1SA 3FOLB 5T1DL 1WBYB 1LE9A 2IADB 1OSPL 3ARVA 2ICWI 3WEXA 4U1MA 1A66A 4UTCA 1CDCA 5FPIA 2BS71 2A73B 1AS8A 4NT6B 1D7BA 5ID0A 3CN3A 4DKTA 4UIMB 3P0VH 2OTWB 1TYRA 4X9GA 4LASH 2C7UB 4L4VB 5E5MB 1JDAA 1JTPA 1PFCA 2A6KA 4U1NB 4FFYH 2R8SL 2OQJA 1OKEA 2Y1AA 3GJFB 3OHXC 2ITDB 2FHBA 1B0GA 5GRZA 2EIDA 1INDL 3QIBD 3WFBL 1E7VA 3SBPA 4L3ED 1JXGA 4X9FA 1KWKA 1XF4A 2HVKA 4G43A 4CSZA 1YNLH 2BNRA 4TVPH 1Z9MA 4IMKC 2V5RA 5L6YH 1UZ8B 1F4XL 2L3BA 4RRPA 4AW4A 4DIXA 1VLXA 2GAZA 3B2UD 3LQMA 4Z7UB 1N2RB 5EZLA 1XF5B 2CG9X 5IF0A 3RWDA 4K8RC 1YY9D 3ZT7A 1DZBA 3QB7C 4BQ6A 1N6QH 4OI8A 4PHZA 1K5NA 5JIKA 1PKOA 5HDQH 3IGLA 4NKMA 1D6VL 1MREH 2YRPA 2FQDA 3QFGA 3VXSD 5I8CA 5IEHA 1Q0EA 2B9BA 3HOGA 4PG2C 5CINH 4A6YB 2HKHH 2IPTH 3D39B 5KVDE 1D9KA 3NFSL 5KYXB 4JLRA 2GB2A 4P3WA 2X3AA 3F7VB 4PRDA 2GG1A 3QUZC 3O6KH 4AGOA 5IUSA 3U7YH 3HZYA 1XGTA 3LDBC 1O9ZA 1JZ7A 1ES0A 1IGTB 5DR5L 4HLEA 3TNMA 2VLJB 5DI8B 3KPLB 1BZOA 4WTZG 3QXAA 2VKXA 3I9AA 6CGTA 2Z8VC 1HEZA 3OM3B 4PR5B 4XN7A 4LLWB 4NZRL 5J6HB 3OKDB 4NKQB 3BWUC 4GRWF 1CFSB 3TFBA 2HRPH 4NNYA 4I18B 5A6MA 2ZE0A 1G9EA 4IEFB 3GINA 4JDVA 3NABH 3JZYA 4RZCA 4KTDL 1AD9B 5ICYA 2F54D 2AABH 2DRUA 2DYSB 2FBJL 1GGIL 3NP3A 1M53A 4BM7A 1KXQA 4DPBX 5FCUH 3ULUC 4OCRH 2VDNL 4WW2B 1L4IA 2HH0H 2BNQB 5E8PA 4NN7C 1AOHA 1AFVH 4LLQA 1PBYA 3BCFA 4OFVA 4S1QL 3BI9X 3SO3C 4GAYB 1RK7A 3FONA 4MZ2A 1CE6B 4QYOB 2Q6WA 5JORB 3ZMNA 1LILA 1WGVA 5FO9B 4Y4HB 3C5ZB 3E80A 1RK1A 4JFWA 4DH2A 1IBGL 1K8IB 3HA0A 3LS5L 1L9PA 1XL6A 2BHYA 2F53A 4L9LA 5GRJL 2EE3A 4FKKA 5AOMA 1IT9L 3QORD 1FJ1A 2HVJB 2NZ9D 3D1MC 3Q8EA 4WLCA 4L8DB 2GT9A 1SYVB 1NCCL 4UMSA 4ZS7L 7TAAA 1SZNA 5D96B 2MHAB 1O5DT 2XC8A 3UTZB 2H2PC 3NIDE 5J1TC 3LH2H 4OGXH 3JTBA 2DKSA 3F58H 2P42B 2VDKH 1NCWH 3IJ8A 2CR0A 2NXYD 4OB5H 1MFAH 5IKCA 3HC0A 2OSLB 1GS6X 3GMPA 1G7JB 3GJEB 2QSCL 3VXNA 1JFQH 4KK9D 1WHPA 5DD1L 5C9JA 4PGDB 3QQNA 1KYOK 1R1CA 3PWLA 4NLAA 4HLZH 3K81A 2CSPA 4Y1AD 3BEVB 4YHYC 2XN9D 3H9SE 3RL1A 3AREB 4L29A 2NY2D 3N2JA 3H6JA 4KROD 4U6VL 2VYRE 4MD4A 3WTVA 4F8TA 2WOYA 4BH7A 1BZ7B 3JWNE 1XH0A 2OMWB 3ZSSA 4ONHB 3KCPA 3NK4A 3HAEG 3O11A 3CXDL 4R5TA 4FI6A 3WN5C 4D0BA 5H2BA 1CBVL 4G9FE 1J8HE 1BZEA 2AXHA 3KGTA 5EC2A 3JSSA 3SDDD 4E9TA 3WD5H 4JDTL 4S2SB 4TSBH 3ZR6A 1F3RB 2QTEA 4XRCA 2K78A 1IEAA 2J2ZA 1U92A 3SKMA 3VXTA 2E7DA 3PV7A 4WV1A 1G7QA 5CHNB 5C09E 2YAOA 2R9HC 2ESVA 2X5PA 4PJBB 4YHKH 4MNQB 3WEAA 1U95A 3EYOB 1R5VB 4XP5H 1JHTB 5FW8A 3BLPX 1C5DB 4JZOA 3D2UD 1KCRH 2GUOB 3T0EB 4ATTA 1NWPA 3HHSB 1T1XB 2WTRA 5BRPA 5C0DB 5CEZH 5DURD 2EXTA 2W38A 3KYMB 1NCAL 1IE4A 4U0RB 3GNMH 3V7AG 2Z8SA 3FF7A 2BCMA 1QFWL 2PTUA 4LSUL 4PAZA 3T6ZA 1MFVA 1GOGA 3T08A 1DQKA 4XPGL 4Z3HA 3I6KB 4TOYL 1NQBA 3KPTA 3RP1A 4ZMLA 4WEBL 4YHZL 1FIGL 4LSTH 3N40F 3O3DA 1BMZA 2Y2TA 1EEQA 4PJXA 5IB3B 2X7LA 4ZUUB 1JGDA 3O41B 4P2QB 4TRPH 3CVHL 2F0CA 1Z7JA 4LRIA 3S98A 5FYJL 1NMBH 4BFRA 4AENA 1IB5A 1QFWM 4N86A 3ABGA 5FKAA 2WKOA 3EZJB 5JW3L 5IT2H 3LPOA 3C2SA 3MMEA 4PJGB 3GRBA 3GLEA 5DD0H 4C83A 2JJSC 1TETL 4GSDL 4GW4B 5GGQH 1MVUA 3VVWA 5KYWB 5HVHC 5C0CD 3CPLB 1E4KC 5D93C 2YKLL 1KJVB 4JFYB 2AFNA 2HT4C 4Q6YA 2Q8AH 1ZLSL 2X05A 3BN9D 3MRRA 1ZHNB 5CZRA 4BK8A 3W9EB 1XAUA 4JHBA 4GG6A 3NCJL 3KHOA 3QEQB 1OAQL 4XNYH 1U2CA 5BS0B 2WLIA 3VGFA 3V9CA 3AB0B 5I28A 1S9YA 3C8DA 2AEWA 4R0LA 1I7ZA 4J1UA 1QASA 2WSDA 3MLXL 4RAVA 4AGMA 4XOCA 2W91A 5CZVL 2FK9A 2HTLC 5LNDA 2YD0A 3TH2T 1H3PL 1K2DB 5E56A 1P9MC 3OXRA 5EPMA 1UVQB 3QRBA 5AOZA 5F9OH 1FNFA 2WUCH 5LGHH 3DMMA 3WFHA 5IR1B 2HX7A 4MD5B 2D7NA 1T2QH 3C60A 3FTXA 1J86A 4PJEA 1DQQA 4W9CC 3VXQA 3INUH 1MHEB 1OCRB 2E3VA 1T0PB 3IBOA 1TU2B 1FFPA 4HF5L 2XXFA 3I9GL 1FFRA 5AW4B 5IGXL 4OFQA 2QV2A 1D5MA 4H2CA 3LMJL 2EVFA 4GO6B 3T8XB 3B4NA 3IJSB 4Y19A 3G7TA 5E6ID 3D33A 4MNGB 1AE6H 3RWJA 5IREA 3ESNA 3GSUB 4HV8B 5TQ0H 5A40E 3RIFK 2LFGA 3NA9L 2DW5A 4MAYB 4Z3EA 5JPNC 1DJZA 3V0VB 1BM3H 1R4XA 4OLVH 2DD8L 4FLOA 4XWOC 4OLYH 3VGBA 2YRLA 4N2MA 2ZKYA 4PJ7F 4A04A 1N12A 2CDFB 5IVZA 2JVUA 4JRYA 3V6FA 5MENA 4LLYA 4O9HH 1CGUA 1XSKA 2DEYX 2V7NB 4PTTA 3OKYA 2IC2A 2BS8A 2EACA 1YYLH 3ABMB 4NPYB 3QDGB 1N68A 2C26A 1QP1A 2O4EA 4M8QA 1M3IA 1R3KA 2AV1B 1UCBH 3NCFB 1CJYA 1JNJA 2YPLD 1A7PL 5B1JC 4DP6X 1MJUL 3LXBA 1AQ8A 4AVKA 4Y7OC 5DVOA 5L2KA 4YNYB 4PY8J 3VWKD 4LCWE 2CLRB 5DK0A 5I6NA 2ZCKH 1OM9A 4HJGB 1G9NC 5LBSH 1I3UA 1SMOA 5E23A 1URLA 4XNBA 1F6AA 4F8OA 4OZHE 4WVRA 3QO1B 3HTLX 2CLVA 4OGYL 4HU2A 1W6WA 2HN7A 5C0RH 3RX9A 3DJZA 3BPNC 2DYPB 3V9FA 4Z77B 1TTBA 3QIBC 4QXGL 1JV2B 3MJ7B 2GUYA 2EUXA 1G7PA 2VWEE 1OCWL 4ZOBA 1G6RB 5KSAA 4R4NC 43C9A 5KANG 4XO4A 2B5IC 1FL3A 4HHAB 1KFAH 3SDXA 1NKRA 4HKXB 1HKLL 2R1WB 4ZSOE 1AR1D 4KDTC 3VDCA 1YY9C 1KTLA 2J8UA 5AZEH 5HHOB 5A2JH 3LV3B 5AL0A 3DVNB 5LQBL 3ZVVA 3DO7A 2WP3O 1XCQA 3R06B 1JZ6A 1NJ9B 4IBSA 1HQ4A 2AEIT 5C0AD 4MJ2A 3KNBB 3RAJH 4LVOC 3UL4A 4JDEB 4HCRH 3EDEA 4KTEL 4PS3A 1VPOL 4P2AA 4LSVH 1KJ2B 4RNRB 2FUQA 2RGSA 4G5ZH 2CZNA 4GRLB 1BFOA 3FUKA 5H94B 4A68A 5DMKB 5C07E 4I9XA 5JW4M 4QGYA 3MKKA 1KDIA 4BZ1H 3VX0A 3DIFA 5IFAH 2UZXB 1NEZB 3P73B 3VG9B 5DUJA 2DQCH 4NNXA 4YGVA 5MERA 2WLJA 2JQAA 4M5ZH 3AXHA 4L0YA 2GITA 1ZLDA 2X4TA 3O6LH 5EBMA 3GBML 2MNJB 3FTUA 3S48A 5IJVB 2ED9A 4OCLC 4ODTL 1MUJB 4PVNA 2QFPA 2W60A 2XWDA 3U0TA 3D8MA 1E50A 4J3SA 4PJHB 4OQ1A 3PWPA 4E0RB 1EANA 3P30H 3LJ3A 5T1KA 1N59A 1MVYA 3FAWA 5J13B 4WUUE 4X2UA 4RMUA 1Q90A 4QO1B 4YFLI 1YEGH 2CJUL 1CYXA 4JFFA 2PP9A 3W39B 3UYPB 3BC9A 2GK2A 1FV1B 1VGEL 5D7LE 3NTCH 1F58L 3SQOH 1C12B 1C7TA 3II3A 4YDLC 3FCTA 2FATL 4X8XA 4ONOA 1N70A 5LNEA 3TEZA 4S0HA 5IWLA 1CD1A 3NJHA 4KMTH 1VKXA 5ELIA 1XO8A 2E75C 3WIHH 2QKSA 2ZOOA 5EN2B 2NLJA 3CUPA 1G87A 1KPUB 3SDYL 1QSZA 4PGJA 3CSBA 1NMCB 3ILQD 3PWNA 1A21A 5T3ZH 2J3SA 1DE4A 2UUDH 4L5FH 1T66D 1F41A 5DS8B 1LO5A 3QORC 2NZ9C 2BNUA 4KY2A 3CDZB 1VA9A 4C56E 1I8MB 4HOZA 1EZVX 3RZCD 4X6CB 3BAIA 2AGJL 1A6PA 4QIRA 3QZWA 2AQ3A 2R1XA 4HETA 2DWEB 4A7GA 1NINA 3BAKA 1DVTA 4HA1A 2X70B 1IQDA 4KK9C 2FB4L 3ZQXA 1DBKH 1W16A 5KSBF 5JW4Q 1TEYA 4X6DE 1J5DA 5GS1B 4JFEE 2QSQA 2VSCA 1SGKA 5CEYB 1EMTL 1XSJA 1GC1L 3NFNA 2QPFA 2NY2C 4KROC 1MDTA 3ZE2E 1NH6A 4NZUH 1NCBH 3A47A 4RFEB 1NGWA 4ZPVA 2YEZA 1L9OA 3L6FA 5FV2A 3KYOA 3JV6A 3ULVD 1Q9LB 2YUXA 1BVKB 4NO3A 2NSQA 4KI1A 4AKOA 3CV5A 1PLGL 1HAUA 2QSVA 2QPEB 5GHWH 3SDDC 5EC1A 1TO5A 5M95B 4YXHL 3V4PH 3U4AA 2AERT 3KL3A 5CD5D 4NQCB 4WWPA 3AU1B 3D48R 4PRPD 1F90L 5D6CA 4APQA 3IJEB 3G5XB 2EAEA 3X14B 2ZX8A 4PYHA 4Y2NA 5I71B 1HESA 4MFHA 4NQVB 3O45A 5FWQA 1MCKA 2NT1A 2VDQH 5HHXL 3B9KD 3VFGL 4Z76B 3BRFA 4F33A 2D7PA 1UWGL 3E6FA 3GMMA 3MV9E 3A22A 2COVD 3QUMH 3ZO9A 2G9KA 2ADJA 3LN4A 3FYEB 2N4IA 2G2PA 3L5WB 1LQSR 1HE8A 5F9WC 1ZA6B 3BP5B 5AALA 2VQ1B 5EU3A 3I02B 4R96B 3A6CH 3JVGC 1X7QA 2BK8A 3G6JF 3KPNA 4O02B 3MRKA 3QEHB 3D25A 2X1XR 4EUPB 2DF3A 4HH8A 1SDDA 4PM1A 1E27B 3IDYB 3X1FA 2YQ3A 1CFTB 3PP4L 3IRZA 4GXUN 1JXKA 1UB5B 1PX3A 15C8L 5ANMB 2XPYA 2BNRE 4JZNA 3CVHA 4WI5A 2VERN 1X5HA 3L95B 3WTUA 3M1BB 1U36A 8FABA 4L4TA 1KCVL 3L1OL 4IOIA 2Y3AA 2GJJA 4NQDD 2HJKA 3REWA 5DS2A 2MPVA 3RPKA 3IVKB 1T7VA 1ZK9A 4KZEH 2AV7A 4PJFF 4EBQL 5ACZB 2ENJA 3ZL1A 2ATPA 4I0KA 3SOBH 1EJ8A 4W81A 2VQTA 3DPBB 5F1NB 1OAJA 4X5QA 2DWSA 5CGYD 3K8MA 4GUPA 4R3SA 3BN9C 3STLA 3UIYA 1AC6A 1NFDB 2ENQA 1TTCA 2PWEA 2QR0A 3BP7A 1KJ3H 2HFTA 3FMGL 3OZKA 4PBDA 2FJFA 2AC0A 4MCNA 4W9EC 1GYUA 1NBVH 4NO5B 1RURH 1A7NH 1QLFB 1RIUH 2E9BA 4XOBA 1JNLH 1OPGH 2VDLH 2ZAGA 3ZZ1A 5HYSA 1B2WL 3C6LD 3KE0A 2KMWA 4YS4A 4D9QE 5D7KE 3NPZB 4CN4A 5AYUH 3OPUA 2H3NA 2MMXA 2FJUB 2HJLB 2WXNA 3CFQA 1PY0A 2ZXGA 1RZ7H 1NAKL 2X53A 5D72H 2OMYA 4P5MA 1FFNA 3ARFC 3BQUA 3CGTA 4YEEA 1PD6A 2EDTA 2WLKA 4WENB 2ARWA 3UIZA 2YBRB 3M6DA 4L23A 2WCPA 1T0MA 2H1PL 1KXQE 4X6BA 4WI8A 3KWXA 1FDLH 3CNKA 4RISL 4DKAA 3BKYL 2ZUQC 2GY5A 1F97A 3Q06A 3TBYB 1MCDA 4FKHA 5IB2B 4P5KA 1TZHA 2FD6H 4HWBL 2P28B 4E5XA 2C9PA 5J9PA 2Y9RT 3KWUA 2FL5B 3QJOA 3FQNB 3S5YA 3KH4A 1FLTX 3C6SA 4Q4EA 5E6IC 1WBZB 2NY1D 4QRRB 3WKNA 4OD1H 3FT1A 3CVIH 2Q76A 3MREB 4NX0A 3LXAA 4PQXA 5KG9A 4GI6A 3WDIA 4AQZA 3UAFA 4PV8A 1IGJA 1ZDSA 1N6UA 4P4RB 2ZWZA 1CZ8H 2CIKB 4LEOA 3TVMA 3OKLB 1DJWA 4X7DC 2OMXB 1IGML 4OZFB 4MDRA 3NOIA 3QAQA 1ET8A 1OALA 2E7MA 2WNWA 5GIRA 1S7QA 4F7PB 4BJLA 1TG8A 4F2FA 1AP2B 3H9YA 1U4FA 1A3RL 1T5WB 1MZZA 1OTUC 1JPGB 4GAAA 4LCYB 4Y4KA 3LKOB 3QJFB 1VGKA 1GZQB 1XCTB 2WMPA 2ATKA 2E7BA 1JZ2A 4FQXA 1USQA 3I6SA 4Q2ZA 3A6BL 4JN2B 3UTQA 3VWKC 4MCZB 4L3AA 5SWQA 5F7FA 1YEDB 5JXEC 3EOBA 4AC2A 5CCJA 3ZRCC 1S5HB 4TNVK 2F08A 3DXAD 1A1MA 1FNSL 2PW1B 3NT0A 4KVCL 3GSOA 3N40P 4M6OL 4QRPD 5ESVB 2IOMA 4IDLA 1EJFA 1S9XB 3OR7B 3EGXB 4L8SB 1TNMA 2ZYHA 4J3VA 3V0WL 3FK3A 3G5VB 3A5VA 5AD0B 4NWUL 1RIVH 1OSYA 1UG9A 4OCSL 4M7ZC 3PHOA 1OD7A 1SXBA 4AK2A 1SFDA 3VQ2C 3DX8B 5HDBE 1UM4L 4ZMYA 4PJDA 5I0VA 2WNKA 5C8JA 3PL6D 1AR1C 2P5WA 5CJ8A 3X2QB 4UTAL 4FP8L 4XMZA 5IROD 4IJ3B 2CDGB 4LHUD 3ZKQD 4KKAD 4RLDA 3PAUA 4X0KB 2B9AA 3IK2A 4BINA 5KVDH 4IJTA 3U2JA 3S35X 4F1ZA 1S46A 2P24A 2PR9A 5HJDA 2MCG1 5K39B 1MRDL 5KYUA 3NJMA 3PWUA 5EUKB 1WS8A 3APCA 3DVIA 4PJXE 3GMLB 1DEDA 1EO8H 1NOFA 5TE7H 1GXEA 1YEHH 3LNEA 4ENED