2F6AA

Collagen adhesin and collagen complex structure
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
303
structure length
303
Chain Sequence
GSARDISSTNVTDLTVSPSKIEDGGKTTVKMTFDDKNGKIQNGDMIKVAWPTSGTVKIEGYSKTVPLTVKGEQVGQAVITPDGATITFNDKVEKLSDVSGFAEFEVQGRNLTQTNTSDDKVATITSGNKSTNVTVHKSEAGTSSVFYYKTGDMLPEDTTHVRWFLNINNEKSYVSKDITIKDQIQGGQQLDLSTLNINVTGTHSNYYSGQSAITDFEKAFPGSKITVDNTKNTIDVTIPQGYGSYNSFSINYKTKITNEQQKEFVNNSQAWYQEHGKEEVNGKSFNHTVHNINANAGIEGTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagen adhesin
publication title A 'Collagen Hug' model for Staphylococcus aureus CNA binding to collagen.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion/structural protein
total genus 64
structure length 303
sequence length 303
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05737 Collagen_bind Collagen binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2f6aA02
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2f6aA01
4HSQA 3PF2A 2Y7MA 3AT0A 4JE0A 3RPKA 4B5ZA 3IRZA 2WZAA 3IS1X 5CFAA 3V10A 4F24A 4OFQA 2Y7LA 1R17A 4LEEA 1N67A 2F6AA 4IGBC 5DZAA 2Y7OA 4JDZB 3KPTA 4LEBA 4IGBD 3OPUA 4MBRA 4Z1PA 4IGBB 3AU0A 1R19A 3RKPA 2X9ZA 4Z23A 2X9WA 3PG2A 3HR6A 2WOYA 3ASWA 2WQSA 2Z1PA 3HTLX 4P0DA 3UXFA 4JDZA 5CF3A 5DZ9A 3QDHA 4F27A 4MBOA 3IRPX 5IHWA 2X9XA 4IGBA 2VR3A 3IS0X 1AMXA 2X9YA 4F20A 4UZGA 2RALA 2YLHA 2XTLA 3QE5A 2F68X 2OKMA 4F1ZA 2Y1VA 4LE8A 2Y7NA 4B60A
chains in the Genus database with same CATH superfamily
1CD9B 3D1MC 1VJSA 3FQ1A 2H5UA 1E50A 4K9JA 4ODWB 1ED3B 2NNCA 1VEMA 5E4OA 5F0MB 4E41B 5CFHA 3QJFB 2OTWA 1MCSA 1TOXA 3K3QA 3CSFA 1U8NB 1SLVA 1G0DA 2ZUQC 2LQRA 1SM3L 2AP2A 4HJ0C 3QEGH 2F15A 3TV3L 2HLAB 3VTAA 1J0KA 2EDKA 3L5IA 3APCA 4JQIA 3ZOAA 5E03A 2WLHA 5I1AA 1I85C 2J1ZA 1OGTB 1WCBA 4NUJB 4Y4FB 2PCFB 5E2TL 1MW3A 4X6FA 5C0GB 2V2TA 3GGWA 3NIFB 4UOZA 4XO4A 2FYVA 1B0GA 4RAVB 2H1PH 5CN2A 2AMGA 5C0ND 1U8KB 2ZKYA 3HS8A 3TWYA 2BFVH 4JKPL 3DJRA 2E27L 2WQ8A 4NO5B 4Q9CA 3B9KB 3S36X 2ZXAA 2D3LA 4HCRA 1G0XA 1TMQA 4QNPF 4AZ8A 3ZHKA 4OZIE 1OXYA 2AQ3A 3DX6A 5I5RA 3MJGX 3MRIB 3GSNH 3HG1B 1X9QA 3CQQA 4F27A 35C8L 2PW1A 1A3RL 1ADQL 1QKZH 1AHWB 1EZSA 1R24A 2VUYA 4N0UE 3U4BL 2CHWA 2VXTH 5C08A 5DD3L 4O4YH 1MELA 1THAA 2X87A 2H3KA 1NFDE 3Q3GA 2XKUA 3ULSA 4TVPE 5FYKU 5BOJA 4ZS6C 2RGSA 5EUKA 3WKML 2F54E 1ZVHA 2B0SH 1KC5L 2VZ3A 4W9LC 5D2LA 2ZKWA 3LRGA 3GRWL 3OGCA 4ONHB 1T0MA 3DPBB 3ARGB 2VM9A 4YFEA 4CC0A 3VSTA 4HPYL 4AENA 1MWAB 1OCWH 1JZ4A 2P47B 3ZHFA 1HL5A 5F7UA 4MMZB 1CC3A 3BPCB 4A7SA 4IKJA 1SJEA 3PJNA 1A9VA 2EUZA 1F2QA 4EZJA 5GSRA 1MFCH 3HUJA 3VXOB 2FD6H 3QEUB 4FQXC 4OFYD 3CUPA 4X8CA 4EOWL 4M02A 3WENA 1CG9B 3F64A 3WE6B 1IE4A 4UV7H 4ZUVA 2DLHA 3NJFA 1KJ2L 5DZJA 3QWQB 4LESA 3RY5A 1YRKA 3EGDA 3NSDA 4KH9A 3FONA 2B1AH 5LGHH 2VDPB 1U2HA 3US9A 1J9SA 1TQSA 4TQ8A 1MCQA 1AO7E 3Q7JA 4L8BA 1WBZA 3L4WA 1JPGB 4L3ED 5GISL 5B39B 2J8UB 3FT0A 3PY9A 1YY9C 4XP6H 3QUML 4AW7A 1L0QA 4KHTL 2XTJB 1FJ1B 4P2QB 5C8JB 1MCEA 1IARB 1C12A 3NIGF 4A63A 1SJHA 1M7IB 4EIBA 1YNKL 4DO6A 1T89A 3O0RH 2AZAA 4B96A 3C5JA 4N2HA 2Z6FA 3LS5H 1Q94A 3TA3D 4R26H 1YMHA 2OJZL 1NFIB 3HG1E 3MGOB 1ONQA 2BO0A 4GW1A 4H26A 4WWPA 2AABH 3FRUA 5GGVL 2GJ6B 1YJDC 1E28B 4EDXA 1I4FB 4K3GA 2DWDB 3H7LA 4DKEL 1RUAL 2O6PA 5JLZB 2BW5A 1P7KA 3JTSB 1UM6L 3BVWA 4HAKA 4IOIA 4NRZA 5DJXB 4YFDB 3C2AH 5DUBA 1HE8A 3EZ8A 2WLJA 1GCYA 1OLZA 4URKA 2EYRB 2F7RA 1EMTL 4P07A 2F7IA 5I6OA 2QGBA 3JVGA 5FXCH 3ESMA 3KPNB 3FT2A 1FN4B 4M7ZB 1A8JH 3NABH 4LPVA 4RGND 4CN6A 5JNYA 3AGVA 1CLOL 4WW2C 4DGIH 2R7EA 1CFVH 4PRPA 1NL0L 4FFVD 3NIDF 4H8UA 2V3FA 1GYUA 3D39E 3SQRA 4QXTA 4KKAD 4KRPB 1DQLH 1IGCL 1YJDH 1AQHA 4MZRA 3MLTB 2ROXA 3CZUB 3MBEC 4JY5L 1G7MB 4KU1A 4BCYA 3VTMA 2N3JA 4HIHB 1AKPA 5DC4B 4LLMB 3PXLA 1I7RB 4Z78A 5F89A 5KUMA 1XF5A 2OM5A 4D0DB 32C2A 4DZBA 4O58L 4BHUA 3UP6A 2BC4B 5AUMB 4PI0A 4O2CA 2W9LA 3D51A 1INQB 1K2DB 1CD8A 1QFWM 3JV4A 5ITFA 3OKOA 2FT7A 4EF3A 2OV0A 4YHNA 1I8KA 5CBEB 2D3VA 3RZCB 2DQGL 1IKNC 3GXUB 3VFVA 1RIHL 3UJJL 1KJ3H 3VAEA 1PEZA 3MBXH 1JFQH 1NLDH 4QMEA 4N2DA 3H2QA 4Y1SA 3ZSSA 4EN3D 1FNGA 4YHLL 1SY6L 1HCFX 2WVSA 2V3EA 2J8UE 2W59A 2YGVA 3HVDA 4FGMA 1NBVH 1MIEH 2ZCHH 3N42B 1HKFA 5KZCD 5DVKA 3SGDI 4KKZA 4RFOH 3NGBC 1O7DC 2ZUXA 4S1DD 1TDQA 4P3WA 3R06A 2XQBL 2EIJB 3AY4A 3CFJA 4NENB 2F8IA 1H9DA 3KLSA 1ECZA 3VSQA 4B53A 1K3ZA 4ZXBB 4E2OA 4Y2DD 4XBMA 4NX0A 4BK5A 5F7DA 2R1WB 5DRZA 3RGHA 3GXIA 3CVCA 1RURL 3HAEH 2UWEF 1TENA 5HHXL 1IFHH 3VW3H 2UV3A 5I1DA 2FVNA 5L4MA 4KNQA 4HUVA 1FVCA 2GFBA 4Y5VA 5LO7A 1WA2X 4QRTB 3BZEB 4UTCA 1A1NB 4YHZH 4Z8FH 1HSBA 1EA9C 2A6JB 3O4LE 4TTGA 3EO9H 5DLLA 5C0EA 3ML9A 4ZPVB 2RAMA 3ZXAC 3POHA 5E94A 2QVMA 2DQUH 5EF0A 2R1XB 2WQVA 4HFUL 2BVQA 2D8KA 3WFEL 4AYMC 5DHVA 4A2LA 3L4TA 1AMYA 3UTTE 1JVOA 4YDZA 2NPLX 4I48B 4JGJA 2XNAB 5KBDA 4H1LH 4D9RD 5KVEH 4FLRA 2XN9B 3GNMH 4JRWA 1ZRUA 2OAAA 3KHOA 4IDLA 1CQYA 3BLBA 3D85A 2Q3XA 2VWEE 1NM9A 4KOCA 1SLXA 4RZCA 4XMLL 5EDXA 4HIXL 1UH4A 3RQ3A 3T0EA 2UUDK 5J13B 4PS4L 1T5XB 3QDMA 5FHBH 4CDGC 2Z8RA 4OCRL 3LRHA 3DBXA 3P54A 5CGYD 2AV1A 4M62H 1T7XA 4K23L 4R4NC 1KV7A 2OTWB 3N44B 3PDDA 1I7TB 3PNRB 4MA1B 4PRHE 1LEKA 5I18H 5I66B 3RFZB 2GSGB 1V3KA 3DIDA 4IEFB 2XXFA 1Z9SA 3MLUH 3W9EA 5I9QB 4AXWA 4YK4C 4NIKB 3ZU8A 1QYGH 1N59A 1LYQA 1F4YH 5DYFA 1T1WB 5I1AB 4M8UA 1BZDA 1U3HD 1WCBB 3WHE0 3ZTCC 3RKDC 2YJQA 4X6FB 4OLWH 1MY5A 2YPLA 1CL7L 2V2TB 3GGWB 1FLTX 2APTA 4LSQL 5EUOB 1B0GB 4RRPA 2ITFA 4OF8A 3QORD 1YEDA 1Q9WA 2WVUA 4JO3H 5FK9B 5I6KA 4G7QB 2UY7A 4KQ3H 4H0GA 3QBTB 1KB9J 2B16A 3FUNA 5DRXA 1FC1A 1QRNE 4TPRL 3H2WA 3WAJA 3PV7A 4NRXA 1YDPA 3ILQC 5ALCH 2PW1B 1R24B 2Z7UA 2X05A 4P48A 5HHMD 2D3NA 1O9VA 3RP1A 3IYLW 3X3FH 2J71A 3X1GA 2ITCA 4UILH 3Q3GB 2CNZA 5C2UB 1IGTB 5IG7A 5EUKB 2O5NA 5L2KA 4G6KH 1B3JA 2FHCA 3K7UA 5D2LB 2B4CC 2CG9X 3S97C 3GRGA 4JBSA 5CSBA 3OGCB 3HS0C 4DO5A 1U92A 1NFKA 3MFFB 1TZOA 4TOYH 3HJEA 3Q2CA 5CN1A 2VXQH 2LLNA 2XSKA 3B7TA 1FAKT 1A5FL 1HT6A 1N0LB 3WHXB 1KELL 4MNQA 5MERA 3KWWB 2KZBA 4XP4L 1CGSL 3KWXA 5BRPA 4PGCA 4FNPA 5GSRB 1KFAL 3HUJB 4AIXA 3RTQD 3CUPB 3I9GL 2GITA 2EDBA 2W8CA 4HF5L 1LTXA 4MLIA 3RI5K 4CVUA 3E3QE 1CLZL 2PPFA 2WXGA 1IGJB 2B4CH 3K5SA 4I9WE 4APXB 3RUGB 5DZOA 2E4TA 5HGBB 2VUOA 3AB0C 1HZLA 1K8IA 4D8PA 3EGDB 3CSGA 3FONB 1BEYL 3LN5A 3HRZC 3RHWF 4DKFH 2PO6A 1WBZB 3VU2A 4HZ1A 3PAUA 4YH6A 3EYUL 4K7FA 5EZLB 3QFJA 3N3EA 3C5ZC 3ARBA 2FX9H 4FQLH 4OJFH 2WSDA 1DR9A 1OP5H 4WHYH 4Z77A 2B1OA 1C12B 5F1NB 1SJHB 3T08A 4Y5YC 3C5JB 2G2NA 5A2JH 4KDTA 1Q94B 1I1AA 1CDCA 1EX0A 3WJLA 5GS2D 3B5GA 4QT5A 3GLAA 1YMHB 4NGHH 4GW1B 1HJBC 1I1FB 3S37H 3QPQC 2BXZA 4K5OA 5C08E 4EDXB 4UF7C 5DD1L 3SPGA 1ORQA 2D4FA 2FK9A 3LNGA 4OZFB 5IOKA 1KF9B 2ZYSA 4E42A 2QHRL 2IPKB 1G7HA 4IOIB 1AR1B 1QWNA 1PX8A 2IAND 4FFZH 5FGBA 3OWEA 2J57A 5D2LE 1FLRH 5A2BA 2RQEA 4NBXB 4NKOA 4YPGA 5ESQA 3FT2B 3R1GH 4S1SH 3PUCA 2YPVH 3TZVA 1ZT7A 4Z7QB 4S0HA 4TV3A 4PRPB 2WXNA 2Q8AH 1JPFA 2I5YL 3TCXA 3WLBA 5B38G 3WDHA 4QXTB 3P40A 5B4MC 3D3VD 4LOVA 5J3HD 3HUJE 4KZDH 3QCUH 3I6KA 5BV7C 4PY8J 2DQJH 3NFPA 2EYTA 2LVCA 3ME0A 4Z78B 1UWXH 2A4CA 4K3EH 1CTMA 5F89B 1NAMH 3MREA 5FPIA 3Q6GH 1NAKH 2A5UA 32C2B 3OAUH 5SWSA 2NT0A 1DBMH 3ARSA 1E0OB 2DH2A 5F7FA 4O2CB 4PJFF 5ITFB 1WS7A 1ZANL 3OKOB 3OZ9H 4TQEL 2VABA 4AEIH 1DVYA 5GS1A 3IJYA 5D7HA 4P4KA 4OQTA 4OCLC 4ZMXA 4JPKH 3D50A 1FNGB 3NBNA 4DN4L 2B2XH 1P7QA 4G7VH 3B7SA 5E2UL 4XBEH 4W9EC 1TIUA 1N6QH 5BV7H 1JE6A 5IR1A 1Z7JA 3B3BA 2XPGB 5F9JA 5JQ6H 5GS3A 4XPBH 1HQ4A 4PJ7B 1SLWA 1OT1A 1U33A 3FQNB 3SKNA 1G7JA 2VMCA 3RB5A 2C3XA 1LE5B 1HDMA 5JXAH 5MEOA 5GGSA 2F53B 4MKTA 4X98A 5FM8A 4KI5C 1CDJA 4PHXA 5F7DB 1P4BH 2Q5BA 3WSQH 4M1GH 1M7DA 2D2OA 2J6EA 1KYOK 1OAZH 1I9RH 1QSED 2HJFA 5I1DB 2PP9A 5DVMA 2DQTH 3GZPA 1FVCB 1C5BL 5F9OH 2JIXD 2YQGA 4KK8D 5AVXB 5C0EB 1WIOA 5H94A 4U33A 3RWCA 5FKAA 3LH8A 3BEVA 2KQMA 2EDQA 2BVOB 3D09A 4OCXH 5AVUB 2KPWA 1J9CT 4PRPE 3ZHDA 5T1DH 1N5AA 5DJ0A 2ALAA 3T2NL 4OZGF 4U6VL 4FTVA 3HNTH 4L18A 3IDGA 4TQPA 2EH7H 3GSOB 3CDGB 4H5SA 1CU4H 1UYWL 4IU2A 1WA1X 1YMMA 1UWGH 5CEZL 3TBYB 4A7GA 4J6RL 3TEXA 1F56A 5J7CC 1J8HD 3BYTA 3QUZA 4J8RB 2EKJA 2F7PA 1A6PA 4JQXA 2WV3A 1S8DA 4Y1TA 3QZLA 4RZCB 2VLME 1SFHA 1DUYA 1C1EH 1RAMA 4MYPA 2Z91A 3DBXB 5IVXA 2NY6D 2Y5TA 5JZ7C 2AV1B 1MG2C 1N70A 1GGUA 1QSFA 4MQXD 3R7QA 1J10A 4PWKA 5ITBH 1UJ3C 4CVWA 3GMLA 1JHTB 1CDYA 3T3PF 2ROYA 2BLFA 4HIJA 1E8XA 4FLOA 1Z9SB 1E4JA 4LCIL 3LKQB 2X9YA 1DQMH 4GRWB 4AXWB 2LU3A 3RVWD 1L9SA 3H9SD 5LGYA 1N59B 2NCEA 4F33B 3T1WA 4ZX6A 5DQDH 5F7NC 4A6YB 2WUBL 3PPEA 3VWKC 4OI9A 3X14A 2YPLB 4MDJB 3ABZA 3NCBB 1XF3A 3T65A 2P8PA 5HDOA 4ZPTA 4OVUA 2IOMA 3IXAB 4HJJL 3EOBA 5IROC 5C7XH 4ZMLA 5IW6B 1NDGA 5I8CA 1Q9WB 2A74C 1OQXA 1WSST 2CCWA 4PJEE 3FUDA 1C5DB 4NZDA 4KROC 2UY7B 5GS0L 4LLUA 4OD3H 2FJUB 2H1LM 3FMGL 1XF4A 4ANUA 4DP1X 5J4MA 1IEBA 4YSQA 1QFOA 3BCDA 1JPTL 2EDYA 2WAQA 4QXWA 2FJFB 4JDEB 3EJQA 4BH8A 2ITCB 5EPMA 3T2QA 5IG7B 3UIZA 3VFGH 3F7RA 3Q8CA 3WFZA 4TYUA 1E4WH 5FHAL 4GQQA 4JHWH 4XAKD 5ANMB 5FW6A 3QPKA 3CDYA 2QELA 1U3YA 1J8RA 2EZ0D 5GGRB 1WIUA 3WY3A 5DURD 4QJ5B 4YR6A 2FATH 1NEUA 2VN4A 4KK5D 5IKCA 4MNHA 4MNQB 1KB5B 1S7TA 5MERB 5E6IA 2OK0H 4UTBL 2CGRH 3EYOA 4QD2E 4OKVB 4PGCB 2PF6A 5HVHC 3CV5A 5C0AD 3AXIA 3T0EE 2GITB 2YD6A 1NIAA 1U3NA 3QDME 4YHYB 4XP5H 5HD8D 2VZSA 4AZUA 5AD0A 4RCAA 3U36B 4O02B 3OV6A 4Q74A 4M48H 3P30L 2X89A 1QQDB 3V95A 5KSBA 2JLPA 1YAIA 2OQJA 4HWZA 2IAMB 3CBKB 5DRNA 3MU3A 3R0NA 4D8PB 3CMOL 1JNJA 4FXTA 5HYQB 2GQHA 2OKMA 4MB4A 1ZMYA 3JWDC 5M95B 3LN5B 3SOTA 1S5IL 5DSCB 5C07D 1RJYB 1GGBH 4BFGA 3GBEA 2VERN 4N1CA 2PO6B 5DLML 2CIIA 3BUBA 4XNZB 3O2DL 1OPOA 4I18B 1ESOA 2YPLE 4BEIA 4WTZA 3N0PB 3ARBB 3EOYG 1ZWIA 3Q2WA 5E7BA 3PAVA 3R19A 2CGYA 4Z77B 2Y2WA 1A02N 4FZEH 1VFBA 1HYRC 2YA1A 1QEWA 4G8IA 2E4FA 2AEWA 3EYVA 3SQOH 4NDMA 5I0XA 2VGLM 3RJQB 1I1AB 2OXHA 2DTMH 2EQDA 2GIYA 1H15B 3FQWA 3JWDH 4QT5B 1ADWA 1M1XA 4JN1H 4QGTA 5CCJA 4Y9FA 4XBPB 1G0YR 5ESVA 4JHZA 3N55A 4U3CA 2XWDA 1KJMA 3TURA 5J6GA 3DVNB 5EU7C 3T3ME 3TASA 2DQ6A 1HU8A 5JOFA 2CUIA 4E42B 5KAQF 1XT5A 1A7BA 5L2KE 1RVFL 2YBGA 4YQXH 5DT1L 2VZUA 3F3HA 3VXNB 4P57A 4YPGB 3WJJA 1YN7A 4HIIA 3TZVB 2QLVB 1A6WH 1ZIAA 2K9FB 1MAJA 3WLBB 3B2VH 2YXWA 4XH2B 3DJ9A 1CI3M 1IM3B 2JELH 4MNQE 4KRNA 3IS1X 4K94L 1Z5HA 2APVA 1MZYA 4PJ9C 5FW7A 1UASA 3H9HB 3WUZA 2YD3A 2VSMB 3BMVA 1PDKB 3NFPB 2EYTB 1Z5LB 4OD2A 2VB5A 3F7QA 2W0LA 2IH8A 3CX5K 5SWSB 2WBJC 4XC3H 4P5SA 5IF0A 4XPAL 1XSKA 2XVKA 3IETA 1WFMA 2KMWA 1O0VA 4ZMWA 2FIKB 5I1KL 1ZLVH 2OMZA 1CJYA 2VABB 2NMSA 3F00A 5GS1B 4N2LA 3PS6A 5F9AC 4P4KB 4ZDHB 3W5NA 1BYOA 3KD4A 5MENA 3GPSA 4OFDA 1AFVL 1P7QB 3H55A 3JXAA 2E9GA 4ZMZA 1J0JA 3QFJE 1DJGA 1P5UC 5IR1B 1HHJB 4K3DH 4D7PA 4LCCC 3VTTA 3WS3A 3HTLX 4XCNB 1HQ4B 5DC9B 1EPFA 1YPZA 1EJ8A 1G7JB 2E6JA 3SGJC 1HDMB 5MEOB 1AANA 5GGSB 2FAUA 1RUQH 3PGCB 4X98B 2MQ3A 5C86A 3DDGA 1LLAA 4FQIH 4XPTL 3FCTB 1PY4A 2LR4A 3K4AA 4BELD 3SPCA 2OSXA 1EV2E 2P28B 4WDIA 5TF1H 3TWCL 3L4CA 1CLYL 4KVNH 4X80H 4AITA 1PLCA 4I9XA 4IRSB 3GHPA 3Q48A 4JFZH 4YO0B 5DWPA 3GI8H 4JPIA 4NRYA 1NC2A 5KVMC 4KY2A 1SOKA 1QG3A 4IJ3C 1YUHA 4Y5XB 2FH6A 3O8XC 4HS3B 2R2BA 3BEVB 4MQSB 4BFOA 1ACCA 2ZD0A 2IALA 2N0KA 4YAQA 3Q5TA 3G04A 3DGDA 3WV0A 4M6AA 2Y2TA 5D6CA 4B9ZA 2XIIA 3Q8FA 2X53A 4H5SB 2CR3A 4IU2B 1TETH 5F71A 1KIQA 1RL1A 4L3EA 3QIUD 2AERT 5JYMA 1TQVA 1GY2A 3GZQA 3EFFA 3QUZB 1ZEAL 3H3PL 1E6JH 5C0CD 3FK3A 4GUPA 3RNQA 5IJBC 5EOCH 3UPCA 3MRMA 4ODUA 5EU5B 1QI4A 3E1F1 5E99L 3AXHA 4IRJA 5DUML 4PG9A 5DZPA 4YC2B 3G6JF 1YYML 4FFYA 5DTFB 2Y5TB 3TA3A 2B5IB 2Y69B 2HH0L 3U4KA 1IC4H 5J0BA 1Q0EA 2ENQA 4PVMA 2IWEA 4HIJB 5SWZB 4A7UA 4NNXB 1HINH 1RK7A 2KC0A 2PXYC 1AHKA 4MAYC 4A2GA 5AVTB 1WGOA 1UZ6E 5IMOA 5JIDA 5FGRA 5GJSL 3UJIL 1WZ1H 3WEXB 2PKDA 2CMRH 3X14B 2NTFA 1TJGL 2E9IA 2IGFL 2XKSA 1HWGB 1LXMA 2CPUA 3S37X 5HPOA 3ULVE 3QS2A 2P8PB 4R6UA 5E6ZA 4AX3A 3BD5A 1PJWA 4ZPTB 4BUGA 1EDHA 4EAEA 4GEIA 1NDGB 4YXKH 1T7WA 1FZMA 3QWRD 1NWPA 4A55A 3CFCH 3QUYC 4LLUB 3CFUA 4Y16C 3KYOA 2BP8B 1CE1L 1BFVL 2C3WA 3EIFA 2O6DA 3K4DA 2OMTA 2GB2A 1IEBB 4JQVC 1LILA 4QUOA 4KJWC 4I4WA 3FQXA 3LHPL 2DMGA 5BZDB 1MIML 4ILDA 4F9PA 3F04A 3HEIB 2JKLA 1T1XA 4BH8B 3C60B 3QIWA 3BRGC 2W1NA 5EPMB 5CJXC 5F0LB 5DS2A 4I1NB 5HDBF 3HE6C 1LWHA 5F3BA 1IE5A 3ESVF 1RUPH 1H5BC 2D31A 1B2WL 2P5WE 4FTVE 4AY0A 3QQ4A 4JFUA 2F19H 1YMME 5B38A 1JFHA 2NNAA 2EXWC 3BDXA 4AYBA 4OLXH 2X70A 1KIRA 3DSNA 1OTTD 4U3SA 5ES4B 4MNHB 2IWKA 4NO2A 1GGYA 3PHAA 3VXUD 2IDQA 1EUTA 4NM8L 4NC1C 1DBJH 2AJXL 4X0KA 2QDWA 3DOSA 4KI1A 3U0PA 4XZUA 2W0PA 3DKHA 3UBXG 4ICWA 4AKQA 4GBXD 3MJ9H 2NX5B 2D03L 4N2OA 4GRMA 2CJTA 5IVXE 5AD0B 3SCMD 3CHOA 4C4KT 1JV2A 4L0YA 1QSFE 4NO0A 3MLVH 4POZC 2F6AA 2X4TA 5DUPL 5KSBB 3UPRA 2OQJB 1YNLL 3QCTH 5F8QC 4AGOA 3TF7C 1SHWA 3WTUA 5DZLA 1G9ML 1T0NA 4YXLL 1QPKA 5DRNB 1LDPL 4WGVB 5DO2C 4YEFA 3LKPB 3EJPA 4G6FD 2YUXA 1TJIH 2XBZA 3GS0A 3VFRA 4AVHA 1S9XB 2A6IB 1PGRB 5ESAA 1DSWA 3SN6N 2XRAL 3AU1B 4LSSH 4PUBH 5FYLD 3T8XA 3X11A 3THMH 5T1MA 4L9DA 4UMGA 1ZWIB 1NPJA 2V6HA 4GXVL 4PJDA 1AXTL 1ZV5A 2ZCLL 3AROA 3D30A 1TPXB 4IK7A 4YUEL 3TFKC 1VFBB 4QOKA 3VRLE 4ELMF 1QEWB 1AI1L 4G8IB 4RMBA 2ISDA 4YXHH 2VDOL 2KPNA 3FQ2A 4PJBA 1JZEA 3EKCA 3EYVB 4NDMB 4UT6H 3STZA 3BAIA 4NN5C 1RJLA 3FUMA 2OXHB 3QJHA 2IDTA 2VAJA 4RGMB 1J87A 2QPFA 4OGXH 2OZ4L 3OLEA 3T09A 4DHLA 3W11D 4K3JH 5BO0D 3ABLB 4PD4K 5DGQA 4B9JA 1GZQA 1DLFH 1F97A 1KZQA 3KJ6L 3ZO0A 1KJMB 5HBBA 3KS0H 1U2YA 4AQ1B 2EIMB 1RHHA 4JFVA 1YQVL 4IIQA 2WQUA 4QEGA 1HHKA 2LT9A 1V54B 2GJJA 4KKCC 5A6MA 4ODSH 4GP8B 2AK1H 2VDMB 4U4BA 1Z3GH 2MKWA 4P57B 4WU5B 5TQ2L 2H32B 2VDLL 4LVOB 1YN7B 4HIIB 2NUPB 3C6LA 5T1LA 1KNOB 5DJCB 1FNAA 4QHNA 5TFSH 1XIWD 3KPOA 4FLQA 4HXBL 4FQ1L 1UOKA 1VLXA 4OLYH 4YDIL 5ISZD 1VIWA 2E86A 2J7LA 1EEQA 2QVTA 3C09C 4FG4A 1YEEH 4K8RD 5F0PB 4UAHA 4CN1A 4HS8H 4B9GA 2JB5H 3TA4D 4P5TC 4IRZL 2OSWA 3PDOA 1I7ZA 4XCYA 2BWDA 2CO7A 3VXRD 5KSBE 4AL8L 2P46B 2HKHL 5IF0B 4YGAB 3PNWB 3FW6A 4EBQL 2ZAHA 1BW8A 4PH8A 1LNUA 5I6XC 2XICA 1KGXA 4X9YA 4AE1A 4JJHA 5KG9A 1RUMH 2ZX9A 2VDKH 4HAGA 5H37A 4TVPH 4OGYL 1MRCH 1ZVSB 1TTUA 4GSRA 2DN7A 3VRJA 2CHNA 4X83A 2WZAA 5AWNL 3NFNA 3WS3B 2HTKC 5EZIL 1PTZA 1HTYA 1KFGA 2NSXA 3NCYS 3AGWA 3MUY1 4NYLA 4F58H 5CS7A 1LWRA 2NYYD 3FAXA 4FG2A 1QFPA 5C6WH 1DZBA 4FF9A 1U8IA 5AVWB 5DJDA 4P2AA 4Y4FC 3BD4A 1T03H 1KSRA 2XI9A 3VFWA 3AM8A 4LAQH 4WDIB 1I1YA 4M6OL 1XL4A 3IJSA 5B3NA 3APFA 2DMHA 1RI8A 3RWDA 1L7TH 1JG9A 2ZJSH 4JPIB 4NRYB 1NC2B 3G5YB 4XVTH 1CLVA 4KPHL 3VGEA 3B9KC 5E08H 3FS9A 3NJIA 1S7RB 1VGKA 1YUHB 2JMRA 2WQXA 2CLVA 3GEWB 2R2BB 5DI8B 3SGKC 5IFAH 2WQRA 5C0BA 2IALB 5F72S 1V7NH 3PWVA 3U9PH 2Q20A 3UTOA 1HIMH 2Z35A 5LGJA 3TS8A 5D6CB 4LDCA 4J12A 4PJFB 4JHBA 4KJQC 3LPPA 2UZPA 4LCWA 1CICA 4IOSA 1GOGA 1KIQB 2LVEA 1ET8A 1J1PH 4L3EB 5CFAA 1N12A 3LIZA 5KBPA 3EDJA 1HXYA 4JB9L 4NI6A 4WI8A 4YWGH 5AZEH 3EFFB 5LB1A 4G82A 2OTUA 5I15L 4GUPB 3ARGC 4HU2A 4RAHA 4LQFH 3Q8BA 5DJ6A 1PLGH 1JWUA 3UTSD 3BKJH 3MRMB 1RP8A 4ODUB 4QLRA 3WNPA 5C2BH 1AGCA 4ZMQA 5F21B 3NRPA 2YMTA 4PG9B 5C70A 4MMZC 2AXFA 3TA3B 1KG0A 3ARRA 2X6UA 3BO8A 1ZLEA 3TNNA 1GAFL 3QARA 1E4HA 1WWAX 2J43A 5MENE 3APDA 2G3MA 3MCLH 1A0QH 4L3AA 2AJSH 3BUDA 3GBMH 2B8OT 4HBCH 3AW5A 2AAAA 4AK2A 3SJVE 1NCGA 4ZS6D 2K6YA 5B7EA 1L3WA 4XVJH 4HOXA 3HN8A 1WEJL 1WO2A 1QACA 4H44C 4LPTA 1YPZE 5FFGA 3PWPA 1OB0A 2J6WA 3MGTA 4PMFA 1MWAH 2X7LB 4RGNB 3LKOA 3VA2C 5CLYA 1X9RA 3LNFA 2FT6A 2R2HA 4N3TA 2D7PA 4RISH 3KVDD 3RFRA 3UPAA 4B50A 1YEWA 4Z7AA 4EI6A 1MEXL 1FZMB 3ZYOA 1K5WA 1J5OH 1BQLL 4YN3A 4FQXD 1VCBC 2Q8BL 3DV6A 1UWEL 4M6ML 4W70A 1GGIH 2XTJC 4XPFH 5T5FH 2HRPH 3WO4C 1F4WL 2OMTB 3RU8H 2HAZA 3W9DA 5DA0B 1M56B 4I4WB 3FQXB 3KHQA 3EO0A 1G9NL 2F1EA 4JG9A 3MVSA 3VFPB 3RVXD 5LWYL 3K5RA 3QIWB 5K9JL 4J4PC 4P99A 1J7VR 2VDPH 4DO4A 1P84J 2JSFA 4XOBA 5IW1A 4H20H 5E56A 3TXAA 3FUEA 1HNGA 2R4RL 4JFFE 5F3BB 2DM2A 4G3YL 3KPMA 3NA9H 1S7QA 2NY2D 4EN3B 3V4PH 1ZV2A 3U4AA 5B38B 2NNAB 4XNDA 2Q1EA 3D18A 4BZYA 5IEKA 2EDLA 1KIRB 3DSNB 3BZ4B 2F2HA 4D0CB 3EHBD 4NO2B 1MRDH 4TKWA 1I8IB 1WV7T 4NBZB 4P06A 4YBQD 3ATBA 4XZ4A 3EGXA 2ZT9C 3AABA 1A7QH 4XN2A 1E6OH 2W60A 5KZCB 1IQWL 1AD9B 3DOSB 3U0PB 4PJGF 5LVEA 4OZ4A 1MHPL 5AOJA 2DIAA 3KPRD 4GRMB 1CT8A 3ZL1A 4KRPC 1JV2B 1CO1A 5FIEA 4NO0B 4RWYH 2X4TB 3UPRB 4AMKL 3MJ7A 4I0PA 4Z7UA 1W72H 3PXJA 4G8AC 4LF3A 3RDTA 4EUPA 2XACC 5ICUA 3F8UB 1XR8A 1PG7L 4U1MA 3VFRB 1ZS2A 4JRYD 4JCLA 5ESAB 4PJIF 5D5MF 2PR9A 3T8XB 3X11B 5ID1A 1TVHA 4JJOA 4PJDB 5INDB 3IAQA 3ULAB 4Q9QL 4OM0L 4AJVA 2QHLA 2CK0L 3P2BA 4RNRA 5J57B 4QOKB 5CBAB 3PUUA 3DIFA 3QULB 4AYSA 3MBED 3ZKSD 5FECB 4PJBB 3FHEA 1XF1A 1R5IA 3AT0A 4X7SL 1EEYA 3HG0A 1FVDA 3BPLC 3RA7L 1M7XA 3BVVA 3MRGB 2EDNA 4UT9H 1J8HA 3BN9D 3TV8A 4HZLB 3V0VA 3GF8A 5LBSA 2A6DB 3CVHB 1CXFA 3MRLB 2AEIT 1TZHB 4YSAA 5LXGL 3Q1SL 2XIDA 2FH8A 3QDGE 3UEQA 1F42A 2JCCF 2MOVA 1YEHH 2HVJA 4ANWA 4IIQB 4BYHA 5IJCC 4OCWL 2WBWB 5GZOA 1CXEA 2NY4B 5HGAA 3PFQA 3RNKB 2AHIA 2YA0A 2X2IA 4LCVA 2Y4SA 3CG8A 4QHNB 1UC6A 4NJ9L 4R4FL 4BJLA 4WJKB 3RTLA 3KPOB 4WTWA 1MF2H 1U3HB 3N0AA 4YLQT 5E8DL 3DUSB 5IESL 2ADGA 3A5VA 3FTUA 2C9RA 4LNVA 3Q13A 4JO5A 5CD5C 1HCVA 5DHYB 5DRWB 3VRIA 3I6GA 4Z7WF 5F88B 2ATPB 3QORB 3WXVH 3PDOB 1I7ZB 1JN6B 3G5XB 1EO8L 4XCYB 4BA8A 4PCKA 4MB1A 3QW9A 2E7CA 2MJWA 5E8OA 2XWZA 4XP1H 3WFBH 1LNUB 2NNFA 1ES0A 4PS7A 2GCYA 3WD5H 1JHKL 2WINA 4WFFD 5I75B 4A2MA 4AUUA 1FFPA 2NT1A 3RVVC 5HHMB 5J13C 3RPIA 1QASA 4L1HA 4ZO9A 3S96A 3ZT5A 4E9LA 4PRIA 4K73A 1QUPA 3T2PA 3MV11 3E3QC 1JYVA 4ZW7A 4LHUD 3T77A 3UTQA 1HYSD 3FU3A 4IQHA 4NWTH 4PJDE 3WIHA 4MA1C 4M61A 2FO4A 4NYLB 5C9KA 4PJCB 5I9QC 1EK3A 6PAZA 2MWCA 1URIA 2AK4D 1JGEA 3HI5L 4QHKJ 3L3OB 5DJDB 5IM7A 3FXIC 1TCMA 3TBCA 4LU5L 2XIBA 4UINH 5E4IA 3BW9A 3ARZA 3VFWB 5KSVA 3Q2VA 2KHAA 1I1YB 5DMGD 2OW6A 5JW4N 1JI2A 3J7HA 3IJSB 4KKLC 5DJZA 3R7RA 5CU5A 3SYQA 5F96L 5T8IA 4Z95H 5HI5D 1A1OA 3IS0X 4P2OA 4D9QE 1VGKB 5D8JL 1TTGA 2CLVB 2Y1VA 1A6TA 4HHAA 4D9LL 1L9OA 4FCHA 5H4YA 5F93C 1EXUA 1DFXA 1DZ0A 4ZUSB 4JQIH 3OG6B 1CURA 1F1GA 1GH7A 3ILDA 3RKDD 1WVZA 1UD4A 3FFOA 4YZFE 5FV2A 2BX5A 2K1MA 3C2SA 3CDFA 4AVKA 4UIKL 1N7MH 2AZUA 2DIBA 3ZBMA 2LFEA 4ZNCD 4FI7A 1E4KA 4TULL 4CMHB 4LT7A 2OTUB 3LNIA 4MJIA 1SBBA 4HCRH 5F3FA 3WEMA 3D6GA 3DX7A 1JWUB 1KXVA 4OFIA 1IGML 1Z9LA 1AGCB 4U1HA 4XMXA 1JV5B 1XEUA 4GXUM 5F7LB 2DY2A 3WKYA 1KG0B 1P7BA 1Z1WA 5D7SH 3MV9A 3BO8B 1CFQA 3CXHK 5GJTH 3RL2A 3ILQD 3TNNB 3PHSA 3VFNA 2NOYA 3F58H 3TYGH 3ALWA 4BSVB 3VYOA 4YX2L 3V0FA 3KGTA 4DTGL 1KLGA 5DVLA 4LSVH 4GQPH 3V4UH 4HGWA 1BJMA 4NHCL 5D7LD 1EJFA 1E5CA 1I9IH 2IANB 3QHZL 3ARPA 2LHAA 4MVBC 3MGTB 2BSSA 3C6EA 4TVUA 1YN6A 1TFPA 2WY3B 3HR5B 4XVSL 2HP4A 3LKOB 5I2IA 3JWNE 1SEBA 3KPTA 1MI5D 1WRFA 4FG6C 2VL5A 4PWHA 3GIVA 3K2IA 4BQ8A 3DC0A 3BJLA 3D33A 4EI6B 4U2YA 1CVSC 1EDQA 1BFTA 1G87A 4M1DL 4A7QA 4N8CH 3D3VB 3FTZA 4PBVC 3QR0A 1T2JA 3B2PA 3FQRA 5TDNB 5AZUA 3JVFC 2VQ1A 2FWUA 4BGDA 3W9DB 1A14H 5JHDA 1N18A 4P5MB 2EUWA 5CAYB 1CL7I 1A7NL 2KERA 3L3IB 4DTGH 4F24A 3G5ZA 2FGZA 2Z1KA 2QV2A 3VCLB 5C0BE 8PAZA 5EWIL 2CLZA 1VZIA 3US1A 4OCYL 3EFDL 5IW1B 3SDXF 5AAPA 1I9JL 2E7DA 5HHOA 3VXMA 1NJ9B 1UA6H 1A3LL 3KPMB 1ZHBA 2VDNB 4FNLH 4PREB 1JRHH 4IHOB 4NERA 1S7QB 4R0LA 3L3HA 4JCWA 4LCWE 3HC4L 4N0YL 3C5ZD 1AR1C 3D18B 5H35A 5IEKB 3F65A 1SMDA 6TAAA 2CUHA 3LPWA 3KCPA 1UGNA 1FIEA 1VESA 3K71B 2W60B 2CRYA 1QR1A 3FRPA 1P6AB 1OP9A 3MV8A 5J6HA 1HZKA 3P73B 3WS6A 4A1RA 1KYDA 2RFXB 4XMPL 1LO2H 4NWUL 2DD8H 3VD2A 3LZPA 4AW4A 4KTDL 5E95B 3MJ7B 3NA4A 3BC9A 3GRBA 4I0PB 5G5DB 4PGZA 2BY0A 4WI5A 1J9TA 1AJ7H 1XZWA 3T5WA 2HPOA 4LF3B 2M2DA 4BFFA 1JNHB 4EUPB 4HJTA 1XR8B 4Y2LA 1HEJC 4BA0A 2C9PA 1OAYH 2R51A 5GRJH 1ZLSL 3PWPE 2P5EE 3EO1B 3FSZA 5HDLA 4QHLA 5ID1B 4ZFOA 1QATA 4FXKA 4QYAA 1VEPA 5CLXA 1MLCA 3MLWL 2WP3T 1OP3K 3V7MA 5HP5A 3INUL 2GY5A 4RNRB 1DBKL 5B4MD 2J4WL 3KEHA 2NUTA 3WIIL 1XGYL 4JHAH 2H0PA 1HNFA 3QIUA 1BD2A 4B95C 1J9QA 5J1AA 3BKML 3ECWA 1J8HB 2HJKA 4GAGH 2VDRL 5IHUL 2OSLA 5EN3A 3C8KB 7FABL 3IK2A 3VD0A 5EIQA 3AY4C 3TO4D 3V0VB 5DK0A 4B27A 3KLAB 4BK5C 5C6TH 5BMFH 4LBEB 5ENWB 4RGOL 2Z7ZA 5TPWH 5JIPA 3X17A 4WWKA 4GS7B 2NY6B 2HVJB 4K71B 2YAOA 5E6SB 3IDIB 5KVFH 2FQGA 5ID0B 1DJXA 4MMYB 1ZPLA 2VXUH 1OAUL 1HCYA 4NT6A 4F20A 4HHGA 4X6EA 1A22B 1CD0A 2ICES 3AG3B 1CR9H 2YXVA 3H9SB 3D0LB 4LHUG 2N0MA 2GTZA 2P8LA 1S7VA 1NUNB 2EXSA 4YHPA 2WSPA 1OEZW 2ADGB 2JF1A 2ID5A 5I23A 1GPOH 3GMOA 3SDCD 5I1JL 2C5DC 1JXDA 4FL4B 4GAFB 4KI5D 3I6GB 1OOAA 2KBGA 2FHFA 4UV4L 3J07A 4NPKA 1MCCA 2EC9T 1SF5A 1PCSA 3FZUC 2O4EA 4WEUD 4G9FD 5TQ0L 5E8OB 2CQVA 3CVDA 2W9DH 1XTMA 3HI6L 3Q0HA 3S34L 4Z7UE 2HTLD 2Y5QA 3FQTA 4XN5A 2GCYB 2IXQA 4N0CC 4GJTB 5L9DH 4XWGL 4WW2F 4Q97A 1F86A 1FFPB 1QPXA 4YHIA 1EJ6A 4K55A 3FO9B 3T0EC 3BKCH 1X4YA 3S96B 5LBGA 4JZJA 3GKWL 1ET5A 4NFCA 4EVNB 4F1SA 5B3JF 3PQYA 4U1IA 5DHVH 1AOHA 1NUGA 4G42A 2MPAL 5K9OA 1BZ9A 1NCCH 3L1GA 2WXPA 4M61B 1JD7A 2A9ML 5LHDA 5TF0A 3GXFA 2FO4B 5LG1A 2DF3A 4N2MA 4G6JH 2QEJA 3TO2B 5KJRL 1QR4A 1FSKC 1JPSH 1LK2A 3NEEA 5KVDL 3K6FA 3ZRCC 1JGEB 5IM7B 4CU6A 4BSWA 5KS9F 2SODB 4OKDA 5C0RL 2W07A 2MQ0A 5B7MA 1QFWL 5KSVB 3UTPD 4NCC1 1RZGA 5I0DA 3ECVA 5DJZB 4KXCA 3GSVA 5C0AB 5EF3A 5JIMA 3HI6H 1FHNA 1EVUA 2F9BT 3EJUA 1DEEA 4GBXA 4HA1A 4MD5A 5SV4A 2Q87A 1A1OB 3PHQA 5JZ7D 3SKJL 4P2OB 2IGLA 2WOYA 3BVXA 3V4VA 3BIKA 2FEDD 2PPEA 2ADYA 3EJTA 4FLSA 4HHAB 1A6TB 1VA9A 2WCSA 5FKPA 4GQ9H 4JVUA 4PW9A 3H3KA 4JN2A 4GRWH 3CDZB 1EXUB 1I8AA 1D5MA 1AMXA 1MFEL 1J1XH 1XXDC 4PJXA 4ZO6A 4A6YH 2ARJA 3B9DA 4JUSA 3GWJA 5C07B 4UYPA 5D1QD 3DO4A 4HKBA 2CM5A 3RIAF 4PJ8A 4E9QA 1GKEA 1EIBA 1VADB 3CMGA 4YGVA 2HKFL 4TM9A 5IBTH 5IROD 2VAAB 2SEBB 4MJIB 1FFQA 2UZXA 4C58B 1DQQB 3IKCA 3IM1A 4KROD 3IWUA 1V55B 5F7EL 3OKLA 3ZRSA 1TJHH 4HWBL 4PEEA 3FT4A 1YUKB 5B22A 4DVBB 3MXWL 1CFQB 3RL2B 3IMTA 3EXLA 3VFNB 4YHMH 1NIEA 1E8YA 1MCOH 2AI0H 4AEHL 1KZYA 1I9EA 4YHYC 4Q0XL 4PRIE 3L3GA 2DH3A 2CKBA 3S8FB 5BZWA 4HGWB 5DS1A 3HBGA 3VI4A 1DVQA 4LRNH 3DI3B 5AOKA 1JNLL 1AVAA 1QD0A 3H42H 4MA7H 2IAMC 4PMEA 3CLFH 1D9KD 1NCWH 4P59L 2V0AA 5D4IA 2IWFA 3GC3A 4G7YL 1F1AA 5G4OA 4OBRA 5ICZB 3IE9A 1S3KH 1SEBB 4B7LA 1II4E 2P24A 2H3NA 2VL5B 2PO6C 3A4FA 3GIVB 4MAUL 4U1LA 3VG9C 1Z9PA 4L1DA 4XNZC 4A37A 3EBHA 3EJRA 4I18C 4FD0A 3L9YA 3X12A 1DYZA 4MZ3A 3ARBC 4UQ2A 5IJDC 2O5XH 5FM4A 3LXAA 3CFEA 2EDHA 3CLWA 1HILA 1X5XA 3FQRB 5DD0L 2VQ1B 4XNMA 1Z6JT 5JHDB 1LK3H 1PJ9A 1ZHNA 4KDTC 2EEDA 3OSVA 1JPEA 2OR9L 1I1AC 3NJXA 1WD9A 1ZAGA 4HUNB 1FV1A 1J12A 1X7QA 3FUHA 4HQQH 4XXWA 1BZ7A 5CUSL 1WFIA 5G2NA 4XMKH 3WJLC 1IMHC 12E8H 2YAEA 4C8XA 2CLRA 4RBPK 3T0VA 1SXCA 3P4OA 1D7CA 3LS4H 3NH7L 1J9RA 5HHOB 4L5FH 5HJBA 1N5YL 2ITEA 3ATDA 4UM9D 4R0LB 1FH5H 1ZTXL 2BSCA 1XX9C 4EI5A 2ZKMX 2MNWA 1MZZA 1XGZA 3V6OC 5FGBC 5DHXB 2BP5M 4LASH 5CIPA 2A9CA 2XPYA 5TK2A 4JFHE 2ARWA 1FGVL 2VRAA 2OP4L 4KY1L 2AGJL 4P2RA 4MJIE 3PU7A 4FN0A 4WY7H 1RPQA 3G9AB 3TZVC 3G3LA 2R56L 3P2TA 4OW6A 4GINA 4TUOA 4ZW8A 3WDJA 5J6HB 3X1EA 4JW3A 4FA8A 3NESA 1M4KA 1VEOA 3VXQB 3MV9E 3A47A 1L9QA 4PIRF 4F7PB 1WZKA 1F02I 1F0LA 4LK4A 3S35L 3KYMA 3DTXB 3FHQA 3WL9B 2VM4A 1NLBL 3K6DA 4OZHA 1OAKL 4WCYL 2R0KL 3GSUA 4UWQB 5I8OL 3V9EA 3IE4A 3QO1B 5IQ7L 2D7QA 1K72A 3AITA 3QRGL 4RA3A 4HIPA 2H2PC 1E9QB 4Y1AA 4OQTL 3V55A 4XB7A 2H6UA 2HVBA 4GI9A 4M8QA 4MDRA 3RX9A 2Y6SD 2EDTA 2JKJA 4GY4A 4UT7L 4QHLB 5GS1C 4YSTA 4ZFOB 1EAOA 1KN2H 4RA0C 4P4KC 4ZAKA 1MLCB 5GPRA 3N40F 1EQWA 2ZX7A 3SQBA 4F57L 4I0CC 2YKLL 3K74B 5EEYA 2J1WA 3P0YH 3ZE0B 7PCYA 3B37A 2RCSL 4Y7OC 4B0MB 3QIUB 2BJML 2Z8WC 4RMTA 1VENA 2F7QA 3WG7B 5J1AB 3DUHA 2HJKB 3ZMEA 4RDQG 3GXNA 1EJOH 2OSLB 5DZ9A 5JHDE 3ULVC 5DK0B 1OCCB 2WBJD 4IBWA 4PJHF 1F45A 4PGDB 4PN6A 2FSDA 1MREL 4NJAL 1ASQA 5ADOH 1KCVH 4FTDA 4FEIA 1QNZH 4AE0A 4D94A 1G7IA 4W6XB 4JK0D 5C9JB 4WWKB 1MFAL 5D2NB 1TTRA 3OX8B 5IOPA 3VXME 2IQ9L 1MCHA 2NW3A 1CFSA 1KBGH 1MQ8A 2B9AA 1OSZA 1WITA 3LZQA 2X09A 3PIQA 4N2BA 1ROWA 4OJAA 4NT6B 3DX4A 3OKDB 4CGUB 4X6EB 1O5DT 4Y5XC 3SD5A 1MHCA 1RIVH 4ONGH 3ZJAA 1ADQA 4BFKA 4LIQE 2KL6A 5DJYB 3HZYA 2JKRM 2GTZB 3OKKA 5C0JA 2P8LB 1DVFA 1S7VB 4XX1E 3ULVH 3FYEB 5AB0A 2YC1B 5CLTA 3H2PA 2BSDA 3OBAA 4XN9A 2X4SA 1RZ8A 4OIIH 5IFHL 2DV6A 4PTUA 3VG0H 3MV8E 3WFDL 2NY0D 4GI8A 3MROA 4P2CG 2J6EH 3LJ3A 1RUKH 4KUZL 3DO7A 4E9XA 3GRWA 3LRSA 5LDSA 1C9SA 4PJ5D 5T3ZL 5I19H 2ZCKH 2WZPD 2GBUA 4QRSB 2VNCA 1EZVX 1OD7A 1MCRA 4PRBA 5FYJL 3QUZC 4JQXC 3DK2A 3O6LH 3FQTB 2IXQB 1IM9A 5DS8A 1PFOA 1A47A 2N1TE 3O8XD 3IMSA 4YC2C 1PFCA 1UGKA 4NC2B 1KJVB 1BXUA 4JZJB 3U1SH 1T1ZA 1A7RH 2E76C 2B5IC 4Z7NE 1ZVNA 1FL5B 3PQYB 4UZSA 4G42B 1M05A 5K9OB 3NQKA 1BZ9B 4MASA 5K9KA 2QSCH 1LMKA 4M5YH 4EDWH 1A6ZA 5JR1H 3BD3A 4LVNB 1A9EA 1KPRB 1WC7A 4NZUL 5GHWH 1GHFH 1LK2B 3BUQA 1NGWB 3U7YH 4GOSA 4FE9A 3RX5A 1S7UA 3C6SA 2XUWA 4BSWB 3KEDA 2EP6A 4QCIA 1BD2E 4F80A 2EUXA 2CM6A 4OY9A 3NFSL 3IBOA 4GO8A 1MCPH 1RERA 2VMJA 4I89A 4X7TA 1HH6A 3HLAB 3VXUB 4F7EA 4NP4L 4OFPA 2GJZB 3LMJL 1MVFA 3GSVB 4TNVF 3BLKA 4GP4B 1UTDA 3QUMA 2C9XA 4GBXB 1DEEB 4J28A 4MD5B 1LO4H 3KYNA 2W9EH 2XT1B 5IJVA 3SCMB 3PRZA 3V4VB 1XCXA 3BIKB 2WXKA 1CFMA 1T5WA 3FTYA 5FKPB 4JFQA 5E9DA 1BOGA 4JN2B 1D5MB 3HB3C 3QS3A 1OPGH 3FTXA 2VR7A 1BZOA 1BOYA 2NZ9C 2X4NB 4PJXB 1F6FB 4X5RA 4G6FB 1GC1L 4MHHG 4N2IA 4UQCA 5D4QA 3I50L 4KI5F 4QRQB 2MNUA 3KVPA 1LQBC 1XCWA 3C60C 4PJAF 3VD3A 2X10A 4L8DA 4DVBA 2D7NA 2JJTA 4YGVB 4JX0A 4NNPH 3SE3A 4NQXA 4Z7VB 3TYFA 5JDSA 2X6AA 5F6HJ 1AOZA 1MKFA 2UZXB 4ZTOH 3S8WA 3WHE1 3IVKB 3IKCB 5IHZA 3QUYD 4I3SL 5DMYA 2AMUA 4Y16D 5E8EB 4CUCA 5L88L 4GT7A 4XE0A 3FT4B 3AS1A 5E6IC 1W0VA 1LDSA 4F2MA 1GGCH 4KJWD 1C08A 1FFOA 4DSYA 3RILA 1QBLL 2WW8A 2ZONA 1G6RL 3EJCA 4JKKA 3BAWA 4PSRA 3ARTA 1V8HA 3L3GB 2MTPA 3CJJA 1CLCA 1ILUA 3VJ6B 5BZWB 5C3IA 2Z0UA 3VI4B 1IJNA 3BT2L 1EHLL 3HE6D 3HIZA 2I69A 4UDTA 2WLNA 3HN3A 2EEAA 1OM3L 4QNPE 3ULUL 2NQDA 4U0QB 2YGPA 4DGYH 1HI6A 4WIQA 5A1AA 2FCBA 3N2JA 3VXSA 5EEUA 1JD9A 2P8MA 4DPAX 5CMAB 2H3NB 2Y9RT 5FA3B 1XMWA 4TF4A 3ZE2B 2X2JA 3X12B 3TEZA 3MA9H 9CGTA 4UQ2B 1SY6A 1Z0MA 5ISZB 1CIDA 2J1XA 4LMQE 1HILB 5EBWB 4BZ1L 1TPXC 4XP9H 3ZL4L 2QQKH 2WP3O 4G80A 5HYJD 1HS6A 4DKAA 4HEMA 3GMRB 1YEIH 2VW4A 2WANA 3MXVH 4XNMB 5F44A 2CDGA 2VLRA 3Q05A 4POZD 4LEBA 1ZHNB 3O6MH 4WFED 1Q1JH 4IDJL 1UADC 4RX4A 4KXBA 2ED7A 1FV1B 1X7QB 2JI2A 1C5CH 1BZ7B 4RGMC 3VH8A 3L17A 3ZYJA 1J5IA 1AQKH 2Z0BA 5CCKL 2Z31D 3IMWA 4M3HA 2DJUA 2RJMA 4PJXE 4XNXL 3VFUA 1H3WM 1EHXA 3DYPA 4M7KL 1X5FA 4Y19A 5CGBA 2DL9A 5HPMA 2XWXA 2X1XR 4AQ1C 1A6VL 4MWFA 1FIGH 2KUTA 4UB0L 3BKYL 4F3FA 4MDIB 2DEWX 2R0WH 5CIPB 1G43A 2NR6A 2DTSA 1H6UA 1CS6A 1N6VA 4P2RB 4J3XA 3KPPB 4LVOC 2CIKB 3SZKC 4YDNA 3MJ8A 2PTUA 1QNIA 3SE9H 1RV6X 3CBJB 1YEGL 3MRKA 3E8UL 4YLBA 4FHBD 5CXPA 1UACH 4QO1A 3OR6A 5GZNA 3ZRFC 3KYMB 3V0WL 3D4ZA 4OZHB 1JP5A 3VU1A 5HGDB 1B90A 4KAQL 5T33H 4CSPA 1H6FA 3LH2H 5C0NC 1G7LA 2YSSB 4QTIL 4DNLA 3VI4E 4P5RA 1SQ2N 5AG8A 3NIGE 4H0LC 4KKCD 1VERA 5DF0A 2H32H 5T3XE 4M8QB 3FO0L 3S3BB 3SEPA 4BE5A 4RWHA 1JGIA 1A25A 3MNMA 3MUJA 5LCVL 4TN9A 5FV1L 4WI9A 3GSNB 2PYFB 2BIOA 4OIAA 4YE0A 4HOMA 3HNVL 3FO1B 4MXWL 3SQBB 1IKOP 4TVPD 3IN0A 1L4IA 3FTWA 2F54D 3BDYH 3IDNA 4R96B 5D4HA 4AGLA 1A6UL 2IDSA 4ZJ9A 1D5IL 3RRQA 3MV01 2YSTA 4P5TD 2QPDB 3VFMA 2UZIL 4KRLB 1IC7H 3MRDA 1DFBH 1FE8H 5J1SC 5EC1A 5D9SB 3KLDA 3G6DH 2DQFA 5TE6L 4GSQA 2OYLA 3HHRB 3UABA 4DQOH 1AHMA 1T22A 3V6FB 3V52H 2BK8A 3BISA 4PIBA 5ALBH 1L0PA 4ZSOE 5IOPB 1G84A 1IFGA 1OD9A 2NW3B 2XG4A 1OWWA 3QG7H 1X4XA 5CJOL 1HAUA 2NDGA 3HE7D 4E0RA 4PCTA 4E41D 2WQAA 4TXVB 1F6AA 2PTTA 3SO3B 1G7PA 3SYAA 3W37A 4YDVB 4Z3HA 1MJ7H 1Q9KA 5BRZA 5C0JB 3HZYB 3OKKB 2VR9A 1BJ1J 1NGZA 3QH3A 2OSYA 3SODB 1NCIA 4Z23A 3HCVA 1RZ8B 3L3JA 3VGGA 4PTUB 1OV8A 2PYEA 4I5BA 3MROB 4X5XA 1AO7D 3E1ZA 3FUFA 3QDHA 4Y4HA 2XQ0A 5TDPA 2WUCL 3KGRA 1OAXH 3NCJH 3OC8A 5D7IA 1NDMB 3DO7B 4LQ1A 3LRSB 3S5LA 4XRCA 3LN4A 1L9RA 3RIFF 2G9KA 4X0NA 1EFXA 2V4LA 2WGNB 4PRBB 2MRYA 1T83C 4Q52A 1R3HB 4AGMA 4ZMOA 1IM9B 1K4CA 1RZ7L 3BSGA 2EIZA 4EIUA 2BCKA 4P4RA 4Y1AE 2WXHA 4MMXA 1W0WB 2XV0A 3RWEB 25C8H 3V0DA 4DFIA 5DVNA 5E9NA 5F7KC 5DZVA 3TA3C 1T1ZB 4GKSA 3HG1D 3QK0A 4PG2A 4O5LL 1YZZA 4L4TA 1M05B 1FCCA 4H2CA 2DQHH 2UWEE 2WGXA 3VD1A 5K9KB 2Z8SA 1KJ2B 1A6ZB 3TOPA 2HYMA 1YYLL 4S2SA 1WC7B 1JWSA 2K70A 1NA8A 2NY2B 4Q6IA 3NMEA 4AH2B 1DVZA 1S7UB 5IQ9A 3EOTH 1IEAB 1FDLH 2CJSA 4HWEL 3EHBB 2NLJA 3VWJD 2OYKA 1TR7A 3ARGD 3I6SA 3BSHA 4X7TB 3PP3K 1HH6B 3GMNA 3KL3A 4RGNC 3NCEB 4FFYH 3T6QC 5DHMC 3D39D 3ISYA 4Z7IA 4FFVC 3WIFB 3QUMB 4JNXA 2YZ1A 2XXMB 3KYNB 1CUOA 3ROOA 3KPRB 3CFKA 4JPVH 15C8L 4ZYKA 5IJVB 2XJKA 1JMZA 1MW1A 3TTYA 1DVUA 3BCFA 3L1EA 5I1EH 4M3JA 1BQHG 3EYSL 5E9DB 5MHSE 4KVCL 3CFBA 4U31A 5D6DA 4QXGL 2LLGA 3P1VA 4LKCB 1BVZA 2CDFA 4FG0A 1WICA 4OLZL 1EH9A 4OTXH 1BWMA 1N3NA 5TJWK 2A73A 3CFIC 4HMEA 3QIWC 4NQEA 1MVUA 4L8DB 3VUAA 4AI7A 4JRYB 1JVLA 1DQKA 1UCBH 3EOAA 5EBGA 1URLA 4W68A 1UD5A 3TIDA 4NQXB 5AVSB 3P4MA 2FWOB 5JDSB 3TBBA 2BNRA 4IKLA 5TE4H 4ZMVA 5KYNA 4L0ZA 3UP1A 4IHBA 4EN3C 2IH9A 4JDVA 4IIZA 3RBSA 5IHZB 2FB4L 4RIRA 4DEPB 1NGXA 3LVEA 5JQIB 3BWSA 4G43B 2XTJD 4GW4A 3LZFH 4QKTA 4F2MB 2QVFB 1C08B 3VI3F 3RGVA 1QW9A 2E9BA 3BMWA 2ZXBA 1BIIB 3QSKB 1HL9A 5PAZA 5EIIA 3D9AH 4J4PD 3N50A 3KAAA 2HFEA 1Z9OA 2WXJA 2UY6B 1URZA 2CBQA 2ZOKA 4LEXH 5IBLC 4UDTB 3MRPA 5B3SB 1PW3A 4KH2A 3QRBA 2PWHA 5IB5B 3JUYA 4YSEA 4AYDC 3O4LD 4XPGL 1MPAH 3ZDZB 1HI6B 3C5XA 2GBAA 4M5ZH 2YMXH 3BGMA 4UTAL 3L9RA 1UH2A 3TT3L 5DC2A 2Y5EA 4RQQA 4CKVX 2CBPA 3IPBA 1SDDA 3X13A 2BNUB 3FT3A 5EZJB 1OO2A 3TBWA 4RFNB 1P9MA 3UTTD 4GKNA 4YVUA 3SOBL 1AD0B 2WTOA 4XC1H 1OGAA 5JPNA 2CDGB 5KOMC 1P4IH 2I60L 5BVJA 3JV5A 1Y6KR 5B1BB 1I8MA 3MLRL 2KZKA 5DMIL 3VH8B 1BQKA 2V5SA 3SPIA 4BH7B 1RPUA 1IU1A 5A2FA 3DMMD 1AKJA 5EU4A 3U46B 3VFUB 4KMTL 1OSYA 2OL3L 4S0TD 4UQDA 1Y1UA 4S1RL 5CZVH 1OT4A 2PCXA 2FEEL 5HPMB 5A6IA 3CK0H 2YGNA 2FGWH 3BVTA 1AE6L 2VW7A 4WUUA 2FE0A 1KUMA 3BEWA 1F6LL 2YEVB 4IIQC 1NTDA 4PRHD 4LHUB 2EACA 4LOFA 5IB4B 2NY4C 3SD2A 4F8PA 1LO0L 3QDJA 3C6LC 3MJ8B 4AQAB 3SPJA 4PRAB 4Y9CA 1U6AL 4W4OA 2AK4B 2NY1C 4NN7C 2VOTA 3TL5A 1MFDL 4FOMA 4DW2H 3FB7A 1OE2A 3CVHH 4FHJA 4HSCX 4XNYL 3EG9A 1HL4A 4DEWA 5ILTH 1E30A 3OXSA 3HC0B 2DYPD 3CHXA 4W6YB 4U1SA 2VYRE 4KTGA 1NQBA 1SXNA 3I3BA 5FO8A 3UAAA 1QRND 4LCYB 5CP7A 1WTGT 1TXKA 5JW3L 2H45A 2ZUWA 2GUYA 4KUCD 5I75C 1IIIA 5IREA 3L8QA 4XCFL 3DX0A 5BNXD 3FU7B 1B4TA 1L5GB 3VXSE 3A6OA 4HWUA 4CADA 5E1QA 2WZ0A 1L9MA 4JRXA 5D1QA 3DNKA 1JZ6A 3OSKA 2NY5L 3OLGA 5B1CA 4X6CF 3LH9A 2C3VA 4N87A 4XVOA 3QNZA 2D7TL 4XO5A 4EE2A 3B1TA 4HEME 2YRBA 4P9ML 3VFMB 2HN7A 2VLRE 3MYJA 1GW0A 3JWNC 1L0XA 3MRDB 3L3OC 4KFMA 4BXSV 3PWNB 5EC1B 4FQCL 3TBSB 4EQ2A 5IB3B 4H8WL 1HSAA 1T22B 3AM8C 4ELDA 1K9TA 5H37H 2E5EA 1X5KA 1P5VB 4HUCA 3UC0L 4Y19E 5FDWA 2VM3A 2WWKT 2AJVL 1LP9A 4YVNA 1QTPA 5DEGA 5FM5M 2QADC 4E0RB 2BVEA 5EF1A 1F6AB 2PTTB 2FJSA 3DHUA 1RMFH 1COBA 4TSAL 4M56A 4YS4A 5BRZB 2APSA 5B21A 3JWNH 1NGZB 3F5WB 3HS0B 3QH3B 3ZE1F 2JK5A 5E0FA 2XQYA 3L3JB 4JPSA 3LIZL 4FQPA 4NZTH 4GP5B 3NAAH 2PYEB 1FPTL 4I5BB 4X5XB 3PAZA 3I85A 1MI5B 4NC0B 5D7IB 2X1OA 3M7OA 4MS8C 1CICC 3S5LB 4XTRC 3O3DA 4XRCB 3TGXA 4WO4A 3P3YA 2R0LL 4KKLD 4W93A 3K91A 4CMHC 3NEOA 3GB7B 2HFFA 4KHXL 1K4CB 2EIZB 3BWAA 2BCKB 4P4RB 2J88H 5DQJA 4MMXB 1U93A 1XGRA 2WMPA 1DCLA 4KRMB 4NQCA 2I07B 4JFYA 2G60L 3S3CB 2KLSA 1NFDF 2AQ1A 2K3TA 1A4KA 3C12A 1T6VN 2HWZL 1Q4NX 2WLIB 4X6DF 3MCKA 1QOKA 1UKTA 4L4TB 4DZ8A 1CGYA 1EUUA 5GGSY 3ARQA 5C08D 1DBAH 4GEJA 2ZX6A 4QRRA 5BRQA 1MFBL 4ZG1A 4LP8A 1MQKL 1RKRA 1JWSB 3WFHA 1FFRA 2D7OA 3QQ9D 1Q0YL 3AQDA 2CO6A 5D7JA 4JO4H 5IQ9B 3ETSA 3NJMA 5F1IB 1U9KA 2DQDH 2MKLC 2ZX8A 1AZBA 2DZEA 3GMNB 4FJ6A 3AXLA 3KR3H 3O2DA 3W2DL 5TE7L 2L3BA 3B9AA 1M2OA 1TQCB 4FJYA 5GS2H 3ES6A 5B39G 5E1IA 3E80A 2D0HA 2EILB 3CFKB 3QA3A 2R23A 4O9HL 4ZYKB 1RZJC 1R5WB 1SBSL 2N1KA 2Q7YA 5J3HC 2WQSA 4HK0A 4FKHA 1D6VH 2W65A 3WDIA 2BSTA 3LNHA 1UFUA 2R4SL 3KBPA 3CFBB 4KX9A 4JPWL 2OMVA 3DGGB 2CDFB 4QRAA 2VDQL 4TL4A 1A4JA 5AYUH 3T6WA 1FL6A 1NAMB 3L2NA 1N3NB 2NYZA 3VFTA 2H4EA 1IT9H 5BRZE 4MVBD 3BVNB 4LL1A 2OBGA 4NQEB 1MVUB 5AAMA 1FORL 2XA8H 5AVYB 4KNSA 3NIFF 5AW5B 4DVRH 4CSZA 4P3CH 4I3RL 4N2NA 5L2JA 4FG6D 4NUGL 2VLJA 5HHPB 4FJZA 4KBPA 4M8RA 1RZJH 2GY7B 3BQVA 1K4DB 2Q9OA 3T3PE 1CD1B 3PAYA 5C3TA 4PLOB 4J23A 1XGTA 4RETB 4AQEA 2FL5A 2ZPKL 3FDWA 3HNSL 4KMQA 2BMKB 4GW4B 5D72L 3Q44A 3SDYH 1H3VA 5LBVA 4OSUL 3FOLB 1OP3H 3GJFA 4NLAA 3TO4B 1IBBA 4H88L 3QZWA 1CDHA 3KNBA 1N8ZA 4MA8L 5JHAA 2AJUH 4NZFA 2HFEB 2ZWNA 5A40E 5J9PB 4Z3FA 1K5NA 2JV6A 2VDNH 1CBJA 1OOWA 1B0WA 3OXRB 1TTBA 5IMMA 2VRKA 1T6WA 4I0PC 5CHNA 3UYRL 4LHJB 3W0WA 4JY4B 2WCPA 5AZ2H 1WS8A 2WZ6A 1RIUH 1UEYA 4ZFGL 1AR1D 3IFLH 1U8JA 2H8PA 5CCGE 4JVPA 2ZNWA 5E6RB 2BIHA 3L9RB 4IU3B 2Y07L 4FNTA 4EJ1C 4U1KA 1SDDB 1WFTA 2Z7YA 3ARWA 4CC4A 4PTTA 4WZ9A 5DD5H 3VD5A 4PRPD 2WZ5A 1PLAA 3FT3B 3KW8A 3FB8A 3TBWB 3SDCB 2XOTA 1U91A 4X2UA 4PY7B 3GMQA 4GFTB 5B8CA 4UIMA 4R7NA 1OGAB 1IKFL 1ZA6B 1ZV9A 1JRHI 4XVUD 4HUWA 2C8NA 1FO0A 1I8MB 2GT9B 5L8KB 4U7SA 4EUPH 1AYRA 3UACA 2VLMD 1CTNA 2Z4TA 5H2BA 1TZ8A 2BINA 1QW8A 4PGJA 4HPOH 4M7LL 3MSPA 3C5SB 1D7DA 4HV8A 2WO3B 2MFNA 2N01B 3N85H 2IF7A 2YXFA 3MLXL 4EIZC 4B9CA 2X2YA 4WUUB 2R29L 2WAHA 2NY6C 3BEWB 1O7SA 1DANT 3MRCB 2QBWA 2E6QA 4K71C 2J8UF 3RY6A 4MQXC 4WKXA 4JFPB 5SX5K 4DWHA 3OZKA 5GZOC 1R3IL 4GSDL 4WNQB 2GIXA 4JMXA 3BP7A 2BNRE 2EDMA 1R34A 4ZUWA 5FB8A 2VXVL 2UXGA 4MGXA 3F05A 4YE4H 3JWOL 4OCSH 3KXFA 4KMLB 4XI5C 3RVWC 3W56A 4GRLA 2OMXA 1IVTA 4MRBA 1ID5I 4Q58C 4X9GA 5ACLA 4HKXA 1G5GA 5LBSH 3FB7B 4K7PX 1N64H 2DLFL 1NCDH 2XWBB 3EG9B 3QG6A 1FVEA 3ZKMC 5BS0A 3QEHA 2V5YA 2PABA 4FL4C 3JT2A 5DQ9B 5GGQH 5TH2A 3IDJA 4LLAA 4TRPH 2ZYHA 4TUKH 5D7KE 3H0TB 4BDVA 3WTTA 4U1SB 1EXHA 4LGPB 3J2PA 4RAUA 4HUMB 1OIOA 3MBWA 5FO8B 1JZ7A 2FX7H 4IBLT 4NPJA 4QLWA 3AC0A 1MJ8H 3IGKA 5MP6L 1D5ZB 1RZKC 4HIEA 5JIHA 5L4JA 2UX7A 4GUCA 1RULH 3HFMH 4NQSA 4BHUI 2E8YA 3BUTA 4V11A 4CADB 4DCQA 3KH4A 3BLPX 4FYQA 2WTRA 1FZOA 4JRXB 5D1QB 4Z7OB 5FOJA 1S6NA 4K2UL 4FQHA 4JFDA 3DURA 3LEYH 4K5PA 4QY8A 3QP3A 2IOOA 5HYEA 1A64A 2C3VB 4NXSA 4Z18A 1BM7A 2EE0A 2IFFH 3E2HB 3D4CA 4GAYA 3D0AA 1OGAE 2PW2A 2EZ0C 1QLFA 3FZUD 3ETBF 4F7TA 3UROR 1FG2B 1KCBA 1RZKH 3D85D 2L7UA 1T1YB 2DWEA 1HSAB 4N0CD 4AOFA 3A4EA 2E7LA 1UKSA 3P3TA 4IBVA 1U8OA 1XZ0A 3T0ED 3D12B 3QDMD 4P9HC 2JB6A 1QLEH 4DN3L 1R3KA 1LP9B 3SKOB 2X3BA 5I1IH 2DQEL 2VN3A 5HD8C 4P2OC 1ORSA 3OAZH 5K93A 3WIHH 1AQ8A 2E9WA 1SHXA 3I75A 1SXZA 5DD6A 3N42F 4FQ2L 1I82A 5CP3A 4ZQKA 4J2QA 2CJ3A 1D9KB 3QDJE 1R75A 4XB8A 2ZE0A 4XAWH 4DGUA 4TSCH 3F7KA 5DJ2B 2BSRA 1TZGH 3MUUA 1CMOA 2J2ZA 2GJPA 3WYRA 3W81A 1MHHB 4PB0H 2A6KA 4RSVA 2YPLD 1ZA3B 2EDFA 4XMVA 3SBQA 1DSFH 3O3DB 4NNYA 4WO4B 1BFSA 2MQGA 4FHKA 3S3DB 1MDTA 2EC8A 3F85A 1E4KC 3QB7C 4O2EA 1PPIA 3L1OH 5CEZE 5DXWA 2BCMA 3HBPA 5IGXL 3BVDB 4K3HA 1CFTA 4KUCF 4NBYB 4OJDH 1KXVC 5DQJB 1HH9A 4MX7A 2MCPL 1IX2A 1U93B 1XGRB 2WMPB 3K72B 3P3SA 5FGCB 3O2WH 1SYSA 2E47A 4JFYB 2I9LA 2L4OA 1A4KB 2HG5A 3FB6A 4HDIA 5CO1A 3MCKB 4DZ8B 3QUKA 3QUXD 4PR5A 3I9AA 5BXFA 1BJ8A 4WW1A 1JCKA 1UUNA 3WFHB 1J0IA 2MPVA 5ICXA 2F5BH 1OCRB 1CK0L 4UUJA 5L2KD 4L8CB 1CBVL 1YEFH 5FO7A 4DGVL 3FL7A 4RBPH 4ZD3L 1Y7VA 2IMMA 1ECYA 2Z1PA 2A9NH 4BUQA 4AQ8A 1U8MA 1IAIM 1GYWA 3AXLB 3NSYA 5GRUL 1YO4A 4JM2A 4MNQD 4LRIA 2JE8A 2X3CA 3F7VA 3Q43A 3ASNB 3QA3B 2R23B 4MJ5A 2XQYK 3Q5YA 2ZKHH 4B9IA 1DUZB 3N44F 3QI9A 4HK0B 4X4KA 3OAYH 3LOWA 1PAZA 4APQA 1SUJA 1T2XA 3UO1L 2ZG1A 1ZGLM 4AGNA 4MD0A 5CILL 5I1GL 2BIIA 1QFWI 5GGUA 2OZ4A 2O30A 3TH3T 2CUAA 2AJ3B 5HYSA 2YK1H 4JM4L 1AS6A 1MXGA 3G5WA 4WNJA 1BDYA 5LJYH 4FP8L 1OGSA 5ELIA 4R3SA 5BUPA 1F90H 4Q9RL 1NOLA 4R7DB 1WH0A 4TNWK 5EUOF 1E43A 1MWOA 4LIQL 3WAKA 2VIRA 2DI8A 5L2JB 3QZPA 1I8UA 4TQIA 2XZAH 5JW4M 3CCHA 4R0LC 1GW6A 1INDL 1RZIA 2WXMA 1KT2A 1LM8V 3IDXH 3QFJD 4QPEA 3ZR5A 1FAIL 1XGTB 5IJKA 2F54A 1YNTB 3CZGA 1IC5L 2OCJA 2DJMA 3M17A 1LE9B 4X4ZA 4YFLI 3GXPA 3UMTA 5IHBA 2B3IA 2N4IA 3GJFB 4PJIA 1A3QA 2VLKE 5D5MA 1UM5L 1I1AD 3O3UN 3WS6C 4NQCE 4ZMYA 3CZSA 1QSEE 3KNBB 2VJ0A 1A8ZA 1DQVA 1N8ZB 2BVYA 4R9HA 1AGDA 2MCAA 2V5RA 2WVTA 1ETB1 3GFUA 5D2LF 3DV4A 1NCAL 4QRRE 4A7VA 5IMMB 4GIPD 1OM9A 2BNQE 1PKQA 2R1YB 2WWOA 4JZOB 3D25A 1QA9A 5CHNB 4ZZFA 1B4JH 3KYAA 5AVQB 3EF4A 1NGQH 1U8JB 2JLLA 3HE7A 3BXNA 1HXMB 1XR9B 4JG1L 4OLUL 2DKSA 3RAJL 3HRPA 3GPEA 1T6BX 3VQLA 4NP9A 1AGEA 2G5BA 5A2AA 3HUJF 3MLYL 2JCCA 4NKIL 3FB8B 1NCOA 1QO3A 5GIRA 4GLRH 1FGNH 1U91B 2NY0B 5HDBE 1AO7A 3AACA 2PR4H 5E1GA 4UIMB 4R7NB 3WN5A 2F18A 3B9EA 2XC8A 4MD4A 4NM4L 3NJHA 3FYIB 3RUGF 3VA6A 4CJ1A 3QIUC 2WN2A 4PJ5B 3LEVH 4LLWB 4KO6A 1WT5A 4OLVH 2X9WA 4LARH 3CXDH 4KZEH 4AG4L 5SWSD 2KDGA 2J3SA 2H2PD 3HI1B 1MDAA 3LV3A 4IJ3B 5H2BB 4MRCA 3Q9QA 4N0FA 3FH8A 5I0VA 4HV8B 1NCBL 3IAPA 4N2GA 5LAPA 2O61A 3LKSA 1ZT1A 1NPNA 4WWKC 1YEJH 4ODTL 3LPFA 2FIRT 1ZDQA 4QJ4B 1K6QL 4P4KD 2GTWA 2VLJE 1ULVA 3IF1B 1YEKL 5J56B 3BP7B 3L45A 1P7QD 3M8OH 1KULA 4URTB 2F58L 3PHOA 4NB7A 5JUEL 5JPMA 3U7AA 3P11L 4Q6KA 3KXFB 2J8HA 1ML0A 1KB5L 3AT8A 2AXGB 3TBVA 4HKXB 2VZTA 2G3ZA 3QG6B 3CPLB 1BMGA 3L5JA 3ZTNH 1FBIH 1X5YA 3EZJB 1EGJA 1TQBB 4HCFA 5BS0B 3QEHB 2N7SA 3SY0A 5TH2B 1NMBH 2Y7SA 3SGEI 2BP0A 2DQMA 2YWYA 2AJYH 4O02L 1ZS8A 5FO9A 4BDVB 5CKAA 1AS8A 3WMSA 1CGXA 3MBWB 2NSMA 4ELME 1PQZA 5DK2A 3UG5A 4M6NL 2RB8A 5MEPB 1GJUA 4OD1L 1RZFH 1TUPA 1SJMA 3W0WE 4GT0A 1P1ZA 2FYYA 4HIEB 4XCEA 4Z7QF 7TAAA 1SDYA 1K6QH 1E2ZA 1T80A 3CSPA 2QR0A 2QMJA 3L7EA 2OMWA 1GIGL 4DCQB 3OJDA 1XGQA 4JZJC 2WTRB 2A77H 1FZOB 4R4BB 4XAKE 1INEL 2O5YH 1UG9A 3L2MA 4JFEA 3DURB 3QAZB 4H25A 4FTVD 2P5WD 3EH4B 5DWUH 2OJEB 1JPST 1YMMD 3L4XA 2PW2B 3OMAB 4IBQA 3GLDA 5DZAA 3N9GH 3A4DA 4L1TA 4ERSH 1B4LA 1DO5A 1KCSH 1QLFB 4NSKB 2B1HL 2FT8A 4F7TB 1BF5A 1OTTC 4IS6B 2J73A 2DWEB 5CWSA 3PYCA 1WHOA 3IEAA 1BQHB 4C57C 2YD0A 1U30A 1U8OB 1FNEB 1ZLDA 2CWRA 1XZ0B 3PGFH 4PP1D 4YHOH 1KXHA 2H26A 4Y9BA 3RX7A 2JB6B 1XSOA 5L4IA 3QHFH 4GBXC 1D3CA 3GI9H 5E4EB 1BLNA 4A2HA 4ACPA 1QSFD 3SCMC 3LQAL 4QXUL 4WFGE 3NSXA 3DI2B 5IUCA 5B1JA 4KJYA 3MACH 4PJ7F 5JIKA 5L7XH 4KQ0A 3WFCL 4ZQKB 2J21A 2ADFH 2VSCA 1BGXH 1KB9K 1KLFB 2ATKA 2C9QA 3O4LA 3ZTJH 1VKXA 4UANA 3MZTA 2BSRB 5FYKH 1OKEA 3TCTA 2J2ZB 4C4BA 2A6KB 3L4YA 4PJ8C 4ANXA 1JOIA 3LHAA 1AXIB 2B77A 4BXVA 2M26A 3PWUA 4OT1L 3T0AA 4I77H 4FABH 1HZHH 4YEEA 1SMOA 3V4VH 1CFTB 2WKGA 2W94A 4ZFFB 5FUCE 4J8QA 4WQOA 3CIAA 1HH9B 1JZJA 1U8PA 1V27A 3ZN6A 4G6ML 1MJUL 1KEMH 1X5GA 2CKBL 4X6CB 3HB3D 3SE8L 2HG5B 1KYUA 3FB6B 5E2WL 2NZ9D 3UBHA 3HPLB 3W11C 5IT2L 3CVIL 2Z31B 1NGPL 5T3XL 1S2EA 2WYHA 4HH9A 4MNGA 4M4RB 5EOQH 1E5AA 1V05A 2ADJA 5I1CH 2XTLA 5CJQL 1SEQL 2YUWA 3UYPB 5ICXB 5FO7B 4JFDE 1OQOA 4PRHA 2C4FT 1NICA 5CR8A 2XY1A 4WKZA 4J5VA 4LSPH 2B59A 1UENA 2VMEA 3L16A 2BWQA 1BAWA 3O4OB 4B3VA 4Z0BH 3CTTA 1VPOH 4PBDA 1PMYA 3MCG1 4UDUA 1P7HL 5E6ID 4AJYV 1BIHA 2V2WB 3H4HA 4KTEH 4WI4A 3QUHA 4AM0Q 1KTDB 4MJ5B 4GG8A 5DHDA 43CAA 3D48R 3BAEH 5J12B 1OSPH 1UT9A 1MFMA 4ENEC 1HHIA 1V7MH 2APXA 2DYPA 3NSJA 4ZMNA 4MD0B 3MV7A 2TRYA 4GRWF 4YSOA 4JE0A 2X89D 3JTBA 3TT1H 4WHCA 3LIUA 5GGUB 2DIJA 3JT0A 5AVRB 5HHVL 1OHQA 3QQNA 5I6LA 2DM3A 4XXWC 4OZIB 1KCUL 4TS6A 5F8RC 1SOSA 3OKNA 3VD4A 4N0UB 4MXQD 2G2PA 3PP4H 5KSUB 3EH3B 4LVHB 2DQCH 3TM6A 4JRLA 3ZZSA 1DQDL 4LSDA 2VDKB 1KT2B 5D7EA 1NFDB 4Y88A 2NXYC 2LABA 2VDLB 4L4VA 4ZOAA 1HL8A 3U1PA 3ATEA 2F54B 5FW8A 1H6EA 3C09B 1IO4C 3R8QA 3CFDB 2AQ2A 1D7BA 1UM4H 3M17B 2BDNL 5E2VH 1OP4A 4JFSA 4P5TB 1OAQH 2AS5M 2BIPA 1JGLH 2XYBA 4PSPA 1JTOA 1UT2A 4HU8A 3QDAA 3FN0H 1SUHA 5DK3A 3TESA 2AEQL 4W1TA 4KZCA 2EVJA 2Q76A 1D2OA 2HX9A 5E5LA 4I13B 2BY1A 5I1HL 2XG5B 4ZTPH 1V5JA 4TSBH 1KCUH 4OUUA 1JHLH 4Y8DC 1JGVH 4ZMAT 4KZ0A 5CIPH 3LVTA 3HE7B 2XV3A 1SNRA 4ODHH 3BXNB 1F4XH 1FRGL 2EECA 1ITBB 3Q5OA 4BFBD 3TJEH 5BO1H 2B20A 1BAFL 5AVZB 4A68A 1BBDL 1FNFA 2ORBL 2WSKA 1RFDL 2HLEB 3O45A 3DO3A 4NZRH 1A7OL 1UXMA 4XOEA 2WHVA 5D71L 1QO3B 1BYNA 4WFHE 3FSVA 1AO7B 2G4EA 2W80C 3ROLA 2Z93A 3WN5B 4LXFA 5E00A 1R1CA 2CD0A 3OR7A 4MD4B 1BMWA 5C0CE 3QCVL 2GSMB 4FQJL 4NQDA 3GKZA 2ENJA 3BSZL 3DX1A 5I8KL 3IFPB 4K9EL 1MAML 3EADA 3HMWH 2FSEA 2WCGA 1TKWA 3H85A 4OGAD 2QVKA 2IWGA 3LV3B 1EAQA 4V1DA 1IGFH 5FGSA 2BRRL 3P0VH 4ZX5A 4A2EA 5JHLL 3K2UL 3B2MA 4PJGE 1KTRL 1HXKA 3L95A 3Q8EA 3LKSB 3QNFA 2O61B 1OANA 1ZT1B 2WNGA 2ZUYA 4BWWA 4KKRA 4M00A 5KW9L 1UQSA 3NZHL 5C6PB 5MEND 2JKSA 3H54A 4GAJL 1NSNL 2ENPA 2BVPB 1SM3H 3SJVD 1DLHA 1M6OA 4F7CA 5JPMB 3TV3H 4LOUC 3SO3C 4PWGA 1YLBB 2PP7A 5TTRA 1OB1A 4L3CA 3TBVB 3AVEA 1DVFC 1EERB 5E2TH 4HXAL 2UZYA 1ZTMA 2VZ1A 3VWJB 4GMSL 3WY1A 5HI3D 4ESKA 4FULA 1RU9L 1YCSA 2K6ZA 4PJIE 1QBML 5D5ME 1BG1A 1TLMA 2VZVA 3SY0B 5I76A 3D39B 3GO1L 2BP0B 3QJQB 2PUQT 5FO9B 4GMTL 4JKPH 4OLEA 1Z66A 2E27H 5JXEA 2JFCA 3B56A 2A83A 3KLKA 4KWUA 4XBGA 1I7UB 1TVDA 1OTUD 3PP3H 2ITDA 1PKQE 1NC2D 1OZTG 2EIDA 1U41A 1AQDA 35C8H 5EZOL 1A3RH 1ADQH 4IJTA 2CDEA 3H53A 5KVGE 3U4BH 5IMKB 2EKSA 3GM0A 1JXJA 3L7EB 4LLYA 5IWLA 2OMWB 5DD3H 1QWHA 4Y4KA 3RVXC 1ZHKA 5JW4R 3WXWL 3MNZA 4IBUA 1FNSL 3WKMH 5I5IA 4JFFD 2JCCE 2DWTA 1KC5H 1MNUL 5EDSA 3U1QA 4H25B 1M53A 4JJ5A 1N4XL 2DPKA 1QLRB 3GRWH 3M1BA 3I9IA 1XH1A 2Y0SA 2XY2A 2NY2C 3SPVA 4HPYH 1AGBA 3V4PB 1EAPB 4PV1C 4WK4B 1JDAA 4E9TA 4BWUA 3EHBC 5TK4A 5B7FA 5CWSB 1IAKA 3WO4B 1JXGA 4KXAA 4YBQC 1X5LA 1RK0B 4WWNA 2ODHA 2ZAIA 2R0ZL 5FUOL 4IRJD 1WBXA 4EOWH 4N4YB 4O2FA 4GNKB 1BLNB 1YC8A 4H1LA 3UBGA 3L5XL 2YAFA 4Z7WE 4A67A 2RH0A 1KJ2H 3LQZA 2IG2L 3O11A 5L6YL 4L8SA 4KJYB 1OGPA 1H3PL 2VDML 1AY1L 2DLIA 4DAGL 4HEPA 3V6ZA 3EH5B 3O4LB 1VKXB 4DESA 3RX8A 3ULVF 1T7VA 2ZX5A 4CILA 3AQZA 1W72B 4M43L 2X40A 5BQ7A 2A4EA 2FNWA 4MXVF 4ZS7L 3SYOA 3WNOA 2JJTC 2VUKA 5GISH 3SE3C 3PWUB 1ZE3C 3QUMH 1NCNA 3HZMB 3L2LA 4KHTH 1P4UA 1FZJA 3OPZL 2MCG1 3A6BL 2Y25A 4P3DA 3O6FD 3UTTB 3GEFA 1EEZA 1YNKH 3RJDA 4DEPC 4QRPA 4WENB 4CSTA