3NCCB

A human prolactin receptor antagonist in complex with the mutant extracellular domain h188a of the human prolactin receptor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
206
Chain Sequence
MLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDAGYWSAWSPATFIQIPSDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prolactin
publication title Two Independent Histidines, One in Human Prolactin and One in Its Receptor, Are Critical for pH-dependent Receptor Recognition and Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/hormone receptor
total genus 36
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2010-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nccB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nccB01
4NM8H 4KC3B 2I9LB 3TFKC 5A43C 1KEGH 5CBAA 2BHZA 3CDYA 5DSCA 3B43A 1EA9C 3H9ZA 1DDHB 1SMOA 3VXMD 3ARYA 5E9DD 1EXUA 1MWAB 3LKRA 3KYKL 5DO2D 1IQWH 3HB3C 4XP4L 1UWGL 1J0ZA 2AV1B 4OZGF 5ESVA 1KF9B 5C0AA 4P5TB 4I4WB 3QDAA 1VGEL 2F8OA 5DQDL 3OXRA 3SDCA 6FABH 1CLOL 3MRRA 5IVXA 3KPMA 5HY9B 1QNZL 5IG7B 2L7JA 5L9DH 5JPNB 5T5FL 1K3ZA 2GTWA 1EAPA 4HW6A 5DK0B 4KGLA 4Z7UB 2Y23A 3K2UL 1J0YA 3TF7C 3MLWH 1JHLL 5EPMA 2V2TB 4C56E 3ARQA 3R8BB 2YKLH 4HD9A 1CD1B 3QFJA 5IMKB 4NQSB 2IBZY 3HLAA 1MCIA 4PREA 2UUDK 1FAKT 2KBGA 2NY3B 1HEZB 1GL4B 3HE7A 3X14B 5E00A 1QR1A 3MA7A 4XP9H 4PRAB 4X98B 2UY6A 3EFFA 1KGCD 5IF0B 3HZMB 3RAJL 4HEPG 3IJSA 1QZ1A 5DVNA 4JY5H 3HPLB 4ZOAA 5F1OB 5LGJA 1PZ5B 3MV8E 2XZQH 3DV6B 1MIML 1B6DA 3DV4A 3OSKA 5D7LB 3PIQA 3OAYK 5CLTA 1AHWB 3VFPB 4CADB 1H8OA 5AZ2L 3ULUL 2FJHA 5D72H 1DANU 4Y2DD 4OZIF 4JKLA 1N2RB 5KW9L 3TVMA 3BUYB 2IAMB 1NANI 3LOWA 1UZ8A 2W9DH 3GMLB 2G75A 5C0BD 2BC4B 1U8NB 2ARJB 1RAMA 4ZFOL 4UAOC 1BFSA 2HA1A 3O11A 3FRUA 4K3DH 1F3JA 5TE6L 4XB7A 1PZUB 4P9ML 4YDKL 1PEWA 5IV2A 3EJYD 4HC1L 5H2BA 1G9NC 4OZ4A 3PWUB 4OQTA 3BWAB 3VXMA 5E9DA 1MCHA 4JCLA 3VXRB 1AI1L 3VXQB 4J3TA 1A7RL 5I16A 3JWDL 5GGUB 1OAZH 2N7AA 5F7NC 3L6FB 2MOVA 1JGEB 1OCWH 1UEYA 3RI5K 1H0DA 2MPAH 3N85L 5FYKE 3UTSD 1CICD 4P9HH 2AV7A 5AAWA 5JW3H 3CMOL 1TETH 4GLRI 1JV5B 1WBXA 4EN3B 5B38A 1CGYA 1P4IL 2F19H 4QO1A 3RY5A 3WFZA 1IGFH 1HQRB 1ONQA 5JIPA 5DUBB 1U8OA 3PP4L 4GKNA 5DD5H 3MOAH 5JR1L 4TQEH 3RIFK 4M6MH 3B9DA 4D9RE 1NLBL 5FUZL 1S7SB 2EE2A 3VDAA 3UTTB 5IHBA 3VFOA 3KVQA 1WFUA 3ARTA 3LEXB 4LSRH 4AM0B 1FO0B 4QHLB 3QIUD 4WW2A 3OTTA 4HJ0C 4C54A 1IL1B 3BVNA 1R3JB 1W2KT 2X10A 2A6KA 1YQVH 1AD0B 5J3HC 4JQVC 1NBZA 4Q2ZA 4MNQD 5AWNL 4LDLB 5CSZB 3UBXB 1AXTH 2X4TA 4IBLT 1Z5LB 2B5IC 4JHAH 4U2YA 4DOHB 3VXTA 4DTGL 4R26H 5FYLE 3WS6A 4HXBH 5E2JA 2XKSA 1YMHB 4PJDB 4Y2DA 4FQJH 4XNZB 2AJZB 1BOGB 5ICXA 3IKCB 1T03L 1J1XH 1V3LA 1SEBB 3VI3E 2VISA 1RZFH 3NCMA 4PJIB 5M7QA 1FNSL 1MRCH 1MFDH 5C0BA 1N8ZB 4UT7H 3TNMA 5J1AA 4M62L 1NGPH 3TLRA 5IFHL 5J4MA 4LVOB 3P4MB 2V2XB 1BF2A 4C56B 4PLJC 3AREB 4LLAA 2VQUA 4U05A 5CZKA 5FDWA 4YUEL 2WNGA 5KAQG 1E4WL 1V7NH 1PSKL 2W9EL 4YDLB 1MY7A 3O2DA 3DMMD 1T80A 1A0QH 3LH2H 3P0GB 3RPIA 5GGRA 2H9GA 2ICEB 3D25B 4OZIA 5E5MB 4ELKA 4L29A 5D96C 5JW4M 2UWEE 5IJKC 4IS6A 4TNWF 5DMYA 3MV8B 1WLHA 5BO1L 1K6QH 5JA8B 4MA8L 3LN9A 2VITA 2D03H 2HKFH 4D9QD 2N1KA 3HFML 3STLA 2EXYC 3FFCB 5DGRA 3T0EC 3UTSA 4RA3A 2YPVH 4OFPA 1CICA 2KKQA 3BPLB 1C5BH 2MNUA 1A6AB 4MWFB 1ZS8A 4PJCB 3T2PA 1I9IH 3QCTL 5IVZB 1WITA 4NBYB 1IGML 3BGAA 1IAMA 2QBWA 5HTSA 4HJGA 1MCDA 4LASH 3FT3B 2QSCH 1K4CB 3MRPA 2AJXH 4KY1H 4GFTB 1ZSDA 4KKLC 4YXLL 5ID0B 3HMWH 4CW1B 5JTWA 1ZGLB 4C57C 1U8PB 4U1KA 1MCKA 2VIRA 1B90A 2NXZB 5EULV 3RWFA 3V6FA 1X4XA 3W11C 1U8QA 3BP6B 2DBJA 3MRFA 3MRNA 3QIUA 2Q8AL 1O5DT 3I6KA 5LQBH 4OF6A 1ZA6B 2BNQD 1RK0B 4M3JA 4R6UA 4KK9C 3EYFA 3UYOD 1B0GB 2PO6B 1IBGL 3RVWC 4MNQA 4KUZL 1JNHA 3DRQB 2F8XC 4PJFB 5EU6B 3BIKB 3DWTA 1TLKA 4Z7OE 4OQTH 1PEZA 5BW7C 2KQMA 1BIHA 4MB3A 1ZLVK 4ESKA 3TIDB 1INEH 3JWOH 5FA4A 2P7TB 3CVHA 1F4AA 2XXCB 3MA9H 1D5IH 1OARH 3EYQD 1F4HA 1HH6B 2NY3D 3QDME 1TPXB 4UQ3B 3H7BA 4JR9L 4YHZL 1XGQB 1T5XB 3P73B 2D31B 4OKVB 5IB3A 4OFDA 3PGDB 4HHAA 4KVCL 4N9GB 5AEAA 2E9BA 3NZHH 4LBEA 4D0BB 3DMMA 1FDLH 2ADIA 2BDNL 4QY8A 5CUSH 2VWEC 5F21B 4NC0B 2AXGA 2C3WA 1Q72H 4WTWA 2W60A 4HUUB 2VE6A 5I1EL 1IE5A 1SYVB 2GFBA 5D7LD 2OJZH 3PL6A 2EH8L 2P8MA 4HKXA 2ZCHH 3MODH 3H7LA 4X7TB 4C83A 4WY7H 4QXTA 4HGWB 5IQ9B 4PJBB 2EIEA 1EO8L 4K8RL 1FE8L 4XNYH 4ERSL 2DLTA 3LDBC 3GMMA 5E8EB 4LDOB 5KS9E 2GSIB 1ZXQA 2FLBT 2I9LA 2FGWH 3OKNB 5T3XD 4PPTA 2A83B 1DDHA 4MJIE 1YEJH 5DQJB 5IOPB 3VXRD 4TUOA 4JB9L 1MWAA 2R2EB 3PNWA 3QHZL 4IRJC 4B7LA 2B8OT 2YD5A 2AV1A 2MCPH 3CDCA 1LE5B 2BNQA 1OP5K 4P5TA 1IC7L 4I4WA 4OF0A 2BY3A 4LSSH 4WI5A 2J5LB 3DIFB 2G5BA 4J1UB 2ADGA 2FJGB 3EZJB 5HY9A 1ZT4B 5IG7A 3R1GH 4U3CA 4EN3D 5I1CL 4W4OA 5JW4N 3G9VA 1U3JA 4YAQA 5JPNA 4ODVL 5DK0A 1XZ0A 4Z7UA 3CLEL 4TPRL 1ZLUK 1A3QA 4XC1H 1IEBB 4KMLB 4LMQI 1EO7A 2V2TA 1CDCA 4JZNB 2CKBB 3O2WH 1SJEB 1CD1A 2VSDA 4NQSA 3UTTD 1T1YB 1KJ2L 3HI5L 3HAEB 1I4FB 4H8WL 3X14A 1RUMH 1WCQA 1INQB 4NWUL 5J6HB 2NNAB 4PRAA 1MJUL 3Q2CA 1BQHB 2BSRA 2J8UE 4NKOB 3RGHA 4LGRB 1JN6B 2AGJL 3K2MC 3HPLA 1PZ5A 3QIBC 1A9EA 2YRZA 3DV6A 1IAIM 4AY0A 3GSQB 5D7LA 4NRXB 3KJ4C 4GXVL 4L4VB 3DX7B 4TRPL 1AHWA 4G3YH 2D7OA 1N64L 3FB6B 3QDHA 5ITFB 3VFPA 4CADA 1GIGH 3M07A 2WBJB 5FO9B 1QR4A 1N2RA 4GJTB 3VXSE 4F7PB 3BUYA 3HZKA 1XF1A 3PWJB 4LDEB 3GMLA 3I02A 1B6UA 1GGUA 2NY1D 2ZOKB 4E42A 1BFTA 5E08L 1I1AC 2ARJA 5GRJL 1G7MB 2CIIB 5IROA 4C56D 2JJVA 3MRJB 4HQQL 1REIA 1FBIL 1J0IA 3QDMB 3VJ6A 5FEBA 4OAWB 3U82B 1AQKL 1TZHA 1L7TL 1ED3B 3TZVB 1CL7H 3PWUA 1T89A 2FRGP 3WS3B 3BWAA 5C6WH 2LAGB 1K2DA 2EH7H 3E2HB 3VW3H 3VXRA 3VXQA 1MJ7L 4QRRE 2JJUA 5C0IA 3UJIL 5GGUA 5ICYB 3MV8D 3C6LB 3L6FA 4UIMB 1JGVL 1JGEA 5F88A 3T04D 4ETQB 4F7TB 2OTWA 3KS0H 1NMAH 1T0NB 3FFCD 2BERA 1A7QH 1FJ1B 2FBOJ 4ZFFB 2ZCLH 3W5MA 4BSWB 5E1AB 4CKVX 1JV5A 4EN3A 4KUCF 2O93L 4U0RB 2FEDC 4DEPB 2FEEL 4XNUL 5JUEH 4Y16B 1HQRA 5EB9A 3SJVE 1BGXL 1G1YA 5MERB 4X0KA 5F6HJ 5KS9B 4XGZA 3ORJA 1Q9OA 3V2AR 4ZPVB 1F8TH 2I27N 1S7SA 3TWCH 4JHWL 4YGVB 3UTTA 3CDGA 1FG2B 4LVNC 1CU4L 2LQRA 2NXZD 3SQOL 1DBBH 4BK4A 4XAKE 3VFTA 1JPTL 4K7PY 3LEXA 4AM0A 1FO0A 3NVQA 4MJIB 1IL1A 3KYMB 1MQKH 1R3JA 3U0WH 1A6TB 4X80L 4ETYA 1KOAA 4X9GA 2V17L 1EFXD 4P2QE 2EC9U 2P49B 3PXJA 2Z8WC 4CDGC 4XVSL 1R0AL 5CSZA 3UBXA 3P0VL 3O9WC 5EU6D 5FYKD 1EK3A 3FL7A 3RX5A 3LZFH 3X12B 3KHOA 1YMHA 4PJDA 5GRVK 4PRPE 1S7RB 2AJZA 1BOGA 4I13B 4CJ1A 4PJIA 3BSZH 3WDIA 1ZT1B 2V2XA 4C56A 1CR9L 4TTDC 4HCRL 3T0BA 1S3KL 2D7MA 1OL0A 4TTGA 3D5OF 3QUMB 4CNIB 3ULUE 5IFAL 2OTUB 1HHIB 3OWEA 2GK0B 2ICEA 3VI3F 1I8LA 4R4BB 5E5MA 1F13A 2CD0A 2J8UB 4AIOA 4O58L 4LLQB 4Q9QH 3RWHB 3OV6A 3MV8A 1CZ8H 3NH7H 4X5LA 1EBAA 1TVBA 4XPGH 3V7AE 5M95B 4YDVA 3FFCA 1YYMH 4N8VB 4YE4H 3HKFA 3I6LE 4DGYL 3OR6A 4ZNCD 4O5LL 1A6AA 4MWFA 3TV3H 1VPOL 4PJCA 1PY4A 2UWEF 3FZUC 5FHBH 3WNNA 4BK5A 2BHUA 2QEJA 3RY6A 1Q9KA 2WUBL 3KXFE 3FT3A 1YEHH 4AEEA 2NY5C 3SE8L 2B4CL 2EDOA 3AMKA 4MD0B 5CEXB 4CW1A 5ID0A 3Q6FB 1I75A 3ECBB 1ZGLA 5EWIH 5HI4D 3TN0B 5DK2A 1U8PA 4RGOL 2MKLC 3QEUB 3GM0A 1L0XA 3BP6A 3V5KB 5CD3A 2XQYG 3T2OA 5D5ME 4Z18A 2ZG3A 3L5XL 2EDKA 1ZVSB 4AYFA 3NOIA 2WWMD 3LKNB 1U8KA 5CJ8A 2JJTA 4BQ8A 1DQQA 1EFXA 4P99A 1B0GA 1AXSB 4EOWL 4ZTOL 5ACZB 1F3DH 4LLVA 1HILB 2VN4A 3ARWA 3DRQA 4YC2C 5JXAL 4PJFA 5EU6A 5KSBB 4JRYB 4PTUB 5DDHB 1ZA3A 4QRQB 5CGTA 4DAGL 3KHQA 4KK8C 5C7XL 2HRLA 1R3IH 3TIDA 3E6FA 3V5DB 4KRLB 2P7TA 3S98A 1MCLA 1FH5H 1HH6A 4UQ3A 4XTRC 5SWSE 1UM5L 5DD3H 3VI4E 3SOBH 1XGQA 2H2SD 3P73A 1A3LH 2F58L 5ILTL 2D31A 4IMLB 2NR6D 3PGDA 4WWKB 4N9GA 1LVEA 4H0HB 5C08E 4Z7OF 1U8HB 1A7OL 5C3LD 2DD8H 3R0MA 4UV7H 4OLEA 4JG1L 5FAAA 5HGDB 3QA3A 4G8EB 4XVUC 2VN7A 4HWEL 1CFTB 4QRSA 3T08A 4IOSD 4HUUA 1TZIB 2IF7A 4GMSL 1SYVA 3U9PL 5H94B 4G6ML 4L4VD 1PLGH 3HPJB 1KG0B 4X7TA 3DUUB 2WBJD 5FA3A 4XH2B 3FO0L 3PQYB 4HGWA 5IQ9A 4PJBA 1SEQL 2F74B 1OQXA 1FO0H 1M05B 4OD1H 4JJHA 5KVGH 1F4WH 4MVBD 3KLDA 3NCJH 2ORBL 5E8EA 1OTUD 2VDKL 2I60H 3GFUA 2GSIA 5GGSB 1JNLH 2BNRB 4X99A 4CDHA 4QXGH 2R9HC 4TNVF 3OKNA 3QDMD 3OJDB 4ZO9A 4EBQL 1WEJL 2R15A 3QXAA 4XNQB 5FKPB 5IMLA 4ZFGH 4TVPL 1UXSB 2QADB 5DQJA 3G5VB 4XB8A 2F5BH 5DJDB 1BQLL 2R2EA 5KS9F 4NO5B 3C6LD 4JPKH 5F96H 3GHBL 1BAFL 1LE5A 4JO4H 4MNGE 4YX2H 5LXGH 1IGTA 4JEGB 3HUJE 4UT6L 5F7EL 3VE0B 2C5DC 4J1UA 5CJOL 3PDDA 1U3YA 1AR1D 4OLZL 1ZT4A 3GMPB 5HI5D 1JZ2A 1OVZA 5HI3D 3B2VH 4K55A 3FRPA 3DLQR 3U1SH 4JO2L 1IEBA 2F5AL 2AAVA 2W92A 2CKBA 2VL5B 1Z0MA 1YEFL 5BVPH 3ZSSA 5C0EB 1SJEA 4OCXL 3VGBA 1T1YA 2V9TA 4FXGB 4Y4HC 5IESH 3TP4A 1INQA 5B38G 5J6HA 4MJID 5F70A 4NKOA 3BYYA 3O6FC 1FFRA 5FECB 4QCIB 1JN6A 4LSUH 5HYEA 2DQUL 1QLFB 3NAAH 4WFFD 3I9GH 2HVKB 3IDXL 3GSQA 3FN0L 1IT9H 4NRXA 1CTNA 4L4VA 3DX7A 2Z4QA 5CILH 2FECI 2PTVA 3BAEL 5ITFA 1U95B 2YPKB 3GSNH 2WBJA 1V3KA 5FO9A 3ZKXC 1A6VL 2CXKA 5E2VH 4F7PA 4G6AC 5HHOE 1KENH 3R06A 4IEFB 4P4KC 2ZOKA 1EHLL 3C6SB 3QCVH 5I71C 2Q86B 1G7MA 5IIEB 3D87B 2NTFB 1U6AH 4UINH 4NQEB 3MRJA 2X2YA 4R96B 4UNTA 1FFQA 1M71B 3QDMA 4FN0A 4EUPG 5SWSB 3DSNA 4OAWA 3QNZB 2PXYC 2V2WA 1C5DB 5HGGS 5I8EB 2EDQA 3WS3A 4G7YL 3DGGB 1YY9D 2BFVL 1QEWB 5ICYA 4KDWA 4JHBA 2E7LA 4MS8D 3C6LA 4QTIH 3LPGA 4UIMA 4ETQA 4F7TA 1L7IL 1S5HA 1IZJA 1FVEB 5DJ0B 4UAOB 2IFGA 4TUKL 4ZFFA 1FL3B 4BSWA 2Y1VA 4PP1D 4PGZA 2AKRB 3MV7E 2BP3A 3CIQA 3SDXE 3RZCD 4KAQH 2APTA 2DWDB 5BVJB 3ZYJA 3LQAH 2DQTH 2H1PH 1MHPL 5MERA 4Y4KC 4QRPE 4XPTH 5CIPA 2NY2D 5KS9A 4PTTB 1YEGH 3REVA 4ZPVA 1MI5E 1MLCB 1QSEE 1TQBC 5I18H 1BZ7B 3TN0D 4YGVA 2B39A 1FG2A 5FB8B 4BQBA 3TIEB 3RWIB 1MRFL 5DMIH 3SE9L 3C09C 4KMTH 5T1KB 4MJIA 5FYLH 3WO3B 3KYMA 3UC0L 5EC1B 1HHGB 5I30H 3GMNB 4IOFC 4RAHA 1A6TA 2QHRL 3MLRL 4QRRD 5E99L 4RA0C 2EKJA 2AJ3B 4M1DH 4X6EA 4ZQKB 3DXAE 3CZFB 4WHDA 2GSGB 3GMRB 3A6BH 3FJTA 3DECA 3X12A 1YC7A 1P69B 4CVZB 1S7RA 1IEHA 5HHQB 1MAMH 5HDQH 4JO3L 2AEIT 5IVOA 3U0TB 1ZT1A 4ALAH 5GRZA 3S97C 1KC5H 4GAGL 1F02I 2L4OA 2WIMA 3H8NA 3BJ91 4WWKD 3QUMA 4P2YA 4XAKD 4CNIA 3UYPA 2B5IB 1HHIA 3L5IA 5JW5B 4R4BA 4DCQB 3L3IB 2J8UA 5FUOL 4PRHE 1HDMB 2Y36H 4P2QD 5IWLA 2FO1A 3V9FA 3CUPA 3MLZH 1UT9A 4N8VA 1F90L 2NY7L 3IU3B 1DQDL 3RGVB 3ULUF 4Y5VC 3EO0B 5CCKL 4GRMA 3WXVL 4F57H 1O7VA 3F8UB 1G84A 4JLRB 2EDXA 2EDBA 3L7FB 3RZCA 1M1SA 2BNRD 4J4PC 3QUXC 1NAMA 1MIEL 1ZANL 3NA9H 3QJHB 5D96B 4NM4L 4H1LH 3V52H 3JTSA 2LV4A 2DS4A 4MD0A 3ARXA 3ECBA 3Q6FA 5D1XC 3HNSH 4O2FB 3TN0A 2HFGL 2QADD 1UJ3C 1AFVH 2VQ1B 4RIRB 3HZVB 3QEUA 2R4SL 3T1FB 3T0EB 3V5KA 3JXAA 1YN6B 1OP3K 4HWBA 2VLKE 5C2BH 4QRRA 1ZVSA 2LE9A 1NDGB 3LKNA 4HDIA 4GSDH 3T4AA 3VXUB 1AXSA 3NA4A 1N4XL 2ARWA 5ACZA 1IEAB 1HILA 2OS7A 3SGEI 4X9BA 4PTUA 1I7TB 5DDHA 4TOYH 4QRQA 3LIZH 1SHMA 5D5MF 4LRNL 4XMLL 4IDLA 3UJJL 5IR1B 2R56H 4YK4C 3SDXB 2XG4A 5F6IC 3V5DA 3RDTC 2EDDA 2O26U 4I3RL 4XP6H 3HB3D 2HRPH 4HIEB 4LK4A 4QRPB 5FOBB 3KXFD 4Q9BA 4OLVH 3MCLH 3NACH 1NGZB 3DPBA 4LEXH 3OX8B 1MI5B 2FX8L 3MV01 3WFDL 4B41A 4IMLA 1S9YB 4WWKA 2VZ3A 1WAAE 5ALCL 1U8HA 3IFPB 3OL2A 5D7KE 5HGDA 2HKHH 2VXQH 2HYMA 3F7PC 4G8EA 1PKOA 4U7KA 1V8HA 1CFTA 1G6RH 3SHSA 2DQEL 5FCUH 1TZIA 1W72L 5H94A 5CIPH 1QKZH 1A5FL 4I1NB 5HD8D 5F44A 3VI4F 3HPJA 1KG0A 3NZ8B 2VLME 3VMPA 2ICWI 3DUUA 1AR2A 4JFEE 5D8JH 2VO5A 1FL6A 4XH2A 4NN7C 1F4XH 2WMPA 3ZKSD 3PQYA 1YEDA 4Y7MA 1VB9A 5BMFL 2XT1B 3CXDL 2DIBA 3RKPA 1L6ZA 4NCDA 1LEGA 4GQ9H 3MBXL 3GRWL 1HZHH 4TULH 4X8XA 5GGSA 4CN4A 2BNRA 1S7VB 1XGTA 2VZSA 3S4SB 2YD4A 5SWSD 3UTQB 5DJ8B 1CLYH 1DEEB 2X4SB 1RULH 3QUZC 1KTLB 5FKPA 1B4JL 4RGMC 1UXSA 5MP6H 4LARH 1BP3B 4LQFH 5C08D 4OCNC 1TJGL 1WF5A 3G5VA 1WSST 2H3NB 5DJDA 1HQ4A 1NL0L 4QNPE 2BRRL 2XZCL 4NO5A 1V05A 3BP5B 3ZMRA 3O45B 4BJLA 1P1ZB 1UM6L 3LDBB 4PRHB 1NCCL 1EEUA 3MJ8B 3FOMB 4OF8A 2BSSB 4NQDE 5DZLA 2CSPA 2EECA 4PJ7E 1NUGA 3GMPA 5L7XL 3P3YA 1NC4D 3QUMH 4PBWD 1KLFA 4AMKH 2VDQH 1QFWH 4QHMB 5DXWA 1HYRC 3JV5A 3VGDA 5F7HA 4JZOB 1BLNB 4QTHB 3HUJF 4I48B 1RU9H 4MHHG 4IRJB 2EEBA 2NXYC 1VSCA 2PF6A 3KXFA 1QYGH 3ZL4H 1OAUH 4HIXH 1FCGA 4BYHA 2HJFB 2D7QA 5CINH 5FECA 4JDTL 4QCIA 3FO2B 3CPLB 4ORGA 3GI9H 4V1DB 4ZO7A 5D5MA 4KK6C 4K71C 1NAMH 2HVKA 2NYYC 1QUNA 1GC1C 2AJUH 1E4XH 2YPKA 1JFQH 3HG1E 3TT3L 5GHWL 5BXFB 3BH9A 1U8LB 2X70B 2YRLA 1VEPA 4HJ0D 3C6SA 3GI8L 2Q86A 3QUKB 3TYGH 2NTFA 5D2LB 2BSED 4TSCL 3L3OB 1OWWA 2DQCH 1RZGA 1DLHA 4ZNEA 4R96A 3QIBB 5DC4B 1MCCA 5J3HD 1NBYB 3MUGB 2FDBP 4YHOH 4HKJB 1TVDA 5SWSA 4WUUB 3QNZA 3SPVA 1IGCH 3KJ4B 1C5DA 5I8EA 1W0VB 3CFBB 2H8PB 4Q7DA 3DGGA 4YBLC 1MCBA 5C08A 4XPBL 2VL4A 1CD8A 2R0KL 4QEGA 4IDJL 5I8CA 1QEWA 1D5BB 1MHCB 1HSAB 3KYKH 1I1AB 3O6LL 1I1FA 1FVEA 5DJ0A 3RGVD 4U6HB 4XPAL 4XP4H 1UWGH 3F7YB 5C0RL 1FL3A 3ZE2E 4K94C 1VGEH 2AKRA 5DQDH 3WHXA 4D3CL 1NC4A 2DQJL 2HT4C 1CLOH 4TVPE 4KDTA 5LBSL 1QNZH 1WTGT 3BP7B 2DWDA 1C5CL 5BVJA 1D6VL 5T5FH 4FFZL 4ELMB 2HFEB 3K2UH 3WCYA 1JYVA 1MLCA 2MFNA 1JHLH 3SCMD 1BM3L 5FB8A 5GJTL 3RWIA 3TIEA 1KBGL 1RZKL 2EDEA 2EXYD 4FMFA 3T0ED 3AFLA 3SDXF 2EDFA 2A74A 5D9SB 5HYJE 2DF3A 1ZMYA 5KG9A 1DN0A 1HHGA 1PG7X 3GMNA 5DJCB 1X4YA 2Q1EA 3GBNL 4NC2B 4Y0GA 3EAKA 2RBLA 1N6QL 3VXUD 5D1QC 5KSVA 4MNGA 3RAJH 3CZFA 5IK3B 2GSGA 3HUJA 4Y1AE 3P40A 1MIMH 4Y8DC 4W4NA 2IQAB 4H5SB 4KKLD 4HAGA 3HZYB 4UQ2B 1O7SA 4NHUA 2F53B 5AZEL 3MV7D 1NMCC 4LVNB 5IW1B 3GHEL 1JVKA 1DQTA 2NY6B 4R2GC 5AZ2H 4WUKL 3HNTL 3ULUH 3U4BL 1E4KA 5KW9H 3U0TA 3JUZA 4KRNA 1BWWA 4KKAC 4QRPD 5JQ6L 5J11C 4UOJA 1DBML 3W9EB 1MI5D 1QSED 4JFPA 4KK9D 1JPST 3QXTA 3QISA 2ITCA 4R4FL 4JGUA 2ESVE 5F7MC 3RVWD 3RWEA 4TN9A 5TE6H 5EUOB 4P9MH 4YDKH 3O9WB 1KTKE 1T2QL 5JW5A 1AC6A 2J6EA 4M7ZC 4HC1H 3L3IA 2DN7A 1T0MB 1P4LB 1KCKA 2GW5A 1HDMA 1GCFA 4KHTH 4RGNE 1AI1H 1A7RH 3JWDH 4JVWA 3DETC 4Q97A 1VKXA 3O41B 2QQKH 3RGVA 3IU3A 4JY6B 3EJZD 2PYFA 4HK3J 4L3AA 1AQDB 2E7MA 4JLRA 4O51A 1J0HA 4S0SD 3L7FA 43C9B 3VXNB 4G42B 1P4IH 4PJ9C 3BZEB 3QJHA 1LNUA 3V5HB 4KTYA 3PP4H 5EO1B 4O2FA 4YHNB 2CH8A 2VZ1A 4FFWC 5JR1H 3E8UH 2NX5B 3C8HA 1NLBH 2VQ1A 3HZVA 5FUZH 3MREB 3T1FA 3T0EA 1NQBA 2IPKB 3F6IA 4JE4B 4L4TB 2WZPD 3KPOB 4KTDL 4PRHD 1RZ8A 1NDGA 4FFYL 4LEOB 5JORB 3DI2B 4AH2B 1T5WA 2B2XL 3VXUA 2NCMA 2VOTA 2V5MA 1IEAA 1UZ6E 1GZQB 1U3HC 1TIUA 1AH1A 5C1MB 1I7TA 5AWNH 1J0KA 4HFWB 3MV7A 3QQ9D 2E5EA 1XIWC 1BJ1H 4YHLH 4DTGH 1MQ8A 3SDXA 5C92A 3L5WB 1A4KA 3MV11 4IRJD 3DTXB 4OCSL 1T03H 4HIEA 3GSWB 4QRPA 5FOBA 1TTGA 3BQUB 3OJVC 1MI5A 1JGUL 4M62H 4LLWB 2H32H 1S9YA 5IFHH 4S10A 1S78C 3IFPA 3FRPG 4YC2B 4YUEH 1U8JB 4HBCL 1PSKH 2W9EH 4MA3B 3D2UB 3KPRB 2R8SL 1ZLVH 4PJ8D 3RVTC 1UB6B 1SBSL 1VFBB 3NZ8A 5DD6B 5I1HL 3BGFB 4CUCA 5F9JA 1OAKL 1QFOA 1WAAF 5F7WC 3TJEL 4MA8H 4BZ2L 4KI5C 1KJ2A 2YUVA 2K7QA 2DI8A 1RHHB 3HFMH 4XMKL 3IRPX 1OGAB 5DJXB 3ZKMC 2DAVA 1PY9A 1NCTA 4DQOL 3AAZA 1L0QA 3LMJH 4H1LG 3QIBD 4PV8A 3QCTH 2JB6B 1FFOB 1IGMH 1DEEA 2X4SA 5L6YL 1KTLA 1HHHB 4GW4B 1C1EL 4YXLH 5I6XC 1UCTA 2H3NA 5EO9B 1IQWL 5D7KD 5CZXD 1U91B 5DVKA 5IT2L 3BP5A 4GG8A 3O45A 1MEXH 1IAOA 1P1ZA 4LP4A 5E8PB 4PRHA 1NDMA 2Q8AH 3MJ8A 3FOMA 2BSSA 3BKML 4NZDA 4P9HC 1R24B 1CDJA 5M94B 4X6CE 3QWQB 1G9ML 5LGKA 2PETA 1IVLA 2R2BA 3MRDB 3KAAA 2HH0L 3MLWL 4X4YB 2CDFA 1IBGH 1HWHB 2ICES 1P84J 4KUZH 1KPVB 4QNPF 2OR8A 1BLNA 3S3JA 4QTHA 3K74B 4DGVL 3QDJE 4L3EE 2FYYB 4RAVB 2VZOA 4I48A 4G8IB 1G7JB 4M7KL 4IRJA 4NKDB 2CMRL 1KV3A 4PJ7F 2Q6WB 3GMQB 4DGIL 2R0LL 3IDNB 3V0WL 2JTDA 2NLJB 5K9JL 2VDOH 2A6JB 1BEYL 1FYHB 4KROC 4JN1L 2ICWJ 4JR9H 1RMFL 1RHFA 2HJFA 4IIQC 2FEDD 4KVCH 3FO2A 4WHYH 3CPLA 3LKQA 5DVOA 4P2RB 2AK1L 4P3WA 4PJ8A 5MENB 5F7DB 4NQDD 5EOTB 2K3TA 4KWUA 3T65A 2FZ3B 5KVFL 2F53D 4OI7A 1NAKL 3L95B 2EH8H 3P0YL 1BZ9B 4NNYB 2NY6D 4FXLA 4FG6C 1A14L 1QA9B 2VC2H 1EO8H 3U4EA 5D7SL 4K8RH 1FE8H 3QUKA 3O6FB 1XR9B 5D2LA 3L3OA 4BFGA 4ERSH 3GIVB 4WI2A 1YJDL 3QIBA 4RWHA 1XH3B 3O3AB 3ZT5A 4AENB 1NBYA 1J9CT 4K7PL 1JRHL 4HKJA 4J2XA 1ND0B 2F8VA 2IPTL 3O9WD 5FM5O 5E2TL 2H8PA 3S7GA 3EYOB 4LLDB 4F8QA 1WAAA 3ZKXB 3MOQA 2ZNWA 2UY7A 1MCJA 1D5BA 2AERT 2VDMH 3V0AC 1MHCA 3LEYL 4JB9H 4PJGE 2MPAL 1HSAA 2ZPKL 3IFNL 4LIQL 4P4KB 3QHZH 5I71B 1FC2D 4X7SL 3AVEA 4U6HA 3F7YA 4TTDD 3RQ3A 2NZIA 2ZG1A 5FYJL 1IC7H 3MRKA 3WFCL 3H0TB 4HCRA 4XNXL 1SY6L 3RTQC 3WMSA 5J7CC 3EHBC 5I76A 3BP7A 2PXYB 5I1CH 1LEKA 4ODVH 4ELMA 4TQEL 3CLEH 4TPRH 2YUXA 2Y9RT 1DQML 4J8RB 1Y6NR 1LE9B 3VGGA 1IM3B 1YNTB 4ODHL 3SKOA 3ZE2F 2GJJA 3KDMB 1P6FA 1A22B 4H0IA 3S37L 5E95B 3TVMC 3RBGA 4WDIA 1KJ2H 1VDGA 3HI5H 4L4TD 5D9SA 2J12B 4H8WH 5DJCA 3AS3A 5KVDL 4KKBC 4NWUH 1YQVL 3QXDB 4NQXA 1OSZB 2M1KA 1MJUH 2HVJB 5IEHB 4W70A 4GRWE 4MGXA 1Z9LA 2AK4E 2AGJH 5IK3A 4WVRA 4Y4KB 2IQAA 4H5SA 4NQDA 5J13C 2OK0L 5C0JB 2LTQC 1TQBB 3HZYA 2EE3A 4UQ2A 2F53A 1S9WB 3WO4C 4GXVH 4TRPH 5IW1A 1KEML 3DO3A 4TVPD 4U49A 1UACL 4X4ZA 1ADQL 3C09B 3JWOC 4P46C 5TFSL 3WJLA 1YEIL 5E56A 4FQ1L 3BQUD 4JDVA 3W9EA 3GJEB 4L9DA 2RR3A 5E08H 1A9BB 5GRJH 4OIAA 3TT1L 3P9WB 5EUOA 4PD4J 3O9WA 1FBIH 3K8MA 2UVEA 4PB9L 5HYJD 1AQKH 3KPRD 1I1CA 1C7SA 1L7TH 2W1NA 4L8BB 4M02A 1P4LA 1BFVL 3P30H 1K6QL 2BMKB 2XRAL 2FH8A 2QTEA 4RZCA 3UPAA 4R9HA 3FQNB 1MJ7H 1P5UA 4HAFA 3V7MA 2FHBA 3UJIH 3O41A 4YFLI 1HXMB 4XTRD 1UKTA 3LPWA 2AW2A 1JGVH 4JY6A 3ROOA 3KJ6L 1AIFB 3EDDA 3HC0B 4UDTB 3RJDA 5E8DL 3JBG7 1P2CB 1OGAD 2ED8A 1QFHA 3TBVB 1KLUB 1AE6H 4NP4L 2XQYK 43C9A 4G42A 1OAYL 3BZEA 3V5HA 4XNUH 4AQOA 4KMQA 1LP9B 1CFBA 4YHNA 3O2VL 2NX5A 4OLUH 2ESVD 2DI7A 4JHWH 1KB9K 1CU4H 5GPRA 4Y5VB 3SQOH 2B0SL 2R23B 1MFEL 4L4TA 3KPOA 3PP3H 1JPTH 3E3QC 5AD0B 1Q0YL 1NFIB 1OTSD 1EHNA 5C8JB 4LEOA 3VXOB 4X7DC 4AH2A 2SEBB 3CXHJ 1GXEA 1A64A 1BWMA 3G08B 2OMBA 3QUXB 4X80H 4PLNC 5L2KB 5E24E 2V17H 3EJYC 1QFPA 2EEDA 3NCEB 4RSVA 4JFDB 1R0AH 5D1XB 3P0VH 5I1KL 4HFWA 3DOSA 1KT2B 1UJ3B 4QOKE 5FO8B 3BKYL 3N1MC 1UENA 3GBMH 1YUHB 4OD3H 3L5WA 3MV9B 1J1PL 1YYLL 3DTXA 1EEQA 3GSWA 3BQUA 5I66A 1LHZA 1BIIB 4PP2B 1UZ6F 3FAWA 3EDJA 1CICC 4LLWA 3NZHL 1HXYB 4NUGL 5DJAB 3V7AG 5I17B 3TC9A 1CDYA 2FX9L 1CR9H 3FO1B 4HCRH 2P8PA 1SYSB 1S3KH 3FQXB 1H3XA 3EFDL 1GH7A 3NPSC 4MA3A 1KLGA 1OM3L 5HYJA 4P2RD 5GSRB 3KPRA 3OBAA 1AKJB 5IFAH 2DTML 3NTCL 1WWBX 1IC5L 3F7RA 4YK4B 4OCWL 2AP2A 5EOQL 4WY7L 5DD6A 5F6IB 4O58H 4EEEA 3RDTB 1JNJA 3CFDB 4F2MB 5E6YA 5DRWA 5J6GB 4PLKC 1U8IB 2GJ6E 1RHHA 4PJAE 1OGAA 5DJXA 4O02L 4DGYH 2C1OA 2DQGL 3W9DA 1T20B 4O5LH 1WC7B 3K1KC 4GO6B 2X4UA 3F12B 4V2BA 5F7LB 1VPOH 3SN6N 4FQLL 3DNKA 3MCKA 4LOUC 4DKEL 4XC3L 4XXDB 1FFOA 2CLZB 3KPPB 1JJUA 4ZS7L 1KIRB 1JBJA 2EIZA 3HR6A 1YEJL 2XYCA 5DMKB 2WUBH 2VXTL 1I1YA 1WWAX 4GW4A 4MQ7B 4AL8L 2A6IB 2UZIL 2ESVA 1M4KA 2B4CH 3SE8H 2W91A 5HPOA 5EO9A 1UGNA 1CL7I 4G6AD 2N4IA 5MEOA 4RGOH 3A6OA 1CLCA 4LSSL 2C9AA 5E8PA 1OHQA 4MCYB 3MLYL 3ROLB 5DRZB 1VEOA 5I0ZA 3L5XH 2J8OA 2VLJE 4HS6B 3S88H 2X4NB 1N59B 4XC1L 3D0VB 1WZKA 4ZTOH 2FL5B 4EOWH 1KNOA 2PXYD 3QUZB 5JXAH 4RGMB 2FCBA 2FYYA 1N0XL 4G8IA 3WKML 3SKMA 4DAGH 1G7JA 5GGRY 1DVFC 4NKDA 4X6CF 4LCYA 1RUML 3GMQA 4NDMB 4NKMB 2NLJA 3OAZK 3CMGA 4KJPD 2A6JA 3N06B 5BQ7A 4DVBB 5JMOC 2DM7A 3I75B 4M5YH 1WCBB 3X13B 3Q1SL 3V8CA 2F58H 5ILTH 4HX1B 2RHEA 5SX5K 4MXQD 3IS1X 2VH5L 3O4OC 5JIKA 1HSBB 1A7OH 1R3LB 4P2RA 4HH8A 4JG1H 4Y4KD 4G3YL 2BVEA 2Y25A 3HMXL 3HS0B 2IBGA 3K4AA 2L7UA 5EOTA 4HWEH 3IGAB 2FZ3A 3CU1A 4GMSH 3U9PH 2RB8A 3L95A 2NXYB 4G6MH 3D6GA 3WIHL 1BZ9A 4NNYA 1ETZB 2JJSC 1BX2B 3VFSB 1FN4B 1G6VK 3STBA 3GSXB 3LKPB 2H41A 3FO0H 3G6AB 5I19L 2X05A 4AK1A 4IOFD 3ISWA 1XR9A 5LJYH 1F4YL 4NQCE 3GIVA 2AJVL 2HTKC 3O3AA 2I07B 2XACC 2ORBH 1FV1B 4NJAL 5ALBL 1WZ1L 1XAUA 8FABB 3EO9L 4K71B 1ND0A 2VDKH 4PJEE 4W4OC 2YEZB 2EH7L 4HLZH 3SY0A 4KRPC 2QQQA 4YPGB 4G6JL 4TVPH 1LK2B 2VAJA 1NUDA 1S7QB 3EYSL 1IQDA 2J7LA 3OB8A 1BQLH 1A7QL 1BFOA 1TMCB 3QEHB 4HK0A 3C5ZC 3EYQC 3QPQD 4Q6IC 3OB0H 5FGBA 3GHBH 4RQQB 1BAFH 2CLVB 5TJWK 5GQBA 4UT6H 3H0TA 5F7EH 3O3BB 2LU3A 5CJOH 1T04B 4OLZH 4K3HA 1F3RB 2GJ6B 3RL2A 2PXYA 2G60L 5JDSB 4YBLB 5ENWB 3MTRA 4PJGF 1RUPL 5CWSA 4LPXA 1LE9A 1IM3A 1YNTA 2XN9E 2WIIB 4UB0L 2G2RB 1DBBL 3ETBF 4LVEA 2ATPA 3BH8B 3KDMA 5H8DA 1YEFH 4OCXH 4LLMA 1AD9B 4KPHL 3MLVL 5GIRB 2CDGB 1KCSL 1V3MA 4WHYG 2FGZA 3ES6A 2P5EE 4Y88A 1OSZA 1KJVB 5AYQA 5IROC 3VFNB 3IYLW 2HVJA 2YPLE 4M8QA 3VRLE 3X11B 5IEHA 4ZMAT 5C0NC 3SDAD 3Q3GB 4Y4KA 5L2KD 3BW9A 3NFNB 1QHPA 1KCVL 5C0JA 4X6CA 3IDXH 1T89C 4ZTPL 2NZ9C 3DVFA 3BAEH 4BSVB 2A9NL 4M61B 3MV9D 1KN4L 4Z77B 1A6VH 4LHUB 1LMKA 4GRWF 4XHQA 4YEEA 1T7WA 5I8KL 4QYOB 3K80A 1EHLH 5IB5B 3EOTL 1A9BA 1AGFB 1I7ZB 3CH1B 3G5ZB 3UTPD 5D1QB 4GH7B 5F1IB 4QXUL 5K9KB 5ACMA 4LSQL 3RNKB 5ANME 4XHJC 3MRCB 1A4JA 3IS0X 3RY4A 3ZDXE 3WE6A 1AKJD 4LMQE 4L8BA 2J4WL 1NMCB 2D3VA 3BRDA 4YO0B 2BMKA 4G7YH 2P45B 4R2GB 3VD9A 5CHNB 5B39A 2VKXA 2BFVH 2XOTA 3FQNA 4F15C 3RDTD 5A2JH 2AK4D 3EBAA 1IRAY 1LO2L 3HCVB 5EFIB 1HXMA 4WU5A 3WNLA 5J11B 1WFNA 1IGIL 2EE6A 4FTVB 1AIFA 3HC0A 3MGTB 1L7IH 4UDTA 1P2CA 4AEHL 3TBVA 1KLUA 4TUKH 3ARBC 4G9FB 1CE6A 5TF1L 3O8XC 5E5UB 1YY8A 3SO5A 4N90E 3QHFL 4M7ZB 4QHUB 2A9ML 2A6DB 1R5WB 2ZUTA 4NQCB 4LIQE 2H2PC 1LP9A 4X6BB 4QRTB 3MLUL 4S2SA 4Z0BL 5JHDE 3UBXI 4PJEB 3IJYB 5FYJE 2CUHA 1MRFH 3TPUB 2R23A 4OZFA 4Z9KB 3SE9H 2NY1C 3KPLB 4LCUB 1NFIA 1WQVT 4HULB 2VNCA 5C8JA 2XZZA 2ZG2A 1JWSB 1S7UB 2WUCL 3UC0H 3UX9B 3NN8A 3P9MB 4P59L 3VD3A 3IDJA 2QHRH 3GRWA 4PJ9B 5E99H 4ODTL 3SDAA 5L2KA 2CRMA 2JE8A 4Q58C 1C12A 4UNUA 4JFDA 3ILQC 4L8CB 3QH3A 1CIDA 3PHOB 3NCFB 1KT2A 4N0CD 5FO8A 3BRGC 2E3VA 1YUHA 3HC4L 5DD0H 5IW6B 3MV9A 1Q9WA 3N1PC 5F1SA 3GSUB 3VG0L 1VA9A 5GZOC 2JJWA 4PP2A 2V9RA 3WFBL 1FORL 1HXYA 4P2OC 2DD8L 1XCTB 5I17A 4BA8A 3OZ9H 5IBLC 1PKQE 1SYSA 1U3HB 1CF8L 3KWWB 1WWCA 1A3RL 2C3GA 5GSRA 2BVPB 1RJLB 4KI1A 1AKJA 4NWTL 4WV1C 1PLGL 1LDSA 3ULVL 3G5XA 3HHRB 2KPNA 4NKIL 4NN5B 5FUOH 3RDTA 2AK4A 3CFDA 5BS0E 2NXYD 4F2MA 1NUNB 1EUTA 3QRGL 5J6GA 4NNPL 1U8IA 2R0ZL 4NBZB 3FFDB 1WBZB 2DLFL 3WNPA 1F90H 2NY7H 3K1DA 3MBED 4QOKD 2I60L 3KPQB 1T20A 5CCKH 4MLIA 1WC7A 3WXVH 1RFDL 3F12A 1H3GA 1LGVA 2JJTC 4FABH 1L9NA 1N5AB 2CLZA 3FN3A 3KPPA 5C86A 1KIRA 4I0KA 3D69A 2WP3O 4PR5B 1MIEH 2WQRA 1YN7B 2BNUB 1A7PL 4NM4H 3F62A 2A6IA 4PJAF 2HJLB 3F7QA 5C3TA 2GCYB 3DX9B 2HFGH 1D5ZB 4YX2L 1WK0A 1DUYB 2R4SH 1LEIA 3SKNB 1IARB 5E4IA 2VLLB 3WIIL 4MCYA 1UJTA 2ZUYA 5DRZA 3GJFH 3QBTB 3S35X 4WCYL 1UADC 3FB8B 4APQC 1OTTC 4HS6A 5AUMA 2X4NA 1N59A 3D0VA 1N4XH 2FL5A 3ZT7A 2GJ6D 4YR6B 3LQAC 4OI8A 3ARVA 5FF6B 1ZE3C 4U3HA 1T2JA 2APBA 3LB6D 5I6XB 2P46B 4NFCA 4YQXL 4LRNH 2OBGA 4XMLH 3UJJH 2ZCKL 5F93C 4EDXB 4NDMA 4I3RH 3LRSB 5C9JB 3AS2A 2GUOA 4DVBA 5FM8A 3I75A 5JHDB 3B5TA 3OKMA 3X13A 5ERWB 2FX8H 3QG6B 3WFDH 4HX1A 2HT4D 1CFSB 4EDWL 1KPRB 4DKAA 1HSBA 5ALCH 4NKQB 1R3LA 1OD7A 1ZT7B 1CBVL 4JM2F 5ESAB 2XA8L 3QI9C 3STZA 2DQEH 2ZKHL 3IGAA 2FLRT 1W72H 5E2VL 2VLJD 1A5FH 4UBDC 1YECL 1ETZA 3VFSA 1BX2A 3PGCB 4OD2B 1FN4A 3RNQA 3VGEA 4GW1B 3GSXA 3LKPA 3W0WB 4LHUD 4JFZL 4OZFH 3MBEA 4KROB 4QOKA 5BMFH 3CXDH 3KYOB 4IIQB 1J86A 1ZHKB 4KXZI 2WWMC 1ITBB 2I07A 5F1NB 3K4DA 2DL2A 4JM2D 3TM6A 8FABA 5D1QD 4M3KB 3MBXH 3GRWH 4OZGE 4FP8L 2YR3A 4GRLD 3PWPB 4U1LA 3WUWG 4CN1A 2CK2A 4YPGA 1LQSR 4YXHL 2YC1B 3KS0J 1B4JH 1EXUB 1LK2A 1TJGH 2Y72A 5GGTA 3WD5L 5FGRA 2QLVB 3QEHA 1NL0H 2BZDA 3BISA 2BRRH 2XZCH 3GSOB 2Z35B 4J6RL 4PJEF 1KELL 4FTVD 1FLTX 1MFBL 1UM6H 2B1HL 4FHBD 3BDXA 1NCCH 4XMPL 5IVXB 3O3BA 3ALWA 4LCWB 4QF1A 1T04A 5DUPL 2IPUG 3LQAL 2GJ6A 5L7XH 4RX4D 3V6OE 5CZVH 1ERNA 2MSPA 5D7IE 4CVWA 5I18L 5EPMB 4NQCD 4G8GE 3SGDH 4OIBA 1WICA 2G2RA 4KVNL 4GRWH 3C5SB 3HE6C 3BH8A 5IGXL 1KXVC 1CTOA 4PREB 3DETD 1AD9A 2EDRA 2E6JA 3UPRB 5I30L 1J87A 1F2QA 5GIRA 2CDGA 1JWMB 3ARGC 1F00I 3N1FC 5CGYC 3RTQB 1YPZE 4MVBC 4YHKL 1RSFA 2ADJB 4G6FB 4M1DL 2WW8A 5IBUG 3VFNA 3QHTC 2JIXD 3WL9A 3O4LE 3X11A 8CGTA 5LGJB 32C2B 4PJ9D 2PYEB 3CC5B 3JVGC 3PJSB 2FWOB 4HS3B 4CBPA 4DVRL 1CDBA 4HMDA 2VLJA 1RIHL 3SDYL 2Y5TA 2OCFD 3IU4H 2GJZA 2FJHB 3ZKQD 1JI1A 1MAML 3D3VE 1CT8B 3TT3H 5GHWH 3TVMB 4BSVA 5BV7L 4M61A 2E7LC 4PY8I 4Z77A 1I3VA 3VRLF 4LHUA 4RFEB 3QIWD 4DWHA 2G75B 3DSFL 4WENB 4YIQB 3ZKNC 5DT1L 3OHXB 4N1HB 5IB5A 5EU5B 2XN9D 3O11B 1AGFA 3GI8H 1C16B 1B0WA 1F3JB 1I7ZA 4JM2A 3CH1A 1AR1C 3BN9C 3G5ZA 3QQ4A 5D1QA 4TSCH 2R29L 4HLZG 3EDFA 5K9KA 4GRLA 1UB5B 4X8JB 3RNKA 1U3HD 1KTDA 2R4RL 4FQCL 5HI3C 5J13B 2JCCE 3MRCA 4D0DB 1X7QB 1MLBA 2DDQL 2LTQB 4MNHB 3M8OL 3WO4B 5HVGB 2EIBA 1HOCA 4YO0A 3OG4B 1X5HA 4OJFL 2NTSP 4YHML 1JZ3A 1NCWL 4NJ9L 4UUJA 4XPBH 5I16B 2R0KH 2GT9B 4P46B 1PX3A 4IDJH 3MLXL 5HHXL 1JP5A 3HCVA 3LS4L 5EFIA 4OGYL 1EERB 4XZUB 4FTVA 1JF5A 3MGTA 3O6LH 4A6YL 1BBJB 4NQUA 2UZXB 2M8XA 3ZDXF 4XPAH 4AG4L 1S78D 2BX5A 4JRXE 5B38B 4RX4A 1NANH 4EVNB 4HKZB 4D3CH 4QHUA 1NCNA 2DQJH 2A6DA 3QEQE 1C5CH 1D6VH 4NQCA 3RVTD 4FFZH 5E5RB 4X6BA 3QDGE 3L3HB 4OZGB 4PJEA 5L88L 3P77A 3IJYA 3V6ZB 1DQLL 2VDRL 1BM3H 5GJTH 3TPUA 1RZKH 4XWGH 5IB1A 2M2DA 1F3DJ 1NEZG 1VADB 4JPWL 3ZKMD 1IKNC 2DQHH 1S7UA 2JIXA 3P9MA 1NBVL 2VUYA 5D6DC 3VDCA 4PJ9A 3GBNH 3S36L 1EPFA 3GGWB 1NBZB 4Q2ZB 2HAZA 1N6QH 2X4TB 4MQXC 4F37K 4EUPB 4L8CA 3PHOA 1D3CA 2LFGA 2R56L 4GLRH 1PYWA 2APXA 5IW6A 3VFMA 5AZEH 4IRZL 3P9LB 4N90D 3GHEH 3GSUA 1TNMA 2VISB 3QIWA 4PFEA 5FV2A 3HNTH 4PRIE 3TNMB 3U4BH 5J1AB 5SV4A 2XN9A 3WEXB 2J88L 5JQ6H 4HT1L 1XCTA 4FZ8L 3L3DB 5JHDD 1DBMH 5FDWB 1GZPB 2O5XL 5FYJD 2Q20A 1U3HA 3ZHDA 3KWWA 5IHLB 3MNWA 3RZCC 15C8L 4IMKC 2BVPA 5DZNA 3VD5A 1QKZL 3SKJL 4N0UB 4HBQA 1T2QH 4PGDB 1MPAL 2NY2C 3KPSE 3UROR 1NGXA 2DRUA 2X40A 1FPTL 3FQUA 2A1WL 3M1BB 4MX7B 4AZ8A 2IADB 1E4XI 3STLB 3FFDA 3DRTB 1CICB 1WBZA 1OAXL 3W0WD 1QFWM 4KROD 1X6LA 2V6HA 2YD9A 2LVEA 4TULL 3B9EA 3QG7L 2N56A 2AQ2A 5DURB 3NPSB 1HN1A 3ZT6A 1WTLA 3T0VA 2D7PA 5HHVL 5IVNA 1N5AA 3QP3A 2B1AL 5JA9A 5C0DB 2XWTB 4X6DE 4PR5A 4XCFL 4LQFL 3MRPB 1YN7A 2BNUA 1ZSDB 3PWPD 2HJLA 7FABL 3QPXL 2VIRB 1I85C 4OV5A 3HRZA 1ROWA 3DX9A 1DBAL 3S34L 4R0LA 1D5ZA 4FG6D 3MRNB 1DUYA 3B83A 4Z76B 3A6CL 5E1HB 3SKNA 2VLLA 2O61B 1GGCL 4E0RA 3U7YL 4KTDH 3WXWL 3PHQB 4MDIA 5BS0D 4NIKB 2B2XH 4TNVK 1F45A 5DS8B 2RCSL 4YR6A 4K3EL 5J1SC 3IT8D 1I9RH 1J5OL 1X5YA 2IG2L 4E41E 1RZIB 1JCKA 3QEQB 4O2CB 4PJXE 1X5ZA 1UM4L 4OF5A 4EDXA 4M9PA 3LRSA 4OCSH 3MSPA 5J06A 4JAMA 4R7DB 3WV0A 5HPMB 5JHDA 5ERWA 3WBDA 3RTQD 3MJ6A 1JGUH 4R4NC 4G6FD 3GIZH 1MFAL 1CFSA 1SY6A 1DTUA 1KPRA 2ADIB 4QY8B 1UH3A 3KLHC 1GOFA 5ESAA 2PYED 4HBCH 5EA0L 3SBWA 3MZTA 4KKNA 5HHME 5GISL 2GQHA 2P8MB 2R8SH 1DVFB 1VEMA 1SBSH 1PX4A 4EIZC 5I1HH 4GS7C 3PGCA 3ULUC 1OAKH 1JF6A 3UO1H 3KPNA 1KB5L 1RJCA 5CP7A 5A2IH 5J89A 3W0WA 4WI7A 4BZ2H 2X6MA 4WJ5B 3KYOA 4IIQA 4XMKH 4H0GA 2VSCA 4WHCA 3O4OB 5F1NA 3ULVE 1BHGA 4P0DA 1AGBB 4GAJL 4DQOH 4MJ5B 3CSBA 3X3GL 3PWPA 1DSFL 5L6YH 4WNQA 2YC1A 2WBKA 5IJVA 3DVIA 1PKQA 2Y4SA 1FYTE 3NPZB 1TJIL 4HIHB 4KFZC 1J8HE 4TUOB 2VR4A 3PNWB 1C1EH 4JQIL 2OXHA 4P46D 1ADQA 3MUHL 3JWDC 1I3RB 2E8YA 3GSOA 2Z35A 1FGNL 4XBGB 2BNQB 5IT2H 2G5BB 2ADGB 4OCLC 5BS0A 4RCAA 3LN4A 4LCWA 3BKMH 1L9MA 4R7NA 1G9MH 4YAQB 1FG9C 2AJYH 1HKFA 1ITCA 1XZ0B 1RUAL 4KRPB 1AGEA 1G7HB 3JUYA 1Q0XL 3VG9C 2HH0H 3CSGA 4Q9CA 5B39G 3CSPA 2AXJA 4LSPL 4PBXA 5HD8C 4PYHA 2ZUVA 4DGVH 3BIAX 4JPIB 3C5SA 5SWZE 1T1XA 4WEUD 4M7KH 2O5YL 1NMBL 2PW2B 3C5ZB 4Q6IB 2CMRH 5GS2H 3UPRA 3T8XB 2HWZL 4DGIH 2R0LH 4NFBA 1CLZL 1JWMA 2V7HB 2EIDA 4BFBD 1OT1A 4JJ5B 3V0WH 5K9JH 1WWWX 3RTQA 2ADJA 2BSRB 5D7IF 4HH9B 1BEYH 1NFDE 2XWJA 1EGJH 1AGDB 3CX5K 4JN1H 1RMFH 2VABB 32C2A 4JKWA 1A9EB 3QQ3B 2PYEA 4J7RA 3CC5A 1JYNA 2WANA 3PJSA 3UTZB 2FWOA 4HS3A 2AK1H 3NBNA 3ZHLA 3BXNB 4NQVB 1YPZF 3OGOE 1CT8A 4OZFG 4JO1H 5KVFH 2AEQL 2EEAA 3HZKB 1NAKH 4PUBL 3P0YH 1MHEB 1JPGA 4RFEA 3S9DB 3I02B 4E42B 4YIQA 1YNKL 2FHCA 3UAJD 1A14H 1Q9LB 3OHXA 4G8GD 2DYPB 5EU5A 5I74B 1QBLL 1C16A 5D7SH 4I2XB 4EQ3A 2NMSA 3IKKA 1WIUA 1YJDH 1UB5A 4X8JA 3VJ6B 4KDTC 2NY4D 4K7PH 1TZHB 2BOCB 4D0DA 1JRHH 1X7QA 4MNHA 5L0QB 4HS8L 3WNOA 2IPTH 5C0CE 1K2DB 5E2TH 4KHTL 2CJUL 4BSJA 5C09E 5SWQB 3QUYC 3O4LD 3MRLB 4FQHA 5C0IB 1YDPB 2X1WL 2GT9A 4P46A 3U7WL 2QQKL 5F88B 3Q0HA 2E9IA 3UJTL 2P5WE 3LEYH 3RUGE 2OTWB 4XZUA 2ZPKH 3IFNH 4LIQH 1MHHB 3CFJB 4LSVL 2JCCF 2EC8A 1BBJA 3DARA 4X7SH 1GOHA 2FIKB 5CGMA 5FYJH 4WFGD 3WFCH 5HHNB 4XNXH 1SY6H 5DURD 4EVNA 3BD3A 4HKZA 4WEBL 1SJHA 5ITBL 4W6WB 4P23D 4X0KB 4XVJL 3E8UL 4XGZB 1Q9OB 1FNFA 4L4JA 4F15B 1DQMH 3L3HA 4OZGA 3QO1B 5FGCE 3CDGB 4WFED 3V6ZA 2DQDL 4ODHH 1JTOA 2E6PA 1MFCL 3VFTB 4PLKD 4N0RA 2F54E 1E4KC 1OAQL 2QKIB 4ZSOE 3S37H 1VADA 3ARBB 4H26A 1J8HB 3LQMA 3O8XB 5DEFB 5KVDH 4JY4B 5KBNC 1TFHA 5D1ZC 1YMME 4LOUD 4Y4FC 5EBWB 3GGWA 1HINL 1MCEA 4EUPA 1BBDH 4YHLL 4QHKI 2OK0H 3SGJC 3DURB 2W65B 5HHPB 3P9LA 2UV3A 1KEMH 1UACH 1XGYL 3QEQD 2NY1B 1ADQH 5E94B 5MHSE 1R6VA 5TFSH 4D94A 4G8GA 1YEIH 3RGVC 2WSKA 1I9EA 3WEXA 4FQ1H 3FCTA 3L3DA 4JM4L 2B7DT 1GZPA 4MD4B 4HUNB 3T3ME 4B7IA 2DWEA 3DBXA 3TT1H 1CQKA 1MCPL 3EO1A 4N0UA 1FQ9C 4FXKB 1YPZA 4PGDA 3MRQB 1H9VA 2MQCA 1MFNA 4PB9H 3O4LA 5JOPE 4D0CB 4FQQB 1BFVH 3SCMC 1DVFD 1MH5B 2XRAH 3M1BA 5JQHC 4MX7A 1TVBB 4HJJH 4Q74A 2IADA 4YDVB 2XG5A 3DRTA 1QRNE 4P2OB 3OR6B 5B3JE 3KJ6H 2V7NB 3LMJL 4K8RC 5T1MB 5FO7B 2BHYA 5E8DH 2YBRA 4OF3A 4NP4H 2IANE 5C0FA 2EDWA 1I3GL 4PRID 4WV1B 5C0DA 4P23A 2XWTA 1Q9KB 1OAYH 3D39E 4JZJA 4U1JB 4XPHL 3NFSL 2HFFB 3GSNB 1BECA 5GJSL 5DK2B 1MVFA 4Z7VE 3U48A 3NCYS 3QWOB 5C07E 1MEXL 3O2VH 3VRIB 5CD3B 2YD2A 1SM3L 3LSOB 4Z76A 2CPCA 2O61A 3KPSD 4WI4A 2B0SH 1MFEH 5C09B 1MF2L 3AY4A 4X6DF 4XXCA 1U8KB 1Q0YH 2HTKD 1DQQB 3PHQA 1EFXB 4O2EA 3UZVB 2P5WB 3IDYC 4U6VL 4LLVB 2E27H 4F80A 2W07A 5FUCE 3O0RL 4N5UA 5DS8A 1RV6X 4KRPD 3EW3B 3BJLA 1EDQA 2ZZUT 1ZA3B 1WZMA 5GRWA 5I1KH 4OM0L 1RZIA 3BKYH 3E6FB 3MPCA 3QEQA 4O2CA 4MMZC 3MYJB 2MQ3A 1J1PH 1YYLH 2VDOL 3C5ZD 2Y07L 1T7XA 1OGTA 4FFVC 4R7DA 3EJZC 5HPMA 4H8WC 4APQB 5FGCB 4DW2L 2QQNL 4NUGH 4PS4L 4S1QH 2FX9H 2BY0A 4WEMB 4ZSOB 3QA3B 1LO5B 3EFDH 4QRSB 3CVHL 4PJXF 1OM3H 3QXVA 2R2CA 2D9QB 2Z8RA 4JFYB 4PJHE 5FHAL 5DC9B 2DTMH 3NTCH 4LPTA 1DVFA 1U41A 3LVEA 1IC5H 2PN5A 4OCWH 5EOQH 5CD5C 3S5LG 5FA3B 3OAZH 1RZ7L 2FHFA 2VC2L 1GGTA 1FRGL 2LAAA 3RU8L 4BQ9A 5DRNA 3R4DA 4WJ5A 5SX5H 4MZ3A 4ACPA 1RZJL 2DYPD 4O02H 4U1SB 1CGSL 3VMOA 2Y06L 1G1CA 2DQGH 1AGBA 5C0ND 4X99B 4PRIA 4MJ5A 1FNLA 5DD1L 4FQLH 4DKEH 1ZLWH 4XC3H 4CMMB 3QI9B 2W0FB 4OGAC 3QXAB 4EUPH 4ZS7H 5GS3A 2NZ9D 4LSTL 2VDML 5IMLB 3QQ9C 1NCUA 2VXTH 3QR2A 4HIHA 1XMWA 2JJSA 4LHUG 4NO2B 4AL8H 3LAFA 2ZNXA 1P9MC 2UZIH 4M9OA 3MGAA 3ULVF 1OPGL 1I3RA 4H25B 4XBGA 1A1MB 2UWEB 5HHMD 1IAII 1IGTB 4R8WL 1RJZA 4HUMB 3MLYH 3W81A 1D6EB 3BKCL 4ONGL 1U2HA 5DJYB 4JFHE 4PV9B 4XHJD 1G7HA 1MWAL 2ICCA 4YPJA 2B20A 4P48A 3N9GL 3UDWC 1MOEA 4PJ8C 4LFHD 2FEEI 4JPIA 2IANB 1N0XH 3WKMH 4Z7NE 5F9AC 4X6DA 2PW2A 3C5ZA 4Q6IA 3T8XA 5LWYL 4OB5L 5D2NE 2V7HA 4JJ5A 3JV0A 4JKMA 5J57B 3ARBD 3RL1A 5TDOB 1KCLA 4HH9A 5C07B 1J8HD 3O8XD 3R8QA 4BZ1H 1AGDA 5GS0C 2AI0L 2VABA 3Q1SH 5I1GL 5T5NF 3QQ3A 5SV3A 5JOFB 1QSZA 1ZV5A 1FGVL 2VH5H 2X89D 4UZGA 4H1LB 4UI2A 3GK8L 5I73C 4X7EC 3UTZA 3BRFA 3VRJB 2J2ZA 4IHOA 3BEWA 5IFJB 2H2PD 3OAUL 1D9KC 1PAMA 2Z4QB 3RIAF 3HMXH 1IZKA 3HE6B 4LAQL 4YNYB 5CKGA 3BXNA 4NQVA 3GDBA 4EI5C 4WI9A 1NFDF 3WIHH 5CZXC 1MHEA 3WDHA 3R06B 4QWWC 2DM2A 4EKXA 3ARGB 5L8KB 3DROA 2CDEA 4HPYL 1TVHB 3WHE1 1Q9LA 5CKAA 5I19H 1UCBL 2DYPA 3ZTJH 1XF4B 1NCAL 4I2XA 5SWZD 2VMFA 1Y6MR 1F4YH 2RJMA 1HIML 1ZGLP 2AJVH 4O4YL 2IJ0C 4NJAH 4WI3A 5ALBH 2AQ3A 1CXFA 1WZ1H 2BOCA 3B6SA 3EO9H 5FCSH 4UT9L 2HMID 3ILQD 4L1HA 5A2FA 2V2WB 2JLLA 3P30L 1ZVHA 1R5VB 5SWQA 4Z7WE 3MRLA 1YDPA 1DL7H 2ZUQB 4G6JH 1VCAA 3CD4A 4Z0XB 5GZOD 5KSUA 1H3PH 3EYSH 1S5HB 4PJHB 3T77B 2VXVL 1MHHA 3CFJA 4E5XA 5T3XL 1AE6L 3QAZC 4P2OD 1AC0A 2FIKA 5IBLD 5ISZE 3VGFA 2WP3T 5HHNA 4W6YB 2DLEA 2D0HA 3K8KA 3MRHB 3GSVB 4KQ3L 1G6RB 2G60H 5CIPB 5EO0B 3RUGF 3UPCA 3REVB 4OLUL 1RUPH 2X7LB 5EZIL 1L4IA 3AXLA 3PWVB 3QO1A 2B4CC 4P4RA 4UB0H 2NY6C 4U1IB 2DKMA 2LU7A 2HJKB 2QKIA 3LV3B 3WJLC 5LAXA 5C0CD 3VH8B 4KUCD 4OFYD 3ARBA 1SVZA 5GS0L 4KPHH 3MLVH 1J8HA 3O8XA 2AJSH 5C09D 1KCSH 4I9WE 4LPWA 4WFHE 5DEFA 4JY4A 4JKPL 4XPFL 4X6EB 5EBWA 2X89A 2P5WD 3T2NL 1BJ1J 3VGAC 1N0LA 2P47B 4X83A 4PY7B 4EJ1C 4QT5A 1JK8B 1WIOA 1UA6L 4F33B 3GBML 1ACZA 3BMWA 1KCVH 4OD3L 2R0WL 3DURA 2YD8A 2W65A 4ZTPH 5HHPA 3X17A 1ULVA 1WISA 3QZWG 4HFUL 1WT5C 5E94A 2A9NH 2FNBA 4Y19E 1E6OL 1G7LA 1KN4H 4ZYKB 1CK0L 2E7HA 3NIDE 4D9RD 4J3SA 5K33A 5SWZA 3QFJE 2CK0L 1JWUA 5I8KH 4GG6E 4APQD 1OTTD 5H35B 5F71A 3EOTH 4MD4A 2BVQB 4U3XA 1J1OL 1Y18B 4O00A 4QXUH 2X5PA 2F54D 5EIQA 5K59F 4LSQH 2X4RA 3QO0B 1S7TB 4FXKA 3MRQA 1I7UB 1DN2A 3M45A 5DGQA 4I3SL 4D0CA 2J4WH 4FQQA 4BH8B 1MH5A 4KH2A 1C08B 1KYOK 2ENSA 2V5YA 3CUPB 4XVTL 2QSVA 5CEYA 3T3MF 5JIHA 5I15H 1LO2H 4P2OA 5FYLD 4ISVB 1IGIH 4GRMB 2V7NA 5T1MA 5FO7A 3VXSB 3PP3K 4P57B 5F89B 1RD6A 5DFVD 4AEHH 3RZCB 4ZG1A 1PDKA 4F3FB 3OKDA 4OFIA 5TF1H 2CLRB 1J88A 4QLRA 3NGBC 1NAMB 5MHSD 4WV1A 5L2JB 2NY2B 3QHFH 4LPUA 2A9MH 4F37F 2ZSWB 3QI9D 3JTSB 4U1JA 2HFFA 3GSNA 2VRAA 4XCNB 5B3JF 4UBDD 3ULSA 4Z5RA 4L1DA 3QWOA 3MLUH 4Z0BH 3K3QA 3VRIA 3VXME 5C0CA 5E9DE 3LSOA 4U33A 1N3NA 4OFYA 1A21A 2HT2D 3NIGE 4QHKJ 3BQUC 3TO4C 3JZ7A 5C09A 5KJRL 4QRRB 1J12A 2OMNA 4HDIB 3S88L 3CH8A 5C71A 3N0PB 4OGXL 3INUL 3T4AB 2P5WA 2WUCH 3C5JA 4W6XB 3RUGA 3P4LA 4P59H 4Z7VF 1BVKA 4RFOL 4ODTH 4JFQB 1CFQA 2K7PA 4JRWA 5J8OA 5ISZB 1GGIL 2G5RA 1INDL 1JMXA 1NSNL 3BDBA 3KLAB 2EZ0C 4WO4B 1D5MB 2IAND 3BGFC 3NFPB 3VFUB 1F2XK 3SJVB 3HC4H 2EKSB 3FTGB 1BREA 3MYJA 3SGKC 4HF5L 3VG0H 5DLML 4M5YL 3IDMB 1N26A 3L3KB 4GKSB 4APQA 3OR7A 1G7PA 1CIUA 3WFBH 3FHQA 1FORH 5C07D 4RMQA 5JW4R 1DP0A 5A2LH 2F54A 4ZSOA 4M7LL 1LO5A 2X1PA 1CF8H 1KCUL 1I9JL 1KGCE 5E6IB 1FFPB 1A3RH 1KXTB 4JFYA 3ZTNL 4YXKH 4NWTH 2OSLB 3FB7B 4P2QB 3ULVH 3HE6D 4NKIH 4N1EA 1FL6B 3SGEH 4GKZB 1YEDB 1DQJA 3Q5OA 2X1XR 1GGYA 1DUZB 3QRGH 2CUIA 4NNPH 1EVTC 3ARGD 5ELIA 4ZS6D 1OTSC 3OXSB 4PRPB 5CGYD 1F6LL 2R0ZH 3WFHB 4LKCB 2DLFH 1KULA 1LEGB 4PJHF 4U1SA 4RGNC 5C0BE 3MLTB 1G7IB 5I9QC 4K07A 1FNAA 1RFDH 1XGTB 4XI5C 1M6OA 1IGJB 4CMMA 3QI9A 2W0FA 1JTTA 4LHQB 3RKDC 2IPUK 1A7PH 4NO2A 4NZUL 5IMMB 2ED7A 1QOKA 3JTTB 4GS7B 1HQ4B 2DL9A 4Q6YA 2OL3L 4OGZA 1CGVA 1N5YL 4H25A 1K8DB 4S1DC 1A1MA 2UWEA 3ZKND 4Z7QE 3WIIH 4HGMA 2XZAL 4ZFOB 3BN9D 5F1KC 4WCYH 1D6EA 1RUKL 4XBEL 3UTSE 5DJYA 4PV9A 4LLUB 3KYNB 2XKNB 4M6OL 1IGYB 3QCUL 1YEEL 2AXHA 3CFCH 2XTJC 4NT6A 2OP4L 4TSBL 4XP5L 2VDPL 3TA3C 5CBEB 2IANA 1FNEB 5F7KC 1T7VA 2IEPA 4PJ5E 4DFHA 4NN6C 1R5IB 4YQXH 3KXFB 2AXFA 2ZCKH 3MROA 5LG1A 5TDOA 4XAWL 5C07A 5GRUH 5IHUL 1KSRA 2DB8A 3CSYB 4LLYB 2CKBL 4ORGB 1JZ5A 5JOFA 2FH6A 3ALPA 3VG9B 5D5MB 4BFIB 4EDWH 4H1LA 1LK3L 2R2HB 4LCIL 4Z7NF 3QSKB 3VRJA 1CBVH 5IFJA 4NQTA 4B5EA 2FBJL 3HE6A 4MNQE 2XA8H 4YNYA 3BH9B 3BZ4B 2ZKHH 4JFHD 4F7MB 2Q7YB 5FOJA 3E1F1 4GW5B 5TQ2H 1YECH 4OCRL 1K4DA 4MD5B 1MCWM 3ARGA 2H26B 3P4OB 1TVHA 1RPQA 5FGBC 4JFZH 1UH2A 3IVKB 4BQCA 1XF4A 3IXTB 3OB0K 3VXPA 1RZGB 2KL6A 1DLHB 3FT2B 3VWKC 3QT2A 1E6JL 2UYLA 3JVGA 1H5BC 4Y2OA 3SPVB 1JMZA 1KACB 1U58A 4MQXD 2DLIA 3CJJA 3AU1B 4FP8H 2HG5B 4N0YL 4POYA 5C08B 1R5VA 5IHZB 1UWEH 4CAGA 5I8CB 5GRXG 4YXHH 1IFHL 3ARPA 5GGQL 3SEPA 1CE1L 4Z0XA 1AP2B 3WD5H 5KANG 4EZMA 4PJHA 2XNAB 3T77A 1OW0C 1I1FB 4KJPC 3V4PL 2CGRL 4J6RH 2H32B 1H3UA 1KELH 1R3HB 3N50A 2I24N 1MFBH 2B1HH 4OUUB 3IETA 3VXSD 2WQ8A 2EYRB 3WHXB 1NC4B 4FMKA 4XMPH 3VA6A 4MXQC 3ZYOA 4Z7WF 4N8CL 1SBBA 3MRHA 1CXEA 5DUPH 3GSVA 1TZGL 1G6RA 3MNVB 1H15A 1FIGL 3ARDB 5EIIB 3CU7A 3PV6B 5EO0A 3QUYB 1MJ8L 5JNYB 2X7LA 1T83A 4LU5L 3PWVA 4QXWA 4ZAKD 1HI6B 1QO3B 4KVNH 4U1IA 5BZWB 3OMZA 3V8OA 5IGXH 4M93C 2HJKA 3CFEB 3LV3A 3S3PA 4FS0A 1JE6A 2EO9A 2A74B 2JELL 3VH8A 5KG9B 4ODSL 1DN0B 5DHYB 1BPVA 3TNNA 4ZUWB 3E6HB 5CJBA 4AJ0A 1UWXH 3C9NB 1LO0L 4YHKH 1KN2H 5HSFA 5DHVH 3U7AA 4DN4L 4MNGB 5KSVB 3B9KC 5BOZG 4U1MA 3HUJB 4PY7A 4ZUUA 1QBML 1JK8A 1JIBA 4F33A 1J8KA 4NHUB 1OSPL 2QQLL 5DD0L 4DVRH 3X3FL 5ISZD 4OV6F 4Z7UE 2JB5L 4JREC 4MA1C 1B0RB 1RIHH 3SDYH 3TYFB 4WO4D 2XXMB 3ZTJG 5TPWL 3SJVD 4UU9A 3CDFA 5BV7H 2OQJA 4ZYKA 1IKNA 3QPQC 2K1MA 3OZ9L 3DSFH 4JFPB 2K9UA 1KCRH 1TXKA 3OPZL 5D6DA 4U1HB 1K8IB 4FA8A 5DT1H 1U8MA 1MRDL 2ITCB 4PJ5B 5D1ZB 3MQIA 4Y4FB 5H35A 3RWEB 4ENED 2BVQA 4I77L 5D2NA 2R29H 1Y18A 4RISL 5I8OL 5IEKB 3B5GA 3WYRA 1HK6A 4AEFA 1UH4A 3QO0A 1S7TA 2R4RH 4FQCH 3U0PB 1I7UA 5E6ID 2DDQH 2UVFA 3L3JB 4I9WD 3M8OH 4WFHD 3NIDF 4BH8A 5EZOL 1C08A 4OJFH 3ZYIA 4GG6F 4YHMH 1NCWH 4NJ9H 4ONFL 3CAFA 2VR9A 2Q8BL 1VKXB 4JANB 1FZOB 3MLXH 5HHXH 1OT2A 3LS4H 4IM8A 3AM8C 4IOIB 4OGYH 1GVIA 4ISVA 2PYFB 4Z78B 4PRPD 3VXSA 4P57A 4O51B 4R4ND 4YJZL 4A6YH 5F89A 5ADOL 4FABL 5HHOB 4AG4H 4F3FA 1RUQL 4IMKA 3KLHD 2CLRA 3SDAC 3H42L 4Y19D 5L2JA 1LNUB 5TH2B 2ZUSA 2ZSWA 3BZFB 1ACYL 4XCNA 3SCMB 4ZAKA 3HNVL 4U31A 5T3XE 4Q0XL 3JV4A 2AEWA 4M1CD 3ULUD 4JCMA 2CR6A 5L88H 1I7RB 1DQLH 2VDRH 2PCPB 1HH9B 3VXRE 3MUY1 4C55A 3G6DL 4Z7WA 5J56B 1QQDB 2NPLX 1RZ8B 4K9EH 4PIRF 5IB4A 1FNHA 4JPWH 3RP1A 1T5WB 4HLJA 2GAZB 1DFBL 1BZQK 3U83A 1NBVH 5EU4A 5I1IL 2OR9L 3S36H 3I6LD 4JFQA 1FIEA 4HZLA 1VERA 3AS0A 5DJZB 3EOAB 3MO1A 5ISZA 4RMRA 1I85A 3MV7B 3NIGF 4Y8AA 4HWBL 3KLAA 1H3WM 4WO4A 4ZOCA 4KJQD 4U6YA 1D5MA 1A4KB 3NFPA 3VFUA 3SJVA 2EKSA 3FTGA 3WUZA 4IRZH 5A16A 5B22A 3CFIC 1X6NA 1H8NA 1JHKL 4MAYC 4Q9RL 3IDMA 3L3KA 1QSEB 1T1ZB 2Q87A 4GKSA 3UTTE 4KZDL 1T6WA 2J88H 3IDYB 4HT1H 4XRCB 4FZ8H 1AGCB 2O5XH 5HGAA 2HTLD 4NPYB 4YHIB 1EVUA 4ZUTB 5E6IA 1FFPA 15C8H 4X5XB 3VD4A 1X3DA 4YFLF 4GAFB 4PRDB 3SKJH 5F3BA 2KQNA 2OSLA 2RGSA 3FB7A 1QSFE 3F7VB 1MPAH 4P2QA 3LHPL 1P7HL 2ID5A 5F9JB 1FPTH 3DXAB 2A1WH 5HJ3B 4OTXL 4GKZA 4DOHE 1Q8MA 3LPFA 1KJ2B 1TCMA 1HNGA 2BCKB 1DUZA 4PJDE 4WW2F 1OB1A 5TF0A 1A6ZA 4JGJA 3OXSA 4PRPA 4UIKL 3WFHA 4LKCA 4M48L 1OAXH 4XCCL 3P4NB 4PJIE 3AAZB 1NGYB 1QFUL 3GJFK 1MSPA 1W8OA 4PV8B 3MLTA 1G7IA 1C7TA 3FONB 3QG7H 4NO0B 4AIZB 4Y19A 2DMBA 1IGJA 2AABL 5HHVH 2B1AH 5DVMA 4GG6A 4XCFH 2HLAB 4N0CC 2EDNA 3CK0L 5IMMA 3JTTA 3RA7L 4LCCC 7FABH 1FNGB 1Z9SA 3QPXH 4EI6A 3MCG1 5F6HI 3S34H 1DBAH 4GG8B 1K8DA 1NFKA 1IAOB 2OZ4L 2IFFL 4JFOB 1NDMB 3FT4A 3A6CH 5DJ2B 4G8FB 1UQSB 1GGCH 3LQZB 4ZFOA 4I0PC 2X4PB 3L9RB 3EUUA 5DZOA 3FFCE 3GNML 2DMKA 3U7YH 5LCVH 3WXWH 2R2BB 5CZVL 4FQ2L 4LLUA 5DFTA 2CDFB 4HC1A 3KYNA 2XKNA 1IGYA 5FYKU 2MTPA 3RPKA 2RCSH 2BY2A 4PJCE 3ARDD 4K3EH 4Z7QF 1DLFL 3QUYD 5CBEA 1N6VA 2YSSA 1FNEA 5CJXA 2UZYB 1J5OH 5DVLA 2IG2H 2P8LB 1R5IA 3OG6B 4AT6B 3ALXA 4NGHL 4O9HL 4FRWA 1RZKC 2EYTA 1UM4H 1ES0A 1BQUA 4MSWA 3GM8A 3MBEC 3OKEB 1S7XA 4OSUL 4JFFE 1XFPA 3L5JA 2KUTA 1CXIA 3CSYA 4LLYA 3PE9A 1U42A 3LKQB 5EUKB 3DI3B 4IRSD 3ZE0E 1MFAH 1LDPL 4BFIA 1MCRA 4HG4J 2VLKB 2R2HA 3HI1B 4LFHG 3IFOB 4PJ8B 3IU4L 1XR8B 4M4PA 5EA0H 1M7IB 3H3BC 3T65B 1W8NA 5GISH 4A2LA 2BJML 3BZ4A 4PJFE 5EU6E 2ZOLA 4F7MA 2Q7YA 5J1TC 4U1GB 4GW5A 3FQWA 3REWB 1MNUL 4MD5A 4CMHC 1CQYA 2H26A 3P4OA 1MCFA 1KB5H 3MJ9H 3U4EB 3BDYL 5EIVA 3IVKA 3IXTA 2D2OA 3FT2A 4LKXB 1P4BL 3DVNA 4G5ZL 4PJ5D 5D1ZD 4R3SB 4Y4FD 3U9UB 2BSTB 5I73B 4GAJH 2XQBL 1KUMA 5TQ0L 1D9KB 3AU1A 5HYFA 2HG5A 4MJ6B 5F9WC 3X3GH 3LB6C 5IHZA 1DSFH 2ZUWA 4EI5B 4RWYL 4XNMB 4LGPB 2YN3A 3BE1H 1TJIH 4L8SC 3Q6GL 1AP2A 3T0DA 5T5NG 4P3CL 4JQIH 2XNAA 2ZSVB 3EGSB 1VFAB 1QSFB 3D18B 1FGNH 2H32A 1R3HA 5DJ6A 3MRKB 4JFEB 4OUUA 4PJBE 2EYRA 5IBTL 5DQ9A 5HHOD 4Z8FL 5I76B 4YHYC 5HYIA 1LEKB 4HMCA 3T0XA 3MNVA 1OQOA 1RUAH 3ARDA 5EIIA 1U0QA 3PV6A 3QUYA 1Q0XH 3QULB 5JNYA 4MAUL 3SKOB 4LSPH 2ADFL 1HI6A 5DMGD 1QO3A 4OFKA 4M6NL 5TDNB 1ORQB 2W59A 4XWGL 5BZWA 1B9ZA 4H88L 4JN2B 2O5YH 1NMBH 1G9NL 3CFEA 4WDIB 2DQHL 3QAZB 3UCRA 4W81A 5E7FA 2HWZH 4K8RD 4L3CA 5DHYA 4ZUWA 1CLZH 2H6PA 2MKWA 3E6HA 4NQXB 1A1NB 3C9NA 4IRSA 5F97E 4JM2C 4PYGA 1ZEAL 3PL6D 1E4JA 1JTPA 2NW2B 4GRLC 3RHWK 3O3EB 4NCC1 1ZOXA 1XGRB 4NQDB 5IMOB 1JGLL 4PJ7B 5C0GB 4OT1L 5JHLL 5AYUL 2CKNA 1K3IA 3WUWB 5I75C 1B0RA 4LP5A 3TYFA 3THML 3ZLQC 3W2DL 2MHAB 1RURL 2AEQH 2WLZA 4PUBH 2YD3A 4HXAL 4JDVB 5ESQA 4X9FA 3W82A 1EUUA 1YNKH 2JKXA 5JZ7C 4U1HA 1K8IA 1WV7T 3BKJL 4PJ5A 5D1ZA 5CLWA 5JLZA 5KVMC 4Y4FA 4OLWL 4DK6A 1QBLH 1EEYB 3VGAB 1DCLA 2Z91A 4Z7UF 5IEKA 3RBSA 1WVZA 2HN7B 4I18C 4ORZC 3U0PA 3SGJA 4NSKB 3WN5C 4JFFB 4HS8H 5INDB 3L3JA 1T1WB 3OKYA 4MXVE 1PG7L 3RWGB 2OYPA 3ESVF 4HIJB 1MUJB 4NUJB 4RZCB 2CJUH 2DQIL 2GI7A 5J9PB 3C60C 1QLEL 4P5TD 3DXAD 4JANA 1FZOA 4L4VE 3U7WH 3ARSA 4OQ1A 4FFVD 5TE7L 3ROOB 4IOIA 4Y89A 3UJTH 1DE4A 4K23L 3HG1B 1TNNA 4Z78A 2J6EL 4LSVH 4F58L 1FHGA 1IMHC 5FDYA 2EICA 1CGWA 1BD2E 1EEZA 1G7QB 5FKAA 5HHOA 4HWZB 1EJOL 4G80B 5IBUB 1HE7A 4NO0D 4GAYB 5TH2A 1SQ2N 2WBWB 2XY1A 2VYRE 4WEBH 5ITBH 3PHSA 3BZFA 1JL8A 3SCMA 1NLDL 3L5HA 1BOYA 4XVJH 35C8L 5EOCJ 5CD5D 4KKCC 2GEEA 4YHPB 4F7EB 1ZLSL 2P24B 4HV8A 1I7RA 2DQDH 2PCPA 1K5NB 2ARJQ 3QIWC 1HH9A 2YK1L 3H9HB 1MFCH 3EZ8A 3C2SA 4PB0L 1QQDA 1OAQH 2XTJE 2VUOA 2EDHA 2GAZA 5C6TL 3TO2B 3TBTA 5EU3B 3NGBB 4DUVA 9CGTA 1G9MC 2FD6L 1ZHNB 2XPGB 3JV6B 3ET9F 1HINH 4OGAD 1I9RL 3QFDB 1JNNL 5HGBB 5DJZA 3EOAA 5D7JC 4NHCL 2IAMD 3MOBL 4M5ZL 4IJ3C 4NN5C 5E8NA 3ME0A 4HIIB 3B2UC 3PABA 5C70A 2W0PA 3TH2T 2OL3B 2VDNL 3MR9B 3TO4B 1U92B 5DEGB 5I66B 1XGYH 1QSEA 4XBPA 1T1ZA 1UFUA 3GIZL 3AC0A 1MY5A 1MJJB 4XRCA 1JHTB 4JM4H 2P8PB 3BP4B 5KZCB 1AGCA 1KLGB 5HYJB 4HMEA 4NPYA 4YHIA 4ZUTA 3BMVA 2VLKD 4X5XA 1OY3B 1MCPH 4PRDA 5EBMB 1X5JA 4WFFE 1JYXA 3F7VA 5DMJB 2Z93B 3DUHA 5SX4H 4I3GA 5C2UB 1M7XA 3UO1L 1IC1A 3DXAA 4Y1AB 5HJ3A 3UYRL 3EDEA 5DRWB 3U30C 4R0LC 4WIQA 3G9AB 2BCKA 4FOMA 5F8RC 4LQ1A 4I0CC 1C8PA 3O2DH 2C1OB 4POUB 3W9DB 1NEZB 3P4NA 5GS0D 1NGYA 2X4UB 1LO3H 3FONA 4NO0A 4AIZA 3MCKB 1YJDC 4G7VH 3OJ2C 2EIZB 1I3GH 5IMKA 1D9KD 1I1YB 4PJDF 1HEZA 2HLAA 2YN5A 5B8CB 2ESVB 4XPHH 2YS4A 1JRHI 3NFSH 4EI5D 5MEOB 1FNGA 3SE3C 5GJSH 4PJIF 4X98A 1K9TA 5EORL 4QWWD 3RVVD 1AXIB 5IF0A 3HZMA 4JFOA 1SM3H 5DJ2A 2QSQA 3WNMA 4MLSA 4G8FA 1QSFD 4FZEL 1UQSA 2VLMD 4RGNB 3LQZA 3ZE1E 2X4PA 3L9RA 1MF2H 2AJYL