3QZMA

Staphylococcus aureus isda neat domain h83a variant in complex with heme
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
124
structure length
124
Chain Sequence
MSQATSQPINFQVQKDGSSEKSAMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-regulated surface determinant protein A
publication title Iron-Coordinating Tyrosine Is a Key Determinant of NEAT Domain Heme Transfer.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Metal binding protein
total genus 33
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qzmA00
2H3KA 4YMPA 4H8PA 2O1AA 4MYPA 5D1XE 3SZKC 3QUHA 4FC3E 3SZ6A 4WJG3 4NLAA 2O6PA 2ITFA 3QUGA 3QZOA 3QZPA 2MOQA 2Z6FA 2K78A 5D1QE 3QZNA 3RURA 3S48A 3VTMA 4H8QA 5D1ZI 2Q7AA 2ITEA 3RTLA 3SIKA 3OVUB 3VUAA 3QZMA 2E7DA 3QZLA
chains in the Genus database with same CATH superfamily
3MMEA 3MGTB 4PR5B 5IOPA 3BAKA 1JGEB 5SX4H 3ZDZF 3A4AA 4O58L 2FD6H 1QSZA 3LHPL 3O3BB 4GIAA 2ZZUT 5IB3B 2Y7OA 3QYMA 2XKNA 4HUCA 2Y24A 3VI4E 4C59B 3FO2A 2J4WL 3PWVB 3KL3A 1BVKB 2PYEB 4U2YA 2O6EA 4HIPA 4RMTA 2NY7L 1OD7A 1UJ3C 3SYQA 4M5TA 4FQPA 5IREA 1WGVA 1QFUL 2GI0A 3LV3A 1SY6H 4KUCF 1ILSA 2FJHA 2HKFL 1QLFB 3GLEA 4MLIA 4S1DD 2KYIA 2VH5H 2APWA 4J3OC 5GIRB 1GH7A 3BIKA 1VADB 3MRGA 3BDYH 1U8LA 4LCWE 2E7LC 1JP5A 4HJ1A 4OZGF 2Z1PA 4FTVE 4G3YH 3S36H 1P4IH 1PG7X 1OW0A 3MRLB 4JJOA 1R75A 4NO5B 3UADA 4FNLH 4JY4A 4J3XA 1XCTB 1DDHB 1YHPA 3QJZA 4C83B 5I73B 1MCPL 4X8JA 3F83A 3KHOA 3HE6D 2VDMB 4WTQA 5E4IA 4Z7VA 3BVNB 1PKQE 3MJ8A 5E56A 2OXGB 3IE4A 5EO1A 1XF2A 4WUUE 4NN7C 5IBLD 4BFFA 1T0OA 4Z7NE 1A7PH 2A6KA 2R69H 3CK0H 3DVNB 3WIHH 3VWJC 4HWZA 4PRNB 3FQTA 3SDCC 2EDWA 2R1WB 1HH9B 3LKPB 5JOFB 1XTLA 4RWHA 1ZLSH 5IBTL 5DYOB 2AV1A 2PW2A 3TVMB 3TFKD 4J8QA 4LL1A 3G5XB 3ULVD 2P42B 1QTPA 2UY7B 4IIQA 3MFFB 4YAQA 3WS3B 3BWAA 2XWJB 3OKNB 1PD0A 5EBMB 2A3TA 1VENA 4KMLB 3T1FA 4UQIM 1OXYA 2XQBH 4KROB 3SQRA 1R3IL 1J88A 3ILEA 4LDCA 5FX3A 3NK3A 4YL4A 3GO1H 4PLNC 5I74C 2ENJA 2VDKL 4UQAA 3WIFB 3PV6B 1TJXA 1QBMH 3BZFB 1U58A 2P3YA 4QHUB 2HA1A 3T0BA 4B5ZA 2Z4QB 4H13C 2Y1YA 5F8QC 4L3FA 4EN3A 3TN0D 4I48B 3NCJH 5F7AA 2VQTA 4C8XA 1I7RA 2EH8L 3D4CA 2DWDB 1ONQA 1OF2B 3SGEH 5F0MB 4WI9A 3FTGA 2ZP9A 2AC0A 4WW2B 3CH1B 1N8ZA 4LE8A 5JHDD 3KPSA 4L9LC 3HC2A 4ZFOL 4Y4FC 1MHPH 4X4MA 3PAYA 1BIIB 2CRMA 4BELD 1KGUA 3BE1L 1QI5A 1V55B 1G7IA 3VVVA 1G87A 5BQDA 4KJQD 3L2MA 2DOCA 2CKBH 2HKAA 4IU3B 1Q9WB 3T0EA 3JT0A 4ISVA 4ZODA 4POZD 4CBZA 3KWWA 3GMLB 2PXYC 1T2QL 5MENA 1YEFL 2OV0A 1T7YA 2BCKB 4HEME 2YHGA 1XGTA 2AQSA 2XN9B 3CFTA 3GMNA 3QIWB 1MW1A 1L9PA 3UCRA 4P9HL 3C60B 3U6XS 3RWCB 5MEOA 1UD8A 5E5UB 2QSTA 4YEFA 2A9ML 5KSUB 3PL6A 3EDKA 2JQZA 3P30L 1TEGA 4XXDA 1BAFH 3VXRB 1SDYA 2PP7A 3BT2L 4RGNB 5F8RC 3IK2A 1BLNB 3KXFA 5AVTB 3HPLA 1DBKH 1OB0A 3BMWA 4WWPA 5KVFL 1F8TH 1BVNP 5AW7B 5FECB 1BQRA 2OL3B 3HC4L 4FLRA 1I9EA 4MBRA 1XH1A 1YYMH 5C0EB 2GUOB 2V6HA 5AD0A 3FQWA 2ZIDA 2L7EA 4NRZB 1C12B 1CJYA 3SKMA 3ZL1A 4R0LC 2LAAA 3ZO0A 4I77H 4F9PA 3SDXB 5JYMA 3F7RA 3JVGA 5FO7B 1ZLDA 1QQDB 2IFFH 1AY1H 5GZND 4PI2A 1A6TA 3MRKA 4C55A 3QJRB 1A7NL 1M7XA 4OZHA 2JTYA 1A6VL 1TQUA 5CILL 3QQDA 2ZP0T 2Q7YA 4D0CA 1LEGA 1S8DA 2R1XB 4JRLA 2CJTA 1P7QB 1K4DB 3HHRB 3WD5H 3UAJC 3WTWA 1KUMA 3K6NA 5DTFB 3JTTA 4OGZA 4U1HA 3ZOAA 4EIZC 2ZSWB 1XIWB 4C56A 4EZKA 4P06A 1T04B 3I85A 5EU5A 4X9YA 1BX2A 3P11H 3P3SA 3KPOA 4ATTA 4E5XB 3WXWL 5GRUL 5AVZB 3CVHH 4ODWA 2NLJA 3VXPB 4EF3A 3QUXC 2AK4B 4TNVF 3QUMB 3DRQA 4PJBF 1BOGA 3F00A 2VM4A 1QBLH 1VFOA 1KULA 2Y1AA 4GBXD 1FV1B 4FXTA 2X4SA 3LKRA 3BT0A 3GMMB 5GGUB 5L88L 4XCYA 4Q74A 2B59B 3RWJA 1JV5B 1FL3B 3EADA 3KYKL 3LRSB 4IW4C 5KJ7E 1FWXA 3T77B 3MRDA 5DQDL 5CAYB 4FQXB 2GABA 5HY9B 4PJFB 1NGZB 5AL0A 1M3JA 5BUAA 4G43B 4Q0XL 1UWXH 4JQVC 4KTDH 3HZYA 1Z0MA 3HBZA 3GTTA 5E1QA 3ZE0B 2BWDA 2JIXB 3BGFC 3BJLA 5IMKB 1DQKA 1T66D 2DYPB 4JRXA 5GRZA 4L8CB 2CIKA 4PREB 4ODVL 4XCCH 1IM9A 1DBAL 1GJWA 1B0IA 1RZ8B 3Q6FB 4IJ3B 4YBQD 5I26A 3SKOB 4MJID 4I5BA 4CADA 5JHLA 2NR6D 1SMOA 5IESH 1V3KA 3G7TA 3TBTB 2ZWLT 2BIHA 2AEOA 2Y69B 1A3RH 4RMUA 1M1SA 4P4KB 2V33A 3V6ZB 1WZLA 3QCUL 4BFIA 5L2JA 5EA0L 1MWAA 3T65B 3RWDB 3TEYA 1TVHB 5JIIA 2DJUA 4YDLB 5CMAB 3ABZA 4Z7VE 1EHNA 1FL6B 4Y4HD 1P7KB 4ZAKC 3IFNL 3KCPB 4JDZB 5E99L 5ILTH 1XF5A 4G6ML 5KSAA 1G7MB 4OCYH 4YDVA 4CVWA 2FJSA 2YBGA 2FQGA 4QXGL 3P3TA 3RZCD 4HGWB 5AQ0A 3ES6A 4W93A 5IEKA 5HJ3B 5LXGH 3A6BH 2V5SA 3K8LA 3L3OC 5C09A 3FB8A 1EMTL 4FYTA 4HX1A 5EIIG 5BZWB 3QVAA 1AHKA 3O4LB 1MZZA 4F8QA 2AXGB 2X4NA 1E5UI 1TCRA 3CFKA 4WO4C 5JPMB 1NUNB 3PF2A 2MEJB 4N5UA 4P5MB 4Y9BA 5JR1L 4LNRB 2GJ6B 3JWDC 3RTQC 1OANA 1UASA 5DEGA 3CX2A 2V2XA 1OGTB 4KRPC 2X28A 1ZK9A 1WGOA 1CFVH 1S9XB 2BHZA 2GC7C 3EFDH 3K4ZA 5CSZB 3CZFA 3IN0A 3JV0A 1OSEA 1FGVH 4JFYB 3WGUB 2HG5B 1BXXA 3S5YA 1FL5B 4K3DH 1JCKA 3DX2A 5ESVB 4HWBA 2O5YH 1QEXA 1JGIA 2RGSA 5LUMA 3ULUD 4NSKA 3T3MF 3IDJA 3AMLA 2G2RB 1PU0A 3K6IA 3U6RB 3DMMA 2NY6D 3GS0A 4P0DA 1GGYA 3IVKA 2CHWA 2VLMD 3EOAA 2QKIB 4XTRD 2WLIA 4O51A 3PP4L 1F02I 1KB9J 4Y9EA 1HXYB 4ALAC 4X4ME 3KWXA 5C9JA 3UO1L 2JF1A 5TF1L 4AH2A 1DN0A 3EOTH 4X4XB 1B3IA 2B5IB 1NWOA 3WNPA 1QATA 4XVJH 3V8OA 4A38A 2XV6B 3NUKA 1NOFA 3HC3L 5F7KC 3ROLB 3NZHH 3T8MA 5GS1A 1T0PB 3RURA 3CQPA 4UTBH 4RMQA 3T0EE 4RAHA 1JPTH 3HG1A 3APDA 4KZ0A 5T3ZL 5ITBH 5MENE 4AYDC 1JTOA 3PXLA 3SE4C 1L6ZA 3UPRA 2HWZL 4IJTA 4NENA 4WGWB 5KYNA 2MCG1 1L5GA 1I75A 1B6DA 2BW4A 2GHWB 2WIIA 5EB9A 2JELL 4JKPL 4DGIH 4DKFH 1CYXA 4EQ2A 1CIUA 2HFGL 3DJ9A 1N7ML 1AD0B 5D5MA 2R0ZL 4RSYA 4ZUTB 4R4BB 3U4EA 1MFUA 1O6SB 3KXFE 2K6ZA 1HVXA 3DK0A 3FTXA 4AL8C 4O4YL 1QA9A 3GYRA 2YD9A 1NDGB 1XGQA 4E36A 3MLXH 4W1TA 5GGTA 3HMWH 1LP9A 1EFXA 4JMNA 4FZEL 3T3PE 4ZTPH 2XVLA 3LDBC 3MNDA 3MLRL 3W39A 1T22A 4E0RA 2I24N 3JXAA 4PJ5A 5EU6A 3RVXD 3K6FA 2NQ3A 4WSKA 3KEHA 2WWKO 1FFPA 2LVEA 3RDTD 3NIFB 1T6VN 1DSWA 2X3BA 5DJ2B 3NJNA 4OFIA 4LCYB 2UV3A 5T3XE 3GSRB 3MRPB 4LMQI 3QDGB 2AQNA 2ZJSH 4AWJC 2G9HB 1L9OA 4DP5X 2YWYA 4YO0A 1L0PA 4KJYA 4JDEB 3L6FB 1SUJA 2IDCA 2PTTB 3GHPA 1ZIAA 2PWHA 4OZHE 4Q8BA 1AXTH 2YJLA 1OSPL 2OR7A 2NY0C 1VDGA 5FYKE 2VR9A 3FHEA 1I85C 4G83A 4PVMA 3TYGL 5KUMA 5AVVB 5I71C 3BC9A 2WSKA 1KYOJ 2CGZA 3ALWA 3EYSL 4LPWA 4RDQG 3S5ZA 1I1RA 5HD8C 1ANUA 1TTCA 3VFPB 1V54B 1MLCB 2DIJA 4HHAB 1SXNA 2OFQA 1IAMA 4N0YL 2V7NA 3S36X 2IGFH 3IKCB 4NIKB 4UTAL 4C56E 4GG6B 5EZPA 1KY6A 4EZMA 3GB7A 5F21B 3DHPA 4YLCA 3FB6A 3DHJA 4WI7A 1C7TA 2NZ9C 2H8PB 4WJKB 3R7RA 3QXAA 1MFDL 4ANWA 4YHKL 3FQ2A 5AAWC 5HYJD 4KJWD 1L7IL 2NW3B 2FQDA 4XWGH 5GS0C 3OHMB 4BFEA 1HKFA 3NGBC 1KTLA 4AMWA 3CBJB 4O2EA 5EZOH 1D5XA 2NY1B 2GC4C 5DUPL 1KACB 4P5TB 1V05A 3AT9A 2HJLB 1SN5A 4PRBB 3BSZL 2VO8A 1IBGH 4OGYH 3K91A 3OXRA 3L2LA 5D7LD 1JXGA 3B7UX 4QRUB 2ITDB 2DQUL 2EABA 2YEVB 4JKMA 5E2JA 4CGUB 4R7VA 4N9GB 1J0IA 3C5JA 4J2QA 3I84A 3CFMA 3FU3A 1PCXA 2C1PA 1ASOA 1ZA6B 3MRFA 4GRLA 3ARBB 3TGXA 4OAWA 1I8KA 5D7JA 1EV2E 3FO9A 1RQ5A 2NNXA 4JJ5A 4HIJB 4LIQH 4DK3A 4GXUN 1DZBA 1MQKH 1NBYA 2CA4A 2IQ9L 5L9DH 1UWEH 3V7AG 4TVPL 3VQ1C 2JLLA 2BIOA 2VDLB 2MJWA 1RHFA 2X9ZA 5BV7H 4NOBA 1U91A 1HSAA 5IIEB 3BAYA 3KLSA 4FOMA 4AI7A 1SJHB 4GXVH 4G7RB 4X6EA 5CWSA 2BZCA 1B0GA 1SHMA 3D50A 3P0VH 4FEMA 2EUZA 15C8L 1IEAA 4R97C 5BO1H 1ACZA 5MP6H 5FKPA 2XOTA 3MX0A 3CHXA 5EO0B 1KJ2B 1R24B 1IBFA 3VXQB 3B2DC 1JN6A 3RNKB 1AAJA 1KCLA 3ALPA 4FFZH 5KVGL 1OB1B 3ASNB 1TENA 3TESA 2C8NA 4BINA 4XB7A 1E3ZA 4IBYA 1REIA 3P0YH 3QIUA 4HIXH 3O3EB 2WXFA 3PE9A 4ANXA 1ZGLP 3DVGB 1MJ8L 2BOLA 1Y18B 5ANHA 4GAAA 1KBKA 1E2VA 1OAXL 3OKLB 4XNQA 2ZG2A 2VLRB 5C09E 1JWMB 1ITBB 1YNTF 2E0PA 5I30L 5DMGC 1G9MC 2K7PA 1B2WH 5KSBB 1KEGL 2WN3A 5EBLB 2NDGA 1OHQA 4MNHA 3MN8A 1BEXA 1KCVL 1KOAA 2EDOA 3OLGA 3WUWA 2K4AA 5J9PB 4P3DB 5C0FB 1UM4H 4TUJA 4IMLB 2CU9A 5I6MA 4OV6F 1YQ2A 1RZKH 2PYFB 5J13B 5L7XL 4Q9RL 2APFA 1I7TA 2DWEB 2FX9L 4L4VD 3GGWA 5EUKA 3CDZB 3NFPB 1EJOH 4OVVA 4YVUA 2X1PA 1GAFH 1X5GA 3B9VA 3VI4F 4Z7OB 4YHZL 2ZYRA 1A1OB 4MQSB 2NY2B 1PKOA 4YN3A 4UM8B 1T1WB 3CBRA 3OZ9H 3SQOH 4I1RA 3VH8B 2BINA 4QAMB 2V4LA 4L2YA 5CGYC 1IT9H 3MNMA 1J8HA 4OJFH 5GRVK 5I8CA 2ARJQ 3WCYA 1PZ5B 1N4XH 1OK0A 2NY4B 2UXVA 3QPKA 5F3HA 1Z6JT 1CF1A 3MXVH 2R9HC 3KPRE 1ZD6A 2VDPB 4BDVB 2YGNA 2KDYA 5C08D 5I1AB 4N22A 4XCEB 2I32A 5DEFB 2BWIA 2F53A 5MI0B 1TOXA 1TJGH 3ERXA 4OM0H 4MMZB 4WTZA 5INCB 2OCCB 3ARWA 3BAEL 1CICA 4NN5B 2TSBA 3WL9A 4QTHB 2DIAA 1NCNA 4QRSA 1B6UA 2W91A 1MY7A 3H42L 4U6YA 2L7UA 1JRHI 3HG1E 4EI6A 1A4KB 1FZMB 3WNIA 3LPWA 5C6WH 1T4KB 2R29H 3FT9A 1KJMA 4QRRB 2VLLA 3SD2A 2YKLL 1DBJL 3MJ6A 5FUZL 5IF0B 3ZYOA 1CG9B 2GTZA 1ERNA 1GZPA 3DJZA 4J1UA 2BVOA 5DQJA 1E4XH 4NJ9H 3S9DB 3UCQA 4PJ8D 5F3BB 3UC2A 5JZ7D 4ABUA 5I5IA 4PWIA 4KKBC 2AJSH 4W9HC 1RUQL 4MMYA 5D5ME 4NOFA 2CJUH 4XWOD 4RH4A 2LU5A 1BWMA 2R2HA 5EFIB 5A2BA 4DKDC 2FRGP 2KQNA 5DFVD 1TJIL 3QRGH 1LP9E 2HRPL 2X0WA 2YZ1A 3QHFH 5BCAA 3W38A 3SE9L 2B20A 3S3PA 2AJ3B 1GMEA 1F3JB 4HD5A 3AXLA 4YGVB 5EU6E 3QI9D 1NCCH 1TZOA 1NCDL 3GMOA 4UOW0 1GZHC 3H0TA 5IFHL 3UYPB 5GJTL 5FOBB 5F9DC 5I1EH 2DQDH 3WE6B 5I18L 5EF0A 5HI5D 2OYLA 2H0FA 3L3IA 1NCUA 4P49A 4ZFQA 5CIPH 5I6OA 4ANVA 2EVIA 3N9GL 3FCSB 3KYOB 5CGBA 4Y9CA 1BXAA 4PP2A 4YHIA 1RUAL 3Q1SH 1GJUA 3QZMA 4XE0A 4KXDA 4A7SA 4L8BB 4FNRA 3MREB 4LCIL 3LPPA 4JPVL 4X8GA 3B2VL 3U46A 5BJTA 1F4XH 4UDUA 4GSUA 5TE4L 2GSIB 1M6OA 2CGRH 5IUSA 3PQYB 3MROA 5F6HI 4L4JA 1ZDQA 1W72L 3NA9H 4TRPL 4LHQB 3RVUC 1L0QA 2VN3A 4PS4L 3LNEA 5F3FA 5I16B 4LAJH 2WZ6A 1DUYA 4JN1L 4H0IA 1OL0A 3O2DA 1HSBB 4K94C 2D03L 1R1CA 3UC0L 4PJCA 5DVMA 5A1AA 1N70A 4QLWA 3JZYA 1I31A 1WFMA 2P8MB 3WNKA 1JK8A 1X5IA 5G4MA 1ED3A 3WFZA 5JQ6H 1WTLA 4FTVD 4KHXH 1Q1PA 2PP8A 3DXAA 3UBXB 4FABH 1CC3A 2QQKH 1ZK5A 1X9RA 4X6CF 1T20B 4N2OA 1FNSL 5F72S 2V17H 4PS3A 1EGJH 4XZUA 3TP4A 4X5RA 2PP9A 3LEVL 1SPDA 2WWMD 3U6XA 3CPLB 1QFOA 1RPQA 5I9QC 4N87A 5CJ8A 3EH2A 1JXFA 3OV6A 2VDPL 4J3BA 3HNTH 3MV8A 2C3HA 2NX5D 4A2HA 3T1WA 3RL2B 1O7VA 3QC6X 1CK0L 5FHBL 3IFPA 5IJCC 2DD8H 3JWNE 2E56A 3HMXL 2EKJA 2IALA 1R3JA 5DGRA 3F6LA 4L1BA 2WNGA 1H5BC 4M8RA 1ICTA 1MG3C 3TO4C 3WO3B 5BUGA 3QUGA 2VZ3A 2ADFH 3GDBA 4BFKA 1IC5H 3I2CL 3NRFA 3FU8A 4NI3A 3BUYA 1LO3L 5FUOL 4F8TA 2YK1L 1DJSA 1TLMA 1QWHA 2X53A 2XRAH 3V9CA 5H35B 2FWSA 5F9WB 4Z3IA 2JFCA 2CUIA 3SCMB 4Z3EA 2R2EB 5KZCB 3PWUB 3GI9H 5DHYB 2WBJA 1NEUA 3SZKC 1OQXA 3L9YA 3FT3A 25C8H 2K6YA 2H9GA 2R2BB 4BSWB 4PB9L 1S9KC 2EDLA 1IGTA 5HPMB 1J8SA 5IJBC 2FEDD 4LKXB 5TFSL 3ZL4L 4S1SH 5KG9B 1OP9A 3PWNB 3BP4B 4YDIH 4FCAA 3V9EA 2LABA 4Y4KC 1N2RB 1GTFA 3B7SA 3D08A 2PPEA 3FO0H 1DBMH 1D5BA 4NO3B 1UJ3A 4AKOA 5J1AA 2ZF8A 4PP1C 1AKJD 4KKPA 1JHKH 3N5AA 4A7GF 3HA0A 1O75A 1DJWA 1JFQL 1HYRC 2BIPA 3B9KD 3DDFA 4QTIH 5I6PA 4G9DA 4YSEA 4GT0A 1F45A 4FP8H 3UTTB 3BUQA 3F6IA 4PJDF 4RIRB 1EFQA 4OCLC 4EMZA 3NFSL 3WXVH 1FJ1B 5FXCH 3P2DA 2E7LA 3ZZSA 1IV8A 4M1GL 5KVDE 3FFDA 3CVBA 4LPTA 1HESA 1R34A 4FNSA 5HHXL 1I3VA 5L7XH 1BBJA 1DQLL 3LZPA 4E9XA 5I17A 2R0WL 3MODH 2R8SH 2D9CA 1JERA 3VFTA 3VYNA 2QMJA 4Q2ZB 3BHBB 4AOFA 2DJMA 1HHJA 1JK9A 2BO0A 1QO3A 5ESAB 4TV3A 1BXVA 5D1QB 5I75B 2COVD 3OKMA 2JMRA 4YZFF 4YH6A 2OMWB 4OFKA 1OD9A 4CVZB 4YHNB 1PDKB 1XH0A 2FO8A 4RSVA 3ZMNA 4LFHG 4AK1A 3US1A 2F53E 3W37A 3RL1B 4GUPA 2WTRA 3HPJA 5JLZA 1CFTB 1ZVSA 2R56L 3VG0H 4OZGB 2VXSH 2Z7YA 4PJ9B 7CGTA 2QGEA 3G5VA 2CO1A 1H3PH 4JW3A 1BVLB 4LKCB 3LS4L 4E9LA 2KZKA 3TOPA 2HT4C 3D51A 1TUPA 3W5NA 4ODBD 4M3HA 2OAAA 2CHDA 3N0PB 1UD6A 5DGQA 2EXSA 4WW2C 4KJPC 5AW0B 4F33B 5LB1A 3Q2CA 3ZTJG 2BSED 4GI9A 5GZOC 1NKOA 2OTWB 4N2AA 1V3JA 2XUWA 2ERJB 2VRQA 4BFBD 4H4NA 1ZGLM 3OR6B 4IGBD 2DLEA 5E8PA 4LLWB 3LKQB 1MREL 4IKJA 4XX5A 1PX8A 1G9EA 2H2PC 2BSSB 3D39E 4AUYA 3GHEH 1XB8A 1RJZB 1I9RH 1OAQH 4JFUA 4YXKL 2N7AA 2DDQL 4X6BA 4J2XA 3X1BA 1LNUA 5D96B 4KV5E 1VHPA 4NZ8A 3M86A 2Z0BA 3QIWC 4NLAA 3IE9A 1JDAA 4L9LA 3SSGA 4IHBA 8FABB 1XVSA 2OJZL 3NP4A 2IDSA 4JAMB 4MWFB 4Y4FA 3T8XB 1E5YA 1KCSL 3QA3A 4G5ZH 3U30B 4KI5C 4AV0A 1NC2A 3QCVH 2DBLH 3VFRA 5I8EB 3D3VA 1INQA 3X14A 2ZPKL 4RGNC 3ULVL 2ZUVA 1RSYA 3P73B 2E47A 2OMNA 2ZF9A 2IQAA 2IANA 3S97C 1IGYA 3CC1A 3L3GB 1F90L 4BH8B 3V79C 3IFLL 5IV2A 5C0BD 4YE4H 5C0AA 4RQQA 1CXFA 1HL8A 3MR9A 1QFHA 1F4WL 1Y0LB 3SB3A 4AMKL 1YNKL 3ESMA 5DJ6B 2HLFD 1BQKA 3WSQL 1P7BA 2OSLB 4BRVA 3GEWB 4ZSOA 1INDL 2YBRA 3K1KC 1KTRL 3DBXB 4PJCE 4UNUA 5T3XH 2YXVA 1TXKA 4G7SB 3UTZB 4G70B 5J89A 1DSFL 1YN7B 2ZX7A 4LCVA 1HHIB 4JO8A 2KI6A 5EN2A 3DXAE 1H6FA 5B7FA 3UTSA 5C2BH 3DV4B 3A6CL 4MCZB 3UG4A 4GAFB 1OT2A 1AGEA 4V1DA 1D6EA 4R0LA 2MHAA 3PHSA 3QO0A 1XIWC 4TPRH 3PYCA 1HH6B 1N5AA 1HWHB 3VD9A 2QZQA 3DX8B 3EXJA 3VI3A 2JK5B 1RJLA 1T5WB 2AJVL 4N8CH 3MV8E 1U8HA 5DZJA 3RNQA 3T3PF 1R5VB 2JJTA 3IRCA 1I1AB 5E9AA 3DUHA 2VYRE 3DX7B 2AJZA 5HI4C 5IB5A 5FC9A 2K0RA 1GIGH 2QJDA 3ZW3A 3QPQC 3UAJA 1AE6H 2CKBB 2IDQA 1C16A 3TCTA 2DIEA 1ZT7A 2KS0A 2FGWL 4Y4HB 5A7EA 4OZHF 3GRGA 5DWUL 4HV8B 4NUGH 2C5DC 4P5RA 3K46A 4E9WA 4EI5D 1E4HA 2IG2L 2V7HA 4FQXC 3F64A 3S7GA 1TPXB 5AUMA 3VM7A 5JXAL 1U6AL 1O6VA 1IARB 2Y9RT 3BIBX 3BUTA 4P3CL 3RZCB 3QR2A 5M95B 3CDFA 4GSQA 3MOQA 3QUXA 3T04D 2XWDA 4EN3D 4X2UA 1HIML 2F08A 2WLHA 4CMHB 1VFBA 4XNMA 4Y89A 2Y7QB 1UZGA 2D31A 4WF7A 1N9PA 5FUCC 4FKEA 2WNKA 3NJFA 4OIBA 1BM3L 2CUAA 3ARXA 1E8ZA 2C34A 3TBSA 3BXNA 4MX7A 5CZVH 4ZD3H 4UNVA 3KPSD 1NCBL 5ESQA 3U36B 5HP5A 1P5UB 1K5NA 1NAMH 2PTUA 4NLHA 1MCJA 3QEQB 4TNFA 4U1NA 5FWRA 1O9VA 2YA2A 2G9KA 5LBSH 5B38A 4FQHA 4N68A 5E8NB 2E7BA 4UAHA 3L3DA 4JQVA 5D93B 2W0FB 4P99A 3OTTA 1AXIB 1QLEH 4R3SB 1RZJH 3S37H 1MCCA 4XMWA 4KDTC 1XR9B 2ADJB 4PJBB 1RURH 4XBGA 1WEJH 2EDDA 1EX0A 1UKTA 2FECL 4MJ4A 1KBGL 2IV9A 5EZIL 3T08A 3E2HB 1TZIB 4JM2C 3MBWA 4R2GD 1XBDA 3KDMA 5DQ9A 4OH2A 4WV1B 1Z3RA 3EJYC 4BFOA 5DK2A 2I9LB 1PZSA 2KDGA 1I3GH 1YEEH 5ADPH 2BVTA 1NPJA 4F7MB 3EYOB 3RY4A 5CKAA 3EHBD 5F7EL 4NZRL 4DAGH 1G7LA 5JPMC 2VSKB 1RH8A 2A6JA 3KXFD 1QTSA 4ZAKA 3LCYA 5LGHL 2F15A 2GKIA 1SJEB 2AQQA 2NYYC 3E38A 1N6QH 1L9RA 2CM5A 2G5BA 3VGDA 3BD5A 3CVHB 4GMSL 2BY1A 4W9DC 1RLWA 2BHFA 5IY5B 2Y06L 3TNNB 1N64H 4JFPB 2WIMA 4M5SA 4GY4A 1FG2B 3DV6A 5HGDA 3ZDYF 1EEUA 1WLHA 2J25A 3TBYA 3NCYP 4A63A 3L3OA 4P04A 2DW5A 4AZ8A 4HOZA 4PIRF 4LSRH 4HWBH 5C7XH 4B9KC 1NANI 3CXHJ 4IRSB 1FAIH 4U6HB 3TXAA 1M57B 4BZ2H 1KG0B 3BUPA 4AGOA 4ODTH 1ECZA 4HIHB 1QW9A 2ADIB 3MYZA 3RTQA 1G1KA 5G4OA 3TPUB 3V52L 4DPRA 1TJHL 5IMOA 3IU3A 1VESA 3V4PA 4ORGB 4EKXA 3QWNA 2EEAA 1MFBH 3GZKA 3MA9H 3OB0K 4F7TB 1E9QA 1W8OA 3Q48A 5ELIA 1HKLL 4D8OA 3LXUX 2OK0L 2XZCL 2B5IC 2VCOA 3CHPA 3U2SB 1JXJA 4MA1B 4H25A 4WLCA 3GSUB 5D1XA 4G6FD 4C56D 1YAZA 3SPJA 3TASA 1MVUA 4H20L 2YRZA 1AQ8A 3RFRA 3KG5A 4PG9A 2AKRA 1UENA 3O9WB 1U9KA 1LO2H 2I60H 5F9OL 4JHAH 1MFCL 5I1DA 3ARGD 2CDFB 4U3SA 1N3NB 3CVIH 2OR9L 1CBJA 3D3VE 4JKKA 4EVNA 5D4JA 3UYRH 3PJSB 4HXAL 4JFZH 1IILE 1RK0B 4NJAH 4AJVA 1OTTD 4I4WA 4XNDA 2D3LA 1RJCA 2WINB 5FM4A 2IANE 2YEQA 2OJEA 5B4MD 4KH2A 3SE4A 3C6EA 4HEPG 1WA2X 1QACA 5GGTH 4I89A 5TDPA 2WXQA 4URKA 4KKQA 4TSAL 4YE0A 2DTSA 2WCSA 3CSYB 4MAYC 2K4WA 5ABAA 1A1NA 4F7CA 4BFGA 1NH6A 1PG7W 4ZSOE 3FQ4A 3ULUL 3CLEH 3OC5A 2ZXBA 2YD5A 2W0PA 4JRXD 3U1PA 5D7LB 1IM9D 3KPLB 4HJGA 2DB8A 4QRPD 1JZGA 2CLRA 4WFFE 2WO3B 4JO3L 1INDH 2D3VA 3UTSE 1CTOA 1CD0A 3RU8L 1C08A 5ACLA 1XSKA 4KU1A 5ECGA 5F88B 2GSMB 1H6EA 3F84A 3N41B 2H6PB 1AH1A 2NXZB 1TNMA 4V1DE 1S9YB 1QFWL 5LN8A 1IAOB 3BH8B 5D7KE 1R5WA 1JPSH 4FA7B 1YN6B 3MLUL 3VI3E 4FHKA 3KNBB 2DQTH 2WLYA 2K8QA 4ACPA 5KSAD 2Y6SC 3WYRA 2A9BA 2VLJB 3D09A 3KH4A 4Q97A 2D7TL 3L5XL 1X9QA 4HUXA 3U4KA 1FZJB 1MH5A 1JGVL 3E3QC 3IDNA 5CHNA 3S8GB 4WI0B 1BZ7A 2IC2A 3VD1A 1WCBB 1M1XA 5C09D 5AB9A 3UZQA 3GEFA 2NY1C 3PP3K 2AANA 4XMKH 1IGMH 3CGTA 2ZXDA 3MV7A 4P5TC 4P2QD 4D8PB 4GO6B 1CE1H 1TKWA 2EXYD 3EG9A 4D0BB 4EDWH 9PCYA 1BQHG 2VN4A 3CJJA 3MHZA 4KH9A 2WNWA 2IAMC 2G5RA 2L0DA 4L23A 2P48B 4LPCA 2VAJA 2AS5M 5CSGA 3GXPA 4GQZA 3O6KH 5DLML 4JX0A 1UADC 3PWPA 1TZHB 3MUJA 4F15C 5C0CA 1OAUH 2FL5A 3FFCA 1Z5YD 4OF8A 1UWGH 3OJDA 4ZBJA 3FCTB 4IOSA 1QLRB 2PCFB 2EEDA 3LB6C 5IMMA 1ID2A 4AV4A 1QWUA 1Q94B 3DMMD 2VJXA 4MD4A 4H88H 5D72L 3O8XB 1MRDL 4JGJA 3WIIH 1NM9A 1M56B 3HHSA 4FX5A 1X7QB 2WGXA 2D73A 1OHZA 3D0AA 4JRYB 2ENPA 3BD4A 3BN9D 2H3KA 3HB3B 2A99A 3H9HA 4J7RA 5EG6C 5ICXB 1JF5A 4L4VB 4JHZA 3VFUA 4A39A 1OLLA 4GNKB 4IQHA 1RIVL 2DQEH 2ZSVA 2LT9A 1P4LA 2X6UA 4G9FD 4R4NC 3IDUA 3BSHA 2CG9X 4PY7A 1TQSA 4MNQA 4NNXB 3PXHA 3FT4B 3SKUD 2HJKB 3TYFA 2CO7B 4OD1L 4HFWA 1AQKH 1IGIH 3FKUS 4JY6B 4E42B 4LDLB 1A6PA 4KQ4L 5CP7A 1TFHA 3QPXH 3J07A 1WD9A 3X11A 3LN4A 3CHSA 1GC1C 3TV3H 1G7JB 5LQBH 1VF5C 1GS7A 4XVSH 1NFIA 5GS2H 4HUVA 4YXHH 3EDEA 3MRRB 4H8PA 2YOCA 3PABA 5EZIH 3HBQA 3NDZE 3ZIMA 5C08B 5I0DA 2HZHA 2YGVA 3DUSA 5ERWB 2F74A 4LF3B 2FJFA 2X4OA 3V6OC 4XN2A 5CJOL 5K1VA 3HS0C 4EUPH 2VDRL 3KJ6L 3MJ9L 4NQVB 4TTDD 5KS9B 1XF1A 1VGKA 3KBPA 3Q8CA 3HNVH 4N2KA 5HJGA 2AABL 1EFXD 5GQBA 3HUJE 4MDIA 5J13C 5GPRA 1XH3B 2VERN 4PJ5D 5LKNA 1FGNL 5C0IB 4B95C 3Q8AA 3ZKSD 1HHKB 2EVJA 2P5EB 1GS8A 2BOCA 2HTKC 5AOMA 5KYXA 3VFSA 5FW7A 3P4NA 3QRLA 1MIMH 2NY2C 3RWIA 3D34A 3EBHA 3FSVA 3D69B 2YQGA 2Y3NA 1NICA 2K8MA 5KVDH 1S7VA 1MHHB 1SF5A 1NCTA 2A6DB 4N3TA 1C5CL 5FCUH 3THMH 2NY4C 4QOKE 2B2XH 4G1MA 4NQXB 2BVPA 2DQJH 3EFOB 3MCLH 2NPLX 4UQ3A 5F1NA 4E41A 3QI9B 2DH2A 1WHPA 2K70A 3IWUA 3O3DA 3D25B 5CCJA 4D9LL 1CGYA 1OAKL 3DGGA 2NW2A 1ETZB 3SEPA 1YNTB 4MHHG 5D1XE 1AGFB 4MD5B 3VSQA 5L6YH 2XFXB 5J1TC 4HOWA 3COOA 3IYLW 3CFJA 3IGUA 1P5VB 3GM8A 5L0QB 3HZMB 5I0ZA 2BSTA 5L8LB 4PRIB 2GT9A 4LARL 3QWRD 3ULSB 1J5DA 4AVHA 1C9SA 1F56A 2XIBA 1HJBC 5KUKA 1HNGA 1KENL 1WVZA 1A65A 3IXAB 1RK1B 3X1FA 4X7SL 3KLHC 3ZE1E 1IX2A 4UV7L 2QVKA 1IFGA 3BFQG 1HILB 3VI4B 2O5XH 4LLVB 4NUJB 3GBMH 1OE2A 2FYVA 1IM3A 3GJFK 3EFFB 2ITFA 1M7IA 1RV6X 1JPFA 3IMTA 4D94A 3K6SB 2CO3A 4MXWH 2RCSL 4Y0GA 5C0DA 3SKJL 5GRJL 3FN0L 4MVBC 5B39A 4MA7L 3UZVB 5D7JD 3DNKA 1D7DA 3GZPA 4WJ5B 4YFEA 1W8NA 4I18C 4LCWB 4RMSA 4M48H 3U7YH 4FTVB 3ECQA 2QFRA 4JFHD 4ENEC 4Z7WF 4OF0A 3GBDA 2I07B 2WOBA 2XTSA 3SYAA 1TTAA 1OWRM 1TEYA 4ZFFA 4EPSA 2B1HH 1WZMA 4S1QL 2CLZA 5TH2A 4XPHL 4HPOL 1KGXA 1HS6A 3ISRA 4Z3HA 1CCZA 2WUCH 3BMVA 4JB9L 4IBQA 1PKQB 1KLFA 5J12B 1OCOB 5DO2C 3ATAA 4WUUB 2F61A 4OM1L 3RFZB 1EA9C 2WCGA 1OCRB 3H3PH 4Z7NB 4IEFA 3S96A 1W0YT 1YNLL 3MCKB 3KGTA 5DUML 3RGBA 4U1IA 2WYTA 1PNDA 3RWHA 3QFGA 1PVHA 2DTML 1L3WA 3E0GA 3RU8H 1BVZA 3H4FA 4PJ7F 4BH7A 4X4YA 4XP5L 4PRAB 3S37X 3QIUD 2WVSA 4FZ8H 2WJ7A 4WJG3 4ONFL 1EZSA 5I1JL 3U0PA 3TZVD 1I8MB 3QW9A 2Y07H 5BMFH 4KV5F 2FJGA 4PCKA 3S5LB 3FQRB 1NOAA 4ZMLA 4P5SA 5AWNL 4YDKH 1OKEA 4AGLA 4MKTA 3DGCR 3PREA 4NNPL 5EZLA 1ODAA 4DT2A 1NGPH 5E08L 1BOYA 4W9IC 3MV7E 3PDGA 1YEDA 3GUTB 1NLDH 5FGSA 5HVGB 5EOQL 4XBEH 2WO4A 3EKCA 5CF3A 2MRYA 4DEWA 2RAMA 3O2VH 3IDXL 3MAWA 4MZ2A 4MQ7B 2F7IA 2O72A 2MCPH 5GISL 4D9RD 2DEWX 1MG2C 1OQOA 5CFHA 2BC4B 1VEPA 2ZKHH 5EC2B 2GBAA 4HK3J 4UOW1 4N2IA 1W80A 3PWPE 4NQQA 5C0CE 3FFCE 1Q1JH 5LWYL 4LVOC 1TG8A 1CE6A 3NIGE 5EO9A 1HXMA 1K4CB 1H3VA 2J21A 3MBEB 5I6XC 1ZA3A 4KDVA 3HOGA 3MLZH 2W9DH 1YJDC 4NT6A 3VMPA 3W1ZA 5ICZA 5LLIC 1J8HD 3B3IB 1AKJB 2ZKWA 5E4OA 3V4UH 1YVLA 3S3CB 3D0LA 4EQ3A 1LE9B 3VG9B 3KHQA 4PJCF 3B9KB 2PCPB 5AB0A 2D0HA 1ET8A 4YSAA 4PRHD 2J5LC 4LRNH 5I8OH 4LHUA 4XMPL 2F53D 2GW5A 1O7DC 2JKIS 5JDSA 2YXWA 5J0BA 1CICD 3FCGA 3UGXA 3SCMC 5CIPB 4MNQE 3W11C 3V5KA 1FORL 4EIUA 3N43F 2CRYA 1IZJA 5DJ8A 3A3YB 5KJRH 3LZQA 4PGDA 1H5BA 1U8IA 3BPLC 1S5IL 4YQXH 5K9KA 4FQLH 1R3KB 2Q10A 2JKLA 5E7BA 4NKDA 4YLBA 5ALCL 4LPYA 4FXKA 4OD3H 2QBWA 4OD1H 5HHVH 1TVDA 1E43A 2AXHA 2E4FA 1ZHKB 4PWEA 3QJQB 4N86A 3FJTA 1KGJA 2ZCZA 4WEBL 2ZOKB 3A22A 3FONA 3Q44A 4PS7A 5CZRA 3SY6A 2DQMA 1VSCA 5HI3C 3II3A 2YIHA 3RIFK 1F86A 5GSRA 2GSGA 3F5WB 2CSPA 3BKYH 3EYQC 3JTSB 2VR3A 4KX7A 1QLFA 2YUXA 4XPGL 1EO8H 3O41B 1BECA 5IWLC 3TTYA 5GIRA 1PY0A 2EDYA 4P9ML 2FLBT 3LKNB 4QYAA 5CR8A 2AZUA 3STZB 1QP1A 4UYQA 1TZGL 4JHVA 4X80L 3QJUB 1E2WA 1J9SA 4F37F 3CE1A 4Y4KA 4FYRA 4F27A 5KW9H 4UIMB 3U1SH 2Z91B 3NESA 3TS8A 2B4CC 3K7UA 2VXQL 3NDYE 3NCBB 1F6AA 1QNZH 3LRLA 4U4IA 2P45B 3OJMB 3P3UA 4M3KB 4ADGA 3VFVA 1KTDB 3OAYK 1LWHA 1KIUA 5MEPA 5FA4B 1KIRA 5D1QC 5DVPA 3S0PA 4ES8A 2VW4A 2KC0A 3OKYA 4HLZH 4F8PA 3V0HA 4KVCL 1NUFA 4LEEA 2LU7A 2QR0A 3ZDXE 3HJ0A 3VWKD 2KLRA 3MFGB 4ODXB 5CCGE 2XZQL 4NQUA 1KIQB 4PJ9C 2K45A 1HH9A 2J43A 3L4TA 5J7CC 2ZCKL 2IV8A 4LSSH 5DYOA 3BP5B 4J3UA 3LH2H 1F4YL 2ZWYA 1YEJL 1NMBH 2H2SD 3PJNA 3I50H 1QHQA 4KZDL 2G60L 4RGMC 3TA4D 4F2MA 4APQD 2ENSA 1A6UL 3CWGA 4OZFH 2XWJA 3MMEB 4GQPH 5IOPB 1BZQK 3OXSA 4GXUM 3V4VH 4ES9A 1QR1A 1CBVL 1YMHB 4OFQA 1J9RA 1OARH 4AZUA 5ISZA 5DMIH 1F1AA 3RIAF 3GK8L 2ERJC 1QNIA 3FO2B 3PV6A 3S3JA 1U95B 4MSWA 4IDJL 2Z9TA 35C8L 4GEJA 3MZTA 1GSKA 1Q72H 5GJSL 5FF6A 4E68A 1QRNA 5E2VH 4OT1L 1RZIA 4Y5VB 5A6LA 3TURA 2DWDA 5EOCJ 2NSXA 3LV3B 3EF4A 1OF2A 1OP5H 3KWTA 5CZKA 1FIGL 2BS71 2FJHB 3QJFA 4WNQA 1GGCH 4R7NA 3SE3C 3DYMA 1CN4A 1ETJA 1MWOA 2W9EL 1E0OB 2FLRT 3BIKB 3MRGB 1U8LB 5GZOA 2C9UA 2AQ2A 3HBGA 1AGBA 3MNZA 4YSPA 1NEZG 1AVAA 3TEUA 1KELL 3U30C 3L4YA 3RWGA 1DO5A 1RVFH 4G7YL 4IRZL 3R1GL 3SO3B 2XU9A 1P2CA 4JY4B 4MNGE 1UA3A 1BD2A 2CR0A 4PM1A 1OTSD 1XB3A 1IL1B 5IZ7A 1WHOA 2GY5A 4X8JB 2BSCA 5GGQL 1JVKA 1USZA 4Z7VB 1IBBA 2OSYA 2DLFL 2VMCA 3MJ8B 1XF2B 4O9HH 2X0UA 4S1QH 1MW3A 4Z6AT 4D7PA 4DFHA 4I0PC 4AEFA 3DX9A 2A6KB 1MRCH 4FLSA 1KXHA 2I5YH 4U6XA 2F7QA 3FQTB 1KEMH 3EXLA 4M5ZL 4JRFA 2WBJD 3QR1A 3INOA 3MV9A 5LHDA 2AV1B 1T1ZB 2PW2B 4S0TD 3ARFB 3X13A 4FXGC 1YNLH 1CLYL 4DGVL 1BLNA 4IIQB 2OMVA 3KLAA 1U92A 4WNSA 4QR7A 3CLFH 3WJMA 3O6FC 2ZOWA 2CALA 4NX0A 5F7UA 5TD4A 3T1FB 3ZE2F 3I9AA 3OKKA 5BO0D 1X4YA 5FECA 3F7LA 4BZ1A 1UURA 4TS6A 2D7MA 4QT5A 3RVWD 4DPCX 3L1EA 1U58B 3I9GL 4WHDA 1JUFB 1C12A 2EIZB 5F7LB 4YBHA 5IVXA 1KBWA 1W15A 1UUSA 1DBBL 2IWKA 4FL4B 2Z7WA 3RVVC 1I7RB 2H1PL 4I2XA 4JCMA 1J0HA 4LOUC 4ZFZA 3GI8H 4ZPTA 1ONQB 2RQ8A 3ESUF 3KS0J 2YLKA 4J3OD 2AEQH 1ADWA 3U9UA 1OP4A 3F6JA 3EH5B 1N67A 3PGDB 3S48A 1N8ZB 2EICA 3NJMA 3E1F1 2BZDA 2R23B 4KKAD 4LSPH 4PTTA 2DEYX 4R7XA 1OK8A 3CIQA 1S3KL 3QNZA 1C5DB 3UL4A 1MF2L 2WZPD 5D7SH 3P40A 3S3SA 1Q0YH 1G7IB 2N0MA 4QPEA 1UOVA 4XNYL 4AC4A 2EDTA 1T04A 3PWJA 4GKZA 3T0EB 3LMJH 4ISVB 4GRWE 3KWWB 5IQOA 4PGEB 3QDMA 3L08A 5MENB 5B3NA 2VW6A 3BCFA 1ODUA 1TPXC 4HFUL 1XGTB 3GMNB 1MJ7L 4CC4C 4PWKA 3SDCD 4WUKH 3OAZH 1JRHH 1O5DT 1MFEH 3PL6B 2ALAA 2K6WA 1ZLEA 4CMHC 4N2NA 4XXDB 2ZNWA 2BRQA 2YMXL 2Z8VC 4LLYA 5ADOL 4JFVA 3VI3F 1WH0A 2IPTL 2J6WA 5GGUA 3KXFB 4M6NL 2NT0A 4M7JL 4OLWL 2YD3A 3HPLB 1CUOA 3GXUB 1JV5A 3LNGA 3LRSA 1T7XA 5JW5A 1VZIA 2NY5L 3MACL 4NM8H 2MPAH 5HY9A 3CDYA 3ZMEA 3LEXB 3RBSA 5I15L 4XXWA 3T3PB 3SODB 3B2MA 4LSVL 5T1JA 3A4EA 2KMWA 3MV11 2OZ4L 5AD0B 4NC1C 3SKMB 1CQKA 4A1RA 3OX8A 4F92B 4XX1G 3Q7JA 1PIGA 2Z65C 5LG6A 4LCCA 4UILL 3TV8A 1A6TB 2BK8A 3W9DA 1KGCD 4OZHB 2XACC 1I1FA 4OUOA 3X3FH 3AMKA 4Y4FD 3C08L 1MEXH 3QQDB 5ITFB 2Q7YB 4D0CB 1LEGB 1S8DB 2VDNL 2AAAA 5I1LB 3ZKNC 5KBPA 1NC2D 5CINH 1U8MB 1ZS8A 4FFYL 3V6ZA 3D3VD 4YBLB 3SHSA 4XNZC 1EQWA 3TX4A 4U1HB 2R51A 3ZPDA 4KDTA 1PZUB 4QHNA 4MZ3A 1WT5C 2B77A 4C56B 5IG7A 2IAND 2WUBH 1WZ1L 4PLOB 2PXYD 2C9SA 2J8UE 3AG4B 5D8JH 2FX8L 1BX2B 2WPGA 3KPOB 2QEJA 4OCWL 4JM2A 1G7MA 3CU7A 1KB5L 5C0AD 4AQZA 4EKJA 4XP4H 3RIKA 3AUVA 3HFMH 4NZUL 5I1GL 2HJFA 5J06A 5BZDA 2XQYA 2EINB 3QSKB 4H2CA 3CBKB 1GKOA 4TF4A 1SM3L 3MXWH 1BOGB 3K81A 4LGPB 1TLKA 3EZ8A 3RUGA 2XZQH 4IRSC 4F2ME 2GAZB 3F62A 2X4SB 3LKRB 4WY7L 5DC0A 2QFPA 4K3EL 4LNRA 4XCYB 5E95B 3RWJB 1DQML 4H0HB 2A77H 4HZ1A 5CSZA 2B1AL 4YR6A 5AG8A 5ISZE 4WFFD 3MRDB 1NL0H 5E6SB 4UWQB 4MXQC 4MYWB 1F11A 1MPAH 3ME0B 1MCFA 1CQYA 2XZAH 1BBDL 2DEXX 4XPFL 3BKJH 3LKOA 3SE8H 1IBZA 1VFMA 3TJEL 4V1DD 1QRNE 3HZYB 3APFA 2EEXA 2ZCLL 3ARTA 3L2NA 3MI6A 3NSCA 3AT8A 1P1VA 3AG1B 1CDCA 1V10A 5E6IB 3U6RA 3FTWA 4P2RD 3QBTB 4DCQA 2CIKB 1V7MH 4XMXA 1IM9B 1KB9K 3HUJF 4R4FL 3O9WC 1U3HD 1DYZA 4WDIA 4CADB 1TO4A 4OGQC 4I5BB 1YYLL 1QLEB 2ZG1A 4ODSL 4DN4L 3UAJD 3FH5A 1WE5A 4X4XA 3V0WH 2F19H 4NPKA 4BFIB 5L2JB 1BD2E 1BW8A 1MWAB 1RXLA 4XP1L 5AW9B 4YDZA 1H3TA 2Q2LA 4KMQA 4GRMB 2F68X 5IHBA 4M6OL 4HC1L 1HQ4B 3A5VA 5C07E 5KSAB 3N06B 4YDVB 4K23L 5E8EB 1PD6A 3ES6B 3NFNA 3WFEL 4HT1L 4D3CH 4DHLA 5I24A 3QUXD 4GLRH 4TNWF 2HRHA 1FLTX 3FMGH 3MV9E 4WEMB 1DO6A 5C09B 3FB8B 2DQIH 2E86A 2B0SL 3OPUA 2VUYA 2X4NB 2YPLE 3CFKB 4OGAC 3CIAA 3D0VA 4AGNA 4NQSB 1F4HA 1NDGA 3LIZA 1TJMA 2YAEA 5DEGB 2OR8A 3FXIC 4YSUA 4JZNA 1RFDL 4BFJA 1N0XL 1AZUA 1D5ZA 4I3SL 4PLKC 5FYKL 3KL5A 1TETH 2B9BA 6PCYA 1G43A 1ZSHA 3ZE1F 2NXZC 4MAYA 5IVXE 3HG3A 4OLVL 4HIIA 4LCYA 4QO1A 3FUMA 3MRPA 4PG2C 1QAWA 1ZANL 4I2XE 5FYJD 4NSKB 2G9HA 4YL9A 1ZLWH 3IDJB 4X8XA 3Q6GL 2Z7UA 4JDEA 3L6FA 3HNSL 4UB0H 3HI6L 2Q2EB 3IVKB 1PEWA 2PWFA 3EOAB 1DBBH 3QG7H 5HHME 3EJTA 4DP6X 4GG8A 2WLIB 4O51B 1SLVA 3D7PA 1A2YB 4EBQL 4A6YL 2Q3AA 1JHLL 2ZXGA 5BS0D 5C9JB 3KPRB 4NZTH 2ZXCA 2R0LH 4AH2B 1DN0B 3APCA 1T0MA 3ZKMC 4PQXA 3N44F 2V37A 4JG5A 4WGVB 1ACCA 4ZAKD 5GS1B 2VL5A 3EJQA 2ATPA 3HG1B 1NIEA 4DH2A 3QDME 1UJTA 5E1GA 4XOBA 1OTUC 1FFQA 1AP2A 1H9DA 3AQYA 3UPRB 4NENB 5CNHA 2J1XA 4K2UL 1L5GB 4Q7DA 1I9JH 2WIIB 4KMTH 2AI0H 3NABL 3Q01A 4FQ1H 4I3RL 2GITA 5BW7A 2SEBA 4NPYB 4DP8X 5MHSE 5DC4B 1R46A 4KFMA 1OE1A 3K71B 3GXDA 5D5MB 4WO4D 3E1ZA 4DP1X 3QGVA 4RZCB 3O8XC 1RUMH 4OFDA 3RTQD 3NEEA 1QA9B 1M71A 1XGQB 3FN3A 4N9GA 2IAMA 1EFXB 1OVZA 1DN2A 3HB3C 5JHLL 3OHXC 3W39B 1T22B 4IMKC 3L4UA 4NYLA 5EU6B 4FG4A 4KKLC 5DZPA 4NNYA 2B8OT 2QSVA 2A74C 3HEIB 1CVSC 4RWYH 1CDGA 1FRGH 1MWAL 5E9DD 1IKNC 1R0AL 2FATH 3QJXA 4RFOH 5T1LD 4L37B 1OT1A 3R0MA 1GHFH 3QXTA 5D70L 3HZ3A 2X1WL 1OY3B 1DEDA 4LVHB 5F7BA 2RA1A 4NKMA 1JF6A 1SJHA 1INEL 2XJKA 4Z0XA 4HULB 3B1UA 1JZ7A 3H9ZA 5EWIH 5IR1A 1N6VA 4NFBA 1RY7B 1SMAA 3SYPA 4YX2H 4UT9H 1F6FB 3OKOB 5EO0A 1S7UA 1R24A 4I9XA 3VXTA 3VXQA 3NJLA 5KVEH 2JQAA 3JWOH 2YZ8A 1IC4H 4G8GD 4LXFA 5TQ0H 3RI5K 5CEZE 3NIGF 1F2XK 2OMTA 1E6OL 3SPGA 4M6MH 5CLWA 2P1YA 3GB7B 4MCNA 5E51A 3FB6B 4RLDA 3O3EA 12E8H 1SYVA 3PGFH 3V6FB 3QXAB 5A3IC 2QADC 4MS8C 5DVOA 1Y18A 4D9QE 4P48A 3FQUA 1QRKA 1WZ1H 3IJHA 2R7EA 2VLRA 2HVBA 1KTLB 2Y7LA 4HWNA 5FW6A 4O2EB 4B5EA 4LEXH 4LLQA 1D5XB 1CLZH 5KSBA 1CYWA 1LL1A 3RUGE 2NXYC 5F9AC 1ZIBA 4BE5A 1NFAA 3V6OA 3L3JA 3HS0A 2OMUA 2V8MA 2X89D 1GS6X 1S7WB 3OXRB 5AVUB 5J9PA 1OGAA 4L3ED 1NLBH 5F97E 5AW2B 1CURA 4Z0BH 5CUSH 1E5ZA 2J71A 4K71B 1MRFL 5K39A 4X0KB 4KY1H 2F7OA 2L7QA 3C5JB 5D7IF 3TT3H 2DWEA 3MRFB 4GRLB 3CDZA 2N1KA 2PETA 5D7JB 4DPBX 2WXNA 3FO9B 4DQOH 2CDGA 4UZSA 4OQ1A 1A1OA 1WC7A 3GJEA 1PGRB 1NBYB 1UXSA 4FD0A 5D2NC 5BV7C 5I5RA 2CD0A 3IWVA 2BNQA 2OXHB 5T1KD 1BBDH 4TLSA 1A0QL 3KYNA 3WKPA 1ZT1B 1U91B 1HSAB 5DWPA 4M62L 4FQJL 4KZEL 1MCDA 1MVFA 1NIFA 5AYUL 1I9IH 1Q0XH 4RISH 1V3LA 1R3LA 3Q2WA 4OLYL 4X6EB 5CWSB 1B0GB 1MNUH 1IEAB 5HGBA 5FKPB 1J5OH 4B9PA 1KLGB 1FPTH 3ZU8A 4LAQL 2ZYIA 2GEEA 2NZ9D 4PJGF 1PL3A 5ICUA 1HQRA 3NN8B 3MLVL 3LAFA 5I23A 3FTVA 2F58H 5IHUL 2WLMA 3DIVA 1NCAL 3UBHA 5L8JB 5GS0D 3ZDXF 2Y2YA 3BJ91 4XNQB 1MLBA 3PWPD 4UM9A 4X42A 1KPUA 1A9EA 1XEUA 3UTOA 5C0CD 3FQXB 1DEEA 2ZYHA 3MDJA 3ZGIA 2O5ZL 1A1MA 2HKHL 3MV01 1LEIA 4K23H 2NOYA 1WCQA 4PSPA 1WWAX 3WFEH 2QZ5A 4MNHB 2XG4A 1DVTA 3B2XA 3WUWB 2BIMA 2QV2A 4GIPD 1BV8A 2AEPL 2V9TA 2YRBA 4GKOA 4TUJB 5I2IA 1P4BH 2YSSA 3ESVF 5J12C 4MYPA 4YHML 3BH9A 3WFBL 3VACA 5EUKB 3GGWB 4K9JA 2XI9A 5K59F 1JXKA 5FOBA 4I18A 1FFOA 2PW1A 4TULH 2ICEC 2EDFA 3OKDB 1CFQB 3F01A 3GRWA 1XGRA 1MCOH 1OSZB 3NJHA 2FHBA 3I74A 4L1LA 2VRAA 1JZHA 2V0AA 3KYOA 4HUWA 1A25A 4Y19A 3HVDA 5I8CB 3QZLA 4W6XB 3VFGL 5F3HB 2Y22A 2HFEA 2QV4A 1VRSA 2CRIA 3C2SA 4ODUA 5LAXA 4Z8FL 4FYSA 2ORBH 3HKZA 3L81A 3L95A 4RRPM 2GSIA 1E6JL 2F53B 4B7LA 3C2AH 4HUUA 1CICB 1YEIH 5CGTA 2OKMA 3CN2A 3WL9B 3FAWA 3TCXA 5IQ7H 3BZEB 4NUQA 4QRSB 4N90D 1KC5H 5D4QA 4O02L 4S0SD 2XWTA 1CT8A 2WB1A 2ENQA 4EI6B 5LGKA 4ILDA 1LDPH 2AQPA 2Q7AA 1KJMB 4YXLL 4HKXA 1SJMA 1H3UA 2VLLB 1HSBA 2WBWB 2GTZB 3K72A 1GZPB 2B39A 4J1UB 2BVOB 5DQJB 1J18A 1M42A 4TUOA 4IDLA 5EBWA 1DVFB 2CIIB 4QEGA 5DMGD 2VDQL 4FQ2H 1NANH 1U3JA 1QYGL 4MMYB 2KH2B 1MELA 4LL4A 3MBEC 1KJ3H 1TDQA 1SXCA 2R2HB 1UZ6F 4GKLA 2ICWA 3G6AA 3E6FA 4U1MA 1CZ8L 2JE8A 4WHCA 3ARPA 1NBCA 3D39B 3VG9C 2F1AA 1HU8A 1SJVA 2BWQA 2ZUXA 4KHTL 1GTNA 4FFWC 5FHAH 3AXLB 4E41D 1H3XA 1NTDA 4Y2OA 5JUEL 2YPVA 4M4RA 2EE0A 1IFHH 2VMFA 3RL2A 1WV7T 5T33H 3H0TB 5C92A 5TE7H 1I8UA 3LQMA 4HIEB 3QAZC 3KD4A 5A2KH 5HYEA 3PNRB 1L0YA 4M43H 2BFVH 3L3IB 2EIBA 1ECYA 5LCVA 5JHBA 2YXFA 1AS8A 2D4FA 4R8WH 5CGYD 4BCYA 4AYGA 2CDEA 3ARYA 3CHOA 1UWYA 5I0YA 3BKML 4P59H 5I1IL 4W4OA 3D85A 3W2DL 4XRCA 4MAZA 4YHIB 4OLZH 4ZMNA 2XIDA 5AVSB 5FO9A 5T1DL 2Z0UA 4NUMA 5D70H 4AW4A 5BJTB 4DTGH 4LLDB 1JE6A 2WY3B 4HGKC 5DJYA 3F7KA 1WAEA 3MROB 4UNIA 4ZXBD 1KYFA 4P57B 1IM3D 3FBKA 2IH3B 4RRPG 1GGUA 2A73A 5KAQG 3AAZA 1C1EL 1MHEA 3BQUC 1DUYB 2J6EH 4FQQA 2UWEA 5AVQB 1OAZL 3WEAA 3ZKQD 1KXQA 3ZTNH 1EXHA 2EXTA 4J3WA 5HYFA 4PJCB 1TQCC 1XD0A 5J3HC 2HN7A 4IBVA 2J7LA 7PCYA 1JK8B 2RJMA 1ED3B 3EIFA 4HKZA 2VW7A 3F58L 5KANI 1G7PA 3IRZA 1N2RA 3QUZD 3DXAB 4Y88A 3VWJD 1JV2A 1KTKE 1V7NL 5K69A 4QDGA 4G82A 1AG0A 4YSOA 3UJJL 1S9WA 3EO1A 4JE0A 1OGAE 4FC3E 2P5WA 4Y16B 4XZUB 4NWTH 1XCQA 4P46D 1JF1B 1VFUA 3DRTA 2DQGH 4N3UA 5IWLA 4ZW8A 3RA7L 2ID5A 3ASOB 5JW4M 3MV8B 2FNWA 1QASA 1YEGL 1EEYA 4G7VH 4HXBH 5LNDA 3ESPA 2HFTA 1NMAL 4JDTH 2J3SA 3QYNA 1HYSC 4XP9H 4AE0A 3BAWA 1PYWA 1L7TH 3IFPB 2BNQE 1I4FA 3NAAL 3AU0A 4JFEE 4MDJB 4PV9A 2XPGA 3TA3C 4W70A 5E2UH 1RMFH 1R3JB 1TZAA 1GGBH 1NUDA 4QHMA 1G6RA 4BRJA 5DVNA 3U83A 2PF6A 3C75A 3B2UC 4G8FA 2Z93A 5DFTA 1J9TA 5EMYA 3CSTA 3T6XA 1DL7H 5HHQB 4C54A 4JR9L 2ODHA 2OMWA 1J1XH 2H47C 5I82A 3WFHA 2G3NA 5KTEL 5CKGA 4R83A 3S88H 1AXSB 5K1JA 4YHOL 3C87A 4TL5A 4LASH 4YEEA 1T5KA 5FGCE 5KBLA 3K2KA 2PO6B 4OZGA 2L3BA 4JFOA 1BJMA 5F93C 4YPGB 5C8JB 3RVUD 3DHUA 1BVLA 3G9AB 1H8OA 1DR9A 4GMTL 4JEGB 2WBJB 2WQXA 2YEZA 1YC8A 4Y5VC 5F0LB 3DX1A 4UQEA 3TBWA 1I8LC 2X2YA 3FT3B 3K2UL 2H9GB 5BRPA 1IGTB 2UVFA 3MUY1 4ZUUB 2J8UF 4TOYL 3QQ3A 4BHUI 4RMVA 1RZPA 3TH3T 5C0RH 5F9JA 4WO0A 1O0VA 2YQBA 4R9HA 1MCLA 2WP3O 4N0CC 2RHEA 5L4IA 5B8CC 3TL5A 4FE9A 4ONGH 2W1NA 5F96H 4ERSL 3O2WL 3SO3C 1UJ3B 1VPOH 1WAAF 5J1AB 5IFJA 3BZ4B 2Z8RA 3L48A 1HI6A 4YHLL 2N4IA 2W07B 2GCYA 5FR3A 3DROA 4MJ6A 3FQNB 4HS8H 5DD1L 3HAEG 4G9DB 2EYRA 3FQ1A 2WJ5A 4NKIL 5I8KL 2VXUH 3UBGA 4GFTB 4AEHH 1PIFA 2ZOUA 1UT2A 2BRRL 4K73A 3UZEC 4A7VA 1BBJB 4FQCL 2PTVA 3MYJA 3QDJD 5HJDA 2VIRA 5I8EA 1UT9A 1ETB1 5I17B 4ZUWA 2ADYA 3TO4D 3VFTB 2VC2H 3ARFC 3RHWK 4Y19E 1A6ZA 4PUBH 4YIQA 3P73A 4J3VA 1HHJB 1JK9B 3F85A 1AZZC 5EF1A 1AQMA 3O2DL 3WIHA 3OKMB 4O00A 1F6LL 4NN7B 4L0YA 3BRFA 2M2DA 4I0PA 2PYED 2V3EA 4GUPB 2WTRB 3HPJB 5JLZB 1ZVSB 1EEZA 1Y0LA 1ZPLA 4BZ1H 2P5PA 1JS4A 2BNRA 3OJVC 3G5VB 4B9CA 4KAQL 1VGEL 4OZFB 4HJIA 3FCUB 4FXGA 3BD3A 4CU6A 1WK0A 2MOGA 4LEBA 3BDBA 4AVKA 3WY4A 4B9GA 3TTSA 3O6FA 2X38A 1HHIA 3KCWA 2X6VA 4L1HA 1J1OL 1RUPH 2QQQA 3NH7H 3CXFA 4FJZA 4OLXH 3DV4A 4Y4KD 1P1ZB 3Q5OA 1K85A 3D4YA 5A2CA 2C4XA 4FCHA 5CR1A 2R27A 4PP1D 2Y36H 4XN1A 2XV0A 4N2EA 1HH6A 1YC7A 4MD0A 1QYGH 3EBGA 2Y0SA 3T0EC 1YLBB 5DMKB 3NACL 4PW3A 5AYTA 4JL1A 1QSFA 4GQRA 2Q8AH 4QGYA 1YQVH 3QXVA 4OQTL 1R5VA 1CGVA 4OCSL 4L9LB 1CXHA 1L9MA 2AMUA 1UYWH 2EVHA 3CFNA 3V0AC 7FABL 1UA6L 2EE3A 3AUWB 3L4CA 4Y4FB 4ELDA 4HCIA 5J6HA 2CO6A 1P9MA 3O81A 5HDBF 3F2LA 3QA3B 1D9KB 3PL6C 1NC2B 4YLQT 3TVMD 3VFRB 1P53A 3D3VB 4G11A 2UZIL 1INQB 5DHXB 3X14B 4HKJA 3J27A 3OAUL 4CL7A 1OEZW 1Z9NA 2W95A 2XJLA 3H6JA 4O5LL 3RAJH 1MCQA 2IQAB 2IANB 4KROD 5SWZE 1IGYB 5IVNA 5EOTA 3FUHA 1UKQA 1YZZA 4POYA 5IV2B 4CC4A 1H8NA 1NCGA 1E3XA 4RQQB 1Y7VA 4ZO6A 3MR9B 3BPOB 1L9TA 4L4TA 4JG0H 3S5LG 5AW5B 2A5UA 4PB0H 3LZFL 4QY8A 3T71A 1CLCA 2HT4D 4F7PA 5AAMC 2UWEE 4ZSOB 1KXQE 2X7LA 1YEHH 2YBRB 4WKXA 5D71L 1AGCA 1MFNA 2H32H 4XCFH 2D7PA 4KJPD 4WNJA 2Y72A 5D1ZA 3U36A 1UXMA 2Z92A 4HHGA 5GZOD 3QEQA 2X9XA 3CDCA 2UUDK 3GNML 5EN2B 3ZUNC 2YLHA 5E6RB 3UTSB 1GZQB 2W0FA 1S2EA 4JPIA 4QXUH 4WRLA 4H1LG 2H2PD 2P5WE 1AGEB 3GSNL 1D6EB 3FS9A 4V1DB 1B4RA 4R0LB 2ADJA 5LVEA 2MHAB 3CLWA 3QO0B 4ZO8A 5FB8B 1RZGA 1N5AB 5CCHE 3VI3B 2WLLA 1RJLB 2EZ0D 2H7WA 3KW8A 3R8BB 1U8HB 2XN9D 3QIWD 3ZDZE 1BIHA 3RNQB 3V9FA 5EOCH 1PJWA 1CDIA 2E7DA 2X2JA 3DX4A 4L5FL 5DZLA 3FSWA 2AJZB 4F7MA 1KN2L 2BJMH 5IB5B 4KI5D 3ORJA 1IAII 2R0KH 2X2UA 4FQIH 2V5MA 4CN1A 4ETQA 4Z5RA 3PIQA 1C16B 4RGND 4MCMA 3S4SB 1WT5A 1ZT7B 1I8AA 3RB7A 4A55A 3GIZH 1NCWL 3GSQA 1BJ8A 3MNWA 4JHWH 2JCWA 2WMPA 3VXSA 1CD1A 2CR3A 2JKNA 2V7HB 4M8VA 5AUMB 4CVXA 3NCYS 1ZV9A 4JM4H 2TSAA 4U31A 4XNXH 3BWSA 4U0QB 3VYOA 2LLGA 3QUXB 3WMPA 3EF7A 2HT3C 1UM6H 1UWFA 2YPKA 4X5XA 5B1JC 4PVNA 4HOMA 4IRSA 2DMKA 3D9AL 2D31B 3A24A 4FNPA 5E6IC 1EHLH 1L9QA 3I3DA 4MQXC 2WXRA 1IIKA 2Z4TA 3TBSB 3TPUA 2NMSA 3BXNB 3H4HA 4MX7B 3OGOE 3FUFA 4JPWH 5HHMD 4ABQA 1DVUA 4MAUL 4HIQA 1SHWA 4U1NB 3SIKA 1RZJC 1JAEA 1P7QD 5B38B 5AW1B 2HX7A 3UROR 5FAAA 3L3DB 1ZGLA 1XWVA 1E7UA 4PYGA 1CI5A 1AJ7L 1XIWD 2X6CA 3RLSA 4UOJA 5CSBA 4XPBH 3ARZA 4XBGB 3BGFB 2DMGA 2FT7A 4K9EH 5F7MC 2B15A 3DVIA 1S46A 4MA3A 2F5BH 4A2EA 4JANA 2IPUG 1QUNA 3MBWB 1CGWA 5EC1A 1EJFA 1X5YA 3KDMB 5DQ9B 2VZ1A 2DLHA 3GD1C 1KFAH 3OF6D 5HI4D 2Y3AA 2IO5A 5DK2B 3VXNA 4A68A 4OZIA 1EUTA 4HSCX 2CQVA 2BOBA 1FO0H 1YECL 3QS2A 4M7LL 2DQCL 3X1EA 3PJSA 3FRPA 5EDXA 3Q8FA 2QPSA 4M9OA 2YN5A 3MOBH 4AG4H 3IJYA 2A6JB 1ZRUA 2ADGB 5AOZA 4FQCH 1ZTXH 4LU5L 1FCCA 2G5BB 2C4FU 4FQXD 4K3JL 5J56B 3MZGB 1QSEA 3ARDA 4RFEA 1J0KA 3LIZH 3HUJB 3WTVA 2BSRA 1MAML 3DV6B 5HGDB 4S11A 5DRNA 3CSYA 2BNRE 2ITEA 2HYMA 3M1BA 5C6TH 2JIXD 3VYPA 3KVPA 1M53A 1MJJA 4H44C 1XX9C 5LBVA 4Z3FA 4AZ8B 2E76C 1D7FA 4NO2A 4PLJC 3UP1A 2DYPD 1KYAA 4JO1L 1VIWA 1A5FH 1JNLL 1TTFA 3DARA 3RTQB 4QRQA 4TSCL 2OP4H 2BDNL 4KRPB 1KCUH 4Z7UE 3CSPA 5IMOB 3IU3B 3RX5A 5IJKC 4QOKB 1FE8H 5F88A 1UFUA 3I6LE 4BV1A 1E9QB 2VMEA 4JMXA 4P4KD 2IOOA 1S9YA 5TGBA 1IAOA 3L54A 1MFAL 5CEZD 4PG2A 1ASQA 3NYKA 5LNEA 5D1XB 3VAEA 1MVUB 1A9BA 1E2ZA 1QSFE 2NZIA 2R4SH 4JM2D 4OLUH 4Z3TA 1G0XA 2NDFA 4EOWL 2WQSA 3EJYD 3N85L 1JHTA 1OPGL 4Y8DC 4BK8A 5JIPA 1CF8H 4P07A 5I1DB 1WCBA 3SDAB 3O4LD 5TDNA 2A7BA 3LIUA 3ZE1B 4EVNB 1U41A 2HX9A 1ZEAL 4D8PA 3GHBH 4MJ5A 5CLTA 5K9QG 4I4WB 1OAYH 2CHXA 5E03A 2GJ6D 2XA8L 1XSJA 4UT7H 2OJEB 4Z95L 3Q06A 3AS2A 4DN3L 5DC9B 2A9NH 4MZIA 1U8PA 2VNCA 5IW3A 1A7RH 2CK2A 4J12A 2NY3C 4O5LH 3MOAH 5TDPB 3TT1L 2K3TA 5C0ND 1XGUA 3MLSL 3UDWA 4L4TE 3IU4L 5TQ2L 3CCHB 4F7CB 2FX7L 4LSUL 4UMSA 3N44B 3WELA 3EJUA 3FT1A 5FYJL 4YWGH 3ZQXA 1JVLA 3O8XA 1BREA 4LSQH 4LOEA 1E4WH 1Z5LA 3A21A 1B0RA 4HJGB 2C9AA 4N1EA 5E24E 5JOPE 2CLRB 2HH0L 3JV4A 3LDBB 3MPCA 3OHXA 4IMKA 4WWOA 3T6WA 5C3LD 4UDTA 1BQSA 4NC1E 2A74A 5IHLB 3U4BH 3A4FA 1IKFH 3KZ8A 2KERA 5IEHA 1IKNA 3A4DA 4NNXA 1R5WB 1JOIA 4KTEL 5DK0B 4E9SA 2ISDA 3E7JA 2ZOOA 1D5IH 4JY6A 4DW2H 3KW7A 4KJQC 4NM4H 1BJ1H 3MA7A 1Y6NR 5JIDA 1YPZF 2APSA 1BGXH 1MXGA 1I7UA 2JB5L 1PQZA 3APNA 1SRDA 4HUXB 2NY0B 4TUKH 4AUUA 4NFDA 4R84A 1MH5B 2GJZA 3MRRA 3IDNB 5CHNB 3QAQA 1S6NA 3VXMB 4G8AC 4KNQA 4U6VH 1MUJA 3V7MA 1BZ7B 3EGSA 2JLPA 3FO1A 3I9IA 1FCGA 3O6LL 4N8VA 3UZQB 2OYPA 2CMRH 4PJEF 2FBRA 4KDWA 3MV7B 4HAFA 2ENYA 3O0RL 4NHCH 1TKWB 3EG9B 1CDUA 1KN4H 2C3WA 2JI1A 3JWDL 4K71C 3VXSE 1LO5A 2BP8A 4I0CC 5E8DL 2IWGA 3V4PL 1AR2A 3RG1C 4CN6A 1LLAA 5FPIA 1UVQA 4GRLC 4XN5A 5C0IA 1FLRL 1EANA 4NQCA 4AXWA 1B4JH 1TMQA 5CD3A 3FU5A 2Z35A 3MRMA 3PWPB 4XGZA 2QSCH 5C0CB 3FFCB 2FL5B 2WQUA 3QDGD 4PI0A 5J4MA 3OJDB 3L1OH 2J1WA 4DOHE 4WFGD 1RERA 4AQEA 3NIGB 5IMMB 1MHHA 4N5ED 1DLFL 3MVSA 4R7DB 4MD4B 4G80B 5SWSE 5TPWH 3OR7A 5AVWB 1AZVA 3HHSB 4NQXA 4LRIA 4KC3B 4ALAL 1UH2A 3D25A 4XAKE 3UJIL 1AI1H 4AEIL 3VFUB 3TWCL 2ZSVB 4KK9C 5D2NA 1P4LB 3R06A 5EULV 4PY7B 3RY6C 4OZ4A 4A2GA 1Y1DA 4MNQB 4LZKA 5HSFA 1AC0A 4QNPF 3TYFB 5BPPA 4AYEC 2AJXH 2CHNA 2WTOA 1J0ZA 5CP7B 1KDJA 3REVB 3DGDA 3X11B 1RUKL 2YD8A 4FG2A 4OZIE 4JY5L 3RY5A 1NC4A 1NFIB 4S1RL 4KFZC 4HUVB 3PABB 4FFZA 3DOHA 2NY1D 2XXGA 4BFRA 1UTDA 2AQ3A 2PN5A 1BQHA 1XZ0A 4NKQB 4P5TD 1N5YH 3DUSB 4UYPA 4KRMB 2F74B 2FJFB 4AVJA 2X4OB 3T3ME 1SEQH 4GI8A 4ZTOH 4AL8L 1VGKB 4K4KA 2V9UA 4GBXC 4RDQF 5KJ4A 1OM9A 1QSEE 1ADQH 1HJCA 1X7TA 2WVVA 3OPZH 4MDIB 3ARBD 4V2CB 5EV7A 5ICYA 3H56A 3Q2NA 4KTGA 4Q89A 4WJ5A 4LCWA 4WFED 2ROYA 1E5BA 1AC6A 5KYXB 1MIEL 3BCDA 3P4NB 1PLCA 3P0GB 3RWIB 5A2AA 3LB6D 4M1DH 3X3GL 1VZHA 1QZ1A 3GRWH 1S7VB 4K7PH 1RU9L 5IBUB 3PFUA 1I8IB 1XSIA 4G1MB 1D6VL 2BVPB 4HJUA 2X1QA 2AQTA 3BLBA 4UQ3B 5F1NB 1LVEA 1T2JA 1DHKA 2CBPA 1ACYL 5GGVL 3ZDXB 1A6WL 1GGIH 2NR6C 4M5YL 2ICEA 3NSFA 4GB9A 4TSCH 4R4ND 3WKMH 3DGGB 1DFBH 4DUXA 5HHOA 1RIHH 2B3IA 3AY4C 1BVOA 4AE1A 1OOWA 1DLHA 1A22B 3JTBA 1HINH 3CFJB 3VMOA 2BSTB 4H8WH 1J05A 4ZS7L 3K1DA 2AXJA 3NSJA 4LESA 4XPAL 2XHNA 1JBJA 1N8OE 3FQRA 3QHZH 1YEKH 3R4RA 5GS0L 2VLRD 2O6CA 43C9B 4M3JA 1DVFC 4NI6A 3R4DA 3QRFM 3VGAC 5DS1A 3INUL 4PGCB 5DZVA 2DQHL 4LLUA 3S35L 1HZHL 4UUJA 4ELKA 2R29A 1RULL 1JGUH 1EDQA 2ED7A 2IH9A 3CN4A 5BRQA 3D2UB 5HGGS 4UBDC 3TF7C 1JPFB 5C0DB 5EC2A 4KKCC 5B39B 2YXMA 2VUKA 3GWJA 3C6LA 4YZWA 4DKTA 2HTKD 1CR9H 5E5MA 1RK7A 2YPVH 2HRLA 3FTYA 1TVBB 2NY2D 2KLSA 2BNQD 2VTFA 2QQLH 5E8OB 3EYFA 1WBXA 2GVYA 5CP3H 3LS5L 4Z18A 2CLZB 4MNGB 4MDRA 2NY4D 3ZHNA 1SZNA 2PCPA 3B9DA 4J23A 4MB5A 5KVFE 1HN1A 1KLFB 2D2OA 2AERT 4XTRC 3L5WA 1UQSB 3LNFA 4HEMA 2AJYH 4KNTA 2F5AH 3EH3B 3TF4A 4OJDH 4ZS6C 4IEFB 5CIPA 4OIIH 3D07A 3G3LA 3ZDWA 1FVCA 3CMOH 3FT2A 3I6GA 4U1IB 3RWHB 2VT0A 1BPVA 1QOKA 1ZLUK 4Y9FA 4BH7B 4X4YB 4QRRD 4X6CA 2FH8A 4Z1PA 3AGVA 4JPKH 2NCEA 3U0PB 4OGXL 4P4RB 1FBIL 2Y7MA 3VQ2C 1NDTA 3VW3L 2FJGB 2WP3T 4G8IA 4RGOL 1ZHKA 1GPOH 3O4OC 2YA0A 4KQ0A 3HLAA 1SYSA 3SOBL 5EZLB 4B27A 3AACA 5DJAA 4OCRH 3VJ6A 1G9ML 1EZVX 3MUUA 3VFWA 1YEDB 3GKWL 4ZRGA 2WXHA 3B43A 3FU7B 5DS8A 3F5WA 4Y16C 1C5BH 3BQUA 5EH1A 4OI7A 3CFCH 3M8OL 3MUHL 3S2AA 1R47A 2CLVA 3UBXI 4ZI8A 1HNYA 1MCEA 4NQCE 3OQ3B 2XKUA 3DX0A 3VSTA 2CBOA 2A1WH 1ZHLA 2VDOH 4AQ8C 4ENED 1CE6B 2Z91A 1EGJA 3MLYH 5EO9B 3AXIA 4UT6L 3GXNA 1ZA3B 4HF5L 4JQXC 4NT6B 5ICZB 3BSZA 2UWEF 1MDAA 5G5DB 4X9BA 5D7HA 3D0LB 3GS4A 5I9QB 1MJUL 4KQ3L 1G6RH 2RALA 4LIQE 4J6RL 4JKWA 5DO2D 4ZT1A 3CN0A 4GRWB 1G5GA 3QULB 4LHUB 2PO6C 5JDSB 4QKTA 3PQYD 5D2NE 3ULAB 1UM5H 1P7HL 1N18A 3V5KB 4FNUA 3TA3A 4UIKL 3CXDL 4LPVA 5DJ8B 5E2TL 3IDMA 4PGDB 5L4MA 1H5BB 3NCFB 4ZZKA 1UCBH 4L8SB 2FVNA 2M26A 3F3HA 4A7GA 5D9SB 3T8VA 2BXYA 1P84K 2IVFC 2PKDA 3PPSA 4NKDB 4HJEA 3MQIA 4YSTA 4FXKB 2ITCA 1BFOA 1JPST 1LILA 1YMHA 2EH7L 4PJDA 3B5TA 3GS7A 3S34L 4OCNC 4PJAA 3KYMA 4U05A 1G9NL 3CUPB 1Z3GL 1UOKA 2DWYA 1U95A 3CVDA 1BZEA 4JQIH 5EU4B 1F1GA 2WWOA 1O9WA 3EDFA 2WZAA 3QQ9D 3B1TA 5DMJB 1ZV2A 3FONB 3QT2A 1HZLA 4Y5VA 2MIZA 1I8LA 5GSRB 4C4BA 2GSGB 2X05A 5JA9A 1EIBA 1E28A 1ORQA 2AXFA 3G6DH 3N1QC 1CD9B 5LG1A 1NFDF 1T89C 4G2AA 1A4AA 5A7BA 5CGMA 5I5MA 2EJ1A 5KOVC 4TNEA 3BVXA 4Y4KB 5B8CA 2Q3XA 5B3SB 4PWHA 5T5NG 4ZMVA 1DQDH 2DI9A 4YDJA 3US0A 1EHXA 1F6AB 1IL1A 1PD1A 3DYOA 3VFVB 1KIUB 2F0CA 3L16A 3GJFA 5MEPB 1KIRB 1H0DA 1PJ9A 1IGCL 2J8UB 3JWNG 1J0YA 4DO4A 2QR0B 5DYFA 1I7ZA 3MCG1 2OPCA 3P02A 3SCMD 5ENWA 3UZEA 5HHOE 1GL4B 1LDSA 3W11D 5KZCD 5IP4A 3V0IA 3IGLA 4HQQH 5DZOA 1T1ZA 3TCLA 4ZX4A 3ARFA 1FG9C 2C7UA 3VRIA 3KYAA 4G6JH 4W9KC 4XP6H 4F2MB 2VZVA 5ALBH 4K94L 1FHGA 3QEHA 4CDGC 2JCCA 4ETYA 3OXSB 4J3SA 2IPKB 1QR1B 1MDTA 2AK1H 3U4AA 1XB6A 4R26H 3ZRSA 4DVRH 5ISZB 3UO8B 4MSWB 1JUFA 2EIZA 1ZKAA 4HJJL 5GS3A 5FF6B 5HI3D 3AS0A 2KUTA 3WY2A 2QPDB 5HYQB 4NWUH 1QRNB 3LEYL 2FLMA 4R5TA 1RZIB 2Q8BH 1PLBA 1CXEA 2VM9A 2J72A 2WWNA 3EYQD 3L8QA 5F1OB 4B53A 4DGYH 3WN6A 5T3ZE 1SDDA 3UTTD 4K8RH 3QJFB 3I6KA 3IDIA 4F8OA 4WNQB 5BRZA 5KYUA 3QE5A 3KEDA 4R7NB 3SD5A 3J7HA 1S7SA 4GP5B 4TQPA 3PGDA 3R18A 1FYHB 3DX3A 1NKGA 2R23A 4U4BA 3DSNA 4XVTL 1AGBB 1MI5A 3MNZB 3DA0A 4WU7A 1A7OL 3DTXA 1C5DA 1D9KC 2GHZA 2WQAA 1KV7A 5LGJA 3KPMB 2AJUL 3RWGB 3PJLA 4BWWA 4CRPA 1A3LH 5FDWA 1P2CB 2D8KA 4GAYA 3H6AA 4OSUL 5I1KH 1BD2B 1UACH 5I19H 4KUCD 4GSDH 5D1QD 4ECNA 4YS4A 4KUZH 3K3QA 5HGAA 2DPKA 4PGEA 1RP8A 2AGJL 3DWTA 4Y5YC 1G0YR 4Z7UF 5E0FA 2EIKB 3WEXB 4NCDA 1NGYA 4GAGH 5C07B 4Y9GA 3DX9B 4OJCA 4HG4J 4PJ9D 4U6XB 1K6QL 2OCFD 3EO9H 3MLWH 1K2DA 1RL1A 3BPOC 3QORC 4GS7B 4HPYH 4QYOA 4G6KH 2FECI 3DPBA 3WFCH 1JYXA 4KI1A 1ZOXA 2ZCHH 4X6CE 2Z31B 3MV9B 1SNRA 4RA0C 1QKZL 5CCKL 2BERA 1LO0H 2EO9A 1SBSH 3VGEA 2Y4SA 3X13B 2V5TA 2XYBA 2YPLB 1QHPA 2OMVB 3KLAB 1U92B 3TC9A 3Q43A 5EZJA 3WJMB 3HG0A 3N55A 3CHQA 4XI5C 3FBQA 1FH5H 3PY9A 4WCYH 3ZTJH 4KVNL 1ZWIA 2HTLC 3QFDB 2ESVA 3LEXA 3BH4A 3OKKB 3U0WL 2IH1A 5KSVA 1CDHA 4X7EC 5EEVA 4PJ8C 4QT5B 4XNBA 2XPZA 5GHWH 5JZ7C 2P52A 2JJWA 1U30A 5JW3L 4XE5B 1SQMA 2LGNA 3SGDH 5IVXB 2PPDA 3C5ZC 3MRNA 4F58L 1W72A 5K1NA 1OF0A 1PSKH 2DYSB 2VDML 3FOMB 4XMLL 2BLFA 4I2XB 5AAMA 4ZFZB 2VXVL 2CUHA 3BP6B 4IU2A 4ZPTB 4B9ZA 5DFVC 1XGYH 4P2CG 4Z76A 3T4YA 1U8OA 1UGNA 3U9UB 1X44A 1KZQA 2JJTC 1IQDA 5HHMB 2I9TA 5ITFA 5I1LA 2DRUA 4PTTB 4J8RA 4PJXA 8CGTA 4B6ZA 1U8MA 3HI5L 3QNZB 4B0MM 3MJWA 2XETA 3VQLA 5CO1A 2HG0A 1ET7A 3KGUA 1DJHA 4DKEL 3PWJB 2CNZA 1ZS2A 4GKZB 2E5EA 5C97A 1JD7A 3VD5A 4K7PX 3LQAH 3QDMB 1T21A 3SGJC 5H8DA 2VXTL 4F1SA 1RZFH 3V0DA 1E9OB 4GINA 2Z3FA 4TL4A 3AREC 4KPHL 4M8QA 3TEXA 2PR4H 2W0KA 4HP5A 4F1ZA 3GXFA 3TJHC 1OCWL 1BG9A 5J6GB 5T5FL 4TQEL 3HMXA 4WHTA 4X4ZA 4JN2A 5E2WL 1XHHA 1T3FA 4GO9A 5H94A 5HDQH 3V5DA 4LLYB 2GAZA 4U7KA 4RBPK 3CV5A 3L7FA 4HH8A 1NAKH 4LB8A 5FYLH 4AYBA 5H4ZA 3O6FD 5L4FA 2J88L 1KJVA 4HCRH 3GPEA 4L3CA 4PJDE 1PLGH 5EHFA 5JW5B 3I3EA 4PJAE 5I1HH