3NCCB

A human prolactin receptor antagonist in complex with the mutant extracellular domain h188a of the human prolactin receptor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
206
Chain Sequence
MLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDAGYWSAWSPATFIQIPSDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Independent Histidines, One in Human Prolactin and One in Its Receptor, Are Critical for pH-dependent Receptor Recognition and Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/hormone receptor
molecule keywords Prolactin
total genus 36
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2010-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nccB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nccB01
4M03A 3RY5A 3V4VL 1NGQH 4P59H 1CLYL 1U3HB 3JWDC 2VXTH 2FR4B 3LAFA 3CVHB 4M48L 4NJ9L 5IVNA 5IV2B 4DAGH 1MWAH 1E27B 4N0CD 3RVVC 2OL3A 3S37L 3TJHC 2ADFL 3RWCA 4DUVA 1SJHA 3SKMA 3P77B 2XV6B 4FN0A 2VXUH 1VACA 5C0EB 3LPGA 1Q72L 4FQJL 4JANA 4EDWL 3T4AB 5IVXE 4JN1L 2EE3A 1UCTA 1NL0L 2ARWA 3D69B 1HDMA 2OK0H 1DUZB 1E4XH 3HZYB 1SY6A 1OVZA 4JFFB 4OIIH 1NMAL 1WFUA 1K8IB 3GB7B 1F4HA 3SGEI 5K9QG 3QIWC 4PRID 2UVFA 4K7FA 3JV6A 5C08E 2QHRL 5DD1L 5DFVD 1IVLA 3H6JA 4BZYA 3EOAB 4WHYH 1LE5B 1MJUH 5ITFB 1UEYA 5GQBA 2AXGB 1FL6A 2FO4B 5EH1A 5GS1B 1ZE3C 4OF3A 3HAEB 2WANA 1CN4A 4WW2B 4Y4KB 5J13B 4OTXH 5T3XD 4HIEA 1F2QA 4WI5A 2VL5A 2DM7A 1HYSD 4OZIE 4ZQKB 4G8EA 3BUYB 5F88B 5KBNC 4GO6B 1ZHBB 4TUJA 1PX3A 1I4FA 5B8CC 1IBGL 2CLRA 1OW0C 1XF1A 3V7AE 4BUHA 2R23A 1NAMH 2VQ1B 2P49B 3KPOA 1H8NA 4NKOA 1BIIA 1F3RB 3CX5J 4OFPA 4GRMA 5I8OH 2BVYA 4Q0XH 1VHPA 3BWAA 3LRGA 4MJIE 1OP3K 1TITA 4MZ3A 1WWBX 2FEDC 3MRBA 3EFFA 2ICCA 5EU4A 2VXQL 5F6HI 1U41A 5F7MC 2DQDH 5F9WC 2WINB 1IC4L 3P9LA 2FEEL 4YXLH 4IBLT 3PL6B 4X0KB 1ADQA 2AEWA 3MV8A 2YN3A 4J6RH 3TH3T 1S7QA 4X98A 2IALA 3O3AA 2JELL 1UACH 4GW5B 1U3JA 5D1XB 1YNKL 4M93B 4GRWH 3EJJX 2MTPA 4LCCC 3P73A 4LNRB 3U46A 1MRCH 1MH5A 2ATPA 1QSFD 1P53A 4QHLB 5DC9B 3ZKXB 4YDVA 3PQYD 3IDJB 1X5HA 1BIHA 3O2VL 1KPUA 1UJTA 4HULB 4JFDD 1FAIH 5ISZE 3MLYL 5C0AE 2X4UB 2VXVH 5CSGA 2FIKA 4JN2A 3MRBB 3L3OA 4ZSOE 2VC2L 3LV3A 5SWQA 5CUSL 1G6RB 1MY7A 5L2KD 1FFQA 1G0XA 2H8PA 3IJHB 4WO4D 1CDIA 4NQXB 4JY5H 3MJ9A 1BFOB 2BDNL 2ERJC 5JZ7C 2HT3C 3MFGB 4GRWB 3BEVA 4ZNEA 4CVUA 4U1GB 3F7RA 2IQ9H 2XQYK 1WVZA 3O6FA 2OR8A 5MI0B 2IH3A 4PGEA 3AY4A 2VMFA 4F15C 5DRZB 4Y4KA 2A77L 2WK2A 2YUWA 3MRNA 5F7YC 4GMSH 2R2BA 1RJLA 3W0WD 2VTFA 2FL5B 3PV6B 4ZS7L 4O2CB 3CK0L 4O2CA 2D4DA 4ODXB 2FDBP 3GHBL 2X05A 1Z3GL 4HIXL 3TM6A 3IFOB 4TULH 5AYUL 1MLCA 5HGAB 3VXME 1CGUA 3D0LB 4OI7A 5IMMA 1UB5A 3VXRE 1S9XB 1ZSDB 3NAAL 3BZEA 3TCLB 3FQUA 2HKFL 4J3WA 4IOFD 2X7LA 2FX7L 4WEUD 1MFCL 3LRSB 5A3ID 1WCBB 3UO1L 4NBYB 3KPNB 3BDXA 4L4TD 3GRWA 3QPXL 3G9VA 4JDZB 3R8BB 2R1YB 5FO7B 4E41A 3T4YB 4PG2C 5C0IB 4LRIC 1CE1L 35C8H 3MLVH 3HG1B 3V9FA 2BNUA 5JTWA 2GJ6D 3GKWL 3WKML 1U8PB 1X44A 3F6IA 1RQ5A 3KLAB 2W0PA 3QO1B 1IAOB 3H3KA 4JRXA 5FUZL 2LE9A 4M6OH 5DA0B 1DN0A 5IMOB 4UB0L 3MJ9H 4YFLI 1XH3A 2AI0L 1E4KC 5KVGL 3EO0B 2NY2D 3T0DA 3SE8L 5I19L 3BIKA 4GW5A 5IBUB 1OCWH 4PJBE 2JKXA 1P2CA 2OMBA 2V9TA 3V6OA 4NZJA 3WNKA 4UT7H 1R24A 1KF9B 1WTGT 2R0ZL 1XF4A 4HKZA 4JFXB 4P46C 4L9LA 4DTGH 4QRRE 3C09C 3KXFE 1YEKL 2QBWA 4P3WA 4LF3A 5F6IB 1CLZL 1ZK9A 4M1DH 1QUNA 5E03A 3VFOB 4HG4J 5BZDB 4YGAB 3CDYA 4XNUL 2OCFD 4JHZA 2V7HB 4GKNB 3VWKD 2BSRA 4P2OB 3HLAB 2DL9A 1P5UA 2NY6C 5ILTL 5F1KC 4UMGA 2VDLL 1NEUA 4K3EH 1U3HD 3W39A 3WFBH 4XP1H 7FABH 4UIMA 1G9MH 5D72L 1QBBA 4FP8H 3RRQA 4HS3A 2XT1B 1U36A 4PRPB 5JORA 1CTNA 3ESVF 4I0CC 5ICXA 2OP4L 4LIQH 4QYOB 2XA8H 5EUKB 4PRDB 2AV7A 4UB0H 3T65A 4P2QE 3WIHA 2ICEA 4PJ5D 1FHGA 5KG9A 4KRPC 2HFFA 1HYRC 3FZUC 3BGFB 5D7JC 3ZDZE 5E95B 3HPLA 3JV4A 3OJMB 4XVJL 3RVTD 3QCTL 4NC1C 3N1MC 4NKDA 1XGYH 1T5WA 1F4WL 1OQOA 3QNXA 3CFBA 4JFEE 3AC0A 4U4BA 2PW1A 3IDGA 3QFJE 4X9IA 3UTOA 5KVMC 1NUFA 2H9GA 5MERA 2H2SD 5CZVH 3MUJA 4MA7H 2AABL 3OAYK 1E6JH 3DROA 3QNYA 3O3BB 4JAMB 3LDBC 5JOPD 4CDGC 3TIDB 1VKXA 3MV7E 1RUAH 4G8FA 3HRZB 3DETC 1INQA 3QA3A 4NP4L 5HHOA 4EDXB 5AYUH 3RKDC 3DMMA 4G7YL 3TFKC 1BVKB 1IGCL 5F9AC 2CGRL 1MLBA 1PVHA 2K7QA 4KK6C 4QY8B 4XNZC 3X3GH 1E28A 4HX1B 4HC1L 3OB8A 2W9EH 5MEQB 5D7IF 2EIDA 1PSKL 4DN3L 4ELKA 3D87B 3KPQA 1XF3B 1DLFL 2X44D 3MUZ1 1UH4A 1NUGA 4BA8A 4RQQB 1P9MA 1CK0L 1WLHA 1NFDE 1FNGB 2E6PA 3RZCA 2AK1H 3FRUA 5ECJE 1SJEB 1YYML 5HDLA 3REWA 4K23L 1QLEL 1NCCL 1AQKL 1K6QL 4J4PC 3OTTA 3AXLA 2AS5M 2P8LB 1BAFL 3IU3A 3PWJA 1KTLB 3N1PC 3QI9B 4POYA 1JPTH 2YPLB 4TVPH 5TFSH 3SKNA 5DUPL 4HWUA 3S5LB 1D9KA 3U36A 1V7NH 3FB8B 2Z35A 4P9HH 2H1PH 1FFNB 4MD0A 4N0UA 3UXFA 4QCIA 3T3PF 4BZ2L 5D93C 2IBZX 4PJXE 2X1QA 4NFDA 2Y5TA 5DJYA 4DEPC 3T8XB 4GLRI 4QRRA 3NAAH 2Q8BL 4PJIA 3F5WB 1CXFA 4DTGL 1OB1A 5I1HH 1MFEH 2VSCA 4MA8H 3OJDA 3ARGD 4M7JL 2F5BL 1A6WH 3PNWA 2B8OT 3BW9A 1FLRL 1M1SA 4Z76B 4O9HH 3TCLA 3D0VA 1ZLWH 5LBSH 3BKYL 2YWZA 3VA6A 3PWNA 4LIQE 4R4NC 4XPFL 1G9NH 1OGTA 4X4YB 4NZUL 2PYED 4RFNB 3GBNH 5IQ9A 4Z95H 1RK0B 1RZ8A 1OT2A 2WQ8A 3DIFB 4U3CA 3WIIL 5EOCJ 3TYFB 3FT2B 1QFWI 1TPXB 3L9RB 2QADB 2UWEF 5FK9B 4DAGL 3RVUD 3QUYB 4GKOA 3V2AR 4YBLB 1KTLA 1U9KA 4L8DB 5CUSH 1G7PA 4KKCD 1U8OB 4X4MA 4KV5F 4X6CE 2VYRE 43CAA 3M07A 3N50A 4U6XB 1SJEA 3N1FC 1ZLWK 5AZEH 4K2UL 1K8DB 2EXWC 5KW9H 1I85A 1YEKH 3H3BC 4PTTB 3MUGA 2PTUA 3LHPL 1UH3A 3HS0B 3WFEH 5ALBL 3QDAA 3H9ZA 1MELA 4YUEL 4ZO7A 3K1KC 1PLGH 3ECBB 4HX1A 4KRLB 4KAQL 3SN6N 4CGTA 4WNQA 1LWRA 1OT1A 3QXTA 5H94B 2N1KA 4NFCA 3RU8L 3OKLB 1Y6NR 5HHOB 2PO6A 4I8DA 8CGTA 4TTGA 1KUMA 1ZT7B 3MUHL 2O5XH 3PDOB 5DJDB 1TVBB 2R69H 4NRZB 5HYEA 2Q8AH 3VDCA 1ZEAH 5IEKB 4P2RB 2J2ZA 4UZGA 5GXBB 1J05A 1R3HA 1BZ7B 2R9HC 4EKXA 4PJEA 5H2BB 1PJ9A 4M6AA 1H3WM 2YWYA 4OIBA 4QTHA 1S7RB 5CBEA 1YEFH 3OKNA 5HYSA 3NIGE 3O11B 3OR6A 3Q5TA 5JW4R 3V79C 3PP4L 5EZJA 3W2DL 4RCAA 4NCC2 2Z93B 2VSDA 3TYGL 2NY7L 3CU7A 4QLRA 2E5EA 1R5VA 2P5WD 4YHZL 3QEUB 4XMLH 2YEZA 3WUWB 4ZUWB 3KS0H 3QRGH 5HHOE 1CZ8H 1X5ZA 1INDL 1EGJA 3CPLA 1BGXL 3ZYIA 2HLFD 4PLKD 3SGDI 4YPGB 3CSYA 2RR3A 3WNNA 1A1MA 4K9EH 2EZ0D 2R69L 4NO0B 1WAAA 1TZHA 1ORSA 4P4KB 4HQQH 5F1NA 2ZSWB 1AHWB 5MENB 4RGOH 5FA4A 2WP3T 3N1QC 3RGVB 5F3HA 1ZT1A 1CIUA 3U6RA 1JHTB 3U0PA 2A2QT 3BESR 4G9DB 3KPNA 5IB4B 3E6HB 3SDAD 3I75A 1DBBL 2EE9A 5IBTH 2Y07L 1AFVL 4DCQA 1YY8B 3U9UA 1RJYB 3WJJA 3KYNB 5I18H 1WCQA 1MHHB 5GGVH 3DYPA 4YFDB 3BSZL 1ZS8B 3DI3B 3FCTB 3LPFA 4LHUB 3P3YA 3TIEB 5J11C 2CUIA 4R3SA 4BFGA 4OGXH 1I9JL 5DD3L 1DN0B 2V5SA 4LAQH 5IM7A 4GKZB 1GL4B 2BMKB 4JGMA 4OM1H 5HGHB 2X9XA 5EG6C 4HQQL 4QWWC 2AEIT 3K81A 1D5IL 4HLZH 4LVHB 3X3FL 4B7LA 1FE8H 5EUOE 1MIEL 1G7LB 4G8GE 3W11C 3G6JB 1QNZL 1I3RA 1EGJL 2XKNA 3C6LB 4M3JA 1QSZA 4UAOB 4FXKB 2HJFB 3KYMA 4YH6A 3C5ZB 3UTQB 1FC1A 2BY0A 3QUZB 4HCRA 5FYKL 4FQHA 1ZTXH 3BZEB 1YNTB 3STLA 3NTCL 5ESVA 1X7QA 3BT2H 4NO3A 5J1TC 4PGBB 5C0BA 1UXSB 4L4VB 1BJ8A 2I07B 2VDQL 3S36L 4PJDE 1G9NC 1FVCB 2R1XA 1KCVH 4OZGB 4TULL 3HPJB 3F7VA 4EQ2A 1OTTD 3ARQA 5FUOH 1I7ZB 1R5VB 5D2LB 1ZEAL 3GSQA 1LP9B 3OKKB 1LP9F 4JVPA 1MCRA 1X5LA 1IC5L 3D3VB 3OPZL 1NDGA 4YXLL 3QQ3B 4QO1A 2R0LH 2JJTC 4AEHH 1AQKH 1K6QH 4X8JA 4P4RA 4XRCA 4QF1A 3KYOB 2OXGA 5SWSB 5HYQA 1I4FB 3NFSL 3LD8C 5DD0H 4H88L 1J1OL 4YIQB 4ODVH 2DQUH 5HYJD 3QAZC 4LSDA 3QXAB 3VFSA 4IRJD 1W8OA 3U46B 1UXSA 5HHMD 2N7BA 1U3HC 4G8IB 4F33A 1S5IL 4H20H 3BDBA 5DUMH 3VD9A 4NJ9H 4YHLL 2CRIA 4AL8L 1CLYH 4CRPA 5JPMA 3H7BA 5IQ7H 3BXNB 1U6AL 4HPYL 4BFBD 3RA7L 2H6PA 5DMYA 2V17L 4JFFA 1HINH 1JYXA 5F7DA 5HVGB 3C2AH 4RZCB 1HH6A 4GQ9H 2CUMA 4WWKC 1INEL 3DVIA 9CGTA 3SPVA 3QAZB 3RFZC 4WHCA 4OQ1A 3SDCD 5DK2A 2F19H 4EI5B 4NKOB 4GKSA 1T20B 4OI8A 1G1YA 2NY5C 5KVEH 1OGAE 3LD8B 4WWKA 2Y4SA 3O81A 1E27A 3VXQB 3GHBH 4JO4H 2EYTA 3WLBB 3V0AC 2D7NA 3FTGB 3BUYA 2DQJH 1VB9A 1I7TB 5FDYA 2Q86B 4WJ5B 5CP3A 5ANMA 3WKMH 1B6DA 1HHHB 1ZANH 1U8QB 1JWMA 1PZ5A 3QWRD 1J8HA 1MFEL 3O41A 4KK9D 1QFPA 4IRZL 3DRTB 1X5FA 2ADFH 1UWXK 5JIPA 2FYYA 5DEFB 4LASH 2Y23A 1DBAL 1QSFA 1U6AH 4MDIB 4K7FB 1JN6B 5C1MB 3GB7A 1ZLVK 3HZVA 4PJ7A 3IAGC 1QSEB 5JHDE 2UZXB 5I74B 3THML 1REIA 4Y8AA 4HKBA 5C0JA 1S9YB 1U8LB 4CN4A 5FV1L 2IAMD 4X6DA 4QRSA 4F8TA 4PPTA 2CDFA 4PJIB 1L9NA 4LQFH 2O93L 3P77A 3PJSB 3DUSA 5ICYB 1MHPL 1U8JB 1EO5A 5E8EA 1NC4D 2ZOKB 1FYTE 4NO0A 2JIXA 1HKFA 3W9EB 3ROLA 3O6FD 1P1ZB 1GZPB 1RZJH 3I02A 5M7QA 3RHWK 1UZ8B 1D9KB 3QDGE 1ETZB 3DV6A 5T1DH 4PJHF 4OFYA 4M6NH 2GJZB 2G60H 5KZCD 5C0GA 1J8KA 2UWEA 3HG1E 4Y19E 1M71A 4MQXD 1VESA 1IAMA 4LBEB 3WIFB 1I3GL 3AXLB 1NMBH 1LEIA 3CXHJ 3WFHA 2HVKA 2IBZY 4JKKA 4BSJA 1U8LA 4DW2L 4MA8L 5JXAH 1DUYB 4XX1E 3ARBD 2DIJA 2ICWI 4JQIL 4JO1L 4XB7A 1CYGA 3TO4C 4F7PB 1IRAY 4QXGH 4UNUA 4XP1L 7FABL 2W9DL 3ARDC 3OJ2C 4PB0H 5DI8A 4JM4H 1QSFB 4WUUA 1OSPH 3OKMB 5I1AA 5MP6L 3RIAK 2IGFL 2WP3O 3VXPB 3DRTA 3MR9B 2VDPH 1HI6B 4BJLA 1RUKH 1U8QA 2ADGB 3MO1A 2B5IB 2NPLX 4GS7B 4XI5D 3WBDA 3WO4C 2G5BB 4G8FB 3KNBA 1JJUA 4LASL 3DECA 4Q9QL 5IB5B 1I1AA 3GMQA 2NY3B 3U79A 2VOTA 3C5SB 4MQ7A 3B5GA 4XI5C 2E9BA 2HFEA 4TVPE 4M43L 1T21A 3RNKA 1CFTA 1F2XK 4D0CA 5IFAL 4MXWL 1YMMD 2ID5A 1AO7E 4NQDB 4DGIH 4OF8A 3RDTA 5A43C 4RX4A 2OK0L 2BNQA 4X7SH 1HHIB 2A9NL 3NVQA 3C6LD 3OL2A 1DLHB 2F9BT 2EDKA 4NT6A 5D7IB 3GK8H 4MNHB 1J88A 4Z0BL 1YC7A 2J8UF 1UA6H 5A2FA 1JF5A 2GSGA 4LKXA 1KTRL 5BZWB 5BVPL 3D39A 1BBDL 3GSNB 4HUUA 1CXIA 1LE9B 2A83A 3CNKA 4L8DA 3C60A 3V52H 4XBGB 4Z7WF 1KPVB 3INUL 3U0WL 2OS7A 3GMNA 3ZE0F 1OOAA 3BQUD 1JHKH 1LO5B 1MRCL 1U8HA 3PP3H 3KPSD 4UIMB 4JDTL 4IRSD 1WQVT 4UT7L 4S1SL 4LPWA 2ZKHL 3SEPA 4F7PA 3NIFE 1NCBH 4YHIA 4UOJA 1GGCH 1HNGA 2VLRD 4HZLA 4KH2A 4X6DE 3K1DA 5F70A 1PY9A 4ETQB 2MOVA 4HXBH 2G75A 2MMXA 4HG4K 4YHZH 5IJKC 5FUZH 1JI1A 2Q6WB 1K9TA 2DYPD 1FVCA 2IANB 4Z0XB 3QT2A 3TC9A 2GJZA 3HE6A 2F74A 3RTQA 5FGCE 5IVZA 4MD0B 1GZPA 3AREB 4N0UB 1FGNL 4AEIL 3O9WA 1G7MA 5EA0H 3SKNB 2DWDB 4UBDC 4TQEL 3MOQA 5ICYA 2E3VA 2EDNA 1PGRB 3D1MC 4Y2DB 3NZ8B 3OBAA 3V0VA 2NY4C 1U8MA 1S9YA 4OIAA 5CZXD 1YC8A 4L3AA 3FB6A 5HD8C 4ENEC 3ULUH 1DZBA 4PLJC 4E41B 1JWSA 2C1OA 3L6FA 4Z7UE 2BERA 4XP6H 2AGJH 1GGIL 3LPWA 3ZDYE 3QHZH 2AQ2A 4HFWA 2DI8A 2DQDL 4JN1H 1WISA 4KK6D 3VG0H 3MCG1 1LHZA 5DRXA 3D2UA 2ITCA 3LEYH 5DMIL 3WL9B 1MLBB 2IQ9L 3GBNL 3LN4B 1NBYA 3BJLA 4IOFC 4NZTH 4JZNB 5HGAA 2B4CC 5EOTB 5J6HA 1P7KB 2UV3A 3MJ9L 3QRGL 2JLLA 1OAZH 4UTAH 4RMWA 1ZGLP 3MRNB 2Y06H 3T2NL 1I9JH 2ENSA 3D85A 3VGDA 1NBVL 2UUDH 5CGYC 1NC4B 1IC1A 5TPWL 1I1CA 3RWJB 1HILB 4XB8A 4N8VB 3AAZA 1NBZA 4Y1AB 5FYLH 2D7QA 2EEAA 3LKRA 5ESQB 5I16A 4OZHB 1T04A 1XF5B 2V5YA 1AI1H 3QWRA 4D3CH 2DICA 5JPNB 5D2NB 5KAQG 3UJJL 2JF1A 1QLRA 5T1KB 2OSLA 3BEWB 4LVEA 5TE6H 3T1FA 1OAUL 3Q48A 4HW6A 1MCDA 1MJ7L 5IBTL 3F6LA 1MI5A 5E24E 1XZ0B 4LPVA 2WUBL 4I48B 5FGSA 4LFHD 1KN4H 4TN9A 3X11B 2JIXD 3IDJA 4NZTL 2FH8A 3MNVA 1AXTH 3K2MC 2W60A 2P5EE 4BFIB 3IKCA 4HS3B 3DNKA 4PRPA 3KDMB 1JYNA 1EIBA 1P84J 1IM9A 5DFTA 3MRDB 3LMJH 4H25A 4PLJD 5KVDL 1MQ8A 4HC1A 4LLVA 4R96B 3RX5A 1ZWIB 4Q97A 3PL6A 4M7LH 3SDXB 5C9JA 1X6NA 1RV6X 1U92B 4XVTH 1PDKA 3BKMH 2W65A 1DVFC 4GRWE 2H2PD 2JJUA 4QTHB 4Y19A 5BOPA 3SGDH 2VXVL 3DUHA 1J0KA 1TVDA 4NN5C 4GXVH 5IEKA 1FQ9C 4EI6A 2JJTA 4KTYA 1X5GA 3LSOA 4OSUH 1IEHA 3DO7A 2PF6A 3E3QC 5GHWH 4BKLB 4MAYB 1OGAA 4LU5L 2DJ4A 2BOCB 4XPFH 2NW2A 5DJ0A 3BP7A 4PV9B 5J06A 1DDHB 4X83A 3SKOB 1S7SB 2L0DA 5KVDH 3AS3A 4LRIA 1A9EA 1MFNA 4JKPH 3EOAA 3CK0H 3WIHL 5F9DC 4OCMC 4HMCA 4GMSL 3IRZA 2X1XR 4OFIA 4HC1H 2F15A 1KSRA 5IMKB 1EUUA 4X9FA 4WDIA 4FXKA 5E5RB 4N5EC 4S1RL 3RJDA 3PXJA 2VR9A 4NRYB 1LMKA 2DL2A 4LLAA 4J3XA 1A6WL 3U7YL 1BBJB 2R8SH 1KJ2H 5E00A 4AG4L 3WFCL 2VLRE 4Z7UA 3HRPA 1UZ6E 3IU4H 5ALBH 2X6MA 3ULSB 2VN4A 2C3VB 3Q6FA 5D71H 3RWCB 4RMUA 4UUJA 3SKOA 4XC1L 1ND0A 2NYYC 2BVUA 1R3JB 1V3JA 4H26B 1SBBA 3SOBL 4TVPL 1FP5A 3Q5OA 2XWTA 3NFPB 4UTBL 2IMNA 4OZ4A 1BF8A 2FL5A 4B0MM 3DX8A 2F53D 1D5MA 4KHXH 1A4JA 1U3HA 2JJWA 4PG9A 5IBLD 3L7EB 3BP4A 1HCVA 1EGJH 1CG9A 2A9NH 4DKEL 3O6ML 3NCJL 1D6EB 1NPUA 1UQSA 4F15B 3MV9A 4G6KL 4Y19B 2FBJL 3KPPA 3L3GA 2KZWA 2D4FA 4WTZG 2VXUL 3ZT7A 1KOAA 5GS2H 1G6RA 3RGVA 5BS0A 2IPKA 3V4PL 5FHBL 1MCJA 2APBA 4OZGF 3NIDF 3EUUA 2O26U 4EVNB 2WUCH 1UVQB 2VQUA 3DVNB 4LSVH 1I8LC 3CLFL 4EUPB 3UTSB 4HEPG 4ZFZA 4QCIB 5JNYA 3BH9B 1YPZE 1E6JL 4I3SH 3RTQC 2DWEA 4H1LH 4NC0B 5ILTH 3O2WH 4ZUWA 1EFXB 3CIQA 5DJ0B 5KSAC 1OL0A 1WGOA 2IALB 3O3AB 1UENA 3GMPA 4YDJB 3MLZH 1WT5C 4NQCE 1QQDB 3CDGA 4HLJA 3L7FB 3U7YH 1DBAH 1VGKA 3Q6GH 2WINA 3P9LB 3TA3D 4L8SB 1AJ7H 4PY8I 2W1NA 4Y5XA 2HLAB 4LSSH 1L0XA 5F1OB 5GS0L 5I8CB 4J3VA 1S7RA 1J1PL 4OAWB 2FGZA 4RX4D 3FFCA 1MPAL 4GG8B 3SDDA 3SDDB 3TT3H 1JK8B 2L7UA 2A6KA 1QEWA 4G9FD 5DZOA 4LFHG 4GFTB 3BKYH 3AAZB 1G7JA 5EOQH 5FYKD 1KIPA 3PV7A 1E4XL 1INDH 2XG5A 4M6OL 1T80A 3FOLB 1G7QA 4P2QA 4PLNC 1JRHH 4Z5RA 3QG6B 3HRZA 3QA3B 2WZPD 5T1KD 1L0YA 3GMPB 2YHGA 3RZCD 4PRHA 2V6HA 1BZ9A 2Q1EA 5TDOA 1TFHA 2W60B 1WBYB 3P4LA 5GS1A 32C2A 3CCHA 3VRLF 4R7DB 4RA0C 4ORGA 1DP0A 1T1YA 2AK4B 3MLZL 4OQTL 3LQAH 5FB8B 5E9DE 2OXHA 3PWVA 4WI3A 1WBXA 3B6SA 1AR1D 3O2WL 4X99A 3PHOA 3I3BA 4PRNA 4CADB 1W0VB 1CLZH 3MGOA 3O2VH 4C4KO 1FZOB 4FXGA 3IDIB 4I4WA 1IZJA 2FLRT 5EC2A 3WDHA 1U8MB 2CK0H 3EOBB 1E6OL 4Y16B 3G6DH 2BRRL 3LN5B 5KSAD 5J7CC 3LS4H 4HJJH 4Y1AA 3CFCL 3VRJB 3B3IB 4TNVK 4PRDA 3OG4B 1ZANL 2VABA 5C0CB 3QUKB 4W6XB 2PCPA 3MBEC 1A21A 3HE6D 3LOWA 4JFOA 1PYWB 1W72L 2RCSL 3K4DA 1QBAA 1AGFB 3B2VL 1RZIA 4R0LB 3VFGL 4ZG1A 4UUJB 4WFFD 5I8EA 5C0DA 3P40A 2GEEA 3K4AA 2E7HA 3IYLW 5F7EH 3TEUA 5GPRA 5KS9E 3UMTA 4F7TA 2ZPKH 3VCLA 3PG2A 5HJ3B 4IS6B 2VLJB 5F9OL 5F7WC 1RI8A 4M61A 1MFAH 1P5VA 1WAAE 3H9SE 1A6AA 2Q8BH 3R1GH 5I71B 3IDNB 5LGHH 3V6FA 5AD0B 4QRRB 3S35L 2XRAL 5D7SH 4LNVA 2ED7A 3TBYA 5D5MA 5F7NC 4K3JH 1MFBH 3GUTA 3MNWA 2Y25A 4JPIB 4OLVH 5E99L 3FB8A 2R2EA 5JHDB 1KXQE 4LGSB 5DD0L 2B0SH 4C56A 5IVXB 1CLOL 1SVZA 2ZOLA 1JNJA 4DOHE 4Z7OF 1GAFH 2FECI 2NXYC 2R0LL 4UQ3B 2BNUB 2Q6WA 1T0NB 5J12C 3EGSA 5D1ZC 2EYRB 4G6FB 4UV4H 3HCVB 4X6BA 3OPZH 4NDMB 2ICWB 1QP1A 2PXYA 2CLVA 4ZMAT 4XPBL 1RULL 4M43H 1JZ8A 3GO1H 5HHMB 4HUWA 4ZYKA 4CU8A 1XAUA 3TWCH 3OKYA 3GI9H 5AEAA 4GH7B 1CFTB 1GRWA 5SV3A 1ZSDA 5DHYA 2OJZH 5J56B 1RVFL 2LABA 3UJIH 4LCIL 4EDXA 2O5ZL 4PJHB 4OGZA 2W59A 3BRDA 5DUBB 2EE2A 3L3DB 3STZA 4X5LA 2ED8A 4D0DB 1DQTA 4PJGB 1WWWX 3BT2L 1F3JA 3KDMA 5EO9A 4NUJB 4Z7VA 2WWMC 3TPUA 2B2XH 5J3HD 5BCAA 3JTSA 2VAAA 1EK3A 5IB3A 4ODSH 4UILH 5D5ME 3V5HA 2DD8H 2E6QA 1EH9A 4NIKB 4UIKL 2EDQA 3RUGF 2B0SL 1XZ0A 3TZVA 5C09E 1BFOA 3ZTJH 4WFED 3IDIA 4K71B 3ULVD 4B53A 2J8UA 1UKSA 4MDJA 4KPHH 4BH8B 1H9VA 4RRPA 1N7MH 1OAUH 2P8PB 3BKCH 4A6YL 3RVUC 4ZUSA 4HHAA 1FCGA 2P7TA 3OJVC 4MJ2A 2YPVL 3BPLC 2E7CA 2QKIB 4PV8A 5F7LB 3VXNA 4O51B 1WBYA 1JYVA 1UEMA 3VI4F 1ITBB 5E2VH 1S8DB 3ROLB 1JPTL 3EYVB 4Z6AT 4PJBA 5IB5A 4I0KA 4OKVB 4HWZB 3S4SA 2WBJD 1NGWA 4PTUA 1MNUH 1QSFE 5JIIA 5HYFA 3WN5C 1LEGB 1EEZB 4OCYH 4Y89A 3VFGH 1FZMA 1CE6B 2FHCA 4ZFFA 5DEGA 3BIAX 4CVZA 5D5MB 2NR6C 3NFNA 4XP4H 5MI0C 2E9IA 3MNZA 4F7CA 4WUUB 4IRJC 4JO3H 4R4FH 1QSVA 2A0LC 3OKEB 5TGBA 4NQVB 5I8CA 1WIUA 4MVBC 1MCEA 5L0QB 2O5YL 3MREB 3ULVH 3OXRB 4N8CH 4U05A 3C2SA 1YEEH 1T66D 1MHPH 2AJYH 2DQFA 3DUUA 3QWOB 4OCLC 1H5BC 4ZQKA 4LBEA 4XP6L 2JJSC 3BIKB 2X1WL 4P59L 1XF2A 2X40A 3CLEL 5JMOC 2UWEB 3ZHKA 1RZIB 1FFRA 2P5EB 5GS3A 1TVHA 2ARJQ 1N8ZA 4XAWH 3ZYZA 4EXPX 1ETZA 5EU6D 2IGFH 1CICA 4P0DA 2PTTA 4PJCB 5KSUA 1N0LA 2GIYA 2AABH 4JQXA 3SHSA 3FONA 3BH9A 2JJSA 3HMWL 1MNUL 1T20A 2QLVB 3VXUD 2OZ4H 5MEPB 5TF1L 2FX7H 5HGDA 1FDLL 1CT8B 3HZYA 4MHHI 3VMNA 1FSKB 4LEXL 1F13A 4HSQA 4JPVL 3VXUA 4HKBB 5TDPA 3GSVB 1TJGH 2C3WA 4YGVB 1FZKB 4PJCF 1PEWA 1D6EA 5IMMB 1S7VA 3OAZK 5IJKA 5B38G 1MLCB 4O02H 2HT4C 3GIZL 3FB5B 2F5BH 4X5WB 2R4SL 4JKLA 1FGVL 2H3NB 4OZ4B 3WEXA 1CI5A 3QNZB 2O5YH 5E8OB 1OY3B 1N8ZB 1T5XB 2CRYA 2VKXA 3N85L 3JV5A 2I5YH 1B2WL 2Q86A 1ND0B 3LZFL 1CTOA 1SMAA 3D3VE 1CFNA 3FTGA 3ORJA 3C60B 1MQKH 3PABB 3PGDA 5DD6B 1FN4B 1T4KB 2GFBA 1CFSB 5JHLH 2H32B 4R4BB 2D9QB 1CL7L 1MCCA 2VLJD 4D8PB 4OZFA 3MLPA 1HZHH 1FBIH 2GSGB 1ZHNB 1YJDL 4LKXB 3VFUA 5FUOL 1JK8A 4NT6B 1QOKA 5D7IA 5FA3A 1IQDA 1YZZA 2BC4A 4PR5B 1ZMYA 4XH2B 1UA6L 4M7ZC 1KG0B 1UG9A 2FJGB 3IAPA 4OUUB 4WHTB 2DTMH 4DUWA 4HAGA 4PJEE 1A6ZA 1FZMB 4NGHH 5F7UA 1PKOA 5BQ7A 3CD4A 4K3DH 4GW1B 2GTZB 2P24A 1DDHA 1HHKB 3BD4A 4MB3A 4L4VA 3EDDA 2VLKA 2XICA 3ARYA 4PJBB 4BQCA 5AUMA 1G9NL 3QH3B 2GAZA 3GSRB 5ANME 3WN5A 4PJ9C 3RL1B 4L4VD 5DDHB 1NEZB 3MOAH 3BN9C 5ERWA 1GOHA 3PWPA 3QPQC 4YIQA 3EAKA 2BVPA 2DYPB 3VXMA 4PRHD 3HMXH 5IB1B 1QA9A 1NDMB 4YDKL 5IG7A 5IG7B 2Z8SA 4YPJA 5IVOA 1IBGH 3FMGL 4W68A 2C1PA 3JWDH 1JRHI 1K5NA 5CSBA 4HZAA 2D0HA 3VWKB 1AD9B 1ZHLA 3R1GL 3L3KA 3QFJD 1RZ7L 1FVDA 3DRQB 1PG7X 3BE1L 3F12B 1KJ2L 2DM3A 4LLYA 3BSZH 1RY7B 2BZDA 3TJHD 3RWFA 4GT7A 4GAYB 3ETBF 2BFVH 1PG7W 1B9ZA 5I1KH 4H5SA 3BRFA 3IB4A 2NTFB 3L5XH 1FNHA 1GSMA 1KV3A 4PJGA 5C0BB 2M8XA 3ZTNH 3FQRB 1A0QH 1X7QB 2X4OB 5I2IA 2QQKL 5DF0A 4ZXBD 1BVZA 1U8JA 1YY8A 3HUJA 4X5XB 1A7PH 2CDFB 5IFAH 3CMOH 4OUUA 4APQD 5FM4A 2PYEA 2X4QB 2V5RA 5TDPB 5FYJH 1B0RA 2VDRL 4WHYG 1KTDA 3UPCA 7CGTA 2YPKA 3MXWL 3S8WA 4ZUVB 4UT9H 4I0PC 5T33L 1CFSA 3Q3GB 4DGYH 1XGPB 1GH7A 2OJEB 2KUTA 4FHBD 5EBMA 5F6IC 5A16B 2LQRA 5ENWA 4MXQC 3QUXC 1ODAA 3LQAC 1CFVH 1HHHA 2XY2A 5DWUL 5KS9B 3HKFA 2JB6A 5JHDA 1BREA 3G04A 4PV9A 2P5EA 3HHRB 3VDAA 2Z31A 2Q87A 4BSWA 4NQEB 4HKXA 4OT1H 1FV1A 2ZG3A 3RWDA 2FX8L 3QIBC 2VQTA 4RISL 5B8CA 5HXMA 5B3NA 2P5ED 2QSCH 2WM0A 4FABH 3BJ91 3LSOB 3QDHA 1IC7L 2BOBB 5GRWA 1T2QL 3OR6B 4F2MA 2GK2A 3NGBC 3MACH 4TUOB 5DMJB 1TCMA 5AZ2L 2DN7A 1ZHKB 3IVKA 3NCYP 1UM5L 2F58L 3TBVB 3VXUB 1XR9A 2EDBA 2CPCA 5DRNA 15C8L 1CVRA 2A74B 4CVZB 4RAVB 3QUMA 5HGDB 1N7ML 3QDJE 4I2XA 5E4EC 2FGWH 2HRPL 5CBAB 5DTFA 2ZZUT 4LLVB 3FJTA 4R96A 3CAFA 3T08A 5IP4A 4JPWL 1WUNT 4YEEA 4LPUA 1I85C 2BRQA 4H25B 1NCNA 4JFOB 3ZKQD 1EMTH 1PLGL 2HKFH 4NQTA 5F93C 4EUPH 4QRPE 4MXVF 1KBGH 3VFSB 3RY4A 2YEZB 3S3JA 4Z7WB 1VFMA 4YHLH 1NCDH 5JW3H 5L2KA 1RZGB 1JNLH 3MRRB 4H8WL 4XWOC 3QRFM 2YD6A 2BX5A 5F96H 3KYOA 1CGVA 2LFGA 5CWSA 5T33H 3QHFH 4OLUH 3QUXD 4ZD3L 1DCLA 1YEEL 1RZKL 2YBRA 3CFKB 3FO9B 3OMZA 2R0ZH 3FQWB 3QDGB 5TE7H 3PHOB 4OZIF 1U93A 1XT5A 4M62L 1JGVH 1KJMB 1HYSC 4J3UA 4XTRC 5KVGH 4PRAA 1F8TL 2AK4A 3RJQB 4P2RA 1EXUA 5IB3B 2VAAB 1UWEL 3M17A 1QG3A 4FFWD 1URLA 1HQ4B 3SDDC 2AVGA 4MNQE 3G5ZB 2VDNH 1CDUA 3FFDB 3QJFB 3QUMH 3TO4D 3VFVA 4F8QA 5IFJB 1LO3H 3MRJB 1K4CA 1BJ1J 1RUAL 3L3DA 3X13B 2PNDA 1OGTB 4B41A 4X7FC 4NN6B 1NC2A 3FOLA 4JFQB 4XPHH 4FRWA 3ARBA 3RIFK 3WFDH 1BHGA 4ZUUA 2P7TB 2F5AL 3EO9L 3MYJA 5DVNA 2XQBL 4J8RA 3MROA 2DLEA 3SY0A 1FPTH 3CC5B 4DKFH 2APXA 4HPYH 1DFBL 1X5JA 2A6JA 2F53B 4WGWB 1DBKH 4L8SA 3QCVL 5C9KA 1YDPA 5I15L 3QCTH 1I8MB 5LAXB 3BIBX 4BELD 3X12A 4HIIB 3VFWB 1BJ1H 3JWNC 3VXSA 4HCRL 1JE6A 1HNFA 4XWOD 5HDBF 1G7IA 2Z35B 3C8KB 2BVQA 3QULA 4PRIE 3F62A 5C08D 4WTZA 5F7EL 4G8GA 1EAPB 4ODVL 1IGIL 1PQZB 4I3RL 3FFCD 2V5MA 4D2NA 1XGUB 4PJAF 2ADGA 3ZDXE 3BP6B 4ZFZB 5JNYB 5DK3A 4FQXC 4OBSA 1H0DA 2QQKH 3V6ZB 3U4BL 4ALAH 3OGCA 2OQJA 4L5FL 4PJ9D 1KULA 2DLHA 2M1KA 2C3HA 4G6KH 1Q9WB 3G6AA 4KUCF 3ARFB 3U30C 3GMRB 2XNAA 3X3GL 3WHE1 3KPRE 5IFHH 4TUKH 2BY3A 4GXVL 1R6VA 1TZIA 4C54A 4MSWA 3UBXB 2H26B 4RMQA 4I9WD 4POZD 4Y88A 1M71B 1J12A 3PIQB 2ZSWA 2VDPL 4UDTB 2WQRA 3QEGH 1H0DB 3DV6B 1U8IB 1SJVA 4Z7QE 5JLZB 4JKWA 3UJTL 3QEQE 4JAMA 5ISZD 5E4IA 5IMLA 4ZDHB 3MV9D 1T7VA 4GOSA 3QUKA 4XMKL 3PJSA 2AKRA 3P11H 4ONHB 3LKNB 5L2KE 3RPIA 2DQGH 4U1MB 5DQ9A 4L3EB 3QYCA 4NM4H 2VLMD 4J3OC 4KJWC 4NKDB 4BH7A 1EBPA 1YDPB 4KKAC 1WFNA 4U1NB 4JFDE 3MGOB 2KBGA 4UOW1 1JI2A 3B6SB 4G5ZH 4PJEB 2FRGP 1CDGA 3C08L 2NX5E 3W2DH 4PJBF 2EH8H 3ARUA 4FQIH 5F3BB 2X2YA 4NQCA 2BRRH 2Y1VA 4KTEH 1M4KA 1J1XH 3MJGX 4OTXL 32C2B 4K3EL 2YN5A 3MV11 1CQYA 1TVBA 5ETUB 3O9WC 1HHGB 1DN2A 4WJ5A 5T1LB 1KELH 2G5RA 4CMHC 2NW2B 4NO2B 5F89B 5TQ2H 1C7SA 4Y4FC 4P23B 3RQ3A 1TLKA 3X14A 4QXUH 4PGCB 4KRPB 3S35X 1I9IL 3IKKA 1SBSL 2G60L 1D5BA 2DB8A 4ZOEA 3V7MA 4Y16A 1NAMA 5GGUB 5TF0A 4MJ6A 2DLFH 3PQYB 5IJVB 1C1EL 2GJ6E 3IFLL 3BGMB 4AEFA 1F4YH 4P5TC 1BQLL 4GRLC 4J1UA 4DK3A 3V4PH 3HFML 1EEYA 2Q3ZA 1HSAA 4GG6A 1MAKA 2H6PB 3C5ZD 2GCYB 1P6AB 4L4TE 5ICZB 1S7UB 1LDPL 2PXYC 2VDOL 3DVFA 2PYFB 2EIZA 4RGNE 3REVA 3IAQA 1DQMH 3QP3A 1ZV5A 5CJ8A 3ULVF 5CZVL 2D7TL 2FSEB 4X7TB 5DJXB 1I1YB 2ZUQB 3VH8B 3C5JA 3MODH 4V1DA 5I17B 3I02B 5I9QC 1DANT 1GGUA 4J2XA 3BZFB 1A14H 1ES0A 4QRRD 5INCA 5TQ2L 4AENB 1LK3L 5CEZL 3T0EB 4CMMA 4JG1L 3QO0A 1P6FA 4TRPL 1OAKL 3PIQA 4YLQT 4XNYL 3IXTB 2G2RB 3SE4A 3RBGA 2R1YA 4GMTL 5A40E 3I84A 4P2YA 1X5KA 2VJXA 1BM3L 2ORBH 3OJDB 3DX9A 4HGMA 5I16B 1NGYA 3ME0A 5DJ6B 1JGEA 5LCVL 1XR8B 3A0OA 1CG9B 3S96A 1NCBL 1IJ9A 5DRWB 3HTLX 3BD3A 5C6TH 1D9KC 1NC4A 5D7IE 1VGEL 3LEYL 1JGDA 3DX7B 4IMKC 2DM4A 1A6VH 5J6GB 5GSRB 1H15B 2HMID 4QXTA 4S0TD 1UFUA 3IDYB 3DV4B 5BV7B 5CINL 3G04B 5DS8B 5DJZB 4JZNA 3IDUA 2FJHB 2H1PL 2BY2A 3MRFB 3F7QA 4ELME 4Q2ZA 1N4XH 4XNZB 3BEVB 5JW4Q 1FNSH 1R5WA 3UTSA 1F4AA 1IAOA 2VC2H 3MA9L 4CL7A 1T22A 3FRUB 4R26H 1U0QA 4XXDA 4JRYE 3SKJL 3SPVB 4HDIB 2DI9A 1QZ1A 1CD9B 2XACC 4P5TB 3ZHDA 4EBQL 4O00A 1AP2A 1IGTA 4BUGA 3U1SL 5HGHA 4D9LH 3AMLA 2R1WB 1A7QH 3HUJB 1EFQA 3RVTC 1CD1A 3TO2B 5GGQL 1YN6B 4QY8A 4YDVB 1N3NA 5EPMB 1P4BL 3CSBA 5CD5C 1T0MB 5CP7A 1NC2B 3ZYJA 1DEDA 4CU7A 4XCFH 3V6BR 1CR9H 4A6YH 4BSVA 1IT9L 1WWCA 1WK0A 1AE6H 1UWGH 4D0BA 4ACPA 3ZTNL 1KFAL 2R2BB 5GRXG 5FF6B 3SJVD 3EOTL 2JJVA 1CLOH 4HWNA 1F45A 3VXSE 4XHJC 1A0QL 5HDQL 4X8XA 4EZMA 1YEDA 2EH7L 3RWGB 5I75C 4IHOA 4MD4A 3P11L 4AJ0A 2NQCA 1T2QH 3IS1X 3DJ9A 2DQIH 2X1PA 3ULSA 2F54D 5DJ6A 1DFBH 1HXYA 2NNAB 4KI5E 4AM0A 1TDQA 4ZSOB 2JE8A 4Q7DA 2Y6SC 5DD3H 3FQWA 4WW2F 3BWAB 4G6AC 3TBTA 1U8NA 1LILA 4HMEA 1FNSL 3RKPA 4JRYA 5CD3B 1NGXB 3LDBB 3P0YH 2ITDA 1U92A 3RWIB 3QQ4B 4KWUA 5IB1A 5SWQB 1G0DA 4DKAA 1P4LA 2BJML 4OSUL 2I25N 1XFPA 1HCFX 5IW6B 3GSQB 3MRIA 1N5AA 4U6VH 4YDKH 4LP5A 3B9KD 2EDDA 2DLIA 5EUKA 1E4JA 2V2XB 1X5YA 5D70H 5M94B 2CSPA 4U1IA 1XIWD 3SE9L 1ZLSL 4KROD 1CR9L 4LPXA 1V05A 4Z7VE 4KQ4H 3H3PL 4MMZC 4L5FH 1LE9A 2GY5A 2DMBA 4JFEB 4XCFL 5GISH 4M4PA 5FO9A 4ZS6D 3MRLB 3DO7B 1T7YA 2PO6C 3HR5A 1JPFB 3QUMB 5JOFB 1YMME 2WLYA 4WHTA 3ULVL 3EYQD 3WLWD 5D2NA 4NRXA 3S37H 1RZKH 2BC4B 4PR5A 1Q0YH 1XEDA 3FZUD 3G6JA 5DURD 4PJ5A 4HCRH 2ZCHL 4NNYB 4YDLB 5SX4I 1G9EA 4GRLA 1JF6A 1I1AD 4I3GA 4MLIA 2CLRB 1T1WB 4W4OC 4TUJB 2EDYA 3OQ3B 5IM7B 5F8RC 3PDOA 1CFNB 4RWYL 1SEBB 2RIKA 4CKVX 1FV1B 1NMAH 4D0BB 5FKPA 3GRWH 3MRDA 4H0GA 2PO6B 1AGBB 4LLMA 1O0VA 2BNQD 3QNZA 3KPLB 4LSPL 3VWKC 4IRZH 4XP5H 5A16A 3C9NB 4JR9H 4R9HA 4X5WA 1FGVH 1MHHA 4FA8A 1MHCA 3AFLA 3FHQA 3KG5A 3LMJL 2DJSA 1FZJB 2IH1B 3KJ6L 1JTOA 2FJFA 3CFEB 3WS3A 5HHXL 4DCQB 3HG1A 5JXAL 1TCRB 4PJ8B 4PJ9A 1JUFA 5T3ZL 2RJMA 2VRAA 1ZVHA 1Y18A 1K2DA 2XFXA 5MHSD 3KXFB 3T0ED 3CXDH 5DT1L 3EFDL 1I8IB 2P44B 1QLFA 2YR3A 1T1XB 5TE7L 3GKWH 1INEH 2LAGB 2FATH 5DJCB 2VITB 4OJFH 1ZVSB 4P4KA 5F1NB 2J12B 1N6UA 4OT1L 4RMRA 4MS8C 5H35B 4OI9A 1GGIH 1D6VL 5DJZA 2YRLA 1KCSH 1JWUB 4QXWA 1HXMA 4TSAH 3DIFA 3ZE2F 5INDB 3WNMA 2D31B 3PV6A 4NQSB 3IJYB 3MOBH 3GRWL 3B9KC 4GXUN 2YS4A 2DDQH 2N7AA 1IGYA 2XA3A 4LEOA 3PWNB 1JPGB 3O6KH 4YWGH 1EDQA 3DTXA 1V8HA 4WI2A 4LK4A 4WW1A 3D2UB 4NC1E 2Z93A 1CGTA 3ZKXC 5J57B 4HBCH 5EUOB 3OXRA 1BQLH 2RB8A 4HD9A 5EBWA 1MAML 1K5NB 4HH9A 3QUYD 2MKLC 3ARGA 3DHMA 4YNYA 4XVUC 2J3SA 2EDWA 5B22A 1MWAA 4HWEL 5E2UL 5KJRH 4N8CL 4C58B 4JGJA 4KJPD 4OFDA 3VXMB 5KANG 4U0QB 1FG9C 1KYOK 2AGJL 2AJSH 5DT1H 5K9OB 3NZ8A 4F7MB 2J8OA 2XTJB 2ERJB 2NY3C 4YHMH 1NEZA 2BP3A 4XNMB 3S4SB 3LKSA 5MEOA 1G7MB 3WCYA 4PBWD 3WNPA 1OLLA 1M7IB 3TH4T 1R3LB 3BE1H 3HMXA 3SJVE 2VLKB 4XNYH 5E6YA 5M95B 2V2WB 1YUHA 3QIUD 3BZ4B 1Z9MA 5HHOD 1XMWA 1KIQA 3WHXA 5JUEH 1N59B 4ZO9A 1MEXL 2Z91A 3GM0A 4DZBB 3KPMB 3N9GL 2Z8WC 1MJJB 3NABH 2BVOB 3VI3E 3EYSH 2A6IB 1PKQB 3ILPA 1HH6B 2APFA 1QD0A 5LWYH 4KGJA 3WFDL 3I6LE 2A1WH 5L6YL 4L9LC 1H5BB 4KPHL 5LBSL 2WUCL 4LL9A 2E7MA 4KK5C 4QEGA 4QRUA 2GKIA 4U1JA 3EYFB 3PL6C 5CEYA 3VXOB 4JO1H 4JQIH 4P57A 3TN0A 1FLRH 1LP9E 1LO4L 1R3LA 3TGXA 1JHLH 2HYMA 2ZUWA 2D9CA 3TNNA 3OKDB 3LH2H 1NMBL 4RGNB 3AGVA 4HUKB 5I1JH 5IB2B 3UYRL 5K9QI 3P4NA 3ULUE 4LCYB 2BSTB 2RQ8A 3SCMA 2YD1A 4LARH 4OLEA 3MRHB 4U6HA 3E8UL 3FQXA 1XIWB 5JQHC 3KLDA 1VDGA 3NA9H 1U8KA 5DHYB 5DI8B 3RUGA 1H5BA 1QRNB 4N9GA 3AB0C 2B1AH 1QBMH 2CLVB 1HIMH 5MEND 1Q0YL 1WWAX 4TYUA 1AC0A 5CGTA 1PKQA 4R26L 5T1MB 4YHOH 1MJJA 3BPOC 2CLZA 4D0CB 4HUVA 2V2TA 3GSXA 3BKJL 4NCC1 2EDOA 4U1HB 3GMQB 4YHPB 2CR3A 3GBMH 5EC1B 4HWBA 3QDJD 3U4BH 4EEEA 4K94C 3J8F7 3QBTB 4L3CB 4X6CA 5DJAA 5C0AD 3W9EA 3SGKA 4YO0B 1EPFA 1VFUA 4LMQI 4LSUL 4XNMA 1D5XB 1EHLH 3ALPA 4NNXA 1M05B 3VWJA 2UYLB 2NW3A 3CUPB 4RBPH 3PL6D 3EW3B 4Y5XC 4L8BA 1MVUA 4IMLB 4IMLA 1CGYA 3G6AB 1FDLH 1JN6A 2XZAH 3G6DL 3T0XA 5TF1H 3O8XB 5FO8A 2X89D 3RI5K 4QRQA 2VLJA 1NLBH 2P4AB 1N26A 3V6ZA 1TJGL 2ZUSA 4LQFL 4Q9RL 2JB5H 4P9HC 3DPBA 2AERT 3BVNB 1AGDA 5C0FB 4E5XB 2QHRH 2Y5EA 4Z7NE 3MJ8B 3QUZD 3U82B 2PO6D 2GITB 3IJYA 2C4FT 3B2VH 1IAIL 1SEBA 4X6CB 3EYVA 5IF0A 2R0WH 3TESA 5HYJE 1UWEH 1BF2A 3MOAL 2JIXB 3DHJA 4JRXB 2XOTA 3VXNB 4HV8B 4MNQD 3WHE0 1DVFB 2KQMA 4UDUB 1IGMH 2HKHH 3BYYA 2APTA 3KXFD 4NOBA 3QNXB 3OXSA 2WBWB 5SV4A 1OP5H 5IW1A 3KXFA 2DOCA 2EYSA 3RHWF 4N9GB 4LCWB 4PRNB 4YBQD 2WUBH 4ODWA 4MJIB 3CFEA 3D0LA 4WI4A 4K3JL 3SO3B 3IFOA 5F7FA 1W2KT 2P8MA 2FD6L 4L4JA 1FG2A 2X4TA 4QT5A 2Q3AA 5I1KL 3G5ZA 2LTQC 4IRSC 2K3TA 4XCNA 4PJFB 4GAYA 3MRCB 3HMWH 3QEUA 5HYJB 2JCCA 4D0DA 4POZC 2YC1A 2HTKC 1AHWC 1GHFH 4HGWA 3L3HA 4UBDD 4XRCB 2ATKA 4NQXA 4JRYB 1OSZB 2VDOH 4JG0H 2E7BA 1U58A 1MRFL 1EA9C 3FFCB 1NFIA 4UIKH 1R3HB 4KKBD 1A7OH 1LP9A 5D7LE 5EOQL 5BVJA 5CJXA 2Z4QB 4IHOB 4MD4B 2EYRA 3VXRB 2H2PC 3ISWA 2YD9A 3K7UA 1X4XA 2ATPB 4KUZL 2YUXA 1E4XI 2BHZA 2HFGL 4Y5YB 1S7WA 3K80A 3BISA 4XPGL 2ZWLT 4M7ZB 3LKSB 1FYTD 2FX8H 1G84A 3JUYA 5SX5K 2BCKB 1NGPH 2XPGB 3MNWB 3ECBA 4M7KH 5DR5L 1EO7A 4LSRH 3TT1L 2KPNA 4TUKL 4IOSD 5DRNB 4PY7A 2YSSA 2ZUTA 3HG1D 4JZOA 4ZFOB 5I1DB 3NACL 5C0IA 2J8HA 4CUCA 4HMDA 5FCUH 4BQBA 1FNLA 2UZIH 4CW1A 2YD3A 3WE6B 2XKUA 3EYQC 4HGWB 4R4BA 4FQXB 5K59E 5HJ3A 5KSBF 2QSVA 1QRND 5FYJL 2Y36L 2IADB 4Q2ZB 4G42A 1CWVA 4RMTA 4HWEH 4ZAKD 1UB6B 4F58H 3BFOA 5D9SA 2W91A 2JTDA 4V2BA 3NIFF 1I3UA 3RX7A 1RU9L 2FO4A 4KQ4L 3WUWG 3EKCA 1IGIH 4CNIA 1FG2B 2ENYA 4X6DF 4ODBD 4CDHA 4MA1B 5BRZD 1LE5A 1I75A 1RUPL 1AO7B 4L8SC 5DVLA 2DRUA 4OM1L 2AJ3A 2RGSA 3H0TB 3O4LD 3O6FB 4MB5A 2V7NB 2CXGA 3T3MF 4Z76A 2JCCE 3EZJB 4JFYA 1FBIL 3BW9B 3V7AG 2F5AH 4P5TA 1FC2D 1MFAL 1DUZA 4FXGB 3RA7H 1AKJA 5LGJA 3WXVL 3FMGH 3H9SD 1F4WH 4WENB 3L5WB 1EO8L 4QHMB 4ZFOA 3IXTA 1C5BH 1W0VA 2HJKB 5HI5D 2FATL 3RPKA 3SKMB 1FL5B 2QR0B 1AE6L 4DGVH 4AG4H 4CMMB 2X4UA 4LKCA 1H8OA 2X42A 3PUCA 4PRPD 4ORGB 5ACMA 4XAWL 4JKPL 5CIPH 4QHLA 1KT2B 4KY1L 3PHQA 3MLXL 3C5JB 3DVGA 1NFDA 2MFNA 2Y36H 4LHUA 1BFVL 5FKPB 3KLHD 1OAZL 3WUWA 2XXCB 3UZQA 4MD5B 1PY4A 3O0RH 5F6HJ 5HPMB 4X98B 3B8YA 4WI9A 4KK5D 1M6OB 2NX5A 2QQQA 4MQTB 1ZLSH 5FYJD 1OAKH 3S96B 4K55A 1RJYA 4EI6B 5DQDH 5GS0H 4KRMB 1KEML 1JGEB 5ID1B 4AQ1B 1A14L 4NNYA 3EFFB 4NUGL 2A6KB 1NDMA 2NY3D 4H8WH 1N2RA 5TGBB 3VFMA 4TRPH 2J4WH 2Q76A 4KROC 2APWA 4XMLL 3QCVH 3U0PB 5TE6L 4KVCH 2G2RA 4JHWL 5I1GH 3MYZA 3GO1L 1BVKA 2QHLA 1QR4A 3A6OA 3HNTL 2MPAH 1D6VH 2GAZB 3GSRA 3WN5B 2FIRT 1ES0B 3ZHLA 3CSYB 4DVBB 3E2HB 2HFGH 2BY1A 1XCTA 5GRYA 4WW2A 5CS7A 3LZFH 4QOKD 3O6LL 3VGAB 4YE4H 4XNQA 2MCG1 4FMFA 4WTXA 3V8CA 1N6QL 5I1IL 1MVFA 5F3BA 5F1IA 1I9IH 1JFQL 4U6YB 2QR0A 1RIUL 5IEHA 2OMNA 2HJKA 3BQUB 2YUZA 1KTKE 2I60H 1JZ7A 4X9BA 5FA3B 4JY6A 5L7XL 1JMXA 3OKNB 4JZJB 5EB9A 4WO4B 1ZHNA 3P9WB 4MX7B 1E6OH 4TVSa 2XRAH 4KMLB 4PJ8C 4S10A 3ESUF 3OR7B 4LSSL 2ARJA 4HJJL 4PJXB 4JRYD 4NPYA 1VACB 4YUEH 5C0EA 2XZAL 3U2SA 3HA0A 3UBXG 2QSQA 3BP4B 3BO8A 1WC7B 2MPAL 1DQML 2DLGA 4I77H 4X6EA 5IMLB 2DIAA 5IV2A 1A4JB 1CFVL 4LVNC 1F6LL 1JHKL 3VXTA 4CNIB 3DX8B 1JBJA 3OKDA 3D9AL 2XWTB 3I3DA 3NFPA 4ZUTA 1HHGA 5T1LA 4A2LA 4H26A 1A02N 1YPZA 1AGDB 1T0MA 3EYFA 4WFGE 1K4DA 4LLWB 4WV1A 3DOSA 5B39B 5CHNB 1UXWA 5C2UB 1IGTB 3ARTA 2ZG2A 3B5HA 5I66A 3CFJB 3KPSA 2DLFL 2BNRE 2FWOB 5IBLC 3PGCA 4PJAB 4NDMA 4Y5VA 2DMCA 2AEQL 3IFLH 3CSGA 3ZKNC 4PBVC 5FECB 4I18B 4KI5D 4X7SL 1WTLA 12E8H 4D9LL 1EAJA 5KVEL 5E8PA 1A6UL 4K07A 5CP3H 2DLTA 3O3UN 3HZMA 3MFFB 2NCMA 3VWJB 4LP4A 1FO0B 3ZL4H 2J6EL 3WLWC 5J4MA 3U36B 3AS1A 1S7SA 1CICB 3WNOA 1C16B 3FT2A 5CGMA 1TVHB 1A7NL 2CGRH 5C08B 2V5TA 4UTBH 1S7WB 1EMTL 6CGTA 2I9TA 5BRZE 1F11A 2NY1D 3GI8L 4OZHF 1ZGLA 1IL1A 2WBJB 4F7MA 3O6FC 5DMKA 2XZCH 4Q6IC 5DRWA 1UYWL 1O7VA 3EO9H 1X5IA 4EN3C 2LU3A 3UO1H 2IQAB 2CIIA 1FYTA 1YMMA 4G8GD 4NQVA 5I66B 2NY0D 4I5BB 4HH9B 5FUCE 4NM4L 4HXBL 2FNBA 4L8CB 2WWKT 4OF0A 5LCVH 4QRTB 1FFPA 5FHBH 4JGUA 2CDGB 2DAVA 3GIVB 2QTEA 4D94A 5C92A 5C07D 4HIJB 1VKXB 2AAVA 4BQ6A 2IFFH 4PJFE 2NXYD 4NGHL 5B3JE 5DURB 5HBBA 5GSVA 3VH8G 3PQYE 2VABB 5JUEL 5HI4D 1XGRA 4Y2DC 3NIDE 2NY6D 4PGDB 4YBQC 1QFWL 5B4MC 5JOEA 4ODWB 5BZWA 2YBRB 3QDGA 1C5DB 4LSRL 3HUJE 5JHLL 5IW1B 3H9SB 3H9SA 4KTEL 4EQ3A 5HI4C 4JM2C 3MLYH 1JUFB 3LV3B 1Q94A 5CKAA 4U3HA 1IZKA 3WS3B 1XF3A 1A8JH 4F58L 4P46B 1I8LA 4Z7WA 2EDJA 1L9MA 4A6YA 2F53E 1F4YL 3EDJA 2V9RA 4GJTB 3A67L 3FAWA 1G6RL 3MC0A 5TDOB 5A2IH 1EZVY 1IEBB 4LGRB 3W39B 4QHNA 2R0WL 5C0FA 4ZTPL 4KDWA 1CGXA 3HAEH 4OZFG 4MA3B 4LAQL 5MERB 3MR9A 3MSPA 1S9WA 3SDAB 4MXQD 1UGNA 3VA2C 4KZDH 5I1HL 1RMFH 4OD3H 1FSKC 4U1LB 1NAKL 3O8XA 3NN8A 4GS7C 3WO4B 3G6JF 3BN9D 4X4XA 1O7SA 3VGHA 3ZSSA 4IM8A 4Y8DC 1MJ7H 1RHHB 3KWWA 1A7BA 3MODL 5E1HB 2XQYG 3L7FA 4J23A 4FQQB 3CUPA 1YEHL 5T5NG 3LKNA 3LIZL 3CLEH 4PJGE 2I9TB 3SQOH 4C56B 2ZCKH 4B7IA 3ZL4L 2UVEA 2FD6H 1K3IA 4N5ED 3WYRA 1W0YT 2R2EB 1FL6B 4JFHE 5IMOA 2OP4H 4JPIA 4LIQL 5L2JA 3QXUA 5INDA 4LHJB 4XXCC 3RTQB 1H3PL 3E2HC 4XMKH 1QO3A 2VITA 1A7PL 1NGXA 3KPPB 4IRJB 2Z9TA 3DYMA 4PP2B 1GZQA 5I1GL 2EC9U 2X4QA 1KB9K 4ZSOA 2L7JA 3GKZA 1EVUA 4J7RA 1OAQL 3FRPG 3O4LA 1Z6JT 4WV1B 4WVRA 4DKFL 2CDEA 5I8EB 2OL3B 3AS2A 4DGYL 2YK1H 4JJ5A 1FZJA 5BXFB 5KS9F 4I0PB 5EO1A 4M8QB 5GGSB 4OCYL 1F4XL 1LO5A 3SCMB 4F57H 4PP1C 4PGZA 1BBDH 4UV7H 4NZDA 4DOHB 4PLOB 1MOEA 1VPOL 4XBGA 4KC3B 3K46A 1NQBA 1KNOB 1B0GB 2GK0B 5A3IC 4GG6E 4EI5D 1OWRM 3I2CH 2CQVA 3Q6FB 3SE8H 3GSNA 4HUUB 3LN5A 3KLAA 4RAUB 4RFNC 2NY5L 3GBLA 3CH1B 4QRUB 4XWGH 1NH6A 1JNHA 4EI5A 1RUQL 4OD1L 2Q8AL 3CXDL 4WO4A 4NO0D 5EIIA 4FABL 4U7MA 1JFQH 4Y4KD 1UM5H 2DQTH 2C9AA 4XVSL 3RGVD 3JVGC 2WIIB 4N0CC 4WEMB 1RSFA 5FIEA 3RVVD 1C7TA 1LVEA 4Z7OE 3ALWA 4U0RC 2ZKHH 5HHQB 3VG0L 4AEHL 3GNML 3HR5B 3VWJD 4R8WH 2VH5H 3BXNA 3CCHB 5I2IB 4ODUB 5FCSH 5FDWB 4Y19D 4AMKH 4G8IA 1P4IL 3T0EC 3WSQH 4NYLA 4QTIL 4H5SB 1RUPH 4F9LA 5E9DA 1KBGL 4GLRH 4X0KA 5E6IA 3QG6A 1ZOXA 5LVEA 3N0PB 5A2JH 1HI6A 5FM5M 4LLQB 4OQTA 3TA3A 5DHVA 3X17A 3O4OB 1FGNH 1WFOA 5IOPB 1KLUB 2VZ1A 5K9OA 2NXZC 5I74C 1EUTA 5SWSA 5HYQB 5L88L 4YZFF 4LCUB 5CIPB 2EC8A 5GGRA 4OCRL 1TTFA 4JM2F 3TA3C 1X4ZA 2X4NB 4F37K 2H8PB 3IJHA 1ONQA 1LEKB 3GBML 3LS5H 1A64A 2BDNH 1GGYA 4JVUA 4WI6A 3F8UB 3SDXF 3QHTC 1RD6A 2C26A 3LY6A 4LSTL 1VFOA 4NJAL 3MRRA 4XZUB 3TA3B 2CRZA 2DTML 4ETYA 3B9KB 1AXTL 3N06B 1KELL 1UM4H 4FQ2H 5HD8D 3PWPE 3O45A 4E0RA 5ITFA 2D31A 3EJZD 3IRPX 1JZ5A 2FHBA 5H8DA 3JV6B 1A4KB 2IPUK 1YNTA 4FTVD 5BS0B 3K8MA 1IQWL 2A74A 1QLRB 1MFCH 2XQBH 5J9PB 2FX9L 2BSSA 1CFBA 4QXGL 1C12B 1NAMB 2WSKA 5GGUA 1T04B 1XF5A 2H32H 2Y9RT 4PJ7F 1NMCB 1KCUH 4GRMB 4ZODA 2V7NA 5BOZG 1B3JA 3EFDH 3BHBB 4K3HA 4D8PA 1G7HB 3OF6A 1RULH 1R3IH 2IMMA 5BVPH 3T77B 2YOCA 2Y06L 3T2NH 1F5WA 3S5LG 3PGDB 5DD6A 3D85B 1P4BH 3OAUH 1IT9H 2FJHA 4LLMB 1CDCA 1PG7L 2O5XL 2ADIA 3HAEA 5FHAH 5J89A 1FNAA 3TF7C 2H3NA 3WEXB 2X5PA 3HZKA 3GSUB 3NPSC 2FZ3B 1HK6A 2OM5A 3TNMB 1OW0A 3Q3GA 5EULV 3HB3C 1J5OH 4N1HB 5E00B 3Q0HA 2KZ1B 4L8BB 2C1OB 2D7MA 3L6FB 2QQNH 2YPKB 3RTQD 1TZGL 3QIWB 2GI7A 4OBRA 2EE6A 3E6HA 3RP1A 1DBBH 3HE7D 1GZQB 1S9VB 2GTWA 5C09D 4XP9H 4XHJD 5IESH 2PYEB 4JHAH 1AFVH 4WI7A 3V0VB 1S9KC 1OAQH 3EDFA 3SGEH 5IKCA 1EJOH 3HE7A 3K0WA 1A9EB 1VEOA 1D5XA 1A4KA 1Z9OA 3SDCB 4AENA 4KUZH 4BQ9A 1EBAA 2MHAA 3RWEA 1AGCB 4S11A 5I17A 4YHPA 4H0HB 2Z8RA 3MX0A 4G43A 5D7LA 1T89C 2J5LC 4PRBB 3DMMD 3LKQA 5CCKL 4GSDH 3P9MB 4ZPTB 3E1F1 5CJOH 2XWBB 2RCSH 3IGAB 1TQCC 2D7PA 1MRFH 3W0WB 2MWCA 4YR6B 4KK8C 3VWKA 1RJZA 2X9YA 1YEIH 5F96L 3MMEB 1IARB 4HK3J 5EFIB 3LEVH 2C1PB 4BK4A 4QF1B 2XNAB 5E5MA 2F8OA 5K93A 4BZ1L 1E4WL 1S78C 1QA9B 2ATKB 1T2XA 3SQBA 5EU3B 4G6JH 1QSED 1LO0L 3OKKA 4KXZH 4NHUA 3BPLB 1ZT4A 1FRGL 4WO4C 1XGTB 1RK1B 3TPUB 4KU1A 2EH8L 4Q74A 1EEZA 4H1LG 3VFPB 3GMNB 5E6IB 3HB3D 3IU4L 1GIGH 2C4FU 3ARBC 4HWZA 5D1ZD 5DLMH 3QH3A 3CDFA 4G3YL 4UQ2A 1HQRB 3FN0L 5ADPH 3EOTH 4LSUH 3NBNA 3CX5K 1V3LA 3B83A 3VXSB 2XZZA 5HI5C 1ORQB 5I1IH 3RVWD 1OP9A 2SEBA 5I30L 1N3NB 4GUPA 4POUB 5AWNH 3UEZA 3P4OA 3KLSA 5J3HC 1D5ZA 1A5FH 5IHUH 2HKHL 3UPRB 3GHEL 5EZOH 3BPOB 1YECL 2X4SA 4JDTH 5GISL 2FB4L 2XWJA 4HS6B 5DHXB 3IT8D 2NY1C 1G7LA 4N1CA 1MI5E 2AXFA 4JKMA 3ARED 3ARBB 2HFEB 3CH1A 2O5ZH 2SEBB 4HK3N 5E2VL 2V2WA 4WCYH 3BN3B 3VFVB 2ILLA 3CFDB 3TVMA 4P2OD 5SX5H 3UJIL 4WU7A 2R0KL 2VDQH 3S36H 1P7KA 2E27H 3ARDB 3JWOC 2VLJE 1NBYB 1CGWA 3ZKND 4PRAB 1MCQA 5D1XC 4AEIH 4I0PA 3MRMA 4PREA 1BECA 1L7IH 1UKQA 4M7LL 1NCWH 1IGJA 5FO8B 1CDBA 1OF2A 3QI9D 1NAKH 5E08L 3OHXB 3ARVA 1A3RH 1HSBA 1DUYA 2QSTA 3GNMH 5D96C 5L6YH 3MMEA 3GSWB 4FFYH 5EUOA 4RFEA 6FABL 4MJ4A 1Z9SA 5C86A 3X3FH 2AK4E 1IMHC 3OGCB 1V3MA 4Y4HA 5DMKB 2OTPA 1IEAB 5CMAA 4RWYH 5E99H 3OB0K 3LCYA 1G6RH 2OTWA 4KXZI 4P5KB 4YO0A 3QFDA 5LJYH 1AXIB 2HT2C 4TTDD 4XCCL 4CBPA 4FNLL 2AJVL 5BO1H 2OZ4L 5E8EB 1SHMA 3QJHA 1B4JH 5DTFB 1K3ZA 3B3IA 3VRJA 5DMGD 2CJUH 3MGAA 5EO0B 1PFCA 5GRJL 4P9HL 4FQQA 2DQFB 3DUUB 1S7UA 2K7PA 1W0WA 4YX2H 5GGRY 4QRSB 1MCOL 3TT1H 1S9VA 3IS0X 1AY1L 4R97C 5L8KB 4LPTA 2IC2A 3H8NA 1FAKT 4KMTL 3PGCB 1YQ2A 4PJAA 4Y5VB 3GK8L 4RQQA 4LSTH 4CADA 3RUGB 4ALAL 1BD2A 1X3DA 4HIHA 4NQEE 4QNPF 1PX4A 1A7RH 5D4QA 5E94A 4F7TB 4JFQA 3BAEH 3U1SH 1Q8MA 4FXLA 4WUKL 3RY6C 5CZXC 4QHNB 5F89A 3SGKC 1AGFA 4KJYB 5D6DC 4JCMA 4K7PH 4OM0H 5GJSH 5D2LF 1GVIA 5DYOB 4WWKB 3M17B 1KLFA 5HVWA 4ZUVA 4HJGA 3IDGB 2DDQL 3D9AH 3SE3C 2R4RH 3QEHA 3HNSL 4TOYH 1MREL 2AXHA 1CGSL 4HS6A 3QUZC 4EJ1C 1OLZA 2GJ6A 1NEZG 4Z18A 1U2CA 4BZ1H 2ZPKL 4NBZB 5A2KH 1T21B 3RNKB 1VGEH 3BZ4A 3QXVA 5EBLA 3GSOB 4HWBH 1DQLL 1GOGA 4G9FA 4AH2A 5EO0A 1A9BB 2AV7B 2VLKD 4QHKJ 4YC2B 1D7FA 3W11D 4CN6A 2DQCH 3VWJC 4U1IB 5T1DL 3JZ7A 2YD4A 4ZPVB 3QG7L 4RMVA 5I8KL 3QFDB 1J0IA 5GGTL 4ODSL 2VB5A 5I0DA 5HY9A 2KQNA 4I2XB 5GZOD 4HUMB 4FTVA 4YXKH 3PHSA 1YY9C 2F54B 1TZIB 5C3LD 1CICD 1A1NA 1QHPA 1KIUA 1NSNH 4FFWC 1VERA 1N2RB 2ICWA 2KKQA 3W9DA 2BVPB 1ZAGA 3BOVA 4HFUH 2Y7QB 4P4KD 1CD0A 4C55A 1QFOA 1L7TL 4LSVL 3MRKA 2R1XB 5C0ND 2EXYD 1IGYB 4I3SL 1V3KA 2IAND 4HK0A 5D71L 5A1AA 1ITCA 5H37H 4N68A 3GZKA 5C6WH 5IHZB 3S5LA 3PHQB 4M5YH 4RGMC 4F9LC 2DWEB 3BGAA 5ISZA 2A6DB 4UTAL 1A6ZB 2ZCLL 3WXWH 3UTSE 4EOWL 1RUML 1JPSL 4GBXD 1FJ1B 5HDBE 3MLSL 3L95B 1I8IA 3RZCB 3VG9B 1AXSA 3O6MH 3T4YA 4HWBL 4OFVA 1HHJA 2YD5A 4ZO6A 3RGHA 1AIFB 3RWHA 4OZFB 5T3XL 1WCBA 5EN2B 1QVOB 3SDYL 4U31A 4JY4B 1MHCB 3OSKA 4RIRB 2NY6B 5DWUH 1K4DB 4LLWA 5DC0A 4MCYA 2NY4D 2WW8A 1EFXD 2RHEA 4PG9B 3NH7L 3TIEA 3INUH 1KLGB 2VDML 3ULVC 3CLFH 2CK2A 3MZTA 2YPVH 2DF3A 1HH9B 3ARSA 3MRKB 3QDMD 3VFPA 1KB9J 3TBSA 1PD6A 4ONOA 1IFHH 1ZT4B 1DBMH 4KROB 1AQDA 4XCEB 4XBPB 1OP3H 2IFGA 4RRPG 4PS4H 1R5IA 3BD5A 1A6TA 5TQ0L 1OAXH 3C09B 3FOMA 5C8JB 3RKDD 5F7DB 2AQ3A 1N5YH 12E8L 2HP4A 4NQED 1YECH 1TQBB 4ZAKA 4NM8L 3RBSA 2WV3A 3SDXA 2VNCA 1SVCP 2FIKB 4JN2B 1S5HA 2IBGA 4OGAC 4Y4HD 4U6YA 3WFEL 5JPMB 1BFVH 4LU5H 4OCRH 3SOBH 2O61A 5FB8A 3FFCE 1S3KL 3TH2T 1AH1A 2XWBA 3WKNA 1C5CL 4XNQB 5D70L 4E0RB 3HNVL 3IKCB 2W0FA 2W0FB 1T7WA 2VDMH 3B9AA 4YQXH 1FNEB 3ARRA 3MA9H 1FAIL 1UADC 4K8RC 1W8NA 5HI3C 2WIMA 3G5XB 3KPSE 2EIZB 3REVB 1OPGL 3MRIB 2BOCA 2Y6SD 3PP3K 3QFJA 4NC2B 3U0WH 4XVUD 1SJXA 3GMOA 1TXKA 4JFHD 1RJCA 4Z78B 3TO4B 1T66C 3HMXL 4IDJL 4XNXH 1OAYH 3CJJA 1I8KB 4MJ5B 2W38A 1BJMA 1CXHA 5GRUH 1AD0B 1AD0A 5ESAA 5ESAB 3V5DA 3VRIA 4U1KA 1BZ7A 3OX8B 4NQDE 4S2SB 4XBPA 4XCEA 1A3RL 2H45A 3BUTA 1UM4L 1BIIB 5IOPA 4L9LB 4JO4L 1R24B 1S7XB 3UTPD 2YC1B 3KPRD 1FN4A 2GFBB 1MCHA 4MAYD 3MV9E 1SM3H 2VLKE 3G5XA 4OKDA 1Q1JL 1CFQB 2HT3D 4TSBL 2VL5B 1ZT7A 4BSVB 1L7IL 5HHNB 1IM9B 4PUBL 3GMMA 1WZKA 2VZ3A 3DVGB 3DGGA 2E6JA 4P5MA 1ACYH 2BVTA 4WFEE 5F71A 1YN6A 1VPOH 2QKIA 3SE4C 1WF5A 1B90A 5L9DH 5BV7H 25C8L 1PBYA 3HI1B 2B7DT 4R6UA 1Y0LA 4I0PD 3AY4C 4I48A 3WV0A 5F7HA 3BKML 1Z9LA 4LCCA 4Y16C 1ZA3A 2CJUL 1CDHA 4E9LA 5JW3L 2OI9C 1NGPL 4YBLC 3D48R 2YK1L 3SO3C 3BI9X 1CL7H 5MENE 4S1QL 3NTCH 5T3XH 4APQC 1UQSB 3T3PE 4DJMA 3U4EA 1J0HA 3ARFD 4LRNH 4GKZA 2A6DA 1NBZB 2AEQH 1B0GA 3E6FA 4KK8D 3W81A 5BS0E 5KVFH 4R8WL 2K9UA 5KTEH 3WS6C 3QHZL 1D5MB 5SWSD 1MWAL 4JDVA 1Q9LA 4XBEL 1JTPA 2C5DC 3TLRA 5F1SA 2XN9E 5IQ9B 1I1FA 4G3YH 4G6FD 4HXAH 1H3VA 2CDGA 5IGXH 5T5NF 1FVDB 1EHNA 4AQOA 2R29H 2IADA 4OGXL 3W9DB 3HI6L 3MACL 3DBXB 5TE4L 3KYKL 3H7LA 4YHIB 3AMKA 1UYWH 1BBJA 5JW4N 2F54A 3IDXL 3HNSH 3CVHL 4TOYL 3F5WA 1AXSB 3OKEA 1ZT1B 4GBXB 2OQJB 5DD5L 2A38A 5HY9B 2ZNWA 2IPTH 4PUBH 2BK8A 3UTTB 5EU6E 2ESVA 4Y2DA 5D2NE 4ZFFB 1KPUB 3M45A 4UNVA 5GRVL 1FFOA 4KHTH 4NNXB 1N0XL 5FYKH 5GS1C 5EUOF 1PQZA 4W6WB 1JRHL 3QDJB 4Y1AD 3O3EB 2X4RA 4YE4L 4MNGA 4ZTPH 3ZE1F 5CJOL 3O6LH 5EU7C 1NL0H 5TH2B 4W6YB 2IANA 4Z0XA 1OGAB 3D39B 4S1DC 3ES6A 1JCKA 4KKLC 3O11A 3U7AA 3QR2A 1OD9A 2R2CA 2FJGA 4R4FL 5TQ0H 1IGML 4U1LA 4QWWD 4PJDF 1D5ZB 1R3KA 4YHOL 2X9WA 2CXKA 4K94L 2N56A 1RIVH 3C5SA 5E1AB 3NPSB 5DYOA 3UYPA 2XI9A 1RURH 1INQB 4ZTOH 1EVTC 5F72S 4XPAH 1IEBA 3LRHA 2BXZA 3NCMA 4LCYA 4WY7H 4Z7VB 3NCBB 5DZNA 5I76A 4FNLH 1NKOA 2NY0C 3O3BA 2HWZH 4XCCH 3OKLA 2RBLA 3NIGF 4L4VE 5E8OA 1B4JL 1B2WH 1BD2E 4F7EB 2C4XA 5GRZA 5T3ZE 4TPRH 5E94B 4JRXD 1OARH 3VFNA 4GQPH 3FO1B 4UAOC 4PYHA 3P30H 1Q9OA 4DZ8A 3WNLA 4QRPA 3VFRA 3PXHA 1B0WA 1SYVB 2QSCL 4JFPA 4Z7VF 1JPST 1WITA 4MNGE 1DBKL 5JPNA 4PP2A 3D69A 4X99B 1NCWL 4N8PA 5D7LD 3FQTA 1F3DH 4R90L 1RZGA 5L2KB 4Y16D 4N0YH 3VW3H 4U1MA 1G7PB 5FV2A 5LWYL 4KRPD 3TPKA 5J11B 4M5YL 3DURB 4PD4K 4UT6H 3TYFA 4K3DL 5D7SL 5CLWA 4MA7L 1C08A 5D7KE 5HVHC 5GS0D 1RK0A 4JLRB 4OF7A 3O2DA 5E70A 1A7NH 2ZOKA 2G5BA 4XPHL 4DW2H 3EBAA 5JR1H 1DE4A 2VLRA 3CDCA 5CLTA 1MCWM 3CZJA 2MQCA 1S7TB 3MRQA 3RIFF 5I1AB 4WI8A 5C0JB 4GBXA 1HZHL 4NN5B 2H41A 5AD0A 1MIMH 4M5ZH 3EHBD 1OB1B 4YNYB 2HLAA 2MJWA 3BRGC 4ZOAA 1YYMH 1KC5H 2AK1L 4IS6A 2YA2A 2YA0A 3Q1SH 2Y5TB 3TNMA 2VXQH 4KMTH 1J8HB 4CN1A 4M02A 3DTXB 3MLTA 4KHTL 4Y2OA 1WSST 1MCFA 1ZLUH 1LDSA 4HPOH 4DWHA 4XC1H 1P1ZA 1WJ3A 5E6IC 1MCKA 2YD2A 4NQCD 1UM6L 3HZMB 4H8WC 3X12B 5HGBB 3WUZA 2JK5B 2V2TB 2GUOA 1IQWH 1ED3A 5FKAA 5K9KA 3O8XC 1F00I 5FYLL 2CKBL 4E42A 5LGJB 5E6ID 4I4WB 5EC2B 5SWZE 3KPSB 1TETH 4XX1G 4JFFD 1MUJA 4M93C 1C5CH 4PJHE 5HI3D 2X7LB 3QCUL 4QRPB 3VFRB 3P4OB 1A6PA 3FO2B 3GJEB 3I6KA 4QGYA 1RZKC 3H9YA 1IAIM 4OM0L 4PRPE 3TT3L 3OAUL 4F33B 2BNQE 5J1SC 3O45B 1HEZB 4YHML 3OKOB 1RJLB 3SCMD 4OCXL 3QIBB 4HBQA 5IB2A 2NY5H 5ANMB 4Y1AE 4MS8D 1A5FL 2YKLL 3CFDA 3D18A 4P49A 4PRHB 3TVMB 3LQMA 4XC3H 5EU6B 1IC5H 1S7XA 5E1AA 1FH5H 1UC6A 3CFBB 1FFPB 1ONQB 2YMXL 3B9VA 3ARPA 5DK2B 3L1OH 1RZFL 5AZEL 2VDLH 5JA8B 2D3VA 3LQAL 1QR1B 1T03L 1IGFL 5GS0C 1XGQB 5IESL 4OIIL 5MHSE 1IE5A 4H1LB 3SDYH 5FO9B 4JFDA 1CF8H 5B38A 1F6AA 3K2UH 2E7LA 1RPQA 5HVHB 1M7DA 5F9WB 4JPWH 2AK4D 3FB7B 5IVXA 4K9EL 1YY9D 4X7DC 3CH8A 1I1AB 2VDKL 4GSDL 2IFFL 3VE0B 5BW7C 4X9HA 1BD2D 4C4KT 2CD0A 3PWUB 4KI1A 1NCTA 3L5XL 3EHBC 1H3XA 1J7VR 1GC1L 3HLAA 4NHUB 4YC2C 3ULUL 1P7HL 3QCUH 4IJ3C 3I50H 2J5LB 4IDLA 2FECL 4LVNB 4Z7WE 5I8OL 4WUUD 1GHFL 1RHFA 1YEFL 1JNHB 1BX2A 1KB5A 3ULUF 3GMLB 2CIKB 3A6BH 3S88H 1CE1H 5EFIA 5D93B 3UJTH 3GJFK 1UXWB 3QQNA 5JDJA 5KN5B 3P0YL 5B8CB 1I7ZA 1KNOA 3WIFA 5HPMA 5D6CB 1V7NL 3T09A 3GJFA 1OQXA 2DKSA 4ZNCD 5D7LB 1I1FB 4ORZC 2R2HA 2DS4A 4ZFGH 3MV7D 1TIUA 3I6GA 2DQEH 5DEZA 2DD8L 3VU2A 2QQLH 3U4EB 5CEZE 5I6XB 4KK9C 4XWGL 2FHFA 1GAFL 1FZOA 5J9PA 1VFBA 4YDIH 3LRSA 1FNFA 3RDTD 4JANB 4PJ7B 5F3HB 1X6LA 3VDBA 3NACH 5K9KB 1KJ3H 1B88A 5D1XD 4OCNC 5C71A 4Q6IA 5I18L 3O4OC 3FKUS 3UZVB 1OTTC 3VJ6B 3V4UH 4RA3A 2B39A 4MCZB 5GGVL 1PEZA 1GIGL 4NHCH 3WSQL 3QEQD 5C3TA 5DFWH 4QTIH 4Z7UF 3DV4A 3OGOE 3TVMC 5GSRA 5ACZA 4PD4J 2ITCB 4KDTA 3AREC 3UYRH 4BKLA 2J1KA 2CKNA 2Y7QA 2EXYC 1G7HA 4J4PD 3WO3B 3GMLA 1G7JB 5EBGA 1ZLUK 3OX8A 4IRSA 5I1DA 4NM8H 4X4ME 3SDAA 2W65B 1RUQH 2VZVA 4OD1H 5DEGB 4OF6A 5FEBA 3TO4A 3ELAT 1M05A 2BCKA 2XPGA 3VGBA 1CCZA 1TZHB 4XMPL 4JFEA 4KGLA 3B2UD 4U6TA 2HG5A 1GPOL 4NHCL 5K33A 4V1DB 1NGZB 4WU5B 4BFIA 1L7TH 1DEEB 2J8UE 1CDYA 4RNRB 4MAUL 2C7UB 1KN2H 4Z8FL 1F97A 3G5VA 3D25A 3UBXI 1NSNL 3IJSA 4R97B 5HHQA 1P4IH 2R29L 4AT6A 1U2HA 4Q9BA 4NCDA 1EEYB 4GG6B 1RIHL 3O2DH 3T1FB 1YA5A 4P4RB 5ALCH 2MCPH 4LMQE 5DGQA 4FZEL 1C5DA 3ZE0E 4M1DL 4NKQB 4LLDB 4OLZH 3KVQA 5CIPA 4OV5B 3MV9B 1B4RA 5H2BA 3MZGB 1R5IB 1D5BB 2BSED 1X4YA 1KXVC 3T0BA 4HJGB 3LN9A 2CH8A 3PDDA 5DHVB 1F42A 1YEDB 2R4SH 3RWGA 3H0TA 4WFHE 5I30H 3L5IA 1F3JB 4JQXC 1A22B 1H3GA 5I1CL 3TN0C 3TNNB 5B21A 5IHLB 4M4RA 1CXEA 4LQ1A 3WD5H 4M1GL 3NH7H 4WRLA 1IAIH 4U1JB 5FFLA 4XCYB 5EORL 2EDTA 1IC7H 2D2OA 4QHUA 4JY4A 5HGGS 4FQHB 2E27L 4MNHA 3EYSL 3JSSA 2NLJB 1AP2B 1MUJB 4O2FA 4MAUH 1BD2B 3C2AL 4NO5B 2P46B 4M3KB 1WICA 3CVIL 4NWTH 2A6IA 1JNNL 4XMPH 4KZDL 4U1NA 3C08H 2HH0H 4D9RD 1AKJD 1N59A 1V7ML 4KQ3H 1W0WB 5EU5B 3D39E 4OCXH 4P46D 4L3EA 5DQ9B 1DJSA 4X80L</