3MXVH

Crystal structure of fab fragment of anti-shh 5e1 chimera
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
220
structure length
220
Chain Sequence
QVQLQQSGPELVRPGVSVKISCKGSGYTFIDEALHWVKQSHAESLEWIGVIRPYSGETNYNQKFKDKATMTVDISSSTAYLELARLTSEDSAIYYCARDWERGDFFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords fab fragment of anti-Shh 5E1 mouse/human chimera, light chai
publication title Hedgehog pathway antagonist 5E1 binds hedgehog at the pseudo-active site.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
total genus 45
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2010-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mxvH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mxvH02
1DQMH 2JLLA 5ELIA 3FB7A 2ADGA 1CDGA 1OWWA 1S9YB 4G8IA 1BOGA 1AO7D 2NMSA 2HJFA 4Z7VE 4CADB 4JKLA 1BFVL 3SCMC 1FV1B 4LDOB 2DLEA 3PWLA 3QDHA 4G5ZH 1UZ8A 2DJSA 3PHOB 5I73C 1GRWA 5IR1A 4F8TA 1RU9H 1S5HB 2QHRH 2BXYA 1RZ8B 3UDWC 1RMFL 3WKMH 4S1QH 1GC1C 1DSFL 1QPXA 3O45A 3NIFF 4JFEA 1YEFL 5AYQA 4HKJA 2D7OA 1EK3A 4ZTPH 5JHDB 3MBEB 4UINL 3W0WD 1DCLA 1JZ6A 1LK3L 1WBZB 3IJYA 4LRIA 5JUEH 5BW7A 4LVNB 5HPMA 5DQDH 3DROB 3IYLW 3OF6D 3OKLA 1NGWB 3MYJA 3UYRL 3FRUA 4CKVX 5C0IA 1LQSR 5FCUH 5EU3A 5ANMA 1RHHA 4NRXA 5F7YC 3VMOA 3IXAA 4GKNA 2WBWB 4P9HH 2GCYA 3BGMB 1PVHA 4AMKH 2ESVA 1GIGL 1MWAB 4F37K 2WV3A 4QRPA 4PJ5A 1P5VA 3IDJB 3L6FB 3T77A 1XF2B 3BP6B 1ZVSB 4J23A 4QXUL 3KLHD 2H1PL 1A6TB 1T6WA 2V9TA 4ZTOL 1KT2A 1FRGL 4V2BA 5E4EB 1K2DA 1T4KB 5INCA 1B0GB 2GK2A 4S2SA 2BERA 3FHAA 5JHDD 1P69B 1MQKL 4ONFH 4LCYA 4NO3A 4LDLB 4U1LA 1YYML 3MR9B 5T1LA 5DFVD 4P99A 3EDEA 4H1LA 2EYTB 1KJMA 5T3XD 1FZMA 2WINB 1ONQA 4NC1E 3BPLB 5CEXA 3O0RL 3L7FA 2CK0H 3TESA 2A2QT 1Z2KA 2F5AL 1XF4B 2NZ9C 4KK5D 4FFZL 4A6YH 4ZAKA 4HK3J 4RISL 5IBTL 4CMHC 4L9LA 2WUCH 4OF3A 4YHNA 1J8HA 4Z7VB 3U6RB 5B38G 3U0TB 3BYYA 5D7JB 5I1HH 3MRRA 5KANI 4PGEA 4Y5VB 3IDNA 5C9KA 1A4KB 1MH5A 1B4JL 4IOIB 4OFPA 3M8OH 3GNML 1TENA 1YY9C 1T2QL 4K8RL 4TUJB 1EO7A 5I9QB 1FCCA 4UAOB 1K4CA 3FO9B 4UBDD 4NP4L 5BS0A 5HI5D 3TJHD 3MJGX 5KSAC 4NKIL 1NUDA 3WNPA 4WWKA 4OBRA 2EDXA 1NANH 3H9HB 4U1KB 2GHWB 4AYFA 1EVTC 5HHQA 1A9BB 3QZWG 5CP3A 1OF2B 1SBBA 2J6EL 4NZTH 4S1SH 1IEBB 1OP5H 5SV4A 5GS2D 4LSUL 1KJ3L 5E00A 5JW3H 4H5SB 4HUUB 4YDIL 4KKAC 3TPKA 4HWUA 5D7JD 1BQLH 1XGTB 5FFLA 2R0KH 3BI9X 3CDYA 1EAPB 1TCRB 3CXHJ 3HZYA 4F15B 5I2IB 2FJGA 5AWNH 5J1AB 1NUNB 4M7LL 2Y06H 3KYNB 1I9RH 2BDNH 3EKCA 3LS4L 2FATL 5FYKH 5MENA 3VH8G 5C8JB 4P9ML 1T7YA 5B39A 1I3GL 3O2DL 1C1EL 4IRSC 3UO1H 1AR1C 1N64L 2CSPA 4HPYH 1P6FA 4HKBB 3WNMA 3FQUB 4NQVB 5C07A 5E1HB 2Z9TA 4U3CA 1F02I 5A43C 3QSKB 1RZFH 4WHTB 4HS6A 4Z78B 3DX7A 3ILPA 3QHTC 1S9VA 4WW1B 3QDGA 4EIZC 1IJ9A 1IGML 2EYRB 3K80A 3N1QC 3WO4B 1EJOL 1Q0XH 4GQ9H 3AS0A 1T83C 4L8SC 3WUWB 3V79C 2QSTA 1NAMA 1TZHA 2HRLA 4FRWA 4W4OA 3VGHA 4ZXBA 4JDZA 3QG7H 1BAFL 5DSCB 2Y9RT 3GSRB 3P0GB 4J8RB 1T04A 3MJ7A 2W07A 2N4IA 1ZHKA 3DX8A 2I24N 1UCTA 2DM4A 4LPCA 4QF1B 1IBGL 4HLZG 5I1LA 5F6HJ 3QISA 4EVNA 3ARDA 5HHPA 1MCOH 2IAMB 1A6AA 3T3MF 3NCJL 1NCBH 1XGYH 5F1NA 4I9WE 4L5FL 5ETUA 4UTAL 2IJ0C 1FZOA 2JIXA 3EOBA 4DTGH 2H9GB 3D9AL 5DJZB 3CFKA 1CI5A 4Q9RH 3T65A 1R3JA 3JUYA 1L7TL 3GKWL 1Q9WA 3AC0A 4PV9B 3OKKB 3IKCB 4G6MH 5F1OB 5HHME 1OSZB 2AVGA 4N5ED 2NXYC 2BY0A 2VITA 1JPFA 4XPGL 3ALWA 3V0WH 3IDYC 1QQDA 4KY1H 4NQEA 4YJZL 4PJEA 1AGEA 1BWWA 1CVSC 2DDQH 3GHBH 4RNRB 2EDDA 5DRXB 1EO8L 4FFYH 5HGHA 4MXVE 1NEZB 1NLDL 2COQA 3NH7H 4Y4HA 4JLRA 2QQKH 1R3LA 4AEHL 4I1NB 4MWFA 2IEPA 5KS9E 5C0RL 4MMZC 4Y4FB 3WHE1 1U91A 4F37F 3K0WA 5KG9A 2PO6A 3S34L 5I1DA 4OLVL 3T8XA 4WCYH 4U6VH 1P7QA 1KENH 4WUKH 5DRNB 5C3LD 5TDOB 2DJ4A 3MO1B 3ULUF 4PD4J 1KPUA 3MJ9A 3WN5C 1K3IA 1KOAA 4JQIL 5JQ6H 1S7SB 4YDKH 1N6UA 3G5XB 5A16A 1O5DT 4TUOA 2A73B 2AEWA 2F5BL 4E5XB 4KK6D 4PJIE 4WV1A 5DVKA 1MAKA 1AGDA 3BQUB 2ZJSH 3X12B 4Q6YA 4W70A 3HG1E 5BXFA 2YKLL 1YEEL 4S0TD 1OGAA 5J0BA 1ZLVH 4Y4FD 4OZHE 2DLGA 3RRQA 2XZAL 1KB5L 4PJ7F 2V2XB 2F74A 5KVFH 2CUHA 2XQYG 2CDEA 1RULH 3K1DA 2IANA 4JHWH 2EIDA 4R2GB 2YPLA 4F7TB 5JIKA 3IDIA 1AHWA 3I85A 2CJUH 5J13C 3FQNA 4X8XA 1DBBL 1NGQL 5DT1H 1YA5A 3BWAA 5HHMB 4XTRC 3WNOA 3R4DA 1G7QB 4OTXL 2LQRA 2PR4H 2X4OA 4H8WC 3EJZC 3BQUD 1LDSA 2OM5A 4U1SA 5SX4I 3HI6L 4LKCB 1JP5A 4JG1H 1J05A 3GO1L 1HHIB 4U6HA 3OXSA 3WS3B 3U48A 4PJHA 2HVJB 2ZG3A 1S7VB 4OZGB 4FXGA 4Z7OF 4I9WD 4OLWH 2XNAB 4KKLC 8FABB 3MLZH 4R2GD 4GRMA 3D3VA 2OZ4H 1R5VB 4OLYH 3U4EB 5EC1B 2NW2A 1KJ2B 3QJFA 5BZWA 5HHMD 1MJJB 4POUB 4XBEL 5E7FA 2JKXA 5DUBA 2VL5B 3RWEA 4X9GA 2A6DB 1WZLA 3E2HB 3QUKB 4X7EC 4ZQKB 3BE1H 1U95B 5GRVK 2BK8A 4GSDH 5D2NA 5DJAB 4NZRH 5F7NC 3QPQD 2FGWL 2X4QB 4YHLL 1EEUA 1ETZA 1AGBB 4HW6A 4WW2C 1F3RB 5EUKA 3OGCB 3W9EB 2VLLA 4MCYA 3QUMB 1VFBB 1FBIH 3QCVL 4Y16A 1P4LA 3SE8H 1OWRM 2PW2B 3UC0L 4ZDHB 1LE5B 1LO5B 1CFBA 3HFML 2XA8H 3S97C 1GYAA 4PYGA 3TBWB 2LU7A 2ZCKL 3O8XB 1H5BB 3ARFD 3HZKB 5F7KC 3QEQB 5IVOA 2IGFL 4YXHH 4N8VB 3IFNH 1V8HA 3OL2A 1FGNH 2I25N 2WAHA 2F19H 2GJZB 5FYKU 2IADB 2EDFA 2EDBA 4S1DD 4JM4L 4Z7WE 1YPZE 3QWRA 4YUEL 1M6OB 1BJMA 3O9WC 3HI1A 3S6CA 3DUHA 3BZ4B 2VISA 3IS1X 5FA4B 1INDH 2KQNA 2BCKB 2O26U 1XGRB 4JZNA 5EZIH 2DYPB 5ITBL 1Q9KB 2BVQA 4UQ3A 3ARTA 4DZBB 4YHOH 4NWTL 3SE9H 2E3VA 3NCYP 5EO0A 3HG1D 4R4BA 1J87A 5EUOF 4O2FA 2OMBA 1BVKA 3QO1A 5ALBH 1T3FA 3GMNB 5I8OH 1OQOA 1IL1B 2OYPA 1TQBC 3DO7B 3IT8D 1TIUA 2CUMA 4WIQA 4U1JA 3NIDF 2VXTL 4JJHA 4XWGH 1JK8B 4WO4C 4NBXB 4NNPH 5A2JH 4GUPB 4EUPG 4G43A 1AC0A 2D0HA 4TVPL 1WAAE 2X4PB 3RY6C 5GGVH 1IEAA 5EIQA 2XZCL 5A2KH 4EN3C 4G80A 5F88A 1S7UB 3FO1A 5EBGA 4KMTL 2DQEH 4YWGL 4JFOA 1HEZB 1MAMH 4Q2ZB 2VH5H 3L1OL 3LKOB 1TETL 4QHKJ 3QUMH 5D7LA 1QACA 4I48B 1V7ML 1PKQE 3RUGF 4PRNA 4C57C 4PFEA 1P4IH 4FNLL 2Y36H 1NGPH 2QR0B 4H1LG 4ZOAA 3U7WH 3O3UN 5SX4H 1AGFB 2LABA 4HUMB 1HE7A 1OAYH 5SWSE 3Q2CA 2O61A 2UWEA 4JCMA 5I18L 3NFSH 3F8UB 4FTVA 4Z0XB 2Z8WC 3IDMB 2QQLL 1G6RB 3MA9H 1W0WA 4F9LC 1YPZB 5JPMB 1N59A 4M61B 4KJWC 4PRPA 4Y2DB 3L3IA 2I9LB 3PGFL 2F58H 2HMID 1I4FA 5I1CH 1T1YB 4RFEB 5LAXA 2OL3L 1OCWH 5I1AA 4YGVA 1S9WB 5IMMB 3P77A 3UPCA 5ACZA 1KGCE 1TCMA 3ZSSA 3MV8B 5C09B 3LRSB 1P9MA 2AK1L 3GUTB 4Y4KC 1GVIA 2FWOA 3T4AB 3T2NL 2PXYD 2YZ8A 4IDJH 2YD1A 4MQSB 5IGXL 5IB4A 1HI6B 1CGXA 1H8OA 3SKMB 3EZ8A 2JF1A 4XCCL 4JEGB 3Q0HA 5DZOA 4U1GC 1NC2D 3S88L 3RU8H 4Y2OA 5E94B 1UWXK 1U3HA 4O51A 4G7VH 4YX2L 3SPVA 4UILH 5HYIA 4PREA 5KBNC 4XHJC 1V3MA 5ADPH 1SJHA 3KAAA 4KAQH 4OZFB 3HC3L 2D7TL 3EYVA 2H2SD 5GIRB 5B8CA 3UJTL 4YNYA 4HJ0D 4MNQA 3A6CH 1UXSA 3DTXB 2J8UA 3THML 1VGKA 3QDAA 4HK0B 5E5MA 3PWNA 4O58H 1HINH 4ELKA 3ISWA 2Z92B 5GRJL 4ZOEA 3GM0A 1F8TH 3DX6B 4FFVC 4M62H 4JAMA 4NHUB 4BFIA 1YMHA 4G6KL 4BZ2H 2YMXL 2OJZL 3SCMB 4XPHH 4PG9A 4R9HA 2K3TA 5GS3A 3MNZA 2R69H 1QBMH 4KGLA 4LPTA 4MAUH 4FS0A 5JXED 3IXTA 3JWDC 1RSFA 3EIFA 2Q8AL 2FSEA 2ITDB 2BNRE 1UGNA 1QYGH 5J6HA 5DD0L 5DWUH 5C0EB 1VEOA 1F6FB 4NDMB 1EBAA 3BJLA 3CIQA 4L8BA 5E8EA 4ZUTB 4JPVL 1QFUH 3B9KC 4LNRB 2ZCLL 1GOGA 4WI7A 3HC0A 2LU3A 3OGOE 1FLTX 4XP9L 5E8NA 1Z3GH 4IMKC 3RWFB 5JIIA 5IB2B 4LVEA 3TA3A 2DQDH 3SCMD 3IETB 5DK0A 3RKDD 3CXDL 5D93B 5SWSD 3K3QA 3DUUB 2CXKA 5DVNA 2YK1L 1I1AB 1BQHA 4MJIA 4P23A 3QDJA 5DHYA 4Y1AB 4FQXA 4OZFH 1G0DA 3O4LB 3FT2B 5L7XL 3KPTA 3JWDL 4H0GA 3RDTA 1Q0YL 3BEVA 3SO3C 4O00A 1CFNA 1EHLH 1T1WA 3UP1A 3VFSB 1KGCD 4Z0BL 3FT3A 3O3DB 3OJDA 2MPAL 1CLYL 4P46C 4YE4H 3HPLB 4X7CC 4K7PH 1NLBL 5HHVH 1MUJB 5ESAB 3BSZL 1QEWA 1XGPB 2AK4B 2FZ3A 3AY4A 1MLBA 2C9AA 4QY8A 5C71A 5LG1A 3VXUA 4AENA 4MXWH 3MLUH 1FFOB 3TC9A 1JYXA 1DP0A 5MERB 3TZVA 5MEOB 4N0YL 2BJMH 4O2EA 2HRPH 4X5LA 5KJRL 2YUXA 3T04D 5FM8A 2K9UA 3DETC 4UZGA 5DK2B 3MCKB 3RIAF 4K94H 3VE0B 3MRDA 3V8OA 4JM2A 1IAIM 5GPRA 2BNRB 3KLAB 5C0DB 5I6XC 4K3DL 3L5WB 1LP9A 5KSAB 3CVHA 1MCNA 1UKSA 4KJPD 4ODWA 1MFEL 3IB4A 2EIZA 1HSAA 5DJ2A 1H0DB 4RGNC 2VE6B 5F6IB 4F3FA 1A6WL 4UUJA 3KYAA 4QRSA 1VKXB 2NZ9D 2R2HB 2ARJQ 1CTNA 4LNVA 4P2OB 4HUKB 4N0UA 4RRPA 4GBXA 5TE7L 5E1AA 4OCYL 1AY1L 4OIIH 3SGEI 5F7UA 4Z7UB 1KIRA 2BFVL 5HY9A 3T09A 1MFBL 4WJ5B 3R0MA 1S78C 1XGUB 2MTPA 4DGIH 1X4ZA 2CDGA 4JFEE 1YY9D 2CUIA 1GAFL 2BNRD 3VRJB 1V7NL 5DJ0B 1ZGLA 2X4TA 4KTDH 4JRXE 5KSAD 1U8LA 2EDKA 2YA1A 1WZKA 2O93L 1F2XK 2R2BA 1IVLA 1EJ6A 2UYLB 1F3JA 4I0PC 2NY0C 4M6MH 5F1IB 3ILQC 3NACH 3K7UA 4XNMB 9CGTA 4JPWL 2ESVE 3OHXA 1QR1A 1ZGLM 4QHUB 4L8SB 5HHXH 4KKAD 1T22A 4JKPL 2ARJB 1RJZB 5C0GB 5DJ8B 3BX7C 4DEPB 5J6GA 4EZMA 1F6LL 2D7QA 1CICC 2HFTA 3ZL4H 3HRPA 3RVUC 4PYHA 1JF1A 3QRGL 3LN9A 4JFYA 3L3HA 2AKRB 4TNVK 2ICWA 5D7IF 3RX7A 2YD6A 3FN9A 2DQFA 4PJXE 1ZEAL 1UXWB 3F65A 1AR1D 3OR6A 3I50H 5D96B 5HHOE 2UZXB 3PHQB 4DAGL 5AG8A 2QQNH 3GSNL 4HFWA 5L2KA 2NY1B 4G6AD 1YUHA 6CGTA 3ZDXF 4NQXA 2DMCA 2ED7A 3FCTB 4W6WB 2B20A 1U3YA 1J0HA 4YZFF 1IFHL 2AGJL 2C1PB 5CWSB 4GRLC 1IGFL 2UY7A 2N56A 3WUWG 3VFPB 2ADGB 4WI5A 3NA9L 2E7LA 4G8IB 1XF1A 3VFMA 4NCDA 1ORQA 4C58B 2JJSA 2HT4C 1CR9L 1JI2A 3PWLB 3QI9A 4IOSD 3VFVA 1K4DB 1NBYB 3L95B 4W6XB 4KRMB 4IJ3C 2VMFA 2YRLA 5IR1B 3CK0L 4NUGL 1P84J 3VFRA 2CO6B 1JMZA 3ZE1E 4GXVH 2R2EA 3H8NA 4N5UA 3O45B 4F2MB 4EI5C 4JFEB 1LE9A 1FORH 3QQNA 3UMTA 3PQYA 4PTTA 1DQQA 3U7YL 1HKLL 2AV7B 3SQOL 1VPOL 3IJYB 5J8OA 1DN0A 4HIXH 2OTUA 5HPMB 5E2VL 1XIWC 4MA8H 2VYRE 3OKLB 3MYJB 4QNPF 5EU3B 5ANMB 1RHHB 4WTZA 4NRXB 2H3NA 3C6LA 1IC7L 4YH6A 1QO3A 1KXQE 3IXAB 4GKNB 4NZUL 2JTDA 2GCYB 5DQ9A 2ATPA 5KOVC 2ESVB 4QRPB 1WCQA 4PJ5B 4LDEB 3T77B 1FNHA 4O4YH 4C83B 3WN5B 1YEGL 3CH8A 1YY8B 3DUSA 4JFED 4NJ9L 4M9OA 1AXTL 4XPTH 4WEMB 5HDQH 2ADFH 2J6EA 4HWBH 2EZ0C 1MRDH 4NO3B 5F71A 4OV6F 4U1LB 1BF8A 1CF8H 1IM9A 2ZSWA 3MV11 4WI3A 3AB0B 1L7IL 2HH0H 1KJMB 4U7KA 4HG4K 4YR6A 4P5TC 1ONQB 1C7SA 5GGQL 5CEYA 3TBYA 1HXMA 5CEXB 4ELME 4GMSH 1IC5H 3NAAH 2ESVD 1MRFH 1DQTA 1VFMA 4R4FH 3D0LA 1QSEA 4ZAKB 4L9LB 3UYOD 4D9QD 1WT5C 4YHNB 5IESL 5I1IL 4TULH 1OT2A 2ERJB 4J4PC 3MRRB 4PGEB 4HWZB 3IDNB 3G6DL 3B2VH 3MRJB 1TJGH 2H41A 1UQSA 1T80A 1MIEL 5HHOD 1K4CB 4OI8A 2BVEA 3BKJL 4WWKB 4LFHD 1R6VA 3V7AE 4LASL 2VQTA 3DYMA 5HHQB 5FO7A 1N7MH 2MQ3A 1DQDH 5F8QC 4WU7A 3AS3A 1EFQA 3UZEA 4XP5H 1Z9MA 2WLZA 4NCC2 1QSZA 5E00B 4Y19A 4QT5A 3CSPA 1RY7B 4I2XA 4PJ8C 4PBXA 1ZLUK 1LO4L 3KDMB 3QDMA 4U1NA 4TN9A 3TN0A 3B2UD 3EJZD 3IU4L 1GGYA 4G8EA 1VSCA 3E6HA 5FUZL 1SMOA 1T21B 3T08A 5IVXE 2DIJA 5FO9B 4LLDB 5F7EL 5B39B 2ZUYA 4PB0L 1FYTA 2NY7L 1FG2A 4WFGE 4WWKD 5C07B 4Z7QE 4JO4L 3VA2C 4JREC 2R1YA 4H1LH 2EDOA 5I1GL 3UJIL 1IE5A 3DARA 4KKLD 4HS6B 4P2YA 1FE8L 3ILPB 1S9VB 3QDGB 5C2UB 4H88H 2AXGA 1A7QL 2AXFB 1XGQA 1NAMB 3K8KA 4ZXBB 1ZANL 3C6SA 3U46A 3BN9D 5GGTA 3SEPA 1J7VR 1OW0A 2X7LA 5LBSH 3TM6A 5F8RC 2DIAA 1T04B 3MJ7B 3O9WB 3TO4A 1ZHKB 5FHAH 1GCFA 1G7MA 1UWXH 5C07D 4EVNB 3ARDB 1T5WB 5HHPB 1HNFA 1JGVH 4YPJA 3RWIA 1A6AB 3VGEA 4JQVC 1E4XI 1TPXB 5DJ6A 1C5DB 5ETUB 2G60L 2A9NL 2JIXB 1FZOB 4Y0GA 2XT1B 3MNVB 3RX8A 2HP4A 3L7EA 4X7DC 4X99A 2WM0A 3RZCA 5CCKH 1TJHL 3CFKB 2GJ6A 5CP3H 4Q9QL 4N8VG 3T65B 5ICYA 1R3JB 5A2LH 4YFLI 1JIBA 2DQIL 3D85D 1UWGH 1CLOH 3MPCA 5F93C 4OCNC 1FNGA 2IPTH 1Q9WB 2HAZA 3FQRA 3RNQA 5GXBB 3LIZH 2AJZA 3BKYL 5D9SB 4F80A 4WO4B 5CIPH 4KVNL 1KELH 3K4ZA 2VITB 1JPFB 1IQDA 3OAUL 4LSQH 1UYWL 3O9WD 3QAZB 4OCXH 3HPJA 1NDMA 3WXWH 1CFQB 4L4TA 3WIFA 1UACH 5FGSA 5KSUB 3KR3L 3OMZA 3QCTL 1AGEB 5ICZB 4WHDA 1KB5A 5I76A 1BQHG 4YO0A 4PJAE 1HILA 3VI4E 5GISL 2I27N 3KPPB 4X98A 5IVXB 2IFGA 1JGEB 2R4RL 3LRGA 2PF6A 3LS5H 4AL8L 1AD0A 4JLRB 1UT9A 4B41A 1R3LB 2DLFH 4V1DE 5BOZG 5HVWA 3SGKA 5CJXA 4MWFB 2KDGA 2BC4A 1RK1A 2YWYA 1U91B 4QRUA 3S36H 3G6JA 5KG9B 1RIVL 4WO4D 4FQCH 4Q6IC 5I1DB 1PLGH 1NAMH 5DZLA 3GIZL 2FBJL 1P7QB 5LCVH 6FABL 4AEIL 5I17A 2XOTA 4GRWF 1KPUB 4NUJA 1HYSC 1ADQL 3BH8A 3V9FA 2HWZL 1ZS8A 5A16B 4G6JH 1A6VL 3AXLA 1ORSA 4WV1B 4H20H 1AGDB 1BP3B 1CE6A 1A22B 3CFCH 3TNNA 2GT9A 1C5BH 2Z35B 1FH5L 5HVHC 1HCVA 3HMWH 5BXFB 4WFGD 1V3LA 1KFAH 2CO7B 2EH8H 1WZMA 4YHYC 1OGAB 3P0YL 4FQLH 3RVTC 4X5WA 2F8OA 1EBPA 3I2CL 2HJKB 1AH1A 3KNBA 5DC4B 2F74B 4UDTB 2CDEB 2OP4L 2IANB 1A3RL 2RCSL 1NUGA 1IAOA 4EBQH 2YPLB 4WUUA 3FB8B 4C56E 3SHSA 1MPAL 1AHWB 3ES6A 4YBLC 3FQNB 4XC1H 2D31A 3T0VA 3BWAB 1O7SA 4M7LT 4PLNC 4ZUWB 4KJWD 1W0YT 3V6OC 2FB4H 2X4OB 3OPZH 4PJ9A 3ARZA 3J8F7 4OZIA 2PNDA 4U1SB 4M8QB 4JO2H 3V52H 3M07A 3FFCE 3MCLL 1IZJA 1J05B 1QFOA 3F12A 4K23L 4RMSA 1NL0L 4U6HB 3OXSB 3ULVC 4PJHB 2FHFA 1IM3A 3LB6C 4LHJB 1DUZA 3IFOA 4Y4KD 3MLTA 1B2WL 3ROOA 3WKNA 5L9DH 1TXKA 2H26A 1Q1JH 4AT6A 5CD3A 4V1DB 4UT9L 4GRMB 3D3VB 4X6CE 3OB8A 3BT2H 3NCMA 3BXNA 4KUZL 3DMMA 1XZ0A 3RNKA 4U2YA 4I77H 1FAKT 4YHMH 1FNSH 5BZWB 4L3CA 4DVRL 5CSZA 5DUBB 1E4XH 4K3JH 4MDJA 4YHZH 3RWEB 4LLQA 4A2LA 3MJ9H 4LSPH 4XHJD 1CL7L 3U2SB 4P57A 4ZYKA 4PLKD 3HHRB 5EZLA 3KXFA 5D2NB 4HH9A 5AYUH 1EH9A 5DJYA 2QSCL 1B0RA 1I9IH 4LHUA 4W6YB 1MFNA 1ETZB 1KCVL 4L4VE 5CJQH 1CD0A 3JBG7 5D7LE 3JV6A 5EUKB 5C9JA 2VLLB 1TTGA 3PL6A 4MCYB 5TF1H 3U0WH 4Y16B 3BP7A 4CDHA 1DBAH 3ULVL 3WFEL 3I9GL 3KLDA 4RGNE 1E4JA 4QTHA 1W72A 4G7YL 1JHKH 4V1DD 5IBUB 4MXVF 1X7QB 4FFVD 1OARL 4XVSL 4LVHC 5FM5M 2XY1A 4Y8AA 3H7BA 4ORGB 5EB9A 1GGBH 5FV1L 2OXHA 3TV3H 3HRZA 2W0FB 5KS9F 3FTGA 1NSNH 1OAZH 3TT1L 4K55A 4TSBL 5DO2D 1RK0A 3PP4L 3SE3A 3IAGC 5HDLA 4WHYH 2RHEA 3HI1B 4OUUA 4LU5L 2L7JA 2R0LL 1J12A 1H3VA 4HJJH 3FQTA 2ICEA 1X5GA 4JZNB 4MJ2A 3X3GL 5FOBA 2BVQB 5JIHA 4UQ3B 3VW3L 2BHUA 4OKVA 4POZC 3PXHA 3VFGH 4D2NA 3C8HA 3KYMA 4PV8A 1MJUL 4R4BB 4QHMA 2DD8H 1BEYH 3FFCB 4HZLB 1MHPL 4IBLT 4PJIF 4ZFOL 1IZKA 4J3UA 4HWEL 4O2FB 1FAIH 3MACH 2FECL 1JYNA 1BVKB 43CAA 4DW2L 1I3RB 3LKQA 3GBNL 3SBWA 4OFYA 1J0ZA 2EDTA 4U1JB 1RUAL 2AQ1A 5TPWH 4OZHF 2MQ0A 4OT1H 3IAPA 4WTZG 4X6CB 3TYGL 4C56D 3QWRD 3QQ4A 2HLFC 1MHHA 5L8JB 1S7RA 2MHAA 1VENA 3MRFB 4XNXH 1Q72H 5TQ0L 2JJTA 3HMXL 5CEZH 1QNZL 4GS7B 4R26L 1X4YA 2AW2A 1N4XH 4G80B 5GS1C 3H6JA 5DQJB 3FO1B 3WDJA 4XNQA 5BV7B 5GGUB 5IQ9A 5DMIL 3FFCD 1P1ZB 4L4VB 5I19L 4U0RC 1T03H 5FF6A 4UIKH 5D7LB 1MFDL 3WFBH 2G75B 1WEJL 1S3KH 3KS0H 4RMWA 4Y5XC 1A7NH 4P46D 4BYHA 1ES0A 1NH6A 3FFDA 4KK8C 4OLUL 1OM3L 3TNMA 4Q58C 3QG6A 3UROR 2E6PA 4NBZB 1MNUH 3P30H 5DMGC 2O61B 2UWEB 3LZFL 12E8H 4FTVB 4J3WA 4UU9B 4PGBA 4PJBE 4MQTB 1W0WB 4TNWK 1N59B 3B6SB 3DETD 4HS8L 3L3IB 3PGDA 1AXSA 1CD1A 3SDAA 4RMTA 1BF2A 3VXSE 4L4VD 2Y07L 2D4FA 5D7LD 3BPCB 2FX9H 3P77B 3GMQA 5ACZB 3BZEA 4NWUL 5IV2A 4HX1A 3MLSH 4AM0A 5CILH 2MFNA 1A7PL 1WBYA 2X44D 4GRWH 2FWOB 3IJHA 4RGND 4GG6A 1J0YA 2DBJA 4IS6A 1E28B 5ID0A 3MUHL 2ZKHH 5IB4B 1UG9A 3QEUA 3HNTH 4TSCH 3C2AL 2B0SH 5IT2L 3WLWD 5AZEL 1K6QH 2FD6L 1JTTA 5C2BL 1U3HB 4O51B 3SPVB 1CLZL 4PREB 3WJLA 3OKMA 1S78D 3WFDH 2C3GA 4RA3A 3SKOA 4PRDA 2OQJA 1SJHB 5DVMA 4Z7WF 5D1XA 2XACC 5EN2A 5BV7H 1AQKL 4OGYH 4XZUA 1BBDH 4P3CL 2ITCB 1OPGL 2V6HA 4HDIA 5C6WH 4YNYB 1QSFA 2Q3AA 4XAKE 4I0PD 2NY0D 4LBEA 2J8UB 3ILQD 5HYFA 3KYKH 3DGGB 3VXOA 2EIEA 3GHEH 3PWNB 2E9WA 2P7TA 4ELKB 3O2VH 1JHLL 1B3JA 5EZOL 3BESR 1GGIH 4M5YL 5CBEB 3VXMA 4GAGH 2EDLA 4JAMB 3TYFB 4M6NL 1CICD 2ZG1A 3RVUD 4LEOB 2ZNWA 3TO2B 3SDYL 2QQQA 3WCYA 4PG9B 3DVFA 1QFPA 1NUFA 5CSGA 1CN4A 5HTSA 3IXTB 2AJSH 5ESQA 4FQIL 2FSEB 4NN5B 1CYGA 1DL7H 1IC4L 1WAAF 2IG2H 4KZDL 1CK0L 4IRJA 4UV4H 1ZLUH 4EI5B 2NTFB 1HH9A 1IAII 1YYLL 3CMOL 5MI0B 2X9WA 4CJ1A 1EEQA 2W0KA 4L8BB 2CH8A 3INUH 2BVOA 5E8EB 4R8WH 4NGHL 4HPOL 15C8L 1RD6A 1HSBA 3HC0B 3SDXA 1XIWB 5EORL 5B3JE 3MBXL 2R4SL 4M1GH 5IW6B 3ME0A 4YHPA 1NMCC 2L4OA 2HT4D 4MCZB 5T1MA 5BMFL 3QXUA 3L3JA 4XXCC 5DK0B 4ERSL 2MWCA 3QIBC 3SQBA 3GBMH 4NKOA 5CAYB 1BGXL 1D6VL 1KTRL 3QHZH 4MJIB 3HZMB 4P23B 3QDJB 1WCBB 2P48B 1EUTA 3CFEB 2X89A 2HFFA 4EI5D 3WE6A 3SJVE 3HR5A 3V6FA 3OXRA 4ONOA 3BEVB 1T7ZA 2WSKA 3MUGA 4YIQB 1CFNB 4X80H 4K2UH 5E6IA 3LHPL 1QG3A 1TZIB 5IHUH 1FVEA 3FT3B 4YDJA 1XIWD 5JDSA 1DLHB 1V5JA 4HFUL 4IDLA 3H2WA 1BM3H 1ZTXH 1U8NA 4KTYA 1QEWB 3AAZA 1VACA 1TLKA 1MLBB 1NJ9A 5E8OA 1KEML 4AENB 2E5EA 3OJVC 4D3CL 4D9LL 2APWA 2Y23A 5HYSG 4KV5E 1QRNA 1B88A 4P23D 3VXRA 1NFDE 1F00I 1LO2L 5I66A 4O2EB 4S0SD 4KDTC 3IFPB 3QUZA 2QLVB 3X3FH 3MRDB 2V7NA 4JM2B 3UPRA 3BDYH 1TTFA 2EZ0D 5L8LB 2KKQA 4UOJA 3ELAT 3HKFA 2VRAA 2VDOL 5MEQB 1CDBA 1LP9B 3QFJE 3CVHB 5DRZA 1U93A 1ZVYA 2ICWI 4P5TD 4XAKD 4GG8A 5FYJH 5J11B 4W81A 1HSAB 5DJ2B 1G0YR 1KBGH 3MFFB 1AP2A 2R9HC 5TE4L 4ZD3H 4F3FB 4UUJB 1MHCA 3JV4A 4F58L 1CE1L 1YQVH 2ZWLT 1ZWIA 1F97A 2XIDA 4GBXB 3W11C 3IFLH 5K9QI 3LPGA 4J4PD 4PJ8B 5B21A 5HY9B 1NFIB 1I7ZA 1HWGB 3GI8L 3G5YB 4ZPTA 5DLMH 1HZHL 5D7SL 1ZGLB 2X4TB 1U8LB 3SJVB 4I3SL 2R2BB 5L0QC 2FJHA 1F3JB 2VDRH 1N5AB 2FDBP 1N0XH 2R15A 4NN7B 3ARBA 1JNLL 2YN3A 1WZ1H 1G9ML 2X2YA 4HLJA 5L88L 4N8PA 4K9EH 4UNUA 2R0WL 3N85L 3OHXB 1QR1B 1SY6A 3X13A 4F7PA 4Q0XL 2K7QA 4Z95L 3I84A 2LAAA 1L9MA 3CDGA 2P46B 4PJ8D 2APBA 4APQC 1CFVL 2LTQB 1ZHLA 2X4SA 2HFGL 4N68A 4JFYB 5LWYL 3L3HB 4HQQL 3VWKC 5EOQH 2DQFB 3QYCA 1H3UA 1CD8A 4MHHI 3OR6B 4M48L 1FPTH 2P8MA 4PLJC 2D0GA 3EO0A 5LGHH 2RB8A 3SJVD 5L2KB 4LKXB 2C3VA 1YUHB 4NQXB 3RWHA 3P9MA 3HLAA 2YD3A 4PJGA 3QCUL 3DGCR 3QIWA 1DBML 2DI8A 3TWCH 4QRRA 4CUCA 3ARGA 1FL3A 1JWUA 2ICCA 3QFJB 5E2TH 1JTOA 5FECA 3VG9B 4LSSH 4OGAC 5DS8B 1UWEL 4XMLH 2OR9L 4N1EA 5HJ3A 4MS8D 3VFMB 1D5ZA 5CUSL 4HUNB 4JFZH 3LDBB 2AEPL 4NZDA 4Z18A 1RUKH 4I3RH 5T3ZL 3VFVB 3V6OE 2XWBA 1ZLSL 4RQQA 4FFWC 3VGFA 1S5IH 3VFRB 2VWEC 1G7LA 1OAUH 4H26A 2P24B 2AEIT 3HN3A 5IFHH 4QRQA 4XPFH 5EBWA 3ULVE 5E6ZA 4HUWA 4ZMAT 3CFIC 5F89A 2XICA 1LE9B 3PQYB 2V7HA 4PTTB 5ESVA 5E5RB 1LO0H 3SDCC 5AAWA 1QPPA 3F7RA 1BFVH 1HXYA 1SVZA 2NY3C 3EJYC 3HB3D 3QFJD 1GPOL 1TVBA 4F7MA 5D1ZA 2OTUB 5F7DB 3V7AG 5I30L 4QOKE 2NY4B 3EDFA 4RX4D 3R8BB 4K3EL 1F4WL 2GTZA 4LARL 2WIMA 2H3NB 1XFPA 5EDXA 4M1CC 2DTML 2VABA 2ATPB 3NFNB 2NYYC 1OAXL 1YEFH 3RJDA 2PYEA 3CSGA 2D9QB 1KIUA 3G6AA 1U6AH 2DQTL 5T1KB 1L4IA 4XCEA 1C08A 4RSVA 5E08L 1Q94A 3X11A 3BO8B 4BZ1L 4MA3B 5FKPB 4ENEC 5F7HA 1EA9C 1OAKL 2DLTA 1NCCH 4FXKA 5HVHB 2ZSWB 1GIGH 2NY4D 2C1OA 3LQAC 4YR6B 4XNUH 2GITA 4G6FB 4QXUH 5CZKA 2H1PH 4XP1L 4FQ1L 5CEYB 3TBYB 5JW4Q 2Y6SC 3TH2T 3ESUF 2K1MA 1ZT1A 3A6BH 3MRCA 3NCYS 3O6ML 3D0LB 1QSEB 3RGVA 4NYLA 1IGJA 2FR4B 3ARWA 5T1KD 2W65B 3VDAA 4YBLB 2HTLD 1HYSD 2ZZUT 2XTJE 5ERWA 1YYMH 4OD1L 1I8LC 1S7XA 3VXQA 4DOHE 4TUKH 3WIIL 2P47B 3UBXG 3T0EA 4WWID 4PUBL 3ZYZA 2V9RA 1UQSB 5E56A 3O0RH 3LQZA 1G7JA 1AIFA 2AJYL 4FFZH 4PJXF 3RVTD 1QUNA 4RISH 5IBTH 4D0DA 4PJFA 4N0FA 1EGJL 5D5ME 1CWVA 2APVA 5FO7B 1E27B 5JW4N 5EBMA 4WU7B 3LQAL 3P4MA 4QOKB 5KVEL 1UM5L 1D5MA 2BOCA 4C4KT 3GNMH 4MZ2A 2OLDA 4QT5B 3FAWA 1T2QH 4K8RH 4KDVA 4TQEL 1YNLL 4I2XB 3NCFB 4L4TE 2JB5H 2DRUA 3QDMB 4NKIH 2ZOLA 2R1XA 2FLBT 3HC4H 1HIMH 4G8EB 2D7NA 2R56L 2X70A 3DNKA 2OI9B 3TH3T 4QGYA 4M7KH 2BMKA 2EKJA 1EUUA 1FYTB 2J6EH 3Q5TA 3LB6D 2EE3A 4LSUH 1KJ3H 5FUCC 3ZE1F 4CVXB 4YDIH 4P2QA 1DBJH 3PE9A 2RAMA 3MGAA 1CGWA 4ACPA 4QOKD 1RZKC 4M7LH 1N0LA 1CG9B 4O5LL 4KI1A 5F1SA 1GGUA 3LS4H 1FNAA 1MFCH 1A2YA 3QFDB 1YJDH 5BOPA 2DQCH 2L0DA 1XGQB 5TFSL 1I3GH 4LCCA 1FLRL 3S5LG 3CDFA 3FAXA 3OTTA 4FA8A 2P44B 4ODHL 3TO4B 3ZTNL 2XTJB 2QSQA 3GMRA 4ZS7H 4D8PA 3EYOA 1CQKA 2FGZA 5D6DA 1KNOA 1IGMH 5ICXA 2EC9T 5GGRY 5CMAA 1EJOH 3RWIB 4I8DA 4OF8A 5ID1A 5CINL 5DJ6B 1C12A 3KJ4B 5T33L 3DVGA 4WW2F 3RZWA 3WBDA 3L7EB 3VD4A 1YEKL 1BAFH 3AM8C 4LRNL 4LPUA 2ORBL 2FX7H 5GSRB 3RZCB 1EHAA 4U2ZA 2GJ6B 4DGVH 4WFHE 4QO1A 4GW4B 3VFNA 1FNGB 3CU7A 2P5WE 1RZKL 3FQRB 2ZPKL 3VWJA 2AJZB 3MGOA 5EOTB 1Z9OA 1IBGH 2NW3B 3O2WL 1JV5A 4MNGE 2F54E 4ELMF 3NCJH 2I07B 1A0QL 1IQDB 1OOAA 3BHBA 3NN8A 3TO4D 1MCCA 1MCDA 1S7TB 2XTJD 2H2PC 4UTAH 2I9TA 3K1KC 1NDMB 4L4TB 3WIFB 3HI5L 2A77H 3GIVB 3QHFL 3D9AH 2VZ3A 4RMVA 5GS1B 4IHOB 4POZD 5IM7B 4X98B 2J5LB 1HQ4A 3PV6B 2X9YA 2CKBL 4M9PA 1NGYB 3T0WA 3VXPA 2VAAA 1JE6A 1AD0B 4U0RB 4NKDB 3U7AA 1LD9A 3WJJA 3RQ3A 1N6QH 2W60A 3K46A 3PWVA 4GXUN 4WEUD 5JO5A 3SKNA 1RK1B 3L3KA 1YN6A 3LH2H 2C3XA 3G6JB 4KQ4L 3TJEL 1X6LA 4FQHA 1WQVT 2HLFD 2VZVA 1RUMH 2X1QA 1QFWM 1WFOA 1YEHL 4MD5A 2R2CA 1BZ9A 2IMMA 5GGTH 4ZUSA 2IQAA 3KXFE 2O5ZL 4L4TD 4NUJB 1SBSL 3C8KB 3BH8B 1K3ZA 3QQ3A 2YRZA 3QNYB 2MKWA 2DF3A 4AEHH 4F7CA 1XR9B 4HXAL 4U1MA 5K9JL 1ORSB 5KVGH 2OX5A 5IROC 5ACMA 2ZUQB 1CE6B 4KJQC 3B5HA 1FO0L 2GT9B 1NEUA 1A5FH 3RGHA 3MFGB 3S34H 5E9DA 3DXAA 5B4MC 4DN4H 1H3TA 5IVXF 1JZ3A 3RWJA 4X5WB 2ZUTA 5C0FA 4KK8D 3MLRL 4I18A 3KNBB 4ZODA 25C8H 3UTTE 1G7HB 4PJDE 3Q5OA 4W68A 2F5BH 4WUUB 3HE7A 1A21A 1T5XA 2D31B 4JJ5B 4OF0A 2VIRA 4KMLB 3VXTA 4XNZC 4M3KB 2YKLH 1YEEH 1IGIL 2Z93A 3MLVH 2F54B 1HHJA 3KPNA 3MREA 3N9GH 4EJ1C 5F96L 2O5XH 1WLHA 2UY6A 1KB5H 4OZIB 5J57B 2G9HA 3CD4A 2WWMC 3DHMA 2Q7YA 3U30C 4PJCE 3WEXA 4KU1A 4YFLF 2GUOA 1IM3B 3BUTA 2WWKT 4P9HC 5DK3A 3TFKC 3IFOB 1XMWA 4HMDA 1DQML 5GRZA 5C0AE 3O3EA 5CD3B 4IEFB 4OIBA 1OY3B 4WFHD 5DJXB 3KPSA 1XZ0B 3IF1A 2R1WA 4IIQA 1ZAGA 2AJVL 3C60C 4HBQA 2BZDA 4L3CB 4NJAH 1RU9L 2B5IC 5CSZB 5AZ2L 4MDJB 2QHRL 2F54D 5BVJA 3WKML 4S1QL 4P57B 4ZYKB 5GGSY 1KCRH 3SKJH 5D70L 5TH2A 3KXFB 4HH9B 1MRCH 1B0RB 4ZTPL 1B0WA 1KXTB 4M5ZL 4N9OB 5C9JB 5JUEL 1BECA 2VTFA 2QTEA 2QKIB 5DQDL 1P6AB 5I75C 5CFHA 1AI1L 5FCUL 4R96A 3V5HA 4CMMA 4XBEH 4PJAF 4QTHB 1IT9L 1RZ7H 1W72B 3VI4F 1KPRB 3HMXA 3FO0H 4GAFB 4KRPC 3E8UL 4B7LA 1Q38A 4AMKL 3GSOB 2XN9A 3KLHC 4QRTB 1CBVL 4X4YA 1U8PA 3H7BB 2FGWH 3MLXL 4PLOB 4YHLH 2R39A 5F21B 2VZTA 3FTGB 5ISZA 1JZ5A 1RK0B 3WS6C 4OV5A 3KXFD 3EO9H 3UTQB 3VD5A 1J86A 3QCVH 4OUUB 3MBEC 3OR7A 2FBOJ 4KKCD 3FQTB 2ICEB 1A7OH 4ONFL 4LVNC 2ZCKH 4CVWA 5E8DH 5BQ7B 4LPYA 2XA3A 5D71L 2PKDA 4OKVB 2LU4A 2A0LC 3ZHDA 3TCLA 3KYMB 4PV8B 2YUWA 3K2UL 3DECA 4JFDE 4QHMB 4X6FA 4WNQA 3PUCA 3GB7A 1KPVB 1RIUL 3NZHL 4U3HA 4YUEH 5FYLH 1VA9A 43CAB 1FJ1A 1UKQA 3N1GC 1AGCA 3LKQB 3TH4T 4KVCH 2NY2B 5T3ZE 2EXYD 4MGXA 3F7YA 4XBPB 2E8ZA 5E4EC 3WUZA 1L9NA 3HUJE 5CKGA 3NZ8A 4HG4J 3QQ4B 1MHHB 2VDPL 4MD0B 4NWTH 4PGCA 3ZE2E 1ACYH 4KWUA 1S7RB 2MHAB 3FT4B 5EG6C 1MY5A 2AP2A 2W92A 2J8HA 3I6LE 5ACLA 3B9AA 1CXKA 3D2UA 2CIKB 1RFDH 4MB4A 1KIPA 4XNQB 1UJ3A 3BPLC 1C16B 3D6GA 4PRIA 3DURA 5IQ9B 2JE8A 2VXTH 4Y7MA 5T3XL 3G08B 3V5DA 1W72H 4TVPH 2E9JA 3C5ZC 3M45A 5CBAA 3VXME 1MWAL 5C0JA 2XZCH 3MROA 5LJYH 5DURB 5JPNA 3QG6B 4X5XA 1CXEA 1H9VA 1FDLL 2R0KL 5DD5L 4KMTH 4YWGH 1LHZA 5CLTA 1I9RL 3L1OH 4PGBB 1INEH 4X6CF 1A6PA 4JO1H 2VWEE 4R3SA 3WO3B 5J56B 3UO1L 1JPST 1KTKE 1E4WL 2ZP0T 3PGDB 3MJ8A 3CLFL 4FNLH 2P5EA 1EEYB 3SKUD 3BEWB 2XFXB 4BH7A 1PY4A 3GMQB 1YNTA 5IV2B 4DKFH 2Y4SA 3LY6A 5I18H 2FH8A 4AM0B 4JFDB 3RJQB 4GG6B 4GQ9L 1QLEL 3IJHB 2R9HD 4IS6B 2QQLH 4HJGA 5DURD 5ID0B 4F15C 4EEEA 3S37H 1TNMA 3CCHB 3QEUB 3PGFH 2FEEL 3VCLA 4QCIB 3W11D 2MNUA 4JFFE 1A3LL 1T89C 3HUJB 2DWEA 1QLRA 3OKMB 4HUVA 2AK1H 3U4AA 3VWKB 4DFIA 3SKOB 4PRDB 1MCOL 2YD4A 5DI8A 3FRPG 3LKSA 4L8DB 5EN2B 5IGXH 4JRYE 4JN2B 5TDNA 4XZUB 1R5IA 3LSOA 4GW5A 1GGTA 4XCCH 3WO4C 2AJ3A 4DTGL 4HDIB 5FAAA 1JBJA 2Y7QA 4Q9RL 2SEBB 4JFDD 3S88H 3I75A 1KJVA 4LBEB 5LGJA 3O6LH 4YX2H 3VXOB 5J3HC 4AIZA 4JZOA 2P7TB 1F4YL 4DKAA 1MLCA 3BGAA 1JGUH 3VXMB 4LP4A 3HC3H 1IGTA 4APQD 1GZPA 4WI6A 5IF0A 2D7TH 3CVIH 3SOBH 3IJSA 4M7JL 2Y5TB 2IAMC 1H8NA 3UJTH 1UH2A 3VWKD 4Y5YC 1A1MA 2DDQL 4BQCA 3C5JA 5ESQB 1CQYA 3I6LD 4YBQC 1NGXA 4PLJD 4HC1A 5GRJH 4IRJB 5ILTL 2QQKL 5FDWA 3RIFF 1I9JL 3S4SG 2ZUSA 4PR5A 3QXTA 1Q8MA 4G6KH 2BVOB 1I8KA 1SMAA 4NFDA 3Q3GA 1HSBB 1CCZA 2UVEA 4P4RA 4OGAD 3MRHA 1GHFH 4DKEH 4WCYL 3VXMD 4TOYH 3FOMA 2H32A 4YHPB 5C08E 3QPXH 2G5BA 4YDLB 1A1OA 1RZGA 2PTVA 5GGRA 1FNEA 1K8DA 2P45B 4YDKL 4QKXB 1NBVL 4PJ7A 5JORA 4LLMA 1U41A 4FFWD 4NKOB 1TJIL 4JFFB 1FVDA 4PG2C 5E8PA 4JPVH 4BELD 2X10A 2ZJSL 1KIQA 1YDPA 3ZKXC 1I85A 2VLKE 4O9HH 2RJMA 3ABZA 5KVDL 2V5SA 4IRJD 1Q9OA 3BKML 4PJBF 3WE6B 4DQOL 2JB6B 4Y4FC 4JY6A 3HR5B 3T4YB 5IHLB 3OXRB 4M1DL 4NQCE 3SDCD 5FUCE 3AREA 3ZZ1A 1WIUA 4LLAA 5E6IB 3S7GA 1EEZA 2W38A 4HSQA 4WTXA 1J5OH 2B2XH 3QA3A 2R29L 3EJYD 1NQBA 4KHXL 2J7LA 1YMME 3CXDH 1FVEB 4YDJB 5KVFL 1MY7A 5DEGA 5B38A 4P48A 2ADJA 3ORJA 3BRFA 2HLAA 4OBSA 5IW3A 3RTQA 1G9NL 1J0JA 3H42L 1Z9LA 2LE9A 2YK1H 4ZNEA 4M1CD 1WITA 4PRAB 4R0LA 4KJYA 3TGXA 3AAZB 1T0MB 3L3GB 1SM3L 1VACB 1JPGA 1GOHA 5L7XH 1ZLWK 1NJ9B 2NYYD 5KZCB 4F9PA 3C08L 3C9NA 4JFFD 1Q0YH 2R0ZL 5J9PA 3LD8B 1QRNB 5TGBB 4CN6A 3VXRB 2AABH 5E6YA 1SVCP 4NRZA 3NMEA 4Z0BH 3I6KB 3C2SA 5EBLB 2ZSVA 3QZWA 1I1FB 4JG1L 3JTSA 5E7BA 4D0BA 1CU4L 1CLYH 4ODTH 4KZEL 4K7PX 3B83A 1NLBH 2V7NB 4RZCB 3UPRB 4JRYD 5IMLB 4JPKH 2HT3C 4R4NC 3W9DA 3BZFA 5F3BA 4PTUA 4R2GC 4X6DE 5DRZB 3MLZL 5E2JA 2VLRA 3SDDA 4GG8B 4OLYL 2Y6SD 1G7IB 4N0YH 2FO1A 3QH3B 5KJRH 3VH8A 2D9CA 5KZCD 3JV4B 1XH3A 3QNZA 2F53A 1NMBH 5T5FL 4BQ9A 1CGYA 4P4KA 1HHHA 5C08B 1MJ8L 3AMLA 5GRXG 1FFNA 5F9OL 1RJYA 3F7PC 3F7QA 4K3DH 1U8IA 1OP3K 1I7ZB 5JHLH 2E6QA 4MQ7A 3DIFA 1MFEH 4AIOA 3DBXA 3JZ7A 4P5KA 3H0TA 1FBIL 1E6OH 1A6WH 4M93B 5SWZA 1MCPH 3V4VL 2XA8L 4UT7H 2NCMA 2AV1B 1BD2A 2FJHB 4YXLH 2XG5A 4JQXA 5F9JB 1JPTL 3B9VA 4OCYH 1AY1H 1U8HB 3ARBB 4X6EB 5E2UH 2BFVH 3E2HC 2F19L 1BJ1H 1MFBH 3MV7E 1FIGH 5EUOA 3NFPA 3UEZA 3X13B 3QWOA 5IBLD 1JNJA 2IH3B 2PYEE 1X3DA 3E0GA 5C08D 3RVVC 1GAFH 1UVQA 1V7NH 4JRWA 5B3JF 3G5VA 2WNGA 3UZVB 1INDL 1ZHLB 3W2DL 2X4SB 2I60L 5IP4A 2JCCE 1UB5B 5EZIL 4HGMA 4YHOL 5I8EA 5L6YL 2VLKD 5E24E 4WDIA 4N8CL 5DVOA 4A2MA 3CC5A 3CX5K 3O81A 3P73B 4N9GA 3O8XC 2P8MB 3EO0B 3WYRA 5I1JH 1REIA 3NGBB 1JF5A 1GJIA 5HYQA 2YS4A 1UB6A 4NQCD 5ALBL 3RWHB 3V0AC 3A6OA 1A7BA 3QIWB 2QHLA 1YMMD 2X4UB 4NKMA 4QRRB 3ARGB 1FL3B 1KJ2L 1JWUB 3ZKNC 4GMTH 5FECB 3QRGH 4NNPL 5DMJB 1LEIA 3D39A 2BVPB 5HJ3B 3RUGA 1ZEAH 2N1KA 5FKAA 3PGCB 2DN7A 5GGVL 5ITFA 2CLRA 4E41A 3LRHA 4RQQB 3DSNA 3CUPA 4PIRF 1G7LB 3AMKA 4H26B 2VH5L 5EPMA 2AGJH 4QRQB 1AC6A 3S8WA 4KV5F 3QUML 1IGFH 4QHLB 5EBWB 4E0RA 2BX5A 3DV4A 4HUWB 3TVMA 2DQHH 1D9KA 2AJXL 1NFDF 2EE2A 3EO1A 3KPLA 4MAYC 4X0KB 5F89B 3NA9H 1KCKA 5JIPA 4ZOCA 1L6ZA 1CR9H 1HXYB 2J88L 1NGPL 1J1OH 1RZIA 1TVBB 5D1ZB 3RVXC 4NO0A 1BHGA 3U7WL 3C8DA 4J3TA 4QYOA 4RWYH 5EOCH 2GTZB 1OAYL 1T2JA 2J4WL 1SY6H 1NC4A 2GSGB 3DRQA 3JVGC 1CDYA 2VABB 3MV7B 5GJTL 5JLZA 2X5PA 1YECL 4NQDA 2PYEB 1DLFH 2VDQL 3G6AB 2H2PD 1IGYA 1HKLH 2F58L 3REWA 3GK8H 5DYOA 1VPOH 3AS1A 4XCEB 2WBJA 5I1CL 1C08B 1FVCB 4OQ1A 32C2A 3QUYC 4XMKL 5E2VH 3ZHKA 1Q94B 3X11B 1OCWL 1H3XA 1IQWL 2CRZA 3RWDB 4LPWA 2APFA 5DGQA 1MI5A 5D1ZD 2W0LA 3X17A 1ZSDB 3PIQB 2GITB 1TFHA 2VQUA 4YC2B 2BY2A 3T0BA 3RU8L 3EFDL 3MV7D 2KUTA 1ZT1B 4MLSA 4NJ9H 4Y2DC 1CXHA 2PYED 2EDYA 3RGVB 5GZOC 4NYLB 1IGJB 3QUXA 1F4AA 5EU7C 1KCSL 4NRYB 2FL5A 5ADPL 5ERWB 4OUOA 4XNZB 3IGAB 5KN5A 1BIHA 3RFZC 1ND0A 2H2SC 3VXQB 1L7IH 3ZO0A 3T0EB 2WUBH 4X9FA 4KJQD 3AS2A 5GGQH 3A6CL 1G7JB 3LQZB 3D25A 1YEDA 3LOWA 1WF5A 1M1SA 1A9EA 4URTB 1SHMA 3RI5F 5B4MD 2MCPL 5DC9B 3P4NA 3SE4C 1HINL 3OKNA 4PJFB 1MVFA 4N0FB 1RJLA 2H8PB 1F8TL 5I1IH 4U33A 4M62L 5EBMB 1NANI 2ZCHL 3P3YA 1WC7A 2VDKL 3NA4A 4LQFL 1DE4A 2BOCB 5FYKE 3G6DH 4XPHL 1G6RL 5DHVH 4Y88A 3GSXA 5JXEC 1QBML 1NCWL 1OB1A 1MIEH 3C60B 3MNWA 2ZOLB 3FOLB 1LMKA 1TMCB 4BFBD 3C5SB 1QYGL 3CXHK 2X70B 4LASH 5GSVA 3VFWA 4MMXC 1T7VA 4PB9L 4XAWH 2GSIA 2BMKB 2WWMD 5KSVB 2LAGB 1QFUL 4P3DB 3TBVA 3FB6A 3RHWF 3H3BC 1GH7A 5LQBH 3TFKD 4JFQA 3VGDA 1PX4A 2DQJH 1H15A 2ZUXA 4P2QB 5I75B 3ULVF 3VFTA 3GI9H 4A6YB 1Z3GL 3PJSA 4AY0A 1LO4H 1UJTA 1YN7A 2Q86A 3WIHA 4Z76A 3RKDC 1CGTA 2DQDL 2ZNXA 5EWIH 4KRPB 3IU4H 3HAEA 5TDPA 3QJHB 5F97E 5I74C 1A2YB 3K8MA 4JZJA 4O2CA 4BKLA 4R7NA 3C60D 3TF7C 3CPLA 4LCCB 4PB0H 2NY7H 1QFWI 2VOTA 4K94C 5IB3A 1WBXA 5E99L 4JO4H 3N1MC 5MEPA 1X6NA 5AUMA 4F7EA 2XWJA 5I1GH 4IOFD 3UJIH 2Z31A 3GMRB 4Q7DA 3H9SA 4D8PB 1FE8H 3NCEB 1PYWA 1UA6L 1DEEA 1KNOB 4XPAH 1A7RL 5JQHC 4U1HA 5CMAB 1U8OB 4OLXH 4O02H 1YNKH 5ID1B 3PV7A 4EUPA 4YE4L 4K7PL 1ZANH 1CD9B 1ZHBA 3GDBA 2BRRH 4KRPD 5D93C 1UEMA 4F57L 1IAKB 2BVYA 2AJUL 5LXGL 3K8LA 3ULSA 1D5IL 1I1AC 1M05B 3MLUL 3VWJB 2X6MA 3MGOB 4LQ1A 2BJML 4MSWB 2HRPL 2PCPA 2GAZA 1SQ2N 1WICA 1KCLA 2X1XR 5EZJA 1JJUA 1RQ5A 3MBED 1CL7I 2G60H 5H35A 2I9TB 1GC1L 3Q6GL 3MRMA 2DKSA 3D69A 5FIEA 4DCQB 3U9PH 3L9RA 5D1QA 5H2BA 1TJHH 4Q9QH 1JFQH 1X5ZA 1Z5LA 2XV6B 3BUYA 4HULB 4G8FA 2A0LD 4KJPC 4ZSOE 4XXDB 2DQIH 1KTLA 2VDML 4KI5C 3V0VB 3BKYH 3VXPB 2VAAB 4EQ3A 4X6BA 2ARWA 1U0QA 3ET9F 2A6IA 3OAUH 5BO1L 3KPSE 1MF2H 4P2RA 5JOEA 5JO5B 2XZQL 4PRHE 3SKNB 3C5ZB 3H9YA 3VRLE 1I7RA 1YN6B 2BSRA 3N0PB 3QCTH 3RVWC 5FYKD 3TIEB 1RVFL 4OIIL 4RGOH 3O6FA 5D5MF 3L5JA 5GISH 4XNYL 2E7MA 4MD5B 1BZ9B 4ZUSB 4QEGA 4KKNA 5F9AC 1M71B 3QQ3B 4AL8H 4U1IA 4PD4K 3L5XH 3QXDB 3MGTA 4G8GA 4OM0H 3MRQA 4KTDL 4U1MB 3QWQB 4FQ2L 5JW5A 2RFXA 5F6IC 3LN5A 3S36X 2BNUA 1RIVH 2FO4A 5D7IA 1BFOA 1JHTB 5E9DB 2XRAH 2WIIA 2FBJH 4P2OC 3EOYG 1II4E 3RWJB 4TTDD 5C0FB 6FABH 3C5ZD 4X4ME 5HHNA 2BOBA 2FECI 5CIPA 1DVFA 4I18B 3FONA 3MV9A 4FN0A 2P8PA 5HHXL 4X9HA 4LCWA 2HJLB 5DJCA 1FZJB 2ADIB 1A6VH 1DBKH 4HV8A 3HE7B 1ZA3A 4YHKL 1T5XB 5FB8A 5J1TC 1U8JA 3OKEA 1IKNA 2VL4A 1FP5A 3PWUB 1FH5H 3SGDH 3BVNA 3V95A 2Z93B 4YK4B 2PW1A 1I8MA 3I50L 1ZA6A 4HCRA 5F72S 2XKUA 2QQNL 3I2CH 4G6AC 3KPNB 1WFTA 2V2WA 1BBJA 4LAJH 5IB1A 2ENSA 2G9HB 2OP4H 5E9DD 5IB5B 1AO7A 1T1XB 3PP3K 1PG7H 1A3RH 2RCSH 1OGTA 1QLFA 2Q7YB 1T1ZA 1HQRA 3IRZA 3WEXB 3ZKSD 4ZSOB 4CDGC 2ED9A 4ZUUB 3NABL 1QFWH 4NO2A 2PETA 4DEPC 1EFXB 4RA0C 1U58A 1A14L 3O3EB 2GYSA 2VKXA 3KPSB 1C5CL 2NLJA 3IF1B 4PRHB 1G7PA 4PY7A 1JPSH 2R1WB 1QR4A 5SV3A 5D96C 4LIQH 3W0WA 1Z0MA 1NL0H 5BVJB 3OAYK 2NY1C 1S7WA 2JK5A 4Y5YB 4FMKA 3OF6A 3N50A 1K9TA 5FDYA 1FORL 4PRIE 1S9YA 1BIIB 5FM5O 3TT3L 1I8IB 4UQ2A 3DLQR 1MEXL 4HIXL 2E7CA 4BQ8A 1OP3H 5HGDB 1LEGB 1U8MB 1EFXD 4R96B 3V5HB 5ALCH 4CMMB 2F8XC 5J3HD 2NX5E 1CL7H 3KPSD 4PRHD 4Z7NE 3ARSA 2IMNA 2BNQE 4MX7A 5F3HA 3WD5H 4UDUB 4M43H 4X4YB 1U8PB 5JHDA 2JELH 1KCVH 1MJ7H 4IMLA 4QTIL 1WBZA 5CZVL 4F8QA 2Z8SA 2IAMD 2VERN 4G9FE 2HVKA 4OV5B 4OZGE 4HAFA 5DZNA 3Q1SH 1KCUL 4JY5H 5DXWA 3BKCH 5M95B 3I9GH 4XPTL 4LRIC 4YBQD 4G7YH 2EDJA 1QTYT 3ZKXB 3OAZK 5BW7C 3MRKB 2VR5A 4PPTA 1MWAA 2FJFA 3L6FA 4J3OC 1XF2A 1XEDA 4EXPX 4B50A 4X6FB 4WNQB 1X44A 2J1KA 3T3ME 3GB7B 2VC2L 3TT1H 4M6AA 5B22A 1B0GA 1MRFL 4NPYA 3PP4H 1RHFA 2NXZB 4R4FL 1AGCB 1PAMA 4RIRA 4LU5H 2R0LH 3F7YB 1Z6JT 2EO1A 3MOBH 4TULL 3MR9A 4PGJA 3MRBA 1OT1A 2VDLH 3F62A 3TP4A 4PJDF 5EU5A 5C0BE 1MJUH 3T2QA 4CVUA 5FGBA 1MHPH 4ZO8A 4HWEH 3AB0C 3G9AB 1XF4A 5CGYC 3D2UB 4HK3N 4DW2H 3QEQE 1KIPB 4JFXA 3GBNH 1UJ3B 2J12B 2VDNH 1EIBA 4PRIB 3DURB 1CFSB 1PG7W 3MLWH 5E03A 4XBGB 1U2HA 4HEME 4LSVH 4Z7VA 2M8XA 4HIEA 3C09B 1QKZL 5D7JA 5DD3L 4ZAKC 5FOJA 4Y5VA 1T0NA 4L9LC 3A67L 4XP5L 1A4KA 3HMXH 4M6OL 4EKXA 1QNZH 5K9OB 5CBAB 4IOIA 3JTTA 4PJCF 2ERJC 4TRPH 2NX5B 5JOFB 1I75A 4JB9L 1MAJA 2BY3A 4TUJA 5C0JB 4R26H 5JPNB 2VZ1A 2XQYK 3B2UC 3ZSTA 4JKWA 2BNQB 5JOPE 1MCLA 4LSRL 4BH8B 2V5MA 5DMIH 2FNBA 4KH2A 2CGRL 1QSVA 2FCBA 3LV3A 5HBBA 1NAKH 4R3SB 4G9FB 1WEJH 2OK0L 4HHAA 4LVOB 4WWKC 4RDQG 2IWGA 3IU3B 3MJ8B 4PRID 1IEBA 2P5EB 2APTA 4OLUH 3FQWB 1PSKH 4H5SA 4HUUA 4K3HA 2HT3D 3OG6B 3CSYB 4R4ND 1X5XA 1XGTA 4BH7B 1YNTB 1EAPA 1KC5L 5J1AA 3BP5A 5I2IA 4NQSB 5DDHA 3EDKA 3LZFH 2NX5D 3G04B 5JXAL 1HDMA 4HJGB 3UTOA 1TVHA 4ZG1A 1X4XA 2DB8A 2DQUL 3NIGF 2GFBA 3BN9C 4HS8H 2BNQD 4WEBL 4HKBA 1UCBL 4NQVA 3PWPE 5LBSL 1NCTA 4JDTL 4M02A 2Y07H 4XVJL 1J1PH 4H8WL 2YWZA 2DWEB 4Z78A 4G9FD 4WW1A 1QLRB 4NWUH 4HUVB 2BVTA 2P5ED 1R0AL 5C0BB 4UT6H 4WRLA 4RAHA 1JGVL 3WUWA 5DI8B 1ZHNA 3UTZB 5CP7B 5TDNB 4NN6B 3QIUA 3C2AH 1MFAH 5IT2H 2AJ3B 5CCKL 5AZEH 2Y7QB 5C2BH 1R3KA 4W4OC 5LGJB 4ZXBC 4ZNEE 1FL5B 5LKNA 4AIZB 4JZOB 2R23B 3FB5B 5FK9A 5JNYB 3STBA 3RVVD 1PFCA 2QL1A 1PGRB 5EU7E 3HAEG 1J1XL 1IGTB 3VGBA 1AQKH 1GZPB 1EPFA 4YFDB 3WXWL 5C7XL 3IJSB 1OPGH 3ARDC 2H9GA 5C0BD 3MV8E 5C09E 1TPXC 3HUJF 1F11B 3FMGH 2Q87A 3C5JB 2XXCB 3ZE2F 3O8XD 3CFBA 2BSSA 1FHGA 4EOWH 3QEQD 4BK5A 1OSZA 3LS5L 5EZOH 1S9XA 5FDWB 4M5YH 3OSKA 4MAYB 2DLFL 4PR5B 2DLHA 1CT8A 4NT6A 2BHZA 2AI0L 4M6NH 1I8KB 1F90H 3ZKND 3Q3GB 3SDYH 3E6FB 4Z9KB 4OD3L 2JJWA 1NAML 3QAZC 1C7TA 2VSCA 3FOMB 4JGJA 4FQIH 2G5BB 1A1OB 2DYPD 1IC4H 1XR8A 5GGRB 1FNEB 1K8DB 4KZDH 1CK0H 3ZKMC 5JOPD 4JHAH 4PJ7B 3T0AA 3PWPB 4G6JL 1VHPA 5CLWA 4WGVB 4ODSH 1FVDB 4H20L 5E8PB 1DQLL 3SY0A 3ZYJA 3CFCL 4HPOH 4Y4HC 3U0PA 3RIAK 1C5BL 1JGDB 3QUYB 15C8H 3LAFA 4FZ8L 4GKOA 5IJKA 4OM1L 1Q9OB 3MBXH 4MAYD 1H8SA 4FQLL 4XX1E 4YXKL 4MJ5A 2EECA 3PHSA 4BUGA 1EEZB 2PO6C 3MO1A 5BMFH 3QA3B 3RVXD 4ERSH 4CVZB 2PTTB 4ISVA 2AXHA 1X5YA 2HLAB 3RTQB 4ZS6C 1D6VH 3BQUA 3BISA 3X12A 2EKSA 1HCFX 4R0LB 4KGJA 4KJYB 4J1UA 1JPGB 4UTBL 4WV1C 3PWPD 1JTPA 5D72L 3C9NB 2FB4L 3GMMA 5J9PB 1KYOJ 5BVPL 2DLIA 3I02B 4FZEL 3G5ZB 1ZKAA 4RFNC 3QUYD 4NRZB 2V2XA 4I3GA 3V52L 3GMOA 2ZSVB 3QZWB 3CH1B 1U42A 1XCTA 4HFUH 4HKZB 4D0BB 3BAEH 3BZDA 4DK6A 5KSBF 3P4LA 4HC1H 4F7TA 3ULUH 4N90D 3O3BA 2A9ML 1JVKA 1KTDA 2VLJA 5L9DL 1HNGA 3W9DB 5F3BB 4PTUB 1Q1JL 1KEMH 1U3JA 3DSFL 3RTQD 1AHWC 3SDDB 1PJ9A 4AEEA 1S7QB 5CJBA 2J8OA 1FNSL 4Y1AE 3VH8B 2H32H 4Y2DD 3O4LE 4TSAL 4LSTH 4K3JL 3WS3A 5GZOD 1XH3B 4LSPL 1URLA 4PLKC 3MXVL 2WP3O 3OWEA 2HVJA 3WFCL 1JZ2A 1S7VA 2CR3A 2OTWA 4P4KB 1HHHB 1RZJH 1FFNB 5AYUL 1RJYB 1MREL 2XNAA 2VDOH 8FABA 4RAVA 1U8IB 3EHBC 1BWMA 3MV8D 5C09D 3P40A 1YZZA 4ZO6A 2MKLC 3C87A 1R5VA 4MQ7B 4NZJA 3DIFB 3ARFA 1R3IL 3U4EA 4OLEA 5EC1A 5KS9A 1KJ2A 4OFVA 3DBXB 4P5KB 5TF1L 5TE4H 2WQ8A 3H0TB 4KI5E 5GHWH 1DBAL 5A3ID 2AK4E 3RL2A 4ZUVB 5I16A 3VXNB 4F58H 1CE1H 4RDQF 1JHKL 3SDDD 3NPSC 3WLBB 1ZT4B 1P53A 1TTUA 1UADC 4G42A 2VSDA 3WNKA 2ATKA 1LWRA 5EOCJ 2X4QA 5C86A 5EUOB 1AGBA 3NFPB 5DO2C 1J8KA 4PJIA 3LQMA 5D2NC 3OGCA 3DVIA 3UXFA 5I74B 1HZHH 1SYSB 1LO5A 3GSWA 5D7SH 3HG1A 4ZDHA 2L7UA 1P7KA 4LEXH 4HJJL 5C6TH 2YD7A 1IILE 4OZHA 4Y16C 4HEPG 4N8VA 1JNLH 4ODXB 1G9MH 2DD8L 2GJZA 3N85H 4PP2A 2C4FT 5HYQB 1FAIL 1UB6B 4Z95H 1M6OA 4OGZA 1OAQL 1CFVH 3SGJA 4NHCL 4Z7UE 3BZ4A 4NKMB 2HFGH 2DM7A 1NDGB 5GGSB 1XGRA 2O5YH 5F7MC 1Q9KA 3PP3H 1LEIB 5IMKB 3CNKA 3D39B 1RJCA 4NM8L 3RUGB 5FKAB 5CEZL 2DOCA 4HH8A 4CW1A 3EYQD 3PDGA 4XP4L 5ITFB 3MZTA 1N4XL 4LLWA 4R97C 2HFEA 3PDOB 3TPUB 1IL1A 3CUPB 4K71C 4GO6B 2DWDA 2DBLH 1YC7A 4MA1B 1DBMH 1A64A 3BIAX 4JY4B 4X7TA 1JK8A 3DV4B 3F6LA 3TVMB 35C8L 3K2MC 2IPUG 1D9KB 3WFBL 4KHTL 3JV0A 1UWEH 3BMWA 3KPLB 1S3KL 2OR9H 4GUPA 4NC2B 5IMOA 3OAYH 5CUSH 1F42A 1D7FA 8CGTA 5IWLA 4DGYL 2VZOA 3EAKA 4DUXA 2AEPH 1RZIB 1A1NA 5ADOH 1T7WA 1BREA 3F58H 3MRNA 4HF5L 4NO0B 2J2ZA 3IDGB 4MLIA 1TDQA 4HUXA 3K4DA 5T1DH 1I1AD 1MNUL 5DVLA 4X6DF 1NC4B 4L3EE 3V5KA 2IPUK 4GS7C 4W4NA 3DRQB 4Q2ZA 4Y1AD 5DMKA 3LKOA 3O4LD 1I7TA 4HLZH 1DR9A 5GRUH 5JLZB 4I48A 3S3SA 5BV7C 4JANB 4XH2A 2N7AA 3IVKB 1IGYB 2KPNA 5DYOB 1N6VA 2WBJB 4OFIA 1GPOH 4WI8A 2PXYA 3GZKA 5HGBA 1WWWX 3UYPA 1UM6H 1F4WH 4LARH 4KKBD 4KI5D 4S10A 2AK4D 4Z0XA 3QXAB 1NC2A 3QR2A 3DPBA 2DTMH 1G6RA 1W8NA 1OAXH 4Z7WA 2NNAA 5JPMA 3QNXB 4M61A 1MELA 3OAZH 5DR5H 3RA7L 3WLWC 3MMEA 2YSSA 1LDPH 5JA8B 1K6QL 3RVWD 2B4CH 3EGSA 2FX8L 2GW5A 3EOAB 2LVEA 5FGCE 5HPOA 1F6AB 4BZ1H 2NY5H 4J3XA 2EE9A 3QUXB 1KXVC 4P0DA 3WFDL 3LRSA 1LO3L 1UENA 2G2RA 3QB7C 1VADA 4HMCA 5D7KE 4WGWB 4X8JA 5JZ7D 2OR7A 5GS0H 1O7VA 1VEPA 5EC2B 3GM8A 1ND0B 5BV7L 1P9MC 4P59H 3SN6N 3WL9B 4XP1H 5ANME 2KQMA 4XCFL 3LKNB 4RMQA 3ZDYF 2AEQL 1OTSC 1GGCL 3D25B 1YEDB 2JCCF 4JFHE 5E94A 1A9EB 3O6MH 4P2OD 1R3HA 5JR1L 4QRPE 4PJ5E 4LOUC 3OKNB 1SYVA 1RJLB 4E42B 1WAAA 2IBGA 4KROB 4D9QE 1U3HC 4OD1H 3AU1B 1WC7B 3ALPA 3O6KH 1DZBA 1DE4B 2DI7A 3WIIH 3WXVL 1WGOA 4PUBH 5GIRA 2A74A 1OLZA 3DRTA 3QO0B 5KAQG 5DEZA 3GSXB 5FA3A 4L3EB 3CLEL 3DTXA 2XKSA 3HE6A 3H9ZA 4HK0A 2AJYH 3LEXA 4EI6A 1A6ZB 5B8CC 5EFIA 4FMFA 1PKQA 1VDGA 3KHOA 5LVEA 3DX6A 3VFWB 2CRIA 4M03A 5KANG 2C5DC 2W9EL 3WHE0 4UV7L 4XT1C 5KVEH 1UM5H 3TBVB 3SCMA 3FB6B 1IGCH 3FB7B 3P9WB 4JFQB 5SWSA 4B7IA 4ZFGL 4TQEH 4UNVA 4PGZA 1BOGB 2UZIH 3KLSA 1YNLH 2HJFB 1J8HE 5DD1H 3V7MA 3VFTB 3PJSB 1YN7B 4ONGL 2Q86B 4Z76B 2RQ8A 3UDWA 3GKZA 1Z9SA 2R56H 1UZ8B 3S98A 3NTCL 3TEUA 2E7BA 2EC8A 2MJWA 3D5OF 4KPHH 4L3ED 4O2CB 3MOQA 4R7NB 4OLZH 3CPLB 3GSQA 1EDQA 4NN5C 3MZGB 5FGCB 5BS0E 1CDIA 2NY1D 4NCC1 2Q8BH 4LLYA 5MEPB 5MI0C 4PP1C 4MZ3A 4HKJB 4Z8FL 4JDVA 4F7EB 2XWJB 2WMPA 2Z31B 3H9SB 2W9DL 5FCSH 4K2UL 1PBYA 4XVTL 1PYWB 1DEEB 2X4NA 1ZVHA 3IETA 3VG0H 4O5LH 5IHUL 3FRUB 5C0IB 2Z4QA 2J3SA 1RIHL 4EUPB 5D2LF 5TFSH 1JZ7A 3TA3C 3MV9E 1FLRH 2XTLA 4H25A 1ZHBB 1ZTXL 4GAJL 2DICA 3VDCA 2ED8A 2XWTA 2FHCA 3FT2A 2P1YA 3ULSB 5DUPH 4ODHH 5MENE 1W0VA 1KT2B 4HXBL 4P23C 4G9DA 1K2DB 4FQXC 5INCB 2X1OA 1OLLA 1KN4H 4S2SB 5C07E 1N3NA 2UUDK 3RDTC 5D7KD 5CINH 1NEZG 4GJTB 5EA0H 4OJFL 4LCYB 5H35B 3X14A 3MRMB 3B9DA 1YEKH 3BDYL 3D69B 4LRNH 5T1LB 5I71C 3QDGE 3L9RB 1HOCA 5D1QB 5H2BB 3LEVL 4H1LB 4XMPH 1Z5LB 3BUYB 4BUHA 4G8FB 1FZMB 5AD0A 4P49A 4X9BA 4H0IA 4K9EC 4JFHD 1KTLB 3L7FB 1FFOA 1QD0A 2ZPKH 3AY4C 4X6BB 1KBGL 4P2CG 4M00A 4QRPD 3O2WH 4PJ5D 4ZD3L 3O2DA 3WIHH 1VGEH 4P2RB 1UH4A 4X7FC 5DK2A 2EDNA 3MCKA 3HAEH 1YQVL 3TZVC 1J8HB 2AS5M 3HI5H 2BSRB 5TF0A 4L29A 4HIIA 2BNRA 4WENB 3O6FB 3TBSA 4YQXH 3L5WA 5KSAA 1MH5B 1X5HA 1WWCA 2YXFA 4JM2C 1G1YA 1OVZA 1H0DA 2VE6A 5T1LD 5BS0B 3MGTB 5CGYD 1HH6A 2C4XA 3MRQB 1VKXA 3OJMB 3P0VL 5J11C 2HG5A 4LLUA 5JW5B 2RFXB 3LKPA 5TJWK 4KQ4H 3TJEH 2FO4B 5D7IB 1BFOB 4EUPH 2F8VA 1NBZA 1WZ1L 4TPRH 4ZAKD 5CGMA 2ZUWA 3VGGA 3IDXL 1YEHH 4P2RD 4DUVA 1L0YA 2DI9A 4GBXC 1J8HD 2O5ZH 5HHNB 2DL9A 2NY6B 5CIPB 1SBSH 3FONB 3MV9B 4WU5A 2P8PB 4NQEE 4XC3L 1QVOA 1IAIL 4LCWB 4PJEE 3HZYB 5DJCB 2FJGB 4IRSA 2VB5A 5K9JH 4HV8B 4Z7VF 1ZA3B 5JW4M 5FB8B 5MENB 1U8JB 3OKEB 1WSST 1MCQA 1FO0H 3MV01 1CDCA 1CXFA 3D0VA 3UZQA 5BS0D 4PBVC 3MQIA 5FUOL 3BVNB 3LKRA 3AVEA 4IRZH 5LGHL 4BSWA 3KPOA 1XCQA 2V2WB 4QHUA 1BBJB 3CMGA 2QEJA 2ZUUA 5IB1B 4NN7C 4L8SA 1T83A 3DX7B 4HKXA 3CVHL 4EXKA 2GI7A 1RJZA 5C0GA 5DJ8A 3EDDA 1OGTB 1QLFB 4M7ZB 1T1ZB 1HQRB 5E2TL 4MA7L 1WWAX 4LSSL 3MV9D 4MS8C 2V5YA 1TZHB 2Q1EA 3CX5J 4JDZB 3R8QA 2LTQC 1UXWA 4JFZL 1IGIH 1CFTA 2PN5A 1RUKL 1EX0A 4LCIL 5MEND 3VD9A 4S1RL 1G7PB 4PY7B 3HNSL 1I7UA 3DX8B 3FCTA 2YPVH 3W0WB 1OAUL 2DKUA 5I1LB 2X09A 2HA1A 3U4BH 1S7WB 2JK5B 1OGAE 4XPFL 4OCWL 5KAQF 4X7SH 1AJ7L 5F1NB 3VFPA 43C9A 3QDGD 1LO0L 3EOBB 3HB3C 1BPVA 2IANE 4UQ2B 3VG9C 2YPLE 1K4DA 1NBYA 3L95A 2E7LC 1TZGL 2AJVH 2NPLX 3LDBC 2JJSC 4ZXBD 4DFHA 2IALA 5AZ2H 3RAJL 1BVLA 3QI9C 1ULVA 1FGVH 1R24A 2YOCA 5D70H 1WV7T 4F2MA 4MX7B 5F3HB 1QQDB 3HS0A 5J89A 3FKUS 4NQEB 1U6AL 2FEEI 3L5IA 4IMLB 1FNFA 4PJEB 2AV7A 3NCBB 4M5ZH 4JRXA 3ARDD 2CQVA 1QRKA 3MLYH 4PJHE 2HVKB 3VRLF 3QRFM 2RIKA 3ROLA 3GSVA 1AI1H 5HGHB 2JIXD 4HCRH 1IT9H 4Y4HB 3S9DB 1NCCL 4FP8L 3E8UH 2NY4C 1SEQH 3D3VE 3QULA 1M7IA 4RGMB 5E5UB 1JNHA 3C6LC 2FJFB 2CK2A 5IEKA 1CBVH 4U6YA 5ENWA 3HNVL 4XNUL 3MLXH 3Q48A 1MCJA 2PO6B 4C83A 5HYSA 3WN5A 2Z0BA 3R06A 3T8XB 4K8RC 5CEZE 2W1NA 4NPYB 1YY8A 3A6BL 4RIRB 5D2NE 2HTLC 4NQED 3MOAH 4PJXA 3VJ6A 4J2XA 2GY5A 4NM4L 3ZKMD 4GXUM 5HHOA 4TUOB 1JNNL 3MRBB 5D71H 5IHZA 2AQ2A 4TUKL 4JR9L 5EU5B 3K2UH 4Y89A 4Y4HD 4RFNB 1RIUH 3T1FA 1FCGA 3NZHH 3O3AA 3F5WA 4JFXB 5HGGS 2BSED 4NNYA 1JGLL 2PO6D 3MODH 3OB0K 4JHZA 4HIEB 2VXSH 3F7VA 3ZYOA 1P7QD 1YJDC 2IF7A 2VDPH 4QXGL 1T0NB 4HWZA 3IDIB 4OF5A 4ZS6D 5F7WC 4ORZC 3GMPA 3MRJA 3JTTB 1OHQA 2BVUA 2JB5L 2XG4A 1UH3A 2OCFD 5MHSE 3HC4L 1HIML 4MVBC 2CR6A 2FYYA 4XI5C 1A4JA 3LV3B 3QEGL 3V6BR 4M7KL 1OGAD 1LILA 5T3XH 4HHAB 1H3PL 7FABL 1PW3A 1A02N 4GRWE 1ZT7A 4FXGB 2YUVA 1LEKA 1MWAH 2LVCA 3ZDZE 1DBJL 2IAND 3I3DA 1FDLH 2YPLD 5DD5H 3KDMA 4EDWL 3BP5B 2NW2B 3NPSB 5DDHB 4QGTA 1E0OB 4TVSa 1RV6X 3QJFB 1F4XH 1T21A 1MFCL 5GZND 1HDMB 1MVUA 1YJDL 1TVHB 5FO9A 2DQCL 4LLDA 2OXGA 5KTEH 2GFBB 4KTEL 3TN0C 4CN1A 1E4WH 2IBZX 4NNXA 2I5YH 4OZFG 3CLFH 4RMRA 4WW2A 1AKJA 1F4HA 3VFUA 2DMKA 2OI9C 3MUJA 3HCVA 3V8CA 4RWHA 4L3AA 5DFTA 4Z7NF 1RUPL 4ODVH 4ZS7L 3EHBD 1KN2L 1ITBB 3P11L 1MOEA 3FO2A 5D8JH 3EZJB 1P4LB 2AXFA 1QLEH 1CZ8L 4ALAH 3VA6A 1ZHNB 3D85A 4ELMA 3VRIA 4OZGF 3D3VD 3S37X 5GS2H 4XX1G 3QIUB 3K74B 2FX7L 4MQXC 1NFKA 2UWEE 1A3LH 4DGVL 4FTVE 1R3KB 3O9WA 4KXZI 3S35H 5C70A 5CEZD 5DEFA 2X41A 5I1EL 2C26A 3IRPX 1OW0C 2W91A 2KL6A 4PRPE 2MQCA 2VXQH 5FK9B 1T5WA 3TO4C 2XTJC 1JL8A 4LSDA 2GY7B 2MMXA 5SWQA 3MLPA 2VISB 4JE4B 1C5DA 1NMAH 4CU8A 5IIEA 3MNVA 2A77L 3U1SL 1J0IA 2HKHL 1BFTA 1PEWA 1JWMA 4R97B 1WFNA 4Y16D 5EO0B 3A0OA 4K71B 3KJ4C 5DA0B 5DRWA 2VLJE 1F4YH 2VXUL 1X5IA 3RZCC 3CFBB 2BSSB 3QIUD 5D9SA 3QO1B 4GRWB 1T3FB 4WO4A 1S9XB 5CJ8A 1U36A 1N6QL 1BQSA 5DJDA 4UB0L 1CT8B 4NT6B 2W0PA 4JG0L 1JWSA 3RY6A 1S8DA 1CFQA 3LH2L 1KACB 5KSUA 4M7JH 4EN3A 2GQHA 5ICZA 4XCYA 4G43B 1RUML 2OL3A 3AFLA 1EZVX 2DL2A 1A6UH 3KPPA 5JTWA 4LF3A 5IVXA 1VCAA 5GGTL 2EEDA 1IEAB 4UOW1 4DN3L 4OGXL 1XR8B 1JGEA 4JO3L 5MHSD 5F88B 1Y6KR 2D2OA 5ILTH 1I9JH 4JFOB 2H6PA 2J5LC 5HI4D 4F33A 4MNQE 5KVGL 4HBCH 2J8UE 3SY0B 2IPKA 3F6IA 3U0PB 3UTPE 1FG9C 1A5FL 4PGDA 2CRYA 1A8JH 4HT1L 5CJXC 3SGKC 4PRNB 5I8CA 2XQBL 5HYJA 4DN4L 4MJ5B 5I15L 2LV4A 2X1PA 5D6CA 4RBPK 1N2RA 25C8L 2X40A 2P43B 4GAYA 1NBVH 2XXMB 4ISVB 4F9LA 3EOTL 1AXIB 1TJIH 3BIKA 3UBXA 2EKSB 4J1UB 2Z35A 5KVDH 5BZDA 3BKMH 2UV3A 4PRPB 1FSKC 4DQOH 3MLVL 2ZUQC 1I9EA 1I4FB 3GMMB 4M1DH 3Q5YA 2HJKA 3N9GL 4Y4KA 5LAXB 2O5XL 1X5LA 2R29H 1NCAH 3FN0L 3MRGA 1PX3A 1U8QA 4KHXH 4CNIA 4YGVB 5I1AB 4UDTA 3GMOB 4OCRL 5FYJE 3RX5A 1XCTB 3MXWH 1G9NH 3FB8A 3H42H 3O3BB 1NCDL 2UUDH 1KTDB 2VLJB 1UC6A 1SM3H 5HYEA 3EYUH 4QHNA 4Q9CA 4CL7A 1EMTL 3C08H 4ZUWA 2R0ZH 4FTVD 5CGTA 3DHJA 5IFAH 4HWNA 4M8QA 4MJIE 3QDJE 4PRPD 4NJAL 4PJ9C 1G0XA 1CU4H 4KZEH 4PJAA 1G84A 2OTWB 1KCRL 3SKJL 1YPZF 5L2JA 4KQ3H 3ZT5A 3TIDA 1MRCL 3EYVB 4RAVB 4KXZH 4OI9A 5B8CB 4V1DA 1W2KT 4ONHA 4MNQB 4V2CB 4FG6C 2Q7NA 2VLME 3ARFB 1UXSB 5KS9B 3MC0A 1OTSD 2VLJD 1VGKB 5E5MB 3RL2B 5I16B 1RZ7L 1HKFA 1HYRC 3DMMC 4HIJA 4LOUD 3S5LA 3FO0L 3U2SA 3VXUE