3QZMA

Staphylococcus aureus isda neat domain h83a variant in complex with heme
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
124
structure length
124
Chain Sequence
MSQATSQPINFQVQKDGSSEKSAMDDYMQHPGKVIKQNNKYYFQTVLNNASFWKEYKFYNANNQELATTVVNDNKKADTRTINVAVEPGYKSLTTKVHIVVPQINYNHRYTTHLEFEKAIPTLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Iron-Coordinating Tyrosine Is a Key Determinant of NEAT Domain Heme Transfer.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Metal binding protein
molecule keywords Iron-regulated surface determinant protein A
total genus 33
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1850 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qzmA00
3QZNA 2ITFA 2ITEA 5D1ZI 3QZLA 3S48A 3QUGA 2Z6FA 4FC3E 3QZMA 3QZPA 2K78A 3VUAA 3SIKA 3OVUB 4NLAA 2E7DA 4H8QA 4MYPA 4YMPA 3RTLA 2H3KA 3QUHA 3QZOA 4WJG3 2Q7AA 5D1QE 3SZ6A 3VTMA 3SZKC 2O6PA 4H8PA 3RURA 2MOQA 2O1AA 5D1XE
chains in the Genus database with same CATH superfamily
2QEJA 1CZ8L 2ITEA 1OO2A 4PMFA 1EFQA 4XP1L 1MJ7L 4BA0A 1F1AA 1AR2A 4I1RA 4BH8A 4D8PB 5DYOB 5EO0A 3OSKA 4ZUSB 3SPHA 1E4XL 3S4SG 3MJ7A 1MF2L 2Z92B 1TZAA 4JRYD 3SYAA 1QACA 4HJ1A 1NIDA 4IOSA 4UNUA 4U1IB 2KKQA 3ARFC 1LM8V 4AL8C 4F2MB 2IANA 4KQ4H 2VO5A 4JGMA 5FF6A 5A2BA 1GS6X 1J1XH 2ICWA 2W07B 2BSBA 4FL4C 4A6YB 1QP1A 2NT1A 2PTUA 4HV8B 1MVFA 1RMFH 4H8QA 3IGAA 4APXB 5CJ8A 3TN0A 3G7TA 5JA8B 2JI3A 4H0HB 2DM7A 2XZZA 1OK8A 3ALWA 3PDOA 5FYKD 2Z9TA 5AW3B 4AQ1C 3BN9C 3P40A 2DTMH 2X42A 4JLRA 4XMVA 1OCOB 5DJDB 3BSZA 5FO8B 1E27A 5FDWA 3N43B 3MRBA 4GMTH 4JG1H 1XH1A 4QRSA 2BERA 2JKTM 5A6LA 4H20L 1IT9L 4K7FA 4CC0A 1CN4A 2Z31A 3KNBA 5FOBA 3TIDA 4DO6A 3HEIB 4Y1AA 1I7UB 4K2UL 2W88A 5C71A 4FJZA 4W81A 3SGJC 4AH2B 4CVWA 5J3HD 3BP6B 3N1FC 2AXFB 4LASL 4Z3FA 3D12B 3R1GH 3VFRA 5DJAA 3L1GA 3APFA 2WVTA 4ODXA 3WLWC 1Y7VA 3RFZA 1I3VA 2UY7A 1DVUA 4XHJD 2Y07L 3RUGE 1YRKA 2RJMA 1MUJA 3W5NA 3AW5A 3LQZB 1GIGL 4J6RL 2AV7A 1D5BB 4N25A 4QNPF 2PR4L 1N19A 3C6LD 3V6OC 3QG7L 1YVLA 4QRQB 1FL6A 3OAWA 3LX9A 3DMMA 2FIKB 3LQAL 1I85C 1HCVA 3MBWA 5F93C 3TA3D 5BMFH 3NAAL 3PGFH 5KN5A 1ZSDA 1U8IA 4TXVB 5EUKB 3F7VB 2E9WA 1F3DJ 5EU5B 3HZ3A 4TUKH 2JELL 2X2YA 2FQEA 5E1IA 2FT6A 3MRFA 1HAWA 1FN4A 5DEJA 3G5ZB 2IXQB 3EOBA 3KPSB 1WV7T 3FN0H 1KBWA 1VIWA 3KS0H 4NUJB 1IMHC 2BOCA 4CAGA 1DQLL 1J9RA 4XXWA 1A6UH 2XBTA 5I1HL 1J9CT 2XDHA 1KCSL 3CFBB 3VA6A 2IBZY 4R7LA 1ITBB 1L7IL 3DGDA 5MEND 4NKIL 2XYCA 1SM3L 4IJ3B 3FW6A 1ZLUK 2VL5B 3UPRA 3OR7A 3MBED 4PRAB 4KZDH 3VRLE 1BFOA 4MQSB 1J1OH 1H19A 3JWOC 4KJPC 5CILH 5DT1L 5IHUL 1AZCA 2SEBA 4OCXL 2XPGA 5D5MF 1P69B 1QEWA 2BP5M 1VF5C 1W0VA 1L7TH 2ICCA 3FUKA 2ZCZA 3SDDA 5CKGA 3C60B 3IE4A 4JKPH 3F83A 4YDNA 2E6QA 1RQ5A 4KHTL 4IOIB 4KUZL 5F3FA 5D1XE 2EKJA 2VXVL 3ZK0A 1JGLH 4CVUA 3S5LG 1S5HB 3LQMA 1Q94B 3RNQA 4DPAX 3GSRA 2CKBL 4XNMB 3NPZB 1HE7A 1FPTL 1JK9A 1PKQB 4S1QH 4ZMVA 3BVVA 5D6DA 2WVUA 5JXEA 5IJBC 3S36X 4X99B 2ZOTA 2DQTL 2VCOA 2EUVA 1RXLA 3RE0A 1OSYA 4M1CC 4U1GB 5KZCB 1NDGA 3O4LE 3W0WD 3S37H 4PJIF 1D7CA 2E27H 1EHNA 2WVVA 4K8RD 3LZFL 3AY2A 3VSVA 5CINL 4HJEA 3ATFA 1FGNH 4PJ9C 3PWJA 5KYWA 2W0FA 1O7SA 1R9FA 4UWQB 1OP3H 2JJSA 5SWSA 5JHLA 1HYRC 5DUPL 2BY0A 4XMWA 4GRLA 4YBQD 3RGBA 4U6YB 4Z7QE 4PSRA 4I5BB 3OAYK 4EZJA 3C5ZD 4G8AC 1YEEH 3VACA 1YC7A 2B4CL 1WFJA 3O9WB 2ZUQB 1CFNA 4ODTH 4YSEA 2P42B 3OAYH 3DBXB 1YNTA 4XCEB 1EZSA 5CEXB 1BIIA 4WI6A 1M7IA 5G55A 3WNJA 3CPLA 4E5XA 1AYRA 3G5YA 1FORL 4MYPA 3R0NA 4ZDHA 2Q76B 1HQ4A 2OMZA 2QBWA 5GRYA 4L48A 1NGQL 1S6NA 5FKPA 3MLRL 3B5TA 1ZANL 4NT6B 3SGKC 4X50A 3V5HB 3MRNB 1HIML 3FMGH 4YIQA 1R47A 3MREA 2KT6A 3POCA 2MCMA 4Y4KA 1BA9A 3KYKL 1U3HD 3QUXA 1NIAA 2QV4A 4F20A 3KLKA 5I8OL 4XMPL 2F58L 3B6SA 4QJ3B 2YO3A 2JKIS 2QKSA 3F58L 2FT8A 3HHRB 3MRLB 3TYFA 1JTOA 1B0RB 4IHOA 5DLLA 1OT2A 1RZJC 1HAUA 5C7XL 3DX9A 1KJVB 3BSZL 4JW3A 4AGMA 5J13B 4KQ0A 4FYQA 3T3MB 1BQRA 1U8KA 3NFSH 1LO5A 2YPKA 4AZ8A 1BBDH 1SY6A 1YY9D 4HKZB 4N2AA 5KSBE 4HIJB 4JZNB 5TD4A 5IJVA 2W59A 3CK0H 2WGXA 4PJDA 4EI5C 4PRID 4RMBA 4F15C 3VD7A 4AGOA 1FIGL 3RY6C 4JS7A 4LSPL 4ALAL 1KBKA 5F1KC 1KFGA 2NUTA 2DLFH 3OB0H 3SDAC 2YD2A 4XVUD 4B5ZA 4YFEA 5IEKB 3K72B 1XF4A 4LSPH 5HY9B 1IKNC 3DPBB 1JAEA 1OCRB 3HPLA 1UA3A 2WYIA 3LKPA 1MCIA 3W2DH 3NSJA 1RZJL 1VLXA 1WFIA 4KX8A 2WNXA 5PAZA 5IKCB 2J1WA 3OKOB 4OI9A 4NC1E 1NINA 3F01A 3QFJB 1W15A 3ULUE 4ISVA 3WIHL 2LR4A 1SYSA 1K2DA 1V05A 1GYVA 3PDGA 3KYAA 4UQ2A 3IFLL 4CBZA 1LE5B 1X9QA 2E6JA 3BT2L 5IG7A 2R9HC 4WFGE 4PYGA 3ZHLA 1HYSD 1WWBX 1RERA 2UZIH 3DVGA 1HDMA 4PS3A 2VITA 2BP0B 1U21A 2NUPB 4B9JA 5F7KC 2QMJA 4CDGC 4WWKC 2WXKA 4NEHB 3T6VA 4XPGH 2E74C 1ZPLA 3UDWA 3N2JA 3A67L 4A2HA 5BOJA 2WWMD 3RGVB 2GSIA 1DVTA 1O9WA 3ML9A 4N0RA 5AW0B 5HJ3A 2Z1KA 2RA1A 2HT3C 1RLBA 2NY5C 2VDRH 1JOIA 1VERA 3I9AA 3WMQA 4X6CE 4UQ9A 1T21A 1V3LA 1FORH 4P2QB 3HE7B 3MV8B 4P06A 1J5OL 5C0BB 1JXGA 2JVUA 4UQ3B 3E1ZA 4I87A 5C9JB 1LE9A 3OL2A 4XO9A 1G9NL 5E0FA 2XFGB 4TKWA 5ENWA 2ODHA 4JO3H 3ZTNH 2YMXL 2K8MA 1RVFH 3PGCB 4PJXB 2AEPL 1N0LB 5AUMB 3CZKA 2ZTBA 4B9PA 1UVQB 4OZIA 1HYSC 3FQWA 4QRRE 3U1QA 2VC2B 3V0FA 4F9LC 5ESAA 4Z7UF 3Q6FA 4IJ3C 4ECNA 2DAVA 1BOYA 2EDEA 3UCQA 4AV0A 5EDSA 4TNFA 1NCOA 2NDFA 5GJTL 2Y7LA 4Z7NE 2EUZA 1IBGL 4R4BA 2OX5A 3WNLA 2X6CA 3S35L 4NKQB 1TZGH 3KJ6H 4MX7A 2EDLA 4HISA 3GXDA 5C7XH 5L2KB 4IBQA 3GPEA 4LBEA 4UOJA 5KYNA 2IDFA 4FL4B 2JB5L 2VR5A 2XQYG 4NN5B 3EJJX 5HDWA 3IJSB 1V7NH 2Z93B 4ZSOA 1TQCC 3S96B 4PFEA 2IAMB 4CN1A 3CLEH 1F1DA 4N6QA 3Q8AA 3HC3H 4O02L 3FQUB 2R39A 4E41D 2AEWA 2I60L 1WAAE 4M7KL 3GRGA 3KHQA 3VXRD 4OCRH 3BPLC 4P46D 3QWQB 4PRHE 5CUSL 3SO5A 5EIIA 5KJRH 4MDJA 3OJMB 4ONFH 4KUZH 2GK0A 4BFBD 4DN4L 3U1PA 5I6NA 3VCLB 5DS2A 4PJ9B 3QIBB 3NG5A 3NQIA 4YBHA 3QJUB 1INDH 4HKBB 2D3LA 2O30A 1H3WM 3LY6A 4HKJB 1C7TA 4JFDB 1R5IA 4ODTL 2CK0H 3AG4B 2FLBT 4UT9H 3DVNB 4O2FB 2HWZL 3WTSA 5F9JA 3HAEB 4RISH 4ZT1A 1OF2B 3I02B 3P4OA 4ZXBA 3BUTA 1FH5H 2AQRA 1GA2A 1D2OA 2Y7OA 1A3RL 2WXLA 3B7RL 3X2QB 2I9LA 4MJ6B 2B1AH 43CAA 4QR7A 5D1ZB 1OAQL 1QABA 4G8FB 2N0KA 3EJQA 1TTGA 3O11B 4LSVL 1GMEA 1QI4A 1QA9A 4DO4A 2BSED 2XPYA 3JYBA 4LEXL 5L7XH 1MWOA 4F9PC 3T4AB 4JY6B 2RQEA 4PJBA 4NWTH 4D3CL 2NNXA 3U36A 4C56A 1GL4B 1O6TA 2PWDA 2NYZA 1CTOA 2IBGA 1AFVL 2JKXA 4BFRA 2FEEL 4BIKA 4FQPA 2IQAB 1ZEAL 4DETA 3QG7H 5DJCB 3JTTA 2WTRA 2CKBH 2R9HD 4FQXB 4A2DA 4FYSA 4F5CA 1IFHL 1UATA 3ZYOA 5ACMA 5EB9A 3M6DA 3NFPB 1J8RA 3IJHB 1IGJB 4HETA 1S7TA 1AKJD 3KWXA 5FV1L 1QG3A 2Q3ZA 4OZGE 2V8MA 4XP5L 3ARBC 3FO2A 3UZQA 1TJGL 2G2RB 2EC9U 4AQ8C 5DT1H 4Z0BH 3ZDXE 3P11L 4IBYA 4QHNA 2FO1A 4KZDL 3PCYA 3QUHA 1L6XA 4GRMB 5I71B 1HTYA 4K71C 1AAJA 3QPXL 3BD3A 4PJGE 2ZD0A 2ZAIA 2WTPA 4KZEL 2HT4D 3H9SE 4W68A 4B50A 4TQ8A 5DFTA 3QDJB 1ETJA 2DQHL 2MCPH 1AQDA 1UG9A 3AXHA 5I17A 4PRAA 1GKEA 3RVXC 2A9NH 3LRLA 5BQ7A 1IU1A 3FO9A 4YSCA 3F7YB 2F54D 4MAYA 1AOHA 4JO2L 1NAMB 1QEWB 2OA9A 3A4AA 4R96A 5SX4I 4NN7C 1KXTA 1LK3L 1FYTB 5DQDH 4PG2C 4GUPA 2OBGA 4GXVL 1TJGH 1XGQB 3MROA 1S7UB 2OYMA 4P3CH 4DEWA 4CL7A 3BVNB 5D1ZC 1PG7X 2C1OA 2CKNA 1JTTA 1XR9B 4CVZB 4PWJA 4BK5A 5HHQA 4UM9A 3RVUD 1KPUB 1IFHH 3A6CH 1FNEA 3D69B 2DRUA 3MKGA 4QO1B 4L1DA 4QAMB 3MA7A 3RL1B 1A5FL 4N22A 4A68A 2JLLA 2CBQA 4NPKA 1Y18A 3VGGA 1R5VB 2XG5A 4W6WB 3WFDH 4JHAL 1MWAH 1U0QA 2WB1A 3LPWA 5KYWB 2AJSH 2XKNA 1BZ7A 1AXTH 4F5CE 3RTQC 2X6UA 1CMOA 1AR1D 2PPCA 4PJ5B 1T0OA 12E8L 4QYAA 4GP5B 4J3SA 2VABB 4I5BA 1NCTA 5DSCA 2EACA 4OZGA 4I0PC 4HBQA 3ZYIA 5E1QA 4GBXC 1UB5A 5H8DA 2XVKA 1D5ZA 2OMNA 1AG0A 5I1GL 2CA3A 1TQTA 3GGWA 3PUCA 3RUGA 4ONHB 5GGSB 5JW4Q 1NFAA 3T2QA 1M05A 3S2AA 4EUPA 3EYUH 4ZTOH 1WH0A 2D7TL 2H6PA 3TNNA 3ALPA 1A64A 1XD0A 3B9KD 2X5PA 5TE6L 3D18A 4CC4C 1ZGLA 5J6GA 3MUGB 1P5VB 5D7KD 5ITBH 3MV01 3S5ZA 2V4LA 1EHKB 2NW2B 3WUWA 2MNUA 4PJIE 1K5NB 3QJSB 2I26N 3H6JA 3RVVC 3V55A 2K78A 3S3DB 2XWTB 3GMRA 4YHIA 4JY4A 1NOAA 4AITA 1R3HA 3CN2A 1UURA 3CVHA 5I73B 3NCXA 2IADA 4KDTA 1HH9B 5ICUA 4PP1C 1XGUA 3EYSL 2X0WA 3FB5B 3P0VH 2WANA 4HS8L 1IEHA 4KFZC 5KVFL 3NRQA 2EKSB 3C87A 5GJSH 3W38A 5GS3A 5CZKA 4CVXA 1EXUA 5T3XE 1EEYB 3EFOA 4TPRL 4TUOA 3TYFB 2OAAA 5IROD 3CU1A 4OLEA 2X1OA 2ITFA 4DF9A 2DI8A 4G6FD 5D1ZI 5HDBF 5J89A 1HE8A 2FX9H 4U1NA 3SY0B 3QQ4A 5AZEL 1LO5B 5C0BD 3V9FA 3DVFA 1RZFL 2NCEA 4XO5A 4P5TD 1T80A 4XZUB 2UZYB 2KC0A 2IOOA 1X3DA 4MSWB 4N2KA 3IDNA 2A7BA 3RWFB 5BPPA 1HHGA 3QIWD 5I6OA 1X7SA 2ZCLH 4FDWA 2NSQA 1E2WA 4X9BA 3VTTA 4M3HA 3DV4B 4TQEL 2FL5B 4NO0B 4XNYH 4X80H 4OCMC 1U3ZA 2GTWA 5CU5A 5HI4D 3RJQB 1FJ1A 1I85A 4LSSL 2EDJA 2ESVD 3KGUA 3R7QA 3SE9L 5C0ND 3PL6B 3CIAA 4EKJA 3L7EA 1E43A 5F9WB 4FZ8L 1SVZA 2CXGA 5IW6B 4F8OA 5IHZB 2YD9A 4ISVB 4RESB 2OZNA 1K2DB 3O6FD 2XY2A 4XOBA 2DMKA 4YWGL 3EH1A 5K9OA 1CLZL 4UQ2B 3UYRH 4Z7WE 3LV3A 4KUCF 4NO5A 4R4ND 3F7RA 3KGRA 2VN5A 5EO1B 1KIPB 5C0AA 2W0KA 1GYAA 1EDQA 2QPSA 5AVZB 1BIHA 3Q7JA 1CFQA 3S3JA 2CIKA 1NFDB 3FH8A 3QUYC 4IGBC 4GKNA 5FAAA 4P48A 2PYEB 4I89A 4P23A 3Q8BA 3UBFA 5EDXA 2BIMA 3CDGB 2J6EH 5L88L 2CO6B 2G3NA 4PTUB 2IEPA 1NUDA 5JXEC 5D6CB 2O6CA 3O6FB 1A21A 5D7EA 1SRDA 3D34A 1TEFA 4L37B 3S8FB 1W80A 4ZPTA 2UWEE 3GJFH 43C9A 1S3KH 3HE7A 4U31A 2WNWA 3AS3A 1WLHA 2FB4H 1JFHA 3NCMA 4MNGB 4AG4L 1A6AA 1I7RB 3H85A 3OKKB 2VC2L 1HWGB 1JD7A 3FYEB 2L4OA 1YN7B 3G9AB 3IAQA 1L9TA 2HJFA 3TT3L 2HYMA 3B56A 4JJ5A 4ORGA 1MI5E 2CLZB 3FOLB 3VE0B 4BYHA 3FT9A 5JHDE 1P1ZA 3PNWA 1EMTH 2Z91A 1ZJBA 4HHAA 3NK3A 3RPBA 4B41A 4NQVB 1A7NL 1ECYA 1YEHL 2H32H 2NY5H 2ZX5A 2Q9OA 2OX5B 4OIBA 3QO0B 3KPQB 4P4KA 5HYSB 1ES0B 1I1AD 1I9IH 2X4TB 5ANHA 5C08B 1BBDL 3ISRA 5GGVH 5JXED 1LEIA 2R1XA 1I82A 2G60H 3TS8A 1JF5A 2E4FA 1TG8A 3H2QA 4JB9L 4P57A 2R7EB 2DN7A 1T89C 3GSXA 3LS4H 3G04A 5H94B 1SF5A 3F58H 1T22A 1Q72H 2BZDA 4ODHH 1ZTXE 1DJIA 5AOJA 3QCUL 2K45A 1FFRA 1DVFC 4CA4A 3U0WH 5C6WH 4DGVH 2F1AA 1JYVA 4PJ8C 2XWBB 1D5XB 2C8NA 3GJFB 4L29A 3QC5X 5D1QB 1IC1A 5ADPH 3FJTA 2EDNA 3C5ZB 3Q2NA 3QDME 4G6ML 4BSWB 3VXRB 1QTPA 1ZANH 3QIUB 4FJ6A 4X6CA 2VIRB 4PW3A 3EH2A 3RX7A 4D9LH 8FABB 1C5BH 5EF2A 5AVYB 5ETUB 3AS2A 2G3ZA 2JXMB 1JZFA 1EEZA 3QDMB 5DUJA 3ZE0B 2EUWA 2DV6A 4FQCL 3MOQA 1OCCB 2YKLH 3VCLA 2ATPB 3QO1B 2CJTA 3WAJA 2JKNA 3CSBA 1KGYE 3L1FA 4Z0XB 3VWJA 3BJ91 1GGBL 4O5LH 1B4LA 3IDYC 5DA0B 4FTVA 4B9FA 2UZXA 5LN4A 2BP8A 1UWYA 1AIFB 1CYWA 2CMRL 4GW5B 4YHPB 2DKUA 3TASA 1HCYA 4KROC 4OT1L 1OF2A 3I02A 4NZ8A 3HRZB 1T6WA 3O6LL 4FG2A 3HG3A 5CEYB 3PGDA 3MFGB 4XGZB 4NJAH 5E6RB 1GZPA 1B9ZA 2FATL 4PRDA 3TO4A 3WS6C 1IAOB 2JQAA 1DDHA 2J88L 3CLWA 3MNMA 2LE9A 1TKWA 1UADC 2GJZA 4GKZB 1NUGA 4MD0A 4UV4H 4PRPD 3G5VA 4UNTA 1OARL 2FJSA 2JI2A 1FGVL 3V0GA 4F91B 2R29H 4AMWA 5JPNC 1KC5L 4XCCH 5K9JL 2PP9A 5LLIC 1RFDH 3GMNA 2F19H 1CL7I 5I6PA 5HD8C 5JHLL 2B5IC 1OAKL 3AT0A 3RUGF 4L3FA 3BAKA 1M9SA 3VXMD 4XB3A 4Y19A 2JE8A 3OKLA 4E9QA 3E6HA 3U0TA 4AVHA 1OGPA 2GC7C 1FL3B 1C5DB 1OT1A 3MRJB 3T3PE 2KI6A 1W8NA 4L4VE 4NYLA 4ZAKC 4FCAA 1VB9A 2YPLD 1UOWA 3D39A 3OZKA 4NZJA 5H37A 2MCAA 3ZZ1A 1WFNA 2FQGA 5IWLC 2JKSA 2DQ6A 4TSBH 3BIKB 5HGHA 4JKPL 1RJZB 3ILEA 4FNRA 3QHZH 4X7SL 1SXNA 2CSPA 4LNRA 2CKBA 1J5CA 3TVMD 3EOYG 3W11C 1DJZA 3V6ZA 3B9AA 2OXHB 1KCRH 1Z9SA 3SQOH 3ZT7A 4J2QA 1RZPA 5CFHA 5ID0A 4L9DA 3V9CA 3VFUB 1UJTA 1B90A 1BJ1H 1KGJA 4E0RB 1FDLL 4HU2A 1NM4A 4CADB 4OJAA 3ME0A 1GC1H 2A9MH 4OLWH 1YEFL 3VXUE 2R1YB 2YC1A 5HHNA 1TQBC 3WNPA 2EXWD 4AV5A 2E47A 4HK3N 2KHAA 3NP3A 1OT4A 1SHMA 1T7ZA 5INCA 3WN5C 2F19L 2O5XL 2QADB 4W9GC 4YO0B 4LLUB 3V4VA 3T0DA 4YSOA 4DGWC 1OOAA 3MCKB 3FU8A 4WNQA 2ATKB 2R29L 3KWTA 4P3DA 4RGOH 4EZMA 2F5AL 2IANE 4IIQC 1COBA 3UTPE 4A7QA 2VSKB 3FTGA 1JGDA 1N0XL 3BKJH 4PGDB 1XD1A 1E4KA 3DX6B 5TDPB 1LK2B 4JFYB 3VXQA 2ARJB 4HGMA 4K5OA 1LO4H 2HFTA 2QFRA 3HE6B 3DDGA 5GGSY 4WO4B 1TSHA 1KTKE 2DWSA 2VQ4A 1XCXA 2FATH 3ZSSA 4UANA 5AB0A 4I88A 5HJGA 3ZJAA 2V8LA 3KR3L 4MA3A 3KXFA 2VQTA 4KKQA 1MI5B 1B6UA 4D7BA 3HZVA 1WEJL 3II2A 4LCWB 4S2SA 1EJOL 3SOTA 4FX5A 1NGWB 1OQXA 5I0ZA 1NL0L 1EBAA 2R83A 3P0YH 3P9WB 5EBMA 5EFIA 5CLWA 4U0RC 5CLTA 3DC0A 3UL4A 3WFCL 3UAJD 4XH2A 1RPKA 2DQCL 4LEOB 4OCWL 4QRAA 2XKNB 3MYZA 3GHEH 5D7JA 3VXUB 2WZPD 2EC9T 2VUKA 4NCC1 3SE6A 2YQGA 3OG4B 3VVWA 3LEYL 2GJ6A 2R2EB 4L4VA 2BVOA 2P9RA 2YPVL 3L3DB 3NIFE 1QSEA 3APDA 4FXGB 3VTAA 4IMLB 4AIEA 3IJEB 2Y22A 4GS7B 3SPVB 3MLVL 4GKSB 3I75B 4ODWA 2XN9E 4HH9B 1XR8B 4OD3L 3U9PL 1FBIL 1TEGA 5BXFB 3SCMD 1HINL 1A25A 4G7YL 1UA6L 1USQA 2EVIA 3MGTA 1PF3A 5AWNH 2WBXA 3CFUA 3ZKXB 4HIEA 4OD2A 4MMXB 3KBEA 1A3LL 1GOGA 4KKAC 1SZNA 1WD8A 2ZE0A 4JPKH 5A6MA 4FQIH 1L0YA 4LFHD 4Y7MA 4UILL 2EDFA 4M6OH 2ZWZA 4OU3A 5C08D 4EUPH 5JHBA 3LMJH 3QDAA 4ZUTA 1SOXA 4FFYL 4K55A 5EEYA 5GZNC 3M86A 1RUQH 1E40A 3WGVB 4XWGL 4D94A 3VD2A 3ZTJH 4PH8A 4R5VA 1TCRA 2C4XA 4F27A 1F3RB 2OMUA 2CRZA 3PV7A 4BA8A 1B4JL 5GZNA 5I75C 4JREB 3GSUB 3SY0A 4AQ1A 4KK6C 3R7RA 4HZLA 4NHUB 2GTZB 3LH2L 3F7QA 5JDSA 4LCWD 1A66A 2VZVA 4AL8L 4L0PB 4JQXC 3IMVA 4O9HL 2MNJB 2FR4A 4GMSH 3UBXG 2HH0H 2WUCH 3N42B 1OB1A 2ZX8A 4N8VG 1K9TA 3DSNA 3VFSA 2F08A 4MJ2A 4FLHA 5HDQH 5C0AD 5F2FA 5J4MA 4YPGB 1UD4A 3Q1EA 5CGYD 3HS9A 3HG5A 1RJCA 4P05A 1AE6L 4XX1G 3RNKB 1DVSA 1DSFH 3TBWA 3EO1A 2XI9A 3X14A 4G71B 3CWGA 5ACLA 4MCMA 4N2GA 4L1BA 4XO4A 3MLSH 1DLHB 3KPRB 1N9PA 2GUOA 2XC8A 3HOGA 1ZLVK 3WEXA 4XNZB 4AIOA 3OF6D 4WO4C 3GSQB 3GBDA 4UOW0 5I8CA 3UBXA 2MOVA 4QY8B 1DL7L 3ZE0F 4NO5B 2YD5A 1DEEB 3QJRB 2WXGA 5E2VL 3QCVL 1BQ5A 1R0AH 3MLZH 3JQOB 3WIFA 1GAFL 2V2TA 4AJYV 4OZ4B 1C16B 2P5PA 2MHAA 3IFPB 3UTTB 4PWEA 2NT0A 4WF7A 1HKFA 4IS6B 4MNHB 4GG6E 4YXKL 4JBSA 1EGJL 4JZOA 2NLJA 4JDEA 2VERN 1UUNA 5IF0B 2FBJH 5EUOE 4PTUA 2AXJA 3GM0A 3L4UA 3S4SA 2QTVA 3DXAD 2PTTA 5ABAA 4KH9A 4MMZC 5F7BA 5LHDA 3KPMA 3QXAB 2CK2A 4MXVF 3PWNA 4MXWH 5E1AA 5LNEA 4AQEB 5A3IC 1VEPA 4WHTB 5EOQH 2R1WA 1T5WB 4GSQA 1M53A 3T9WA 4QEGA 3OKKA 3U2JA 1S7SA 4X7TB 3SBRA 1NMAH 3NEEA 3TL5A 1MHPH 4H0LC 2CDFA 1CFSA 2TSAA 2IOMA 4ZOBA 5K59F 1UZ8A 5BRZB 5KVFH 3V0WL 2A6IB 3RVXD 5EZJB 1XGRB 3RBGA 1G9ML 4UU9B 4JFZH 4Y5YB 3PPSA 4U4IA 1SXZA 1CYGA 1RI8A 3O3EA 3ZQ9A 1SJEB 4MASA 3CH1A 15C8L 4K3JL 3TH3T 1SEBB 2FUQA 3STBA 3JBG7 4HLEA 2DYPA 4XNBA 1SOSA 5DZPA 2YBRB 3KPQA 4P4KB 1DVFB 1NGXB 1ZV9A 2AGJH 1ET5A 2OR9L 3MRMA 4HIIA 4RAHA 4DCQA 2DQUL 4Z7OE 1YEJH 4M5YL 2BPBA 4DP9X 2PW1A 2GSGB 2R7EA 4NZUH 1DVQA 2BFGA 2E7MA 3BOVA 4D0CA 5DFWH 3BPOC 3L5XH 4XP4L 4ZTOL 5DHEA 3KVDD 3V0DA 3WI9A 2NYYC 3BPNC 3QXWA 2VYRE 5DS8A 4ZG1A 3T0EA 1XT5A 1KOAA 3ZKSD 1IQDA 4EJ1C 4E68A 5H2BA 4OW6A 2EVGA 1IX2A 4F57L 3C5ZA 3S8WA 2OJEA 3G6JA 4DESA 1KDJA 5JIDA 4ODVH 2AXWA 1W72A 3DRQB 5BO1L 1CB4A 3LKRB 1U92A 3VWKA 1L4IA 4N6RB 2QKIC 3PHAA 4YHLL 4NWUH 2AJSL 3C2AL 4ZO7A 3WO4C 4PY8J 3KLAA 1TJHL 2J4WL 3VFRB 4GQRA 4E9XA 4MDIB 1MAJA 1DE4B 1Q9WA 1TTRA 3ETTA 3WDIA 4G7VH 1MUJB 1MY7A 4MA7L 4OM0H 1IL1B 2GC4C 5D4HA 3ZR6A 2DL9A 2BP8B 4GW5A 5LGHL 4NN6B 4PJXF 4JFEB 4QRQA 1QUNA 4XBPB 4J3VA 1TLKA 5JIMA 3D30A 5AAPA 5J9PB 1XAUA 4GAJL 3MZTA 4U1SA 1RU9H 4LSUH 5ADOH 1D6VH 5L2KE 1IEAA 4Q14A 2QVTA 2PNDA 2GJZB 3DUUA 5TQ0L 1E5BA 4KKLD 3G5VB 1DJHA 1WT5C 4DFHA 2KQMA 5T3ZL 1UHVA 1S78D 3DJSA 3HNVL 3V6FA 3SDYH 4JO5A 4FD0A 3ZN6A 1VCBC 1X5YA 2DW5A 1AD0A 1HZHL 4J8RB 5DLMH 4PVBA 3FT1A 5KEZA 1AP2B 4X8JA 5JOEA 1WA2X 1KFAL 4YDVB 1MZYA 4WCYH 5DK2B 1R3KA 3WE6A 4XNDA 4EBQH 1T2QH 4N0UA 1SN0A 3ARFD 3NH7H 2AK4B 4ZTEA 3RU8L 4X9GA 4Y9BA 4BXVA 4R7NB 3VMPA 4ZK8A 3UPRB 3OR7B 4ODBD 5SWQB 5IT2L 2XJLA 1N5AA 3EBHA 1NLDL 3D4ZA 1BFOB 2CGYA 4HCFA 3EOTL 2C3GA 4I0KA 4XP6H 4Y16A 4XHJC 5F7HA 3UDWC 4NYLB 5MENA 1G7IB 3QJFA 1A6ZB 1A3QA 5IB4B 1F8TH 1A7QL 4LKCA 2ICWJ 1NIFA 3W3BA 5IBTH 1MFUA 1M1XB 4WEEA 5IQOA 1V27A 2GITA 4IRJB 2A6DB 4RCAA 2OYPA 1E8XA 5I8EB 3OKNB 5I76A 4RGNB 3NZHH 4ORZC 5FGCE 4XBEL 1N2RB 5T5FA 3UTSB 1J8HB 4TS6A 4FLSA 1L9OA 5BS0D 5DWPA 1GMIA 4CGUB 5FPIA 3O6ML 5H37H 4AI7A 5C2BH 1MCLA 2BCMA 2QVKA 4OCYL 5DRNA 5CIPA 3TIEA 4AYFA 2EYRB 3HW7A 4DW2H 2YEQA 5JYLA 1OAUL 3ILDA 1CDGA 5A2LH 1WDAA 4YR6A 3S98A 1K6QH 2UX7A 1RIVL 3CTTA 4MS6A 3SD5A 1AZUA 3TCLA 1JFQL 4Z78B 4P5MA 1WBXB 2QGCA 5IFAH 1MVUA 5ISZD 1WISA 4W4OA 4PI2A 1UM4L 2PTVA 2XWZA 4ZXBD 2Z8WC 1U8CA 4YH6A 3S34H 1XH0A 2PO6C 2OTUA 3DIDA 2APXA 4LSVH 3QUKB 3LNDA 3QUML 3TV3H 2NY0C 3N42F 3J27A 2EH8H 4N2MA 2WMPA 3AWEA 3WKML 2A6KA 1VKXB 2X70A 4PN6A 5GRVL 2H2PD 5SV3A 2XIBA 3TJPA 4RISL 3ZHDA 2VXQL 4NNPL 2B5IB 2B3RA 5F9OL 4S2SB 2CJSA 2ZCHH 3KE0A 4HS6A 4NQUA 5A1AA 2V17L 1RULL 3IPBA 4GG8B 4I4WA 3ZL2A 5KANG 3WTXA 1CGWA 3HS0A 1NGYB 3FTVA 3CVHH 4WI2A 3T4AC 3DOIA 4ZZFA 5L2JB 1N59A 2R0ZL 3O2DL 4PLKC 3WY2A 1S5IH 4Q97A 3LIZA 3US9A 3X3FH 2BVYA 4UB0L 4FQJL 4HK0B 2BY2A 2D8KA 5D9SB 4GT0A 1L9SA 2AV1B 2FWOA 3QEQA 2G3XA 5TF0A 4L4TA 5B38G 2YGQA 4ZFGH 2YPLA 3ALXA 5E23A 2YSSB 3OXSB 5EC2A 1AC6A 2PLTA 1AGFA 2VDOH 5FO9A 1JYXA 1KEML 2YD7A 2QPDB 3GM8A 4A37A 4XBMA 4XNXH 5EN2A 4AE0A 5CBAB 4S1RH 1N64L 1TZIA 3TBVA 1J9SA 1S78C 4MMXA 3EXLA 1SLVA 1Z5HA 4C54A 5TK2A 4NJ9H 2I85A 5IBLC 3Q5TA 5G4OA 2XZAL 1ZHBA 4QWWD 5TDOB 1YJDC 3ARPA 1N68A 3E6FB 2ADJB 2DDQH 3IWVA 4ZMZA 4AGPA 5FYJD 3VXNB 3F12B 4R6UA 4OIIL 3SJVD 4HK3J 1RLWA 1TVHA 4WI4A 4Z7VE 2J2ZB 5I30H 1UWGH 4FXKC 3QUZC 1ASOA 1S7XA 1RIHL 2UUDK 4NN7B 1TITA 5EOTB 4LMQI 2J55A 3VGHA 4M48H 4YQXL 3MODH 4YSDA 5JHMA 2P5WD 1FZOA 2ZUQC 2ZOWA 5C0IB 3UMNA 2YMXH 3FSOA 3WJLA 3FCUB 4A7GF 2MKWA 3ULVL 4TSAL 4L8SA 2QQQA 3CVDA 4NBYB 3PREA 3B4NA 1ZHLA 2DJMA 2V5SA 3EJRA 1JRHL 4U4BA 1H8OA 1AZNA 5AVTB 3W81A 4HUWA 2FX7L 4WFFD 4G83A 4E9TA 2EYSB 2VXSH 1ZSHA 4YGVB 2Z0UA 1HDMB 4QGYA 2ID5A 3RWDB 4UNVA 4PJHA 4MXQD 3TV8A 4E41B 2XXMB 2X88A 1NSNH 1GJUA 1KELH 1LEKB 2NY2C 5FGBA 5CLYA 4OCNC 2BHUA 3I2CH 1JHKL 4G8GD 2BSRA 35C8L 1U8NA 4EI5D 2CDGB 3KJ4B 4F33B 1P7QA 4NNXA 4OUUB 2Z35A 4JPWH 5L2KD 1T3FB 4KMTH 3ULUL 3C6SB 4XVTH 5D70H 3II3A 1QSED 2FECI 5DHMC 3DK0A 2XTJB 4O2EB 4WO4D 5LB1A 1KCLA 4XAKD 4E2OA 1MIEL 2C9UA 3MXWL 3INUH 4FC3E 1B88A 1NPNA 1T1ZA 1X5IA 5HGBB 2H32A 1P5UA 3QISA 4XR8C 4XVOA 5DGQA 4IS6A 2WLYA 4CW1B 1AD9B 2ICES 2L8AA 3AQYA 1K4CA 3LKNA 4FJYA 3P73B 4UDTB 5F96H 1EO7A 2J8UE 3CHPA 3JV6A 3R0MA 2VLRA 1WIUA 2HN7B 3O2VL 3U4BL 2J5WA 3KPSD 2D2CC 2KPNA 5F0MB 3OXRA 3UTZB 3AS0A 5GS1B 4K07A 3UGXA 4AQEA 5HDBB 3LS5L 1OF0A 4CC1A 3PL6D 5L2KA 1O6SA 1UXWA 3IGUA 3NA4A 4RZKA 4QRUA 3UGUA 3WV0A 2Y6TE 4YDZA 2A73A 3FL7A 1E8ZA 1ZHNA 3B8SA 1M71B 3S9DB 5ALCL 2B7DT 2ZICA 3OHMB 3JWNC 4HJJH 2JB6A 4PJBF 1UZ8B 4WTQA 3GKWL 3LAFA 4DKFH 4U2ZA 3DYOA 1EDYA 1YPZA 4WW2B 1JNHB 4H5SA 2V6HA 5I1CL 3VD3A 5DC9B 3FN3A 2AERT 3MV8E 1SJXA 2WP3O 4ZZKA 5J1AB 4YHOL 4L8CA 2OXGB 1F3DH 3FSVA 5EIVA 3V52H 3EIFA 4YXHH 1OCZB 3HLKA 4A7TA 4Z3GA 3BWUF 1JPST 2HFFA 4LHJB 4KWUA 5F1IB 2BHYA 4QWWC 4WFGD 4BUQA 5GRJH 3O3AB 4GP8B 5T5NG 5H35B 3P4NB 3N9GL 3H54A 1RUMH 1P4IH 4JFDA 2GJ6D 4BHUI 4HOWA 1ZLDA 4OZHB 1MEXH 4MGXA 4MQTB 3S36L 4HFUH 1J12A 1BWWA 2JKWA 2WLJA 2Z7YA 4J4PD 5CJXC 5L4MA 3JV4A 4QXUL 1PX8A 1S8DB 3BQUD 4P0DA 4G9FE 4CDHA 4LLYB 1BQHA 1KBVA 3PWVA 2BFVH 4I0PD 1YUHB 2Y06L 2HG5A 2X3AA 3T6ZA 1RZ8B 2EE2A 4TQHA 1MLCB 4X0KB 3SKUD 3RIAK 3PABA 3VD1A 2JJUA 5GSVB 2FECL 1CC3A 1EZVY 2XN9D 1I7UA 4MZ2A 2VLKA 5L6YL 1U2YA 1KXVA 1I7ZB 1DE4A 1SN2A 3QEGH 3EO9L 4GQ9L 3TFKD 1LO0L 3DOHA 3RHWF 3G6JF 4HUNB 2XZQL 4OM1H 1F4AA 4PJCA 3H4HA 5FYKL 1IUZA 3IKCB 4WU7A 4H1LA 4JPVL 3DUHA 3IVKB 3LZOA 3N5AA 3QZWG 5I16A 4IQHA 4CJ0A 3N1PC 5IEHB 3KWUA 2Y24A 4OZHE 4W1TA 3RGVC 3VJ6B 4MLIA 4X6DB 4D0BB 1MQKL 4N2EA 4Y4FD 4IDJH 3T3PF 3NZSA 5HVGB 3WD5H 1JGLL 2BNRE 3MCYA 4HCRL 3EOAA 5HYFA 3MACL 1T1WA 3ORJA 5IB5B 4LOUD 4DKEH 4OZIE 3CHOA 3V6FB 1BZ9B 5EU5A 2W9EL 2NQ3A 3SKNB 2WBJB 2XVBA 4QTIH 4A6YH 2VZ3A 1RSFA 2MPAL 5FEBA 1K8IA 3RDTB 2ARJQ 4Z95H 4XX5A 1D9KD 2WYHA 3NUKA 4K7PY 5BOPA 5IIEB 1CDYA 4B0MB 4P49A 3N40F 2BOCB 2DYRB 2VE6B 2VW7A 3VXRE 2HUHA 1M3IA 1ZA3A 3QXDB 4GIOA 4PGCA 4U1HB 5CF3A 2VR3A 4FQXC 5GZOA 4JCMA 2GEQA 4YVUA 1N5AB 5E2JA 4TNWF 1UH3A 2VL5A 2P24B 2PWFA 2ALWA 1ACYH 4QOKE 1A6UL 2APWA 2G2PA 1LP9F 4KKCD 5GS0L 3BVXA 2VWEC 3K6NA 3Q5OA 4ZNCD 4PJGB 1YEKL 2ZWLT 4HC1L 1VZGA 4AGLA 4G5AA 4RX4D 3HKFA 1WO2A 4LLWA 3OKNA 4RETB 2JELH 1BLNA 2O5ZH 2B0SL 3KGSA 5JHDD 1PAZA 1CE6B 3SDDB 1R75A 3KM1A 3SKJL 3WLBB 1JPSH 3HI5L 3HG2A 4XPBL 4XXWC 4ZMWA 5IMOA 3IXTA 2FHFA 4K7PX 4R83A 5BRZE 4CVZA 1RSYA 2WBWB 4YZWA 4NQSB 2HB0A 4YHYC 4UT7H 3QFJD 2CLRA 4DKDC 4CSTA 2VAAB 4F7CB 1IO4C 2Y7QA 3TIEB 4AYFB 5DMJB 5E94B 2AF2A 1GIGH 3EBIA 3V4PL 1BVNP 2ARWA 2VSCA 1OP9A 2NY3D 3IJ9A 4MTMA 4UTCA 4X99A 4FNUA 4AENA 4LAJH 4WFHE 2V9TA 1HOCA 3FUEA 4LDEB 1TQUA 2HMIC 3O3DA 3DKHA 5AKRA 5C1MB 3VM7A 4A55A 4KO7A 2WXPA 1T2XA 1U8CB 4OKDA 2PETA 3OR6B 5C6TH 4Z1PA 1UXSB 1Y6KR 2F61A 1IAKA 2LU7A 1HS6A 5CIPH 3RWHB 1JNNH 1I8LC 5LXGL 1FVEA 2FQDA 3I3BA 3BSHA 3V7AE 1JGVH 1YEDA 4E9WA 2E7LC 2NR6A 4KI5C 2OZ4A 3RDTD 3ZO9A 2VDQL 4ONHA 4L4TD 1YMMB 3FU7B 1TU2A 1HEHC 5KSAA 4N0FB 1S7QB 3FC8A 2R0KL 4GG8A 2QQLH 3I6GA 3UC2A 4Q6IA 3DX8A 1KN4L 1NFDE 1N8ZA 3WHE0 3C8KA 1HWHB 1NGZA 1YEWA 2G5RA 1NKRA 2FRGP 1NWOA 4X83A 4LL4A 3DOSA 5I1IL 4N5ED 2OMVA 4HUKB 3SGKA 3CPLB 4ZOEA 1J0ZA 5D93C 4XVSL 3VH8B 1PLGH 1NEZB 1SDYA 2DQEL 3T0XA 1C8QA 2VMCA 3HB3C 1J8SA 4W6XB 3BAYA 2WUBH 2JK5B 3QEQB 2BIQA 4OZFB 1EHAA 3QWRD 2EABA 3V5HA 5IFHL 2P1YA 1BZQK 5I8KL 2K3HA 2QHRL 2F53E 4PJHF 2B59A 2EVHA 2DQIH 4Q89A 5MP6H 3VU2A 2P5WE 1S9WB 1AGFB 1EEYA 2ZUTA 3VDCA 3US0A 3QNYB 4P2OD 1WS8A 2ESVA 4AIXA 3ZKQD 3RDTC 4W9CC 2HPOA 3R8BB 2DMBA 4HWUA 2VR6A 4N9GB 5KVDH 3D48R 2CALA 4PJ8A 4FMKA 2MTAA 4PV8B 2HJKA 3L3OC 4W9HC 3QNZA 3TWCL 3ARQA 2R0WL 3IFOB 1KIUB 1MLBB 3UYPA 4GIAA 4FP8L 1A6TA 3GTTA 1HQRB 1IBBA 1OSPL 4HKXB 2WZAA 3PS6A 4R5XA 2DB8A 1AXIB 1O7DC 2QSCH 3KPNA 4AYDC 3FO0H 2IOIA 4QYOA 4F1ZA 1HFUA 4MJ4A 3L3JA 2UXFA 3QWNA 4DK5A 5C07E 3DHPA 1MW1A 2VDKL 5CMAA 3K72A 4JG9A 2BZ7A 3MYJB 3CN1A 1XIWC 1NBVL 1XXDC 4P2OA 3TT1H 3ZHFA 1CFMA 4BM7A 4ZMPA 4FE9A 1GJIA 1DFBL 5EWIL 5SV4A 5IKCA 1KCWA 3Q8FA 3CVIL 1OM9A 2YLKA 3NP4A 5A2AA 3V0HA 3ARTA 4BBWA 4QIRA 2VLLA 2B2XH 2VDML 3U0PA 1NFDA 2PYEE 3QG6A 1AO7B 1FFPB 1DUYB 4UOQA 4ZODA 3JSSA 1L6ZA 1KJMA 4R7XA 4ZFFB 1NC2B 2BSCA 5GRVK 3MV7D 3HZMA 1EO8H 4LLDA 5GSRA 2BSRB 2NY4D 3EYOA 1HT6A 3N3EA 3ABGA 4QI3A 1UEYA 1MIML 1QBML 2OJZL 2ZKHH 4M6AA 1PZ5B 3UACA 3OAZK 4G9FA 4UQCA 1EANA 2EO9A 2ZG2A 3C6SA 5HGGS 3I84A 3QE5A 4P8QA 2Z8SA 4MNGA 4F3FB 4ZAKA 4O2EA 4YE4L 3NTCH 1E8WA 4PR5B 3UBGA 5H4ZA 1FRGL 2IH1A 3MV7E 5EBGA 2WLZA 3B3BA 3SBWA 4YE0A 1A4AA 3K91A 2EDMA 3GWJA 1KY7A 1U8JB 3ZKND 2KZ1B 2VLJD 2FX8L 4A2GA 1DN0A 1J0IA 4RGND 3FOLA 2NY4B 3L5JA 1A2YB 3T0BA 3DNKA 3AM8C 1VACB 1I8MA 3IJ7A 3V7AG 1T7WA 3QXTA 4M29A 5F7WC 3U4KA 1FC2D 5DXWA 1AVAA 2WNGA 5DMIL 3TURA 4YUEH 4X5WB 2ZSWA 3ATBA 4Q9RL 4RMWA 1L9MA 5BZXA 5F71A 1JD9A 1I31A 3HCVB 5B1AB 1OGAE 3ZMNA 4LGRB 4HBCH 4U6TA 3AMKA 1A4JA 4OLUH 3H55A 5AVVB 1FYTE 1HXYA 3BEWB 3OC8A 3QRLA 4IIQA 4JHBA 2CZNA 4UNIA 4WUUB 4JZJC 1KZYA 4WW2A 2Q86B 4LRIA 4F9LA 1HCZA 3MMEA 3AB0C 2J56A 2NNAA 5C09A 4V1DD 3O0LA 1IGFL 1KXHA 3T2NH 2Q7AA 2BJML 3ARGB 2JF1A 4PI0A 4PJIB 3VXRA 4PS7A 1F1GA 4QXTB 2AQPA 3O4OB 5E6IB 2NTSP 2VIRA 4RZCB 1LP9B 5DR5H 1ND0A 3N55A 1NC2D 1VA9A 4C55A 1GCYA 3FQRB 3OHXC 2P8PB 1MFAL 1G6RL 2WBJD 1HNYA 1ET7A 1X5MA 2Z7WA 5E7FA 5JPMB 2MMXA 2ZIDA 1JHLH 4JHWH 3T8XA 1JJUA 2D03L 3ARRA 4KHXH 3CZFB 3IDGA 2QDWA 5EIQA 2VLKD 1ONQA 2ZXDA 3GJFK 5EZOH 4ICXA 3NEOA 5B21A 5FM8A 2AMUA 1F4YH 2ZSVA 1PMYA 1M7DA 2IV9A 2Z31C 4LCWE 1WHOA 4PW9A 4K7PH 5F7FA 4Z77B 3OC5A 2EVJA 3QUZA 1IAOA 4J3BA 3BIAX 4ZW5A 2BWDA 4HD9A 3OB8A 4GH7B 1KLFA 5LBSA 1KBPA 1TVDA 2PN5A 1QBLL 2I9LB 1SPDA 1MREL 5CSZA 3PABB 4O2CA 3RAJL 3PWUA 3VWKD 3L08A 1PYWB 4YBLB 3HAEH 4KMLB 5H37G 4GW4A 5AVUB 3NCYP 4O51B 2XY1A 5DRZA 1Z9OA 5FO7B 3GSOA 2A9DA 3U36B 4MQ7B 4UBDC 5BRPA 1JN6A 3VGAB 3PWPD 3B9VA 4OTXH 4QRBA 5L9DL 2J1ZA 1DBMH 3CFTA 1BHGA 1W2KT 3LN4A 4F7TB 2P44B 4Y2OA 2UXTA 4KV5E 5TFSL 4NPYB 5IEHA 5T1MB 1A6VL 3OZ9H 3BO8A 4AM0A 3D39B 4N1CA 5AW5B 4BZ2L 3NFPA 3AY4A 4KQ3H 1YNTF 5KG9A 5IOKA 3T1FA 3A5VA 3FO1A 3UO8B 4KNUA 5I15H 4HT1L 1N4XL 3ZY7A 5TF1H 1YYLH 1T7VA 3EDDA 4LNRB 5D1XC 1ROCA 3RWJB 5EH1A 3X1NA 4DVBA 4V33A 1L0XA 4KO5A 1BBJA 2DH2A 4PJ7E 3T77B 1PFCA 4Y4HA 3QIUD 3VFUA 1XF3B 2XV3A 1B4RA 2XUWA 2VE6A 4L3AA 4GRWH 1HXKA 5FYJU 3VB8A 4NGHH 5E95B 5I23A 2XETA 1BFVH 4B27A 2DWTA 1F4WH 1XBRA 4JPIB 4EPSA 1U42A 4AK1A 1P4UA 4NERA 5I1JH 3SYPA 4QKTA 1NAML 4MD5A 2YKKA 3W11D 2DEYX 3VNZA 2BIOA 2N1KA 3P77B 3Q01A 1HKLH 3BPOB 2Y3NA 3U2SB 1PD6A 2R2HA 1GZQB 2UYLA 4QRPB 4LIQH 4GUPB 3KHOA 1I9RH 1MAMH 5ECJE 4YDJA 3C6EA 3DURB 2NY2D 3ULAB 3TA3C 2C1OB 4I13B 4JQVC 4MA3B 4Z7AA 4HIHB 1QI3A 2FDBP 4JG0H 1RP8A 1ZHKB 3MDJA 1CXKA 4FQHA 5AD0A 1DBAL 5HHQB 3K2MC 3HMXL 2ZUYA 2ZOKB 3WNIA 4YHMH 1I1YB 4Y5YC 4MAYC 5IMLB 1XEUA 5EBMB 3RL1A 3FBQA 5E2UL 4DNLA 2CWRA 4Y4KC 2EIDA 4I18B 5KW9L 5KS9B 1F2XK 2P7TB 3WXVL 3B2VL 4HGWB 4KTEL 4LDOB 4YX2H 1FZJB 1ZTXL 3CE1A 3GS7A 1UB6B 1J0YA 3M1BA 4ZUVB 1T1XB 4YHYB 4XN7A 1P6AB 2YUVA 1W91A 3VGBA 1XGZA 3EZJB 3FB6A 1CI5A 3IB4A 2CRYA 3VXOB 3WFEH 4ZI8A 4JFXB 4OLXL 4HH9A 3T09A 2I9TA 1CFBA 4L4VD 5D7JC 1G6RB 2XV2A 4B9ZA 4Z7UB 3T0EC 4YBLC 1BCIA 4Z7WB 3A23A 5CJBA 5ESVA 4CRPA 3WTWA 1DN2A 2JI1A 3DX8B 5D2NA 3IGFA 3QZLA 3WTUA 4OD2B 1BJMA 2LABA 4LP8A 4W9ZA 2DMCA 1ZLSH 2H6PB 3MUGA 1CVSC 3KM2A 2WQVA 2A1WH 2WN3A 4FADA 1JZ4A 2I5YH 4JUTA 3UROR 4WNJA 4RFOH 2BDNL 5TH2A 1TYEB 3BDYH 2ZCKH 4HJ0C 2M1KA 3CC5B 5SX4H 3OTTA 4AW7A 3UYOD 2J43A 4QHKI 4IU3B 4M8UA 2E3VA 4Q56A 5HI5C 2DF3A 1HH9A 1UACL 1KLGA 3P0GB 5DD1H 2DWDA 5HYQA 3KLHD 2PCXA 2XTLA 3K81A 1BQUA 5IWLA 2FE0A 2KERA 1EHLL 2YIHA 1G7QB 3L3GB 3ZGHA 2OPCA 2F7RA 2YXMA 3O41A 3SQBB 3VFMA 3VB9A 1EO5A 4PWKA 4FFWC 3CZSA 5D4IA 1XIWB 3UEQA 1KCUL 1YNKH 1JF6A 3BI9X 4MJJA 3VFVB 3QYNA 2W38A 4Z7UE 2GY5A 1NEZG 3KCPA 3NDYE 5CEZE 3LPGA 2MRYA 1EX0A 3QQDA 1EERB 3BGMA 4H25A 5BJTA 1QSFE 3L6FA 4ZYKB 4OF6A 1IGCH 4MJ5A 1C1EH 4JREC 4NUGL 3IDNB 4Y4FC 2IFFH 3CZUB 4QYOB 4XN4A 4IOFD 2X4UA 5F1NA 5LKNA 2ADYA 4TQIA 3QR0A 2BVQA 1LO3L 3FFCA 4TL4A 4RA3A 1A7PH 1F4HA 3DV4A 3GDBA 3VRJB 5A2FA 4OCSL 4Q9QH 1PCSA 4HUVB 3JV0A 1DLFL 2AJXH 4X5XB 2GBUA 4KJWD 3CLFL 5CMAB 1OHZA 2RTTA 5FM5O 5KANI 5IMMA 4P2QE 2A0LC 2KYIA 25C8H 1QKZH 5AL8A 3RL2B 1U8MB 2AJYH 1Z1WA 3U30B 2D9QB 5FO2A 3UX9B 5CD3A 1N70A 1X5ZA 3A47A 4FCHA 3I9GL 4FXTA 3MOAH 5HHXL 4PP2B 3L1OH 5CLXA 3TN0C 2FO8A 3IE9A 4JZOB 1J1PL 1NCCH 2VISA 4K5LA 4BKSC 5C0CD 4QRPE 4BUGA 5EO9B 3MLPA 4AEHL 4U3SB 1VFBA 5EEXA 3DECA 1BZ8A 2H47C 4YC2C 4ELKB 5DD0H 2QZ5A 5K93A 1HU8A 4H8WL 3CMOL 4IBTA 4TLSA 5D6CA 4WHYH 1EBPA 1JZ2A 4OF5A 1FVDB 1LEGA 1JWMB 4OLZH 4FHKA 2OTWB 3D09A 3L13A 3UAFA 4EDWL 4AUUA 4PR5A 4P4KC 2FH8A 3RBSA 4L1HA 1CICB 1SMOA 4K3DL 2DYSB 4G2AA 4IHBA 2CR0A 3GXNA 4AEIH 5C0RL 4TRPH 5CHNA 4I3SH 4N87A 1E9PA 2A6IA 3IJ8A 3IU4H 4N2NA 4UU9A 3X12A 5BVJA 1T83C 1TYJA 2FO4A 4X6EB 4NRZA 2Q8AH 2VSMB 1SEBA 3CXDH 2Z92A 4I48A 2FBOJ 5IOPA 5F7DA 1P1ZB 1U8OB 3PNWB 4PRHD 1DVFA 1NGXA 3ZTDC 5IB3A 2COQA 1FF5A 1YY9C 1A47A 3WFHB 4V2CB 4DTGL 4B7IA 2PW1B 1WZ1H 4AYGA 2V33A 4WKZA 3DV6A 2ENQA 5DTFA 1KB5A 1S9XB 5L0QC 4D0CB 3CHSA 5D7SL 4N26A 1UWFA 1UXMA 1KYOJ 4DGYH 3NSFA 3QQNA 4XCYB 4Y2NA 2WVSA 3T2OA 2NR6C 3FRUA 2NR6D 2UWEF 2YOAA 3QJXA 4QMEA 3T6WA 2C3VB 1F4XL 4S0HA 1CICD 3REVA 4K94C 3BT0A 1H3TA 3AG2B 3DYMA 1JWSA 3DRTB 4R7VA 5D8JL 4KJYB 4UINH 1N3NB 4YL4A 5F3HA 2VJ0A 1XZ0A 4H8VA 1CQKA 4GRWE 4KRMB 1AQKL 2NTFA 3KNBB 4RWYL 3TIDB 5D5MB 2NXYB 1X5XA 4FG0A 5EORL 1JDAA 1SQMA 4PJHE 4HMCA 1NIEA 4FXKA 4H1LH 5JQ6H 4V11A 4MXVE 1Q9WB 1IGTB 1JERA 1IKFL 5C0CB 1L0PA 3FHEA 5ELIA 2X2UA 3MJGX 3QO1A 3HZKB 4HQQH 1OPOA 1E2VA 2P28B 5BZZA 3PHQB 2PP7A 4HAKA 5JMRA 3DTUB 2CHDA 4E9SA 1ZLVH 4LT7A 5FFGA 4PGZA 4G5ZL 3UFIA 3LQZA 3WKNA 3DIFA 4DUXA 2UZXB 4G59C 2Z4QA 1YEGL 3QFDA 4ABWA 4OFKA 3UEZA 1SFDA 1UYWH 2L04A 4JRXA 4HSCX 5T33H 4LVHC 3HBPA 3ENEA 1XGPA 1XCWA 2XACC 5GRXG 2WWKO 2Z4TA 1AO7D 2XYBA 1DBJH 2ADGA 3PNRB 4GKOA 1J5HA 5IROA 4R3SB 2ICEC 3FB8A 4I7ZC 2DJSA 4KTYA 4WY7H 5KBMA 1B0WA 1IC4H 1Y6MR 1R24B 1BVZA 3HN5A 2ZYSA 1WAEA 1ASQA 3MLUH 5DJ2A 4PUBH 1VRSA 1LGVA 4UAHA 1I75A 1MFMA 2YGPA 3B7YA 2H1PH 2EEDA 3LEXA 4Y2DB 3UAEA 1GJWA 4Y9EA 4B9IA 5AZ2L 4C57C 2E8YA 1WT5A 4XWOD 2P80A 2CJ3A 2WN2A 1E30A 5SWQA 1YZZA 4IBZA 1A8ZA 4MMZA 4AT6A 1X7TA 4MAUH 4TVPH 3MBEA 3S97C 4NRXB 3QQ9C 4KVCH 3UH8A 4MAUL 5CCKH 3W9EA 4WWKA 2I07A 3MGOB 5DMGD 2BNRB 4L3ED 3QORA 1HSBB 4NQDA 4XPHL 3LD8B 4HF5H 2VQ1B 3THML 2JLPA 4B3EA 4MMYB 4JFOB 4NQTA 1E6OL 4PUBL 3ZR5A 1MRDH 1EFXA 4GAGH 4MA8H 2ZX9A 2NXZB 4YNYB 3IF1B 3DARA 1S5HA 3VDAA 2AEIT 5BV7C 2DD8L 5DJ6A 3RVVD 1SHSA 4F58L 2N56A 3SBWC 1DBJL 1K3ZA 1W9XA 4OJCA 2ZF8A 1B2WL 2O6PA 2H1LM 2B1HL 2GJ6E 3GZPA 1H15B 4QXGH 5DFVD 2EYRA 1KUMA 3B9DA 2BVPB 3VG0H 1I3GH 1JG9A 2BY1A 1YEGH 3VX1A 5KVDE 5IVXF 4GQZA 3U2IA 4A2LA 5FHAH 5D7HA 3O6KH 1ODAA 1CBVL 1F3JB 5GGTL 4IDLA 2IFGA 3QUYB 1JWUA 1IVLA 1SLXA 4G8IB 3IXAB 4WV1B 3UABA 4PBVC 3IJYA 1U2HA 3MV8D 1JE6A 2XXGA 1JGDB 4L5FH 1SEQL 3DX7A 2ZKWA 2V3EA 5SWSB 5BV7L 2A77L 1QPKA 1SXBA 2Y0SA 1ILSA 4XNQA 3GKZA 1N67A 1PX4A 2EXYC 4F24A 1Q0YH 1F6AB 3BQUA 1SY6H 4JUSA 1TETL 1OOWA 3BP5B 3HPJB 3GBEA 4W9DC 4MNQD 4BFOA 4JM4H 1NGYA 2CUIA 1JXFA 4I18A 4YDKL 2WAHA 2X44D 1N59B 2P7TA 4HZ1A 1T4WA 4N90D 3UMTA 5DK3A 2YBGA 3CCHB 4OFDA 1BVLB 1G7HB 1RUAH 3D0LB 4MB1A 2Q76A 3BRGC 3Q2CA 3CZNA 2O61B 1KJ2B 2EYTB 3O2WL 3BH9A 3MRRA 3H7BA 3MCLH 4MVBC 5KS9E 4ZXBC 1MNUH 1XTMA 4ZO8A 3ABKB 1QSEB 4FXGA 1UC6A 2I7SA 4N24A 5I5MA 3DX0A 3I6SA 2Y36L 1OM3L 4XC1H 3CSFA 4M5ZL 4LLAA 1KT2A 2QPEB 4YHKH 5T1JA 5I9QC 1L3WA 1N26A 4GOSA 3HR5A 3HI6H 1KNOB 2R56H 1ETZA 4WDIB 4W9IC 4MQXD 3QSKB 3ILQD 3WFZA 4PJGF 3LXCA 5TDOA 1C12B 1LDPL 3DX9B 1Z66A 5INDB 3CQPA 4OQTA 3QPKA 1I1FB 3K6IA 4G42A 3RWEB 3B2UC 2VR9A 3OJVC 1QD0A 3WS3A 4M3KB 3GS4A 5HPMB 2NY6B 4OLZL 3RZCB 1A6WL 2HRLA 4F93B 2IF7A 4FFZA 4JO1H 4DGIL 5HVHB 4H8WH 2AS5M 5HYEA 3K71B 3MNVA 4OZGF 2FZ3B 4X9HA 4UT6L 3MA9L 2OV0A 1T03H 3L5HA 3OAUH 5IEKA 3QHTC 2AABH 3GNMH 4LHQB 4AEHH 1L5GB 2ZKXA 5FFLA 4YXLH 5I18H 1ZVHA 3BKCL 3CFJB 4IKNA 4ZX6A 4ADIA 3SQBA 1NWPA 1J87A 3ECUA 4GIPD 3VFMB 4LSTH 2OTPA 4D8OA 4JRYE 3MLWH 1FNSL 4KTDH 2DLTA 1AI1H 1BAGA 2WZ6A 1U8HA 1QFHA 4HWBH 3DI2B 1RZGB 4ZYKA 3O9WC 5HYJE 4E41A 3BP4A 3KPLB 3MTRA 4R4FH 5DI8A 4LAQH 2EQDA 5AEAA 1ZE3C 4WK2B 1ZXQA 3TYGL 4M6MH 1TTAA 3ZDXB 1CT8A 1Q9LA 2VZUA 3SJVE 4ENED 4BZ1A 2OMYB 3EGXA 3L7FA 5FX3A 3ZRFC 4P07A 4LOEA 1DLFH 5D72H 1E6JH 2NY7L 3NJGA 5J6HB 3EO1B 3IFNH 2BO0A 3WJMA 3QZPA 4FFVC 3BZ4B 4BSVB 3QDJE 4HYTB 2NZ9D 3AREA 4AVKA 1H9VA 1YEIH 5D7LE 3NZ8A 1DQDL 2ICWI 3G5XB 3LHPH 1M7XA 4P2RA 3AFLA 2BIPA 4GRLC 2HKHH 4J7RA 4MNQE 2R2CA 5IHBA 3MV8A 5B39G 1SLWA 2AI0L 1TZHA 5B1JC 3UG4A 4ZMQA 5J12B 3T2PA 1LE9B 2H32B 2IPKA 4MD4B 2O6DA 3GFUA 1D6EB 3F5WA 3TFKC 4EIBA 6CGTA 4Z7QB 2WQXA 1K4CB 2GK2A 4NZRL 1MI5D 3DUSA 5HVFB 4IW4C 1M1SA 3RG1C 2VLRB 3G6DL 2C1PB 4QHMA 4LRIC 1HILA 1DQIA 1PEWA 2YK1H 3GSWA 4YMPA 1BQLH 1E4HA 4UT9A 4PCSA 3OKEB 2MQ0A 1AS8A 1SBSH 4IJTA 1HHJA 1O75A 1EV2E 2F54B 1G7LB 4FTVD 1CL7L 1XCTA 4G6KH 2VW6A 5I0YA 3MRDB 4PY7A 1LILA 2F2HA 3CJJA 3H4FA 2EE0A 3O4LB 5DS1A 2O5YL 1FG2B 3PWNB 2BDNH 5CZVL 1TPXC 3S3CB 3LDBB 5DD5L 4WFED 4LZKA 4I2XB 4I0PA 1S7SB 2JB6B 2VKXA 3V2AR 4JQVA 2R69L 3MOBL 2ZUUA 1OGTB 3K0YA 4HCGA 2YLHA 4RIRA 1JF1B 5IVZA 3TJHC 1GPOH 2A4ZA 2E7BA 4A7VA 3H56A 2K3TA 5IVXA 3HFML 5J1AA 4Y5YA 3FT4A 4R97C 2OXGA 1Q90A 2VM4A 1JK8B 5DURB 1B0IA 3CH1B 3O0RH 1RURL 4KZCA 1CU4L 1A9EB 3OGOE 3WXWL 5FYJL 4F7EA 4OLXH 3QJQB 1MCOL 3O4LD 4XTRC 2R8SL 3FCSB 1HEJC 3ZOAA 1F86A 3K6SA 2OP4H 5D2NC 5DF0A 2VZOA 4P59H 3ZIMA 1MRCL 1JZ8A 1UOKA 4QJ5B 4G8GB 3MRMB 1FL5B 2FWUA 3HI1A 5TE7H 1CD1A 2GJRA 1OGAB 3UAJC 1OIOA 2J7LA 4CC4A 1Q9KB 3HNSL 4EI5B 3EFDH 5K1JA 2Q10A 2ENYA 3GI9H 1VFUA 4NSKB 4WTZG 1F41A 4A6YA 1WS7A 3AU1B 1BAWA 3V0IA 2ZNWA 1LJMA 1S8DA 2X6AA 4JQIA 5E2UH 3HAEA 5FA4B 3BUYA 4P3WA 3TN0B 4OJYA 2O1AA 1DBBH 2CU9A 4HALA 5B7EA 3FNKA 3PWPE 5BO0D 2I24N 4H1LG 1IKNA 4X6BB 1BYOA 5I19H 3ZT5A 4G8FA 2E9JA 2Z7ZA 2H8PA 1PX3A 3FCGA 3EJTA 1U92B 2DKMA 1DJGA 2Y1VA 1QNZH 3WTYA 1INQA 4P5KA 3UIYA 3TLRA 5CWSA 4GAFB 2VWEE 3BZFA 4NM4L 3B37A 2VLRD 4DQOL 4O58H 4MDIA 4AH2A 4AEEA 3W56A 5T8IA 1ETA1 3DSFL 1NMCC 3OGCB 5AW2B 5I6XC 1Z9PA 2JJVA 2W60B 4FKKA 5LAXA 3RKPA 5AOIA 4Y4HC 1T4KB 4YN3A 1OP4A 2PKDA 4FQLL 4OJDH 3LCYA 4PJFE 5DJCA 1BFSA 1PKQE 4XBPA 5EZIH 5J57B 5GIRB 5E8PA 4G9FD 3APNA 3ECWA 3IDXH 2EAEA 4S1DC 1H3PH 5JTWA 3MXVL 2W9DH 4EKXA 1BD2D 3WDHA 2ZJSH 2FSDA 3FO2B 4JHVA 5DD3H 5T1LD 5DJ2B 4NM8L 4R7DA 1NANH 3F85A 5KSBF 1AMXA 3NIFF 3OV6A 3GSNA 1XB6A 2NY0B 3G5ZA 4GRMA 4R26H 5J06A 3HHMA 3ARFA 1R3KB 3IDYB 4KQ3L 3DTXA 4FI8A 4HIXH 5DDHA 1TCMA 1U6AH 1IZJA 4Q9BA 3WNNA 4NNYB 5DQ9A 2P5EA 5IQNA 1SJVA 3TA4D 2V2WB 3F05A 4PJAB 1JDCA 3LVEA 4M43H 1AACA 4JJHA 4KXZI 5A7EA 1A6ZA 1YC8A 2OI9B 2WKLA 4JAMA 2R0LH 4LLWB 2A38A 1FYTA 3KH4A 4QRRA 2GEEA 4EIZC 3ETBJ 3M1OA 4QNPE 1CDJA 3K8KA 1G0YR 3IXTB 3NCWA 3KPTA 3ARDA 4JFEE 2XNAB 4Z8FL 5F0JB 4Z23A 3HE7C 5DJYB 3HE7D 2YR3A 2WO4A 4HXAL 1BXVA 5IM7A 4NENB 4PRPA 5LWYH 1U91B 4KAQL 4KVPA 3VFGH 4LCUA 1BM7A 2NSXA 4AENB 1FNEB 3D69A 2AC0A 1GHFL 1MJUL 3IS0X 1NCDH 1Z3RA 5CZXD 3PQYD 3FZUC 3OMAB 5E5RB 4HUMB 5K9QI 1EK3A 5I1EL 1OAYH 1FAIH 1ULVA 1SGKA 4XO8A 5DA4A 2Q2EB 3FQNB 1WCBB 2XG5B 3B3IA 3PIQA 5BS0E 3DROB 1UXSA 2AQ1A 3EYQC 4G80A 1FO0L 2PWEA 3D52A 1PZ3A 3OJDA 4PJEF 3V8CA 3E3QC 2Q6WB 2F53A 1LWJA 3V0AC 1MFAH 1OY3B 4POYA 7FABH 4TNVF 1XHHA 2R69A 4NHCH 1VAHA 1XO8A 1F6AA 4FEMA 5EOCH 5CJQH 4C4UA 2Y5EA 5HHOE 2NOYA 3PWLB 5JQHC 3BP5A 1XMWA 2R4RH 4N8UA 4CUCA 3B43A 2HP4A 3B7SA 4J28A 2AITA 7CGTA 1FHGA 2VAJA 5GGUB 1N8ZB 1WCQA 3VGEA 1KYOK 4G1EB 1BXAA 4OZFH 1HOEA 1EHXA 5LGKA 2O72A 4YZFF 2R23A 2HTLD 2FNWA 3D18B 1ZGLB 1QRNB 3LVTA 5KSAD 3RWCB 4I77L 2YAHA 3T1WA 4MHHI 3VW3H 3GEWB 2ZOLB 1EZLA 1NAKH 3QQXA 4IOFC 3WUWB 1GGCH 1CE1H 2ZKMX 2EYTA 2CR6A 2VB5A 2XWTA 3GMRB 3JWDL 4QRPD 4ZDHB 4JFHE 4YUEL 3VXME 2OMZB 4JY5H 4JPQA 5FYLD 1XGUB 1S9WA 1JNLL 3K6OA 4Y5XA 3ZDYE 1QSFD 5F97E 3EJUA 5JHDB 5MEOB 2H6UA 3QNYA 3RWGA 3OXSA 2BSTA 3HS0C 5DQJB 5EU3B 1WP6A 3DO4A 4XCFH 4DWHA 1KNOA 4LQFH 2EDRA 5LAPA 1CUOA 2K8QA 2Y2WA 1IGMH 3N1MC 4XBGA 5AYUH 3EYVB 3EHBB 3VH8G 3QNZB 3WYRA 1AANA 1EJFA 2FH6A 3NABL 3ETBF 1FQ9C 4FQ1H 3QRGH 4XAKE 3WNKA 3WIIH 3VFPA 3C5JB 4AQAA 2RGSA 5CP7B 2UWEB 1CK0H 4JKMA 1ET8A 1KGWA 5IK3B 3VFTB 3DXAA 3MZGB 2H3NA 5MEPB 3ZE1B 1IFGA 5JPNB 4LSDA 3RA7L 3U9UB 3S88L 5IJVB 5IB2A 1UD8A 2FSEA 2RCSH 2JQMA 1PQZB 3L2NA 1Q0XL 3DX4A 3RYMA 1R33A 1Z7JA 3LKOB 4MB3A 3X3GL 1NANI 4GUCA 5EOTA 4C83A 1QYGL 4OQTH 5JZ7C 3QVAA 5A16A 1AGDB 5C9KA 4R8WL 4YOKA 1RIUH 4KKAD 1ZLWH 4EOWH 3CZGA 3QA3B 1NUFA 3S5YA 3K80A 5KSUB 4FFZH 1KY6A 3OQ3B 1INEH 2BP3A 3PP3K 3U79A 3DA0A 3HJEA 5D1ZD 2WWKT 3GMLA 1D9KA 4FOMA 5HDLA 1SYSB 5C3TA 5FYKU 3S3PA 2CQVA 1AO7A 1FFPA 4FLQA 4XNUH 4BK5C 4ZS6D 1QHOA 5HDRA 1ECZA 2CM5A 3RWDA 3B7TA 4FMFA 4ZFFA 4NFBA 1ACXA 5T5NF 2XQ0A 3ISWA 2VUOA 3B2UD 3IAPA 4TULL 5AKVA 2EC8A 1NCJA 4IKJA 3B9KA 3NOIA 4U1GC 4A38A 1HHIA 5AENA 1P7HL 4HPYH 3P3TA 5AZUA 5IESL 2V3DA 3RPIA 2WIIB 1JBJA 5C8JA 2QGEA 3NZ8B 2BW5A 3KYNA 2NNCA 1MY5A 5F72S 1JZIA 3OHXB 4Z5RB 5T3ZD 2B15A 2CGZA 4DUVA 1ZRUA 2K6ZA 4MBRA 2R0WH 2K70A 4LVOC 1T21B 4TSCL 2ZXAA 1W0WA 3WIIL 4HJIA 1EUTA 2BC4B 1DN0B 5C0BA 1H6TA 5D1XA 3C8DA 4RGNE 5I5RA 1M56B 3T65A 2ICEB 1I7TB 1UZ6F 1ZT4A 4GG6B 4XX1E 1KB5H 3GSWB 1EWHA 1PLBA 2ZXQA 4J3OF 1OM3H 1TTUA 4LK4A 4HP5A 2DKSA 1AJ7H 2YUZA 2CGRL 2HN7A 3EXJA 1TFHA 1QLFB 1G0XA 4Q52A 1G7LA 3MCLL 3HC4L 4YFLI 1G9MC 2ZF9A 3TZVB 1MVYA 2WAQA 1GTNA 3O4LA 5B8CB 3JZYA 2D31A 4I18C 3HBGA 4H2CA 3R4DA 2GBAA 5F8QC 3OSVA 3ZIYA 1WK0A 2J1XA 3SDAA 3IDMA 1XF2B 1G9NC 1WZAA 4HH8A 2ERJC 1KJ2L 4K0OA 5LDSA 4PS4H 3SD2A 1AY1L 5CCGE 5JNYB 3KZ8A 3MV11 1N5YL 5DVNA 3G04B 4UTAL 2WXJA 1DJXA 4U3XA 2N3JA 4I77H 2B16A 1KCVH 2XXFA 3JWNG 2NY4C 4RSVA 3GPSA 2Z93A 2EDTA 2XRAH 3L9YA 1GGIL 1UASA 2AHIA 3FT4B 3X3GH 5DEZA 4H26B 2H2PC 5CSBA 5EA0H 2XQBL 1GZHC 2XZCL 3KYMB 2FJFA 2HRGA 3RY5A 1ND0B 1X6LA 3MUJA 2X7LB 4DVRH 4L8CB 3FCSA 5GGTA 4ZD3H 2OCJA 3MLTA 4U1KB 1NBYB 2AANA 4FXLA 2YARA 3PQYA 2AMGA 1EAPA 3B83A 1EEZB 2PO6D 5BOZG 2GIXA 3H53A 4PJAE 1ANUA 2AJVL 5TGBB 3SYQA 1QHQA 5C97A 3APMA 4FNLH 1NFIA 2BSDA 4YSTA 2CE6A 4ZUUB 2QR0B 3NRFA 5FHBH 2VGLM 1X4ZA 1DANU 2OL3H 1ID2A 1EUUA 2X0VA 3MTXA 2FLRT 3QPQD 4WZ9A 1MXGA 4YHPA 5I74C 3ZU8A 2B1OA 4NDMB 2ROXA 4F2FA 1DJSA 4EVNA 4M8RA 3MRHB 5F9WC 3UIZA 3TBSA 4HS3B 3TO4B 2F8IA 4BELD 2BSSB 5ABZA 2HT4C 1YUHA 4UT7L 4WIQA 5E2WH 1BP3B 4XPTH 3CVCA 3BESR 4HIPA 4BDVB 3RVTC 4LO9A 4NKOB 5K59E 4ETYA 3BFOA 3GTNA 3HUJB 3V0JA 2V7NB 2K7QA 4BH7A 5IJDC 4DOHE 3NPSB 4IEFA 2JQZA 2APFA 1QATA 5C0DB 1FLRL 2VDQB 4HWEL 1RUPL 1MH5B 4JM2F 4QRTA 4YSAA 1IC0A 5LCVL 1KEGH 1WJ3A 4R2GD 4EIUA 5CR8A 3E6HB 3U0TB 3HNTH 4F7PB 1EXGA 4OJFH 3U7WH 3OWRA 5F3BB 1QR1B 5F6HJ 3MBXH 3JUYA 4L1TA 5I16B 3GBLA 5KG9B 4FQXA 4L3CB 1G1CA 1A7OH 1AIZA 5J12C 4K94H 1WUZA 2AW2A 4B7LA 3WKQA 3GXFA 1V7MH 4G11A 3MRCA 3RWJA 4HG4J 1T1WB 5E9DE 3DGGA 3BE1L 4OLYH 4MJID 5DWUL 3EGSA 1UQSB 1V10A 4GUOA 1KTJA 2NX5A 4Y1SA 3QXUA 4P4RA 1R3JB 2IQ9L 2XJKA 4LLQA 2ZG3A 2F5BL 3ULVC 3GUTA 4E0RA 5K9KB 4UM8B 3ULUC 1YN6B 1NCBL 1FNFA 3EGDB 4NQCB 3A0OA 4PWHA 2V2WA 3BGFC 4JPVH 1CR9L 4PJAA 5LG1A 4RBPK 4AMKH 2WY3B 4NO3A 5IVXE 3VXSD 2OK0L 4MRCA 3SPJA 4RSYA 1UCBL 2Q87A 1NICA 1KBGH 3T4YB 1VPOH 4H2AA 1NCAH 4JEGB 4PJGA 3GB7A 4QAWA 4CGTA 3U6XS 5CGMA 2D3VA 1OK0A 4R96B 2A74B 3WSQL 2XA8H 1BLNB 4GSXA 2AK1L 3QCTL 1M7UA 3QI9C 3V0VB 4WO4A 3MNDA 4IRSA 4N90E 4NQXB 4UTAA 1OCWL 2ODIA 1FNHA 2ED9A 4QF1B 4W4OC 1MHCA 1N6UA 4IRZA 3C2SA 1ERNA 3SODB 4B9GA 1MPAL 5AOZA 2WSKA 2OSYA 4G9DB 1HOCB 1CXHA 1NEUA 3K4ZA 3OMIB 5DJ0B 3TBYA 5IMKA 5C0FB 1RD6A 5SWZA 3QEHB 2F54E 1T1XA 2VDOB 4FI6A 3BAEH 3V0EA 3DJ9A 2IG2L 1TZ8A 1DEDA 2X1WL 3OJDB 4LHUA 3HMWH 4DP1X 4ZO9A 5FK9B 1AHWA 2ZJSL 4N85A 2W80C 2KLSA 4EN3D 2Z8VC 4NRYA 4XOEA 1AQ8A 1VZIA 3NYKA 4JFXA 2WLIA 4NS0A 4XODA 3ABMB 5FS5A 4O02B 2IMMA 2I9TB 4LSRH 4Q2ZA 3WO3B 5J8OA 4PJ7F 3V52L 1UFGA 4Z7UA 3GINA 2XBZA 4Z7VB 3D3VB 3SCMA 5FYJH 3ULVF 3J2PA 4K5NA 2FHBA 1CU4H 3P30H 3GMOB 1BVKA 2MQ3A 1JVLA 5GGUA 2OR7A 3RI5F 4ERSL 1IGIL 2X4RB 2Y5TA 1PZUB 4KH2A 3QWOB 3LJ3A 4Q6IB 3WMPA 4RAUA 4YHNA 4O58L 5EBWB 1GYCA 4D2NA 4KRPC 2R69H 3X1EA 2OMVB 3MRQB 2CLVB 2XTJC 1I8LA 3PP4L 5FR3A 3GBNH 2P43B 1ADQA 3VGDA 3CIQA 1YDPB 2BCKB 2ALAA 1LD9B 3JWOH 2J1YA 5ITFB 1CLYL 5KYXA 3ILPA 1II4E 1XSOA 2VMEA 4OZFA 3H9YA 1XWVA 4XRCA 2XWJB 4RWHA 5MEOA 4DIXA 2IADB 2WCSA 3UTTE 1CLYH 3Q2VA 3ZPDA 4UOZA 5I0DA 1HH6A 2GAZA 2X4SA 1TCRB 2KL6A 5MHSD 4L3EA 3TPKA 5MEQB 2JIXA 3JT2A 1C5CH 1WVZA 2EECA 4JDTH 1DJYA 1E4WH 4Z7IA 3FSAA 3NFNA 1VHPA 4BZ1H 3MJ9A 4PJ8B 3SKOB 5BS0A 3KWVA 2VDKB 3F00A 1E28A 4U6HA 3W39B 4OGYH 4YZFE 4Y5XC 3CXHK 3D39E 1CVRA 2BM3A 4Y0GA 5D70L 4A63A 3BD5A 5JPNA 2VLJB 4WGVB 3U9UA 4XO3A 1Q0EA 2LLGA 3FQ4A 3KPNB 4FULA 2VDPH 1FZMB 3VO0A 5KTEL 3B1TA 2H26A 4LSRL 2GI0A 1PG7H 3K1DA 1QFUL 1QLRA 3IFNL 3PJNA 4HUUA 3BZEA 1QQDB 3ARWA 2HFEB 2YD8A 1GPOL 3BFWA 4WHDA 5KTEH 5M95B 1T0PB 1EIBA 2IFFL 3LH9A 4HXBL 3TJEH 2IH3B 2J44A 1U58A 1ZT7B 1C08A 4I3RH 4ELMB 5CEZL 6PAZA 3V5DA 1T6VN 1P7KB 3V9EA 1V5JA 3F62A 3V4UL 2OYLA 4BWWA 2QVIA 4S10A 1FSKC 3GBML 5CGYC 1SJMA 2VDRB 4HWBL 4ELME 5FUOL 1YHPA 4JNXA 1NC4A 1LTXA 4G6KL 4XN2A 1AS6A 2VISB 3AITA 3OKDB 4XVUC 3F8UB 2AK4D 1P6FA 1BYNA 2LOEA 5JIHA 2QPFA 3Q06A 3BKCH 4MA1B 3GMQB 2ENPA 2XN2A 2CIKB 2IANB 2BNUB 1U3HC 4X6DF 5EZLB 5D93B 1F58H 4J2XA 5AAMC 1RIHH 3FPYA 3VG9C 4Z7NF 5ICZA 1HL4A 1IJNA 1UWXK 2Y7SA 1IKOP 1MFDH 5DUMH 2NW3B 1C7SA 2QKIA 5KVGL 3V4UH 5KSBB 1CICA 2NMSA 2A1WL 3QORC 5TE4H 1FCCA 4LCVA 43C9B 2BLFA 1W72H 4LP5A 4BFFA 1A22B 2DJ4A 1F56A 2EUXA 1NCIA 3NVQA 5TTRA 2BWIA 4L23A 2MKLC 3LXAA 4P04A 4DPRA 5HHPA 5DYOA 2VDOL 1SHWA 3AQDA 5EO0B 1U8PA 5F89A 4DAGL 1SMAA 4U49A 1A3ZA 2XQYK 8PAZA 4R90H 4HIQA 5ALBH 4LF3B 4HX1A 4PV9B 4XTRD 3VE0A 3JT0A 4W9JC 3MFFA 5L8KB 2AXFA 3Q5YA 5C07B 3O8XD 2GHZA 2WIMA 4OGYL 4TM9A 3UTTD 4JQIH 4FABL 4F1SA 3IDMB 5JR1H 4NP4H 1ZTXH 3AS1A 4Y9FA 5I0XA 3AT8A 1MAKA 1A14H 3MUHL 1FNSH 3S0PA 1KACB 2Z0BA 5L4IA 3BEWA 4IIQB 2C34A 2WCGA 2OMXB 2DTSA 1F90L 5AVWB 5BRZD 3FN9A 2FWSA 3PAVA 4RBPH 5KN5B 4QT5B 1JPTL 1QW8A 2X4NB 4G3YL 1RK1A 5H2BB 2F1BA 2LLLA 2NX5E 4Y9CA 4A2EA 5JW5A 1FFOA 2B9BA 1G6VK 2FJFB 1TTFA 3FOMB 1T0MB 3L4YA 4WKXA 1TF4A 2NTFB 3ARGA 3MRFB 1AKPA 1MCHA 3GHBH 4AVJA 1W72B 4XPFL 3VMNA 2P49B 3HN3A 1I8UA 4K7FB 3AB0B 3IGKA 1ORQB 3PRZA 4J23A 4X4ME 1NLBL 3K74B 5BNXD 3KDMA 2AK1H 2WOBA 3D2UB 3KLHC 3KLQA 2PCPA 4K4KA 4U1JB 3VXPA 5C0CA 3BMWA 4XPTL 1JDDA 4KFMA 1BMZA 3WSQH 4XMXA 5E2TL 4WO0A 3QDMA 3ZDZF 4U1LA 2VT0A 1FAKT 4HA1A 2DLGA 3QIWB 3TO2B 4LDCA 3GSNL 4TLKA 1XGTB 3PHOB 1TO4A 1XTLA 2Z4QB 2C9XA 3DETC 5FCUH 3O6KL 3QZMA 1JGUH 2FIRT 2HT3D 3Q8CA 5T5FH 3MRHA 2E5EA 3W0WA 1I3GL 2CG9X 2Q7NA 2WBJC 4QCIA 2ADGB 3WIAA 2B1HH 4XP9L 5IQLA 1NOLA 1ZK5A 1TVBB 5I82A 4JMNA 4O4YH 3V4PB 2OL3A 4IRZL 2FVNA 2TRHA 3MKKA 3NZHL 1YA5A 4LSQL 4OFVA 3HG1A 1QO3B 2GYSA 3E8UL 4GW4B 3LQAC 4HT1H 4JGJA 3IDJA 1MDAA 3I85A 4OSUH 2H41A 3ZYZA 1E6OH 2XZCH 4PRBA 2XQBH 1AMYA 4LARL 4BZ2H 3L3IA 4K94L 5MENE 4AT6B 2XRAL 1OLZA 3CSGA 5TFSH 2BHFA 2CUAA 3RQ3A 4JFED 3TNMB 4JHUA 5E7BA 1JXJA 3S5LA 1T5KA 4X5RA 1WWAX 1TETH 3FQ1A 4JN1L 4ZS7L 1GTFA 3FT2B 4NQDB 4H44C 1T0NA 1YMHA 3OM3B 4Y88A 1KEGL 3ZHKA 3PXLA 3MRJA 4LCCB 4K9EC 4AJVA 3TBBA 1UD5A 5GGQH 3U6RB 1W8EA 3H9SD 3U30C 5EPMA 5BQDA 5I8EA 4N5EC 2RB8A 5GS2D 1P5UC 1QR4A 3IF1A 3C6LB 3C60A 4M1DH 2G9HB 5T3ZH 3D1MC 3MJWA 1IC4L 5F7YC 2A5UA 1Q94A 1IFRA 3LIZH 1R3JA 1VGEL 3NJHA 4XCEA 4AKQA 4TTDC 4IRSD 2H45A 2F18A 2VH5H 4LSUL 4TNEA 1DTUA 4WHCA 3CDFA 4AGQA 1KGCD 3QIBC 2ATAA 3VYNA 2G4EA 2ED7A 4NAQA 3ERXA 1MFVA 5C2UB 2M2DA 4WFFE 4P5TA 3DJRA 3EJPA 1TJMA 2R1YA 3NJJA 1J8HE 3NMEA 5KWYC 4Z78A 1FZKA