3DHMA

Beta 2 microglobulin mutant d59p
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
100
structure length
100
Chain Sequence
MIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKPWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Beta-2-microglobulin
publication title DE loop mutations affect beta2-microglobulin stability and amyloid aggregation
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2008-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3dhmA00
2E27L 3OJ2C 3U7WL 3UTTD 4KPHH 5INCA 1QR1A 1MI5D 4JM2A 1FGNH 2F53D 3F58H 4P9HL 5DUMH 1CGWA 4J4PC 3EYOB 3QA3B 4JZNB 2GFBA 5TE6L 1FAKT 4KUZL 3RWGB 3REWA 1BMGA 5C08A 5JQ6H 3O45B 1RZJC 1RFDH 4I18B 4LLUA 4XH2A 4X5LA 1G7JA 3IAQA 1GGYA 3PWPE 1YEFL 2NXYD 5I1IH 1FO0L 4D8PB 2R0ZL 3K8LA 5C07D 3FFCB 3V5KA 2FSEB 1AGEB 1MCPL 1U8KB 3QCUL 3M07A 3RX7A 1HINL 3FN9A 1ZHNB 2ZKHH 3OJMB 5CCKH 5C86A 1MWAL 3QHTC 2IPTH 2CXGA 5JLZB 1GIGL 1QBAA 4G6KL 4DAGL 3QCTH 1L0YA 1OSZA 1R0AH 4Q9CA 4HKZA 1FNAA 2JCCE 2WV3A 3D6GA 3ILQD 5I8KL 3GI9H 3ZYJA 1CLYL 3NCJL 1XEDA 2BVPA 3QEQD 4Q0XL 3ARFA 4MCYB 4Y4FB 4WEMB 3TJHD 4QY8B 4NZDA 4EOWL 2AJVH 3LKPA 3HUJB 4FMFA 5EBLB 1PG7W 2WBJB 3SGDH 1UM5L 4S0TD 1M7DB 4NUGL 4X6DE 1CT8A 3U9UB 4M8VA 5INDA 5D2NC 5DUPH 2BY2A 3RGVD 4V1DA 3IETB 4P2OC 5CHNB 1M1SA 2FX8L 1VSCA 2IANB 4KRNA 5F7FA 2VDQL 5GRYA 3FMGH 3LDBC 4MJ2A 1OGAE 4L4TA 3DX6B 5KJRH 5KTEL 1BQHB 5ILTL 1ZLVH 5DJ6B 1UJ3A 4NKOB 1G1CA 1DE4B 3MRMB 1RZ8B 4J23A 5L6YL 5GIRB 1SY6A 5EUKA 3CFDB 1KBGL 1WT5A 2C3WA 2Q7NA 1CBVL 3T08A 3NH7L 4PRHD 5E95B 4YHYB 2OQJA 3O9WD 4M6NH 5ADOL 4HAFA 1EHXA 3QIWB 2AEQL 4P4KC 1J9CT 2EC8A 5B8CA 1GZPA 1BVKB 4HUWB 3UTTA 5TDOA 1MJUL 2OS7A 1JF1A 4OAWB 5IF0B 1MI5A 2F53A 3LQZB 5MENE 4MLIA 1I1AC 2W0KA 3KR3L 1K6QH 2UYLB 3U48A 5DURB 1D5XA 3I75A 2AERT 3MRHB 4HEME 3ULUF 4JAMA 5FCSH 5F7EH 1B0WA 3IDXL 4NQDB 5EUOF 7FABL 3ZKNC 5IB4A 1WWCA 1EBAA 3RVTD 5GGVY 4PJHF 3LHPL 2DJ4A 3L3KB 5F8QC 4Z5RB 3GMMA 5I15H 4PJ8D 4TULH 3IU3A 3E6HA 5C07A 4ETYA 4JO3H 4POYA 3F7RA 2VZTA 2LTQB 4U6HA 4PJEB 4L8CA 2CJUH 3MV7D 5EIIA 2FB4L 1SQ2N 4N0UB 3MRFB 4NN6B 2FR4A 4PG2C 1R3KA 2ZUYA 3IF1B 3VMNA 4AK1A 4DW2L 4EUPH 6FABL 2W65A 3VCLB 3E6FB 4XP4L 1SYVA 1U2HA 3FAWA 3P0YH 4U31A 1JZ6A 1DQML 5HDQL 1WICA 4M6OH 2H26B 3QEQA 4X7SL 3L6FA 1VGEL 4JREC 1F6AB 1S7WB 1P4IL 1L6XA 1YN7A 2XKNB 9CGTA 2FEDC 1HNGA 5DEGA 5EBMB 1LNUA 3ZKMD 5FOBA 2QSTA 5HYSG 1LO4H 2CKBH 3H9YA 2VUOA 1RVFH 3RGVA 1NDGB 5BW7A 1RD6A 4NN7C 4O5LL 2YPLD 3MO1B 1XGPB 1Z3GH 4PGEB 2FLRT 1P7QB 1S3KL 2Z8RA 3OKKB 5BRZD 3VWKB 4M61A 4U3XA 1I3RA 1J0JA 1P2CB 1MFDH 4LQFL 1NDMA 5HVWA 4GG8B 1CE1L 4U1JB 5DJCA 2A83B 4OZGA 3U7AA 1Q9WB 3ZE2E 4NDMA 3QEHA 4RMTA 3R0NA 4LSTL 5HYJB 4PB0L 2E9WA 4YZFE 2EXYC 3HAEA 1BHGA 2F15A 1RUKL 1DBML 2IMMA 4YJZL 4PRHA 2O26U 1HHGA 4GAYB 5TE4H 1OAYH 3O9WA 4QHLA 4TUOA 1RUPH 1RJLA 3MJ9H 1AXTH 4XPGL 2VLKE 4Y4HD 5E8EA 3UZEA 1FJ1A 3SGDI 4P9ML 2EDOA 3HNSH 3DGCR 5I1EH 4P4RA 4YC2B 5GJTH 5MP6L 4Y1AD 4ZPTA 3RKPA 2YUZA 1MFEL 3LH2H 3BHBA 2DDQH 4EEEA 4LVOB 1T1WB 2APTA 3VFTA 4ZUWB 1GPOL 4PJFF 3TN0C 3D18A 3SDAD 3RVXC 4JFPA 3OZ9L 2EYRB 1GZQB 1Q72L 3MLRL 5LQBH 1CK0H 4L4VB 5CJQL 4PJ8A 3CSPA 3BQUB 3QXDB 1XCTB 3VXRB 2PXYB 4EI5C 4UINH 1KLFA 1NC2B 1VCAA 3UTSE 4OBRA 1S7VB 1N3NB 5BS0D 3MV7A 1WFNA 1OY3B 1EAPB 5EFIB 4YXLL 1JGDB 3SE9H 4HFWB 2RCSH 3EDDA 4ZUSA 3RWHB 5F1SA 2I9TB 1FCCA 4PGCB 1OTTC 5DZNA 4JQIH 4K3HA 4FABH 5FAAA 4KFZC 1J0KA 4GMSH 3VFMA 15C8H 4L9LA 1D5IL 5SWSE 4BH8A 4NQSB 1WIOA 3HMXH 2VAAB 1RK1A 3QUXC 1EO7A 3PABA 3GHEH 4OM1L 3CVHL 2XT1B 3MOAL 4M3KB 5DD5H 4OZIA 2FJGA 1UWXK 5E5MA 2G2RB 5CZXD 3DMMD 4K8RL 5ENWA 1I8MB 4YUEL 5JORA 2Y5TB 5IROC 3GHBL 4Y5YA 3I9GH 4DKFL 3V52L 2WIMA 5FEBA 5HYQA 1EX0A 2YPLA 4P4KD 5KW9L 3GO1H 1BVLB 1FZMA 1H0DB 1IQWL 1BECA 5BRZA 1A9BB 4I9WE 5I76B 4YDVB 3TPUB 2KDGA 3WIHA 3K2UL 1FFRA 1NC4D 1FP5A 2NY7H 1F3JB 1U8NA 3OTTA 3VXSD 2ZWLT 1VEOA 2B5IC 1ORSB 4CJ0A 1F02I 5CSZA 2JLLA 2X4RB 4PBXA 4WWKB 5CJXA 2M8XA 3ZKND 3QDGB 2YD1A 5D1XB 5EO1A 1KG0B 4LMQE 2LFGA 3O8XD 4FQCH 1EVTC 1TZHA 1WFOA 3HB3D 1XF5A 5ITBH 3FTGA 5A40E 1QFWL 2XY1A 5M94B 4Y4HA 3DI2B 5HHQB 3L3IB 4XNYH 5DRZB 2R69H 3LPWA 4G6AC 3EJYC 4Y1AA 5F89A 1QACA 4PJIE 3M1BB 4M02A 2FHBA 5GS1C 3DXAE 1T0PB 3F65A 2EXWD 2BXZA 4YGVB 5J11B 3NZHL 2ADJA 2H32A 4E42B 1T1XA 1U2CA 2Y9RT 4KJPC 1XF3B 5FA4B 4YXHL 3O11B 3SDAA 4NRXB 2FECL 4XTRD 1P9MC 4DGIH 1PAMA 4ODXB 3MR9B 3T0ED 1KB5A 5MEQA 3V79C 4PGZA 1QQDB 3L3OA 3DRQB 5A2JH 3UBXG 3FT3A 2X7LB 3VI3E 4D9QD 5BS0A 3T0DA 3ULVE 3RPIB 4Y19D 1M6OA 1MEXL 3DRTA 5D2NA 3UTTE 5CEZD 5MI0C 5D9SA 1IEBA 1ZWIB 1S7SB 4M8QA 1T22B 3MFFA 3EHBC 1OCWH 2Q6WA 1GC1C 3FO9B 5HYFA 4MAYB 5FYKL 1HH9A 4NJAL 3AMKA 2MPAL 3SHSA 2BSRA 1CFNA 4RFEB 4PLKD 1Y6NR 3R1GL 5D5ME 1FAIH 5IV2B 3VD9A 3WN5C 1RUQL 1MRFH 1AIFB 1JNLL 3W9DB 3L5HA 3KPNA 1TTGA 4YR6A 1UZ8B 1X5LA 1T66C 3TT1H 5C07E 2Y36L 1VB9A 3DMMA 4P2YA 4XCYA 1B2WL 3P4OA 2OTWA 5EOCJ 3BH8B 2LAAA 1XGUA 2ATKB 4P4KA 5EWIL 4MJ6A 3QWOB 1W0VA 5E99H 5C0BB 1MFNA 4Y2DD 43C9B 4TQEL 1U8OB 5CP3A 1OGTB 3T1FB 5C2BH 4WO4B 3WFCL 1NC4A 1AKJB 3VGBA 2P5WB 3EGSB 3VXSA 1M7IA 3ARRA 3L95B 4APQD 2VR5A 2BMKA 5JHDE 3P9LB 4E0RA 3QEQE 5AG8A 2J8UB 3IKKA 1ZV5A 3RVXD 4BSWA 4F7PA 3O8XA 3UAJC 3FB5A 3DHJA 5T1MA 5F44A 4NRZA 3MLXL 5K9QI 5I2IA 2IBZX 1A1NB 2GW5A 4YO0A 3OJDB 1PKQB 1JF5A 3KJ4C 1IT9H 2GJ6D 4TUKH 4OIBA 3BYYA 4XBPB 4YDJB 2YMXL 3THML 2YZ8A 4BQCA 1LEIB 2V2XA 3VXMD 3QUKB 3EYVA 1IC7H 1FH5H 1OSPL 4ETQB 4IOSD 4LLDB 3LB6C 4WHYH 1NGYB 5KOVC 3DIFB 2QQKH 2PYFA 5MHSD 1WZ1H 4BQ8A 5DGRA 2EE9A 3PWVB 3N1GC 3OKLB 3QQ9C 1HHKA 4G9DB 4D9LL 3HE7B 2AJSH 1DBKL 3JV5A 4G5ZL 4I48A 2GCYB 4XT1C 5T3ZE 1C08B 3T0EA 1MFCL 4FG6C 2D4DA 3U4BH 4LIQH 3JV6B 5FO7A 4DUVA 1DFBL 4WU5B 5C0DB 3EYFB 4ZO7A 4AT6A 1MRCH 1BWWA 2X4OB 5EU3A 3QG6A 1L0QA 3P11L 4Y19A 1E6OL 3T09A 4QRUA 4LLVA 1S5HB 4TVSa 5B38B 3MJ8B 2X4NA 4I77H 4QHNA 3RL2A 2CKBB 1FDLH 3NA4A 5DMKB 2X70B 3G6DL 3CH8A 2NZIA 3ZE0E 3UPAA 5ISZE 3A0OA 1BVZA 4PJ9B 2APXA 5SX4H 3I6GA 4KKAD 4MLSA 2D9QB 5E03A 4O2FA 2NR6C 3D9AH 3IKCB 4I3SH 5L8KB 4L8BB 5F6HJ 5GGQL 2Q3AA 3GMQB 2EDKA 4QOKD 3RZWA 5KSBB 1YEJL 4AH2A 1C5DA 3MJ7B 3BZ4B 3VXTA 3EOYG 3SDYH 3IDIA 4MQTB 2NCMA 1YUHA 1NMAL 4PFEA 4Y2DA 1EA9C 3L1OH 3EJYD 3VRJB 2NW2B 1YY9D 1JV5B 1UH2A 3VE0B 2J4WL 5EU5A 2HWZL 3HG1E 3RY5A 4PJBB 5LKNA 2M1KA 4NO3A 4APQA 3SPVA 4QWWD 4H1LB 3KPMB 4PLJC 1FNSL 4RAUB 1CIUA 3S36H 5JQHC 3UYRH 1C16B 4NUJB 3VXNA 3O3DA 3D3VD 3U36B 4PJDA 5I1KH 4MDIB 2BVQB 2BK8A 3QULB 1D5ZB 4D0DB 2JCCF 4KPHL 4IJ3C 3QZWA 2F58H 1FGNL 2DQUH 1TTFA 3BZFB 1S7XA 3VWJD 5ICYB 4JFOA 2IQ9L 2HLAB 3N0PB 3TYFA 5JQ6L 1A4JA 1BOGA 3LN9A 2GJ6A 3EYQD 5BVJB 1UQSB 5I17B 1RFDL 2FLBT 1G9NH 2VXTH 4X6DF 3VXMA 4LLMB 2YKLH 2X9WA 1AE6H 1YEKH 1ZT7A 2GSIB 5LBSL 4JPKH 5I1IL 3BUTA 4DK3A 1IJ9A 2CDGA 5IHZB 1TZGH 3AM8C 3P77B 3D0LA 4KJQD 3F8UB 4P23B 5HTSA 2X1PA 4HWNA 3SGKC 1FG9C 1C7TA 1IAOA 2ZKHL 5CCKL 3MBEB 4PJ7A 5CJ8A 1AHWA 4HKBA 2R1YB 2HVKA 2IPTL 4CDHA 4JO1H 3VGFA 1CXFA 3Q6FA 4O9HH 4E5XB 1BF8A 3QCTL 4PP2B 5CLWA 1XF2A 1R0AL 1QNZH 3DOSA 5F96H 5JW4N 3BPNB 1YEIH 2EIZB 1T0MB 2ZSWA 3WO4C 5I8OH 4J1UB 2BCKB 5I71C 1UWGH 1IGJB 1T20A 1X4YA 2HP4A 5IBUG 5F7HA 3BN9C 1PEZA 4P5MA 5D2LF 4P46B 2J6EA 3C60C 4H25B 1RU9H 4TYUA 2BSSB 5MEPA 5DUPL 5JO5B 3MLZH 5HGBB 1NANH 3F5WB 3GSWB 4KQ4H 5GGTA 4PRIB 2E3VA 4TNVF 2QADC 1CG9A 4QOKA 4P9HC 3FMGL 1QFUH 4P57B 4ISVB 3L7EA 1DUZB 4HMDA 3S96A 5KJRL 4K9EH 4F2MB 5D2NE 2NZ9C 3G04A 4CJ1A 3QUZD 4XRCB 2V5RA 1CDYA 1QBML 3OGOE 4R2GB 4QO1A 3HPJB 3Q6GH 5DK3A 4MS8D 4LCYA 3TFKD 4Z7NF 5I19L 5IVNA 4M6NL 4GRLB 3GMRB 4YHNA 1EHLH 3P0VL 1R3IH 3J8F7 2M2DA 1IQDA 3D3VA 4UV7H 5FV1L 4XB8A 3QQ9D 2XTJC 2YXFA 3LOWA 4IMLA 1ZHBB 2AXJA 5DQ9B 5C1MB 5JW4M 3VFSA 5ALCL 4XMKL 2BSTA 2LV4A 3VWJA 4QRQB 4Q6IA 1K6QL 3U2SA 1S7UB 1ADQA 1TVBB 1YMMB 1YECH 4U6YB 5F7EL 3BW9B 4O4YH 4WIQA 4MX7A 3UXFA 1P1ZA 2UVEA 3LKRA 4LLQA 1IGCH 4OGAC 5DWUH 1BGXH 4L8DA 5I66B 3B2VH 3ZYIA 2N4IA 1BZ9B 5KVMC 1LDPL 2FCBA 2PO6C 1T1ZB 5H94B 2FZ3B 5DMJB 3QIBC 1JRHH 2CJUL 3RL1A 1IGIH 1ZKAA 2V7HA 3HNVH 3T8XA 4EN3B 5C0EA 3CJJA 4U1GB 4MMZC 1N5YH 4LCUA 4YZFF 4NM4L 2P45B 5EZLB 5EB9A 5A16A 4OGYH 3ARDB 3KNBB 4ELMB 3PGDA 4X8JB 4EKXA 4WFEE 4WTZA 4I3RH 3PWUB 2OI9B 1GOGA 4NFDA 5FDWA 2AQ1A 3SCMB 3U1SL 1U9KA 1J0ZA 4AIZB 3GGWB 3BIBX 3GSUA 3ARWA 1KCKA 3TESA 2XPGB 1ZLWK 2EE2A 2VERN 3RDTC 3FQTB 5DJYB 2HN7B 1FIGH 3NGBC 1Z3GL 5J0BA 3BEVB 4RGMB 2YSSB 4P3CL 3MNWB 3OV6A 5C70A 4Y8AA 4NCC2 4O2EB 1MFDL 3WEXA 2LVCA 4K23H 5JW5A 1UEMA 2VABB 2YWYA 1I7UA 1N0LA 3QUZA 4DUWA 3H7BA 1WVZA 4OLXH 1RJZA 2DLFH 2QHLA 3KDMA 4LF3A 1FFNA 5F6IC 2XQYK 2BERA 1BD2D 4OZHB 4YBHA 4Z7OE 2YA2A 1RZIB 5HGDB 4JM2F 1QRND 5TE4L 1OAYL 1RUPL 4WEBH 4NNXA 3UTOA 1AXTL 1T6VN 3HHRB 3MGOB 2GK2A 1BM3H 3NIFE 4X6EA 3NIGF 3HNSL 3ALPA 3ZT6A 3NCYS 5I1EL 3MYJB 4JPIA 2AJUH 5SX5K 3S9DB 3I6KA 3WFHB 4RFNC 4J8RA 4GS7B 1YEGH 4JFXA 1V7MH 5B21A 3CSYB 4BSJA 4P3DB 5CD3B 2C7UB 3LH2L 5DHYA 3DVGB 3ULUL 2DDQL 1U8HB 3LPFA 1NAMH 5E56A 2XWBB 3HI6H 4HCRH 2QHRH 3JWDH 4E41B 2GK0A 5HGGS 4KKBC 5LQBL 1CK0L 2VSCA 1B6UA 4PGBB 4FZ8H 2QJDA 4HIJA 3TIDA 5E2JA 1I7RA 2NLJA 1YC7A 2H1PH 4LSPH 4UINL 2BNUA 5ECJE 3BN9D 5HJ3A 2JJVA 1NFIB 2ZCLH 1NKRA 1ZAGA 4O2CB 4PJCA 2Q7YA 4PJDE 3BP5B 4WUKH 3HR6A 2EDJA 3X12B 4F80A 2QR0A 3BE1H 5HHNA 3SE9L 1AR2A 1WBYB 2IALA 3QT2A 5L88L 4JQIL 1OVZA 5HVGB 1UM4H 3W2DH 4FABL 5D96C 2MFNA 5I75C 3HI1B 2JB6A 4GMSL 2YHGA 4MDJA 15C8L 4XMPH 4KJYA 1XGQB 5EIQA 4OCXL 5CSBA 3HMXL 1NCWH 3G6JB 4BK4A 3V0AC 2NXZB 1NBQA 1CDIA 3GHEL 2I9LA 5DD5L 3CU7A 2AXHA 1LO3H 2O5ZL 4NWTH 2WSKA 5IQ9A 3BX7C 4G42B 4XNUL 2LAGB 2J8OA 4OKVB 3U0WH 3GO1L 4YBLC 4GXVH 3KYOA 1Y18B 3P2TA 4QT5A 4GG6A 1S5IL 1Z9MA 2XKUA 2Y25A 2NY7L 1CI5A 4R97B 4XCFH 1VACB 4ZUVA 4ZS6D 4ZD3L 2CD0A 3LKSB 3N50A 3QFDA 1NJ9A 3SDDB 2YS4A 3C9NA 4F7TA 5JOFA 4BSVA 1B88A 1NGQH 3CPLA 5I1DB 3T0BA 5ACZA 4OGAD 1PJ9A 2BXYA 1FZOA 3WFDL 4NHUB 4ORZC 2DJSA 1BD2A 1INDH 2VXSL 1REIA 1CFTB 1HSBA 4FQCL 1QRNA 2XWJA 1ZK9A 3DGGB 5HHOD 4MXVE 5L0QB 2R0LH 2X9XA 1D6EB 3VG9B 1EO5A 4H8WH 2GUOB 1NKOA 1W72A 1KJVB 3KPQA 3PDGA 2R69L 5GRVL 2EDYA 3SGKA 2Z31D 1CGUA 1AC6A 5I0DA 5LGJB 2DBJA 3BWAA 4G43B 3GI8H 4P2QB 3Q5TA 4PJ5E 3I50H 4ZQKA 4R7NB 2MOVA 1JK8A 2X1QA 2P24A 2PN5A 5DRWB 2XZAL 3O3AA 4MD4B 5JW4Q 4CMHC 1JCKA 4WFGD 5I30H 2ARJQ 4Z7VB 1SJEA 3QUYB 3MLPA 2ADGB 4AEFA 4OCYH 3WXVH 3WNOA 5BV7H 4N0RA 3RWFA 4Y5VB 3D39B 3H3PL 4OFPA 2LE9A 43CAB 1ACYH 2ZUUA 1ED3A 2UWEE 1MVFA 3VD7A 4LLAA 4OQTA 1NCCH 5I1HH 4K8RC 3QH3A 3DUUA 5BXFA 1ZVSA 4I2XE 1U36A 2X4QA 4LKCB 4JDTH 1OCWL 5KN5A 3UTQB 3NPZB 1KIPB 4JANA 4JKKA 3FHQA 3CFJA 4H5SB 4DFHA 4DN3H 1G7QB 1OB1B 4FZEH 2FJFA 5K9OB 4WUUE 2BNQD 2GT9B 3CK0H 1MRFL 3FO1A 5DD6A 1CFSA 4RGNB 3ZDYE 1JWUB 3EYUH 5TDPB 3K0WA 4HS6B 4IOIA 1JZ7A 5DO2D 3SJVB 1AJ7L 1U3HC 1NFKA 5E99L 2CDEA 2P1YA 4OZGF 3WJLA 4ODUA 3PJSB 1IZKA 2J12B 3EOAA 1J18A 3FCTB 5AWNH 4GXUM 3L3DA 4HQQH 1J5OH 5I74B 4WU7A 5JW4R 1MVUA 5T5NG 4F57H 1N6QH 1BPVA 1IC4L 4KK6C 3VDCA 4IS6B 1ZHLA 1DUYB 4XXDB 5DJXA 1KNOB 1A5FH 5D7JC 3S3PA 1VADA 1NAKL 3GSOA 4KK9D 2I60L 1ZHKA 3QEUB 4MXQD 4HPYH 5HHOA 1A6UH 4XNZC 4RZCB 2H3NA 2JE8A 2Y23A 4HS3B 3A6CL 3HE6B 1OW0C 1IT9L 3RAJH 1JJUA 2Z31A 3L9RA 4NGHL 5DHVA 2A9MH 2WNGA 3OB0K 3ZYZA 5IESH 3WUWA 5ESQB 4Z7UB 4M9PA 1I1RA 1IC7L 2VLRE 4KDTA 1OLLA 3LMJH 3BZDA 3WS3B 3VFRA 5KG9B 3B43A 1BIIB 1WZ1L 4XP5H 3UC0H 4ZAKC 2IFGA 5E6IC 2GI7A 4NYLA 5EH1A 2AJSL 4F3FA 2NTSP 2A0LD 4GOSA 1UXSA 2PTUA 4LIQL 3U4BL 2J8HA 1QYGH 4MD5A 3GMLA 3WJJA 3OR6A 2XXCB 3OGCB 2VH5H 1PZUB 4LVHB 1PGRB 2AKRA 5BMFH 2OSLA 3PF2A 4FQ2H 3E1F1 3QXUA 4PJGA 4LOUC 4PRNB 4UBDC 1R24B 4I77L 5ETUB 1F4XH 1KXQE 3PQYB 4KROB 4JFDB 3TBWA 1ZGLA 2GY5A 3GB7A 4OZIF 5FF6B 2CLZA 1V05A 2BNQA 3VWKC 1N8ZB 3EOTL 1DL7H 1I85A 3S4SA 3LEYH 2EKJA 2ILLA 4AEHH 3MNVB 3DPBA 4OZFB 4AM0B 3P40A 4KAQH 3IDMA 1JPTL 4U0RC 1ZT4B 4LBEB 5IEKB 2PTVA 4S1QH 1JGVH 4X6CA 4PJCE 4QHKJ 1F3RB 3SDYL 2FATH 3H9ZA 1BLNB 1XGTA 5IVXB 3MUHL 4G7VH 1FFOB 1R3LA 1LE9A 1FVDB 3LAFA 3ZHDA 3JTSA 2YPKA 3ARVA 4HV8A 3FFCD 2C5DC 2ERJB 3GMOA 5FKAB 2DQTH 2IQAA 4UUJA 3KAAA 1OF2A 4FQHA 1UENA 3S36L 2HRPH 4LSRH 1E6JH 1U95A 3CMGA 1WWWX 2C1PB 5CJOH 4PD4K 3OQ3B 3GRWL 1SJHA 1P7KB 1ZLUK 2F58L 5C0CE 2Z92A 2DQUL 2W59A 5KOMC 1NAMB 5GZND 1GL4B 3MBXH 1G6RA 3X13A 3BH9B 1CZ8L 4ZPVA 5T1KB 5KBNC 1HZHL 5JPNA 5E00A 1G9NL 4Y4FD 2VXTL 4M9OA 5GZOC 1PY4A 3C5ZC 2PXYC 2YKLL 5DJDB 1YEKL 3QWQB 4MQXD 3FQUA 4MB3A 4ACPA 4U7MA 4QXTB 4YHKH 3PWLA 2ZUVA 4M1GL 4QRPB 4G8FA 4P48A 2FIKA 4ENEC 1AGCB 1WC7A 2AV1B 1W0WB 5DYOA 2ARJB 1EIBA 1T5XB 3FQWA 3QISA 3U46A 2VDOH 3D5OF 2W9EL 1O7VA 2H9GA 4JO1L 1OP5H 5B39G 4TUJB 4O9HL 1HDMB 3RHWK 1ZEAL 1MJJB 3DLQR 3MROA 4NRYB 5D7KD 5F96L 1IC5H 4XBGB 1M7XA 1YEIL 3O6KL 4UZGA 4GRMA 4U1NB 5I8OL 2ADIA 4AIOA 3PIQA 4NZTH 2NY1C 5BVPH 5KZCB 1T21B 1KC5H 1NCBH 2QBWA 3KYKH 3T3PE 5IW6B 3FB6A 1HNFA 3V7MA 4WCYL 4NQCB 1D5BA 5I16B 4GKZA 2ZG3A 3IGAB 3LEVH 3SO3C 1RU9L 3MXVH 3EYOA 3QA3A 2DL2A 4JZNA 4KK6D 4WI8A 3BMWA 4R0LB 5CGTA 5DURD 4FQLH 3RWGA 1BFOA 3PV6B 3O45A 1JP5A 4HUXB 4MZ3A 2RR3A 1YQVH 3OG4B 3ULSB 4NQDD 4YIQA 4DN4L 4I18A 5SWQB 5DD1H 1AQDB 5C0JB 4LU5H 5CGYD 2BOBB 4LHQB 5C71A 4BELD 4M93C 1G84A 3QI9B 1EVUA 1OQOA 4HJ0C 4D8PA 2DWEB 2EC9U 1X4ZA 3RUGE 3Q6GL 3RWJB 2XQBH 2PETA 3FFCA 3TNNB 1EEZB 1UH3A 1AGEA 2FSEA 1ZXQA 1YN6B 3HTLX 3LY6A 4NO5A 2XOTA 4RFOH 5ADPH 1ZHNA 2VLJB 5E5UB 4LAQL 3S36X 5AAWA 3UO1H 4F9LC 3F7VA 3FOLB 1QLEH 4XPTH 5I0ZA 1R3IL 4Y4KB 1YC8A 1PZ5B 4M1DH 5EZOH 1R3JB 2ZOKB 1UA6H 3EJJX 3QR2A 1I8LC 2C26A 3CVHA 4M5YH 1WTLA 2B4CC 4KKLD 3ZDZE 3KPOB 1WZLA 1F4YH 4O4YL 3NVQA 4N68A 4MCYA 1ULVA 4Y4FA 5BV7B 2WWMC 5DJ0B 5EBLA 3KG5A 1IGCL 4XI5D 3RIFF 2XFXB 2R1WB 1BGXL 2XTJE 4NQED 2D7TH 3B2VL 3TJEH 4UOJA 1M7DA 3HCVB 4UBDD 1C12B 2CR3A 3C08H 4P2CG 3U9UA 1E4XH 3B5TA 1A6ZB 1KB5H 5FUOH 3IETA 1MFBH 2H2PC 3PL6B 2XICA 4DEPB 3VJ6A 4HSQA 4JRYD 4R9HA 2D0GA 3TYGL 3VWKD 1J12A 5CEXB 2NTFA 1DBBH 4Z6AT 2J1KA 3PDDA 4IIQB 3ZSSA 5F7UA 3K46A 4Y5XC 4UDTB 1N5YL 5F7DB 4AMKL 3OAYK 1BQHA 3QQ4B 1K85A 1KCUH 1JTTA 2OM5A 3QRFM 4NKOA 3ROOB 3FO0H 3GM8A 1DE4A 4LFHD 5HYJD 1RZ8A 5E8PB 5GIRA 3WIFB 3U6RB 3CFDA 1Q1JH 3JZ7A 3MPCA 4P59H 3NIFF 2VZOA 2IADA 2Q20A 2B1AL 2V7NB 4X0KB 5JNYB 3A6OA 4WI5A 4PR5B 3SQOL 4LSDA 2V9QA 4N9OB 4EVNB 4HUWA 25C8H 3ES6B 1UT9A 4OAWA 5IF0A 3LQZA 3I3BA 5E08L 1K4DA 3OL2A 1JMXA 2UYLA 4O00A 4F7MB 3MRHA 4W4OA 2AW2A 1NGXA 5GJSH 5EZIL 4MHHI 4ODHH 3GK8H 4NQDA 4LGRB 4OF5A 5CP3H 4BZ1H 4PYGA 3QIUB 5EC2B 4K23L 2HKFH 3REVB 2D7OA 1CGXA 3TP4A 5KS9B 1AO7E 3HC0B 4PJGE 4HGMA 1FYTE 3L3KA 4K7FB 4OLXL 4Z5RA 3BQUD 5D7SL 4XPAH 2DLFL 3VXRD 2PXYD 4PJDF 2VDLH 1NC2D 4JG1H 4G7YH 4PJEA 4EQ2A 5E9DE 1HYSD 2VL4A 4XWGH 1EFQA 4N0UA 4WEBL 3MRFA 2WM0A 4V2CB 4WV1C 4XBEH 1BM3L 3ECBB 4JN2A 2A77L 5E6IA 3VCLA 3E6FA 1ACZA 2AJUL 4GLRI 1YEGL 5GHWH 1V7ML 4ZFZA 4A6YB 3ZZ1A 5CAYB 5HI3D 2KL6A 1ZA3B 1JGLH 3BT2H 3NABH 3RIAK 4KY1H 4X6CE 5E8DL 1JUFB 1F6AA 1S7WA 4K3JL 5DF0A 3S7GA 4HCRL 2AJXH 2QHRL 4OI9A 2XKNA 4NQEA 3JWDL 5EBMA 1YNKH 4PJ7F 2NY1D 3ALXA 3EDJA 2Y4SA 4FZ8L 3ESVF 3JUZA 1T5WB 4ODWB 2VC2H 1KXVC 3BDBA 3SKNB 1XGPA 4PGEA 2ZCLL 3KPLB 3MA7B 4JRYA 3OKKA 1HEZB 3VWKA 2CUMA 3MCKB 4WUKL 5B3JE 2YK1L 2DAVA 3T2PA 4L3CA 3BE1L 1P2CA 5CEZH 4S1DD 4QKXB 4U1JA 3VDBA 3QUMH 1Q9WA 1UM4L 2CRZA 3VXOA 3MV8E 4WWKD 1WV7T 5HYJA 1DTUA 2WINB 4UTBL 4MXVF 2LU3A 4HIHB 1JF6A 3QDGD 4UT7H 5D1XD 4CL7A 4R4NC 3HFMH 2NY3B 3KWWB 4GAYA 1NH6A 2W1NA 2FO4A 4HJ0D 2R1XA 1E4KC 1KF9B 4U7SA 5IW1B 4OV6F 3OXSB 4R4FH 2BNRE 4W4NA 1LO3L 3LSOB 3IRZA 5BZWA 4NWTL 5DFTA 3BPOB 4QXWA 2VKXA 3BGFB 1CXEA 3H42H 5IT2L 1QKZL 4U1HB 3MV11 3NBNA 5L2JB 1T1WA 5FM5M 1OD9A 4DGYH 3CLEH 3BKCH 2DM2A 2EYRA 5EBGA 1GZQA 5I8CB 2B2XH 3QP3A 4ZUUA 3ULUC 3ROLB 3NN8B 5CEYB 4K71B 1WBZB 4M7ZC 1OD7A 3BQUA 3L3JB 4TVPH 1J05B 1KJMB 5HHMB 5HYSB 1TETH 1XCTA 3QXDA 3VXRA 2PXYA 5ITFB 2JJTC 1NC2A 1INDL 1U8IA 1S7VA 1N3NA 2KQNA 2R0LL 1EAPA 4OF7A 5EFIA 3WFZA 4TRPH 5E7FA 4H8WL 4HFWA 3OAZH 2H2PD 3BESR 2I9TA 3H0TA 4PGCA 3VXPB 4OKDA 4JGUA 4MAYD 1MCJA 4K7PH 2GQHA 4DKDC 1U8JB 3O81A 3ARSA 2HTLC 3VD3A 4PJAA 1ONQA 3GI8L 4PJXB 3HZYB 3VD4A 3I50L 2PYEB 1Z5LB 5ICZB 1OTSD 1R5WB 3SKUD 3VXUB 2VAAA 1FNFA 5EO0B 3QEGH 4P5TC 1B4JL 4JFFE 1G7PB 3JBG7 2Z4QB 3Q5OA 2G2RA 1NLDH 3PP4L 4X9BA 3VG0H 4F9PA 4OCYL 5B4MD 3WXVL 4DCQB 1I8MA 2Y5TA 1ACYL 5J89A 3SDCC 2E8ZA 4JPWH 1BVLA 2IFFH 5C0BD 1H0DA 1NCCL 5I1HL 1CR9H 1OP3H 1A9BA 3TCLB 4YDVA 3TPUA 1MLBB 3WV0A 4AG4L 4WO4D 1AKJD 1BWMA 4XP6H 1QBLH 1AY1H 1F3JA 2P5WD 1NPUA 1A0QH 4U0QB 2X4RA 2RQ8A 1DVFC 1LVEA 2A9NH 4WWKA 4ZFFB 2AABH 2GSGA 1IARB 4DN3L 3QDGA 4FZEL 5D1XA 1CU4H 4D9RD 5I1CL 2J6EH 2LQRA 1PVHA 1HIMH 2I24N 5FKPB 4NT6B 3EYUL 4YHZH 2VZSA 2DI7A 3L3IA 2X44D 2N56A 5DRZA 4R7DB 4CVWA 1AD9B 3O6FC 3IDYC 3OG6B 1KPUB 4N0YL 3SE3C 2DKSA 3OKOB 3M1BA 4D0BB 4QTHB 3UROR 2YRZA 2YRPA 3W0WB 4XAWH 4YGVA 2OTPA 1HCFX 4DTGL 4E42A 3DV4B 5F1OB 1EFXB 3QXAA 5AWNL 3V9FA 1A9EB 1XF3A 5FA4A 4PIRF 3O11A 1J5OL 4NRXA 1I8LA 4ODXA 3HE7D 3MR9A 3IVKB 1CGSH 1AXSB 4F57L 3IS0X 1N6QL 4RNRB 2WWKO 5F9JB 1QQDA 2DKUA 4YDIH 3DRQA 2Y6SD 4HK0B 3O4LE 1A5FL 5JW3L 2X7LA 3MLUH 1IAKB 4HPYL 1LK2B 4W6WB 4C57C 3RPIA 4JDZB 4J3VA 4U2YA 5C0FB 3QJFB 5DZLA 1R5IB 1QBBA 2EDTA 4Q2ZB 1A2YB 1ZWIA 1S7SA 3ARBB 1T22A 2GTZB 3RAJL 1WIUA 3CD4A 3FO9A 5TFSH 4MAYA 2A9ML 2AK1L 1NLBH 5IESL 3FN0H 4RFEA 1NFDB 1AFVH 2PR4H 4QGTA 3LMJL 2VL5B 5IV2A 2AXFB 4PJ9D 1U8LB 1N26A 1AIFA 1OAUH 5E2UL 3W9DA 5EULV 2VE6B 4XP5L 3UC0L 2A6IB 5BO1H 5FM4A 3RTQB 1UZ8A 2CUHA 4PJCF 5IR1A 4JPVL 4R4ND 5IWLA 3P4NB 2OP4H 5JXEC 1LWRA 1H8OA 2HT4C 1T83C 3BH8A 1J1XH 1PW3A 3LS5H 2ATKA 3P4LA 2X4SB 5FYKE 4JFEE 4WJ5B 3QWOA 4MJIB 4GQ9H 3QNXB 4HMCA 43C9A 1U8OA 4CDGC 3SDXE 5C0GB 2EZ0C 2ZCHL 3BDYH 1OGTA 1YEEL 5C09E 3T1FA 5BMFL 4MWFB 4XNXH 1AKJA 4DVRH 2P5WA 4UTAH 3EGSA 1F4XL 1BQUA 1TMCB 3B9KB 4KRMB 3WE6B 4GJTB 1CYGA 4LCCB 5F9DC 3JV0A 5CD5D 3P9LA 2VRAA 1MHPH 3K7UA 2J8UA 4XAKE 1MCOH 3UBXB 4HIIB 1KJ2B 1IGMH 4HXBL 2O5YL 4NQEE 3SKMB 2WLZA 2VNCA 4YDKH 2EDWA 1A4KB 2JJWA 3LEYL 3KPSE 2HLFC 2VZ1A 1FLRL 4KDWA 4AEHL 1MCHA 3OJDA 1PKQA 5J1TC 5EOCH 4C56E 1RJYB 4GG6F 1A7OH 2XN9D 4XBPA 4YDJA 3ETBF 1MFAH 3NFNA 4KHXH 3W5MA 4HHAB 3VMPA 3DURB 4MA3B 1JGVL 3QUKA 5DUBB 4JRYE 3EO9H 3W39A 2FATL 2VMFA 3QCVH 3DYPA 4LLDA 2YUXA 3MRLB 3DIFA 4ODVH 3QFJE 5E2TL 5J4MA 4KTEH 5BZDB 3MREB 1BFSA 3PWVA 3OKLA 5ACLA 4P23D 1IM3A 5F7LB 5HI5C 5AZ2H 4G9DA 4G80B 1N7ML 2GCYA 3MBED 1C08A 3EOBB 3VFNB 2HRPL 4LSRL 2F5BH 1E6JL 4B5EA 3JV6A 1KEGL 4RDQF 1DR9A 1IMHC 4WU5A 3WNMA 5C0DA 5IJKC 3EYFA 2ADFL 3AS1A 1GSMA 3KLSA 3QDME 3B8YA 4X83A 2HKHH 4OLWH 3T04D 3T3PF 3B3IB 1EUUA 3TA3C 1S5HA 4J3TA 5B38A 3MJ8A 5D8JH 4OQ1A 1IM9B 5E8OB 2W60B 2CKBA 5DMKA 2X70A 3O4OB 2YN5A 1HXYB 5FO9B 4E9LA 1HHJB 4KZDL 1S7TB 2JJUA 4DOHE 3NPSC 1FQ9C 4P46D 4PJ9A 4YHKL 2NPLX 5KSAB 1KLGB 4GW4B 5TQ2H 3IKCA 2VISB 4L8BA 5JMOC 3QXWA 4PRID 4U6TA 1ZSDA 3GMQA 1XF4A 3QUMB 3AFLA 5KSBA 3UJJH 3BZ4A 4DFIA 3EYSH 1EGJA 3DI3B 1MHEB 1FL3B 4YK4B 1P4BH 4PS4H 1FC2D 2EDHA 2FWOB 4LLYB 4PD4J 4WNQB 2WLYA 4HWZB 4FXGA 4FQ1H 2NXZC 4R2GD 4NZRH 1IC5L 4ONOA 3NIDE 5LCVH 4YHML 3VRJA 3MJ9A 3T1WA 2NW2A 1BAFL 4P99A 1JV5A 1ZS8B 4GQPH 4RWHA 4U6VL 4PJBA 1CD9B 5BVPL 4PJAE 5TJWK 1KC5L 1NCBL 4GRLD 3KPMA 2JKXA 4RAUA 5HVFB 3H9SE 4NUJA 3U36A 4U05A 3UYOD 1ZT1B 4MDIA 1L7IL 2BVQA 5F3BB 1QOKA 4X5WB 3QULA 4D0DA 1UB6B 3ZHKA 1PG7L 4TN9A 4X99B 1EMTH 2D9CA 3W81A 3MXVL 3BZFA 3VFUB 1D9KB 3ZDZF 5ICYA 4K94H 2HLAA 1T1YB 3DUSB 2Y5EA 1HHIA 2W9DL 1YMMD 2HRLA 3RVUC 4CU8A 3L7FB 1JWSB 4BKLB 2XN9A 2D7QA 5AUMB 5BVJA 1UQSA 3MUZ1 1XIWB 1JZ8A 4EDXB 4LU5L 2ARWA 3WIHL 2AXGB 4FFYH 4IRJC 2GSIA 1U6AH 1SMAA 3Q0HA 3I2CL 1UACH 5IEHB 1X5AA 4I5BA 2DLHA 2C4XA 2XQBL 3P77A 3W11D 1QEWB 4P23A 2AV7B 3RRQA 4NP4L 4RFOL 2R2EB 5ADPL 3MBEA 3WS6A 4LGSB 3UO1L 1CWVA 4YDLC 1QLEL 4UAOC 4EN3D 4XPTL 4JY5H 1UYWH 2R1YA 4BUHA 5FYLH 1FPTL 4QCIB 1QO3B 4XC1H 1BQLH 4XHJC 1W72H 5EU6E 4PP2A 4MSWB 5IW3A 3HMXA 5EZOL 1J10A 3ARDD 4HS8L 2NX5E 2X5PA 1UA6L 2EIZA 1T0MA 4RDQG 1SVZA 5DI8B 1A1MB 4LSQH 4NFBA 4J1UA 2BCKA 1Q94B 2Z91B 4NZUH 1IGJA 1F4YL 2X1XR 3MUY1 1JNNH 5EORH 4N0FB 2AVGA 1U91A 3SCMD 4R3SA 1QSEB 3UPRB 4P46A 1CN4A 4BQ9A 4JDVB 2PW2B 1JYXA 4H25A 2HG5A 2BSSA 3CU1A 5JO5A 1KB5L 3TNMB 5HGBA 5FUOL 1MFBL 2ZZUT 4FTVB 2B0SH 3F5WA 3HRZB 4PRIA 2X4TB 1QLFB 4RGOH 5LWYH 4P57A 2AAVA 2VSDA 4HH8A 3HLAB 1DBBL 3MRRB 4NWUL 4PJGF 3OHXA 3OF6D 1F6LL 3SE8H 4F2MA 3HMWH 1LP9E 4TTDD 4XRCA 1RURH 1WWAX 3FO0L 4H88L 1TQBC 3HPJA 4YNYB 3TO4B 1YPZE 3GSQB 2V5TA 4YE4H 1JZ5A 4LHUG 4BQ6A 4KJWC 3BZEA 4GRLA 2MKLC 4P59L 3GMRA 1SYSB 4Y16C 4JG0L 1SBBA 3HKFA 4XVJH 5E2WH 3TBTA 4F8TA 4LEOB 1LILA 1P5VA 3E8UH 4Z95H 2GAZB 3U79A 25C8L 4QRRB 1ZHBA 5DQ9A 1F58L 1CFQB 4X6CF 1F97A 2QTEA 3ZLQC 1C1EH 4BQBA 4WFHE 4QRQA 5AEAA 3BXNB 4GRWF 1S7UA 1TVBA 4PRPD 5IFHH 1YMMA 2XWTA 5DMGC 4QNPE 1UCTA 3JVGA 3C5SB 3D25B 4U6YA 4TNWF 5GJSL 3BW9A 4ODHL 1VKXB 3GK8L 3MMEB 5CBAB 1AC0A 1AGBA 3C87A 4BZ1L 2VLMD 4LHJB 1KCVH 2HKFL 5I66A 5IBUB 1NCAH 5IIEB 1CIDA 4E41D 1BZ9A 2ED7A 2YWZA 3P4MB 3V5DB 1H5BB 1T1ZA 2NY0C 4TSAH 5H94A 2FZ3A 2VDLL 1GVIA 4HFUH 4G7YL 4XPFH 1OTUC 3NA9L 4XWGL 3TF7C 2K7PA 4EN3A 2X2YA 4TTGA 4HWEH 3SE4A 4XBEL 2BSED 2VDKL 5EZLA 2D7MA 3U7YH 3PWPB 5GGUB 1PD6A 3ARDA 5GHWL 3KNBA 1QD0A 4ELMA 3FB7B 3BP7B 5F6HI 4X8JA 1P4LB 1JGLL 1RUAL 3BT2L 3KGRA 2EEDA 2OTUA 3NACH 4KY1L 3TH4T 1LD9B 4IRSB 3PWUA 3V8CA 2NXZD 3CFCH 3OX8B 1NCNA 2AJXL 3NTCL 1DEEB 1Y6MR 4XP1H 5C3TA 3SCMA 4BUGA 1JGEB 1YNKL 3FN3A 1HKLH 4JZJB 1JWMB 2XPGA 5CBEA 1VPOH 4GUPA 4CAGA 3FQTA 3IRPX 5DJYA 2R0WH 3FQXB 2HN7A 5FECB 4PGDB 5GSRB 2OJEB 2VN7A 3BEVA 3GSRB 5DR5L 3DX8B 3KXFE 2HTKD 2JCCB 2YSSA 2DWDA 3MNWA 5JZ7D 3G9VA 4LEXH 1V3MA 4O2EA 3ULVH 3EKCA 1VFBB 3OF6A 1M4KA 4HLZG 5CEZL 1SM3L 2CPCA 4LSUH 2VABA 3AY4C 3GJEB 4R6UA 5ANMB 1INEH 3SDDD 2YD8A 4G8EB 3CMOH 4X6DB 4LVNB 4PG9B 2CIKA 4UT7L 4HK3J 4OZHA 1RZIA 5HGDA 4O51B 5GRJL 1U41A 4R4FL 3T3MF 1I9EA 4OV5B 5K9JH 1OGAB 3MYJA 4ZTOH 1JPFA 3WFHA 3S4SG 2YN3A 3RWIB 4H0IA 3AB0C 2WUBH 4C54A 3QPXH 5LXGH 3H42L 3CSYA 4CADB 4NKDA 5CD3A 4P2QD 5KSBE 4PRPA 4GRWH 3K4AA 1T2JA 2C7UA 3BP4B 3DVGA 3TVMB 2FO1A 1U8HA 3HS0B 2XWBA 4AYFA 3SBWA 2FJHB 4BM7A 4DGYL 3CLEL 4KI5C 5D1QB 4E41A 5KVEH 3QUYD 2CQVA 1N5AA 3RPKA 2B2XL 1MCFA 5DVMA 4PGBA 2ZG2A 4X7CC 4I0PC 3DNKA 1YEHH 4TVPL 3D39D 1TETL 4F15C 1F90L 4QRSB 3JWDC 3T4AB 4QLRA 2HT3D 5MENB 2YR3A 1NFIA 4NCDA 5DA4A 5EU4B 4QF1B 2ZJSL 3BP5A 5HYIA 3X12A 1UWEH 4TRPL 2QV2A 2EDFA 3MX0A 4XP9L 1G6RH 1WBYA 2E7CA 3ULUE 3OB8A 4KKCD 2SEBB 2GEEA 4JGJA 1UKTA 1X5IA 3IXAB 4KRPB 5EIVA 4U7KA 3O3UN 4K7PL 3M8OH 1BFTA 2CLVB 3HI1A 3RVWD 2XN9E 4YHIB 3RKDC 1RZKL 1LEKB 4QGYA 4JJHA 4XC3H 3DO7B 3DTXB 2VDNL 4U1IA 3G6JA 3PGCA 3QEGL 4RGND 2P7TB 3O0RH 4Q9QL 2K3TA 4WI7A 3A67L 5IHBA 2KUTA 2XTLA 4EDWH 4KJWD 5FK9B 4G42A 3SJVD 3BPLC 4MA1B 1HOCB 1CICC 5T3ZH 2PUQT 3PHQB 2C1OB 4OKVA 5SWZE 2B1HH 2IFFL 4H20L 5BQ7B 1CR9L 1Y18A 2AK4B 5KSUA 3D69B 4W6YB 1CTNA 4XP6L 3EZ8A 1QBLL 1AY1L 3MJGX 1J88A 5FYJU 3LKSA 4HBCH 3TV3L 5JHLL 2XZZA 1A0QL 3SDDA 3F12B 4JHZA 1MHHB 2A9NL 1HQRB 3LCYA 2AABL 4RBPK 5I1DA 3ZKQD 2P8PB 3TZVB 1JBJA 1T04B 4NHUA 5I1LA 3S6CA 3GZKA 1CXHA 1CFTA 3VRLF 1JE6A 2J6EL 3DGGA 3X11B 5H37H 5JA9A 5JXAH 1D6EA 3OKMB 3SGJC 2GUOA 4YHZL 1O5DT 5E8NB 5FCUH 1KJVA 5HD8C 5GGTL 1OT2A 5F1KC 5C8JB 1OAZL 5LGJA 4KK8D 1OTUD 1CS6A 4H0HB 5C0ND 3T2OA 4M1CC 3WIIL 3U30B 4H8WC 1WFUA 4G43A 1FN4A 2XV6B 2O61B 4P2QA 1NGWB 4UQ3B 4XAWL 5DRWA 3F7QA 4K07A 1RIHH 3UDWA 3UTPD 4O02H 4Z7VA 4PJEF 2R2HB 3QUYA 3MZGB 1CGSL 2ADGA 2EDEA 5F7NC 3D39A 43CAA 3ZL4H 1JZ4A 3O6MH 3EO0B 4OUUB 2ICWA 5K9KB 3FO2B 4ONHA 1CE6A 3FRUB 3K2MC 5DD3H 3STLB 4CW1B 1UWXH 2DN7A 4LKCA 1ADQL 4LNRA 4OIAA 5DSCB 3PGFL 1UCBH 4K7PX 5ICXB 3PQYD 3T65B 5E24E 4WI4A 5TFSL 3UTQA 2EDQA 4KROD 5GSVA 1NLBL 4JFDD 1JFQL 3L3GB 3OJVC 3LN4B 3FN0L 1G7QA 2PR4L 1OB1A 5K9OA 2AS5M 3IFOB 3Q3GA 4WI9A 1OAUL 1Q0YL 4JY6B 1LGVA 3ARFC 1CVSC 3UTSB 3V4UL 1VFOA 1JWUA 2AJYH 5TDPA 4X9FA 2N7BA 3BDXA 2FH6A 4FQXC 3MRIB 2YD4A 4HS6A 2D0HA 2OP4L 1ORQB 4JN1H 1KELL 3SJVA 2GFBB 3CXHK 1J1XL 2ICEB 3LS5L 3KPPB 1IGTB 3REWB 2OMNA 1A6TB 4GQ9L 4UNVA 4CGTA 5C0IB 1MQKL 3MLVH 1OQXA 4UOW1 3QDJE 4LLUB 4MA7L 3PJSA 5SWSB 2F5AH 3FCTA 4FQQA 4MVBD 5IG7B 5JOEA 1G7JB 5AZEH 5J13C 7CGTA 4UTAL 3FZUC 4JJ5B 5MERA 4UI2A 1U8QB 5A3ID 1MCCA 2P5EE 4IS6A 2DD8H 3CDYA 1MHPL 4G8IB 4JFHD 4XXDA 1MCOL 4KI5D 4CVZB 3MUGB 4XHQA 3VGDA 1IGML 3P3YA 4XVSH 3GKWH 4YDKL 2QQLH 4M7LH 5E7BA 3DBXB 4HS3A 1YNLH 3WL9B 2KQMA 5B8CC 5EOCL 2FEEI 1KOAA 5T1KD 2BY1A 1MCDA 1A7OL 5KVGL 1MFAL 1CTOA 1UXWB 2YA1A 2L0DA 5ESQA 3EO9L 1JGUH 4Z7UA 1GHFL 3MGAA 2CO6B 4Q9RH 4ODVL 5KG9A 1ZANL 4KTEL 1BIIA 2PTTB 5CZVH 1YMHB 1DLFL 4ZDHB 4QRPD 2A1WH 4S10A 2X05A 1JNHB 5AZ2L 3RKDD 1G0XA 1CT8B 5FIEA 4Z0BL 2F5BL 2ED8A 4KK5D 1N59B 3A6BL 4XPHH 4JRXE 3NIDF 4JR9L 3BEWB 5C7XL 1EEYA 3OBAA 1K8IB 3OGCA 4PJIB 5J8OA 2Q8AH 4RA3A 3DXAB 4OLWL 4PJAF 2A74B 3VFWB 2UVFA 4PRNA 5D8JL 5ESVB 1R24A 5ETUA 3PQYA 5GISH 1FZJB 1UJ3B 1V3KA 1Z9OA 4JFDA 4PRPE 3MTRA 5IB1B 4NQCD 5FF6A 1I1FB 3ILQC 2VKWA 5F1IB 2VLME 2OQJB 1S9WA 4LIQE 1N8ZA 4JQXA 1F45A 4TNVK 3TJHC 1RIVL 1YNTB 1QLRB 3MNVA 5C9KA 3UTTB 4AM0A 1P84K 1G7LA 1JF1B 3IJHA 1ZT4A 5L9DL 4NKIH 3UJJL 5IEKA 3HR5A 5F9WB 3RGVC 1FSKC 5BW7C 3EYSL 5F3HA 3VGAB 2DQCH 5FXCH 3I75B 1BLNA 3QI9D 5HD8D 5IVXA 3MFGB 4PS4L 3EO1B 3GIVB 4FQ1L 1FVDA 4NZRL 5D5MB 1NGPH 3I84A 5LCVL 4WWID 3IS1X 4IEFB 2ZUQC 5FKAA 4WHCA 2NXYB 2VLJD 4ZG1A 4GBXB 5IFAH 1DLHB 3GMMB 4LFHG 3MV9E 5DEZA 3E6HB 3LRGA 1OOAA 2C1PA 3AVEA 1FORH 2HVJB 3G6JE 1P7KA 2OK0L 4X80H 2F74B 2VO5A 4NSKB 3O9WC 1EMTL 1XZ0A 1NAMA 2QLVB 3CCHB 3E0GA 4K94L 4X5XB 4DK6A 3PHOB 2W65B 5T1KA 2D03L 1U58B 1CDJA 2IPUG 3ZSTA 1DQDL 3WUZA 5DJDA 3FT4B 2KZWA 4FFYL 5JHDB 2R4SH 1U6AL 4QXTA 4JM4H 2H6PB 3L6FB 1UACL 4HF5H 1TFHA 4N90D 4QRPA 1DQLL 4DJMA 5HVHC 4MGXA 1AGCA 3PL6D 1QFWI 1LNUB 2AV1A 4HMEA 2ARJA 1M71B 1T5XA 5J6GB 1TIUA 3UJTH 1UYWL 5F7WC 3GJFK 4XVTH 2CDFB 2NQCA 4J3WA 5FYLL 3X3GH 4TUJA 1SHMA 1W72L 2J2ZA 3BUYB 1HDMA 4FQXD 1QSFB 4HLJA 1MJJA 2IH3B 4NRYA 5L7XH 3CDGB 3DYMA 2IBZY 3G5ZB 4XBGA 4M03A 4UNUA 5CINH 2WQRA 4U1NA 4LSQL 5DJCB 1I1CA 4NZUL 1T21A 1KN4H 4HT1H 4Z18A 5IW6A 3QAZB 4N5ED 2Z35B 5EORL 1HXMB 4NQCA 2NY4B 5I16A 4L9LC 1XGYH 4WW1A 3FFDB 4FFVC 4JFQB 1KB9K 3QPQD 3EZJB 4YPJA 2DQEL 5TH2B 1FZKB 1I3GH 3SN6N 1IBGH 4R0LA 3PV6A 2H8PB 3ILPB 2DLIA 4JHAH 1JHKH 4RGOL 5IKCB 2WK2A 4P4RB 3ULSA 2X6MA 5SWQA 1AQDA 5C0JA 1CXKA 3QIUD 2BOBA 4ZPTB 2VIRB 1KACB 2F54D 1DZBA 3QI9A 3SE8L 4EXKA 1JYNA 4KH2A 5KVFL 4MAUH 4DGVH 4S1SH 4G6FB 5EPMB 4QHMB 1RURL 2DWEA 1TTUA 5ISZB 3BVNB 3VFTB 5H2BB 3RWJA 1EEZA 2J8UF 1YN6A 4YE4L 2H45A 2VLJA 4LDEB 3MRQB 4HPOH 4JHBA 4PJ8B 3FOLA 4XVJL 5CJXC 5E2WL 2LVEA 1OAQH 2O93L 4OF6A 3E8UL 4Z95L 5IBTL 4QTIH 5D71H 4TSBL 5B39B 1PZ5A 3R8BB 3GSNB 4GH7B 1FGVH 4XXCA 2GJZB 2ZOKA 5C0RH 2YRLA 4Y4HC 4MNHB 1NEZB 2ZP0T 5IFJB 4XPBH 4TPRH 4XZUB 1I9RH 1TQCB 4Z77B 5C0AE 4X4YA 3HG1B 4X7TA 5DD0L 2ICCA 3C6LB 3LD8C 5DJ0A 3T77B 5I6XB 2R1WA 1KCVL 2MSPA 4Q97A 3NZ8B 3HCVA 1KPRB 1C12A 3CSGA 1TCMA 2QKIB 1HILB 1S8DB 1A6ZA 4TSAL 3BKMH 1N2RB 4ZSOE 3ARBC 3PL6A 4NBXB 3SDAC 4XPFL 1XR9B 1MRDL 1YYML 4ZUTA 1T3FA 2XRAH 3CXDH 4AEIL 5CEXA 5HYQB 3DETC 4OCRL 4MB5A 1ZLSH 3MJ6A 1ZA6B 4KXZI 5F7DA 4FQXA 3QQ4A 4J3XA 1H3PH 4NQVB 5DC9B 2DQIH 5J9PB 3U7YL 4OSUL 5FGBA 1F00I 3WIFA 1U8NB 1EJ6A 2NY3D 3P0GB 1IKNA 3RU8H 4AL8H 3CFCL 2V7NA 3RZCB 4X0KA 5JNYA 4PR5A 1F4WL 4XP1L 3V0WH 2VR4A 5EO1B 3ZKXC 5FA3B 1HWGB 1HKLL 4EVNA 1QTYT 1DBJH 3ES6A 4U3CA 5KSBF 1BP3B 3CC5B 1G7IB 2OL3H 3BJLA 2X09A 2EKSA 4F7MA 1E4JA 1DEDA 2E9JA 2HMID 5CZXC 3DMMC 1JN6B 3MRBB 5GS2H 3MRKB 3WDJA 3CFKB 2AEPH 1RULH 1T2QH 2QL1A 2G9HB 3QIUA 5EC2A 2FD6L 3L5WB 3REVA 4PJBF 1TNNA 2F54A 5KS9A 3HC0A 3WNLA 3QG7H 4K7FA 3ZTJH 1MCQA 5HHMD 3CMOL 5L2KE 3NAAH 5D2LE 1IFHL 3QQNA 1S78D 3K4ZA 4U2ZA 2EC9T 4XNMB 2EYTA 5ABDE 2DTMH 3PV7A 1OM3H 5K9JL 1WAAA 3O8XC 3V6FB 5T3XH 4ZTOL 1GC1H 1EJOH 4OLVH 4UB0H 2G5RA 3HB3C 1S7RB 5D2NB 1C7SA 2FHCA 5LXGL 4A6YA 1NQBA 1G9MH 2P49B 4P2OB 1ZA3A 1KTDA 3VXUD 2R2BA 2FNBA 1BBDH 4X9GA 3OKNB 4I1NB 4Z7NE 3IYLW 2NW3B 3L3HB 3LDBB 4JRWA 1EEQA 5KVEL 5EU7C 5J06A 2EXWC 2UY7A 1YEHL 4NJ9H 1GAFH 1A14H 1WWBX 4EUPG 4ODWA 5DLMH 4F7EB 3SKNA 1FCGA 3O2WH 4XTRC 1AGFB 3KPLA 1UKSA 3MA7A 5JDSB 1HEZA 4XCYB 4FFVD 3R06B 4ZFOB 2OTWB 3MCKA 4KI5E 3T0EC 3ARTA 1UWEL 2CRMA 1G6RL 4P4KB 3AU1B 4Z78B 3WBDA 5J1AB 3T4YB 3IT8D 1ZLWH 3T2NH 4HIXL 1IAMA 1AR1D 3M8OL 3FB8A 1IEAB 3KPRD 1I1AB 1KEML 2WINA 2F8VA 3JWOC 3MRCB 4HIHA 2ZUSA 3QO0A 4XC3L 1RZ7H 3KWWA 4JCLA 4QRTA 4U6XB 5IW1A 1KLUB 2BMKB 1A7RH 1B0GA 3O0RL 1OAXL 2L4OA 3OXSA 3WLWD 1LO2H 4PLKC 4BFGA 1TJGL 2LU4A 2FEEL 4BZ2L 3LSOA 2J5LC 5DRNB 4IDJH 3LRSB 5I2IB 3PP3K 3O6LH 1EGJH 2B1HL 3P30H 4U1HA 3W0WD 1FL6B 4PTUA 4JHWH 2VXVH 3S88H 5L2JA 1I7ZB 1KGCE 1EFXD 2W0PA 5KVDH 3CLFL 5J3HD 1VFMA 4M7LT 4NKMB 2I07B 4HBCL 4JKWA 2GIYA 1J0HA 5SX5H 4Y2DC 3ROLA 5CEYA 4H1LH 1WBZA 5HYSA 3L3JA 4IHOB 1KJMA 5LGHH 4B50A 3C09C 5ITFA 3AREB 1E27B 4YBQC 1JPGB 4Y2OA 2XACC 2RAMA 3PDOA 1YYLL 1WGOA 4APQC 4I48B 2D7NA 2ZOLB 1WLHA 2ITDB 3F7YB 4WENB 4PRBB 4FQIH 4JREB 5FCUL 2YBRB 3ARBD 1JYWA 4MD0A 2E7LA 3VXPA 4JVUA 2CMRH 1U8JA 1H8SA 5EOTB 3GIZH 4HJJH 5K93A 4NN7B 3DETD 2BJMH 4PJXA 4RCAA 1J8HE 1X5ZA 5D72H 5ICZA 1R5WA 3VXUA 1QFHA 5EO0A 3PXJA 2UZYB 1RIHL 5D70H 1J0YA 1G7PA 3KVQA 3RTQD 2JK5B 3UCRA 3LQAL 1RZKC 3OKEB 4AEEA 1Z9SA 3VGEA 4DCQA 1YEDB 2KBGA 4ODBD 2DL9A 5C08E 2CK0H 3ZL4L 3NIGE 4MJID 2KH2B 4OCSL 1KIUA 2IH1B 3TCLA 4ELMF 1C5DB 1MLBA 1AHWC 5EN2A 5DD3L 3TBVA 4OBSA 1YUHB 3CFIC 3IDNB 1UCBL 2IGFH 4I4WB 2DYPB 5K9QG 1MIEH 4LARH 3DVNB 1MPAH 3KPRA 4P3WA 4CVXB 4ZFFA 1ZVHA 5EU5B 4KZEH 4IDLA 2RHEA 1W8NA 3BYTA 3M17B 4L5FH 4WRLA 5AYUL 1XF1A 1VFAB 4K55A 5FKPA 4NT6A 2AJYL 4D94A 1W8OA 2ORBH 1KFAH 4KTYA 3TN0B 5JOPE 2A6DB 4WHDA 5DDHB 1AD9A 5DT1H 1KPUA 4F7CB 1LDSA 4KKAC 2C3VB 2BRRL 1G7MB 4EI5B 1ZVYA 4D0BA 1BOGB 2COQA 5IMOB 4KQ3L 4XX1E 3W0WA 2XY2A 3MCLH 3UZQA 3MA9H 1K4CB 2F5AL 3DV4A 2FRGP 2OLDA 1EFXA 1WUNT 1RZFH 3B8SA 4NQXB 1A9EA 1ZT7B 4YLQT 4OCNC 3T0AA 4OZHF 3GMNA 1GGIL 3IVKA 2IMNA 1AXSA 4V1DE 1KCLA 4RNRA 4I13B 5F9JA 4NO0B 2VAJA 1H3TA 4FHBD 1YY9C 5CGMA 4R26L 3CDCA 1IAOB 5KSVB 2R9HD 4QWWC 4XVSL 1LK2A 3GKWL 1I8KB 4JDZA 4L4TE 2QQLL 5C0FA 1HI6B 2ZPKL 1F8TL 3H3BC 3QJFA 1R5IA 3QUXB 3BN3B 4IM8A 4M7LL 1DJSA 1YNLL 4Q2ZA 2OCFD 5E6YA 2RFXB 3ARBA 1J1PL 2GTZA 1IM9D 1M05B 1H5BC 4S1RH 4XCNB 3CVIH 3VWJC 1NFDA 4Q6IC 2BFVL 3CXHJ 2VL5A 2VITB 4Q9RL 4R90H 2AXFA 1U8LA 1JPSH 3EYQC 5CZVL 2F54E 2VE6A 2A1WL 2A6IA 4YXKL 1K3ZA 3RTQA 4OFDA 3WHE0 4OFKA 2NY6B 1MI5E 2F53E 3P4NA 2B5IB 1KIQB 4P9HH 2N7AA 2JB5L 4XPHL 4KJQC 3TGXA 4WJ5A 4MJIA 3QNXA 1CG9B 2X40A 5C0GA 2Q8AL 4PJ5B 4MWFA 5KANI 3H2WA 1WBXB 3OXRB 3V7AE 1C8PA 3KLAB 1DANT 1FO0H 3G6JF 3WE6A 2GHWB 4LPYA 4LCCA 3ZT5A 5JMRA 3ARGC 4ODSH 4C83B 2OL3B 4C4KT 4L3ED 4ERSH 1KT2A 3UBXA 4HIIA 2AJ3A 1U8PA 2ATPB 5GS1B 1TCRB 4XCEA 4HKXA 3IDJB 2UWEB 4N9GA 2MMXA 5CUSH 1D9KD 4RMRA 3STZB 1QHOA 3NFPB 4YBQD 1RJYA 4LGPB 3BGAA 4I2XB 4X4XB 1XIWD 4NKIL 4R8WL 3VFSB 4HHAA 4LSVH 3DURA 4MA3A 2A6KB 4TVPD 5DUBA 4UIKL 4IRZL 3U2SB 3G5YB 4X98A 1T03H 3UX9B 2ICES 1CLYH 3NCJH 3MRLA 5BZDA 2J88H 3MREA 4WUUB 1NGPL 1Y6KR 2E7HA 3LKRB 5I73C 3IFPB 1UM5H 5MI0B 2V2TB 4G80A 4NUGH 5IFAL 2OXHA 3OB0H 3QUZC 3EOBA 3GNMH 4D2NA 5IOPB 3VFNA 2DQGH 2WIIB 4MS8C 3TFKC 4BFIB 2NY5H 3WN5B 2VDQH 2BVEA 2W0FA 3N1FC 2IF7A 4N8PA 3KLDA 3B3IA 4OGXH 1OLZA 5FHAH 3WCYA 4N8VB 4OZGE 3Q48A 2QEJA 5ILTH 1IM9A 5E8OA 4Z76B 4UV4H 2W60A 3T0XA 5A16B 3QNYB 1P84J 3K81A 1HXYA 5FO9A 4WEUD 1S7TA 2UV3A 4Z7VF 4XCCH 4PRHE 5CZKA 1QSED 4J3UA 4L4JA 5HPMB 4JM4L 4HC1H 4EI6B 3JXAA 3QRGL 1FE8H 5ADOH 1KLGA 1CLZH 2EH7L 5B22A 5D4QA 5IUSA 3BOVA 4X6FB 2YD9A 4GW4A 4FTVD 2VLLB 4UQ2B 1KJ3L 2VISA 3GKZA 5HHME 4WGVB 3KJ6H 4K2UH 2JELH 1A6VH 1MJUH 1S9XB 3QUMA 3UJTL 1EH9A 3BRGC 4XVTL 1T7YA 5AAMA 3KR3H 3MXWL 1QP1A 3X3GL 1BJ8A 1FL3A 3RWCB 4LLYA 4OF0A 3B5HA 4U1MB 1A22B 4WNQA 4HWZA 5L7XL 1LE5B 2ZSVB 2VLRB 4DKEH 2KZ1B 4NM8H 7FABH 3K8KA 3TO4D 4HZLB 1ZS8A 2WBKA 1I7UB 3KJ4B 2AEWA 1KN4L 4HT1L 4M5ZL 3IFNL 1RJZB 4LF3B 3S34H 1TXKA 4KHTL 1ZT1A 4L3EA 1TPXB 1S7QA 3MV7E 1XGYL 5BOZG 5F3BA 4X5WA 1UB6A 2UUDK 5J12C 1A1OB 4X99A 3VFUA 1D9KA 1IBGL 1T7ZA 5IVZB 1T1YA 3DUSA 3IAPA 4DWHA 3L7FA 1JWSA 4B7LA 4BKLA 2VXQH 4Y88A 5D6DC 1PBYA 1XIWA 4EDXA 1MCIA 4JFXB 1YY8B 3U4AA 4K94C 3R0MA 4M43H 5FYJH 2AXGA 5M95B 1DQMH 2NNAA 1ZLUH 5HDQH 2C4FU 3C8HA 1IAIM 4ELKB 3IU4H 4MAUL 4DGVL 4S1SL 4WHTB 4CNIB 5IEHA 2Z8SA 4OZIE 3F58L 5DUML 1QEWA 3N1PC 2AV7A 5D7IA 2R2EA 4GAFB 4HK3N 3KPRE 2YD6A 3JTTB 1A3QA 1RAMA 4HPOL 4NN5C 3U30C 1HQ4B 2YPLE 5F7YC 3TIDB 5F93C 1FNLA 1OAQL 5IMLB 4QCIA 1QO3A 3ZE1F 4QTIL 5BRZE 1IGYA 3BIKA 3P9MB 4MSWA 4KKNA 1FGVL 3PWPD 1KB9J 32C2B 4Z7UF 5A1AA 4RISH 5HHNB 5C0RL 4JKLA 5EZJB 5DI8A 1A1MA 2EYSA 4JFYB 3OKYA 1Q94A 4TPRL 1NMCC 2Z91A 3BRDA 1CF8H 3DUHA 4IRSD 1G0YR 1MCEA 2JB6B 5CIPH 3TO2A 1CCZA 1GJIA 1KYOK 1MQ8A 4CUCA 2VR9A 1QSEA 3UPRA 4PPTA 4NFCA 1H9VA 4JDVA 2PW2A 1GOHA 3INUH 4XB7A 3TNMA 3ZMRA 3GM0A 3ARGD 3BKML 5C0CB 1X5KA 4FTVA 3HRZA 4HKJA 3RBSA 3GI9L 1QLFA 4Y1AE 4Z7QF 4Z7WA 2XRAL 5C6PB 3HLAA 4LRIA 3RFZC 3MRRA 4OLZH 3TBSB 2AJVL 3QQ3B 4EBQH 1UC6A 3BI9X 2E6QA 3E2HC 1MFEH 5JTWA 1H3PL 2A73B 3EDKA 4QT5B 2ENYA 3GSXB 1MREH 3VI4F 4B0MM 3WYRA 4YNYA 5DQJB 1F11B 1PYWB 3TO4A 3GSQA 4KV5F 3S37H 1Q72H 3MLRH 1L7TH 1MY5A 2VDPH 4BSVB 1SYSA 3RU8L 4Q7DA 3WKNA 4LEOA 5BS0E 1A02N 3BO8B 1W0YT 2GAZA 1SMOA 1OGAD 4C58B 4AY0A 4FXKB 1CFQA 2HJKB 4QXUH 4YXLH 3CSBA 2OL3L 5FHBH 3C6SB 5IVXF 4UU9B 1KCRH 3C5SA 3TVMD 1XGRB 1VKXA 3MMEA 5JR1H 5CBAA 4MJIE 2AEPL 1RULL 1T2QL 1VESA 5KAQF 2MHAB 2MJWA 5D1QD 1D5IH 5IIEA 5ID1B 3P4MA 4XVUC 3V5DA 1TZIB 3WJLC 3LEXB 1H5BA 2ESVD 5SX4I 4OM1H 4KI5F 4X6BA 4PLNC 4MNGB 4JB9H 3WO4B 5MEND 4ZS6C 3ZDXF 5DMIH 5I71B 3KYNA 5I18H 1EV2E 4DKFH 4DZBB 2DTML 1A64A 5T3XL 2X10A 1EJOL 4KRPD 4OLVL 3C60B 4UMGA 3PWPA 5BXFB 5GGUA 2Y1VA 3ABZA 5I15L 3FB7A 3VXSE 4TULL 1G9ML 3BP7A 3GSVB 1P4LA 4JO3L 3RUGB 5DRXB 2Z31C 1LD9A 2QADB 4LHUB 4IRSA 3CFJB 3OX8A 5IVOA 1IAIH 1DEEA 1SEBB 4YX2H 3OAYH 1JGEA 3MCG1 4KDTC 5ID0A 1N64H 4JZJA 5ACMA 4G3YH 1JWMA 4NC0B 3WDHA 4NJ9L 3CZFA 4AENB 1GAFL 1A14L 1CGVA 3ARGA 5DLML 3FQXA 3P0YL 5FECA 4ORGB 1MUJB 1JHTB 4PGDA 5GSRA 2OJEA 4R4BA 3O2WL 3GSRA 3NFSH 4IOIB 5C2UB 3DX8A 4N0CC 4GO6B 1FO0B 4M6OL 1RZGB 2AK4D 2Q87A 3PXHA 5EU7E 1VFBA 3WJJC 4YEFA 2CDEB 3MOQA 3GJEA 5ANMA 3C2AH 3T2NL 2XTJB 4P2RD 1T7WA 4U1SB 3NZHH 1LO4L 2CKBL 4G8EA 1MWAB 1RVFL 5JUEH 4YXHH 3TZVD 1F5WA 3T0EE 2CUIA 3WLBB 1RZ7L 4O58H 1TENA 4O51A 2IAMC 2I26N 1LO2L 1KUMA 4D9QE 4OV5A 1CL7H 1MF2H 2X4UB 1VADB 5CP7B 2X42A 3D87B 4OZFH 2HJLB 4Y19E 1OGAA 3MNZB 5CEZE 4L29A 3RWIA 1MEXH 2AI0H 1I85C 2PO6B 3O6LL 5JPMB 3BPCB 1G9EA 4M4PA 5DEFB 4BK5A 5TGBB 1EGJL 3QIBB 1GOFA 1PEWA 5DO2C 3BP4A 1T7VA 4JHWL 3TVMA 2VXVL 3G6AB 3HS0A 4MA8H 4U49A 3S88L 2MPAH 2ICWI 3BGMB 3MJ9L 3V4VH 5D1QA 3R1GH 5FYLD 2DKMA 4LL9A 4HX1A 5DJ8B 1FVEB 2B8OT 1PFCA 1YDPB 1JNLH 5HY9A 1K8DB 1EPFA 5LGHL 2ESVA 5GJTL 2GKIA 4QRSA 1KTLB 5MENA 1NANI 2Z8VC 5EU4A 1MY7A 4L3EE 1EXUA 1B2WH 4FQIL 1UXSB 5I9QC 4MD5B 3GMLB 2BRQA 3O41B 4PTTB 4MJ4A 3B2UD 3IXAA 4KK9C 1BJMA 4MXQC 5CMAB 2CMRL 2P42B 1AO7B 2CLVA 4HJJL 3RDTB 4NPYB 5TF1H 4YHIA 1FYTB 3B9EA 1F4HA 2BJML 3NGBB 5I8EA 3I6LD 4ONGH 4TVPE 1LEKA 3DO7A 1C5CH 3QNZB 5D72L 1XAUA 3QXVA 3HA0A 1ZGLB 1VENA 3UTSD 2AEIT 2P7TA 2FBOJ 4POUB 5E9DB 3EFFB 2MQCA 3E3QC 2RCSL 5D1ZB 4BFBD 5D7IE 2FIRT 5FK9A 3MLXH 1HOCA 3D0VB 5DZOA 2CRYA 3S4SB 4WW2B 3PHQA 2C1OA 2GJ6E 4M00A 1MAMH 5F6IB 1HSAB 1FLTX 3WKMH 1YQ2A 5BQ7A 3VXME 4L8SC 5SWSD 2A0LC 2AK4A 3HZMB 4X6CB 3D69A 4MCZB 3PG2A 5IB2B 1QG3A 1T80A 1XGTB 2IGFL 2BY3A 3PUCA 5MHSE 4MNQD 4P2RA 1MIEL 3F12A 3KLHD 3DYOA 5D6DA 4LARL 3JTSB 4RFNB 4HV8B 1MHHA 4OI8A 1HQRA 4XWOD 2O5XH 3I9GL 1I3UA 2P8PA 4OD1H 3I02B 3TZVA 1T04A 4PJ7E 4G5ZH 1OAKH 4L5FL 1OF2B 4XVUD 3X11A 4FQHB 5DFVD 1JRHI 4RAVB 3DWTA 3OKMA 1KFAL 5E8NA 1E28B 1IAII 1PQZB 2YPVH 1SJHB 2B39A 4HUMB 5C8JA 3S35H 4FTVE 5DT1L 5AD0B 3P11H 1E6OH 5DXWA 1BZ7B 1GXEA 4Z7WE 1L0XA 1X6NA 3ELAT 4U1LB 5KS9F 4ZPVB 3MV8B 2O61A 2BVOB 4UQ3A 1JZ3A 4LPCA 5D7LD 3V5HA 3MA9L 4I18C 1RZFL 5ITBL 3BP6B 1LO0H 3OKDA 2R2HA 5HGAB 3EAKA 4XNYL 2BNRB 3H6JA 3T2QA 1V3JA 5D96B 1KXTB 4PBWD 5GGVH 5IHLB 3MRGB 5GGRA 3LQAC 1NUGA 4J12A 2ID5A 1WAAF 4QOKE 5GGQH 1SEQH 4Q9BA 2CKNA 3FAXA 2E8YA 3KS0J 1Z2KA 1QHPA 5K9KA 3FO2A 3DXAD 3FRUA 4U1KB 4DQOH 1BX2B 1L6ZA 3LZFH 3STLA 4CW1A 5CIPB 1RPQA 3BMVA 1CL7I 3L5JA 4L1HA 5ICXA 3T65A 4DGIL 4N0CD 4RMWA 1BOYA 4S1RL 3L3GA 3LN4A 1MJ8H 5GZNC 3CVIL 2CLRA 2QSVA 4C59B 2J4WH 1T0NB 4U3HA 3IFOA 2MCPH 4L3AA 5K59F 4YBLB 2MCG1 1FNSH 3D3VE 1OP9A 4HUNB 4Y4FC 3UTSA 4F8QA 5HDBF 3HZKB 5L8LB 1DSFH 4GKZB 2WBJC 3ULVD 3G08B 2GTWB 4MQXC 3VFPB 3MRIA 4G8GD 3V0VB 4YFLF 3VH8B 1F13A 2EIDA 3ZHLA 1ORQA 2IAMD 1WZMA 2IQ9H 2ICEA 1G6VK 2DQJH 3ESUF 1IGTA 3KPPA 4JLRB 1BFOB 1OT1A 1TJIH 1A6TA 5C0IA 1FAIL 4A2LA 4YIQB 4XX1G 5SWSA 4URTB 3RZCC 1PX4A 3QDHA 4HXAH 5IG7A 2OMBA 4G9FD 4JJ5A 1UZ6F 5LBSH 1UGNA 4HH9B 4JFFB 1TLKA 4GBXD 4LKXB 4MNQA 3TT1L 1MNUH 1U8QA 2G60H 3CIQA 1CQYA 4ODSL 5GGSB 4G8IA 4NO5B 2ZUXA 4OZ4B 4ERSL 3FOMB 3MODH 4CVZA 3MUGA 3D2UD 4YHYC 4OLUH 3F7VB 5CUSL 3S5LB 4JEGB 5ERWB 5C2BL 2V2WB 3DBXA 3QIWC 4CMHB 3WL9A 2MKWA 2Y06H 2B4CH 4UDUB 4LSVL 1UXWA 5HXMA 3CVHB 1T03L 5JHDD 2V5SA 2R0KH 35C8H 4W4OC 5D7LA 1UEYA 3FT2B 2J88L 2PTTA 1EAJA 1YMHA 4ZDHA 3U9PH 3KHOA 5ANME 4YWGH 5CGYC 2HFGH 3MLSH 1UG9A 1JNHA 2CK2A 3RWDB 5IMMB 3OMZA 1EO8H 2Q86B 1O7SA 3SKOB 3GNML 4TUKL 1MH5B 3DV6B 2BDNH 2DQGL 2XNAB 3B6SB 1N59A 2FYYB 3BEWA 2LTQC 1FH5L 5FGCE 3VJ6B 1QSFD 2HH0H 3BSZH 1K8IA 2NY5L 4PJIA 2LABA 4FN0A 4NN6C 2QQKL 3DXAA 2NTFB 2A74A 3B9AA 3VFWA 1ETZA 4OGXL 3BFOA 5FHAL 4A6YH 4PJXF 1X7QB 1RJCA 2JIXD 2PW1A 5ESVA 4LPXA 4OCLC 1DDHA 4UV4L 1FZJA 3V7AG 2NMSA 1QBMH 2Q76B 1GRWA 5IB1A 5T3ZD 2NY4D 4XCCL 1I1FA 1J0IA 5I19H 1U3HB 5F1IA 3O4LB 4KKLC 4HC1L 1WCBB 4GFTB 1RK0B 1FE8L 3MACH 1CLZL 2IADB 1MRCL 3P0VH 2BP3A 5EA0H 3C2SA 4XI5C 1YNTA 3VA6A 1QLRA 1H15B 1X5HA 3QSKB 4G8GA 2ESVE 3KJ6L 4K2UL 2JELL 1A6VL 3RI5K 4I0KA 2FX7H 4POZD 5ALCH 4CN6A 4NC2B 2IAMA 4XMKH 4ZS7H 1FDLL 1I8IB 1K4DB 1IGFH 2P44B 4W81A 4X7EC 1N6UA 1F42A 3HC4H 5D7JB 4M62H 3EO1A 1K2DB 1NGXB 1Q9LB 3L5XH 4G6FD 3GIVA 4ODTH 4DKEL 5ISZD 5D5MA 2EICA 4XNZB 4NM8L 2VB5A 4N8CH 5DTFB 5CS7A 1NGZB 3Q5YA 3D9AL 4G9FA 4I3SL 2DLGA 4GBXA 1L4IA 1LDPH 1DLHA 5IBLD 1LO5B 3AXLA 1JHLH 4LK4A 3S34L 2APVA 5FO8B 2HVJA 2FGZA 2YC1A 3D2UA 2F74A 4NSKA 4JFEB 3LN5B 2VOTA 3L1OL 2A6JB 4TNWK 3CCHA 1OL0A 4X5XA 3SDXB 4JO4H 2R2CA 5C09B 4JN2B 3PHOA 4ZAKB 5E6IB 3MUJA 2XZQH 4NM4H 2VXQL 1U58A 4PBVC 3HG1D 4YC2C 3C6LD 4ZFZB 3AREC 3FT4A 4M43L 5FYJL 3HAEG 3UYRL 5JHDA 2AK4E 3W9EB 1NUFA 1TNMA 5I1KL 1EZVX 3IU4L 2H6PA 4HIEB 4LVOC 4JKPH 1ND0B 4LPTA 4P2RE 4NQEB 5DA0B 3U1SH 2HFTA 5GRUH 12E8H 1DQJB 3KPSB 1M71A 5J6GA 3BQUC 4C56B 2CDFA 4HUVA 1AE6L 2WBJD 3ZTNH 1I4FB 5FUCC 1HK6A 3BUYA 4GG6E 2JF1A 1QSFA 4JRYB 1ES0B 2IH3A 4JPKL 4P3CH 2XG5A 3CDGA 1HYSC 3HC3H 2IBBA 3G5ZA 4L3CB 5JDJA 1TZGL 4RQQB 4J4PD 4RISL 1NFDF 4NNYB 3ISWA 3QFJB 5BCAA 1U0QA 2JIXA 1INQB 1CF8L 2IAND 4J3SA 3VXOB 1EERB 4U0RB 4L8SA 4PLOB 1Y0LB 1X5JA 2Z35A 3RZCD 5D6CB 1BD2E 1HXMA 3FONB 3FQNB 1GH7A 1A7PH 5F7MC 5HI3C 1QRNE 4MHHG 5DJZA 2N1KA 3FFDA 4JFQA 2FO4B 2R1XB 4ZOCA 5FYLE 5TH2A 3OAUH 3INUL 1FZKA 1QNZL 5MEOB 4TSCH 1Q9OA 3IJSB 3QDMB 2H8PA 3ILPA 5IB3B 4QYOB 5BZWB 5F21B 5IKCA 2FH8A 4OB5H 4F9PC 1UWGL 1IL1B 1DQQA 1NMBH 4OLZL 3U4EB 4EBQL 3QIWD 2VIRA 2HFFB 4B41A 5IJVB 1VHPA 3ULUH 5EPMA 4QHMA 3H9HB 4DOHB 1MREL 4WDIB 3BVNA 5ISZA 5H2BA 5BOPA 1DQTA 2HAZA 3MLZL 4S1DC 3P73B 4BFEA 3S37L 4KQ4L 1BF2A 4ZUUB 3MRQA 2XKSA 1L7TL 2VDPL 3I6LE 1QFUL 4WWKC 3C5ZB 2Y72A 4OFYD 5D1XC 2QSQA 3RNKB 1U8IB 4IMKA 1KYOJ 5B39A 4K9EL 3GSNA 4H26B 4QXUL 3TWCH 1ZTXH 1FNHA 2GJZA 3V4PH 1S9KC 3SKJH 5FHBL 4P2OD 4MNHA 1NEZA 1U8KA 1DCLA 2FX9H 2FHFA 3H0TB 4XZUA 5IFJA 1KCRL 5L88H 3CX5K 4Z77A 5JR1L 3HG1A 2E9IA 4YFLI 4LDOB 3C6LA 5EO9B 2P8MB 3T77A 1A6AB 4PJAB 1EHLL 1ONQB 4MXWH 2R23B 4UV7L 3NZ8A 5JLZA 3H9SB 4OCXH 1KPRA 2QKIA 3O2DA 4HJGB 5J11C 1HILA 1S8DA 4NNPH 4HGWB 4MNQE 4N1CA 1N2RA 4JB9L 2E7BA 2DS4A 1XR9A 2NY1B 2O5ZH 3LKNB 5DMIL 3JWNC 5GS0H 4Q6YA 1YECL 5I18L 4KC3B 4MJ5B 4XNUH 1A6WH 4QY8A 3HUJA 3VMOA 5DWUL 2WBJA 3PWJB 1ZA6A 5GQBA 1U93B 3BKYH 4NQVA 3SO3B 5J9PA 1PDKA 1S5IH 4KU1A 4NOFA 4J4PA 1QUNA 1I1AD 2NY6C 4ZD3H 1JZ2A 4F58H 1X5XA 5CHNA 4YHPB 2EDNA 1JRHL 4KI1A 2IANA 4MAYC 1P7QD 3SY0B 1IGIL 3UP1A 3HNVL 3RZCA 2GSGB 5D7LE 1IAIL 5CWSB 4YX2L 3WFDH 5FA3A 4I3GA 4M93B 2VXSH 5HHOE 1RHHB 1N64L 1R3HB 3DX6A 4G3YL 1OTSC 3CC5A 2EH8H 1G7IA 5DJ6A 3TPKA 1QSVA 4OGYL 5EU6B 4NC1C 3MRMA 3CGTA 2P4AB 4ZOBA 3DVFA 2F8OA 3NFSL 2NX5B 1AP2B 5IWLC 1JN6A 3MRBA 1J1OH 5B4MC 4WFED 3MRKA 5JA8B 5B3NA 3CFKA 4I3RL 2G9HA 1BBJB 3L5WA 3QIWA 5T1DH 3C2AL 1BVKA 2XZAH 4WFGE 1V5JA 3QXAB 5M7QA 5DK0B 4WO4C 5JUEL 5DVNA 3S37X 3ARED 4PY7B 4V2BA 1FIGL 4O58L 1KJ2H 4XNMA 2OBGA 1GGBH 2FGWH 3H3PH 2R15A 1CL7L 2GY7B 2FEDD 1MF2L 4OFYA 1RUMH 1MHCB 4HEPG 4BA8A 3B4NA 3V6FA 4WTXA 1D6VH 1S7RA 4L4VD 4G8GE 2AI0L 4Y7MA 3T0VA 2CH8A 1LP9B 4D0CB 4P2OA 5ELIA 2AQ2A 4N1EA 1YPZB 1SVCP 4MA8L 1X5FA 3OKNA 5T33H 3L3HA 2NW3A 2BNQE 3V4VL 1G9MC 2NY2B 5D7IF 3IF1A 4Y5XB 4GKOA 2OZ4H 3V8OA 5E4EB 4G9FE 4HDIB 2FBJH