3QZMA

Staphylococcus aureus isda neat domain h83a variant in complex with heme
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
124
structure length
124
Chain Sequence
MSQATSQPINFQVQKDGSSEKSAMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Iron-Coordinating Tyrosine Is a Key Determinant of NEAT Domain Heme Transfer.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Metal binding protein
molecule keywords Iron-regulated surface determinant protein A
total genus 33
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qzmA00
2Z6FA 4YMPA 5D1QE 3SIKA 2ITFA 4WJG3 5D1XE 5D1ZI 3QZLA 3QUHA 2O6PA 3QZNA 3VTMA 3OVUB 4H8PA 2K78A 4NLAA 3S48A 3QUGA 4H8QA 3QZMA 2Q7AA 3SZKC 3QZOA 3RTLA 4FC3E 3QZPA 2H3KA 2MOQA 3RURA 2O1AA 4MYPA 2ITEA 3VUAA 3SZ6A 2E7DA
chains in the Genus database with same CATH superfamily
5E8PA 3RWIA 1UFGA 4PY8J 5ANMA 1DCLA 1P6FA 3JXAA 4GAAA 1N59B 5CHNB 5IJDC 3CFNA 3FQ1A 1C7SA 3CUPB 2E6JA 2K78A 3V5KB 3A67H 3RJOA 4G9FE 1JYXA 3RG1C 1JGLH 4PWKA 1A9EA 3S34L 2IDUA 4XWGL 4OFIA 2V5RA 4MTMA 1QFWL 2Y3AA 2JKSA 1UH4A 4N2FA 1E4XL 1ZVYA 4O02B 3BC9A 5I5JA 4X4MA 3KJ6L 3QI9D 1JK9B 4MYPA 2RQEA 4PRHE 2WLNA 3SBWA 2VLKA 4XMWA 1SFHA 2OSLA 1CGWA 5DMYA 3IN0A 4K3EH 5F9WC 4OY9A 3Q7JA 3ZJAA 3BAKA 2PW1A 5EMYA 4PRHB 3JYBA 4P2YA 3UTTD 2NNRA 3ZE2E 5I6MA 4U4IA 4TPRH 3ZT6A 2YAHA 4APXB 3UPRA 4JHUA 4OIIL 5JMRA 1PZ5A 4P2OC 3AQYA 5KSAD 2Q7YA 2WN3A 1X7TA 4NNXB 3H42H 3H0TA 3ZDYB 4I4WB 4R5VA 1G7JB 2ATKB 2YQGA 3QE5A 1AQ8A 2FEJA 2R0WH 3E7JA 3KPQB 5JO5B 2QQNL 3ZE1E 3JT0A 1ZVSB 3I6KB 2WBWB 4EUPB 2BFVL 2BSED 2ZONA 4WW2F 1BXVA 1PLGL 3IGAA 1PS3A 4M61A 3PPSA 1OAKH 4FFWD 2EE9A 2X88A 1IVLA 3LKOA 4PJ5D 4CC4C 4PB9L 1CTOA 3BP5B 3QIUB 1J9CT 3B9KC 3MCKB 5FKPB 2H7WA 3WN5C 2CHWA 3HZYB 3NFNB 2X4OB 4KZ0A 3TONA 4CGUB 1DYZA 1RZJL 4UIKH 4PUBL 1JF5A 5KSAA 1OTSD 3LQZA 4QRPD 3SKMA 1WUNT 4PTUB 4ZFZB 1ETJA 4UDTA 5E99L 2DQDH 3THML 1LM8V 4PS3A 2XRAL 4FLSA 4A2FA 1QI4A 1CLYH 2VKWA 3A0OA 1MPAL 5MEPB 1OCCB 2E74C 3D3VA 5TF1L 3TCLA 1AGEA 5F9DC 2NZ9C 1OOAA 1T83A 2Q3XA 4R97C 4Q7DA 4AYGA 1HX0A 2CU9A 3RWCB 4A2EA 2WNKA 2C26A 2C4FT 4KXCA 4GBXD 3P9MA 3LX9A 2CGRH 2OTUA 2YN3A 4QOKE 3HIZA 2E7DA 4PH8A 4PMEA 3PY9A 4NNPL 2Q86A 5FYLH 1XGUA 2JIXD 1E4KA 3HG1A 3E80A 3JYCA 5HHQB 4JO3H 5LB1A 4GAYB 2BP0B 4P23B 1I3VA 4G1MA 4DUWA 4AZUA 4ELMA 3CHXA 5DQJA 2CJTA 1L9TA 1QLEB 5KVGH 1UWEH 3LSOB 4MMYB 4Y7MA 1GTNA 2CRMA 3O9WA 2X89A 2WXJA 2CKBB 3IFOB 3KGTA 1OGTB 1I8AA 3L3OB 3IDJA 3ARXA 4F37K 2QDWA 1IARB 3NEEA 3V6ZA 1FDLL 4I3SL 1EGJH 1BXXA 4AT6A 3LKRA 1OXYA 1T66D 3LIUA 4HKJA 4JFOA 4JN2B 4MQ7B 1ACYH 1WAAE 3EH2A 3ISWA 2XU9A 1EAPB 3CDGA 3FFOA 4CUCA 4Z77A 4ZPTB 1FLRL 4UZUA 3GDBA 4XVTL 4IDLA 2FJUB 4JRYB 1FHNA 3QIUD 4H26A 5I0XA 2F54D 2AI0H 2X2JA 3RL1B 5D55A 3GSRB 5CD5D 3QUMB 1M3IA 2EH7H 3R7RA 4OFQA 5DO8A 2MCPL 4OT1H 3LDBC 5EUOB 3GSQA 1XEUA 4LLWB 2XPGB 4PP2B 1X44A 2DWTA 2Y2TA 4P5TA 4JL2A 3QORB 4NCC1 2G3NA 4NQSB 5IQ7L 3TVMD 5C0BD 5IB1B 4PRPB 3KGSA 4YAQA 4L3EA 1T21B 3MNMA 5J8OA 1U8IB 3ZPDA 4YE0A 1P2CA 1KV3A 1C08B 3SE6A 1WT5A 2X6MA 2CDGB 3D05A 4L1TA 4NJAH 1E30A 5BO1L 1KN4H 5GJSL 2FQGA 2DJMA 2NUTB 4JFXA 3QCUL 4FQIH 1AE6L 1ZK9A 3MRCA 1ZA3A 2WXIA 4JO4L 2FIKB 5IMOB 4PLNC 1NAMH 4FI6A 4TPRL 5DD5H 1W6LA 1NICA 1TENA 1TQCC 2VDKB 3ZE0F 3FQ2A 3FSZA 4HXAH 5D4QA 5D7HA 5T3XH 1ND0B 3DSNA 1WBYB 2R2EB 1KXTA 1WF5A 2VDKH 3V6OC 4HOMA 2R2HA 4NO0A 3PGFH 5E6SB 3AU1A 2VLJE 1KFAH 3UAJC 5KSAB 3MFFB 2NQCA 1N2RB 3CHRA 4UINL 3FTUA 4A2DA 5B38A 4FNTA 5DS8A 2QGEA 7PCYA 5EU7E 3S3BB 3QDMB 2DYPD 2X4UB 4X5WA 3F00A 3QUZC 4KRPD 2D31B 4F2EA 3FMGH 1UOVA 1AIFB 1RPQA 1BM7A 5DRZB 3FCTB 3D69B 3TPKA 1MFEL 1S7VA 1QI5A 3CFTA 3WKNA 5INDB 1YEIH 5FWQA 5SWQA 5E24E 5E08H 1BYNA 1S7QB 1INQB 2F53E 1EO7A 4GI8A 4AYFB 1P9MC 4Y1AE 3KL0A 3A6CH 4XMPL 1IILE 3TBVA 3VXUD 3L3KB 4ZPVA 3X1GA 2XBZA 5I8CA 3CSBA 1AQKL 1QSEE 2QKSA 3QCVL 5CSZB 4NXKA 5LBSA 1JZ2A 1T1WB 4HBCH 3LB6D 3EYVA 1HEZB 2YPVH 3O4LB 4HGWA 3M8OL 1RJZA 1TJIL 2NYYD 3ZVVA 4H5SB 3VXTA 1XAKA 3BQUB 4LCWA 4QRPB 4TSCH 5EIIA 3NAAL 1NCGA 2DN7A 3MRFB 1LEIB 1TZOA 3HEIB 5IHLB 2NT0A 5J13C 3L3JB 1QEWA 5FYKU 3MRHB 1ES0B 1PKOA 4JB9L 4LU5L 1VGEH 3ASOB 4FNLL 4MJ5A 4E5XG 1RZFL 5H37A 3L7EA 4HKJB 4JFOB 3ZUNC 1TTAA 1PG7W 4P4KA 2R2CA 4QHMA 3GO1L 4N0YL 5H35B 4BQCA 3AREC 3OKDA 5HJ3B 2KZKA 2WLIB 4MB1A 2WB1A 4MAUH 1QLFB 1QLRA 3HNTH 3VWJD 5I0ZA 3OZ9H 4TVSa 4WKZA 4GQRA 1G7IB 5DZAA 5I19L 4ZQKB 4U0RC 1M7UA 3T04D 4ZUVA 3QZBA 1GRWA 5K1VA 2HAZA 4R96A 1A4KA 5AAWC 5JLZA 3D50A 4BDVA 4HIJB 1D5BB 3KYOB 4YHOL 3CXHK 3D0LA 1MH5B 4BH8B 5KVDE 5TDPA 1ACXA 1NDGB 4F9PC 5AZUA 4KXZH 4R4FH 1BEYL 1UXWA 3HAEG 4MVBC 1T6WA 4P9HC 5GZNA 4YMPA 5KSBA 3G6JE 2FBJH 3K0YA 3LRSB 1CFQB 1UD2A 3EFFB 3QYCA 2Y36H 4GXFA 4JRXA 5HDQH 4OBRA 1MW0A 1XGTB 4KXZI 1UWGH 2A99A 2BSCA 3NSYA 1L9RA 4U3XA 4E0RB 3P0VL 2VR6A 2OS7A 4LCCA 4MAUL 1I7TA 1HT6A 2YBRA 2YEZA 3TPUA 1MY5A 4OLVL 4JJ5B 1S3KL 4P07A 5LAPA 4PJBF 3MV9B 5KS9E 1RZKH 2WBJA 5T1KD 3DXAD 3KWUA 4GRLC 5IGXH 1JERA 3RB5A 1I1AA 4HDIB 3PXJA 2PYEB 4MNQE 4WUUD 4AM0Q 2UX6A 2B9AA 2EEAA 2VDRH 3UDWC 4KZDH 4HALA 4FFZA 2YUVA 4FF9A 5EEXA 4NO5A 1DFBL 1KLFB 3L5XL 3ZKSD 1H6EA 3K7UA 4X2UA 1SDDB 2AK4D 1O7DC 4AJ0A 5LXGL 1OAKL 2NZ1A 4JZOB 4U1HA 3V0EA 4IHOB 1E6JH 5B8CA 4EOWL 1F8TH 4WI5A 4XI5D 2JJUA 4OJFL 1XF1A 1D9KB 1R0AH 3W0WA 4OKDA 1FZMA 1HJCA 5BV7B 1L3WA 5C2BH 3PGDB 3OKMB 4XP5H 1MVYA 1IGTB 1YUHB 1YEFH 3DYOA 4NYLB 1U2HA 5IEHB 2BVEA 5K1NA 1RK1B 1XXFC 3OPZL 2F19L 5EPMB 1J9QA 3T8VA 3VFSB 4OVUA 3KPMA 1WBZA 1N0LB 3FSVA 3VCLB 2DD8L 1S9VB 4PCYA 4BFEA 4HXBL 4JK0D 1EUTA 1W72B 3VFMA 4D9QD 4N6RA 2XWTA 4NO2B 3MLSH 3IJ9A 3FRPB 1UH3A 4GB9A 1NJ9B 4XNMA 4EI6B 2J3SA 4JAMB 1CIDA 2BIIA 2GSMB 2C7UB 1X5ZA 1OPOA 1KG0B 5C6TL 3M45A 1HYRC 4TUJB 3B9AA 3EYSL 1E65A 3H4FA 4KRLB 2Z91B 5EOTB 1KXVC 2VMJA 1MCEA 1QKZL 2Y69B 3PWJB 5E2VH 3QI9C 4ZX6A 5F7BA 5K9KB 2IAMC 3H9SD 1UB6B 2WM0A 1S9XA 1RSFA 2NY2D 2QTEA 4GG8A 4QRSB 1N5YH 4IKNA 5I8EA 4AQ8C 4FNPA 2JVUA 4ZUVB 2YR3A 3GPEA 4IGBA 4IOFD 2Y7QB 4P2QA 2DWEA 5E1AB 3SDCB 3T6ZA 4LXFA 4WTZA 2WZ0A 2GCYB 3JWNH 4Y2OA 4AZ8A 4BK5C 3R7QA 2F5AL 1CDCA 1IGFH 4TS6A 4WI4A 1XMWA 5ALCH 2Q3ZA 1PZ5B 3MFGB 2DBLH 2DWDB 4X8CA 4NO0D 1MW2A 5DJAA 1BQHG 1R5VA 3O2VH 2VGLM 4LCWE 2ADJA 3ZDXF 2CO7B 3LZNA 5I1JL 1FNEA 1QUNA 5HHPA 4DW2L 4H40A 3HS0A 4BQ8A 1NCWH 2ZOWA 3CDZB 2WP3T 4K07A 4Z0XA 2XFXB 5D9SA 2ZX8A 4MSWA 3RUGE 1XGRB 1B6UA 1DVZA 3FTVA 2JJTC 2R56L 4DVRL 5CINL 5JORB 1GZQA 3LEYH 1ZANH 4FL4C 3VWJB 3D0VB 1MOEA 1IQWL 5T3XE 3D0AA 2YQ2A 3LIZL 3BO8A 1NANH 1D5ZB 1KFGA 1B0GA 2EYTA 3C6EA 3QPXH 4PRDB 4K3GA 1HE7A 2QPFA 5JMOC 4W9GC 4YR6A 4W68A 2YK1L 1FGNH 3Q0HA 1NFDA 5L8JB 4FYQA 4M1CD 3NUKA 1FV1B 5L6YH 3GNMH 4OLYH 3U4KA 4KK9C 1DVSA 3AXLB 3ZRSA 1JXDA 4PLKD 3P73A 4KWUA 1GZPA 1MCIA 2RACA 2W59A 4BFBD 4WNJA 2PWEA 5DZOA 2VLJA 2OL3B 4LPYA 2QKIC 3WIHL 3G5VB 1B4JH 2G5UA 4R7DA 1D5XA 4P23C 1CD9B 5DD5L 4PJ7E 5ESQB 5AD0A 5EU6E 3ARFC 2ORBL 1MKFA 3R06B 4Z23A 4YSOA 2E86A 1CFSA 1WCQA 1LO3H 2BJML 5F7UA 5DJ6A 3RE0A 4B9GA 2G9KA 3CVHB 4X6BB 6PCYA 2ZF9A 5C0BE 1GCYA 3SB3A 2P49B 4XVSH 2UWEA 5F9JA 5D4IA 5GGSB 2O5XH 4ZT1A 2YIHA 1KCUH 4YX2H 2V2XA 1GJUA 2HKFL 2HP4A 2KHAA 2F6AA 5JHMA 1PZ2A 1NBYA 1K4DB 1SXCA 4GRWH 1I3GH 3N40P 5D93C 3C9NB 4I48A 2Z31A 1U8OB 3M46A 3AY2A 1NINA 3O0LA 1UB5A 1CL7L 3O8XB 4DEWA 1XGYH 1HHKB 5FA3B 5IF0A 3NOIA 2WKGA 4PJDF 2X0WA 1HEHC 4WZ9A 5EN3A 2LAAA 3MX0B 2HWZH 3EJYC 4G8GA 2AQRA 1MREL 3JVFC 2VXUH 5GRUL 3K6SB 5DEGA 3EZJB 3EDKA 4WW1B 4LLAA 2VSKB 1TTFA 3INUH 1Y6KR 4ATWA 3EJZD 2XTLA 5DVLA 2YOAA 4BWUA 5CGYC 3BD5A 5AOKA 2X6BA 1UA3A 4HH9A 1EGJL 5KOMC 2XVLA 4MAYD 3F6IA 2DKUA 1BAFH 1E5ZA 3WOVA 3BMWA 3SGKA 1WYJA 5C3IA 1OL0A 1IU1A 1JNNL 5AG8A 1IGJB 3MJ7B 1RLBA 2FYVA 2Z34A 4N8PA 3F8UB 1A9BB 2JE8A 4YDIH 5ELIA 4R4NC 5FYJU 3HE6D 3VFRA 3TYFA 4LP4A 1NC2D 4HWZA 1LO5A 1UC6A 1DJWA 4P2CG 4M6OH 1KGXA 2EABA 1JF1B 4LPVA 1TVDA 2CDFB 5I6KA 3NJMA 3BN9D 3BH8B 1WFMA 1E2VA 3NABL 4RBPH 4X0NA 3HNSL 1BP3B 3Q06A 3BXNA 4RFNC 2ED6A 2NT1A 3EG9B 5LHDA 1X5JA 1Z3RA 1IAKB 4BCYA 4MZRA 1FVDA 3E9UA 2NXZD 3A22A 2R39A 1NBQA 3PJSA 2DTML 2FNWA 2XKSA 2XN2A 4ZDHA 1F4AA 5I8KL 2NQ3A 1D5ZA 3BRDA 3LHPH 2R7EA 5HVFB 3H6JA 3SDCD 3T0EE 1XF5A 2MNUA 1GHFL 3NFPB 2VXTL 4BFIB 4M5TA 2VERA 3ARED 2K9UA 1JPSL 4K5PA 2RJMA 3V79C 1M05A 3U46B 2QADC 4PJEE 5FYJH 1I82A 1MI5E 3LPFA 3BQUD 4QXUL 2JJVA 5TE4L 3UDWA 3U9UB 4YSPA 1ZK5A 2EEDA 4GSRA 2OYPA 3QEUA 4OGZA 1BIIB 1SHWA 3F2LA 3VD2A 4BCXA 2JKIS 4K5MA 5ESQA 5AD0B 2YJLA 4HOXA 3KYKL 1LEKB 4GXUN 5E5MB 4DZBA 2MTPA 4TF4A 3X12B 3QNYA 3RWJB 4FQPA 1IM3D 2EC8A 2YPLB 4ZW8A 4ONGH 4UNTA 3WIAA 4QUOA 1HL5A 3LQZB 4YVNA 2PXYA 2VXQL 4KMLB 3SKMB 3FYIB 3VFNA 2FHCA 5DVKA 3RKDC 4KK6C 3FAXA 1JGIA 3PNRB 3SGKC 5GISL 1C5CH 4FQCL 4JKMA 2HRHA 3QEQE 4WHYH 2WQWA 4JVWA 2W65A 2DQ6A 3LDBB 4IOIA 4WTQA 5FO9B 2G0LA 4G8EA 5JHDB 1RV6X 1RIHL 1PF3A 1B4JL 2NY3B 3VFWA 3QJHA 3MRPB 4HHAA 4OIIH 3FOLB 3I6GA 5HI5D 5BZXA 4QXGL 2VDNB 1XCWA 1H15B 5E4IA 1KB9J 4FYRA 1KJMB 5JIIA 3WELA 5EWIH 4MDRA 4W9LC 2Q86B 3GHBL 3HMWL 4FTDA 5HGHA 3GSVA 1TETH 4M9PA 4RH4A 3CHPA 4LEXH 1PQZA 4K8RD 1IM9B 3ASWA 3TA3D 2VDMB 4GAYA 1AO7D 3IXTB 3X17A 2QFRA 1MCJA 4RGNC 2O30A 1PL3A 4Z7UB 3RGVB 3DHUA 3C5JA 4KQ4H 1CI5A 3MKGA 2VL4A 4K7PY 4YC2B 4ZO7A 1CZ8L 3D18A 2W8CA 4X6FB 3WUZA 1NH6A 1TZ8A 1MRCL 2BVOB 1YEHH 4WWID 1A47A 4ZMAT 3U2SB 3W9DB 1FN4B 2V33A 3NFSL 4G6ML 3MGOB 4PM1A 1TZGL 4GSXA 5GZOA 1OCZB 1BFVH 5ENWA 3RX7A 3SDXB 3DLQR 5DDHA 4UIKL 1NMCB 3MR9A 1WZMA 1NAML 2RTTA 2NY6D 5DQDH 4IBQA 3LD8C 3P40A 2OL3H 1CF8H 3DV4A 4R0LB 1WZKA 4ZBJA 4KTDH 2LU3A 4F58L 4S0HA 2LVEA 5DYOB 3ATEA 5J1TC 2NY1D 2QLYA 5J3HC 3REVB 1MQ8A 5BS0A 3VGDA 1NMCC 2O6PA 1LE5A 1QR4A 1CVRA 5I73B 1IO4C 4QRRD 4RA3A 5T1DH 5BRZA 2JJSA 1TKWA 3V0VB 3MKKA 4Y5YA 3WFHB 4CDGC 3IEAA 4PYGA 2XWZA 2GSGB 3TF4A 2H8PB 4U6HA 3L3IB 3N0PB 4PLJD 2G2RB 2XBDA 2ROXA 4A7SA 3PGCB 3VG0L 4GG6E 1U3HA 2UWEF 1OW0A 5E94A 4XRCA 3S37H 2D73A 2Q3AA 2VISA 4GLRI 1JVLA 2BSTA 3I9GL 4LOVA 3CN0A 3ULVF 1T03H 3QFJA 1NBVH 3P3SA 4HIHB 4JDEA 1PX3A 3V4PB 3WN6A 1AR1B 3L95B 4V1DB 3FTGB 4J7RA 4UB0H 5F93C 4X5XB 2XZCL 2YPVL 3C8HA 5EU4B 3CZFA 3OG6B 4IHOA 4JRFA 4OQTA 4CA4A 1A7NH 5IKCA 2QV2A 1E4XI 3IS1X 3TV3L 1A7QL 2TRHA 4WWPA 3PAVA 5FO2A 3OC8A 5C07B 3TJEL 4FKHA 4HD5A 3FU9A 4F8TA 4OCWH 5I76A 2JV6A 5C0ND 2EC9U 3ZK0A 4X8JB 3SCMD 2VM9A 1N12A 5D70H 2DQGH 4NO3B 1WPCA 2PNDA 4YN3A 2BNRE 5FFOA 1FH5H 2FO8A 1G6RH 4FQ1H 2NNCA 3FCTA 1KGIA 4KI5F 1A7RL 1WP6A 3IYLW 3S6CA 1FL3B 5JW4Q 1YMHB 1FSKC 4RZCB 3ZZ1A 5KBMA 3AREB 2PP8A 3JZ7A 4AOFA 4U1IB 5ACZA 5F6HI 1BG1A 5BW7A 3RWGB 1IAOA 1G9NH 1CLOH 2A74C 3O3UN 5F3BA 3B1UA 1GOGA 5SWSE 3ULUL 3OB0K 2C3VA 1ZJBA 1UATA 1EHKB 2A6IA 4P9HL 4NWUL 3WLBA 3IAPA 4Z7VA 3BSZA 3OR6B 3DOSB 1S5HA 5B21A 3VACA 4KK9D 4Z1PA 4P2OA 1T7YA 2G0KA 3GJFB 2FWSA 1RJZB 5A7EA 4LBAA 3DYPA 3HNVL 4H4NA 5T1MA 1DBAH 4PJGB 4EIZC 4IRSD 3T6QC 3CMGA 3EJJX 5T33L 2V17H 4L9DA 4ZUWA 1UM4H 1ROCA 2WINA 4FQHB 4ZRGA 3MROA 3OX8B 4DK3A 1I8IA 1NOFA 5JHDD 2BSSA 1ZSDA 1YVLA 2FNBA 3CK0L 4CW1A 2D3LA 4ACPA 4G6KH 4JFDD 3VX0A 2E4FA 2IGTA 3LIZA 5I30H 4BSJA 2O26U 3FNKA 3QR0A 4R83A 3ZSTA 3WIIH 4X83A 1AXSB 1T7WA 1CLOL 1QA9B 4N1CA 2OZ4L 4KHTH 4J39A 1T0OA 2OMYB 3DROB 3UCRA 2LLLA 4LLDB 2DQIH 5JYLA 3M1BA 1YN6B 5FR3A 3CPLA 3QZWA 4AYMC 3PDOA 1KTLA 2VABB 5D1QB 1XX9C 5I74B 1F86A 2QTVA 5TQ0H 3FFDA 1ZHKB 1QOKA 1ZVNA 1U8PB 5TK4A 2Q1EA 4DO4A 2ENJA 1FFQA 2VZ1A 3QCVH 5EA0L 3LXBA 4PJGF 2RA1A 5FYLL 1XT5A 5DJYB 1QNZH 2CLVA 2R1XB 1K4CA 4FI8A 2XIBA 3CFJA 3QARA 1DBKH 4NHUA 4YE4L 3IFLL 4GPVA 4HP5A 4YHYC 3RJQB 2XN9E 4YBQC 5H4ZA 3FN9A 5FDYA 5CXPA 2HN7B 1B4LA 4PLKC 3HW7A 4OZ4A 4MD4A 1PMYA 2AQNA 2H32A 4H8WH 1E4XH 4ZK8A 3NAAH 1UWEL 1FIEA 4EXPX 5A1AA 3SDDB 1A7PL 4GRWB 3W5MA 1UJ3C 4K0OA 5F1NB 3NEXA 3NA9L 1BMZA 1NMBL 1AGDA 2DD8H 3KH3A 3V0WH 3IFNH 1G9ML 4BFOA 2DI7A 4QRTA 3U6XS 1FI8C 4IU3B 1DQKA 3CBKB 2BXZA 3D1MC 4RAUB 5I1HH 4FXGA 1WICA 1A3LH 2OPCA 1F3DH 1YN7B 1GGUA 2A9AA 3SDDC 1IC1A 1AI1H 2WIIA 3TBYA 4POZC 1KULA 1I1FA 5LGKA 5IEKA 2HJKA 3TWYA 3P1VA 2ZUXA 5J57B 2FT8A 4P3DB 5T3ZE 1UZ8B 4LAJH 4X5RA 2HXAA 5C1MB 1DEEB 1U91A 2AJZB 2BH0A 4N8VA 1T1ZA 1HL4A 3ROLA 1KGYE 2XNAB 4I85A 43C9A 2B1HL 2CK0H 4PB0L 2JLPA 4Y2LA 4FA6A 3IVKA 1P7QB 4NC0B 4ONGL 1G6RA 5HHMB 5F96L 3MN8A 3OL2A 1XCTB 1KIUA 4KNSA 4HIEB 2MQCA 4O5LH 2AITA 3V0WL 1FPTL 4DKAA 2EDRA 1G9EA 5F88B 4R3SA 3EOTH 5ILTL 1JK8B 5DC4B 5IFAH 2PO6A 2QMJA 3TIDB 5CBAB 1W0YT 2X44D 2BOBB 4IBVA 2AJYL 4OLVH 1JGDA 4NQTA 5CP7A 4XNMB 2L7EA 3IJYA 2PPFA 3UZVB 3UGXA 1OGAB 4P2RB 4IRSA 4E42B 3MRKA 2QR0B 7TAAA 2EJ1A 1MLCB 2XG4A 1MCRA 2YHGA 1FQ9C 3HE6C 1I85A 3IJ7A 5GS0L 2CIIA 2WVVA 1E8ZA 3T4YA 3UGEA 2VAJA 1Z32X 4ZFOB 1TQBC 3BPOB 1B2WH 2VZUA 4KO7A 4XNUL 3RU8L 3GMRB 3LNHA 2EE2A 5CCKH 32C2A 4W9IC 5IMLA 1YY9D 3CFIC 1GGYA 1YEGH 4NLAA 3TWCH 2WGNB 2FAUA 2XX1A 3CFKB 3QIWD 1I8KA 1DBJH 3CZGA 4Q6KA 2V17L 3RFZA 3IMVA 1MCFA 2K70A 2NYYC 1G4MA 2B9BA 4PVMA 3QXDB 4NWTL 3ALPA 3FB7A 3II3A 3AQXA 4AENB 2I7SA 3ARFA 3QJFB 3UTSD 2Z6FA 5JW4M 5FIEA 2F19H 1SJMA 3K1KC 4O4YL 5INCB 4QRBA 1I53A 4M7LL 3BISA 4UANA 3D3VE 3BVNA 3QZLA 3ZHLA 4QHLA 1FIGL 1IMHC 3VQ1C 3VRJB 1FDLH 4H20H 3WY3A 5K39B 5DJ8A 1OANA 3B2VH 4LSQH 4PJHF 3D6GA 3T0DA 3D39B 2V9RA 4YEFA 2GSIA 4E41E 5E5LA 4PV1C 4RQQA 1IL1B 1RZIA 1ZLVK 3GIVA 4YIQB 1WC7B 2DJUA 1QATA 3C6SB 2W9EH 5TDNB 3TP4A 2EE3A 1XGQB 3P3RA 1WIPA 1XXDC 4C4KO 2IV8A 2W81C 4I18C 4LO9A 3WKMH 1I8LC 2D0HA 5D72L 3ZRCC 4WUUB 5FF6B 2BNQD 2AHIA 1YA5A 1U92B 4Y16B 1QTPA 4GFTB 5A2IH 3I9IA 3JWNG 2ZT9C 2CLRB 3AG4B 1YN7A 4FFVC 3NTCH 4PJCF 3LRGA 4WEBH 4M6ML 1DUYA 5KBDA 4A04A 5CCHE 4XMUA 1G6VK 1N7MH 2VH5H 4LLUB 4RIRA 5AW2B 3MLZL 3PL6A 4PJ7A 4JPVH 3GZKA 2HH0L 3SKNB 2ZKWA 2Z35A 4FKEA 5KSUB 2Q8BL 4CVXB 5HI5C 1E43A 5AZEH 3QJHB 4WFEE 2VDOB 2X2YA 2BDNL 3GSUA 2PPDA 2YGVA 4FQLH 1AGBB 2UY6A 1DN0B 4J4PC 4TQEH 2Y5EA 5DD6A 4PJAA 3BZ5A 5BS0D 3QWNA 4K73A 3DBXB 4WTXA 2FBJL 1RZ8A 3HR5A 1DJSA 3LNEA 5JPNB 4GKOA 4NQDE 4QYOB 3X14B 3KCPA 2BY3A 3CN1A 3TO4A 3SOBH 2IAND 1ZEAH 1HKFA 1XH3B 4TVPH 3N44F 4MQTB 3ARGC 4N85A 1IQWH 2W5PA 3A67L 3ZE2F 4P06A 4N2GA 2ENQA 1CFMA 3KXFD 3OKEA 2GBTA 5DGQA 4D94A 4DKTA 4GIOA 3BZFA 3DVGA 3EGSB 5C0JB 1G0YR 4GO6B 3S4SG 1FGVL 4ZMLA 2NUPB 2WPGA 1S7SA 3QS3A 1RUPH 2NY6C 4HWBL 3ZIMA 2HH0H 4X6CB 1OAJA 3BH4A 1BDYA 3JVGA 4X7CC 3X2QB 2X1PA 3W9EA 5C3LD 5DJCA 2E6QA 3MUY1 1MLBB 1QSFA 3X3FL 2UZIL 3VXOB 4WEMB 2H0JA 5LQBH 5LNDA 1OD7A 1JGUL 3ARUA 1WEJH 4L4TE 2X4RB 2NY1C 4TV3A 4XMPH 1PSKH 2YGPA 2HX8A 3N0AA 2B15A 4Y19B 4B6ZA 2V9TA 3PWPB 1CDBA 2WBJC 1AFVH 2TAAA 2ZQKA 3EYQC 4IMKA 4JVUA 3S5LA 2AJYH 1J8KA 4QRAA 2WLYA 3U0TA 4WU7B 5IJVA 3SE4C 5D7LE 4LLMA 3ZL1A 4A63A 4LP5A 5EO9A 2Y7SA 4PV8B 3MUJA 1N8ZB 1OB1B 5JOEA 1UM4L 4UQAA 3AY4C 1JHKL 2K7QA 3KGUA 2J8UB 1NUDA 2P5WD 1J8SA 5IVNA 1MFNA 4GI9A 3NMEA 4XVSL 3WTXA 4XMKL 5EDXA 4N2NA 4AKOA 4RVBA 5HPOA 5I6XC 3OG4B 1PZ3A 2SEBA 5T1LA 4U7MA 3MNWA 1E6OH 3MUGA 3QDJD 5CCKL 4LNVA 5I30L 4CNIB 4I1PA 4MDIA 1WLHA 4KK5D 5SV4A 3MA7A 3HKZA 5K9JH 1WGOA 4Z7QB 1Y18A 4DF9A 2FATH 1AD9B 2VISB 4TVPE 4IRSC 1DSFL 1OM3L 1WK0A 5L2JB 3K74B 4BXVA 43CAA 3KYNB 3OMAB 1BFOB 4YL9A 3GSOB 2WVUA 5IB4A 3ZHNA 5SWQB 2I9LB 3RVXC 4ILDA 4E36A 1E9QA 4Y4KC 3ALWA 5C0AD 4YZFF 2EIDA 1J12A 3C2SA 1BLNA 1DVFB 4LOUD 4C83B 3ZDXE 3VRLE 4JFUA 3SGDH 1MQKH 2X05A 3QDJA 4JN1L 2Z64C 2VDLL 1PCSA 2E9IA 4W4NA 4Q14A 4EI5C 1JZ3A 5E9DB 5AKVA 4U1LA 3TIEB 1GYAA 3L1OH 3UTSB 2PF6A 3G6AB 2OMWB 4K7PL 4XO8A 5BMFH 2FHBA 4OQ1A 3EGDB 1LXMA 1ZPLA 1XR9A 2G60L 3PXLA 1CTNA 1DQLL 1DFXA 1DVFC 4UV7H 5CR1A 2OSXA 3MPCA 3NP3A 1A14L 2F53B 1B9ZA 1LEGB 3D25A 1HZHL 5HPMB 1KDIA 3GXPA 3Q1SL 1W9XA 1USQA 4DPBX 4DN4H 1F58H 1OK0A 3HR5B 4LKCB 3ZHKA 2WBXA 1E3XA 4YZFE 1JI2A 4Y9BA 3TBWB 1NC2A 3QDME 2AGJL 4AQAB 4DCQB 5C07D 4ZI8A 2DQHL 2I69A 5KVEL 3QQDB 4OZIE 4TL5A 3VFWB 2CJ3A 4XXCC 2WXLA 3D52A 4FHKA 4LEOA 4XE0A 4J8RA 2KDYA 1EDQA 2QJDA 4NFCA 4BZ2H 4EVNA 2FQEA 5CKGA 4L8DB 5E2UH 7CGTA 3CX5J 1H3TA 1QZNA 5FGRA 3RIFF 3QQ3B 3Q8EA 2DLIA 4JFZH 3U6XA 3L54A 3CSFA 2A1WL 2P48B 2YRZA 1HWWA 3SDAA 4B5ZA 1AMYA 4PJ9C 2MPAL 2PW2B 4LVHC 3UCQA 2FJGA 1N5AA 3FQXB 2K6YA 2R4SL 2FJHB 4DKDC 4EPSA 3B2DC 4TTDD 1GL4B 2XWJA 2GTQA 2R1YA 2KQMA 1YPZA 2CALA 1MCWW 4K8RL 2AV7B 4ZO8A 1JNLH 1BVZA 5I6NA 2EDWA 4ELKA 3QRLA 3WL9B 3KYKH 2ARWA 2C9AA 5IQOA 1KXQA 2GJZB 1WIUA 4H8UA 4XGZB 3N43F 1U8HA 2ORBH 3QSKB 2L8AA 4MA7L 5KVEH 1FFRA 1E27A 3FL7A 3O3DA 1NBVL 3B2UC 4ONFH 4RMQA 4G3YH 2EXSA 1PU0A 3N41F 2VXVL 4KRPB 4QIRA 2KBGA 3IGUA 4KX9A 4L48A 5A2AA 4NJAL 5GS0H 1EUUA 4JPKH 1OQXA 1KGJA 1GZHC 2Q20A 4ONHB 4MA8L 5DYOA 2NMSA 2WZ6A 1KCRL 4PP1D 4XC3H 5D5ME 2E47A 3BUIA 1HOCA 4A2GA 5ICYA 5JW4N 4P5KA 3CXDL 3OXSA 4AMWA 4BJLA 1M42A 4MX7A 1J48A 3FH8A 5E6UB 4JDTH 4UZGA 4IDJH 3BPCA 3ARPA 2A7BA 4H25A 4U3SA 5C08B 2KI6A 2H32B 2IGFH 2WIMA 5I1CH 2X6UA 1I3RA 2GTZA 5ID1A 4I4WA 1IBGH 3A6OA 4JZOA 1KELL 1BZ9A 1GW0A 3HI1B 4WW2A 4UINH 1E9QB 4E9TA 3EBAA 3FUMA 4M4RB 3IWUA 2G9HB 4ES9A 4R4ND 1OAUL 3VNZA 4BIKA 1DE4A 2UX7A 1U36A 4QO1B 4KUZH 1IAMA 3JWDL 1YYCA 2VQTA 4XVUD 1SYVA 5FC9A 4OM1L 3UTSA 4N1EA 2CDEA 5AB1A 3F84A 4Y4KB 1E5AA 5IROD 3WXVH 2E27L 4BWTA 4JFQA 2IOIA 2X87A 4WUKL 3KPPA 2MRYA 2WWOA 4M43L 1QR1B 4NQEA 1FYTA 4X9BA 3QR1A 4MDJB 2X4PA 1JFQH 2RH0A 2CG9X 1OF2B 2JJSC 1SJEA 2P8LA 2VLRD 4HBCL 4HIIB 4JO3L 4QJ5B 3NESA 2IQ9H 4P2QE 3Q48A 4ZUTB 1FSKB 2VNCA 1U30A 4PJIE 3HB3D 4GUOA 4LE8A 1W6WA 3FZUD 4K23H 5EB9A 1JZGA 3BP6B 1I9IL 2XG5B 1W8OA 4XAWL 4P2AA 2E6PA 2MEJB 3D48R 5D6DC 5BOPA 1YJDL 2OMTB 2YKKA 3LNGA 3E8UH 4BFNA 4BSWA 5EUKA 3KPLB 2P8MB 4UQ3B 4XBEL 5JQ6H 2VMDA 4RISH 3CFCH 1TVHB 3DA0A 3QJRB 2X3CA 3FB5B 3NN8B 4HIXL 2WQ8A 3GO1H 4XPBL 3UPAA 1B4RA 4U6TA 4PJXB 3VFVA 1YNTA 1XSIA 5GSRA 1BZ8A 3VGGA 2VC2L 1MNUL 4AL8H 4N4YB 3BOVA 5CZRA 3I85A 4XCCH 4MD5A 4MXWH 5IM7A 1E9PB 2YWZA 4XVJL 4CSPA 2R0WL 2B4CH 3F7VB 3F05A 3JWNE 3K46A 4YHPB 5T1KB 2MKWA 4P57A 3HKFA 5E2UL 4G8FA 2DIEA 5ANME 4LHUG 1D7DA 3KYMB 4HMEA 3WHXA 2Z93B 3G7TA 4KMQA 5CR8A 6CGTA 4WI0A 4ZS6C 5E8OA 3QEQB 1CLVA 1PLGH 2R83A 3TX4A 1KCUL 4Y1AA 3VM5A 1G9MC 1VSCA 2H45A 3FFCA 4LRNH 1JMZA 1MFBL 2KUTA 4EBQL 2UXGA 2QQKL 5TFSH 3EZ8A 2IQAA 1JTTA 2CA3A 1EGJA 5D7KE 1CL7H 3RLSA 1UGKA 1AGFA 5E8NA 4RGND 1NOLA 3TNMA 3W1ZA 3B7TA 1TLKA 4MMXB 4CADB 2VXUL 3R1GH 2UY7B 2GSIB 1ZGLP 3CVHH 1NFDF 2V5TA 4DP5X 1M7XA 1CL7I 3KNBA 5D2LA 4Q4IA 4D9RE 4PJFF 3JWOH 4OAWA 1YQVH 2D7TH 4ETYA 2EIMB 5DZ9A 4LASH 1SEQH 1N3NA 3L5JA 4NWUH 4B7IA 1K4CB 4Y5XB 4LPUA 3OHXB 5B3JE 5GGUA 4YSSA 1YNKH 3NVQA 4XC3L 3B6SA 1SN5A 3FQNB 4TUOB 1JZ5A 4TULL 1SLUA 3VAEA 3HPJB 3NSJA 4PSRA 4TYUA 1NFKA 3WS6C 2WZ5A 1OLLA 4WV1C 3ZDZE 3UYPA 2YK1H 3ES6B 3IPBA 4YFLI 5A7BA 5LGYA 2WBJD 3VW3H 1Z1WA 3A4FA 3EYQD 2LU4A 2Q6WB 3SBRA 2NTFB 3SO3C 2GHWB 4PGCA 5DLLA 5JXAH 1T3FB 4A7TA 1TEFA 4O2CA 4PFEA 4WNQA 1JPFA 2JB6B 5D5MB 4F15C 4X7FC 4L05A 5T5FH 2ED9A 4QOKB 1U8MB 2LVCA 3WY1A 5KVGL 3LN5B 3BE1L 5AAMC 1Q0EA 4NQEB 3KLHC 4CDHA 5IIEB 4NN6C 1R5WA 2B3RA 1WAAF 5JXEC 5ETUA 2M26A 1I8MA 4OD1H 1MIEH 2RHEA 1TJXA 3BWAA 3PWPD 3U7YL 4DO5A 1M1XB 5SX5K 4HJJL 4D3CL 3KPTA 1EPFA 4PJAE 3LKNA 1EJ8A 2OMXA 4JKWA 4OZHA 1JXJA 3N1MC 1YY8B 1TQBB 2BERA 3L4YA 5J56B 3TZVB 2L7UA 4D0CB 1B88A 1F4WL 1ODUA 1J05A 3BWUC 4J28A 1QO3A 5KTEH 4S10A 4WUKH 3HUJB 4KKCC 4P48A 5EIVA 5MEOA 3PHOB 3V9CA 2EUZA 3FU5A 4NAQA 1LWHA 3E2HC 3VW3L 12E8H 3K91A 3CMOH 5IUCA 1OT4A 4GIAA 5DJXB 1CC3A 1F97A 1RUMH 3VI4F 5DTFB 3F7YA 4FL4B 4PS4L 4H8HA 2YMOA 4OSUL 4B95C 3TEXA 5AB0A 5KYUB 1RJLA 2IH3B 4N5UA 3Q01A 2A9NH 4JFWA 4EI5D 3HC2A 4OV5B 4X8XA 5EU6A 2VXQH 5D1XA 1RP8A 3DO7A 2XPYA 2AJXL 3M07A 3HE6B 1DZ0A 4XBEH 4Z3TA 4WHDA 3EYOA 2HKHH 3FU7A 1A7NL 1MAJA 4NENB 4M48L 2HTLC 5C0FA 3M7OA 1G7MB 2PTUA 4F7TB 1VRSA 3IRPX 3ZKNC 4DPRA 1PAZA 1PVHA 3LEVL 1I7RB 3KHQA 4AV0A 1WHPA 4HSQA 3MCKA 2FWOB 4PJEF 1DQJB 4ENZA 1C1EH 4I3GA 3BD4A 3MYJB 5HHXL 1ZLWK 5TDOA 4YK4C 5D2LF 3NFPA 2VL5B 4XOCA 1INDL 3D51A 4QHKJ 4EDWL 5IMKB 4FQXA 1ZHBA 4P4RA 3CMOL 3U2JA 1SOKA 1BMGA 4V33A 4HCFA 3BUTA 5I0DA 2J6WA 4HKBB 6FABH 3PHAA 4XMKH 4DT2A 1A6ZB 1BM3H 3D0VA 5JHLL 3KJ4C 1DVUA 1DEDA 3ZTCC 2X1QA 3QXDA 2EDJA 5EULV 1L7IL 4NKOB 2QSVA 5ACMA 5IVXB 1JXFA 2EXWC 2NY0C 3HRZC 4WHTA 3RVXD 5EO1A 5CFHA 4ZD3L 4G5ZL 1Q0YH 3IJEB 2HT4C 2MHAB 3B6SB 4TUOA 2VDRL 4M56A 5AUMB 4HK3J 5J9PB 3SHSA 1L7TL 1GHFH 1AZNA 3JSSA 1QHQA 4AVJA 2A9ML 3P9LB 4HF5L 1HKLL 1AO7E 3MNDA 1J10A 4ZNCD 5IFHL 3DJSA 3SD2A 2IANA 4A38A 1QASA 1U8NA 4PJXE 1LNUB 4ZNEE 5MERA 4PR5B 5HDBB 2DLGA 4GAGL 3MVSA 2G4EA 1RFDH 1DVFD 3PAZA 2Q7NA 2P5ED 3NIFE 5BV7C 4NBXB 3ZTNH 1AGCB 2H47C 4ABQA 1KT2A 2IPKB 3EFOA 3ESVF 4IK7A 4XO9A 4H1LH 3PWUA 3RU8H 5F9WB 4WY7L 5JA8B 3LY6A 3DUUB 1AKJA 1SY6L 4KKLD 4PRIB 4QTHA 5EV7A 1TJHL 3PWVB 2O6DA 3FSAA 5JPMB 1RZFH 2AJUL 1BXUA 3Q44A 2ZOLA 5KN5A 2OQJA 4HU8A 4CU7A 1JNHA 4IKKA 3MXWL 4JM2C 4DN4L 1D9KA 1KCBA 5HDWA 4WFFE 3ZL4L 1MUJA 3T65B 1CYGA 2XQYK 3S37L 3EXJA 1OE3A 2ZX7A 2IEPA 4IM8A 5E2JA 2VWEC 2N0MA 5A2BA 4YGVB 4QXGH 1FZOA 4QTIH 1E8XA 1KYUA 1DANU 2BC4A 2JB5H 2HJFB 3QXTA 4DUXA 2GT9B 1YEEH 4H1LG 2V8MA 3FK3A 4NT6A 4LVOB 3ZTJG 5FFGA 5ESAA 1A66A 3DI3B 5A2JH 2E7HA 2FBRA 2OMVA 4WI8A 2YWYA 4PJ7F 1GGBH 4Y2DA 1DO6A 2DEWX 4F7KA 5JPMC 3ULVE 2I9TB 3AAZB 4X6CA 3LZQA 4PGDB 3CFCL 2HVJB 3CNKA 2X7LA 3U6RA 3ILPB 4CN6A 2NY1B 3II1A 1AQDB 3IXAA 3MACL 3WHE0 5FGCB 4G8AC 3GRGA 1YEJH 2WUCH 1U6AL 4ODXA 1NCWL 4XPAL 3KEHA 3V8OA 4LKXB 1E5YA 4FFYH 5DGRA 4E41A 4H7VA 4KKBC 5JW5B 3UAJA 3GM0A 1GGIL 2DYRB 3I3BA 4PS7A 2PKDA 4TNWK 3WDIA 5FM8A 5DS8B 4UM9D 5TPWL 1SM3H 1U8QB 2BDNH 3L3GA 2J57A 4FJYA 1NMAL 3HUJF 3C8KA 3FJTA 5BVJA 1EVTC 4NKMA 5I6XB 3NZHH 3VI3E 5IVXA 1FFPB 1M71A 3VSVA 5KW9L 3UZQA 2DM2A 1MF2L 4ZAKB 3FOMA 3E8VA 4RFEB 1ADQL 3SQRA 4GMTH 3ARDC 1JGEA 5SWZB 1HHIA 5IJBC 1HFUA 5CNHA 1HCVA 1GVIA 5I1GL 1X7QB 4XMLL 3SZKC 1QLEL 1YZZA 1YHPA 5FO8A 2ICEA 4I0PA 1ZIAA 2ZYRA 4OLEA 2F15A 2R2BA 3BW9A 4XVUC 5JOPD 4OV6F 3GSWB 1MJJB 2EVIA 1S78C 1CE6A 1JWUB 4OZHF 4GI6A 5ABZA 4MWFA 3V95A 5LGJA 2AMGA 4P46D 1IC5L 1CF1A 1WWBX 2Y9RT 4PRPD 4R0LC 1EEYB 3ROOA 4WO4A 1PZAA 4DP1X 1Q1JH 2KT6A 3QGVA 4JFFE 3RDJA 4HXBH 3S3PA 5ACZB 8FABA 2NW2A 1KN4L 4UDUB 5GJSH 4F8PA 1WEJL 3DUUA 4PBXA 1ADQA 4P2RD 3AY4A 2A9BA 1Q0XL 4OZGA 2OXHA 1ZHNA 5E2WL 5IHBA 1CR9H 1JZEA 4Z7VB 5JPMA 3VFOA 1UWYA 2ZAHA 1FYTE 1B0IA 4GUPB 1TVBA 1O0VA 2ENSA 4YNYA 3RZCC 5C0BB 4YSEA 5ABAA 3QEHB 2ARJA 3O8XC 3PUUA 4HVBA 5JHAA 1UWGL 3H56A 2EDDA 4K4KA 1OE2A 5GGVH 4RNRA 4GKSA 2EO1A 4XNZC 1N5YL 2P8MA 4UQ3A 5T5FL 1JYNA 2OK0L 1KJ3L 4L2YA 1TCMA 2X70A 5F97E 4OLZH 5ITFA 1NEZB 4Q9RL 4O4YH 1IB5A 2BK8A 2EIEA 1FH2A 4KQ4L 5FYKL 3KHOA 3S3CB 4EN3B 1BXAA 5JDJA 1G5GA 4UT7H 3RZCB 3TBWA 1H3PL 1NIEA 3S2CA 1QEXA 1M6UA 1UWXH 3HN5A 2ZUYA 4UM9A 4WI2A 1OCWL 2F0CA 4X6FA 4DVBA 1TZGH 4E9QA 4X9HA 2P1YA 2BCKA 1ZLUH 2V0AA 4EVNB 3L2NA 3AWEA 3GUFA 5F7DA 5I1IH 3QUMA 1MVUA 2EADA 5BRZE 4HU2A 4LLVA 1NIBA 4AL8L 3WKML 4APQC 2PN5A 4XB3A 1U58A 3K1DA 4QXWA 4HQQH 3Q6FB 1CXIA 4Y5VC 5AW3B 3Q13A 4I7ZC 4G8IB 1T1YB 2GK0A 3WEXA 3EO1A 3GM8A 3DX9B 4JG5A 4FA8A 3MGTB 1MZYA 5LBSL 5IVXF 1NCIA 2WBJB 3P30L 4MA3A 3EAKA 3LEXA 4HEPA 3COOA 1BQLH 4OLZL 3S5ZA 4NQCE 4Z76B 4JRXD 4MCYA 4FQXC 5MP6H 1HINH 3VXMD 3KLAA 5KYNA 2A38A 4LCVA 1C9SA 1FVEB 1AOZA 5FHAH 4N6QA 4IOFC 4PRIE 1BOGB 4KKPA 1HYSC 2CCWA 1OVZA 4P59H 1NFDE 3ZYOA 5DEZA 3RX9A 1WBXA 5D2LB 1T2JA 4KU1A 3MA9L 4P5TC 1IGYB 3HE7C 3EF4A 3TXAA 5IT2H 3I74A 4H44C 4QAMB 4EO5A 2GUYA 2R23B 1CBVL 4GT7A 1NCJA 3FTXA 5GRVK 3CN4A 2AEOA 5HBBA 1ZTXE 1DUZA 5D7IB 3VQMA 2GJ6E 2W0FA 3IGAB 4BEIA 3CZSA 3RUGA 1E5UI 1RIUH 2Y6TE 5J6GA 2NR6D 1LK2A 3OTTA 4XP1H 4OBSA 5K9OA 2CR6A 3SJVB 1AHKA 3G5YA 1R3JB 4FXLA 5LGJB 1R3HB 4N90E 3FT4A 2C9PA 3QFJE 5IV2A 4NIKB 5L7XL 3KLHD 1EAPA 2VZ3A 2IADB 5EFIB 2ADGB 1RY7B 5C71A 2PPCA 1P4BH 3L9BA 5C3TA 5E9DD 5A3ID 2DAVA 4BFRA 5ALBH 1JGUH 3FQ4A 2HFFA 4V2BA 1PD0A 3GMOA 4G80A 4Z95H 2IAMD 2EECA 3U1SH 2NY3D 2OTWB 4XNYL 4AEEA 3QW9A 4B9ZA 2P52A 3GUTA 3FQTB 1A6PA 3TF7C 1BMWA 4NPYB 2QPUA 3UTPE 5JYMA 1YEDA 4HG4J 1IFGA 5C08E 4DUVA 1U2CA 2QDVA 4KXDA 4R2GD 1JPST 2W91A 4YDZA 5LUMA 3C75A 3DDFA 4R4BB 4CMHC 1IIKA 3NCJH 2B14A 4Q89A 3QFDA 5ITFB 4BRJA 4F7MA 4X80H 3T1FA 3QIBB 3S4SB 4KMTH 4EDXA 4U1KA 3ZN6A 4EJ1C 4ZMNA 1P5UA 5D5MF 4NCDA 2XT1B 5D72H 5I2IA 1W0WA 4LOUC 3VB8A 1QLFA 3P4NB 5D7JD 1OGAD 3KPOA 2WUBL 1WCBB 2AEQL 5I28A 4YSTA 5EZJA 5L8LB 3OQ3B 3UBXB 2I5YL 4ZZFA 4L0YA 1Q8MA 3VA2C 2Y5TA 4PJ8B 3DO7B 1FP5A 3BSZH 1WVZA 4MS6A 3UJTL 2IO5A 1JJUA 5I6LA 4YDLB 3KPNA 3MROB 1XF3B 5C0CD 3BPLB 3D0LB 4GSUA 4PEEA 3D7PA 4PYHA 3MODL 5C0DB 3ETBJ 4KY2A 1DLHB 3EJYD 1NGPH 2O5ZL 4UF7C 3ZHDA 1P1ZA 3QH3A 4U6YA 5DHVB 2BS8A 2P80D 3FO1A 4KH2A 4M1CC 5AEAA 5KYXB 4J8QA 1KIPB 1PNCA 1ZT1B 2QQLL 3CH1A 4CU8A 2WYIA 3HAEA 1KJ2H 4K3DH 3V4VB 3MC0A 2BNRB 3KYMA 4LSDA 2WLKA 2NW3A 5EUOA 3OZLA 4ZMOA 1MFCH 3K2KA 4ODVH 3C6SA 5TDNA 1UEMA 1ZHKA 3BHBB 4RCAA 4TNVK 1UADC 3TVMA 3FQYA 2VLME 4XH2B 4Z8FH 4H1LB 1DBBL 4HFWA 4F9PA 3CVBA 1GC1H 2JCCE 3QDHA 2BZDA 3QHFH 1FBIH 4UOJA 3JT2A 3HRPA 4XPGL 3QPKA 3RTLA 4URKA 4XN5A 4KJPC 3CVHA 3KW7A 4WNSA 4H5SA 3P4LA 1K5NA 4N90D 5J9PA 5HYEA 4JG1L 4DP2X 3LYRA 2UYLA 3MREA 1W72L 3KDPB 2OXGB 3FSWA 4MXVF 2AF2A 1JVOA 4GAJH 4LLUA 1KGUA 2QPEB 4UMSA 4UM8B 2EINB 3LMJL 4TVPD 4MJ5B 5TF1H 1CQYA 1Y6MR 3F04A 3VXNB 3CZLA 1MFUA 2XETA 3ZE1B 3KBFA 4BELD 2YPKB 3PHQB 4XBMA 2EYSB 4NHCH 2QHRH 3ENEA 2G2RA 3VFUA 2J1WA 3BIBX 2XN9D 4OTXL 2LW3A 4AQ8A 2L04A 3ZDXB 2CGRL 3BQVA 1F4WH 2WN2A 4JFPA 4L3AA 4U49A 3D30A 4LMQI 4B27A 4IOSD 4HW6A 4E9YA 3PGFL 2V2WA 3QFJB 4GQPH 1UXMA 4PP1C 2Z3FA 3E6FA 3WLWC 5JLZB 4GSDL 3FQTA 4FG2A 3FT2A 2C3HA 4WY7H 1V7NL 1IGML 3SODB 1MG3C 3GSXB 4N8VG 5F96H 3BN3B 1G9NL 2EIZA 4R8WH 2GJ6B 2VLRB 5CLZA 1D5IH 1W72H 5AZEL 2AJXH 4ZUUB 4HJGA 1DJXA 3MTRA 3DX4A 3HHMA 1BQHA 4TQEL 4Q0XH 5E2WH 4AITA 1CFVL 4G7YL 1BZ7A 5HYQA 1EV2E 2J8UE 3LEVH 3BN9C 4M5YH 2EEFA 2FSEB 3BQUA 3B56A 1ZT7A 2JTYA 1FNSH 2DJSA 2HLAA 2BOBA 3H3BC 4ODWA 4PRID 3QJTB 1UA6L 4P2QB 4Q2ZB 3GGWB 4LPCA 1O6SA 4J3SA 2BRRH 2HVKA 4Y7OC 4YPGB 1WO2A 4AYEC 3PHOA 1N6QH 1XBRA 1FVCB 2NXZC 3VI3F 4HUVA 3NSCA 2VR7A 3VGAB 4AUYA 1Z5LA 3DRQA 1PPIA 1OWRM 3B4NA 2AEPH 2CIIB 3RWHA 1V7NH 4I9WD 1OO2A 4LDEB 4NO5B 5IQ7H 1QRNE 4A6YB 5DT1H 3FKUS 4UT6L 5E6ZA 3HZYA 1L5GB 2GTWB 3MJ9L 1ZHLA 3C2AL 2K45A 4GMSH 3SE3C 3OJVC 3GMPA 5MENA 2ADIA 3MLYL 2PLTA 4I3RL 3BAJA 2BPBA 3FZUC 3O8XD 2PR4L 4ZSOB 1PZBA 3AG2B 4YHZL 5GGRY 5TQ2H 4AV5A 1S5IH 5EBWA 2E8YA 2RBLA 3QRGL 5HGAB 3QS2A 4HXAL 4OCMC 5CF3A 2E8ZA 4EZKA 4L0PB 2IANE 4EAEA 2XIIA 5EF1A 1AR2A 4NZDA 1KGCD 2AJ3B 2Y0SA 5T5NF 2VM3A 4FMKA 4M8QA 5D93B 1VPOH 3OD3A 3DGGB 1XZ0A 2Z4QA 4OGXH 5CWSA 4YWGL 3ZZLA 5I1KL 5T1JA 2XLLA 3C08H 4X98A 1ASOA 4JQVA 5EU7C 5JQHC 4JLRB 5JDSA 3MCG1 2D8KA 4UILL 5ICZA 1SJHA 3CU1A 4LAQH 1MFEH 4L8BA 2AMUA 3WJLA 2AQ1A 1R5IB 4P59L 5EO1B 4U1JA 1ZT4A 3QNFA 3NDYE 5HYSG 2ODHA 1VACB 4FABL 3NABH 3US0A 2F53A 4DW2H 4BZ1A 1VEOA 4J3WA 1A64A 3NGBB 1NZRA 3QG6B 4U1NB 2ZUUA 4KJQD 4M6NL 5DVPA 5B3SB 2EIKB 4K8RC 3TA3C 3E38A 3MV7E 4F2ME 5E8EB 3BGFC 4WUUE 1XF2A 3QQ9D 1CFTA 4JY6A 4LOEA 2HCZX 3RGVA 4Y4FD 2PCPB 1E0OB 2L7QA 3LHPL 1RU9H 1TVBB 1QVOA 1QBML 3L4UA 4OM0H 3RWIB 4ORGB 1FG9C 5IMMB 4IS6A 3D39E 1U8OA 4ZFGH 3W9DA 2AEWA 3ESOA 2ZWZA 1TNNA 3OAWA 3L4CA 2E9GA 4ZUUA 4K71B 4ZXBD 4OZFH 1GKOA 2F54A 4XVTH 1S7UA 4KOBA 4DO6A 2QADB 3R18A 3V5HA 4NQVA 4AIZA 1QW8A 1NEZA 3GMLB 4LAQL 1P84K 1OEZW 1BQHB 3OJ2C 1A6UL 5TFSL 1MCPH 5B8CC 1ITBB 5DK0B 2AEIT 4L1DA 5DUPL 5GS0D 1KEGL 4BZ2A 4LOFA 5AW6B 5HJDA 4Z7WF 3LKSA 5CJOL 7FABL 1AHWA 1BREA 4KVCL 1FCCA 4J3UA 3GEWB 3IJ8A 1QABA 3E1ZA 4Q9RH 1G0DA 1H19A 3QHZH 2ZXQA 3TEUA 4GS7B 3WL9A 1D9KD 4HZ1A 1Q0YL 5FEBA 1YECH 4YGVA 3D9AH 3IDNA 4BBWA 1HI6A 1T20A 2Y6SC 1J9TA 1OCWH 2DYSB 1XIWD 3CSPA 4FI7A 5LQBL 5I24A 5KANI 2VDOH 5DJCB 2WANA 5E95B 1YYLH 3QZOA 5KJ4A 5A3IC 1HS6A 2A9MH 3AS0A 1BEYH 2WXQA 4MB4A 1K8DB 1UM6L 4HAFA 3TYGH 1TTCA 1UH2A 1X9RA 3OAZK 2FEEI 3OF6A 1F90H 4LCUB 3R06A 3RPIA 1HTYA 1AACA 3SKJL 4PQXA 3UG3A 4AK1A 5C6PB 5C0EB 3H4HA 4NQCD 2IQ9L 3V9FA 4DQOL 3BSZL 2EXYD 3CFMA 3NJHA 5F3FA 1J5DA 3BYTA 4YDVA 3OVUB 3VTTA 4YQXL 1C12B 5EC2B 5IW1A 3RP1A 1WFNA 2BOCB 2FZ3A 4AW4A 1XZWA 3IXAB 4U0QB 4CC4A 4JFYA 4XNQB 4C56B 5CN2A 2X42A 4KBPA 1QUPA 1YUKB 1EEQA 2XFXA 1XH1A 4PWFA 5I66A 3STLA 1EANA 5E4EB 4JY5H 1Y18B 3WJMB 3EYUL 2Z31B 4KKAC 4F7EA 1JF6A 1I1RA 1TQSA 1P4UA 1YYLL 2EH8H 2ESVD 2JCCA 3AACA 3CFUA 3V0FA 3VXUE 2MSPA 1HEZA 1LO4L 4JFEA 1BOYA 1EXUA 5BVPL 3O45A 5A2LH 1B6DA 2BZ7A 1BAGA 1QSFE 4HSAC 4XT1C 4XCYA 3WMPA 1W91A 4DN3H 5MEND 1H5BA 2HSIA 5ADOH 1NFDB 2WNGA 2AK4B 4K94L 2HTLD 2FB4H 5GGVL 2ZPKL 2ZSWA 5HJGA 3H2QA 3Q8AA 1KENL 1HSBA 3L4ZA 2ZNWA 4P46A 1RMFL 1H8SA 2ICEB 4I5BB 2VB5A 2IXQB 2UXTA 2DM4A 4OI8A 3AMKA 2AVFA 3S88H 2BIPA 4BH7B 4CGTA 4GBXB 4UV7L 3VTMA 4ZMYA 3CU7A 1U33A 2Q8AH 4D0BA 3R4DA 4LVHB 1GIGL 1KBGL 3UC0H 4BZ1L 4OF6A 2COQA 4I8DA 5C0AA 4X6BA 1KACB 4K9EL 1JF1A 4JM4H 3TJHD 1NAKH 1NEZG 1EFXD 4G9FD 4PCTA 4APQA 3V5HB 5KVFL 1NGWB 5DJ2A 5DZNA 1FLRH 4X6DA 4UBDD 5A2FA 3VDAA 3BESR 5ITBH 1HNYA 4RIRB 5CJBA 4OZFB 1Z5HA 5KJRL 2EDBA 3QJVB 2ZCLH 2O61A 3VFPA 1LK3L 1KJ2B 3AT9A 3PWPE 4YHOH 2Y1VA 1Y1UA 2IFGA 3FF8A 2ZPKH 2WLLB 2BNUB 2VN6A 3NZHL 3HC0B 4NM4H 4FQ2L 4L4TA 4GOSA 1ZWIB 3DVNB 3RAJH 4A7VA 4Y4FB 3KR3H 1YEGL 4ZFFB 2KC0A 1T4KB 3QZWG 1Z9SB 2H3XC 3OKKA 4ZD3H 1HINL 4HG4K 2G75A 2OAAA 3DHMA 4LLYA 3ZZQA 1BF5A 1U93B 1QWUA 1F1DA 3HZ3A 1PFOA 1F3JA 4G42B 1LQBC 4AIXA 1GIGH 1KBGH 2UZIH 2G5BB 5FDWB 3U0PB 2KKQA 2BCMA 5HP5A 2EDHA 4F33A 1QBLH 2IDFA 4NZUL 3O41A 1GY2A 1RZGA 3V4PL 3AS1A 1MCQA 4TTGA 2ZP8A 2VC2H 1XR8A 3MI6A 4Y4HC 3MRGA 3WUWA 2VDKL 2CXGA 1I3UA 3L3OC 4ONFL 2GG1A 4RMTA 4TUJA 4LEEA 3ZTNL 2ZCKH 3EBGA 1CICA 2FDBP 1KY6A 1V5JA 1XGUB 3U0WL 4ICWA 4RFOH 3AWGA 2FEDD 1TZIB 4AJVA 3MLXH 3MGTA 4CVZA 2H9GB 2XSKA 3NSFA 5AW5B 5HDLA 1NPNA 3SE9L 5K9JL 1UZ6E 2VDPL 2OMZB 4HUWB 5E1AA 4W9KC 3GTTA 3FOLA 1X5FA 4MMYA 3TASA 2OX5A 4PJFA 4X5LA 5IBLD 4H25B 4BM7A 3I2CL 2WLJA 5KS9F 3RZWA 2XZAH 1RVFH 5GGTH 1E90A 1QHPA 1OAXH 3ZTDC 4OSUH 3ZL4H 5SWZE 3AGVA 5CS7A 3DVIA 1A1MA 1IV8A 1UXSB 2JKXA 4N2MA 4PREB 4TUKH 3MNVB 1ZTMA 1PW3A 3DWTA 5LG6A 1F56A 3IXTA 4MBRA 2A9DA 3T8MA 2I26N 3HI5H 4KHTL 3P3UA 4PTUA 4X9GA 4YHIB 3K6IA 2Q7AA 4I2XE 3FUEA 2ZWYA 1M57B 1CD1A 1BGXH 2A4ZA 2CLZA 3MO1B 3HBQA 4TLKA 5C97A 5I1EH 3FHEA 3FFCD 2V5SA 2J71A 3RX8A 4QRRE 3NDZE 5K9KA 3MNZB 5C0CA 3G04B 1BFSA 3MRLA 4NP4L 3X3GL 2VAAB 3GKZA 1K6QH 1AJ7L 1LILA 4R3SB 5FO7A 1EHLL 1VGEL 1U8JA 1GKEA 3S36H 1A14H 4HWBA 3ARQA 5A43C 3DXAB 3HZMA 1TTGA 4OF3A 3M1CA 4B7LA 2I5YH 2R15A 2ZWLT 3L9YA 2XVKA 1OGAA 2IG2H 3BGMB 2H6PB 3QJSB 4N0CD 4JO2H 3UTTE 3VXUA 2IH1B 4LSUL 2FX8L 3MXVH 4GW1A 3ORJA 5L9DL 2CHXA 4XBGB 5DJDA 4XOEA 5KVDH 2BP0A 4YXLH 3WNLA 1EHNA 2M8XA 1F42A 5D1QC 3UBGA 4N2BA 5DUBB 3G6AA 2XTJE 3BH9B 3MRBA 2Q76A 3DRTA 3F7RA 5DHYB 1P4LB 1SQ2N 2CHNA 3PAUA 5GHWH 4PW4A 4J6RH 1FORH 5E00B 5AOIA 3RL2B 3RDTC 3KMDA 1MDTA 5E1GA 4WWKC 4ZQTA 3HCVA 4P0DA 3H6AA 2FEEL 1AHWC 1Q72H 3IKCB 2MPVA 4PGBB 3VI4A 4XCNA 2ZG3A 1T0NA 4AMKL 5IW6B 4GIPD 4O2EA 1JAEA 4V11A 4OF7A 3OMNB 2A74A 3LZFH 5H37H 1CXHA 4P46C 2B08A 5C0RH 4HEMA 2EYRB 1AJ7H 1G5AA 1M7IA 1USZA 1EAOA 1OGAE 2MIZA 1MFCL 1SFDA 1UJ3A 1WISA 2JNZA 4MA1C 4M61B 4QHNB 2VQ1B 4DGIH 4Z3GA 5DUPH 1J5OL 2DRUA 1C5BL 4LQ1A 3QQ9C 3EFFA 3BKYL 1FYTD 1SVCP 1CE1H 4YFLF 1SBBA 5CD3A 3CUPA 2V2TB 1RURH 1V3JA 1ZDQA 3NZ8B 3CHSA 3QQ3A 4EI5A 1GC1C 4GJTB 1DN2A 2VIRA 1PD6A 1IC5H 1P7QD 5HHMD 1MFAL 3ECBA 5EZLA 2XTJC 3Q6GL 4NC1C 2J73A 5DEGB 3DJ9A 2LU5A 3G5VA 2YBRB 3BP7A 1AZZC 4PRNA 3QNZB 4L0ZA 4JG0H 4ANUA 1FPTH 2G2NA 2NR6A 3FFCB 3LMJH 5DYFA 2E3VA 1HXYA 1T5XB 4RESB 2XI9A 4HEME 3TC9A 1QBLL 2R51A 2WKOF 4U6YB 3T0EC 5SV3A 3QQXA 2V3EA 2AJVL 4LFHD 4IRZL 1KGCE 2J7LA 3TNMB 2H2SD 3DIVA 2EKSB 4KTDL 1TYRA 3U9PL 3F7KA 2D7MA 2CNYA 4A66A 3GTVA 4NN6B 3UXFA 4RGOH 4J3OG 3N3EA 4LASL 3OJDB 2DLFL 3KH4A 3NQKA 3SO5A 3SKNA 2K3TA 4KRMB 1IJ9A 3DX8A 2A6IB 2IGLA 4L3EE 4S2SB 2VE6A 5DZVA 3WLBB 1KJ3H 4ZMTA 3GIZL 1ZVHA 1ZLEA 1WAEA 3GSNB 4TMPA 2QSCL 3TBCA 4J4PD 3O6MH 4MNQD 1VFAA 3INOA 4YHLL 3UACA 3DECA 3MRRA 2OZ4H 1CK0H 2UZXA 4RAUA 4AVKA 1NLBH 4FHJA 1DR9A 1G7IA 1QWHA 2FLRT 2G3XA 3F01A 2V7HB 1YEKL 4FQCH 2NSMA 3HMXA 5I9QB 1B0RA 3EW3B 2J8HA 3HBZA 4L4VD 3IF1A 4ETQA 5JOPE 2GAZB 3D5OF 4BV1A 2OQJB 2XQYA 3IPEA 3R8QA 2EXYC 4LGPB 3SYPA 3I9GH 5C6TH 4Q52A 1OW0C 1XIWB 2DQDL 4L3CA 3NH7L 3SGEH 3THMH 1RZPA 3DPBA 5I5IA 3HC4L 5ID0A 1NGYB 4NUGL 5SX5H 5BW7C 4H20L 3PS6A 3MRDA 1DVXA 4UOW0 3RVWC 1BQUA 1R3KA 3G6JF 3GMLA 1N68A 3KL3A 4OW6A 2X41A 2VLLB 4QTFA 3WN5A 3PWJA 3O4LA 2E7LC 3TYFB 2MFNA 2GC4C 4KKAD 3ZY7A 3OQRA 2C1OA 2WWMD 2YSSB 1ETZA 5TGBA 5G5DB 4AQEA 3NA9H 2RIKA 3HCVB 4HUMB 4QHUB 4TLTA 1N9PA 2GJPA 2YSTA 3VM7A 4WEEA 1D9KC 5IW6A 2B0SL 5ACLA 3UZVA 4K8RH 5KVFE 4QT5B 4UQEA 3QHFL 3TO2B 2XYBA 3NRFA 4CVWA 1NCCH 3MDJA 3FO2B 1H9VA 3HUJE 4H13C 6PAZA 2VLKE 2VR9A 3HI6L 1YDPA 1UT2A 3QHTC 1KCKA 4QY8A 1ZA3B 1WZ1H 2OL3L 5CLTA 3FBKA 4X4ME 1MJUH 1OK8A 1EVUA 1KCSH 1E7UA 2WVSA 1UYWL 3AU0A 4OD2B 4P9HH 5D7SL 1EXHA 2IH9A 2FJFB 2WNWA 4L29B 1NC4A 1PDKB 2E0PA 1IIIA 4NQQA 1A02N 5EC1A 3TFBA 2NDFA 4IK6A 1T22A 4M7JH 2I07A 4LIQH 1VGKA 2W60A 3RPBA 5CD5C 2P7TA 3U4EB 1O7SA 4Z7UA 4TOYH 3O3BB 2X4UA 4BQBA 3SKJH 1TO4A 3MYJA 3VG9C 3S3JA 5CBEA 2IALB 3HG4A 2A83A 4GSQA 1K85A 4UNUA 3H3PL 1MCNA 5ALBL 4XN2A 1M2VB 1IBYA 4LF3B 5DRXA 5CJXA 3GLZA 2P5EB 3U2SA 3TBTA 4YDKL 3A24A 5C7XL 4HKBA 5BV7H 3AXIA 5MEQB 1A4JB 2YD4A 3WIIL 3IMSA 3VTAA 2NY4C 3S5YA 3SPJA 4MLSA 1H3PH 4TL4A 1EBPA 1I7TB 5ISZD 4NQSA 3D4CA 3H7BB 1A6TA 4Y1TA 3WS3A 4F5CA 4GKNB 5BNXD 2JXMB 5EIQA 3RGBA 4HIEA 5C07E 3QCUH 1PG7H 5KZCB 2ZZUT 3IFPB 2ADYA 5IOPA 4NGHH 3TT1L 3B34A 3TWCL 3SE9H 4JGJA 4LHJB 4MS8D 5HI3D 1X5AA 1BVKB 3DUSA 3L6FB 1M2OA 3A4DA 4XHQA 4XODA 4A7GF 3FQUB 4NKDA 1IKFH 4XNDA 4NDMA 5ICZB 4MQ7A 5A2CA 5H94B 3VXPA 1P5VA 2CO4A 2XWDA 2NSXA 5B8CB 5EF0A 4QOKD 4P2RE 4Y2DD 3U1QA 4Z5RA 4LVNC 4MJJA 3IETA 3QDGD 5IVZA 5LN4A 5JQIB 1UKQA 4XXCA 3RL1A 1TIUA 4NYLA 2NY4B 3WI9A 1IGIH 2Y7MA 3UTQB 1VB9A 5DQ9A 1NPUA 3BCFA 5HHVL 2W0PA 1RUAH 5HHOB 2X09A 3B3IA 1ZTXL 3BIAX 3QORA 4UOW1 3OHMB 2VRKA 4N8UA 3SY0A 4W9ZA 1PG7L 1A3LL 5J6HB 1A6WL 1U91B 3DV6A 3N40F 4L8SB 2EDFA 2F8VA 4GKZB 4M1GL 5ESVB 2PCFB 1VIWA 1AQKH 2WAQA 1KPVA 4JAMA 4CAGA 3LRSA 4LSVL 3AADB 4OCRL 3WTSA 8PAZA 2FUTA 2NUPA 4E5XB 1NSNL 1EDYA 1OF0A 4Z7AA 3V4LA 4R26L 1YEEL 1KELH 1YDPB 4IEFB 3QUZB 5J6SA 1IBDA 2WMPA 1MCLA 1RPKA 5BRZD 1F4XL 3UH8A 2FBOJ 3NCXA 1IGCL 4WRLA 2AQQA 4TN9A 2RCSH 5C0GA 1U3HC 2GVYA 2Q2EB 2Y07L 2WXPA 1BX2B 5F9OL 4F1SA 3VWJC 1FG2A 4YDMA 5IB2A 1BECA 2C9XA 1OHZA 4O51B 3HZKA 4DP6X 4AQZA 5I16A 2VN3A 3ZE0B 3Q8CA 3T2NL 3C8DA 1GTFA 5DJXA 1JS4A 5E4EC 3MACH 1FJ1A 3WIHH 5D1ZB 2A6DB 3F3HA 2AXGA 3FB6A 1AXIB 2DIAA 2C9QA 2FEDC 5AZ2H 3RNQB 3VXSA 3WXVL 2YAOA 3SDYL 2AGJH 4F8QA 5BVPH 1TT6A 1EQWA 1XF5B 2WLIA 1KXVA 1XF4A 2AJSH 5FYJL 2MWCA 5EA0H 4ODXB 4X6CE 1GGIH 4Z3FA 3C5SA 4ENED 4H0HB 1T89C 1FO0H 1A7BA 3W5NA 2ITCA 1SXSA 3B83A 3O6FA 4HV8A 1N59A 4LPTA 1FAIL 4NUMA 4S1QH 4R4FL 4TRPL 2R0LH 3UL4A 3L3DB 1HAUA 2UY6B 2FQFA 5K69A 1JCVA 3SE4A 4O2FB 3C60D 1AO7A 2MPAH 5GGSY 2GBUA 4ZS6D 4G8GB 3X1FA 1ODAA 2Q8AL 2C34A 3QUMH 1CG9A 3UZEA 4A6YL 2P3YA 2XBTA 4PCSA 2XZAL 4FN0A 1LEIA 1JGEB 5SWZA 1L4IA 3PG2A 1FV1A 2YXWA 2BFGA 4HH9B 3K4ZA 3VH8G 5EF3A 4GRLD 2ATPB 4PJAF 3QZWB 3QUKB 3QXAA 1AYOA 1OGPA 2YGOA 3CCHB 3EGXA 4HEPG 1TJMA 2VUKA 3AT8A 5F7LB 1F6LL 2VXVH 2GB2A 5AL8A 4G1EB 4QF1A 4X5PA 1S9YA 2XTJD 2R1WB 3C5ZB 3ARBA 3EOAA 1TETL 3QIWA 4KROC 4CSTA 4ECNA 3ML9A 2QV4A 1MCKA 2EVHA 2DI9A 2K4AA 3PWLA 1ZD6A 4H0LC 4ICXA 4LGRB 1MJ8H 3EJPA 2R0LL 1FFNB 2ED7A 3QFGA 1A6AA 4JDTL 2VDML 3MLUH 1S7WB 1T5KA 3OKNA 2A6JB 5ES4B 1TTBA 2NPLX 4PG9A 2EVFA 3QIBA 3S4SA 3VD1A 1S7TA 1QSEA 5C08D 3B2XA 3S35L 5D7LA 4PBWD 4JN2A 4ABWA 2XKNA 3ETSA 2J20A 1B0WA 1XGPA 3OSKA 3C5XA 2PTTB 1GPOH 3FBQA 4M29A 2Y3NA 3BP4B 4JUTA 2C1PA 2FYYB 1LE9A 2AXFB 1TSRA 3JBG7 3FQWB 3HE7B 5H37G 3AM8A 5AOLA 5A40E 2JCCF 4PWHA 1ZXKA 2O5YH 4PPTA 4Q58C 3N50A 5DZLA 3H8NA 3BFOA 3MV01 1BBJA 2PO6D 1KCVL 3CPLB 2JI1A 1R17A 4HJIA 1G1CA 3LQMA 5B7MA 5E8OB 4Z7UF 5DD0L 2ZXDA 5TE7L 1JGVL 1GOFA 3FHQA 3NZSA 2EYRA 4E9WA 5IESH 4FXKC 3GMMB 2DQIL 1INEL 3VCLA 4WCYH 2ESVE 2KMWA 4L3EB 1UJ3B 4GEJA 4KJQC 3C6LD 4TULH 2ADFH 3RI5F 5E6IA 3DURB 3L2MA 3K71A 4EI6A 4E68A 1INDH 1CGSL 3FT1A 5BPPA 3BDBA 5E51A 2JFCA 2XC8A 4Z3EA 4XGZA 1VADA 4LSVH 3UMNA 3S96B 3RIAF 4J1UA 3MLTB 5J06A 1FF5A 4RWHA 4WK2B 1M56B 2AXGB 1IEBA 3FB6B 3MUUA 4GSDH 3VXSB 5GSVB 4NWTH 1EHAA 2R2EA 4XI5C 5F3HB 3MAWA 4QMEA 4E9LA 5F88A 3VXRE 4YBHA 2CKBH 5GRUH 4IOIB 4EN2A 4S1SL 1DCEA 3OBAA 4TM9A 3TNNB 3WE6A 4IGBB 5L4MA 1NGPL 4BKLB 1BAWA 5GS2D 2NCEA 4NRYB 3OLGA 1AE6H 3RY6C 3QPQC 3TO4D 1KPUA 3OXRA 1C16A 2E4TA 5HPMA 4JPWH 3ETTA 4OUUB 5DFVD 1WBZB 1M9SA 2Q2LA 4A7UA 2PABA 1L9QA 2WHVA 4AT6B 3FC8A 2F8OA 1RZQA 4P5RA 1V7MH 4CKVX 2CO7A 5F7KC 3U83A 2ED8A 2P5WE 2X1OA 5HYFA 3ULVH 3IDUA 4DAGH 2Y6SD 4DGYH 4ZFQA 3Q9PA 5HHME 4CMMB 3OAUL 3RNKB 3MCYA 3VXME 2N0KA 3SY6A 2BM3A 2CUHA 4BGDA 4JO2L 1QQDA 2G3ZA 3I3EA 3VRIA 1JL8A 4HULB 4JDZB 1IC7L 3BRFA 5IB3A 4BINA 4D9LH 3PABB 4ADIA 5DURB 5K9OB 3DK2A 1KB3A 1S3KH 5DT1L 5T5FA 4AIOA 1WGVA 4QRSA 4FXKA 1F11B 3QUYD 3K8KA 3SDXE 5FGSA 5EZIL 5IQNA 2BINA 3KLKA 5HDRA 4WJKB 2PW2A 1U95A 1DSFH 1UD5A 4OD3L 1MRDH 2MMXA 4FP8H 1RAMA 4KZDL 4OZFG 2YD8A 3VFNB 1HH9B 2F61A 5AYUH 1V05A 1KBVA 1SLXA 2ESVB 3HFML 5JZ7C 2DMGA 2CRYA 3V4PH 2Y1ZA 4IHBA 2DLHA 5M95B 2GJZA 5IB5A 5JHDA 4AYBA 5C0CB 3UPRB 4DWHA 4LEBA 4PJHA 3TT3L 4FZEH 1GGCL 4MCMA 3WUWG 3SBWC 2R4RH 2OYLA 3IBEA 4FNUA 2A73B 2B59B 2MCAA 4KVPA 4GRLB 4E9VA 2EDNA 1ORQA 3V55A 5HGHB 2R69H 1JPGB 2DS4A 1MJ7L 2X4SA 2G60H 4EUPA 4OZGB 5CUSL 3KDMB 4LKCA 4OFYD 5C0FB 5I1AA 2YD9A 3ATFA 4QY8B 2YJQA 1II4E 1U8CB 4HAKA 1JRHI 2UWEE 4R7NA 5BO1H 3QCTH 2JELL 2NYKA 1F58L 4KXAA 4LGSB 1Z0MA 3VG9B 1CB4A 3CZJA 1ZA6A 2D7PA 3QWOB 2PMZA 4OI9A 4Y88A 5CGYD 2R27A 1HDMA 3A4EA 4XN8A 3M1BB 1VAHA 1H9DA 3VNYA 4M3KB 1KBWA 1HQ4A 1P5UC 2JKNA 3IBOA 3VYOA 2C3WA 4JFDB 2F7PA 1J9RA 1NEUA 4PCKA 3AG1B 4OCYL 2EXWD 1HHJB 4NUJB 4ANKA 4IIQB 4ZUSB 5DSCB 1XSOA 3P30H 1FUNA 5MEPA 3TJHC 2HT4D 2WZPD 4PWEA 1KJ2L 5AVTB 5JW4R 2NCMA 4XCEA 5KYXA 1QBBA 1PD1A 2NLJB 3O3EA 4Z7WB 3MBWB 4IW4C 2CJUL 5FA4A 1F1AA 3MBXL 4K7PX 4JS7A 3TBTB 3EHBD 4IRJD 4PV9B 1IRAY 4YHNA 3EADA 4YS4A 5I75C 4CADA 3C60A 4IRZA 1JNJA 1NDMA 5A6MA 1G7PB 3BEWB 4MB5A 1XSJA 2XQ0A 25C8H 2XVBA 1DBBH 1W0VB 3O2VL 2KH2B 3DSNB 4PRNB 4PS4H 1G7JA 4XPBH 2R9HC 2CKNA 4U1SB 3T2PA 3UADA 2V9QA 3L7EB 3WS3B 1CN4A 4XXDB 7FABH 4JM4L 2WXRA 4LP8A 3MCLH 1MELA 1RIVL 1N7ML 1S5HB 1Z66A 4G8EB 1AZCA 1WG3A 4OU3A 4TLSA 2J6EL 5FAAA 1B90A 5GGUB 4UTAL 5L88H 1H6FA 5FM5M 3BXNB 5E7BA 5E6YA 4GYBA 5FUZL 2BIHA 1TQWA 2Y7OA 1IAKA 2GJ6D 3KGRA 5FUCC 5KYYA 3VXSD 4LSTH 3OLIA 2P44B 3BKCH 1RJCA 1IM3B 3WYRA 4FTVA 2MOVA 3D69A 3OJDA 1QFWH 3BP5A 4JQVC 3GWJA 5LXGH 2Y5QA 4G6FB 4PJBA 5IG7A 1ZSDB 2VUOA 1NDGA 1VZIA 2YPKA 3PHQA 4HPOL 3MNWB 4OCSL 3V4VH 3FYEB 2WSKA 3GMNA 4YK4B 4OZGE 3L3KA 1EEUA 4ZPVB 4DAGL 3ZT5A 1K2DA 4XZUB 5DC2A 4H8QA 3W2DH 1J1XH 2B7DT 4D2NA 2F18A 2QPSA 5I9QC 5ISZE 3EOTL 4F3FB 3QRFM 1RERA 3D39D 2ZE0A 4MD0A 1CYWA 2OP4L 1B0RB 1WFOA 4I1NB 3OKLA 2TSAA 1U6AH 1A25A 3WXWL 2Y06H 1WZ1L 3OR7A 5LDUA 2QELA 1CDHA 2RMNA 2XPGA 4IMLA 3QG7L 2YAPA 4LCCB 1P4IH 1ZV5A 4PP2A 3B8YA 5JOFB 3H3KA 3X11A 1YC8A 3NCWA 1UENA 1KTDB 5ADPL 2ETWA 1CFNA 4B9CA 5FK9A 5FUCE 2WCPA 2WWKO 4NAJA 2OMUB 3TV3H 3MLXL 4HIIA 4UQIM 3REVA 2WWKT 3TH2T 3GMOB 4G80B 3ILPA 2HKFH 1KIQA 5DJZA 3CN3A 3S37X 3E6HA 2VUYA 2YARA 5T1LB 5E6ID 2A3TA 4GFXA 1DZBA 2JJTA 3NJKA 2ZSVA 4KKBD 2CGYA 5DMKB 4R96B 3VSQA 3RPIB 4CC1A 2APFA 3H85A 4PJEA 4RSVA 2WINB 3FRUB 4P49A 4FQJL 4JFDA 2YD5A 3K2MC 2VR5A 4HWUA 4NKMB 4O00A 4NI3A 1P7KB 5D96B 3FMGL 5FHAL 4KNQA 5DD0H 4IIQA 1PY9A 1BQKA 4ZUSA 4MCZA 2Z8VC 4HC1A 3VWKA 3H9ZA 1IEAA 3NT0A 5I1EL 1AY1L 1IQDA 3KPOB 2VN5A 3B8SA 1J11A 5EEUA 5BJTB 1I8UA 1BVLA 3OWEA 3CZFB 3ZKMC 4BSVA 4DSYA 4P5SA 1ZY9A 3CIQA 3QR2A 5DFTA 4NGHL 3SYAA 3PJNA 2XWTB 3CDFA 1V3MA 4X99B 4N25A 1KMGA 4QRQA 1CLCA 2CWRA 3QEQA 5T33H 5KJRH 1TTRA 3FCUB 4WWKD 3NCEB 5IP4A 2K4WA 3GLDA 5EBWB 2OTPA 4KFZC 3IDMB 4APQD 1E9OB 2W0LA 1T21A 4XP1L 2YXVA 1NIDA 1AC6A 2VDLH 3MRQA 1H6UA 3W38A 5AVZB 1JXGA 4NJ9H 4M00A 1CPUA 1NCHA 1KNOB 1EJOH 3K2IA 1HESA 3ARGB 1UB6A 1W80A 1IKNA 1OIOA 1OGTA 3ARBD 2ZKYA 2VJXA 2IFFL 1IE4A 3FH7A 4OI7A 2HMIC 2H1PL 1MDAA 4KZEL 3TTSA 2F8IA 3JV4A 5L4FA 3PWNB 1L6PA 1TFHA 4K71C 2ZOTA 4UAHA 3O3DB 3VSTA 4U7SA 4U1HB 3C5JB 1KXTB 3PQYE 1KWGA 3JZYA 5HHQA 1G94A 3V9EA 3II2A 1SF3A 5H2BB 2ZCHL 5EO0B 4ELMB 4JHVA 1HOCB 4ZMXA 1JD7A 1H6TA 1DJZA 3G5ZB 1IGTA 1HEJC 2AFNA 4DETA 5D1QE 3QG6A 4U1NA 3LSOA 1R24B 3LVEA 2FO1A 4OV5A 3EJTA 3QI9B 1DBKL 4U7KA 3IFOA 3L3OA 5IWLA 3D4ZA 5D71L 3HE6A 4OGYL 3QUGA 1KOAA 1YNKL 1IC7H 1Q94A 3NPZB 2ZWSA 3SE8L 2EP6A 2VZVA 4ERSH 2RR3A 3CZNA 1CDGA 1ECYA 1NGQH 1TU2B 2AV7A 1UA7A 3MV7B 4F2MB 2EDMA 5ANHA 1ZWIA 4RMVA 3MRCB 3GKWH 2HX9A 3VD9A 3BUPA 1J1XL 5E56A 4Z7OE 3FT9A 4OKVB 1Q9LB 1U58B 1E27B 3MA9H 5L4JA 1KJVB 2B1AL 3N6YA 2CO6A 1BCIA 4ODSL 3WEXB 4JZJB 4HT1H 4HOZA 3EO9L 5E8DH 4M7ZC 3U30B 2X4NA 3HPLA 2IMNA 1YY8A 2JI3A 4GXUM 4WU5B 5AOZA 4ISVB 4Q9QH 5IGXL 1TQUA 4HX1A 5IZ7A 5FOBA 1BF2A 3GHBH 3HMWH 4WLCA 3IDIB 5FYLE 1ES0A 3FONB 4JZNB 4IGBC 4AXWA 3BWSA 4NKIL 3MRGB 4O02H 4N2DA 4P99A 3B7RL 4FS0A 4K3DL 4R2GC 4FQ2H 1R19A 1NCOA 2QSCH 3PL6D 1CICB 3HN3A 3ULAB 4PHXA 4JDVA 4P5TD 3X3GH 3IGFA 1KEML 2P46B 3HE7D 4NOBA