3QZMA

Staphylococcus aureus isda neat domain h83a variant in complex with heme
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
124
structure length
124
Chain Sequence
MSQATSQPINFQVQKDGSSEKSAMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Iron-regulated surface determinant protein A
publication title Iron-Coordinating Tyrosine Is a Key Determinant of NEAT Domain Heme Transfer.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 33
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qzmA00
2E7DA 2O1AA 4H8QA 5D1XE 3QZOA 3VUAA 2K78A 2H3KA 2Q7AA 3S48A 4YMPA 3QUGA 2Z6FA 4WJG3 4FC3E 5D1QE 2MOQA 3QZNA 3QZLA 3SIKA 3QUHA 4MYPA 5D1ZI 3SZ6A 3RTLA 2ITFA 3QZMA 3OVUB 3RURA 3SZKC 4H8PA 3QZPA 3VTMA 2O6PA 4NLAA 2ITEA
chains in the Genus database with same CATH superfamily
1A6VL 1YC7A 3QFJA 2DM7A 5DRWB 3F00A 4NJ9H 4G70B 3HHRB 3KLSA 4FKHA 3T4AB 4AYFB 2Z4TA 2ZOKA 4TTDC 2YC1B 2OYLA 3ROOB 4APQA 3BPCA 2ENQA 4OVUA 1SY6L 3MJGX 4BHUI 5CMAB 2OMZB 1TQSA 2NX5E 4IYKA 1PDKB 3ARFB 5I1KH 4GRMB 5J1TC 1DE4A 1D5BA 2DBJA 2X70B 3D6GA 4R7LA 3RWFA 3GXNA 1OTUD 2BHFA 4BBWA 4KH9A 2AMUA 3QXWA 2A83A 4H5SA 2OYPA 2HMIC 3KAAA 2AV7B 3CVHL 5IG7A 5T5NF 3RVTC 1HEZB 1UUNA 5IVXA 1FVCA 4GEIA 2DQTH 2CKBA 4S0TD 1EEQA 3HZMB 1XF2B 1B4JH 1NCDH 3C08L 5I30L 4F5CE 3RTQB 4ZMLA 1RJLB 4I3GA 3M17B 4WHYG 3VNYA 4NRYB 3ZTDC 3FCUB 4P57A 4XNMA 2WWMD 2NXZC 4QLRA 2OTWA 4TVPL 2QSCH 2IWGA 4KK8D 4LSSL 4AVKA 1CL7H 4IJ3B 1JCVA 2DRUA 5GISH 3VNZA 1JHKL 5A6MA 4LVHB 5CO1A 2X88A 3LPGA 1CT8A 3T3ME 4MDRA 1TZHA 2DIEA 2X3CA 3ISYA 4HCRH 4G8GA 4AJVA 2PP8A 2P26A 3P0VL 3SO3B 1Q1JH 3OF6A 3LKPA 1E7VA 4F7TA 1DJSA 4M29A 1Q0XH 2P80A 3ARVA 4XN5A 4AYID 3TT3L 1AE6H 1XGUB 3EOAB 4QXGL 2DQGH 1RJYA 5GRVL 3PWUB 2Q7YB 3HAEG 2PW1A 1T5XA 4NO2B 2P24B 4XI5D 5TDPA 5L8JB 4WO4C 4MQXC 4BFIB 3WKML 1DVFC 4QT5A 2BIIA 3CFTA 1FLTX 3D69A 5EZOH 4IS6B 2NUPA 1OLLA 1OARH 4OB5H 1E6OH 2JXMA 4ES9A 5ECGA 4PJXF 3MJ6A 1L9RA 3F5WA 3R4DA 4K71B 3B9DA 2Y07L 2VR6A 4J4PA 2WPGA 2CRYA 1QLEL 1RVFL 2ADGB 3DI2B 5EOTB 3KWTA 3VXSD 4HUMB 2F53E 1X9QA 5CLZA 3CPUA 1DQKA 3HOGA 4EI5A 2X38A 3LQZA 2OL3A 3U1PA 3HR6A 4XBPA 4AQAB 4F15B 1SVCP 4XNQA 1SY6H 5GXBB 4ZW6A 4FQIL 5KVDH 3LNDA 4OVVA 4FL4B 2R1WB 1XR8B 3HE6B 4NQDE 1HWWA 4Y4KA 5KVFH 4P3DA 2AEQL 3B3IA 3EJYC 1IILE 4Q7DA 1OZTG 2ZWYA 5C0AD 3NA9L 4KK9C 3RVWD 4YN3A 5DJDB 1SEBB 2Q0ZX 4QRPD 4NHCL 4MAYD 2CR6A 4OGAC 3C9NB 2QGDA 5JXAL 3FN9A 5DJCA 1YECL 2P5PA 5I30H 3BEVB 3OMNB 1K8IB 3FQRA 5B8CC 5CGBA 1IFRA 3BRFA 1IE5A 4ZK8A 1WICA 2KPWA 2WIIB 3LKOB 3DURA 4W9DC 4GFXA 1J9TA 4S1DD 1UT2A 2B2XL 3DUUA 3JVGA 3PNRB 3HJ0A 4RMVA 4KDTC 4HFWA 4BZYA 3VWKA 2CA3A 4B9YA 1F0LA 3U0PA 1A7QL 2X4OA 3I9IA 1X9LA 4TVPH 5E4IA 4LSSH 5T1KB 3GMQB 2EVJA 3HC0A 2IPUK 3EG9B 5LXGH 1JHKH 2CMRL 2WBWB 4LP5A 1KGXA 4AQEB 1Q1PA 5D7LE 3FT2B 2E86A 1BIIB 2F8OA 2HJFB 2LLGA 5DRZB 4KKQA 2V9TA 1O9WA 3SPIA 1RJZA 4CU8A 3L13A 4LCCA 4PUBH 1Z7JA 1L0XA 1XF4B 3G6AA 4FP8H 2Z0BA 4R97B 3SKMB 5E9AA 2EICA 3L4CA 4FQCL 1BOGA 4U0RC 3TZVB 1F45A 2VAAA 4Z3FA 2P5ED 2BOCB 3DX4A 1T1WB 5MEND 2PNDA 3GMOB 1JN6B 3KL5A 5SWZD 4P23D 4R8WH 3WKMH 2AJUL 3BN9D 3BKMH 4GRLA 5EEZA 4PJCA 2FHBA 5E2UH 3WMPA 5AL0A 4ETQB 2XPZA 4HPYL 3P9LB 5DJ6A 5KUMA 1MH5B 3X17A 5JXEA 2Y07H 3RDTD 3EDKA 4GXVL 5IF0B 2J21A 4KPHH 1QLEH 2XFXB 1OPGH 2UZXA 4ZMYA 1BVNT 3KPRA 3MRBB 4IRZA 3IFPA 2VDMH 2LT9A 4HCGA 4NT6A 3GJEA 5J7CC 1KYDA 1BX2B 1JHTA 2AQQA 4PRHE 2CCLA 4UMSA 1JGVL 4OD3L 4P3CH 2CGRL 5LNEA 1QA9A 3ILQC 3DXAB 2ZCHH 1WHPA 4QXTB 3KPSE 1BMGA 2AEQH 1QFOA 3EGXB 5KYXB 3P3TA 2X2UA 5ISZA 2XWBB 3U46B 4XBGA 4FQPA 3LMJH 5IMLB 1G1YA 5EB9A 3UZEA 4M62L 3S98A 3GSXA 4OU3A 1RI8A 3STZA 4N2OA 5JZ7D 5EO0A 4ZSOB 4N3TA 4WRLA 1MY5A 3BMWA 2JCCB 2DWXA 4TSBL 2C7FA 3OKYA 4QGTA 2R39A 4NQQA 3DX3A 4OLYL 5CU5A 2BVPB 3S88L 2BWQA 1DP0A 2XRAH 4M1CD 1WA1X 3FB5B 4YDIL 1BJ1H 5EO9A 4GAGL 1A0QH 1RIVH 4NRZB 4TNEA 4HLJA 4J7RA 4BWWA 4Y89A 3K80A 1NTDA 4IIQB 2AK4D 5J13B 4PBWD 1A4JB 1QEWB 1S9VA 2JI3A 43CAA 2NY2D 3CIAA 4HOMA 5FUOL 2X6VA 2OLDA 3CUPA 2GBUA 3EJTA 4IGBD 1BZ7B 1CLCA 4TNVF 3S8WA 5DJAB 5LNGA 4TOYL 4GEJA 3O3DA 3ATDA 1HINL 2M1KA 2XZQL 3B9VA 4HQQL 1JPSH 2ZX7A 3U2SB 4MA3B 3VW3L 1Q94A 4ZO7A 1H5BB 1T5KA 1JTTA 3N1FC 4I5BB 3NIFB 4LKCA 2P8LA 3I6SA 4OT1H 4J4PC 1OO2A 2WLZA 5H35A 3BUDA 4K9EL 2DQ6A 4U49A 4NKIL 5FYKD 5E9DB 1KTBA 3DX2A 5HP5A 4EI5C 3HNSH 2CAKA 1NMAH 5EF1A 2VXQL 1H6FA 2VJ8A 1SXZA 3MRPA 5IQNA 3W11C 2ATKB 4NOFA 2VQTA 4Y4KC 2OMTB 2HAZA 3CMGA 5I6MA 4JG0L 4YXKL 3COOA 2WCSA 4F33A 1P1ZA 1UOVA 4ZMXA 1CK0H 3R06A 4XNBA 5DO2C 3QIBC 4OD3H 3ZJAA 3TFKC 3JV6B 4JPIA 3GB7A 3MYJA 5E8OA 5ECJE 4X98B 4URKA 4X42A 4PJFF 3RA7L 2EINB 4GYBA 1ZY9A 3E8UH 2WLIB 4PJ7B 2BIPA 3TCXA 3MNMA 5C09D 5AW2B 3TN0C 4M62H 3JVGC 4YBQC 2DI8A 5JW3L 4C83B 1E5UI 4WFFE 1PKOA 1OGSA 5KVGL 5C0GA 3L4WA 1R5WA 2HCZX 3GGWA 1HL5A 2W65A 1QPKA 3I3EA 2C9AA 4PHZA 4OLYH 1XSOA 3ZKND 2BNRB 3H2PA 4EUPA 4XMUA 4MB4A 1ILUA 2HLFC 4FMKA 4YDIH 5A2KH 1BPLB 4LL4A 5CLXA 1P7HL 5AOLA 4NDMA 1U8JA 3S6CA 3AQDA 2A7BA 1MF2L 2WWOA 4LCCC 5FW6A 1PX8A 4H20L 3FFOA 3NSXA 3S0PA 1AYOA 4WUUD 1R33A 2CE6A 3S36H 4N0CD 2N56A 4TYUA 3UTZB 3U83A 4ZS6C 4IDJL 4ANKA 5JDJA 4RBPH 2PPFA 3HJEA 4G72B 3K6DA 3MXWH 2E47A 1B4LA 2OW6A 2ADIA 3GO1L 3NQKA 4UDUB 5GHWH 3O6FC 4X80L 3IN2A 3VW3H 4ZXBB 1Z5LB 2AJYL 1H3VA 1NJ9B 1V7NH 4MNHA 4MRBA 3MC0A 3MFGB 5JXEC 1IUZA 1TKWB 3UBHA 1N0XH 2Q9OA 3QNYB 4OLUH 1YN7B 4EDXA 2HXAA 1I9JH 4HD5A 4HCFA 4NRXA 4ODSH 1BG1A 4LLQA 4RMUA 4QHUB 1TIUA 1BREA 1HNFA 5I74C 1ZLUH 3VA2C 4JPVH 4JHZA 4DFIA 4RFNB 1A3QA 1OL0A 1OP5H 1NKRA 3O4LE 4WDIA 5LBSA 4KVNH 4BH7A 3M1CA 2ZWSA 3QWOA 3AQXA 1A14L 5D7HA 4GNKB 2H0JA 4JG0H 2EXYD 3WL9A 4D8OA 1CCZA 2E7LA 4RIRB 2WINA 3DX6B 2NY6D 5D7JB 3UZEC 1Z5YD 4F27A 1VENA 3IDGB 4PRDA 3DRTA 3E6HA 2PTTA 4IEFB 4JRYA 1RCYA 1U91A 2PPEA 2VDMB 3U1SL 2ZCKH 3FTZA 4AIOA 3F7PC 1HCYA 4UM9A 3W1ZA 5JA8B 1MRDH 1V54B 4NQCB 2ARJQ 5E1IA 3WDHA 1PLAA 2D9CA 4LSRL 5KJ7E 3K3QA 5K5YA 5I1IL 1UB6A 2X1OA 1FGVH 1MHHA 3LZQA 4K7PY 2QGCA 3SDCB 4W81A 1VFAA 1SXBA 4LBAA 4YFLF 2Q7NA 3ETBF 3IJSB 3CFBA 4FJZA 4OKVB 3BHBA 3DO4A 5FA3A 2ICWJ 4X5XA 1XIWC 5LGJA 1VEPA 4P8QA 4X9FA 1OM9A 3HBGA 4N2IA 2H0FA 1PQZA 4H20H 1FFTB 1DFXA 2R69H 4Y2NA 5IVZB 3W9DA 3UACA 1SJHB 3ZE0F 2D2CC 1T21B 2BERA 3C5XA 2X2YA 4LAQH 1M9WA 1DVYA 2X40A 3DMMD 5CHNA 2YGQA 3U4AA 5CP7A 5HHME 2GFBA 1MCQA 5CIPH 4X6FB 1V10A 2O5NA 1DUYA 1CDUA 4TULH 1KXHA 4G9FE 1OGPA 3N40F 1URIA 2EO7A 4P4KC 5MEPA 1YNLH 4JG1H 4LASH 3D33A 1UHVA 4MA1B 3AMLA 2FTAA 5TD4A 3RFZC 4NUMA 3UYPB 2X4UB 1P7BA 4WJG3 2BSBA 4YGVA 4F57H 2QSTA 4P9MH 3VGDA 4EBQL 3U4BH 3OHXA 3LKQB 4YXHH 4MMXB 4L4TD 3GYRA 3BYYA 3ECQA 2QVIA 3MNWB 4Z7VB 2Q2LA 2LAAA 1C7SA 1TQCC 3SGDH 1ZWIA 4KK5C 1A6TA 4P3WA 1M2VB 5ID1A 2JMRA 1P5UB 4OFYA 3ZYIA 3BDBA 1D5ZA 1KNOA 4AZ8A 4KXAA 2J7LA 5K93A 2NW2A 4DT2A 4GG6A 3LNEA 5AVRB 2JI1A 5D2LA 5I26A 2P47B 1CD1B 2Y25A 4OSUH 4TLTA 5ERWA 5T1LD 4OCRL 5CP3H 4FEMA 2R2HB 5DJZA 4AM0Q 4N8VB 4QF1A 3VRJA 4CSTA 1OAQL 2IGFH 4Z77B 5IIEA 5KSVA 4HWUA 4AEFA 2W38A 2JELH 4L48A 5FGCB 1N2RA 3K6NA 3LTVA 4ZUVB 3UYRH 4NNXB 4ZUWA 2H1PL 5E6ID 1HYSD 1JGEB 1YAIA 4KRPC 3LEYL 1U8PA 3GMPA 2P4AB 3QDHA 1I75A 5JHDA 2K45A 5IQLA 4FHKA 1K5WA 1MI5D 1GZPA 2QHLA 3LOWA 1PMYA 3SKJH 5H37H 1HHIB 1EH9A 2OX5A 5AVVB 4PJGE 1KCWA 4Z7WA 2V2WA 1NCBL 5HDQH 4GBXD 4ZRGA 3F12B 1Q90A 2YK1L 3H54A 2DYRB 2MQ0A 3UTTA 3FC8A 4N86A 2B0SH 2NUTB 4ZO9A 4OTXL 4K2UH 4XN4A 1J87A 3QPXL 3D18A 5F1NB 3LIZA 1ANUA 3VFTB 3B3BA 3LYRA 3T0EA 4FAAB 3SGDI 1B0RA 4PJAF 1P4IL 2ICES 3KNBA 1E2ZA 1ORQB 3B7UX 1MLCB 3GM8A 4PW3A 4EI6A 4KY1H 4TSAL 2WBXA 5CN2A 3HC4L 1M71B 2JK5A 2VKXA 3BSHA 3GMNA 5IJBC 4I1NB 2CO2A 2ZAIA 3SDAB 3X12A 4PTUB 2ZG3A 3EAKA 3MBED 3MV7E 1UT9A 3O2WL 4QTFA 4Y16D 1AANA 2A74B 4H4NA 3OVUB 4M56A 5MEQA 2E7LC 4YDJA 1Q9KA 5I1AA 3C5ZD 5C9JA 3JTSA 2OCFD 1K4CB 2ZONA 3FUIA 1H19A 1INDL 4HUXB 3TO2A 5C1MB 3EO0A 5TTRA 4P07A 3FHEA 5IP4A 4OJDH 4LP4A 2HB0A 2DI7A 4XVUC 3ERXA 5CKGA 3NUKA 1X5ZA 1ILSA 1T83C 3ILPA 1HXMA 4OCRH 1XSKA 4ADIA 3FCGA 3RIFK 4KKBC 2QL1A 1QRNB 1SHWA 2QFPA 5DHEA 2H8PA 3P2TA 4MQSB 5SX4H 1QW9A 2KUTA 2GTZA 3QRGL 4W9EC 3GBEA 2H1PH 3INUL 3OKKA 2J73A 5DMIL 4O2EA 3TBYA 2VE6B 1CGTA 1IT9H 1VFBA 2BNQE 4HJGB 1OSEA 3DO3A 1H6EA 3GUFA 5EZIL 4LCYA 5JIIA 3QYNA 4JM2A 3B2PA 2W80C 2H4EA 3FB8A 1TU2A 4I3SL 3THML 3CHOA 4L8CA 1TYRA 4PRIA 1CJYA 4XN8A 3OLIA 3P73A 4FDWA 4OI9A 3R7QA 3L3JB 3QJVB 1TEGA 1ORSB 2CM6A 3A4DA 3ZTJG 2F1EA 2YK1H 1NAMH 4TNGA 4LT7A 1S9KC 1DDTA 1INEH 4D94A 2IIJA 4A7GF 5JIQA 4P05A 1UXLA 3W2DL 1DJXA 1T4WA 3WJMB 3JWDL 1FYTB 3UTQB 3S37X 3MRMA 1QFWL 2WVVA 1KBBA 2BH0A 2ZXGA 5EWIH 1RK1A 5FYLD 2CDFA 2OMUA 5D7IF 3RGVA 3MRLA 1FP5A 1MUJA 3OHXC 4W4OA 3V6OA 3IGLA 5CIPB 3K6OA 3A4FA 3FT1A 3GJFK 3KHQA 4MAYB 3SQRA 4Z7NB 1DVZA 1AGCB 3O2WH 4OLZL 4YNYB 1UGNA 4KZEL 1ZIAA 1ACXA 1MCIA 4NLAA 5SX4I 5DJXA 2DDQL 3CHQA 3D85A 2D73A 2J5LC 4KOBA 3D34A 5BUGA 2BSTB 5TPWH 4PJ9D 1INDH 4K15A 1LQBC 2DEYX 2A38A 3SE8L 3KEHA 4ZFFB 2Z31B 3T4AA 4ODXA 2G5UA 4LSUH 1BBDL 5I5JA 4JQIA 3NCFB 4J3BA 2GK2A 4JGNA 2B59A 1OB1B 4EOWL 3O41A 1WWBX 5J0BA 3CX2A 4X4XB 5IQOA 4XPAL 5CMAA 1FAIL 3SYQA 5FM4A 4UQBA 1I1CA 4P2QE 4R4BB 4Y1AE 2DBLL 1AGBB 1AKJB 1PDKA 2R4SL 2BIQA 3ARFA 5D71L 2ZE0A 3EYSH 1DBKH 4CN6A 2G2RB 4JKWA 2BMKA 2W9DH 5B38A 1O6SB 2X70A 5L0QC 4N2HA 1OAYH 2OJZL 3WUWG 3NRPA 5CGMA 3V6FB 5D93C 5EHFA 4PGZA 4OCSH 2AV7A 3VX1A 3BZEA 4G7SB 1PKQB 2EDXA 3IS1X 3GT6A 1MCEA 1HEZA 2PXYB 1FNLA 3NZHL 3QRGH 5FGBC 3C75A 5DMIH 4NPYA 4YLBA 5I2IA 1XF2A 4P23B 5BZZA 1LEKB 3RTQA 5K1JA 1RJLA 4R7XA 1VRSA 3M17A 4NZTL 4NRYA 3D2UB 4W4NA 2RHEA 4PJDF 2D3JA 4FLQA 3WEBA 2X6MA 5IHZA 3ZDYB 3EZJB 3RDTB 3T0EC 5DRXB 1IFGA 5LWYL 1ZHLB 2EH7L 4LEBA 2A2QT 5E51A 2VZ1A 3T0XA 5F9WC 2HFFA 3ZR5A 5I1EL 1TJHL 5B1CA 1D7FA 3NGBB 4KJYB 4KJPC 5IBUB 5CD5C 4BUGA 5I6KA 35C8L 2MOGA 3BVXA 5C0JA 3GRWL 4Z7UF 3V7AG 1ZV9A 4QD2E 5GIRB 1ZIBA 4ZNEE 2WAQA 3ZDWA 4JZOA 4IKJA 5C70A 4LSQL 5KBKA 2IVFC 1XGUA 3QUHA 3EOAA 2HWZL 3QAZC 4OCMC 1AZBA 1O5DT 3QUZD 4U6YB 2Q7YA 3PWUA 4YVNA 1OAXH 4NO2A 1IGYB 2P24A 3QFJE 4R4NC 4S11A 1U8HA 1B90A 3BW9B 4OLZH 3V0FA 3H2WA 2OP4L 1ZT1B 3HC3H 4IS6A 4XP4H 1WCBB 3FS9A 1Z3GL 5GPRA 2ADYA 5BW7A 2B14A 2DDQH 1RUMH 2EDBA 3FMGL 3SCMB 2J71A 1O9ZA 1W15A 4J3UA 3QI9C 4UZSA 1LEIA 4JPQA 3UDWA 3APMA 4FQJL 1YJDL 2ADGA 5EOTA 2FZ3A 4PAZA 3EF7A 2E7CA 5TDNB 1TJMA 1TEYA 4W1TA 4Y9CA 1IGTB 1ODUA 2JKSA 5D5MB 4Y9EA 4PY8I 2XSKA 5AB2A 3FTSA 3IDNB 3UAAA 1GJUA 2NY2B 3QULA 4OF0A 4NFDA 1J5OL 2QZQA 4L1SA 4LCVA 2R4SH 1XR8A 4WEBH 2P44B 3WLBB 5LCVL 4BXVA 4I87A 1AD9A 2OJ1A 5EIIG 4G82A 1X5MA 1PZBA 2Z7WA 4FNSA 4NXKA 1G0YR 2RALA 4FLOA 2FX7L 2LU4A 4L1HA 5DJDA 3PFQA 2BSCA 4FQLL 4RWHA 1XCXA 2G5BB 1GCFA 1H3WM 4NM8H 2GB2A 2NR6C 5JOPE 1C5CH 1TJIH 3C9NA 3WUZA 2B39A 3BUBA 7PCYA 1K8IA 3N43B 1HHGB 3LKOA 2WIIA 4FZ8L 3RJDA 5JHLH 4G8GE 1FFNB 1KGYE 3O0RH 1H3PH 4J3OF 4A2HA 1QFUL 3SD5A 5TE4H 4C58B 1BF8A 5BXFB 4OF3A 3QRFM 3S4SA 3GMQA 3C6SB 5D70L 3MRFB 5EN2B 2QDWA 5AVQB 5GJSL 4ZMWA 2VNCA 4AQEA 3EXLA 3V6OC 3KYNB 1ZANH 5CZKA 2Y72A 3FT2A 3GI8H 1BIIA 1UATA 2CXGA 2HJFA 3GRWH 3MLRL 3SPHA 4CJ1A 3QDMA 1NAMB 2I60L 1QSFD 1XF4A 4AQ1A 4AIEA 3X11B 5DK0B 4LEXH 4H8WH 4Q6IB 2IH1A 3SKMA 3ZRSA 3VD9A 3TOPA 2X0VA 2HWZH 2AJVL 2NW3B 3KBPA 1R19A 3T2LA 3TZVA 3IFOB 4KGLA 5DJ2B 2BOCA 4FG4A 2WQAA 1JN6A 3U30B 3VTTA 2CRIA 3M7FB 1IQDB 2HFEB 4GIOA 5I5RA 1TNMA 5LO7A 1Z3GH 3GMLB 1JFQL 1WLHA 3GHEL 4ZMZA 1ES0B 3V0DA 4ETQA 4PLOB 3P9LA 1EJ6A 4UV7L 1MH5A 4W6YB 1XH2A 2X4QB 4EIBA 5FLVA 4TQEH 5IF0A 2X41A 5C08A 5LUMA 3IPFA 4OV5A 3GDBA 5AYUH 5AAWA 3MO1B 4QAWA 4WUUB 1WZKA 3M8OH 3PWLB 4FRWA 4MGXA 2ZUXA 1J5OH 2H45A 3AABA 1TSHA 5CKAA 3DXAA 4Z7OE 1PZCA 1A7NH 2KKQA 5LCVH 3EGXA 5KYXA 4PBDA 2FX9L 1FZOB 3RYMA 3P3RA 3T1FB 5CBEB 2XWBA 1QTSA 2XVGA 2GC4C 3EFOA 4LVEA 3BAEL 3MAWA 5IMLA 1HKFA 5EA0L 4OZGB 4G6FD 4ZSOA 2R2CA 3UTSE 4FTVD 5TQ2H 1ED3A 2AV1B 3CDCA 3HG1D 4LOEA 5CFHA 1PZSA 4NO0D 1CD0A 1OGTB 4QXVA 3HMWL 1PTZA 3KXFE 5A3IC 2Y7QA 1BWWA 5BS0B 2ICEA 2BVPA 4ZO8A 2R0KL 3L3IA 2IOOA 3Q9QA 4G59C 4YBLC 4YSTA 1SJVA 4NRZA 2D3NA 2GJRA 3QEHB 4WSGA 3SKUD 2QV2A 2CO7A 2H3KA 4ZDHB 5GJSH 3NABL 4G42B 2LGNA 3H53A 3WS3B 1A4JA 1QEWA 3A22A 4JM4L 3H7LA 4I3RL 3AJ7A 3BAWA 1C16B 3H3BC 3QW9A 4HJJL 1FYHB 4X4ZA 2J4WH 5DJAA 1JHLL 4PJCE 1MCLA 1U8LB 1YPZE 5F7AA 1JBJA 3T6WA 1GGCL 5IJVA 4AOFA 1LWJA 4MA3A 3QG7H 2AJVH 4MNGB 3I3DA 1H5BA 3VI3F 3B34A 3WE6B 3UDWC 1A6ZB 3KPRE 4Y5XB 3HI1B 4TL5A 2MKWA 3FTUA 3QXAB 3RI5K 4Z78B 4Z9KB 3P4LA 5CEZE 4MCZA 5EN3A 3TESA 1NC2B 3S96A 1XL6A 2Q5BA 3CFMA 3F7LA 4X0KA 1KGWA 5HDBB 1JOIA 1TQTA 3RWJA 1P7KA 2ATKA 5GZND 1CDGA 5T1DH 5HI5D 2BDNL 4GMSH 1FL3B 2OMTA 2NYYD 3MRHB 5ISZE 3WEMA 4BK8A 2VMCA 3OD3A 4XRCB 4R7DA 1E4XL 3HZ3A 3HAEA 3S37L 2H2SC 3SQBA 1UKQA 1TPXB 4HF5L 4X98A 4ALAH 5LNDA 5JHAA 1RUPL 4W9LC 2NY5H 4A1RA 2MCAA 4MB3A 1NWOA 1KGJA 4PJ7A 4PVLA 4WWKA 4NQUA 3EJQA 5EA0H 4C83A 5CZVL 1LP9B 3AB0B 2ITFA 3CSYB 3EOTH 4IBLT 4MWFA 4OFVA 3F6JA 5GSVA 3K2IA 1RU9L 1UJTA 3C09C 1GPOH 2A6DB 3ZKXB 2BNRA 2BJML 3MLVL 2X1PA 2I9TB 1KJ2B 3DJRA 1ET8A 1YMMB 2Y36L 1ID2A 1L3WA 4OCYL 4V1DD 4DUXA 4HEPG 3H2QA 1NDMB 4L4TB 1KPVB 3VFRB 3Q5TA 4G3YL 5KN5B 4AQ1C 3NABH 2VGLM 4DGIH 2VDPH 3BUIA 4I85A 1PD0A 5IMKB 3CX5J 4I3RH 3OZKA 5AVXB 3K2UL 2RD0A 1VA9A 2FJHB 4WK4B 1TTUA 2DJSA 2JIXB 3BPLC 1AR1C 2O6EA 3LPFA 4UDUA 2VMEA 2BINA 1NZRA 1OW0A 3MLZL 4N8CL 4PRPD 1Z5LA 1GGCH 4N0FB 5T3ZL 1KB5H 4AKOA 1NJ9A 5T1LB 2J6EA 3MZGB 3B2MA 1AZZC 1YCSA 1IBYA 4KUCF 3L16A 3OKEA 1EZVX 2FUQA 3QNYA 3STBA 3IRPX 4O00A 2CJUH 1LQSR 1ZGLP 2YMXL 4Z18A 3D39B 4HBCL 2ZKYA 1BJ1J 2EUWA 1FORH 3JWNC 1MWAL 3DUHA 4JVUA 5IW3A 3VD4A 3FU8A 2HTLC 2Y1VA 1E5ZA 4WW2F 1QUNB 2Y2WA 1GY1A 5C07D 5HXMA 5LGKA 1KPRB 4GBXB 2D31B 4FFVD 4E41E 1G87A 3DX6A 1K72A 4LL9A 5KSAC 3IDGA 3BDYH 4HXAL 2BX5A 4IEFA 4MHHG 3FT4B 1Z9SB 4M1GH 2VOTA 5D1QC 3Q2WA 3LZFH 2J3SA 2NY1D 1C12B 3L54A 4M1DH 4NQCA 3SY0B 4XP9L 4AYBA 4ORZC 1NFKA 3EJCA 4BZ1L 2ICEC 5CZVH 4DP0X 5FUZL 3RQ3A 4ZMTA 2GIYA 1RU9H 2OI9C 5EU6D 1N4XL 3GLDA 1OALA 3E6FA 3FFDB 3IJSA 1U0QA 5AVUB 2BJMH 4ZMNA 3MLVH 1KGCE 1CZ8L 3DK0A 5J13C 3VGGA 1CLOH 3V0HA 4Y16B 4OCYH 4MMZB 4YOKA 3H9YA 1G4MA 1WYJA 5ICYB 2JKLA 3AS0A 2X7LB 4IOFC 2BY0A 2Q86A 1GOGA 1HNGA 1DFBH 2AAVA 1SJHA 4CU6A 5EU7C 1T21A 4JKPH 1A6PA 3HPLB 4TRPH 4LCIL 1H5BC 5E00A 4DO6A 3BFOA 3D08A 3WHE0 1L6XA 1AZNA 4Y2OB 3VXRE 1XSIA 1RV6X 4X6FA 4DEPB 2YWZA 4H0LC 5TH2B 2E9JA 1XGQA 2BVUA 3BSZH 2XG4B 5T3ZH 2R2BB 3TGXA 3CFEB 3KGSA 4K73A 4X9GA 2WO4A 1FBIL 3ZL4L 4RNRA 5E1GA 5BMFL 1J1OH 3WFBH 4GUCA 1GKEA 1JG9A 3K6IA 4ETYA 4OJFL 3F85A 2K6WA 2X4UA 3CGTA 3RWGB 1KIPA 5GRUH 2YMXH 5HVWA 4S1RH 4K94L 5DMYA 2W9EL 2ZUUA 4X0NA 4D8PB 3CU7A 3ULUH 4PW4A 4QCIB 1F3DH 2XPGB 2UYLB 4JRYE 2CCWA 4MMXA 4NXSA 3W39B 3ZT5A 3S35L 3VB9A 3C8KB 5F0JB 4ZX6A 3MNWA 3RWIB 5MHSE 4A39A 3T6VA 4XE5B 1H15B 4P46A 5CEYB 5L6YL 3S8FB 1SMDA 4WWKC 1M2VA 4HWEL 3Q2VA 5HBBA 3EFFA 4DOHB 1A8JH 4Z3IA 4NSKA 4HXAH 2AK1L 2WNWA 3MYZA 1H8SA 2PYEA 3EYVB 4NNYB 1S9XA 3LHAA 4A7QA 1BQUA 5ACLA 3HZKB 1CD1A 5EF3A 3TBVA 1KTRL 4X6CF 1T89A 2R2HA 4BA0A 4M7LL 4XP9H 4RRPG 1WIOA 5B39B 2ATAA 7FABL 3QC6X 3TA4D 3GSNL 4PSRA 5D8JH 3O8XC 1KENL 5A2FA 4G2AA 3CWGA 5IT2H 2PO6C 2YRBA 3WEOA 5C8JB 3LNGA 2K9UA 4NNXA 1P53A 4BQCA 1DR9A 2EVIA 2B20A 1CZ8H 4HVBA 3HHSB 3KS0H 3EHBD 2AZUA 4MDJA 1RUKH 5DFWH 3C6LD 1I1FA 1HHIA 5HPMB 5IFJA 4JFZL 4GMTH 5ADOL 4K5NA 1OW0C 4FN0A 3F6LA 5CJXC 1T03H 2VDKL 4HHAB 1ADQA 1QSEE 4RAVB 2NUTA 1JJUA 1GAFL 4PVMA 5DEFA 1U3HC 1FAKT 4QRRB 1WIPA 4W9FC 1Y0LB 1MZYA 2VDPB 3J7HA 4PWKA 4BD4A 4ZODA 5KS9F 3MKGA 3AROA 2YKLH 3L3DB 1ORQA 1A3ZA 1X6NA 1FBIH 3L4XA 2NNXA 1RL1A 2DJ4A 3QQXA 2O61B 2V9QA 1USZA 1VKXB 2YLKA 1G7JA 1M71A 4NGHH 4G6JL 1LWHA 4OJFH 1Z2KA 3SDXF 5F7NC 3ARQA 4A2DA 3DUSB 1KB5B 5DGRA 1EXHA 3RZCD 1LO3L 1J8HE 1F4YH 3KM1A 1CYXA 3NSCA 3RX7A 2O6PA 2A74A 3QIUB 2UWEB 1GGYA 5TQ0H 4QJ4B 3WKNA 1FZJB 5TDOA 4PJGF 4GG6E 4AUUA 1MFCL 2WOYA 3P77A 5HHNA 4LEEA 5EDXA 4OBSA 4HUXA 1HDMA 1RXLA 4F2MB 1UC6A 1R1CA 3IVKA 3AG4B 5L6YH 2UVFA 4PQXA 4E68A 4R26H 3VG9B 1M1XA 4XOEA 5L7XL 5AB0A 3BYTA 1D9KD 1TTRA 5F1OB 1NUDA 3UBGA 2ZICA 4KQ4L 1UA7A 1Z9LA 3PY9A 3V95A 4A7VA 2N1TE 5BV7B 1OCZB 4AW7A 4IRJD 4JE0A 1QRKA 4AL8C 1QRNA 4YDNA 5CINH 1M7DB 5JW4M 4M5ZH 1KENH 4MVBD 3QJFB 5HI4C 1T7WA 1AY1H 4JFDD 4OD1H 2UUDK 1S5IL 3MCG1 4Z7WE 4UTAL 1MRFH 3UTTE 5ITFA 2RFXB 4I0CC 5IQ9B 3CPLA 2ZKXA 1V5JA 2DTML 1KJ3H 5HI3C 1V3LA 2MSPA 3FH8A 4X9BA 1T0MB 1KCVL 3T0EE 2IWKA 3BWSA 1NINA 4GP4B 4IKKA 1F58L 4LARL 5F1SA 5ADOH 2FQEA 2NX5D 3L3JA 4XNUL 3VXSA 4R83A 2E7DA 3NDYE 2NNRA 3NA4A 3FB6B 3WJMA 4XP6H 3I6KA 1FYTA 3IEAA 3UTQA 1NPUA 5L2KB 1UTDA 3NIDE 1PGRB 2R69A 3IFLL 1J5HA 1S7XB 3BPOC 2XKNB 5CCGE 4XPHL 2J6WA 1NA8A 1IBGH 1EHNA 2VUYA 5JQ6H 2ZPKL 1INQB 1OQOA 2B16A 5I6XB 2QPFA 3HI6H 3HI5L 1S5HB 4N2GA 2AXHA 3E9UA 4MAYA 4JY4B 3ZHNA 3VGAB 2V5YA 1AGCA 3RWDA 3U6XS 5GJTL 4HA1A 4YNYA 5DWUH 4P46C 5I0VA 1QBBA 3P9MA 3M1BB 3MLUH 2HFGH 1S7VA 3P30H 4APXA 5JTWA 5F7YC 2FEDC 3DIVA 1R3JA 2D4FA 3HRZB 4LRIA 1FG2A 2BSTA 3RU8L 2C4XA 3IKKA 4ZFFA 1ROWA 5JPMA 4I4WA 4XX5A 1OB1A 3RIKA 4AMXA 4DAGL 1V7ML 1R75A 5F96L 4LLDB 5A16B 5DZLA 4KQ4H 4AC4A 4R4BA 2Z92B 3QZBA 4OF8A 1M1SA 2G2RA 1OANA 2K7QA 2DMKA 1O6SA 4TQHA 1QSFB 3G3LA 1SLUA 4YDMA 5FM5M 4XXCC 1E42A 2F7OA 3W0WD 1CD9B 3V6FA 2H0EA 3MA9H 25C8L 4K4KA 1U8KA 2P5EA 4OV6F 1JGDB 4YFLI 4OZIA 5MENA 4NQXB 1X5IA 1WFTA 4P23A 4FI6A 5HDOA 1EWHA 4RDBA 4AY0A 1GJWA 2VR8A 2F53D 4XC3H 3D2UA 2BHYA 3UIZA 4J3OD 1KCVH 4JY5H 5IJDC 1XV8A 4JO1H 2KDYA 1TCRB 2ZNWA 3WO4B 1IC1A 3RDTA 4LARH 4KZ0A 1FZMB 2CCVA 4NBXB 4F2FA 1ZHLA 1KWKA 4AXWB 2CK2A 2EE3A 3UJIH 3ATBA 3V6OE 1OTUC 4JKKA 2Y2YA 4XMKL 2BW4A 3LN9A 2P8MA 4KJYA 2VW4A 1ZHKB 5IVOA 4PJFB 3L1EA 4PRNA 3VFNB 1C9SA 4JS7A 4XPHH 3FCBA 1FDLH 3POHA 4DW2L 2ZPKH 4MSWA 5IBLD 3Q5YA 5EUOF 1JIBA 3MLXH 4U6YA 1MIEL 1NCGA 2HT3D 1IGYA 2WNGA 4BFKA 2FJFB 1ZLWK 4FTVB 1YEFL 3FZUD 5J4MA 4XMXA 1ZT1A 2D7TL 2IQAA 1WCBA 5TE6L 6FABL 2O26U 4PJ5E 3AY4C 3RDJA 3APDA 4FS0A 3L2LA 4P5RA 5KJRH 3B7SA 3CLFL 5LQBL 1CXKA 1CYWA 1X9UA 3Q8AA 4Z0XB 1KBKA 3ORJA 4HJ1A 3GSQA 3P4MB 5T33L 2QPUA 2BIOA 2AK4A 2HKFL 1NGPH 1YYMH 4XH2A 5ICZB 4OJEH 3IDNA 1V7MH 3QJHB 5D7KE 5F96H 4HS8H 2XTSA 3K72A 5GSRA 3TF7C 4JDVB 3W37A 4PS8A 4NO5B 5G5DB 4XI5C 1PFOA 1SEQL 1WZ1L 2CD0A 5IHWA 3WLBA 1U58B 4KTEH 1G5AA 2WXFA 3FOMB 3UP1A 4XCNB 5FA4A 4HK3J 3UC0H 2ZUYA 2YQ3A 3S5YA 2GJJA 1UH4A 5JDSB 1IU1A 2VQ1A 3QEUB 4HKBB 4WK2B 4YLQT 3U9PH 1EUUA 1YEJL 1DBMH 3LPPA 5DC2A 1JUFA 3I84A 3K2MC 1KWGA 1CD8A 3VVWA 2L7JA 2XQ0A 1NLDL 3CBRA 5AG9A 3LRHA 1HHGA 4GXFA 1SOXA 4XN2A 1L0PA 4OFPA 1FFNA 4P9HH 5AVSB 3Q2NA 3L8QA 1G7PA 3MRQB 4X7FC 1KIRB 4UM8B 2C1PB 3MRFA 4XMKH 1KGUA 3KYNA 3RVWC 5FKAB 1P5VA 2DMHA 3QORC 2HVBA 1NAMA 2E9WA 5SV3A 3QZWB 2PYFB 5IK3A 1PG7H 3PWPB 4DW2H 3FF8A 5DK0A 5IB2B 1HL9A 3FTVA 2NW3A 3LS5H 2N0KA 3D0AA 2QQKL 3ZUNC 1SQMA 5DJ2A 4ABVA 1QTPA 3FH5A 4LRIC 3QEGL 3K1KC 3KPLB 1EA9C 3X1GA 1N7MH 5JPMC 4X6BB 2XWXA 2XWJA 1GHFL 3ALXA 4PY8J 3GMLA 5TF1L 1ES0A 3BH9A 5SWQB 4GY4A 1S6NA 4FULA 4JB9L 4NB7A 5I15H 1KV3A 3SPVB 4V1DB 2HN7A 4LLYB 5HHPB 1DSFH 1E90A 4N2DA 2FX8H 3O2VH 3LQAC 4Y0GA 2OS7A 4HT1L 4W9GC 4FXTA 3BX7C 1ET5A 4BUQA 4YLCA 1NCWL 2VC2L 1MNUL 3MO1A 1YYLH 4WUUA 3TA3D 4WNSA 3B9KB 3PWLA 1LO2H 4JDZB 2OK0H 3QWQB 2XIIA 1MW1A 2CJTA 4JREB 4XO4A 5E2WL 4D0CB 2JB6B 2PETA 3MRNA 3KVPA 4P23C 1MJ7L 3BN9C 1R24A 2E46A 4PRPB 5CBEA 5BVPL 2VRAA 4EVNB 1ZPUA 3L3OB 3O2DH 4I77L 2VLRB 1YEJH 4OZGA 3B2VH 5IOKA 2VITB 5DF0A 3U4EA 5ITBL 2XZZA 5F3BA 1LD9B 3KR3H 2CUMA 3NACH 1T2XA 4FX5A 3CZSA 2ZG2A 2ISDA 4M5YL 5JIHA 4XWOD 1BVKB 3PGFL 3K8MA 3MHZA 2WVSA 3QDME 5DQDH 4C56B 2VABB 1KLUB 3JT0A 2BVQB 3QDAA 4KROD 2AGJL 1X5YA 3KLLA 3UEQA 3WUWA 4G42A 1KTLB 4P2AA 4PB0L 4XMPH 4O02H 1TNNA 1NFDE 4UTBH 3MA7B 1VEMA 3M7OA 4Z7OF 2YQGA 1U8MA 4GRWE 1C16A 1D5RA 3ARWA 5JZ7C 4QLWA 3IMTA 1HHJA 5T3XL 1U8LA 3MREA 1CFNB 4G9DA 4L3ED 4KUCD 5D1XB 3TEXA 4ELDA 4TNWK 5F0MB 4MNGA 4RGMC 5J8OA 3ZE1B 3FSWA 5C08E 3SBWA 1L5GB 3BWZA 1TUPA 4PJIA 3HI1A 1YG9A 3IMUA 1J5IA 3NK4A 5EU6B 4OCXH 4Z78A 1HWGB 3MROA 3G6JA 3JWNE 1NBVH 4M7LT 3RIAF 3GC3A 3ELAT 3D4CA 1RZ8B 3F7VA 1CTNA 3DXAE 3QXTA 4HAGA 5ILTL 1BFVH 4KC3B 2Q76B 1RPQA 2K8MA 1KIUB 4Q56A 4IGBC 4ZD3L 1H8NA 1R47A 1NCWH 3MRHA 4XT1C 2K78A 1YN6B 4LLWB 4CUCA 3GSVB 2DJUA 3BGFB 4L4VE 4CSZA 5JUEL 1YPZF 1JRHH 3ILEA 3NEEA 4PJAB 2EDFA 5D1QE 3RNKA 1GGIH 1MJ7H 4QGYA 3IXAA 3OAZK 2FSDA 3IB4A 1G6RA 3LH2L 4XR8C 2FBRA 9PCYA 2IAND 4J3TA 4HFUH 1MRCL 3FT3B 1I1AD 4GW1A 3INOA 1DQTA 4L18A 3PHSA 1X7QA 1EZSA 3D9AH 3CSYA 5I9QB 3HMXA 4X8CA 5KBLA 1SFHA 2VXSL 4LNRB 4H1LH 4B6ZA 2A6DA 2AXFB 3JVFC 3EXJA 1CURA 4M3HA 2I9TA 1KJ2A 1AC6A 4F3FA 2J8OA 3PGFH 4HC1H 5E2JA 2OCJA 1FSKC 4L4TA 2AABL 1KPVA 2BOBB 5JW4R 1E9OA 4JX0A 1SJEB 1AGDA 5D96C 4LRNL 2NNAB 2VISA 5EU7E 3WIFB 1ITBB 3H8NA 3GQFA 5IMKA 3U6XA 2H7WA 5A2BA 3T6QC 2MWCA 3KD4A 1HEHC 3GRGA 2BM3A 5B22A 4UINL 2VIRA 3MODH 2FJHA 1DQML 1WJ3A 2JIXA 3FCTB 3Q13A 1MCJA 5K39A 4L3FA 2G9KA 5T3XH 4N0FA 5T1LA 3STLB 1N9PA 2Z6FA 3MLSL 2Q8AL 2ZUQC 1JRHI 1GC1L 1AG0A 2RH0A 4LHUD 4PVNA 2AHIA 3AITA 4Z0BH 3FU7B 4NKDA 1E4JA 4XMVA 5E6IA 1MHPL 1BGXL 5C0CB 4JQVA 2GAZB 4J23A 3IDYB 5INDA 3LKRB 2GJZB 5IR1B 4KXBA 5LB1A 4N0CC 3DO7B 2CO3A 1MI5A 2Z93B 5JO5B 4IBWA 4CSPA 4HLZH 4YPGA 5DQJA 2OMYB 5GGTA 1I8KB 3NP4A 1LJMA 3FH7A 3P54A 4GQ9L 4LDOB 4GBXA 1UM6L 1P9MC 2RCSL 3UG3A 5HD8D 4GO6B 2PWFA 4F9PA 3BKCL 2OMVB 2PPAA 1MFDL 4XP5L 4WV1A 3L3HB 3P4NB 1DLFL 1CF1A 3A6OA 3F7YA 3FT4A 4EPSA 3LRSB 2R9HD 5DC4B 4YDKH 2IF7A 3QHFL 1NDGA 1C12A 3IGUA 4Y4HD 4UZGA 1QAWA 4CW1B 4QRQB 4LFHD 2ZX6A 5G55A 1UQSA 3DPBB 2Y24A 2CIKB 4OM0L 2KL6A 2Y1YA 2WBKA 4RX4D 1OSZB 3QUXD 4ODUB 1Z0NA 2HP4A 4XHJD 1JZEA 3PQYD 4FCHA 1WP6A 2ZSWB 3FFDA 4O9HL 5F21B 3RZCB 4LL1A 4JZNB 2EXYC 3H9SE 3QXDA 2JJUA 4Y16A 1E28B 1OCOB 5E7FA 2Q6WB 3UAFA 5J5EA 1G4RA 2NY6C 1SF3A 5D72H 4CILA 2AABH 3WIAA 3C5ZA 2ZSVB 4YHOH 2DYSB 4JFHE 2X7LA 3PXLA 4TNFA 3UPCA 2Y7MA 3L1OL 4NP4L 1OT4A 4O58H 5H37G 1OTSD 4BDVB 4UT9A 2VXVH 3P69A 5FB8A 4Q6KA 4KZDH 1XGYH 4UINH 3TM6A 1IBBA 2ZOTA 2VW7A 1XF3B 1XZ0B 1VCAA 1CG9B 5BVJA 4O02B 3DSNB 2VL5B 2QEJA 2FH6A 2XG4A 1WC7B 3JTTB 1J12A 1YEIL 3CFEA 3U82B 3MLSH 1AI1L 1O7DC 1YA5A 2YPVL 4MTMA 4NLHA 1XCTA 3ENEA 4XCYB 2CA4A 2WQRA 4QUOA 3PAZA 2VQ4A 5B7EA 1XTMA 1S7WB 2Y6SC 4OD2B 3QE5A 5FHBH 2DD8H 1BF5A 4KOCA 2QJDA 1HIMH 4XBEL 1NKGA 1F6FB 1F5WA 4BQ6A 2H26B 4FOMA 4G8FA 2YD2A 5IESL 2YEQA 4PJDB 2HTKD 4QCIA 5EF0A 1EERB 3T08A 3W39A 1RSYA 4KTGA 3U7AA 3VU2A 3DMMC 4X8GA 5CU9A 3LS4L 4N1CA 4RETB 3RWIA 5I75B 2A9NH 2C9SA 5I1CL 4GQ9H 1ACYL 2NX5B 3PFUA 5CEYA 4KNUA 1UD5A 3WKQA 5DYOB 1RY7B 12E8H 3TWYA 1CO1A 1WFNA 5AB1A 1TITA 1YDPB 4Z7UB 4XO3A 1UWXH 3WNOA 2XBTA 4MNQD 4NNYA 1QWUA 1ZTXE 1ZLSL 5FF6B 3UH8A 2HYMA 1RIHL 1ULVA 3QHFH 1WISA 4HS3B 3TO4C 5DC0A 1NFIB 4DETA 5F1IB 3MV7D 2WCGA 1GGBH 2GSGB 2GHZA 1H8LA 2YD8A 3ABZA 3WN5C 2ZD0A 5CWSB 1T0PB 5C8JA 4JRXE 4WU7B 5IKCB 4NWUL 2DWSA 2WP3O 4P4RB 1D6VL 1JPTL 4PJXA 4DZ8A 2IDFA 1FL5B 2WKGA 3MCYA 1BFSA 2YAEA 4JZJA 4NS0A 1IGCH 4ELME 4O2CB 3UBXG 4I9XA 2O5XH 4H1LB 2EE2A 4PJ9A 2VZ3A 1V8HA 3VXOA 3K71B 2DOCA 3L1OH 2EDTA 1NEUA 3T3MB 4FI8A 2WZPD 3I6GB 4NP4H 2QSQA 1A7RL 5HGGS 4HHAA 2DWTA 3CX5K 3LV3A 1MVUB 1AFVL 3BEWB 4R5VA 3VFOB 1KF9B 1Y0LA 2E56A 1FE8L 1NIEA 3CSPA 3PL6B 4EXKA 1BLNA 5E6IC 1HYSC 3QZNA 3GF8A 3L3DA 4AMKL 3D30A 1YEIH 4WWID 3V5KB 1F4XH 2CJ3A 4OF7A 5KVMC 4KDVA 4N6QA 2YPVH 1YC8A 4Z8FL 4HEPA 1VKXA 1WHOA 4JNXA 2ZQKA 4ZAKD 2IDTA 3BZFB 1FIGH 3DUSA 4YEFA 3BWUC 1YEKH 3QC5X 3B5TA 5IESH 4WFGD 3MBXH 2DQCL 3LKNA 2F54D 2H6PB 1CVRA 1J88A 1KCKA 2F53B 2D03H 3APNA 1KEGH 4N3UA 2BOLA 1HX0A 3IDMA 2PYEE 5BRZD 1VDGA 3LZLA 4WV1C 5I17B 2C4FT 2JKJA 3TEWA 4KKZA 1RLBA 2BIHA 3WNMA 1RZGB 4F2MA 1UA6L 1ACYH 1YEDB 1AS7A 1CGXA 3QCTH 4U1NB 2JKRM 4MA7H 3S34L 3FQ1A 4NQDB 1KTKE 5C9KA 1B2WL 2CDEA 3C2AH 3TBTB 5C0DB 2GY5A 3GBML 4JPKH 2OXHA 2WTOA 4M9PA 1RHFA 2X10A 3QQ4B 1LK2B 4H25A 2K1MA 1KG0B 3MBEC 4E42B 3REWB 4FJ6A 4U4BA 3A5VA 5B1BB 5A43C 1RZJC 2ATPA 1TLKA 1M7DA 2EEBA 2KZKA 3EADA 1JGUL 4HZLB 3RWEB 3PABB 3C5ZC 2FEJA 3CD4A 4NWUH 1VFMA 2X4SB 4CMHB 1A7BA 5J12B 1M3JA 3AG1B 1F3DJ 1BQHG 1NANH 1W0YT 2RFXA 4H7VA 2GG1A 1J8KA 5IQ9A 4KQ3H 5B21A 3VQLA 1SVBA 5IFHH 3W38A 1VGEL 3ABKB 1S9WB 2DMBA 3FOLA 4JFED 5D7LB 3RVXD 2DLHA 4HGMA 4L1DA 5EU5A 3CBJB 5A6IA 4FG6D 1A7RH 4G71B 5CAYB 4ATTA 3X2QB 3MLWL 5B3NA 1QNZH 1BV8A 3VAEA 3WXVL 1HQ4A 4RMTA 5IV2B 5L2KA 3WOVA 1OSPL 4HJIA 1ZRUA 5DD3H 1RH8A 5DJYA 3J2PA 1P6WA 2CXKA 3D06A 1I8IB 3LEVH 1DN0A 2QR0B 4ERSL 1FV1B 1J05A 1SYSB 3OPZL 1INQA 3DWTA 1EJOH 4UV4H 1R34A 5LXVA 1W91A 5D1ZD 2SODB 4OIAA 5F8RC 1CFVL 1S5HA 4G7YH 2UXGA 3WI9A 4YHYB 2OXGB 4JY4A 5L4IA 1GH7A 2B1OA 4UIMA 1ZE3H 3CG8A 4J39A 1IM9D 3TV3H 1U4FA 2EEXA 3GIVA 4NI6A 4CVWA 3U4KA 3Q3GB 4LHUG 1NANI 4K7PX 2BZ7A 3CZUB 1PZUB 1KCSL 4PRHB 3L3KB 5GRJH 4Q9RH 2X53A 3P9WB 3W56A 3NIDF 3KPSB 4TUJB 3RP1A 1JYNA 2YD0A 2AJXH 2D0HA 3GBMH 4LLDA 5A16A 2ZUSA 2Z91B 2Z92A 4NOBA 4X99B 2FVNA 4AC2A 1JNJA 3BUYB 3QDJD 1QSFA 5AVWB 4NN7C 2IFFL 4XXWC 4J1UB 4H8UA 3MACH 5CCHE 4JZJC 4YUEL 4QRSA 1I3VA 5DD1L 4FABL 1MCSA 3OC8A 2YN5A 2BRRH 3QJRB 4NQXA 4PJ9C 3VXSE 2YD6A 1ZLUK 3BKYH 1BOYA 2EIJB 2XQYA 1OP5K 1T20A 3TCLB 3V4VA 3VTMA 4DN3L 5CCKL 3ZU8A 4LFHG 1U8OB 4L3CA 1IBHA 2JCWA 4FCAA 4N5ED 1CGWA 3QUYB 4AXWA 4U1LB 2GVYA 2HJLB 4GI9A 3VFUB 3DOSA 5C0AE 3TA3B 4ZFOB 3MLWH 1NCCH 2PP9A 1YZZA 3WXVH 2AI0L 3KW8A 4QRPE 1OSPH 3T1WA 2E27L 2WYZA 4PJFA 2W59A 1IL1B 5JIKA 3VFNA 4Z7NE 5I6NA 1AHMA 3RGBA 5JOEA 2CRMA 4BZ2A 1VIWA 1G6VK 5ACZA 3OPZH 1MLBA 3SDYH 5I1JH 2FD6L 2ROYA 4RGOL 1N8ZA 1NAKL 4R7NB 3T09A 3IKCA 2VDQB 2W0LA 1SLXA 2HLAB 3EDJA 1DBAL 4A6YH 4UNVA 1KMGA 1WQVT 2NTSP 4FTVA 4GUPB 3HG1A 1RK0B 4NO0A 4MXQD 3AVEA 2XVKA 3KPMB 4BKLB 4UU9B 1IQWH 2NDFA 3CVIL 3MXVL 2OYKA 3W3BA 5KJ4A 2WKOF 3P4MA 4UI2A 1JYVA 4NUJB 4WEMB 1CE6A 4X8JA 1GTNA 4PP2B 1B0IA 2F5AL 2P5EE 3QJHA 3QUZC 4OZIE 2IADA 3AXLB 5MENE 1T0OA 1AC0A 3ETBJ 3FF7A 4MAZA 4MZ2A 4NO5A 4WJ5B 4G1MB 4XNYL 3FO0L 4M6NH 5BQDA 5SWZE 3WIHA 3SBQA 4PG2A 3FOMA 3NCJL 2GTQA 1QBMH 5AOKA 1JXFA 5FV1L 1ECYA 4K5MA 4PREB 4JANB 3MCLH 3HN3A 2WKLA 3QEUA 4HKBA 1KN4L 1EHXA 1KXVA 1G7QB 3W11D 3PDOB 4I18B 4EZLA 3VD5A 5EC2A 4ZPTB 2F08A 1G9HA 1KPUA 3HG4A 3LRMA 4FFYL 2F1AA 3D3VD 2V17L 4HKJB 4OKDA 1AQKL 1VGKA 4KVCH 4M4RB 4KQ0A 2V0AA 5I18L 4WW2B 2UZIH 3NRQA 3QIBD 4NAJA 3TFKD 3MRQA 2Y06L 4WY7L 1IAMA 5GZNA 5I5IA 2OR8A 1F18A 1KIRA 2X6CA 1OE3A 3QR1A 4LCUB 2VH5L 3QZLA 1Z0MA 4OM1H 4UM8A 4DGVL 3U1QA 3NFPB 3RX5A 3UJTL 4PVBA 1AMXA 5I6XC 3OL2A 3OKLA 3RJOA 5CLWA 3ASNB 2BVOB 4YBQD 4RGND 2E27H 3TU6A 2OQJA 4ODWB 4UT7L 3QZWA 1QNIA 2PYFA 4IDLA 4I48B 1W80A 4LE8A 3U0TB 1UCBH 4A7UA 5J1SC 3UTSD 2VDNL 1LO0L 1UXSA 1JV2B 2ZNXA 4JO4L 2XBZA 3T77B 1JCKA 5C2UB 3EH4B 3KXFD 3ZKQD 2VLJE 2HLFD 2NY3B 3K4AA 1DBAH 4XPBL 5KTEL 1KCRL 3FTGB 5I1GL 4K8RL 2E3VA 4P5TB 3O4LB 4CSSA 2AK4E 4JFXB 3SY6A 4XHQA 3OJDB 1I8UA 2X89D 2HZHA 1S46A 4FNLH 2CBMA 4N4YB 3ARZA 4ZS6D 1KDIA 2DH3A 1PZAA 3AC0A 3QFDB 4V1DA 3SPVA 1K4DB 4JL2A 4LLYA 4YSSA 3CFCH 5HHPA 1AP2B 4IRSC 2GITB 5FKPB 3KDMA 4HUCA 1FZKB 3VXPB 3O6FD 1W16A 4G6MH 1BSIA 3GJFH 1UM4L 4WLCA 3VH8G 1ECZA 5EG6C 1IEAB 3CTTA 4C4KT 3G6DH 2R0ZH 2DQFB 3E2HC 3PWJB 5FYKE 1E4WL 2HLEB 1AD0A 2KZBA 4RAHA 1E40A 1XEUA 2FIKB 2WD0A 5IHHA 3MR9B 4PRPA 4M7KH 4K7FB 1FF5A 4WAFA 3L3OA 3CBKB 5I8KL 5CEZD 3KMDA 2VLRA 3CCHB 4FE9A 4AVJA 1GGTA 4B41A 2QVTA 5DZ9A 4O51B 5F7LB 2OSWA 2HRPL 1G9NC 3NJGA 2ITDA 1LD9A 4F37K 3UEZA 3QZOA 4XCCH 5AUMA 1OHQA 4FFYH 5KAQF 5LGYA 4G6KH 3OJMB 3APFA 3CDFA 1BVKA 2X0UA 4K07A 2LLLA 5DS1A 1EUTA 2FLMA 2Y06H 5F44A 2BVQA 3QWNA 4N0RA 4FXKB 3LB6D 3I9GL 2FNBA 3IETB 5HHMB 3QJZA 5J1AB 5E08L 4U3XA 5C09E 4YHPB 2WLJA 3GMRB 1NOAA 2DYPB 3HN8A 4KRLB 4G9FB 3EH3B 1X5GA 4LDEB 3IAQA 3V9EA 2FHCA 3RL2B 4F8NA 1NL0L 3GKWL 1OHZA 4R2GD 4YSUA 2R29H 3CVHA 4Y9BA 3KVQA 1QFWM 5KYNA 1FO0L 1SHXA 5D1XA 2AFNA 1AG6A 1ZPLA 4Y4HB 3KGUA 1E3ZA 5HJ3B 1T04B 4A2EA 4OGXL 4YSDA 1XIWD 4XPBH 5KTEH 3ZXAC 2NZIA 5DJCB 5FEBA 1R3HB 4WUUE 4ORGA 5EU6A 2FGZA 4XAWL 4JN1H 2ITCB 1BJ8A 3TV8A 1KBGH 1AVAA 2RB8A 2BP5M 4MJJA 4G8AC 2CKBL 3FUKA 1RZ8A 2A1WL 1CTOA 2CJSA 1DQJA 4A6YB 1Y18A 2ADJB 3QUMH 2Q76A 5ES4B 1KIUA 4HYTB 1NFDF 4G43B 1YEEL 2X42A 2IQ9H 4GRWF 1A6WH 1A1NA 4MDIB 1UM4H 4N0YH 4LLWA 4P4KD 1N67A 3S7GA 3VCLB 1BM3H 3D4ZA 3GSVA 1J7VR 2E7HA 1ND0B 1CFQA 4L5FL 4ONGL 2CLRB 1KXVC 1NIBA 2ERJB 3HG3A 4PJAA 2WK2A 3RFRA 2CO4A 3SKOA 3VWJD 1KYFA 2WWKO 2XN9E 2RAMA 2H1XA 4GXUN 1QYGL 3EKCA 2R56H 2JWYA 1EHLH 4ANVA 4ZTOH 3FT3A 3UROR 2LR4A 3MFFB 3P3YA 1DYZA 1JS4A 3D07A 3ECWA 4I13B 3WY3A 4EDWL 1N68A 4MJIE 5I6PA 5DD0H 1MXDA 3IGAB 5I19H 5GZNC 4LNRA 3SE9L 5HI5C 1XR9B 4ZBJA 3WTSA 2CUAA 4DVBA 2NYYC 4PJGB 1P2CB 2XWZA 3HS0A 3ML8A 1AXIB 4FXLA 2R2EB 4UB0L 3ARGB 3WIIH 4RWYH 4E41D 4K7PL 4ODBD 2EE6A 2QGEA 1SJEA 2I5YL 3WFZA 1FWXA 2D8KA 2NNAA 2G9HA 3I9GH 4M8QB 1DQDL 1L7IH 1Q8MA 4PN6A 4YJZL 5IB1B 2EIBA 2NZ1A 3TFBA 4JAMB 3BE1L 3MMEB 3MNZB 1NL0H 2DTSA 3V6ZA 4PJIE 4EXPX 1I9RH 3VRLE 4LSVH 1LLAA 5DC9B 3S3BB 3G6JE 1KFGA 3CXDL 1BQLL 1E43A 1TG8A 3L7EB 4KAQL 1O7DE 5C3IA 4NWTL 1YSOA 8CGTA 4MJ2A 4XZ4A 4GINA 3MV7B 1SBSL 5INCB 3MOBL 1RHHB 1KGCD 4ZS7H 3V7AE 5JOFB 4JHAL 4CVXB 3FU7A 1VFOA 5F7DB 3FL7A 1EFXB 4PYHA 1EO8L 5C0CA 4PGDA 2Q87A 2VDRL 2GJZA 1E3FA 3LKRA 5IR1A 4H8QA 2G0KA 4QRUB 2CKBH 1I31A 2C34A 4NQSB 2JJSC 2Z93A 4LPYA 4P5SA 1E4XI 5JO5A 3QYMA 1WEJH 1OOAA 4FD0A 1BXUA 1TZIB 4BQ8A 3VXRD 1I3GH 1I8KA 1OCWH 3A6CL 3ZO9A 3WFDH 4A7GA 2EIZA 4N1HB 2LOEA 2EKJA 3NH7H 4Y19E 1I8AA 2OMVA 4L5FH 3L3HA 3P4NA 4ZQKB 4OZFH 3H4HA 3LRSA 4KJQD 3GJFB 5D7IA 2VRKA 4OZ4A 3UAEA 5F7KC 2R23B 1RZQA 3CLWA 5CSZB 3V79C 4QRQA 2ZX5A 3ECBB 3FQ4A 3DPBA 4L4TE 3UMTA 2AVGA 4EDWH 2C5DC 2CIKA 2A9MH 1F6AB 3OWRA 4DPAX 3CN0A 2NXZB 3FU5A 4ICWA 3RZCA 5DQ9A 3O2DA 4JZNA 1BCIA 3CFJA 3FAWA 2XA8H 1NEZB 1CN4A 4YWGH 4N90D 3U2IA 4FFVC 2Q6WA 2EIDA 2DEWX 4OIIH 4YDVB 4DCQB 2ZSVA 4JMXA 2OV0A 1OAJA 3DGCR 4PJHF 1DQDH 7PAZA 3SBPA 4BDVA 1BBJB 2C8NA 2NY1C 2BSED 2AXWA 5KANG 4FKKA 2IG2H 4IRZL 2WLMA 3QS2A 5BQ7A 3GBNL 5DEJA 4YPJA 3SJVE 2OL3H 1UENA 5DEZA 1S9YB 1EJFA 4J6RL 2VL5A 1I9EA 2ZCLL 3ABGA 1QLRB 1WC7A 3JTTA 4KAQH 1XGTB 4WO4B 1IGJA 2VT0A 5GS0L 2NY0C 1PU0A 1SBSH 1MI5E 3MOBH 4XCYA 4PTTB 1ZS2A 1S7WA 3QZPA 4OD2A 1B4RA 3DX8B 4OUOA 4P59H 2H26A 3MJ9L 2FE0A 3P3UA 5AZ2H 4PJDA 5D7SL 4FADA 2HSIA 2JQZA 4NM4H 1CBVH 1CDHA 4NNPL 3NT0A 2ALAA 1BDYA 1QSED 3ARPA 3I75B 4LESA 2V2TB 2PPDA 3A6CH 2IPTH 3GZQA 2NX5A 2F68X 3HNVL 4P2QB 2X0WA 3EYQD 4FZEH 1QZNA 4Y1AB 2DV6A 2R0LL 5EZLB 5DYOA 1RPKA 4O4YH 2OFQA 3QUMB 2OYMA 3N44B 4Z7UA 4X5WB 1IGML 2FT7A 2EH8L 4X7CC 2DPKA 1NFIA 4LO9A 2GSGA 3KYAA 4HWZA 3HS0C 1SJXA 1J8HD 4Z3JA 1IC4L 3O0LA 4O5LL 4G8EB 2MCPH 5F89B 1KLGB 4XO5A 2CHNA 3VM7A 3ZE2F 4AQ8A 5AL8A 5ESVB 2RIKA 3VFVB 1FL5A 1CLYL 3GK8H 2MPAH 3B1TA 2IC2A 4HGWB 4BCYA 1MFBL 3RE0A 4U1IB 1WUNT 3WMQA 5KW9L 2D4DA 1QWNA 1X5HA 3K71A 3L95B 1HE8A 4K9JA 3CV5A 5CILH 5KSUB 4GP5B 3ESUF 5GRXG 4IRZH 2ODHA 3GFUA 5TFSL 5B4MD 3BEWA 5KVEL 3VFOA 4NBYB 3GBNH 1AACA 4Y4FC 4U0RB 2NNCA 3BIKB 4B9FA 5FO7B 1KULA 2YD9A 2FWOB 5FX3A 1LEGA 2YPKB 2ZCLH 3RBSA 2MTPA 3WFCL 3QFJB 2B3IA 3GHBH 3QDJB 3V5KA 3LD8C 4I2XE 3WG7B 5L9DL 1R0AH 2ZOKB 1OT1A 1IM3B 3EHBC 2EYRA 3BPCB 4M93C 5JPNC 3RY4A 3V0WL 4D7BA 1KN2H 2QMJA 2AEIT 2XV2A 3BZFA 1FFPB 3C6LC 2B5IC 4XNZC 3US1A 1HZLA 3N1QC 3PYCA 3Q8FA 4ELMF 2G60H 2VSKB 5D7SH 4ONHB 1LE5B 3RWFB 2F53A 3DJTA 1D5IL 2A83B 1PLBA 1C1EL 5I17A 5DFTA 1NH6A 3RY5A 3JTBA 1RZGA 3CN4A 1FI8C 2JSFA 4QRBA 4U1NA 2OMNA 4NQDA 2XVBA 1COBA 1TFHA 2K9FB 1JD9A 1UB5A 3N9GL 3O45A 1FIEA 3OMAB 4OZHF 5EORH 5TK4A 3TTYA 5HYIA 3DVGB 4XNMB 3SQOL 4R4ND 4FTDA 4PJXE 3QQ4A 1KG0A 3TJEL 4E42A 1XCQB 3REWA 1SM3L 2OTWB 3MNDA 1NGXB 2V5SA 3WHXB 1IC4H 4OZFB 3C8HA 4JCLA 4HZAA 3PABA 1WIUA 4PV8B 3H6AA 1T7XA 1MWAB 2P3YA 3BPNC 3LNIA 4KKAC 1EO5A 4N1EA 2O5ZL 4NZRL 4PS7A 3Q6GH 5FXCH 1LGVA 4G8GB 3ZLQC 3V8OA 1O5PA 3IDUA 3LKPB 4F7TB 1CLYH 2ZUTA 3OZLA 2Y7OA 1Z32X 2YOCA 3QPKA 1D9KC 1WE5A 5AWNH 2WANA 2QMKA 1MIMH 5KW9H 5D7LA 2PW1B 1T5XB 1PLGH 1JNNL 3FO2B 1MNNA 1YHPA 4IRJC 4GSDH 1RZ7H 5LBSL 4H8HA 3MRJB 2NXYD 2NUPB 4UILH 5IV2A 4KK6D 2F58L 3F5WB 3NJFA 1JZFA 2ZAGA 5EZJA 3D7PA 2QR0A 1II4E 4DK3A 1FV1A 1SYSA 4UQEA 4ABQA 1NCAL 2BHUA 3WNNA 4EI5B 3AXHA 1RZKL 2OL3B 3MOAL 3IXTA 4XBPB 3VXUD 5B1JA 4XNQB 1GKOA 3V0JA 4RZKA 2OXGA 3Q48A 3QCVL 4IK6A 4KHTH 2I32A 2WBJC 4POZC 4Y4KB 4LK4A 4BZ2L 1CB4A 3RVVD 3B3IB 5SWSD 1TZGL 2O6DA 3CH1A 4GW4B 4TPRL 2AEPH 3IU4L 3Q3GA 5JMOC 2WXIA 4EUPH 2E9GA 2VLLB 1LDPL 3QIBB 1F6LL 1FH5H 4EZJA 1X4YA 2P52A 2C9PA 1G7MA 2OA9A 3L3KA 4K9EC 3TIEA 3WY4A 1U41A 4Z7OB 4R4FH 5FLUA 3N9GH 1I7TB 4TUJA 3DURB 4L37A 4PJ8D 3TN0B 2OMBA 2Z91A 3EYUL 1E27A 1ZHNB 4MA8L 4X99A 4XPGH 4AQ8C 3QEQD 3R1GH 3TJEH 2Y7SA 2PWGA 2YKKA 1SM3H 4GAYA 3MI6A 3UTSB 3VI3A 1UD8A 4HXBH 3HC0B 1TZOA 1CDBA 3V52H 1MW2A 3KXFB 2VDLH 4JR9H 3WKPA 1AOHA 15C8L 2NSQA 3MLYH 1IC7H 5CUSL 3ZTNL 4CL7A 4BIKA 2O5ZH 4L9LC 1E4KA 1F3JB 4LCCB 3VFGL 4DO5A 3G6AB 3TCLA 3V10A 3OZ9L 2F19H 3NJLA 4Z6AT 3JQOB 3ZL2A 1U8OA 1IAIL 4JO3L 4OAWA 5D7KD 2B7DT 1CC3A 5DFAA 3VU1A 5L8LB 2A9DA 5I73C 3QUYA 4WF7A 1TQUA 1OAUL 4U1LA 2HJLA 5LJYH 3VFUA 3O6FB 5LBSH 3TA3A 4AW4A 2QPDB 4ZFOA 4NPKA 4PJCB 1YPZB 2F58H 3AMKA 4D2NA 3C6EA 1UD2A 3PIQB 2XNAB 5IEHA 1AS8A 1TSRA 2UZXB 2X4TA 1YNKL 3IFPB 4H26B 5F70A 1NCAH 4NT6B 3GJEB 4P49A 3SPCA 4M7ZC 5I74B 1KC5L 4QJ3B 4R7NA 3BVNA 2HLAA 4XPFH 1EDQA 1S3KH 3ALPA 4GUPA 3UERA 1QA9B 1RFDL 3IDXL 3UJJL 3IAPA 3TYGH 4BZ2H 4GKNB 2YGNA 4J3VA 3KPMA 4BKLA 2Y5EA 1TZGH 4UU9A 3IU4H 5ISZB 3R7RA 4XBGB 1DHKA 1I85C 1UD6A 4E5XB 1RQ5A 5EO0B 4QY8A 1TENA 2BZDA 4UT6H 1YQVL 5D9SA 4CC4C 3SDDD 4HP5A 3BT0A 4K3GA 2ILLA 4NUJA 4GLRH 4ZUUB 1R5IB 2FO1A 1A4CA 2F5BL 1RJCA 2Z65C 1AO7D 1DVQA 5E24E 4PMFA 3AXLA 2AQSA 2AMGA 5CJ8A 5G4MA 2HT3C 3D2TA 4RMBA 1R17A 3HEIB 4MA8H 3I74A 4R2GB 3K4DA 4TS6A 1M7UA 5E23A 4DF9A 3KBHE 1R3KB 3IFNH 3DLQR 3FZUC 2YRZA 5HDLA 4EEEA 1T1ZB 4PREA 4L3EA 4JANA 2H41A 3I50L 3LIZL 1EEYB 3QIWD 1EVUA 1S9VB 4X83A 4ZZKA 3OAWA 1A1OA 1HT6A 4UQ9A 43CAB 1G7QA 1XIWB 3PDOA 4KTYA 4XO9A 1BYOA 4I18A 2EYTB 5AW1B 2XETA 5IBTH 2W07B 5FO8B 4ZPTA 3I02B 1E8ZA 2FWUA 1ZOXA 1CPUA 3DTDA 1DL7L 5KWYC 4AYSA 4WUKL 3KJ6H 4PJFE 4WW2A 5AVTB 4M6AA 4MZ3A 4TNVK 4HIPA 5EDSA 3V4PL 4LKCB 1W6WA 1EQWA 1SLVA 1M3IA 3FT0A 1SQ2N 2UUDH 4LU5L 2X3AA 4WCYH 3HKFA 4P4KB 2WQSA 3FO1B 5DEGB 1FGNL 4XVTL 3B7RL 3V9CA 2BVOA 5B1JC 3HG1E 2MEJB 4F8OA 1IEBA 3MRPB 4NZUH 4ODWA 3RFZB 3U0TA 4PS4H 2J1YA 4GLRI 5PAZA 1EEZB 4IBZA 2NPLX 1NM4A 1MFVA 2XQYK 4U0QB 2IANA 1I1AA 1P1ZB 3ZR6A 4MYPA 5JMRA 3OLEA 2CH8A 4TVSa 3NZUA 1I9IL 3FTGA 1I4FA 4Z7QF 2A9BA 5JORA 5E8OB 1NIDA 1RFDH 3GB7B 2YGPA 3IDXH 3MYJB 3O4LA 4JFXA 4ANWA 1T5WB 5ID0B 3OJDA 1P4LA 3AU0A 1TQCB 1FH2A 2ZKHH 4OLWH 4JDTL 1I7ZA 3QFDA 5DLMH 1K4DA 2CWRA 1AP2A 5FKPA 5ICUA 4E41B 1YQVH 3VXPA 5C0GB 1R5WB 4G1EA 4G7QB 5FDWB 2LHAA 5F0LB 1NGQH 2Q8BL 3L5WB 4W9JC 2LLNA 3UTOA 5F7MC 2ZOLA 5LN4A 2LVEA 3BLBA 5HHOD 4AMWA 1MVFA 2DQFA 3NK3A 3PWJA 4OLXL 4MLIA 4AKQA 2XN0A 2W1NA 2FWLB 1E4KC 5IVXF 2WXJA 3WGUB 4DQOL 2O5YL 3L5IA 4K7FA 4KRPB 3QQNA 4WWOA 3WCYA 3OXSB 1D6EA 1DVXA 3CCHA 3UP6A 4UUJA 5J6GA 4LHUA 4GG8A 4JFFD 4MXVE 3CHPA 4Y5YC 3LNFA 1W72L 1IBZA 3FXIC 4JQXA 2ADIB 43C9A 3VDCA 3WJLA 2VDLB 2OMWB 4X7SL 3TWCL 2JNZA 4WUKH 4EKXA 4Q0XL 4FLRA 5FGSA 5KSAD 3II1A 2CPCA 1ASPA 4FNRA 1E8YA 1F42A 4L4VD 4U6VH 4FXKA 1K2DA 1P7QD 2YD3A 3IETA 3VXRB 3GIZL 4F9LA 2APFA 5HGDB 2B1AH 4ODHH 3GMRA 3VQ2C 2ED8A 1CU4L 3U7WL 1T22B 3OG6B 1KCLA 4WFHE 3BH4A 4X6CA 2C3VB 4WDIB 5E2TL 2BFVL 4FNPA 4L1BA 4BH7B 2HG5B 2C3HA 1A6UH 5FOJA 3QWOB 2CSPA 5AW0B 5DR5L 4Y4HA 5CD3B 1T04A 3WL9B 1A3RH 3BP7B 1HC1A 2AKRA 2CHWA 2P46B 2WINB 3TONA 1TOXA 3SODB 3T65B 3I85A 1QI3A 3ZE0E 1ETZB 4PRDB 3HUJE 4JRYB 3E6HB 2KT6A 2PTTB 3QUXA 4RX4A 4IOFD 3KLAB 1TZAA 1NUFA 4JFUA 4KROC 3F8UB 4HV8A 4LQFL 3PQYA 2IPUG 3WEXB 3AUWB 4BK4A 2V7NA 5L88L 3GI9L 4UM9B 3AACA 4M7JH 4JDTH 4A6YA 1MFNA 1R3IH 4ONFL 4PY7B 2APBA 1XT5A 1UB6B 4WW1B 2YA1A 4N22A 3QK0A 4G43A 5E9NA 1MQ8A 4PLJD 1ID5I 3FUFA 1JERA 4HLZG 3UADA 4NN6C 2WXGA 1ZLWH 1AOZA 5AKTA 3CFBB 4PP1C 5G4OA 1KYAA 1SXCA 4EJ1C 5FA3B 1QR4A 3ZUCA 5J6SA 5KS9A 4JGMA 4I18C 1BVLB 3VFWB 2UXVA 3UCQA 1BXXA 1PQZB 1MCPL 1UYWH 5HVGB 1SN5A 4S2SB 1I3UA 3W9DB 3ROLA 4X6DF 3MFFA 3SDXA 2R27A 4Y8DC 1MCBA 2X1QA 2ADFL 1JGLH 4NKMB 5C97A 3S8GB 1HZHL 3IGAA 1IGIL 1ZSDA 5CP7B 3K91A 5IB5B 1XR9A 1G1CA 5C07E 5IJCC 1DUYB 2FB4L 3CDZA 3V0GA 4PJGA 3TWCH 1P2CA 3Q8BA 1JI2A 5HHXH 3QCUL 5MEPB 3PJNA 4D9LL 4UNUA 5EOQL 5DYFA 1DTUA 2F1BA 1QSEB 1V27A 3MLPA 2ENJA 4M8QA 4X9HA 2AF2A 4W9ZA 4YGVB 2FECI 5E1QA 5IB1A 4LIQL 4JAMA 4JN2B 1I1AC 3MNZA 4YVUA 3OHXB 3RJQB 4JQIH 1KELL 3M46A 3O8XD 2PO6D 1L4IA 2BFVH 4BKSC 4YQXL 2IXQB 4TVPE 1VERA 3D09A 3L7EA 3VG0L 2K3TA 1A3LH 3MV7A 1AR2A 5INCA 5ID1B 2COVD 3EJJX 5JOFA 3H9SD 1CXLA 1J8HB 2J55A 3MDJA 3OB0K 3U7YL 1D5ZB 2J5LB 4MMYB 1BZOA 4NN5C 5F7DA 3UXFA 3JWDC 4AZ8B 1HCVA 4GG6B 1E6JL 2Y5TB 1NICA 1WBYA 5DK2B 1MCKA 2ZCZA 1WGVA 5ERWB 4QRUA 2R1YB 5DJZB 2ED9A 4QF1B 1G7HA 2J8UE 3B1UA 3V4UL 3T3PE 3VGEA 3FCSB 5IIEB 5KSVB 1HJBC 1U3HD 2XQBL 5AW4B 4PWJA 1N2RB 1O7VA 1TZIA 1LXMA 4L8DA 3K8KA 4B0MM 4E9RA 3K6SA 2B1HH 1LNUA 5F9OH 2WZPA 3IBOA 4B3VA 2QKIC 5L0QB 3KL3A 4TUOA 3D1MC 3VRLF 3AS1A 4LOFA 5D93B 1OV8A 3D87B 1HL4A 4ZQKA 3VXMD 2VR5A 1P4BL 1V3KA 1GS6X 2W81C 3AS3A 3LKSB 4H88L 5DFVC 3KPQB 4JQXC 4Z7WB 1DO6A 5CSZA 3UTTB 3ECBA 4K3JL 2I85A 3AS2A 4KMTH 3L81A 2A77L 2B4CL 4ZAKA 3MGOA 2RGSA 1WVZA 3D18B 3NVQA 1UXWA 5D4JA 3T2QA 2ZX8A 3T2NL 3T0EB 4F9LC 2BSDA 1NCNA 4HIXL 5K9JH 1X4ZA 2F54A 1YNTF 3QCUH 5F9WB 5HD8C 2OMXB 5C0RL 4YDVA 4DCQA 1CYGA 3OKOB 5BRZA 5IQ7L 4I0PD 4WO0A 3MV8D 2JK5B 2R9HC 3SGJC 3GEWB 3NIDB 3X12B 2CZNA 2XYCA 5AKVA 1CDIA 1KDJA 4YO0A 3JYBA 3QAZB 1Z5HA 2XI9A 4YDJB 2BW5A 1Q9KB 1XSJA 2XC8A 5C9JB 3ATEA 1DQIA 3CN1A 3QUXC 2R0WH 2YQ2A 4XHJC 2WZ6A 2X4RB 4WO4A 4JRXD 1XGTA 3HB3D 3TO2B 4NJ9L 3HIZA 1Z9PA 3WN6A 3EO0B 4YZFF 2R29A 3JUZA 4PTTA 3S36X 3P0GB 3QI9B 1BQ5A 3DX8A 4HJTA 5ESQB 1JVOA 2KHAA 3NJXA 1RULH 5I1KL 5DVOA 5A1AA 1R9FA 1OTSC 1UM5H 5GS2D 3RY6C 5CGYD 3V4UH 4RESB 1H3GA 2ERJC 5D7IE 4ZMVA 1P0SE 4L4JA 2GTZB 1O9VA 2ESVD 2XDHA 4EE2A 4J27A 2TRHA 3NEXA 4JFOB 1RLWA 4O2EB 4TUUA 5H94B 1KCUH 2WM0A 1B4JL 1WO2A 1MFEH 3FRPG 3I9AA 5E70A 5EZLA 3P11H 5KSBF 3MN8A 1TU2B 4X5WA 5FCUH 1PYWB 4PV9A 1P4BH 4L29B 5ANHA 1AJ7H 4IKLA 4J6IA 1YJDC 2QZ5A 5EUOA 2V9UA 1WFMA 2ZKWA 4GS7C 2P42B 4L8SA 1ZJAA 2QSCL 3BWUF 1GMEA 2HTKC 4AUYA 4YIQB 1X9RA 2B4CH 3MZTA 3ZO0A 4XAKE 4G8EA 5F89A 4KDTA 3MRMB 1XBRA 4EIGB 4HCRL 1NGZA 3T2NH 5ESVA 4YL9A 5ELIA 3H42H 5DA4A 5DMGC 3MJ8A 3VFVA 4GRWH 2OMUB 1IM9A 1WH0A 1NUNB 1H3XA 2Z9TA 1Q0XL 4HGWA 4HWNA 1AE6L 1MUJB 3OAZH 3QRBA 1F4AA 4GPVA 1KXQE 1SMOA 4U1IA 2DLFL 2DQGL 1ITCA 3L95A 2DN7A 3GTVA 1PX3A 1KIQB 2C9RA 2AQTA 5FV2A 5KSUA 3WS6C 4ZNEA 2FGWH 3OMZA 3WTWA 2JFCA 1OARL 4OB5L 1J9RA 4JFDE 5DJXB 3D85B 3WKYA 2Z0UA 1K5NB 5EO1B 3BIKA 3QBTB 2V5MA 3JWNH 2IGLA 5FHAH 5D2NA 4BWUA 1KZYA 2EDHA 4K8RD 3QDJA 1HHHB 1DBJH 3LCYA 3V7MA 2ZAHA 4ODXB 3CK0H 4FLSA 1WBZB 4HIIB 3RX9A 4JK0D 2B59B 1QP1A 1IM3A 3O41B 2Q7AA 1T7YA 2YHGA 4PJ5B 2NQDA 3LVTA 3MV11 4XVOA 5KVDL 1FFPA 1D5XA 3D51A 1GRWA 2X2HA 4OR1A 2GK0B 2YQBA 4QR7A 3LXCA 4L3AA 1ZA6A 4ZTPH 5B38B 3LH8A 4NCC2 4ONHA 2BMKB 1LE5A 5KVFL 1IX2A 1WD8A 3MV01 1B3IA 4Z7UE 5GRWA 1U33A 2CDGA 5DHYB 1OOWA 5CLTA 5K9QG 3BZEB 4F8PA 3LQMA 3NYKA 4QOKD 1UKSA 2YD7A 2ENSA 4H2CA 4OLVL 2J1WA 3ES6B 4NPYB 4AM0B 5I2IB 3T0BA 1QVOB 2JLPA 2A9CA 1MDAA 3DVGA 4ZAKC 2EAEA 5IHZB 3CXHJ 3QT2A 5G2NA 1XCQA 4G6AC 3ULVL 1NGXA 5IJKC 3WHXA 3DJ9A 4AYDC 2BSRB 1SZNA 3FT9A 4OZFA 3GSOA 3DPDA 5LXGL 2HFFB 4N9GB 4WHYH 3CQPA 4PV8A 1CDCA 1MWAA 2NY4D 4KVPA 3KWWB 4YBLB 5C0JB 4L05A 5I0DA 1H6TA 1T80A 2VXTH 4PUBL 4Q9QH 4F7MA 4JZOB 3DGGB 3OLDA 4FP8L 1AHWC 4WVRA 2E6QA 2DLFH 2WHVA 3L17A 1WRFA 5KVGE 1MPAH 3QJQB 2PCPB 1AHKA 4ZMQA 3H1ZA 3FO2A 4L1TA 4R8WL 1U8HB 2P7TA 4LEOB 3W0WE 3BKML 5L4FA 3MRJA 3FNKA 3ZHFA 1HL8A 3D4YA 4OBRA 5DUMH 4N5UA 5E2UL 4OI8A 5EIVA 3RHWF 3Q2LA 4BZ1A 4BQBA 1JI1A 3ESMA 5IZ7A 3PGDB 5M94B 1LEIB 1LWRA 2WXLA 3NCYP 4V11A 3HAEH 4KPHL 1HOEA 1OPGL 3UABA 3VA6A 2FZ3B 3ZHDA 1M57B 4YHZH 1DQQB 2MNWA 2N0MA 2VDML 2B9BA 3GHPA 4JHBA 4CNIB 2DL9A 1U8NB 3ULSA 3M86A 1CQKA 3ARDC 1JZHA 4Q52A 3HNTH 1B9ZA 3QULB 2FQFA 4GSQA 4F7PA 4P3CL 3RVXC 2ZCHL 4FG6C 4QHMA 5EULV 1AD9B 1FUNA 2K4AA 5ENWB 4GW4A 4FFZH 5IOPA 1BAGA 3MQIA 3LMJL 4YDLC 2DKMA 3WEAA 1X5XA 2P43B 1A9BB 2VLLA 2WNXA 3QIBA 3QORD 4P06A 5CJ5A 1PCSA 4OLVH 4CN1A 1N6VA 1HJCA 1MCCA 4L8SC 2J20A 4IU2B 1I7TA 1NMCC 2CHXA 2WTRA 3Q01A 5D1ZC 3TN0A 2I27N 4FG2A 1OWWA 1Y6NR 2XRAL 5KBPA 1ZHNA 1IIIA 4F80A 1A0QL 1RIVL 5I0XA 1JZ5A 4D7PA 3U36B 5F3HA 2Y1ZA 1WZAA 3C09B 3O6KL 3UTSA 3ULVH 1DANU 5F88A 1P6AB 3KXFA 4YHKH 2YZ1A 1NEPA 2W95A 4M02A 2J6EH 5AD0B 4LDCA 3BAKA 3DBXA 1BEXA 4JG5A 1F3JA 1IV8A 1K6QH 2PCFA 2ENPA 3QDMB 4AV5A 4AQ1B 4FEIA 2IALB 3D0VA 2IH1B 4PU2A 3OMIB 1JPSL 1IIKA 1NBZB 5TE7H 1L9SA 2HH0H 2W0PA 3MKKA 5E4AA 1NFDB 4F58H 2FBJH 4OT1L 1DLHB 3HVNA 4GRWB 1VACB 3BPLB 5D2NC 1AR1B 3O6FA 3ZDXE 1MSPA 1FJ1A 2V2XA 1YPZA 1OZUA 3HNSL 3QUKB 1NMAL 3I2CH 1BFTA 3PIQA 4YSAA 2XNAA 2N1KA 4OFDA 5A2AA 5C08B 5KBNC 4OV5B 4H26A 3DYMA 1L7TL 4PM1A 5CN1A 4CADA 5DMKB 4W6XB 5GGRA 1AIFB 5I1DB 2B15A 1CK0L 1JMZA 4JFFB 2QVMA 3JZYA 3WO3B 4N5EC 1BD2D 4GKNA 1THCA 1UWEH 4V33A 3E8UL 3P2DA 3ZPDA 1ZTXH 3MTRA