2F6AA

Collagen adhesin and collagen complex structure
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
303
structure length
303
Chain Sequence
b'GSARDISSTNVTDLTVSPSKIEDGGKTTVKMTFDDKNGKIQNGDMIKVAWPTSGTVKIEGYSKTVPLTVKGEQVGQAVITPDGATITFNDKVEKLSDVSGFAEFEVQGRNLTQTNTSDDKVATITSGNKSTNVTVHKSEAGTSSVFYYKTGDMLPEDTTHVRWFLNINNEKSYVSKDITIKDQIQGGQQLDLSTLNINVTGTHSNYYSGQSAITDFEKAFPGSKITVDNTKNTIDVTIPQGYGSYNSFSINYKTKITNEQQKEFVNNSQAWYQEHGKEEVNGKSFNHTVHNINANAGIEGTVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagen adhesin
molecule tags Cell adhesion/structural protein
source organism Staphylococcus aureus
publication title A 'Collagen Hug' model for Staphylococcus aureus CNA binding to collagen.
pubmed doi rcsb
total genus 64
structure length 303
sequence length 303
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05737 Collagen_bind Collagen binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2f6aA02
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2f6aA01
5CF3A 2Y7OA 3PG2A 3AT0A 4LEBA 2Y1VA 3IRZA 3UXFA 3HTLX 4Z1PA 4IGBA 4F27A 5CFAA 5IHWA 3IS0X 2Z1PA 3KPTA 3QE5A 4LEEA 4MBRA 1R19A 3RKPA 3OPUA 3PF2A 2F68X 1AMXA 4IGBB 2VR3A 5DZ9A 2X9XA 2X9WA 4HSQA 2Y7LA 3ASWA 2XTLA 2WQSA 1N67A 4JDZB 4B5ZA 3RPKA 5DZAA 4Z23A 3AU0A 4MBOA 2X9ZA 1R17A 4F20A 3IS1X 2F6AA 3HR6A 2Y7NA 2WZAA 4P0DA 3IRPX 4IGBD 2Y7MA 4F1ZA 2X9YA 4UZGA 4OFQA 3V10A 4JE0A 2YLHA 4LE8A 4IGBC 2RALA 2OKMA 4JDZA 4B60A 4F24A 3QDHA 2WOYA
chains in the Genus database with same CATH superfamily
5DSCA 4KY1L 2WCSA 4LFHG 5E03A 2FL5A 3MJ9L 3DHJA 4Z6AT 4AC4A 5HYIA 2ZAHA 1XGZA 3NZSA 4K7FB 5I6OA 3UAAA 5H4ZA 1CR9H 1Q0YL 3DX9B 3L17A 5DVMA 1Q9OA 3INUH 4OCWL 1QO3A 2YRPA 1KTDA 2RJMA 4ZUWA 5LGHL 1YYLH 2XRAH 4ELKB 2WUCH 3BX7C 1OK0A 3O9WB 3DX2A 4G70B 2IXQA 4IRJB 5E4IA 2K6WA 3I85A 3ULVH 2FBJL 2J88H 3U79A 1NBVL 1HZHH 1YEGL 2PUQT 1I8IA 1CURA 1L0QA 1Y0LA 4HUUA 3OX8A 2H45A 3GMQA 4F15C 3MLSL 3S7GA 3X1GA 2LU4A 4XO9A 2R8SL 5D5ME 2DV6A 1XGYL 1ZXQA 3AW5A 3V95A 2ARJA 2H2SC 3BUBA 3RX9A 3LN9A 1BFVH 1ZK5A 2WO3B 3EDEA 3QI9C 4TMPA 2X89D 2E46A 2RBLA 3HUJA 4L37A 2BH0A 4N87A 1EZVX 3CX5K 4RBPK 5JOPD 1VRSA 4CW1A 2CO4A 2DEXX 2O4EA 3VI3F 1A0QH 1QLRA 4F58H 1QQDA 1YQVH 1U8OA 4LRNL 2QADB 1TZOA 2AQRA 5IR1A 1OGAE 4R4FH 3CC5B 4NWTH 3U9PH 1G6VK 1C1EH 3CWGA 1U3HD 3RWDB 1BXUA 4OI9A 5IOKA 3LJ3A 4XBPB 1GHFL 3HG1E 4JCLA 2NMSA 1N70A 4M29A 3AMLA 3AGWA 4HIPA 3SDYH 1IV8A 2OP4L 3L3OB 3WS3B 2OL3B 3JZYA 4W6XB 2ZJSL 4AQOA 3DARA 1GS6X 3SYCA 3DHUA 1G7IB 4PV8B 2X6CA 5AEAA 1JPEA 2G0KA 1HHKA 3VD7A 4BINA 2G30A 3B8SA 5GIRA 2CJTA 1AGDA 3D87B 4G1MB 2AJVL 3HUJF 4NQEA 1IBGH 2J7LA 5F7LB 5EF1A 2QV4A 3CDGA 3SDDC 2EEFA 4UANA 1E50A 4LLDA 1F56A 5MP6L 4GW4B 3N3EA 4CVZA 4M56A 5HYEA 2RAMA 2E7LA 3SYQA 1ZSDB 2F5BH 4E42B 3T9WA 3BXNA 1M2OA 1PKQA 3MLRH 1BZEA 5BMFL 3KH3A 1IGIL 3CVDA 5T3XL 4LLAA 2I7OA 2VRAA 2EVHA 1I1FA 3ULUD 4YSCA 1Y1DA 1ZAGA 1L9NA 4KDTA 3QDJB 1VHPA 4EZLA 1A1OB 3BPOB 1RHHA 3AS3A 4G8GE 4BHUA 3RURA 1RK0B 1U4FA 1KV3A 3G6AB 4UB0H 3DVNB 3PUUA 5FFGA 3VXNB 3WFBL 2G4GA 3O11B 1CGUA 3GS4A 3WNKA 1CN4A 4S11A 2OJZL 3HN3A 4UT6A 4XCNB 2F18A 5DDHB 3UTZA 2YD6A 1OIOA 4A7QA 3FUDA 4NPYA 3ZMNA 2FK9A 2VISA 1CL7L 1U6AL 4UOW1 2WQVA 4KROB 1HIMH 1ZEAL 4IHOA 4LLDB 9PCYA 5D8JL 5ENWB 4H2CA 5E8PB 4P9HL 2Q6WB 5IVZA 4PRDB 5DHDA 1SEQL 4FNRA 1MFNA 2Y4SA 3ASWA 5I30L 5T5FH 3T0DA 4M8UA 3PUCA 3LH2H 1TZHA 4IRJC 3BT2L 4POZC 3O2DA 3QUXD 2BC4B 3MXWH 3HMWL 3HVDA 2DQMA 5IMKA 3SPGA 3D06A 3KPOB 1QNZH 5M94B 4OCYH 4Z7NB 2PCXA 3GBML 4CN1A 5A2JH 3CFKB 1MCWW 5CD5C 2ZX6A 1QBMH 5D1QB 1MXDA 5DEZA 3ZE0F 3NA9L 3C6LD 3GGWA 4FNLL 4YSOA 4HOMA 1YEEL 2X2IA 3PWJA 3LRLA 5IROD 1MPAL 2VL5A 4NQXA 4LQ1A 3OG6B 3S34L 3I3DA 2XACC 1FJ1B 5DZAA 1MKFA 4KI5D 1OAQL 2V7NA 4DUVA 4ZOBA 2D8KA 5GPRA 2CCWA 2Z31D 2WV3A 2Y5TB 1NCJA 2A6KA 3IJHB 3D4GA 1AANA 4QOKB 3IDIB 4F8OA 3ARQA 5I0WA 1BVKB 4AM0A 1T0NA 1N8OE 4H5SA 4PJEE 5E5UB 4OFPA 1M56B 3D69B 4ENZA 3MUGB 3C60B 4Y16A 3WU1A 2X3AA 1AXTL 4NRYB 2QSTA 3K72B 1T3FB 1M7XA 3PWVB 3V0WL 2Y7LA 4JAMB 1OGTB 4LCWA 2CO7B 4JO1L 4WWKC 1YDPA 1SZNA 3FT1A 3LRGA 4V1DB 2Y7NA 4XH2B 5D70H 4K55A 4LCWE 1PQZB 1A3LL 4NZRH 1HC1A 1UZ6E 3FCTA 2E59A 5I1HL 1MCRA 5D7LE 3BQVA 4P46C 5AW0B 3N40F 3CCHB 1TJIH 2IPTH 1URIA 3CPLA 4D8PB 4YK4C 1G7MB 2NX5E 3QFJA 2WZPD 2H0FA 3ETTA 4LP4A 3GSWA 4XO4A 1T80A 2J2ZB 1MI5D 3TCXA 4AYBA 2IH9A 5KZCB 2BOBB 4W70A 3PABA 3FN0L 2NX5A 3MNVB 2VL4A 3QFJE 4UIKH 4WNQB 5EU5B 2XPYA 3TA4D 4YDVB 1BM3L 5HHVH 5IWLA 4PJ7E 1A7NL 1XL4A 2WLYA 1AO7A 2JXMA 5CP3A 2ZWNA 4PB0H 1P2CA 4OH2A 3UTSB 3WMQA 4JY6A 3CU1A 3HCVB 4M1DH 3RX5A 2HG0A 2VLJE 3VD5A 3VD4A 2VSDA 1NC2B 1NMBH 2V37A 3MJ8B 4WK0B 3ISYA 3QR1A 4YZFE 1DSWA 3C6SB 5EC1A 4XN4A 5IFJB 3V4PL 2JWYA 4GIPD 3FB7A 2MTAA 3MOQA 4BZ2H 3LH8A 5J0BA 2WBJD 2X1PA 3C2AH 4EBQL 2VZ3A 5EO1B 4E36A 1E7VA 4ODWB 5DCCA 4J3OF 3FFDA 3OGOE 4DPBX 2DLTA 1TSHA 1ZA3B 4JN2A 1EAJA 5EHFA 5I24A 4AQEB 5I1CL 3ROOB 2BVTA 4X5QA 2FVNA 4P2OA 1HHJA 1UWEH 1ZT1A 2R9HD 1O9VA 3BMWA 2LQRA 5GGVY 1JN6A 2A5UA 2DQDL 4JFEE 2OV0A 3BKJH 4L1BA 2AS5M 1DQDL 3M45A 2J12B 3KLAB 1LDPH 3T4YA 1WBZA 3MLVL 5GGTH 3VG0H 3VXTA 2XQBL 2OYKA 3WTWA 4WU5A 3RUGE 1YMMB 1ZHBA 2EDMA 1T1XA 1GC1L 4N85A 1PKQB 3FQ2A 3ZE2E 5I6MA 1W8EA 1WFJA 3TA3D 5KVEE 1NDMB 1ZLVK 2EXTA 3WEOA 4F2EA 4G7VH 3LEXB 3FXIC 1UCTA 3OKKA 4KI5F 4L3CA 2VDMB 4PJCF 2AITA 5F6HJ 2IMMA 4PV1C 4YPGA 1P4LB 4Y4KB 4GAGH 2GAZB 2D3JA 4YQXH 3S3SA 2ID5A 3E3QE 2A9AA 5DUML 5J56B 2WTOA 3C09B 3PAVA 1P84J 3B1TA 4MZ3A 1IUZA 3SGDI 5I2IB 2EUXA 1Y6KR 1MRFL 1YYLL 3FPYA 3JZ7A 5CZKA 4HOXA 1NAMH 1EERB 4XR8C 3ISRA 4PJFA 1NCUA 1A25A 1N26A 5E56A 1WCBB 3GK8H 4BSWA 2VZ1A 4FHJA 5DJ8A 1AIZA 2AXWA 1IGFL 3D2UA 1MIML 1WWCA 3DSNB 3SE6A 2DI7A 1CE1L 5JOFB 5E95B 4Y1AB 1WSST 1HWGB 2R7EA 1CU4L 4MB4A 5EZJB 3C08H 1T7ZA 4N22A 4U7KA 3O9WD 3VFWB 3NQIA 1MFVA 2FIRT 4JS7A 2WWMD 1EXGA 4HPOH 1B2WL 2XZZA 32C2A 2DMBA 5KEZA 1PD6A 2IPUK 1JHKL 1JZIA 5LHDA 4JCWA 5F9OL 4IJ3C 1EEYB 4LBAA 1W6LA 3SDDA 3X1NA 4PJFF 3LMJL 4KZEH 1M2VA 4O02H 4PIRF 5DZNA 4HKZB 2NXYB 2VSCA 1TU2B 1VCAA 3MLTA 2CPUA 3S37H 4TLSA 1G87A 5KANG 1ZLUH 4PPTA 4TUOB 2OPCA 3U6RA 2AQTA 3KM2A 5J1SC 3LPWA 1SHXA 4EKJA 1ZA3A 4JN2B 1B0GB 1I7TA 2CO6B 4CC0A 4LPUA 3M1CA 3LZRA 4M4RA 3U9UA 2XN9B 1QNZL 1F0LA 1U3NA 3Q43A 1ZS2A 4K94L 3FUIA 3WEBA 3U83A 4OCSH 1D9KA 3UPAA 3K80A 3ZDWA 2NW3B 4FMFA 1BFOA 4BUGA 1SYVA 2FWLB 5CEZH 3SE4A 3MODH 3WO4C 3EO0B 2IOIA 4N3UA 2ZYRA 1ZPLA 2OMYA 4L1DA 3TO4B 3VSQA 5KSVB 3WFEH 3ENEA 5EZLA 1MW0A 4BFGA 1ADQH 1O6SA 2IADB 2XTJD 4ZTPH 1JXDA 1L3NA 3AB0C 4WNJA 1CS6A 1EGJH 2VN6A 5ETUB 2E27H 2ROXA 2VDNH 3KGSA 5FUZH 2WY3B 3H0TB 3MNZA 4RRPM 3QDGE 4GINA 4BUQA 1AHWA 3Q13A 4BSJA 2JKRM 1QHOA 4NM8L 1TKWB 4JDEA 1V55B 3HS9A 1UD3A 1KB5B 2BNRD 2PWHA 2CBTA 3MX0A 4PJDF 5C0EB 2ESVE 4LASL 1E65A 3UYPA 2DH2A 2JKWA 5DC0A 1XF5B 1J10A 1ET7A 2YEVB 3MRDA 3PPSA 4H1LA 4BFRA 2X6MA 1LNUB 1N68A 3AU1B 3PHOA 4TUJA 3VWJD 1HEJC 3TO2A 4DIXA 4FXKB 4UWQB 5HJGA 3U9WA 5E4EC 3NCXA 2X2YA 2C9SA 2YAEA 1ERNA 5DJ6B 4NZRL 1YNLH 5FUOL 1OWRM 1L9PA 4H44C 1M7DB 5B39B 1PTZA 1GH7A 1PPIA 4JAMA 2SEBB 5LCVL 3FTSA 1I1AA 1QI3A 2IGLA 1HHHB 5J6GB 1UZGA 4OLUH 2AC0A 4L4TA 4WJ5B 4LNVA 4KQ4H 1ZIBA 4LEOA 1T0NB 5IMOB 5AVUB 3Q6FB 5IGXL 3BAXA 1S4IA 4ZPTB 5JPNB 3C5ZD 1A4AA 3S8WA 5D7SH 1NWPA 3T71A 3NSDA 3GKZA 3P3YA 4YDLB 4M7KH 1SMAA 3NFPA 2ED8A 1X5MA 4L9LC 1ILSA 2IO5A 2O1AA 2VIRB 3VFSA 4BFKA 2J73A 2Q7YA 1NCCH 5KTEH 5ES4B 2R2HA 5LG6A 3VFTA 4Y5VA 4M43H 1D6VH 1X4XA 1DUYB 1ZWIB 1YNKH 4HIIB 3ECVA 4HEPG 4BZ2L 1GZHC 2QSCL 4FL4B 4N68A 2MCAA 3ZYIA 3UYRH 2YXMA 3CZNA 4ZOEA 4FKEA 2PWDA 2HLAB 1OSPH 3PL6B 2OL3L 2WPGA 1WZMA 5DTFB 4KK9C 1XT5A 3RWEA 2G5RA 2OQJB 3QZBA 5CINL 5EBWB 1VFUA 3F05A 4H88L 1YN7A 4FJ6A 3W3BA 3KE0A 2BIPA 5I66A 1BAWA 1UB5A 1MHHB 2HAZA 2Z34A 3C5ZA 1H6TA 3ECUA 4IGBD 5IIEA 3N9GH 5AB9A 3I9IA 1A6TA 1BPLB 1RZ7H 4XPBL 4LSTH 4LEXH 5D55A 2IAMA 2MCPH 1U8KB 1NCWH 1BBDL 3F6JA 3X11A 4ZQKB 1CFVL 1Y7VA 4WWKD 1FE8L 4Q52A 1M7IA 4XP1H 1R3HA 1F90H 4Z7IA 2P28B 4WNSA 2XKUA 5EOTB 3QIBC 3MLXH 3PXLA 3F84A 3DROA 3GRWL 5KVDL 4CVWA 4UQ9A 4X5WB 4GAGL 4XCYA 1IIKA 3F6IA 3RY4A 5FKPA 1JI2A 3KDMB 2FT7A 2FD6L 3EJCA 2WUBL 5GISL 5JPMA 1UA3A 4ICWA 3BAEH 1JPFA 3GO1L 3AB0B 1HXMB 2Y1VA 1KPVA 4HF5L 2X4TB 3HR5A 4XXWC 4X80H 1XD1A 1UEMA 3MJ6A 4KTGA 4Y4FA 3GK8L 4RAUA 3VMOA 1BMZA 1L9SA 3WSQH 1OQOA 5CJOL 1LXMA 1P5UA 1P7KB 2BWQA 3KPRD 5E2WL 3DGDA 1SXCA 3BW9A 4PJ8D 4NYLB 3ULUH 2Z35A 2CIIB 5DDHA 3UTZB 1H5BB 2FEEL 4UT7H 4L1SA 2HN7A 4RAUB 1A7NH 3VRJA 3P2BA 4FG0A 4LKCB 5JDSA 8PAZA 3US0A 2ED9A 4O02B 3EZ8A 3L3HB 1X5IA 3UTTE 4PRIB 3NJGA 4QF1A 4YBHA 3QK0A 4PP1D 1YEJL 3IFLL 3KLAA 1ORSA 3F12A 3OAYK 4CJ0A 4D9LL 2ADGA 2YLKA 3UTTA 2ZG1A 1X7QA 3DUUB 3BWUC 1PKOA 1NAMB 1I85A 2X41A 1XZWA 3FOLA 4XCEB 1IEBA 1QATA 3QS2A 3IF1A 1EO8H 2O6FA 2D9CA 1JFQL 3S5LB 5HPMA 5KVEL 4F15B 1FDLH 4HEPA 4YIQA 3H53A 4KNUA 4LVNC 4RESB 3UJJL 3I3BA 4L8SC 1MRDL 4JPIA 1XB8A 1E27A 3LNEA 4ZUSB 3ZE0E 3QAZB 5JW3H 3RL1A 4Z77B 2JQMA 4LNRB 5EFIA 4Y5XB 1IM3A 4EOWL 1IEHA 5I1LB 4GAFB 4PG2A 4ZW7A 2PYEE 5EIIA 5C0NC 3ZYOA 1CLCA 2R0LL 1FVEB 1MHHA 4XH2A 4Z7UF 1OT4A 3ZR5A 1P7BA 5ABAA 2AJZA 3K71B 4OFKA 3S48A 4L29A 4S1SH 4QRTA 3RZWA 4HG4K 5IB2B 3TVMA 4OF3A 3LHPH 1UM4L 3E38A 4P23A 5LLIC 5C3IA 1HQ4B 2VDNL 4PWEA 3H42L 3OD3A 25C8L 4ANVA 3V4UL 2ZCHL 4XWGL 5DK2B 1BLIA 3ZSSA 2DBLL 1DBBL 5JO5B 4N5ED 1WK0A 1L0YA 4LCCB 2WW8A 2G0LA 2YQGA 1MRCH 3EDDA 4OLXH 3PWNB 3TF4A 2JKNA 2MOQA 4PSRA 2KLRA 4I18B 4JZNA 4LHJB 2NYZA 5DO8A 1NBZA 5L7XH 4PYGA 4RQQB 2IBBA 3HC2A 3VX1A 3VDBA 5D1ZC 3R4DA 1SHSA 1IT9L 1KTDB 3PWPE 4AEEA 2WWMC 1U91A 2ZYHA 3CG8A 2AQSA 4BZ1L 3B9KC 5HVWA 4FQ2L 1JPSL 1U9KA 1KDJA 4GS7B 4ZS7H 3MRFA 5AKSA 1H8OA 2RIKA 4F8QA 2BZ7A 2HLEB 2KPWA 3B9DA 3MRMA 5BOJA 1FG9C 2CCVA 4P5TB 1F1AA 2XOTA 3Q7JA 1JOIA 4HT1L 5DTFA 1CBVL 5HBBA 1EQWA 3NEOA 3I6LD 4L3EB 5E99L 5IHUH 2H0EA 3ARUA 2UZXB 4PJCE 3ARED 3VFNB 2O93L 5IB2A 1K6QH 4NOBA 1BECA 4Z7VB 4X6BB 4AI7A 1YECH 1H3GA 1MW2A 2O6EA 2AK4B 1AYOA 2HXAA 5D7SL 1GY2A 4G9DA 3D4CA 5FGCE 1P69B 3NSXA 4TUUA 4XX1E 5AL8A 4PD4K 2BJMH 4ZUTB 3K91A 4GQQA 3V4PB 1RZ8A 4BQBA 1J12A 5BS0E 3EO1B 1UEYA 4B9JA 4K8RD 2DB8A 4TUJB 3WG7B 1Q90A 4MA7L 4MZIA 1S2EA 4BFIB 1A22B 3EFDH 4HYTB 3RVUD 2BVEA 3GHBH 4HLJA 4QRRE 5D2NE 3HZMB 1BG9A 4ZUSA 1N4XL 4KK6D 4XMLL 1WTLA 4XPFL 4F8PA 3D12B 2AF2A 3T65B 3U1PA 1J8KA 1NPUA 2CNZA 4P59H 1TUPA 1SMOA 1EFXA 1KBKA 4TL5A 2X89A 5JPMC 4MAYC 1HXKA 1J8HB 3OKDA 1FHNA 2XIIA 4KMTH 4DUXA 4GG6E 3APFA 4LHUG 2ADGB 3CFMA 1RJZA 2QT6A 2V3DA 4JPWL 3L9RA 4EXPX 1ADQL 3QG6A 5IF0B 4IOSA 3KL0A 3BZFA 3TFKD 2KI6A 3ZOAA 1AP2B 2XG4B 5SWSE 4I9WE 3FQNB 3G6JF 1O7DE 3OKMB 2NNCA 4N0CC 2X4RA 4U6YB 3CVIH 4DKAA 3QO1B 3I6GB 3HUJE 5F7DA 2FWSA 3TO2B 1CI3M 5AZEH 2R83A 5TH2A 3E6FA 3EJZC 4FI8A 2ERJC 3MA9H 5EWIL 3VXPB 5C0BB 2ZOLA 2CMRL 5AKTA 1JK9B 3UL4A 5BZDB 1T66C 4D9RD 1ZMYA 2OLDA 2X3CA 4B0MM 5AW6B 3QUXA 1I1RA 1OGAA 1VGEH 3G6DL 3QIBB 2XSKA 1KB5A 5C08A 3QQNA 1MFBH 3A4DA 4HK3N 3NCBB 5F6IC 5DRXA 2F7RA 3HNVL 4TSCH 1ET8A 1IGYA 5IROC 1FRGL 1PY0A 1JGUH 2ZSVB 4HZ1A 1HK6A 2BNUB 3H3KA 1QABA 4FTVB 1I1CA 3IU4H 2CUAA 4BH8A 1MREL 1DCLA 3CZSA 2VDPB 2VUOA 5KJ7E 1WFNA 1AH1A 4WV1A 4HWZA 1YY9D 2C9UA 3RWDA 3NZ8A 2DYRB 1XMEB 2W60A 4NWUL 4OTXH 4LXFA 4A6YB 3NVQA 1T21B 3WY4A 4PJDE 3PJLA 3J2PA 2R7EB 1E4WL 1A3RL 4HWBH 3AREB 3FN3A 2DWTA 3FU0A 2OMBA 5FV2A 5D1QC 5GRJH 3CHRA 2VMDA 3H54A 1KXTB 3A6BH 3VYNA 3ZDXB 3VXRE 5LXGH 3C5ZB 4L9LA 3RKPA 1FORH 4GMSH 3GMNB 1P9MA 5K5YA 4MQ7A 2VXQA 4F33A 1NCCL 5AOIA 2ZCZA 1EHXA 2VR5A 2CNYA 1ZHKA 3NPSB 2ZXWB 4A68A 4QKTA 3L4WA 3KEHA 3D4ZA 5FCUH 3Q44A 1U8LA 2BIQA 3RFRA 3B3BA 3HHSA 3K3QA 4ODSL 4P2QD 4Z7QF 1JFQH 2YEZA 4WO4B 3RWGB 4KJYB 3TYGL 4MLIA 2OCJA 5AVRB 2OMTB 4XC1H 5CUSH 3ZIYA 2GHWB 1LE9A 1S7QA 1HT6A 1YN6B 2Y3AA 3TBWB 5KBDA 1U8KA 3T4YB 3DSNA 2IGTA 4WSJA 5D9SB 2AI0H 3GRBA 1FWXA 3NCFB 4I0KA 5LGJB 2ZWZA 3EYSH 2UUDK 5HDOA 1FL6A 3HG4A 3IGAB 3VD3A 5KW9H 4WI7A 3TTSA 4CSPA 2WWOA 4B9CA 1Q0EA 2FJSA 5IUSA 3SJVB 3JTTA 4YS4A 4L3ED 3CXHK 3EZJB 3S2CA 1I7RA 1I1YA 1OGAB 4L9LB 4LBEA 1KB5L 2AVFA 2F08A 4A38A 4QWWC 4XP1L 2CDFA 3V0AC 5J57B 1CZ8L 2G9HA 3N43B 3P9LA 5T1KB 3GRWH 1G5AA 5KVDH 3QIUC 2ZUXA 1MJ7L 1VACB 5LCVA 2LU5A 4MB5A 2A7BA 5AL0A 1XCWA 5C9KA 1CD0A 1HQRB 2ZUVA 1B0RA 1MEXH 2XWJA 1C8PA 2V33A 3SODB 1GVIA 1T2XA 2X87A 4JPKH 5CBAA 2O6DA 2BFGA 4HEMA 4OCRH 4XCFL 1DL7L 3NFSL 4MJIB 1DQTA 4QXTB 5CNHA 2OMVA 2UXVA 1PLCA 4KJWD 4GRMB 3WFDL 5I1KL 2IGFL 3NK3A 4JMXA 3L7FA 1G4RA 5E9DE 1KGUA 2YHGA 2XQYK 2AGJL 2GIMA 2R4RL 2CRIA 1ODUA 4XMPH 4A2HA 3MBEA 1XB6A 3L4VA 4BDVB 5E9DA 2WGNB 4W6WB 1BA9A 4J23A 1NGYA 1T89C 3MRCB 2VLJD 4WKZB 5PCYA 4OD3H 1OEZW 3CFTA 1B4JH 2DL9A 5EULV 5HTSA 5DD1L 1MCWM 3SKJH 2L0DA 2CAKA 2ZWLT 4C54A 5IFJA 5I8EB 2WZPA 2AVGA 5G4OA 1AJ7L 4GRLB 4YSPA 5CKAA 5T1KA 4WKZA 3VTAA 2P5EB 4FQXC 1HL8A 4Z7VA 1MCQA 4EF3A 4ZXBD 5HVFB 5KSBA 3PWVA 5JW4Q 3QI9B 5D7LA 3QEQB 1MRDH 4JG0L 2D31B 5ITFB 5JOPE 4Z7VE 1T2QH 4I4WA 4MNGB 4ZOAA 1B0IA 3VGGA 4N90E 1YEFH 4LGRB 3UC2A 1BGXL 1HJCA 4GNKB 4MMXC 3D25B 5CILL 3RI5F 4MAUH 5F9WC 4UTAA 2CLZB 2GPZA 2VLKD 3L1OL 3JV5A 4F7CA 2V7NB 4QTIL 4WHYH 2QJDA 3T2QA 4K5LA 5JQIB 3LD8C 3Q2NA 1G9EA 5ADOL 1A6ZA 4PUBH 5D1ZA 2XNAB 4XN8A 1WC7A 3Q2WA 4D8OA 4JCMA 4ZMWA 2FX8L 4OUOA 3QEUA 4QRSB 2W0FB 1C9SA 4E5XG 1JCKA 2QPDB 4NZ8A 4GQ9H 4JM0A 2HA1A 2Z0BA 3D39A 3CFQA 2D7OA 1CMOA 1T1WB 1WD8A 2XT1B 3ALXA 3VVVA 4U1GC 4PBDA 4PRHB 3L3JB 2GQHA 2H9GB 2LFGA 2XLLA 4K3DL 3EGDB 4QHKI 4QRUB 4ZDHB 5TE4L 5I8CA 3FL7A 4X8GA 1E2VA 1GIGH 5C0CD 4KK9D 4NUPA 3S96B 3GHPA 2ZUYA 5D1ZI 4EI5A 3EXJA 4P2RB 5DJ0A 1DZBA 5BCAA 1FNSH 1D5BA 2G75B 4NP9A 3QRGH 2ADFL 5CHNB 4YHPA 5DUBA 4ZAKB 4FAAB 5I1LA 3J27A 3QQ4B 4X42A 1TQCC 4ZS7L 4KX7A 3KS0H 3UC0H 2EIZA 1UACH 2KBGA 4D3CH 1PZ3A 4WO4D 3QGVA 4NQVA 1LE9B 1CBVH 2YQBA 4NWUH 1AGCB 2GVYA 4UAOB 4G82A 4V2CB 3FYEB 3TIDA 1JHLL 1GTNA 1X5LA 4UYQA 5DJAB 1N7MH 1HKFA 1QA9A 4JFUA 5IHZA 3L16A 2FUQA 1H15A 1A8JH 3ARFB 3IU3A 3O2WL 4L18A 4FFZA 4NZUL 4GKSA 1R3KB 2A9CA 4UV7H 3HKFA 5GZNA 3UDWA 3WJJA 2Q3AA 3SQRA 3FCBA 4QF1B 4ZFGH 2AJZB 1OB1A 5D96B 5IFAL 2CSPA 3QDJE 2YPKB 4PRDA 3K71A 1UWXH 4XMLH 3P0YH 35C8L 1IFGA 1WFIA 4WI0A 4YPGB 3BAKA 4AY0A 5IM7A 4BBWA 4E41D 5D5MA 5J3HD 1VEOA 3CJJA 3PP4H 5DURB 4L4JA 3CZEA 2PTTB 1KLGB 1FAKT 3QUYD 4FGMA 4OLWH 2W60B 3IKKA 2HVJA 3KHQA 1QTPA 3FPXA 2DEWX 1MQKH 1MJ8H 5L6YH 3PAYA 2BIHA 4P04A 2IPKB 4W6YB 3APDA 2M1KA 2V3FA 3DO7A 2GBUA 3D7PA 3JWNG 2ZNXA 2D0HA 4RISH 1H8NA 1MF2H 3QWRD 2IALA 5AZEL 3JV4B 1HWWA 2DQHL 3MUUA 2A9BA 3ROOA 5INDB 1DCEA 2ZOTA 3Q8AA 1R5WA 3BH8A 5DVLA 2N4IA 3CTTA 3THMH 5H94A 4DP8X 3BXNB 1JK9A 1Z9SB 3QPQC 1BVZA 3CCHA 2AQQA 3O2VL 4XXCC 3U4AA 5SWQB 4K9EL 2KLTA 4FI7A 2HPTA 2GG1A 1KPUB 5BQDA 3QR2A 1IAKA 4JRWA 3S37X 2CKBH 3DV6B 4S0HA 1UT9A 4K71C 5KSUA 5F71A 3MI6A 3T0AA 1WHPA 1UA6L 5ERWA 2F9BT 2JJUA 1MEXL 2X28A 3IU4L 3RVVD 2DD8L 3TTYA 3LKQB 1SLVA 2FEDD 1EBAA 1U95A 2EEAA 4JPKL 4G8AC 4OGZA 4LLUA 1ODAA 43CAB 3WTYA 3HG1D 1BBJB 3N0AA 4N2EA 1AR1B 5CEXB 3TBVA 2BSDA 5FKPB 1OTTC 3LKOB 2BNRB 1F18A 3L2LA 1V8HA 1X9UA 3W5NA 4Q9BA 1PKQE 2XQYA 3D34A 2F8XC 1O5PA 3D30A 3OZKA 3KYAA 3D51A 3FT3A 4GRWB 3S36L 4GSQA 4YE4L 5ACZB 2A6JB 1A1MB 1RI8A 5F1NA 4QLRA 3FF8A 3VQ2C 3WGVB 4Y1AD 2HT2D 3CHQA 1AGBA 3U0WH 4GPVA 5FV1L 1MHCA 3DOIA 1A6PA 2HFFA 4N90D 2OAAA 4KTYA 2C4FU 3CLWA 3V4VA 3B7TA 2EH8L 5EH1A 1KG0A 5BRZA 3U7YH 3MV8D 4N8VG 5DFAA 5AQ0A 1I7UB 1O7VA 3BC9A 4XRCB 2IMNA 2JKSA 4MXVF 3OHXC 4DN3H 4FG6C 1OK8A 5IMKB 1VZHA 2EIEA 3LY6A 4XGZA 5AVVB 3C60A 5JHBA 1UJTA 2R29L 4U6XA 3CQQA 1CXKA 2P49B 2R27A 2Y06L 2PR4L 3K6NA 5CJQL 1JYWA 4LAQL 3SKOB 1FL5A 2LW3A 1RZQA 4EDXA 4AQAB 4IOIA 3EH3B 2FJGB 2VABA 5DQ9B 1KC5L 5FUCE 1BM7A 3L2MA 4Y5XA 4N6RA 4PJXE 4HIEB 3P30H 1UTDA 5I74B 4RGNC 2W9LA 5F88B 5TF1H 1TQBB 2AERT 3ZE2F 1YRKA 1JZFA 3T04D 1CFNB 5BJTA 2NY7H 3RQ3A 2VDLL 5IQMA 3V0EA 1D5XA 1KENL 2FL5B 3A5VA 4JPVL 4O00A 2DAVA 4KROC 3WUZA 4LCIL 1U92A 1VZIA 4U4IA 3KXFD 3MRPA 4FLHA 5J8OA 4Q6IA 1J9SA 1W91A 3B9AA 2LU7A 4DJMA 5CD5D 4OF8A 1EEUA 4IOFD 2MQCA 3WKQA 1MFEL 5DVKA 4FYTA 2P5EA 4X5RA 3HS0C 4YBQC 1Z0NA 3TWCL 2WLZA 4Z7OF 3TA3B 2P5EE 5ALBH 2OTWA 3OB0H 3PNWB 2WYTA 1KJMA 2VISB 1KCVH 3P3SA 5L8LB 2HMID 4KJQC 3W9DA 1ZHNB 1BYPA 3WYRA 4WTXA 3LQAC 5H94B 4ACTA 1IGJA 4S10A 3ZJAA 3H85A 1TEFA 5CP7A 5FB8A 3ARGA 4FERA 2PPCA 2DMCA 4HAKA 1ETJA 2Y72A 4DOHB 2FJFA 3K46A 1UD8A 2HT3C 3VXQA 3TC9A 1AZNA 1JDCA 3E2HB 5CCGE 2JTDA 2QTEA 2XZAL 1J0HA 3LRKA 4X7EC 4LVOB 4R7LA 3O6FC 3LNIA 5KYUB 5FGBC 3SDDB 4RFNC 4UU9A 5JHDD 1S9WA 4I7ZC 3LTVA 1HFUA 5EN3A 3ZYJA 1GRWA 1KTCA 4WDIA 2EP6A 5EV7A 3UFIA 3FTGA 4OBRA 2K78A 4LPWA 3SE4C 3A4FA 3PWLB 4GFTB 3Q5YA 1XB3A 3FONA 1WISA 1BCIA 3DJTA 3NP4A 4PTTB 4Y1AA 1ASPA 1E4XH 1IGCL 2FWOB 2WVUA 1FN4A 3QJFA 4MAUL 3GC3A 1IEAA 3IS0X 4DK5A 3BVXA 3QO0A 4Y1AE 1EDQA 2J43A 3BVDB 4OZGF 3N85L 4P5KA 3HR5B 2DKMA 1QRKA 4V33A 3IGUA 2R0KH 5EOCL 2Z31A 4MDIA 1MCFA 2C9PA 4QHKJ 3NIGE 4WUKH 3MGTA 3RGHA 4W9JC 1R3KA 1N64L 2SODB 1FL6B 3UBXB 5I73C 1DLHB 3KVDD 3DNKA 3G04B 1NL0L 4JDTH 3KWTA 3OX8B 4AQ1A 4BIKA 3EJRA 3VRIB 4ABUA 4GUPA 3ATFA 4YDIL 3QZMA 1Z3GL 5CSZB 1WO2A 2ZAIA 5EOTA 3BVUA 5A43C 4UILH 1Y18B 3QNFA 1UUNA 3RVVC 3TIEB 3MKKA 1DUZB 2GC7C 5C0AE 1J5OH 2BNQE 3H1ZA 3O4OB 4PJ9A 2MQ0A 3LV3B 2Q3ZA 4IRSB 1EZVY 2Q86B 1FV1A 3CVHH 4K9EH 3C6LC 3OHXB 3VA2C 3QJUB 4MD4A 4WTZG 3EOAA 4P57B 4MHHI 2RH0A 5JQHC 4NCDA 1MFCH 2VUKA 4D9RE 1G9NC 1WLHA 2NY2D 2DD8H 2DWDB 2Z7YA 5FC9A 3BDYH 3ZTDC 1UACL 2XV6B 4LT7A 4M6MH 5K59F 4UF7C 5I5MA 5FB8B 1J88A 1W72L 2OZ4A 2JQAA 4OU3A 4DEUA 2A9ML 3L3IA 1MCKA 2MNWA 4GQZA 2GJJA 4X9GA 3QDMA 4JJ5B 3T4AA 3MN8A 3AY4A 2C3HA 3D39B 1T89A 4QRQA 3KCWA 4Z76A 5JHLH 5I76B 3FB8B 2WIMA 3QC5X 1G9MC 4U33A 5EU6B 4DP7X 3DGCR 3WFCL 3QIWB 4UCFA 3BFQG 1X7SA 1QLEB 3W0WD 1NCIA 1FGNL 3NCJL 4JANA 3QUKB 3D5OF 3MRCA 1PZ2A 1VZGA 4KKRA 1CLZL 2VIRA 1RHFA 1FH5H 1V7MH 2Y1YA 4OJEH 3P0YL 3QH3B 4DCQA 1T03H 3A22A 3M7OA 4P4RB 2NY5H 2Z64C 4LOFA 4HLEA 2ERJB 1WUZA 2WLHA 4NQDE 1UASA 3AG4B 4X6CE 2Z8VC 3ECWA 1P4BH 4HX1A 1SOXA 4AVKA 1BJ1J 1A6UH 3TBTA 1USQA 2PN5A 4QTHB 4X7DC 4PRIE 2OK0H 5TQ2L 1P5VA 3KYOA 4HUXA 2OMVB 3QEQA 1OGPA 4QHNB 5TF0A 2ZUTA 2AQNA 2PR4H 1OOWA 4LSUH 1CGTA 1IGTA 1EEZA 1F11A 4Y7MA 5DMIL 5JHDA 5HHQB 4Z0BL 1FNEB 2B0SL 3HTLX 2M26A 4GJTB 3MO1A 4QGTA 1MH5B 2NRDA 1DR9A 3UJTL 4KVNL 5IB3B 2A73A 2QGBA 5I8KH 1KC5H 3H9HA 1D6EB 4NAQA 3QJXA 1CJYA 4BELD 1NAKL 2DZEA 2YUWA 4FFZL 1PZCA 2RTTA 3MGOB 4QKXB 2G9HB 1QRNB 2NY3D 1OPGL 1H9VA 3TT1L 1IB5A 1A4BA 1HXYA 4JHWH 4KXAA 3THML 3UAFA 4ODBD 5D2NA 4F1SA 5C0EA 1EFXB 5F0LB 4LCIH 5JZ7D 4CVXB 5HJ3B 5C0CE 2CRYA 5FKAA 2AANA 5B38A 3UBHA 3L3GB 2A4EA 3F8UB 1KG0B 4PM1A 2UVFA 3TJEH 5D4QA 1J0JA 1TCMA 5KVDE 3BZDA 1OAZH 4LVHC 1XR8A 3QS3A 5AAMC 3Q8EA 5EU7C 1DQJB 4F9LA 1F3RB 1K72A 3VWJA 1S7QB 3CFBA 3X3FL 1GMEA 3FN9A 4DF9A 1G84A 3UADA 5E00B 4H25A 5JXED 1UYWL 1I8LA 3ME0A 5E1HB 3I02B 5DVOA 4B27A 1F3DH 3QJOA 3LB6D 4ODTL 2AXHA 4UAHA 5CD3A 2EIJB 3S5ZA 3D52A 2JJSA 2YARA 4HHGA 4R97C 1OAXL 1SN0A 3IMSA 1IM9B 1T1ZA 2VZUA 2N0MA 4QMEA 1RZJC 2P8PB 5J13B 3WY3A 3ZZLA 3CN1A 1MIEH 5EBMA 4YEEA 3N41F 1Z5LB 1SNRA 1G9HA 1NANH 1C5BH 4G6JL 4MDIB 3MV9B 3ZT5A 1G94A 3ETSA 3IDIA 2BOLA 3CDFA 1WGOA 3DXAD 2B59A 2Z3FA 2YKKA 3BVNA 1NBYB 3S4SG 1M05A 1E67A 1OZUA 3GMMB 1GJIA 3OKOA 5DHVH 1SDAB 2Z4QB 2NNRA 3CVBA 4L3CB 4ZOCA 3MOBL 2PCPB 2Z6FA 4Z78B 3VXUB 3T2PA 1HSBB 3EOTL 5F7WC 1T21A 2V9UA 3DECA 4OCXH 4LVEA 2ORBL 4PS4L 2DIAA 1RJLA 5MERB 5HHPB 5MHSE 3EJTA 3MHZA 4ODUB 3D18B 4CC4C 2G3NA 3RWJA 1OP5K 4PJAF 2QADD 4EEEA 1XGUA 3P3TA 4XNQA 1YPZB 5JXEA 2GUOA 1R9FA 4DOHE 4G43A 1KYOK 3MA7B 3SDXE 1FPTL 1BW8A 2OSYA 5E6SB 2CRZA 2MIZA 3MGTB 3ZGIA 5FYLL 2ZUWA 2QKSA 5DJYA 4XCCH 5FGBA 4HCRL 5BZZA 4Z3JA 3HI1B 5E8PA 3CN3A 2G5BA 1AOHA 5HVHB 1CGSL 3ULVL 1YJDL 5SX4I 1X5YA 3RIFF 4YK4B 3T3MB 2XFXB 3H2WA 3QPXH 4ODWA 2NXYD 1G9ML 2PP8A 3NRQA 4NRZA 1QFUH 3ZRCC 4TQHA 1NIDA 2FRGP 1MAJA 5AB0A 4BWTA 2YK1L 3IDGB 1AZZC 1MLBA 4TULL 5E8DL 3PWLA 5FYKH 1VFBB 1FYTE 3C6SA 2A83B 1UFUA 5EZPA 3FRUB 1QVOA 3GJFA 3RDTA 1NCAL 2YN5A 3NIDF 5KS9E 5I1EH 3QZWG 4LEBA 4OQTH 5T1LD 2CPCA 3NIFB 4FQIH 1MFCL 5F6IB 2X4NA 1XO8A 4DN4H 3FF7A 2EEXA 3ARDB 4OM0H 3MRJA 2FJFB 3VJ6A 4KX8A 2VJ0A 2NYYD 5DJAA 3H4HA 1HE7A 5F89A 3N2JA 3RAJH 3T8VA 2JI3A 3UABA 1FZMB 4N20A 1PZ5A 2GSGA 2IEPA 3QRBA 4N0UA 3IWVA 5F88A 1KBPA 2Z35B 5D4HA 5AYUL 5E4OA 1GC1C 4OLYH 4PRAB 3LN4A 4LARL 5FGCB 2EC9U 5JHLL 2OP4H 3S4SB 2E47A 2B3RA 4JFXA 4JY5L 4UM8A 1EWHA 4OFYD 5F7FA 5EO0B 4M3JA 2QBWA 1OO2A 1HCZA 4EN3B 3NCJH 4JQIA 1R4XA 3RLSA 5EMYA 4PJAB 3P11L 2R59A 3ARBD 4BSVA 3LZFL 4LVOC 4OIIL 2W81C 4ENED 1I9IL 3EJJX 3BWAB 3E1ZA 5AVXB 3CHOA 4OFQA 4DEPB 3VFRB 1KJ3H 3IJYA 1E4XL 1IGCH 1AR1D 1GCYA 4NENA 5T1DL 1T22B 4J12A 4W1TA 4HDIB 5I1GH 2ZCKH 4GG6F 4Y4FC 3SBQA 2WVVB 2KQNA 3HMXA 1KLUA 3JUZA 3WL9B 5T3XH 3RVTD 2P9RA 1A6ZB 4EIGB 2VLMD 5C7XH 2D73A 3BKMH 2YBRB 1CQKA 1ZSHA 4ZQTA 1SEBB 3CUPB 1VFMA 4WUKL 5DEJA 2NY6D 2FX7L 3TBYA 4YDMA 3F7RA 3TA3C 2AXGA 1P4IH 2B1AL 1BMGA 1LM8V 4ORGA 2AMGA 4HKXA 4G6FD 3TT3H 4B60A 4ENEC 1ZT4B 4YMPA 5FO7B 3F01A 2NY4D 4I4WB 1RH8A 5DWUL 2X6UA 3BRGC 3GSRA 3O8XA 2XYCA 3H3PL 3CHXA 3UCRA 3D9AL 3DKHA 2QELA 2F19H 2NY6B 5C0DA 5J6HB 1U95B 43CAA 4D2NA 7CGTA 4PVMA 1CL7H 1U6AH 3P4MA 4U1MA 2F54D 2N01B 4XVOA 3FCUB 3NG5A 3ZDXE 3FQYA 3L81A 4XNAA 3VWJB 2YPVA 2EEDA 4A7TA 2CXKA 2X6BA 2O5NA 1NGWA 5D1ZB 1FJ1A 3H55A 3H9SD 2PR9A 2R51A 4LDOB 5A6MA 4NQXB 1TJHH 3QNZB 3V6OA 2O61B 1MVUA 2YSSB 4K07A 1NOAA 1ORQB 3DX9A 3QXAA 4PJHF 1PZ5B 3K2MC 3U0PA 2IPUG 1FFRA 4M62H 2LVEA 2VDPH 4H0HB 3B3IB 4WCYL 2A38A 3HZKA 1NFDB 2L04A 1OT2A 4XPHL 2DQGL 3HBPA 3O4LD 1U30A 5K9JL 4JNXA 4O2CB 5DHEA 2BS9A 1NM9A 3WFCH 3FOLB 3MRQB 2AXFA 4C57C 3WIIL 1J0IA 5A2LH 3CXDL 4QCIB 4R2GC 4KKNA 3T0EC 1T1YB 4C4UA 4QRBA 4Y9FA 4Q2ZA 5EA0L 1CLZH 4EN3A 2KZ1B 2BP5M 2IWFA 3HBQA 4HHAB 4HK3J 4UT9L 4ZW8A 1QR1A 2XKNB 2IG2H 2IDTA 4DKFH 1E4KC 1H3XA 5SWZB 4N2LA 2NY5L 1KYFA 1QTYT 4GXUM 5DUPH 1QSFD 5HHQA 2B08A 3B2UD 5FCSH 4HVBA 3G5VB 2IQ9H 3P4OA 4LU5H 1KXHA 4NBZB 3GM8A 2ZX9A 3RX7A 4N8VA 4N0UB 1P84K 1GOHA 1NUFA 3RGVA 2DKSA 4UUJB 3SD5A 3UYPB 4Z7QB 4EN3C 1LEGB 3IDJB 5E94B 2BHYA 5AB2A 4CA4A 1KPVB 4F7EA 1SBSH 3NCYS 4XNUL 1ZY9A 3V0WH 3G6AA 3DX4A 3GMRA 3DK0A 1J8HD 4W9IC 4PY8J 4KVNH 3QZOA 2GBVA 3TEZA 5EEVA 4CDGC 2WXGA 1RIHH 5C9JA 3L3OA 5GGSA 4FC3E 2WLNA 3EYFB 1YQ2A 4WZ9A 4B9KC 3OKNB 3A67L 2XYBA 2DMGA 5CEYA 3TIDB 1AD0B 1DJXA 4JY4B 4O02A 1F6AA 2G2RB 1MLBB 4N9OB 5BRZD 3NJNA 1UOLA 4PREA 1WQVT 5D7IE 4Z78A 3BZEB 4MXVE 2R4SL 2RQEA 2CDFB 1BMWA 4FFYA 4JO4L 1JNLH 3TYFB 5D7IA 2HRPL 5A6LA 3R06B 4ADGA 1KCBA 3SDXB 2C26A 4KVCH 1BREA 4OQTL 4DP2X 3AU0A 2ZONA 4AVHA 4LSSH 1OAKL 4E41E 4Y4KD 1MHPH 1M6OA 4F5CE 1JRHI 4ZMXA 5I8CB 2YBGA 4RGNE 4OM0L 3PL6A 4X9IA 4MXWL 3TH4T 3V7MA 1SLWA 1XGUB 2ENJA 2F7IA 4JFED 1C16B 3T8XB 2X38A 1R3HB 1TT6A 3QEUB 2FO4A 2CJSA 4PG9A 2F54A 1FFNB 5DRZA 2J5LC 1AIFA 3WNIA 4XMKH 4AEIL 2VR3A 1ZLSL 1QW9A 5AOJA 6PAZA 3HNTL 1JCVA 1G7HB 2YA1A 4OLYL 5BV7L 3NMEA 3OJ2C 3NIFE 1QO3B 4LSVL 5BRPA 2VXUH 4OZGB 3V5KA 3VM5A 4QTFA 4AT6A 1A7OH 4YNYA 5E2UL 1L5GB 3K6FA 5DFTA 4B7IA 4B53A 2QGDA 3S96A 4FYRA 2VXVL 2WOYA 2EVJA 2MSPA 4X7CC 3TV8A 2OMZB 1U3YA 3TZVA 4Y2DB 3NDYE 3CN2A 1Q72H 4HJSA 1KB9K 1XZ0A 2WHVA 3PU7A 2AHIA 1TEYA 3UX9B 2GCYA 3QJRB 3DXAA 4ZJ9A 3VGDA 3CZKA 1YJDC 3T6VA 4QR7A 2UY7A 1S5HA 5C6TL 4G11A 3FAXA 4XTRC 4MSWB 1OL0A 4OR1A 4PJFE 4ZZFA 2ZOKA 4X8JA 4X7FC 4DW2L 4F7TA 1FA4A 4JFVA 4GEIA 1NEPA 4DH2A 4JFHE 5T8IA 4MX7B 2ZUSA 5KOVC 2LR4A 1FZKA 5DS1A 3DX6A 4AIZB 3OXSB 2YK1H 4MBOA 3LCYA 3MRRB 4TULH 1ZKAA 2YAQA 2P80D 3LOWA 3T3PF 5ITFA 1HXYB 3V0HA 1MSPA 2X9YA 3PAZA 1BQHA 3K5RA 4HPOL 3C6EA 1D9KC 2WVTA 2FLMA 2GJ6E 3UP6A 5DRWB 1KFAL 1AGFA 1AHWC 1B0RB 2GIYA 4OZFG 5E4EB 2P8MB 4V1DD 5DJXB 5IY5B 4YAQB 2PWGA 1SYVB 3ILQC 4QRPB 4X0KA 3DIDA 3WJLA 5GGSY 4UTAH 5I71B 3OZLA 4P9HC 2DTSA 3HHRB 4WIQA 2Y23A 1IQWL 2J8UA 1AO7B 2JXMB 1X4YA 1NEZA 2FAUA 1KTKE 1MZZA 4P5TA 3MMEB 3T0ED 4C8XA 4WCYH 2EH7L 3OB8A 2WSPA 3RDTD 2I07B 4FS0A 1L3WA 2TAAA 3PE9A 4HIXL 5IZ7A 2ADIA 2JKLA 2Y7OA 5C09E 3CHSA 4HD5A 5T3ZD 1EMTH 2Y5TA 1FVDB 3U4EA 3W0WB 2Z8RA 2XXGA 1K4CB 4YSDA 2E7CA 4X4MA 3AS0A 4F3FB 1LK3L 4HEME 5L0QB 5KBNC 3UROR 1O6TA 4IKIA 1S9YA 2WBKA 3E6HA 4PJ9D 5KS9B 2J6EA 4KBPA 1MLCB 5E9DD 3RZCC 2YFNA 1B4TA 3BN9C 3LNDA 4X4ME 5CAYB 3PV6B 2Q86A 2VNCA 4KGJA 4N0FA 4K7PX 5K9OA 4W9HC 1XGQA 1GZQA 5FUZL 1EA9C 1E5ZA 1II4E 1AC0A 2V6HA 4NO5A 2Z8WC 3KWVA 4LCCA 1TTBA 4M5YH 4QXGL 2HJLB 2WAQA 1JTOA 2BY1A 2UYLA 3CZGA 1CCZA 1ONQB 3AADB 5DXWA 5IB4A 1CTNA 1Q1JH 4H1LG 2NY0D 1KYUA 1TR7A 4XVTL 1AD9A 3KLLA 3LRMA 3O4LB 5IJKA 1UOKA 2F53D 1JRHH 2A1WH 4MJ6B 5JR1H 2Y3NA 4O51B 2CBQA 3RZCB 1MN4A 4XRCA 4V11A 3WE6B 3CFDB 3HG3A 4LSDA 2GBAA 5H2BB 1A1NB 5EO0A 1FGVL 3FOMA 5CR8A 4XVJH 1F13A 1XDTT 3QCUH 1MWAB 2DQCH 1LO2H 4L4TE 4LK4A 4G9FB 3B9VA 5LGJA 2HFFB 1W8NA 5H37A 4JFOA 1NDTA 4PH8A 4XBGA 3UPRA 4G6MH 2BLFA 2J71A 5AVQB 4PJ9B 4XCNA 5E7BA 2JFCA 1RUPH 2OMNA 2F54B 1E6OH 2WXPA 5D1QA 5INDA 1CVSC 2JCCB 2ZOWA 3FZUC 4WU5B 3UAJC 4KZCA 4MJ5A 4DP4X 3EF7A 3EYFA 2F53E 4OZFB 2HT4D 3VFMA 5JQ6L 1OALA 3BE1H 1JNLL 2NQDA 2NY4B 1WCBA 3C6LB 1FUNA 4JUTA 4KKAD 2QQLL 4BSWB 5I15H 3EFFA 3JTSA 3HG5A 2GB2A 3CMOH 3V55A 1KXQA 4P46A 2A9NH 3QIUD 3GSNL 1AY1L 1EVUA 5KUMA 3D2UD 5DHMC 5CWSB 4ZSOE 2ZX8A 3L3HA 3ARBC 1AZVA 1X5FA 3KM1A 4K3EL 1B6DA 2B3IA 2W95A 5BZDA 3H3BC 1I4FA 3JWDC 5E6IA 4PV9B 1IAIL 2GBTA 3AAZA 4NPYB 3UYRL 1OGSA 5D5MB 5TJWK 4HUVA 4JRYE 4JFDB 3LXCA 2J57A 4KXDA 1YEIL 5TFSL 3IGKA 4JZOB 2Y7MA 1IKFL 1FFPA 1IC1A 5FFLA 2BIIA 5CINH 4Z7WF 1MCJA 4NSKB 4UT9A 5BNXD 2GITB 4H20H 3D05A 1G7IA 3DVIA 3DJSA 4PV8A 5FO2A 2WTRA 1TQCB 3QHZH 3EG9B 4KZDH 2ZOOA 4XNQB 3HC3H 3WN5C 4G80A 3VXMD 2FX9H 2UV3A 5DEFB 2H8PA 2I9TA 4W9CC 2XWRA 3HZVB 1KLGA 4LPCA 2C7FA 3DTUB 1ZHNA 3QUZD 2RD0A 4GH7B 2ZYIA 4WU7A 1TQWA 4GW4A 1MUJB 5IHWA 5EBGA 5DEGA 3W9EB 2B20A 1G7JB 3TEYA 1RIHL 2C3VB 5TD4A 1ADQA 4KFMA 2VJ8A 2YZ1A 2FD6H 3FBQA 3FAWA 1R6VA 3B5GA 2GTWA 5FECA 3ARVA 2BVOA 2VXTL 4QHLB 1YY8A 1IKNC 1IBDA 1RUAL 3V52L 4QJ4B 2YGVA 3IMWA 2OR9H 4Y16B 2HFTA 1R0AH 1PZUB 1MY5A 1ONQA 4AG4H 3TS8A 5E2WH 4GAYA 4G71B 4HKXB 4OI7A 1UATA 1KBWA 1I7UA 3E7JA 3PQYA 1KJ2L 1TZIA 4HP5A 4EI0A 4QRSA 4X6CA 3PFQA 4MMXB 3JV6A 4LMQI 3T3PE 1EEQA 3UGXA 3MBXL 1IKNA 3PV6A 3GHEL 3ULSA 2GTZB 4FQLL 4UIMB 4KVCL 4RGMC 2MHAB 1XR8B 4LSSL 3GYRA 2K3TA 4AJYV 2NW2B 2Q8AH 1OTUD 3JV6B 1JHTB 3WD5L 1PZAA 4DEWA 1DDHB 2ICEB 4CBZA 2ZIDA 2V4LA 3ZVVA 4Z8FL 5FO9B 1JSYA 3Q6FA 1E42A 2G3ZA 1AKJA 3CLFL 2NUTB 4K15A 2I07A 5IESL 2X4QA 2BC4A 2QEJA 4EZJA 2E9JA 1KGXA 2V5TA 3B4NA 3E80A 1AKJB 1K3ZA 4OF7A 3L9EA 5IEHA 3IE9A 3GMPB 4ZFFA 5DMJB 4HK0B 1I9RH 1EJ8A 5KN5A 3ZZQA 3BZ5A 3GJEB 3NJIA 1JZ2A 2QQKH 2R0LH 4I0PB 1IAOA 3BP7B 2BIOA 5CLTA 1UKTA 3VFOA 5C86A 1ZGLP 3GMLB 3R7QA 4L4VB 2MQ3A 1YCSA 4KUZH 3UACA 4LLWB 3OF6A 2QGEA 4X6EB 4F2FA 3SGEI 3B9KA 3APCA 2NCMA 6PCYA 3T5WA 5KVFH 4K8RH 1BZ9A 3O11A 1LWHA 4ECNA 2EVFA 4M5YL 4UT6H 4A2MA 2ZCHH 5B3SB 3DUSA 4I2XB 4WO0A 5DZVA 3EGXB 1BSIA 2CR0A 2R39A 1Z9OA 3PWPA 4DKEL 4MX7A 1K8DA 1RVFH 3OQ3B 3QQ9D 4QT5A 5CIPB 3G5WA 2RCSH 5ESAA 2C9QA 2A1WL 4AENB 1QFWM 4F58L 1C7TA 1YQVL 2N7BA 3S97C 3I50H 3UOAB 2M8XA 3JVFC 3L4YA 4HUCA 4TL4A 3AXLA 5EZLB 3S36X 3RIAF 4BQ9A 4E9LA 3WUWG 3FQUA 4GKLA 4RVBA 4LKCA 1C1EL 1PX8A 4C59B 2WXFA 1PLGL 1DN0B 3L2NA 1AXSA 2WVSA 3T0XA 2BWIA 3AAZB 5IVXF 5CCJA 1NGYB 3NIDB 1JGVH 3HZYB 3ZHNA 4XAWH 2FB4L 4IIZA 2OJZH 2XWBB 4W93A 1RP8A 2B15A 1T5XB 2JSFA 2Y2YA 3RILA 4ZFOA 2OMZA 3MRRA 3SGJA 1HXMA 2YSTA 3NAAL 4Y2DC 1PCSA 4OM1L 3S35L 2W0KA 1LO0L 4JREC 1KIPA 3ARDA 4S1RL 5DJCB 2ATKB 4QRRA 3RTQB 3PDOB 3O0RL 4WO4C 3VXME 3LH9A 2A9NL 3AGVA 1MVYA 2NYKA 2F1AA 5L4IA 1QASA 4KTDL 1GPOH 2AJUL 3BT2H 5JUEH 5DT1L 1CGXA 5A16A 3NPSC 1CD1B 3SBPA 1MW1A 2FGZA 2YS4A 5L4MA 2J21A 4HWNA 5HHMD 4Y5XC 2VYRE 4ZFZB 2NW3A 3E9UA 4KI5E 5CSZA 4JDZA 3S2AA 2ODIA 2JLPA 4ZFQA 4DVBB 1EMTL 1HH9B 2DLFH 1F2QA 3ZTNL 1XGPA 1HILA 2CHWA 4L8SA 1NBYA 2EDXA 3HI1A 3RFZC 3CXHJ 3L1EA 4EI5B 3VB9A 2YPKA 1CC3A 4NKOA 1OY3B 4AQZA 2EDWA 5LBGA 4RMWA 1F4WH 2LV4A 3IXTA 5HYJD 3V5HA 3IK2A 1OAQH 2ARJB 4Y19A 1L5GA 4N0YL 3EFFB 3JTSB 1ILUA 1WFUA 2VQTA 2ILLA 3CVHA 3L3JA 4P46D 4JR9L 2B1HH 2HLAA 4H40A 4A04A 5AW4B 1UJ3B 3QEGH 3QHZL 3PXHA 1A7PH 1NSNH 2VDRL 1IBZA 3VXSB 5IMMB 3RFZA 4DEPC 4GBXC 3WIHH 2AJYH 3JWNC 3BGFC 4U0RC 4MCNA 1EZLA 4O9HL 3FTGB 5D8JH 1E4XI 3GZQA 2OMTA 5JR1L 2BW4A 1AFVH 3I74A 3VXSA 5IMMA 1A47A 1BYOA 1JUFA 2Z4TA 4PB9L 3SDAC 1BZ7A 4FQ1L 2P47B 3T3MF 5C0CB 2AEPL 3TVMD 1FIGL 3GI9H 1RZKC 1K4CA 2X2HA 6CGTA 3ARGC 2MNJB 1E4JA 5E6ZA 1DP0A 1U8MB 3D33A 2DTML 3RUGF 5AFAA 4QAMB 2EAEA 2IBGA 5LQBH 1WFMA 1AR2A 4R84A 2FECI 2DJ4A 3GWJA 4CVUA 1KELH 3HBZA 4J3VA 3DX1A 4AUUA 3QORC 4I3RL 3P0GB 5HYJA 1V27A 4WUUD 3NA9H 4FNLH 1P7HL 2XTJB 1E6OL 2JI1A 4RFEA 4EO5A 4AG4L 3DETD 3SDAB 4PWIA 4BKSC 5G4NA 3ESVF 4C55A 3MRHA 4LPXA 3DRQA 2A4ZA 2NSMA 3ZDYF 5JQ6H 3GBNH 4DP5X 5FFOA 4C83B 3EJUA 4QGYA 4L05A 4O2FB 3O9WA 8CGTA 4Z7UA 1AGFB 4LRIA 3ARPA 2YPLE 5EEUA 2XN2A 3LN5B 3K2UL 4QIRA 1NGPL 1P6AB 4BH8B 3DTXB 3KBFA 4Z7UE 2Z1PA 1J8HA 1QPXA 3DMMC 3DI3B 5IQ9B 1WBXB 3B2XA 1SXBA 4Z8FH 1YMME 2PW2A 4I2XA 1WZLA 1C5DB 5K9KA 4R5VA 5C2BH 1CG9B 5D6DC 1JGIA 3MZGB 4B96A 3PL6C 1Y07A 2YUZA 2LE9A 2Z8SA 3QXWA 2D4DA 1I8MA 4PVNA 1I3RA 1ZLUK 4M5ZH 5L2KD 3TM6A 2E9WA 2Z65C 2CLVB 1EUTA 3IMTA 3IRZA 3NABH 2HH0H 4M5SA 4PAZA 4R4BA 1B0WA 3F5WA 4K7PL 4OJCA 2HMIC 3N41B 3W2DL 2WYIA 3S3DB 3FQWB 5KW9L 4WSKA 3R8BB 3KYMA 5IW6B 1ZHLB 3MRHB 5J06A 1EAQA 2VRKA 4NPKA 3VG0L 3HC3L 2EZ0D 3UG4A 2VB5A 3GRWA 1A6AA 3V4LA 3R18A 1VA9A 2JJSC 4WEBH 3O8XB 3U30C 1KSRA 3MYZA 5D2LA 2EO7A 5JW4M 3TBTB 4O2CA 5INCA 4F93B 1AKJD 4FABH 1WZKA 2IV8A 2B4CH 2Z7ZA 5IP4A 4HX1B 3MLWL 5JIIA 5D2LE 3GXDA 3RPBA 3FU6A 1WD9A 3KPSB 2XUWA 1ORQA 1F45A 3BVWA 1XGRB 2PO6A 5AW2B 1AXIB 2VC2L 2R15A 4N9GA 2R1YA 3STLB 3F6LA 1XGTA 5EU4B 5F1KC 1RUAH 5FOBB 2E8YA 4NQDA 2WVVA 5JW4N 5L8JB 3M8OL 1SFHA 4MQXD 1OCRB 1EAPB 4AZ8A 4DZBB 5E0FA 3PREA 3SCMA 3D3VD 5EB9A 1D5MA 1GGYA 3O45B 1FL3B 3QEQE 3RVWD 3K8KA 3C08L 2FB4H 5E1QA 4M4RB 5FGSA 1DLHA 1GS8A 1YC7A 1TPXC 1B0GA 2CO6A 1Z2KA 4XP9L 4B95C 1YUHB 1GCFA 4TF4A 5KWYC 1B2WH 3CSBA 1VKXB 3FQTB 4M8QA 4NBYB 3FB6B 5GGTL 5ESQB 1NCBH 2CDGA 4LVNB 1BEYL 4F7KA 5BO0D 1HI6A 4J3OD 3W9EA 4K9EC 2C5DC 1BPVA 2IH3B 1TO5A 4PJ8B 5JIHA 3MV7D 1TF4A 1MUJA 1ROCA 1IL1B 1XV8A 3HBGA 1FN4B 5DRNA 3HW7A 4FXTA 3MFFB 4BA0A 3RL1B 1ZA6A 2I5YH 3NESA 1AIFB 5C0RH 5HDBB 4K4KA 4FADA 4JG0H 3MJGX 3GB7B 3UH8A 1L9OA 1M42A 3HC4L 3HI6L 3HPJA 4OKVB 5GGSB 1EJOH 3P73A 2F2HA 3MODL 3HZ3A 2K8MA 3PHAA 4HFWA 3ZL2A 4F8TA 3ARDC 3V0VA 1HKLH 5ITBH 3W5MA 2VZTA 3Q6GH 1RUMH 2VLJA 1A66A 1RK1A 4TOYH 5KZCD 5ERWB 2IOMA 3JVGA 2X4SB 3H9SA 3RGVB 3I2CH 4KXCA 4XMVA 3QJFB 4P2YA 4F5CA 4PTTA 5C0ND 3WIHL 4MNQA 5D7JD 3ZHKA 2K70A 1YYML 4JPQA 4NIYE 4H8QA 4O02L 2XKNA 1N59A 1XTMA 4U3SA 5DQJA 3TA3A 1FO0A 2AK1L 1TIUA 4UI2A 4A7VA 3DX8B 4PB9H 2WQXA 4DVRL 3L9RB 1KCUL 1E2ZA 1PNDA 4OFVA 4AXWA 2UX6A 3EH1A 4P3WA 4UU9B 4AENA 1RHHB 5D93C 4NJAL 3LXBA 5MEND 5I6XB 3WHE1 4OGAD 3K4DA 4WRLA 1GXEA 4M7JH 2H3KA 1GW6A 4DETA 3HPJB 4G3YH 4IRZL 4J4PD 3EHBB 2QQNH 1DBJH 4L0YA 3GT6A 3WHXA 3HB3C 4DZ8A 5ECJE 3X13B 3ZT7A 3MUJA 2JCWA 4O4YH 3QNZA 1SF3A 1IJNA 1XBRA 4OM1H 2J20A 2C7UB 1PFCA 5C0IB 4ZTPL 4RMRA 3V4PA 4PJ8A 5LNDA 3LZNA 4URKA 3QYNA 2YPVL 3Q2VA 2NT0A 3MCKB 5DLML 4UV7L 3O0RH 2EE6A 2KDGA 1T83C 4HCGA 3VXRA 3KS0J 5D1XE 2R69L 2XN9E 4KTDH 5JUEL 4NQSB 1IGML 4G6FB 1BAFL 1XXDC 4ZK8A 1GYVA 5C07E 3A21A 3AITA 3MA7A 2YIHA 2AJXL 2VSKB 2CUMA 4LOVA 1LWRA 1DO6A 1GA2A 1RJYB 4MMZA 5E24E 1AOZA 2BPBA 1M7IB 2L7JA 2GI7A 4JO2H 4ZTEA 4G6AD 2EUWA 3QIBD 2VQ4A 4LIQE 3IFPA 1JD7A 2IJ0C 4YSUA 3IJ8A 3FUJA 4RQQA 1UA7A 4JL2A 2JKXA 2ZD0A 3MRNA 4YHYC 2FHBA 4JR9H 1QEWA 1XMWA 2OZNA 1FL5B 4ES8A 5F3HB 1W0YT 1TG8A 2MCPL 1DVUA 5C1MB 1M7UA 2AJYL 4N0UE 2X4OB 4Z7QE 4NRYA 4X7TB 4YZWA 3X17A 3AROA 3QG7L 1E7UA 1SYSA 1DSFL 4MZRA 4JE4B 4TN9A 2SEBA 1THCA 4HC1L 3G5XA 3ZU8A 4F57L 4Z7WA 5BXFA 2YEQA 3I9GH 4JQIL 2EE2A 3ESOA 3KPLB 3NUKA 5FGRA 4YAQA 2CDEB 4OZGE 4PR5A 4RSVA 1WTGT 4JQVA 2XN9D 1X9QA 8FABA 3DBXB 1SN2A 3SE8L 5K69A 2FHCA 3OG4B 4GW1A 4D94A 4X80L 4ZW3A 4HETA 3JWOH 4I3RH 4M7ZB 4UZUA 3RWIA 1U33A 1L7TL 2OW6A 4YDJB 5F9AC 4X99A 3GDCA 2X4PA 5IEKB 4OZ4A 3LKSA 4LLMB 2ADIB 4LCUA 4FQHB 5B1AB 1LO3L 1RK0A 3SPHA 3H0TA 1LO5A 3MNZB 1HYRC 4NDMA 3ZT6A 3B7RL 1VIWA 4DCQB 1GOFA 1ZOXA 2OZ4H 1RFDH 3NCMA 3PCYA 4LSTL 4Q9QL 5DHYA 5GSRA 2YFOA 5CBAB 3K2UH 2BIMA 2CALA 4X0KB 5B21A 4MB3A 4FDWA 5JXEC 5BVPL 1M53A 2A83A 2MKWA 3IDMB 4YXKL 2WINB 5G5DB 5CXPA 4AOFA 2D0GA 3U7WL 2WXIA 3SKNB 1CDUA 4PRAA 3MLXL 4XAKD 3IDNA 3S6CA 2NCEA 1P5UB 4G5ZH 4Y4HB 1WA2X 2VLKB 3RBGA 5KJRL 4CC4A 3GSVB 4QHNA 2K7QA 5AOKA 4PJCB 3GBLA 3T0VA 1RU9H 1EVTC 3WMPA 3CMGA 5FF6B 2W07A 4OCWH 1G4MA 1XEDA 3ZDYE 1UD5A 2V7HB 5IJVA 3GO1H 2P80A 3K5SA 3R0NA 2HP4A 4HF5H 4KK5C 3RHWF 4DKTA 4L3AA 3W2DH 1A14L 3L45A 1E6JL 3PQYD 1WAPA 4MBRA 3QH3A 3UTTB 3VG9B 5JYMA 5HVHC 1HKLL 3AZUA 1RMFH 4MD4B 4OSUL 1JMXA 5DQDL 2MH4A 2XPGA 1KYAA 1I1FB 2DEYX 1UM4H 2VDRB 4Z7UB 4DP6X 1VCBC 2J72A 5SX5K 1XGYH 4NC1C 5AVYB 3QORB 4NQCB 1K5NB 1ZVSB 1HVXA 1LEKB 2AV7A 3O4OC 5C09B 4CC1A 5FK9A 4XWGH 3RPIB 1D9KB 4FQJH 2CUIA 2PW1A 2XIBA 5M7QA 1ZE3C 3OMAB 5DFVC 3QRFM 4H0IA 3VI4B 3QQ4A 5CFHA 4UQBA 4CW1B 1OB0A 5DA0B 1E5BA 4PJFB 2AP2A 2PWFA 4ESKA 5HDBF 3WKMH 3UAEA 1N5YH 1F3JA 2FJHB 5E8NA 3FSAA 3U9PL 2PTUA 3DURB 1F02I 4KGLA 3FK3A 4QHUA 4J3OH 4ADJA 4QPEA 3V5KB 3PAUA 1SJXA 4XT1C 4NEHB 1RZKH 2K9FB 4AK2A 4ALAH 3Q8CA 2Z31C 1EAPA 3QT2A 3RKDD 2Q76A 1KTLA 1IZJA 4U1NB 4XN7A 4H8PA 3NZ8B 4JFSA 2O26U 1ZLEA 4ZQKA 3UG5A 4PTUA 5IR1B 4D7BA 3CSTA 4GP4B 4XMUA 4S1SL 4BEIA 1IBGL 1PG7L 3LHPL 3TCLB 4PP2A 5H37G 3OKOB 1XR9A 3E0GA 1L4IA 3FUFA 5MHSD 1ED3A 4RFNB 5KYYA 1HHJB 4YZFF 3BAIA 2GJZA 3SCMD 1VADA 3V5DA 3WE6A 4OJAA 3EFDL 4E9SA 2CK2A 4HMDA 2YXFA 1NC4D 1IGMH 3VWKA 2J5WA 4PGEB 1QRNE 5ADPH 4OLXL 2EZ0C 1FSKB 1SY6H 5SWSD 3CFNA 1AS7A 4XVUC 4F37K 2ZOLB 1QRNA 3JWOC 4N2FA 5K1VA 2FQGA 1HYSD 2XV0A 2WBJA 3B7UX 4NO0B 1IT9H 3S88L 3D85B 4AZ8B 4ELMA 3ROLB 4FF9A 4NC0B 5JW5A 4JFPB 2DDQL 4JRXD 1V7NH 4FQ2H 4MAYA 2FSEB 1IZKA 1S7XA 2IVFC 5HI3D 4X6DF 3GNMH 4KO6A 4MYPA 4BV1A 1NKGA 4FLSA 1J87A 1IBFA 4TNEA 4M93B 5HYFA 4ONGH 1IGYB 3G9VA 1Z9PA 4P5TC 3RWFA 1LO5B 2ZX7A 2X6AA 5J12B 5GRXG 3EGXA 4YPJA 3CH1B 3MR9A 1IC7H 1Q1PA 5E1IA 3KR3L 2OYPA 1RZIA 3GSWB 1NFIB 1ND0B 4N1CA 4HJTA 3PS6A 1B90A 3L4TA 3NP3A 2R0ZL 4W9DC 1E9OA 3BPNB 3BVVA 1UHVA 4FZEH 1U36A 3LH2L 1NEUA 1M7DA 4JREB 5EU6E 5TQ0H 4N28A 3MSPA 5GS3A 4NJAH 1DN0A 1HCYA 2EDDA 1FRGH 1JPST 3IDMA 3MXWL 3QE5A 5K33A 3TONA 5FDWA 5ICYB 2QPSA 3D0LA 5EU6A 2CBMA 1KDIA 3US1A 3SJVE 1DJSA 4HGKC 4OAWA 1K5WA 3OTTA 4HKJA 2PP7A 4H8HA 3SE8H 4F80A 2BSRB 3AC0A 4M6ML 4P59L 3ZQWA 1G5GA 1USZA 1HX0A 1I1YB 3BHBA 2A6IA 3QWOB 2FEJA 2KT6A 1E4WH 2NY0B 1FNGA 2BO0A 3L7FB 2F53B 1CFMA 3IFOB 2FBRA 5AYTA 1BJ1H 4X2UA 3A6BL 1KFGA 3MQIA 2TSAA 1D5XB 5CLYA 5KYYB 1VAHA 5LXGL 1UD4A 4KKBD 4X6EA 2F7QA 3SDCD 5TTRA 1G0DA 4AYGA 4G1EB 4YDNA 4JANB 1BAGA 4HHWA 5C7ZA 3UGEA 4AYID 2FBOJ 2XJKA 4P06A 1AG0A 1HOEA 4MMXA 3BUDA 4HS8H 5IQ7H 3G6DH 1GGBH 1A6VH 4NENB 1AG6A 4LCWB 1KXVC 3QDMB 4JJ5A 5KJRH 5DHXB 1TXKA 4OB5H 1CFTB 4R5TA 2HUEA 2YWYA 4LP8A 5D5MF 2E7HA 4Z3TA 1AQKH 3VGAC 3V5HB 4NO2A 2H6PA 2W65A 5EUKB 4MQ7B 5DI8B 3ETBJ 1D9KD 4U6VH 1BIIB 4P4KC 3NQKA 2GAZA 4HV8A 3DJZA 1M2VB 4L4VD 3EYOB 2VXQL 4PCSA 3TJHD 1J9QA 1V3LA 3Q3GB 4W4OC 4NKIL 4FLRA 3OHXA 2H2PD 4DGYH 1SOQA 3SZ6A 2DL2A 5CLWA 2ALWA 3MV8A 3GI8H 1J05A 1LMKA 5F9JA 1JBJA 2DH3A 3FO2A 3BPNC 1OXYA 2YOAA 4UZSA 4IMLB 2LTQB 2WXLA 4ODXB 3CDCA 4H26A 4JRYB 5J1AA 3I9GL 1E9QB 4QYOA 2G4EA 4YC2B 1FSKC 1T6VN 1VF5C 1J0KA 2LAAA 2X42A 4HGWA 1OCWL 4P3CH 1TNNA 3QEQD 3SPCA 1ZVYA 3WKML 1OAZL 4U1IA 3BWUF 3DK2A 3MACL 4QRTB 1CDYA 4EBQH 1BQUA 4L48A 5ANMA 1IE5A 3JWOL 3MV9E 4GSUA 2HN7B 3VRJB 3LDBB 4IHOB 4Y19E 1E5YA 5GRZA 4U1SB 4RX4A 5KSAD 2CUHA 2MRYA 1NDMA 2WNKA 4ODTH 4AYEC 3C5SA 2HT2C 2I9TB 1K5NA 1ZVSA 3O3EA 1MI5A 2CRMA 2LFEA 4AKQA 3WELA 1MIEL 2YC1B 1V3JA 3M1BA 3HOGA 4Q2ZB 5DC2A 1WBZB 1JPFB 3VXTB 2XPGB 4YUEL 4JJOA 4BA8A 5T3ZH 1HNFA 5GXBB 3VD0A 4EKXA 5BVPH 3GPEA 3TPKA 5C9JB 1U8HB 3P4NA 4AVJA 3MPCA 4GKSB 3VMPA 1OAYH 1EV2E 2QKIA 3U7WH 3KW7A 1NPNA 3ILDA 4GQRA 2E3VA 1RK7A 4KOBA 2JTYA 3OR7A 3RL2A 4R0LC 2IFFL 5IVXE 3D1MC 2XY2A 4IEFB 1BJ8A 3O3AA 5EORH 3LXUX 2JV6A 1OOAA 5CBEB 3CPLB 4F37F 2OFQA 2EC8A 4PSPA 3L5XH 4MMYA 5ESVB 4L8CB 3BYTA 3ARYA 1O75A 2JLLA 1KUMA 4P5RA 2EDBA 3SOBL 3VB8A 4BYHA 4W9LC 3QUYA 4HCRA 5FYKD 1LD9B 4JN1L 4KTEH 3P4MB 1V05A 4RRPA 5E23A 5F1OB 5I17A 5I66B 3TPUB 5IMLB 3UIYA 4U1HB 3FQXA 2HKFH 5I19L 3UTSA 1IKOP 4XXCA 1R3LB 4JM4L 5I6LA 4HFWB 1BZOA 3SGDH 2EDFA 3R0MA 3QA3B 1GGCL 4WW1A 3OJVC 1U92B 1YEWA 4JRYA 2J4WL 2YPLD 1ULVA 3UP1A 4D9QD 5A7BA 1JI1A 2TSBA 3VQ1C 4U1GB 3KVQA 4PW3A 2RB8A 1KXVA 1QFPA 2GIXA 1BZ9B 3MREB 4CADB 2QL1A 3F00A 1YZZA 3LMJH 5E9NA 1UUSA 1XGQB 4KZEL 1P7QD 3VNZA 2QHLA 4NQVB 3O3DA 4BUHA 3FSZA 3KYKH 4ZTOL 2NR6D 1E4KA 1RY7B 1AQ8A 1ZA6B 2DM2A 1DFXA 4XBGB 3DOSB 4HWEL 4XP6H 3ZRSA 2IWGA 2P48B 5C8JB 2W9EL 3AFLA 1XL6A 1T6WA 4JFFA 5HHOD 2XBTA 3BFWA 3P4LA 2OXHA 2RFXA 3PY9A 4OIBA 4FA6A 4GMTH 4HXAH 2WO4A 1ZANH 1G0XA 1FO0H 5FW8A 4GUOA 4CVXA 2Q7AA 5F70A 3UC0L 3LIUA 1FNGB 3EOYG 3BQUA 3CU7A 4PRHA 4WY7L 1N0LB 2VR8A 3WFEL 4U1HA 5AG9A 4ZUVA 5KS9F 2VDQL 1N8ZB 4P05A 1LWJA 5BRQA 3AVEA 4WWKB 4PRHE 3QUZC 5IVZB 4QHPA 4FZ8L 3EJYD 3ZRFC 2OS7A 4QXUH 2IWKA 4MNQD 5D7JA 2ZG3A 3I6KA 4G7YH 4P2QA 5L2JB 3QP3A 3T77A 3NSCA 1XGTB 2YLHA 5EU4A 1OP9A 1UZ8A 5I75C 5FA3B 5CCHE 4UIMA 3EH5B 1UT2A 4GKNB 4P2QE 3TBBA 3VH8A 1G6RB 1AGBB 5ADPL 4B9YA 1DEEA 1WITA 4OIIH 2A0LC 4NUGL 4F7CB 5LO7A 4E9QA 5DZLA 2QZ5A 3QEHA 3ZX1A 3VA6A 4XN5A 1NM4A 5F89B 1IAII 4JGMA 5I6NA 1SN5A 2UXGA 2HRHA 3PP4L 5KUKA 1D3CA 5IMOA 1CVRA 2NQCA 2TRHA 3JWNE 4MWFB 2NZ1A 3TEXA 2KC0A 2P5WB 4AH2B 3GIZL 1KY7A 1NQBA 5EC2A 4AQ8C 4M5TA 1YNLL 1MCSA 3CZFA 1AQKL 5CZXD 2ICWI 3FQXB 3B2VL 3CHPA 1Z7JA 1FZOB 3OKLB 2ODHA 3TEUA 1UGKA 3RDTC 1CUOA 1DJIA 2P44B 5HHME 5C0GA 3TZVD 4F2MA 1P4UA 4PCYA 5ICXB 1W0WA 4AYFA 2P5PA 3P3RA 4PJHE 2Y2TA 4N2CA 1PFOA 4RIRA 2XZCL 3C5SB 5CLZA 5LN4A 1Z32X 4J3SA 2WQSA 1VGKA 2XWCA 5D7KD 1N7ML 3OGCB 5DU7A 5IM7B 5ALCL 3T4AB 2HG5B 5KBLA 1OPOA 5I71C 4ZYKB 4IYKA 3M17B 4NZUH 1XH3B 4NZDA 1FI8C 4ZMQA 2WXKA 4G80B 2ZPKL 1T20B 2Z92B 4BFFA 4JFZL 4DK3A 4X6FA 4DPAX 1OANA 4M43L 5IWLC 5EZOH 4DWHA 1OTSC 2I9LB 1OCWH 4RZCA 1F4YH 4Q8BA 1KYOJ 5C0CA 2YOCA 3SZKC 2P5WD 4IMLA 1RXLA 5F21B 3KPNB 3GZPA 32C2B 3QQDA 3PP3K 1GL4B 1FFPB 1VFAA 4O2FA 4EMZA 1F1GA 1AI1H 4P48A 1VACA 2R29A 4M3KB 2DQGH 5LNEA 4HUNB 2DJMA 2NNFA 2I7SA 1B4RA 1FP5A 3SDCC 4ONFL 2ARJQ 3WNMA 3CFUA 4LDLB 4DTGH 2APVA 3WLWC 3EO9H 5DUBB 3U7AA 2N7AA 2DWYA 4WI0B 5DD6A 5JNYA 4MA3B 3WNLA 3N9GL 4MNQE 1LK2B 1ZHKB 3QHFL 4NI6A 3DPDA 4Z5RA 3LS5H 5T3ZL 5JIQA 2XV3A 1C08B 5EEXA 3EUUA 4YXHH 2EYSB 2VH5H 1CD9B 1CFVH 4P5TD 1U8MA 4I18C 5GRYA 2GC4C 4XNYL 4HS8L 4QRRD 4NN6C 4Q14A 4PJEF 4B50A 1IFHH 1QA9B 5DUPL 3G08B 1Y0LB 5E8OA 1TZGH 4Q7DA 5BS0D 3CFJB 1S3RA 3UBXG 1G7PA 5LDUA 3K6IA 4GKOA 2FGWH 3S5YA 5B8CB 2CKNA 2FSDA 4RX4D 5KBKA 2WB1A 1J8SA 2R2HB 3BAJA 3VGBA 3VD9A 3Q1SL 4XNUH 3EH4B 4KAQL 2OMUB 1SJMA 4LAQH 4N2MA 4KY1H 5EIQA 4B9FA 1ZDQA 4YHIB 2FO8A 1MFAH 4JLRA 1J5DA 4FCAA 4BKLA 1MZYA 1TENA 4I1PA 5FA4B 1Q0YH 1QX1A 1MFMA 3ZUNC 4JN1H 2J5LB 4KTEL 1P7QB 1AGEB 1QW8A 5DRXB 1GKEA 1EH9A 1NGQH 4R4NC 1HHIB 2A3TA 1PD0A 2E8ZA 2X1XR 3FT9A 1L9RA 4ZO6A 4I9XA 2ZUUA 3SDXA 1W72B 1GZPB 4DO6A 4JM4H 5GS0C 4FFYH 1S8DB 1XCXA 3GTNA 2AV1A 3KYNB 4N8VB 4JPVH 3H2PA 3EBGA 5JLZA 2WXMA 2AQ1A 5C07A 1JDDA 5C09D 2EADA 1BIHA 4AX3A 1MELA 3NACH 4L8BA 4RZKA 5HGHA 2OULB 1KEMH 5FYKE 1UFGA 3FTXA 4NXKA 4Y2OA 1HL9A 4GUCA 1WC7B 3G3LA 3Q5TA 5C0GB 3PPEA 4P9MH 4N8UA 2ZXGA 1BD2A 2NY1C 1XGRA 1E8WA 1FVCB 5J89A 3V2AR 1RSYA 3ZKNC 1DVFA 4FEMA 3NRPA 4GMTL 3UTQB 3HPLB 5ALBL 1LQBC 2EXWC 3II2A 4JHZA 4IBLT 2P43B 4JDEB 3HG1A 2YKLL 4LRNH 5EUOB 4LLMA 1J1OH 2EKJA 1HJBC 3MROA 3KGRA 2B39A 3BHBB 3QWOA 4D0DB 4W9FC 5E8EA 1BVNT 2AJ3A 1C5CL 3QYCA 1UM5H 4HZLA 3LNHA 4AEIH 1TYRA 1ZLSH 4YSEA 4NQED 4U2ZA 5KSBF 5LAPA 1HDMA 1QLEH 3P30L 5TPWH 2R2EA 2ITCA 5I8EA 5G5DA 3SDAD 2BWDA 3C5JB 3O41A 3QIWA 4AYFB 3IDYC 5PAZA 4YSTA 3TNNA 3EFOB 2JJVA 5E4AA 2BSEA 4U1MB 2J8HA 1E5UI 3V4UH 1NC2A 5FDYA 4A2DA 1UXSA 3U2SB 2IFFH 4GAAA 5FHAH 2VXVH 4LLQB 1CICD 4RRPG 2AJVH 4ICXA 4ERSL 1P6FA 4ZODA 3KCPA 1BFSA 3H7BA 3MBEB 2I27N 4PGDB 4F9PA 3KLDA 2NQ3A 4NN7B 3O6KL 3GEWB 3K6SB 5H37H 4ZW5A 3OXSA 3NJXA 3FBKA 2PW2B 2GABA 4IGBA 1NGXA 3ML8A 4K2UL 4ORGB 4PRBB 1JNJA 4J8QA 4KUCF 2ZXCA 4G83A 5BMFH 1JPSH 1FHGA 2ETWA 5T5NF 2NSXA 3LZPA 5D7JC 2C4XA 1JNHA 1A64A 4G8GA 4DW2H 1LP9A 1EIBA 5JTWA 3GMLA 1KCVL 4ZMZA 3C8HA 4TSAH 3UJIL 4M4PA 3WY1A 1NBZB 2UXTA 3HAEG 3A6OA 3O3DB 4P2QB 5IKCB 4X6CB 4R96A 4HDIA 5DMKB 4YGVB 4OZHE 3SKOA 1S7UA 5L9DL 4ZUVB 3DIFB 4O5LL 1U8NB 4WI6A 1XIWC 2GCYB 3ZO9A 4J1UA 4Z7VF 2R0WH 4N2GA 1FFOA 5KVFE 4PJGE 4GW5A 1E8YA 5D71H 5CEXA 3STZB 3ZY7A 3VWKB 3LIZA 3W1ZA 1DEDA 3WN6A 2GT9B 2W9EH 2Z91B 1BQ5A 4Y9CA 1LLAA 2F6AA 4OV5B 4X4XA 3ZKQD 5DD5H 3IMBA 3E1F1 2WM0A 4GG6B 4RGND 4P3DB 3X1BA 2RR3A 2L8AA 2WQ8A 3IAPA 4DVBA 4L2YA 5C0IA 2X0UA 5GGVL 1KCSH 1M71A 4UTAL 2HVKA 4PWJA 3X2QB 3IGFA 4G8GD 2ZUQB 5HI5D 1JPGA 4PJ9C 4TV3A 5C09A 1LEKA 2VSMB 5HHXH 1I8UA 4AV5A 1WJ3A 4U1NA 1ETZA 2EH7H 2ENPA 4PBWD 5IG7A 1IFRA 2K3HA 3F64A 4KJYA 2FATH 3D2UB 5HPMB 4X5XB 3AREC 5JA9A 2I24N 4QWWD 3RIKA 2C3GA 3CFIC 2BDNL 3KD4A 4MLSA 3TBVB 3WY2A 2UY6A 4M03A 4PGBA 5E8NB 1FGNH 1T0MA 2A9DA 1HCFX 4X6FB 4TKWA 1CYWA 5EWIH 5EEYA 5CF3A 4ZI8A 4YDIH 5I17B 4JHVA 3GQFA 2UWEE 1IBYA 1J5HA 2C9VA 1AQMA 3ARGB 3U1SL 1KIUA 3BP6A 2HVJB 1K4DA 3F7QA 1H5BA 1IC0A 2UWEA 5EU6D 2RA1A 2OTUA 4CL7A 1F42A 4BFEA 1TZGL