3NCCB

A human prolactin receptor antagonist in complex with the mutant extracellular domain h188a of the human prolactin receptor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
206
Chain Sequence
MLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDAGYWSAWSPATFIQIPSDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prolactin
publication title Two Independent Histidines, One in Human Prolactin and One in Its Receptor, Are Critical for pH-dependent Receptor Recognition and Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/hormone receptor
total genus 36
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2010-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nccB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3nccB01
5D7LE 5KTEH 1NCNA 5IHLB 1X5FA 4JM2A 1A7BA 2GAZA 3CFDA 3MBED 3QDGB 4PGCB 1MCOL 2DQFA 5I18H 1C08A 1YEGL 1U92A 1HEZA 1CFVL 3GKWL 5BOZG 3EDEA 3O3AA 4FFVC 5B3JE 1NGYB 3DV4B 1F6AB 2V2WA 3X11A 3CSYA 3QEQB 4QF1A 3LN5B 5E8OA 4JZJA 4D0CA 4U33A 1QG3A 3DRTB 1J88A 1KJVA 2BHZA 4NP4L 3K4AA 4RMSA 1VCAA 3T04D 1MFAL 4PY8J 2EDFA 1KC5H 4UDTA 5TJWK 2AQ1A 5IVZA 5D2LE 3WXVH 1YEFH 1OL0A 4Q97A 3I6LE 2XWJB 5F44A 4EN3D 4UTAL 4C56D 2V5SA 3I6GB 5DQ9A 1NGXB 3QH3A 4XNXH 2D31A 5ACZA 4LBEA 4L3EE 5HVFB 4MJ4A 5D2NB 3L5XH 1OD7A 2Y9RT 5ICYB 5IMOB 3D3VE 1G7IA 2CLVB 1DBJL 4QWWC 4U0QB 1JPSH 2IFFL 5KSAC 5TDNA 4OCWH 4TTDC 1KLUB 3D25A 4TVSa 4LDEB 1TQCC 3WNPA 4NO0D 4OCNC 5DHVH 4GAYB 1S7XA 4Y16B 1K8IB 1RZFL 4A2MA 1X6LA 4TN9A 4MDJA 1IAIL 4M61A 5F6HJ 2HTKC 2JJVA 5I8CB 4KKNA 4LAQL 5HI4C 2YRLA 4MA1C 3KPPB 3P11H 3M1BB 1T7WA 1IC7H 4DJMA 4X9BA 3U7YL 2W92A 5MEPB 3QISA 1FG9C 1QLRB 3BEWA 3RWDA 3VD9A 5E6IC 2DLFL 3DGGA 1SY6A 1EEYA 1LO0H 1E4XH 2HJKA 4PREA 1AIFB 4H0HB 5E9DD 5C0AA 3W11C 2HP4A 3QXWA 4HLZH 5D7JD 4Z7VF 3JTSA 1LD9B 5KSUB 4DKFL 1LDSA 2CK0L 1BQHB 2WBWB 3DXAD 2C5DC 3TO4A 3RWIA 2Y5TA 4CVZA 2X4QA 4CADA 4XCEA 1BQUA 4G7YH 3HPJB 3GMMB 4WEBL 1A3RL 3PWPB 1S7SA 3V6ZB 1HIML 2BY0A 3LV3B 3MV8B 5L9DL 4ENED 1A6ZA 2H45A 3G08B 2EDRA 3HZYB 3PP3K 3KJ6H 1BBJA 3UC0H 4M43L 5D7KD 3TP4A 1NAMB 3L95B 5FYKU 3O2WL 1FIGL 4DZBA 4JANB 3D5OF 5ICXA 2DDQL 1KSRA 1KTKE 4YUEH 2P24A 2W9EH 3QWRA 3TZVA 3WJJA 5JXED 1RUKL 2AKRB 1ZMYA 3OKMA 3A0OA 3DVFA 5C0IB 1JHKH 1RK0A 1XAUA 4LHUA 2NX5B 5A2JH 4GLRH 3KYOA 5E56A 3R8QA 1FYTA 4QGTA 4ZUVB 5FYKE 1IKNA 3IKCB 4HWBA 1MFNA 1EK3A 2D03L 1VKXB 4Y0GA 2X4SA 4F7CA 2YD3A 3VWJC 3BO8A 3QUXA 5HYFA 5IB2B 2VN4A 3MMEB 1GC1L 3WXWL 5TE4L 5ILTL 2NY3D 3DTXA 3FO9A 1CLOL 2R1XA 2AP2A 5FF6B 1I75A 1JWUA 3G6JE 3LIZH 4LVNC 3WFBH 1F58H 2ADGB 1XCQB 1VGEH 4HIIB 1BOYA 5GISL 3FONA 3CAFA 1QSFB 4YDLB 4TVPL 3WCYA 2ICEA 2YSSB 3GSUA 4FTVA 5FDWA 5IP4A 4L3CB 1OQXA 1TVHB 5IJKC 1YUHB 1MCPL 2IALB 5GS0H 4E41A 4BQCA 3LN4A 3ARPA 3P9MB 5ESQB 4GRMB 4P46B 4Z7UF 3TT3L 3EOAA 3P9WB 5BVPL 1I8IA 2JELL 4X99B 1T7YA 3B43A 4NHCH 2DB8A 2Z8RA 3TFKC 2NYYD 3RVVC 3HE6C 3L3HB 3AU1B 3BIKB 2X4OB 4HGWA 4EI6B 3TN0B 3U4BH 2A77L 1GGBH 3MRHA 3MXVL 4XPBL 1NMAH 4HSQA 4G8GA 3LH2H 1FNFA 2LQRA 4J3SA 2CMRL 4NUJB 3H7BB 3H3KA 1MCBA 3JWNC 1I8KA 2XN9A 2FEEI 5FEBA 3O4LA 1Z3GH 4KPHL 3HNTH 4RGMC 5KSBE 3RUGA 1I9RL 1T1YB 1I7ZA 3IJYA 3EYUH 1BBDH 2I27N 1M7DB 4UIMA 2GEEA 2VLKD 4MNQA 1KB5L 2BFVH 5JUEL 4KH2A 1F3JA 5GGVL 2I9TA 3CUPB 3MGAA 3VRLE 4HHAA 5ANME 3VXNB 4IDJL 5IGXL 4LASH 1U9KA 1SM3L 4OQTA 3IAGC 2QR0A 4L1DA 3IFNH 2R0LH 5FUZL 2XZCH 3UJJL 2E27H 5FUCC 3IFLH 4UB0L 3ARED 4HFUH 3IDJB 5I6XC 5I8KH 5CKAA 1T03H 1SJVA 1FV1A 1A2YB 1ND0A 4PRPD 3ZMRA 1MCSA 2EDEA 2E6QA 5DJ8A 3ME0A 4CU7A 1J1PL 1UJ3A 4PRHB 5E00B 3WNOA 4JN2B 5EOCH 3KPLB 4NQCD 3IDNA 4YE4H 2DIJA 2EYTB 1SYSA 3CXDH 1EIBA 5J6HA 4P3CL 3ZE0F 1YQ2A 5EIQA 4U7SA 3MLVH 3VFWB 2NY2C 1YYML 2Q8AL 3ARBB 2X4TA 4OLUL 4P9HC 2YA1A 4F9PC 1VERA 2WUBH 4LDLB 5E8EA 5EU3B 4U7MA 4L8SA 3HN3A 2I60L 3DMMC 1MIML 3NCYS 4R0LB 3SGKC 3BJ91 1OARH 2X1PA 2YHGA 4WI3A 1GZQA 5J57B 4GS7C 3QEGH 3MRCA 3WUWB 4PJIB 2CJUH 3S5LB 3E0GA 3C60C 3RA7H 2X09A 2JK5A 3G5YA 5IB3B 5EZLA 1BJ1J 3GO1H 4HFWA 4MZ3A 3KYAA 4J6RH 4NN6C 2RFXA 4H8WH 4PV9A 1SMOA 3I84A 5ID1A 1ES0A 2VWEC 1H3GA 2OQJB 4U1SA 1YMHB 4BQ9A 4GXUM 3T4YB 5L88H 1NJ9A 3F5WB 1JNHB 3O3BB 2NXZD 4UMGA 4OLXL 1DLHA 1Q94A 5DSCB 4LLVB 3F7RA 4HC1H 1NGQL 5EC1B 1OVZA 2N7BA 3RNQB 3PDGA 1YNTB 3QEUA 1BAFL 3V0AC 2DBLL 3SKOB 3UTTD 3PDOB 1FAKT 4N90D 4PRBB 3BAEL 3Q5OA 5JO5A 1INDH 5GXBB 3G6AB 2WBJB 3FTGB 2ZKHH 2VABA 3MNZA 2IFGA 3Q6GH 5GGSA 1TZHB 1HCFX 4JM2B 2GAZB 3KPRD 4X6BA 5FYKL 4DGIH 3HAEH 2YEZA 3VGHA 2VKWA 3VXQA 2W1NA 4LKCA 1C08B 4Q2ZB 3K8MA 1U92B 1HEZB 1CICA 3HI1A 2IC2A 5INCB 3UDWC 3H9ZA 4RZCB 3V8OA 1GGUA 3ZKSD 1CTNA 4YHNB 2MKWA 3CSYB 4WFEE 3X11B 5E8OB 2B2XL 4JZJB 4D0CB 4D8PA 1KJVB 4MQTB 1XGUA 5D72H 2AGJH 3ZTJH 2F15A 3S4SB 5EZJA 4GKSA 5IVZB 1G7PA 3EO1A 1ZA6B 4V1DE 3VA2C 2HYMA 3M45A 4KV5F 1EGJH 4JFXB 5DQ9B 3QH3B 4LBEB 1REIA 4U2YA 5LQBL 2OI9C 4K3JH 5KVDL 1WAAF 2QEJA 5GRYA 3KYMA 2HT4D 2NY6C 3KHOA 3W2DH 4U31A 1TCRA 1JF5A 3MLZL 3IDYC 5SWSB 5F9DC 3D25B 2JJTA 5FK9B 1PGRB 1XGQB 3JV0A 2XZZA 1IC4H 1N6QL 2GSGB 1P6FA 4OD1L 1KCSL 3VFUA 2YUWA 2QQLL 1ZHBB 2M2DA 1S7XB 1M1SA 4I3RL 1IVLA 2IAMA 1EAJA 3H7LA 1BWWA 3OAZH 4OI9A 4MDJB 4M61B 5F3HA 2BVPA 5K59E 1IL1A 2Z31C 3O9WB 4MNHB 4LU5L 2D9QB 5GS2H 1L7TL 2ED8A 4TNWF 2C4FT 3RY5A 4F9LC 3BEWB 2VDKL 1EEYB 4FA8A 4M5ZL 5C0AB 5I75C 5IVXE 2NY5C 3EGSA 3JTSB 4YPGA 5FCSH 3UPRA 5E2VH 3DJ9A 1X4XA 4MAUH 5HHPA 3GSNA 2ZOLB 5C0RH 3ES6A 3C5ZA 4XWOC 3TO4B 5I8EB 3RWIB 3UBXI 1Q0YL 2Y5TB 4CVZB 2X4QB 3WNNA 3GI9H 3S9DB 1OLZA 1OSZA 4BSWA 3SJVB 1MRFH 4ETQA 2OMBA 1VEOA 4R96B 2R4SL 1S5HA 4PJDF 2EH8L 3HG1A 2ARJA 2XY1A 5BXFA 1DUZA 1U6AH 3LS5L 4JHAL 1F2XK 1CWVA 5E99H 1ZV5A 1A7OH 2QSVA 4U3CA 1CFTA 5HXMA 1JYWA 5FUCE 3Q6FA 1BBJB 2VDQL 2VISA 2YK1H 1I8MA 5DD6A 1E6OL 5MEOA 2H2PC 2FBJH 5ICXB 1NDGA 3ZKXC 2P24B 3I02A 5C07E 2H9GA 5KOMC 4JREB 3U46A 2VYRE 4NN7C 1J1XH 2WIIB 4C58B 3RTQD 2QQNH 4TSBL 1CLYH 1RK0B 2DI8A 2X4RA 1UWGL 1MRDH 4L4TD 1CZ8L 1CU4L 4G7VL 3KYOB 5D1ZC 1KIQA 1FYTB 3OGCA 5T3XE 1BQSA 1C1EL 3ARYA 4X9HA 2X4SB 4F7CB 3O6LH 6FABL 4DTGH 2HFEA 3I50H 3QUXB 4RISH 3CZFA 1ZLWH 5L0QC 4EZMA 4LIQE 4M7ZC 1RZGA 1QFHA 3MRDA 1FFQA 2VXQH 4ZSOA 3DTXB 2EDWA 3FO9B 1G7JA 2JTDA 3MC0A 1JWUB 1QZ1A 4LSTH 4YX2H 4J4PD 2IADB 3PV7A 2C9AA 5ISZD 4BZ1L 3P0YH 4BFEA 3FONB 1AHWC 2ICEB 4FTVB 4K8RH 5FDWB 4PB9H 1YY9D 4F7PA 1WEJL 5DHVA 2W9LA 2VWEE 4E41B 3INUH 3BXNA 4UNUA 1WBYA 3QDHA 1DZBA 4XCNA 5T3ZD 1IAKA 3EOAB 1I8IB 5ABDE 3P40A 4GRLA 3K3QA 1AI1H 5I1EL 4PGEA 1S3KL 4LCCC 1CFBA 1HQRB 1RZJH 4Y5XB 4A2LA 5CKGA 2HLFC 2NY0C 3O3EA 4LPUA 3MRHB 4OCXH 4G8GB 3W5NA 1UZ8A 1J11A 3E2HB 3QUYB 3L9RA 3K8KA 4ESKA 3DX8A 1PZUB 1I8KB 2XN9B 3RFZC 3O4LB 3W9EA 1D5IL 2YPLD 3NIFE 3RUGB 5MEND 3U7AA 1UKTA 1I7ZB 3IJYB 3WFDH 2KH2B 4KJQC 1QSZA 2BOCB 4Y2DD 4CMMA 1P7KA 4UIMB 5D71L 4M3JA 3RKDC 3ULUF 2VO5A 5C3TA 3C9NA 4MNQB 5F7YC 1PKQA 4HKXA 1F3JB 4MVBC 4Z95H 1I8LC 4OZFG 1ZHNB 3FQUA 4X9FA 3BISA 5IOPB 5CP7B 1Q0XL 3ISWA 4NUGH 5CSGA 3O4OC 5CJ8A 1PDKA 5HYEA 5L7XL 4K71B 2VL4A 3QIWA 4Y4KD 1ADQL 2QR0B 2LVEA 3BGMA 1FRGH 4OGAC 4TUKH 2XXMB 2ERJB 3UTQA 5HGGS 4P23C 1A9EA 5J0BA 3SGEI 3BPLC 4LLMA 1KN4H 5C0BA 1OAUH 3TBYA 1ND0B 4LOUC 1J8HE 1N0XL 2ZG1A 5DJ8B 3U79A 2WUCH 1N7ML 1AC6A 4ZYKA 3MYJB 4I0PC 4I2XE 4NWUH 5CD3A 4R97B 3O11A 1LNUA 3VMOA 2CXKA 3IT8D 3IDNB 3MRIA 5IESL 2QQKL 2W9DH 1NCCL 1A7PH 1CDJA 5J6HB 2VH5L 4EJ1C 4HZLA 4ZFGL 4CNIA 1I3VA 4Z7QF 2X4TB 1VPOL 4TULH 1T83C 4UT7L 1ZEAH 2GT9A 4AMKL 2HFTA 3H42L 5JW3H 5E8EB 4QRRA 5EOTB 4L8SB 5HYSG 3MACH 1KENH 4BFBD 2XZQH 3DYPA 5BZDB 1OCWH 4M9OA 3BGFC 5CCKL 1GZQB 5FM8A 1FNHA 1MRCL 5AUMB 5J56B 5SX5H 5C0FB 5AG9A 4RNRA 3G5YB 5D70L 5EZLB 4HEME 1T0MB 4HFWB 1E4WH 5HPMA 1RFDL 2CLRA 2AJYL 4PJAF 2RFXB 5KVGL 2FECI 1SJEA 5D6CA 4PV9B 3SDCC 5ID1B 3VGFA 4MJ6A 1J5OH 3A6OA 4MJIB 4KKCC 4GKNB 4R2GB 1UADC 1I9IH 1NJ9B 4LCWE 1V7NH 4OGXL 2AEIT 4RX4A 1DLHB 2PO6B 2F5BL 2Y6SC 1B9ZA 3MLSL 4KMLB 2E3VA 1PAMA 4QTHA 3QEUB 3H9HA 3V5HB 4LVEA 4RRPG 3WS3A 5DVOA 2VR4A 4KHTH 1CVSC 5IM7B 3B3IB 4EI5C 1JBJA 3NACH 5F7EH 3L3GB 1TZGH 2VABB 2JJSC 3MNZB 1G7QA 4WY7L 2BNQA 4Y4FC 1VFAA 4ZUUB 5GGSB 5T3XL 1MCWW 4X6BB 4P9HL 3S37L 1ZSDB 2Q7YA 3VXQB 4LKCB 5GRVK 2FJGA 4LMQI 1GOHA 5DTFA 4KRPD 5DK0A 1CICB 3HC3H 4L4VD 4LIQL 4WW1B 1HYSC 1J05A 3IAPA 2RJMA 3UJIH 1MCNA 4W4NA 5TE7L 4PP1D 3QUKA 1OAKL 3HE7A 4NKOA 3JVGA 3HC4L 5IF0A 4D8PB 1XGUB 4RMRA 2CDFA 4PJ9A 4KK6C 4OZ4A 3EYVA 3L5IA 2P47B 3PL6A 3AB0C 4M7KH 5E6ID 4JLRA 1U93A 2D7OA 1G7PB 4WWKB 4NQSA 2X9YA 4JRXE 3EO1B 3SDDA 1QSEA 1R3LA 4OT1H 1JRHL 1A1MA 4PJHA 5F21B 2H6PB 3C08H 1UKQA 2VZUA 2AXHA 1AGDA 4JQVA 4PJCA 4KTDH 5C2BL 3N0PB 3I2CH 2IH1A 1P4IL 3KYMB 4ZFOL 1XF5A 1IRAY 3PGFH 1K4CA 4BQBA 1TCRB 5I0ZA 4POZD 5DD1L 1WFOA 5GGRA 3GSOB 1TPXB 4EDWH 1QHPA 1ZLSL 5ETUA 3SE3A 1KGCE 5HHQA 5TQ2H 4WU7B 4KZDL 2NY7L 3N85H 2H8PA 3VFUB 3HR6A 3K4DA 3FB7A 4NZRL 1Q9LB 4LQ1A 5FV2A 3BMWA 2EYRA 5SX4I 3NFSL 3KNBB 3MV7D 5CINH 2NY1D 1HWGB 3P77B 1WZ1L 1N59A 3MA9H 4YHKL 4WHTA 4WW2A 3EYFA 1OGAE 4WUUA 2JCCA 4FZEL 5I1IH 1KNOA 1NL0H 3QI9C 3T4AA 1GAFL 3RZCA 4XP1L 4P49A 4JG1L 3U1SH 1IL1B 4HS3A 1A0QH 5D5MF 2YD4A 5DMKA 2ZNWA 4K7FA 2AAVA 4XNQB 4KY1H 3VXPB 3LHPL 4PLKD 3SGJC 1IC1A 3IJHA 4Z0BL 3LKQA 2HRPH 4OF0A 4XNMA 5F88A 1N0LA 2R23A 2VDLL 3C09C 2ZG3A 4V1DD 3QDGD 3EGSB 3QNXA 3RPKA 2O5YH 4YPGB 4HC1A 5DUPH 4YHML 4YBHA 5HHPB 3AM8A 3GSNB 4KK8C 3ES6B 4Z7UE 3C5ZB 5JQ6H 1I7RA 4Q74A 4YIQB 3RVTC 3QAZB 5IVOA 2WP3T 4Z7WF 1OSZB 2IBBA 3QEQD 4OM1H 4XHJC 4BUHA 4QKXB 1S5HB 2ZPKH 4X8XA 2P8MA 5KVFH 4QO1A 4MCYA 3HG1B 4JVUA 3WNKA 5DMJB 1MREL 2ATKA 5BXFB 3MUHL 1DUZB 3LD8C 4EIGB 2AJ3A 1KCRH 5LBSH 2FWOA 2F5AH 3Q6FB 3PHQA 5EUOA 1I8MB 5DD6B 1WBXB 3QUZA 3NAAL 1BFSA 5MEOB 3T0DA 3VI4F 1HINH 4JFFE 4UOW1 3W9DA 1NDGB 1NGPL 2H9GB 3B8SA 1I1CA 4X98A 3HE6D 1OAYH 1IC5L 5IK3B 1L0YA 2E6PA 5EPMB 2HH0H 4PJXA 1DBMH 2PCPA 3I9GL 4GKOA 1HK6A 5FCUL 4Y5YA 4Y19B 5TGBB 1KIQB 4FQ2H 3V5KA 2RB8A 4R26L 3JTTB 3MQIA 4N0FB 1NC4B 2HFEB 4LPVA 1EGJA 3CZFB 4P0DA 4Y16D 1RZGB 5BS0A 2MFNA 3BPCB 3MRDB 2NY5L 3QJHA 4ZSOB 3V4PL 3WN5C 5DC9B 5HGAB 7FABH 1G7JB 1A3LL 3GHBH 4AIOA 5DFTA 3ARDC 1JUFB 3TA3C 3GI8L 3GBNH 4HJGA 3TF7C 2MNUA 3BSZL 4HF5H 2C3GA 3T1FB 2P5WA 3EZ8A 4KK5C 2VQUA 3VWKC 1NCWL 1I1FA 4QEGA 5ALCL 4F37K 1BZQK 2HFGH 3T0EC 3ET9F 2I9LA 5DHVB 3ZT7A 2BSSA 4I8DA 5FM5O 5DO2C 2CQVA 3BXNB 1NCUA 4RWYH 4XCNB 1QA9B 1IAKB 4ONHA 1H3PH 2OJEA 4GRWF 2BC4B 3L7EB 4PRNA 4Q9RH 1Z6JT 5J11C 4P2OA 3V6FA 4MD0A 4PGEB 1Z0MA 2H26A 4PY8I 4ZQKB 4PUBL 4B7IA 5CJ5A 3O3EB 4O2CA 4NWTH 5CZXC 1YEHH 3X3GH 1UZ8B 3HHRB 3FFCE 3AS2A 3PWPD 5JNYA 3OKEA 4I0CC 3DX8B 1KJ2B 4N5UA 2ICES 4Y5VC 2QSQA 3VFGL 3W9EB 3MV8D 1A7NL 1YNLH 3CLFL 5T3XD 1KBGL 3NN8A 3OQ3B 2XNAA 1UYWH 3TVMC 5FOBA 1K5NA 3CMOL 5I0DA 2NW3A 1INEH 5EH1A 1CL7I 5DJ0A 2YPKB 4G6AD 3C9NB 3EJYD 1PKQB 4HKXB 1C5CH 2R9HC 5GHWL 3BN9C 2GJZA 1MOEA 5HHOA 3RX8A 4LSUH 4NCC2 3WDIA 1OAZH 3FQUB 1FZJA 3SHSA 4ODXA 4ZUTB 2EE2A 1YMMA 4YQXL 3D18A 3Q2CA 2NX5D 1DTUA 4WNQA 4C4KT 5IQ7H 1FJ1A 1KEML 4I9WE 3QIWB 4RCAA 1Q1JL 5ITFA 4CVUA 3BGMB 5F7MC 4IRJC 4HIHB 1YPZA 4JZOB 4XNZB 2VC2L 3BP4A 3UTQB 1A9EB 4I18A 3IFOB 5C0BB 3RX5A 5CHNA 4PJ8A 4IIQB 3H9SA 5DVNA 2APTA 3UTSE 3VFTA 1KJMA 4PTUA 1U3ZA 4LSSL 4ZYKB 5EZIH 1OTSC 1JHTB 5CD3B 1C5BL 3VXSB 3ULUC 1I3GH 4BUGA 4OFIA 3QXDB 3VFPB 2ZCKL 5ALBH 1NCAL 1A4JB 4ZUSA 5F9WB 1QSFD 4JO2H 1MAJA 2ESVA 4HZLB 4YDJB 1UM6H 4CNIB 4ELMA 1XCTB 3W0WE 4YXHH 2GT9B 1U8MA 1JZ6A 1I1YA 4QRRB 1MFEL 4D9RE 4P46D 5F7KC 1IGMH 2YMXH 5ID0A 1X5KA 3TIEB 2D7NA 2A6KA 1EO7A 1MCWM 1LO3L 4KV5E 3QULA 4LRNH 4O51A 1CF8L 1TZIB 1WAAE 2GCYB 4NKIH 4RNRB 1BOGA 3TN0D 1GJIA 4KMTL 3UROR 3FCTA 4G9DA 5FYLH 5I1AA 1W0YT 5HPMB 3ZTNH 2CLRB 4Q9CA 1CD0A 5D6CB 1G9NH 4KFZC 4M1GL 1QOKA 4LSPH 4JAMB 1NLBL 1DQLH 2F74A 4KQ4H 4HWUA 5IROC 5J1AA 1NBVL 4RWHA 3BDBA 4HMEA 1N64L 2EE6A 1CDBA 3CIQA 4R3SB 4XVTH 2B7DT 4I77H 1NFDA 3MROA 3H9HB 3QQ9D 3OKKB 4XPHL 4WHYH 4XBGB 5DJCA 3BI9X 2NTFA 2BNUB 3RL1A 5C7XH 2ORBH 2GITA 5HI3D 5CEZH 1AO7A 3GMQA 4PG2C 1X5JA 5LGKA 5JW4R 4GG6A 1G7QB 2BNQB 4UZGA 4JB9L 3GSVA 3PP3H 4GQ9L 4YXLH 5E5MB 5IVNA 1DQJB 5GRWA 5EU6A 1HH6A 4O5LH 4F2MB 2FJGB 2EIEA 1EVTC 5DK0B 3GB7A 5DTFB 1X7QB 3QQ4B 3DX7A 1J05B 3MBXL 3UMTA 4WDIA 3VH8G 4OBSA 1HILB 3QUKB 1CFVH 1NCTA 2APBA 3HE7B 4NKOB 2B1HL 5IF0B 3B9AA 4PRHD 4JQXC 4PRIA 1U95B 4BK4A 2CDFB 1N5YH 3ZYJA 4YDKL 3PL6B 4ODTL 3HUJA 1U93B 3ARBD 1MFAH 4NQSB 4PJ5B 4ELKA 1QSEB 4IMLA 1R3LB 2EDNA 4PJDE 5C0CE 3GM0A 2ZUYA 4PJHB 5F1NB 4UTAH 6CGTA 3FO0L 1WIUA 3WBDA 5F9OL 2IH1B 3DHMA 5CFHA 1RUML 1XF5B 2F53B 1K4CB 4IRSA 3U0PA 3U2SA 2RGSA 2EDHA 1K8DA 1A9BA 3QUMB 5B21A 1DBJH 4OZIF 4X6DF 5GGRB 2IFFH 4HZAA 3WEXA 4URTB 3HMXL 1MHHA 1L9NA 2AJXH 3T0EE 5HHQB 3ZSSA 2H8PB 2VN7A 5HDOA 3TJEH 1BF8A 3MLUL 2EYRB 3TJHD 4LVOC 1BECA 3KXFE 2GJ6B 4S1QL 1N59B 4GKZB 4WW2B 3EYFB 4WUUB 3T0AA 2JCCB 4QCIB 1KNOB 1R24B 1KIPA 3RZCB 1SVZA 4M8QA 2FJHB 3KLHC 2J5LB 4HS3B 1IAIH 4UILL 3LEYH 4OCMC 1A21A 4EOWH 4K7FB 3QO0A 5C09A 4LAQH 4AL8L 3X12B 3IJHB 3LKQB 3QNZA 3RGHA 2WBJD 1H3VA 4XC1L 3U7YH 1T20A 4XNMB 5F88B 2GUOB 2GI7A 2JKXA 3WFEL 2DLFH 2R23B 2Z8VC 4JM2D 4LLAA 4ZODA 2AV1A 4M6ML 4DAGH 2Y25A 3RHWF 3UYPA 3CDGB 1K9TA 4U1JA 3CMGA 3QNXB 4HJ0C 4S10A 4WV1C 5DEFB 1DQQA 3SKMB 5FO7A 2FR4A 3S6CA 5KSVB 3CC5A 4NOFA 4FXKA 5CLTA 2E8YA 1DBAH 2LU3A 1NAKL 4FQPA 4JY6A 1BFVL 1T1ZA 4MCYB 2MWCA 1DBKL 4PJ7A 3LKOA 4WEBH 1A3RH 2ATKB 3P73B 1EXUB 1C7SA 4XBEL 1HIMH 2DTSA 2FWOB 4GAFB 3PHQB 4K07A 4MA3A 2A6JA 2W60A 4FXLA 3QUZB 1KACB 3O3DB 4UAOB 3R1GL 4DVBA 4NQTA 3QA3A 2IPTH 3E6HB 4X98B 2PTTA 3O2WH 1FIGH 3TYFA 3LVEA 2DDQH 5HYJE 2FEDC 4CGTA 3ULUE 2C3HA 1CXFA 1MWAH 1RUKH 4NRXA 4Q9BA 5GZOD 2PCPB 4NM4L 12E8L 5CP3H 4ZXBC 1TJIL 2O5XL 4FQXC 5SWSD 4QRPE 3U30B 1OGTA 3K46A 3UJTH 3V5KB 3BWAB 1CK0L 2R1YB 3SDAC 1XGRA 1JMZA 1UQSA 5BS0B 2JLLA 1XR9A 2YRZA 4EQ3A 4YHZL 1CGSL 1J18A 2XQYK 4MLSA 1HNFA 1GC1H 4LLDA 4MAYC 3WXWH 5TE4H 5ILTH 3JV5A 3DUUA 3O9WD 1CLOH 1R3KA 5ADOL 1QO3A 1FNSL 1A22B 2P5WB 5DYOA 1BHGA 1LP9A 4MXQD 3DETC 4F15B 1I1FB 1UM5L 3V6BR 5GISH 2K1MA 4OGYH 1EHLL 5TPWL 2BSSB 2VLJB 4TVPH 4JRYE 5IFJA 3FQXA 1MCPH 1MFBL 4Z7QE 3D2UB 4ONHB 4MD4A 4YHYC 4P4KA 4Y1AA 5DJ6B 5CMAA 4PRNB 5JTWA 5KJRH 4P2OB 3WLBA 4DUWA 3MLXH 2JELH 4QT5A 5KBNC 2KPNA 3ARFA 3TO4D 3U4AA 3TH2T 3OG4B 2VKXA 4I0PD 4U1LA 4CMHC 1YEEL 1I1AA 5MI0B 4APQA 4S0TD 4O2CB 4DFHA 1A5FH 3SJVD 4UUJA 1QKZL 1PYWA 4R4NC 3OKEB 2A77H 4MJ5A 4KRMB 1A3QA 1F00I 2HAZA 4X7EC 1VFUA 1EJ6A 2CMRH 4X4MA 4C59B 3ULVF 5CJOL 2YD8A 4PJAE 1K5NB 1UB6B 4KPHH 2NW3B 3KAAA 1W0WA 1XIWC 1OD9A 4BQ6A 3K2UH 5DJ0B 5D9SA 4KROB 3KPMA 1KTRL 2G5RA 2X40A 5FHBL 2BVEA 1CGTA 4OLWL 5DR5L 3LEVL 1MFDH 2P5EA 5HI5D 1UT9A 2DQEL 4F80A 2C1OA 4TNVF 5GGVH 1YMMB 3QHZL 1WCBA 4JO3L 4LCUA 5ITBL 4HBCL 2J6EL 2KKQA 1FYTD 4R4FL 1FJ1B 1P6AB 1FGNL 4IDJH 5C0ND 1CIUA 1YPZB 3QUXD 4V2BA 4RFEA 4I18B 5FUZH 4LEXL 3UJJH 3MBEA 4PJ8B 3FRUA 3AC0A 4CN6A 4UB0H 1BJ8A 1RJCA 3VFTB 1KJMB 4PTUB 4DCQA 1G1CA 2Q76B 4OKVA 5DRWA 5GIRA 3N1GC 2OTWA 3FRPG 4JEGB 3MODH 3JWOC 3ZT6A 1PX4A 4MA8L 4OF6A 3RDTA 4X6CA 3OKOB 4ZUSB 2VZ3A 3FQWA 4FTVD 3R0MA 1MCLA 2ESVB 4U6HB 4JN1L 3OR7A 4UQ2A 4WFHD 4DGVL 4ELMB 2YR3A 2EE3A 3EDFA 1IGFL 1MUJA 5IB1A 4JDTL 1FCGA 2BSRA 2HG5B 2J88L 4E41D 1U8MB 4JZNA 1X5IA 2IQ9H 1HQ4A 1I1YB 2Q8AH 4OLUH 4EN3A 3V9FA 5ID0B 4TUOB 2A83B 3PWLA 4C56A 5DA0B 5E4EC 2BY2A 3QULB 4AYFA 1QVOB 1BOGB 4UQ3B 4B41A 3FCTB 4ZPTA 3VG9C 4G8GD 5I1AB 3QUYD 1KCVL 5CGTA 3UO1L 4NKMB 1TTFA 1YC8A 3C2AH 32C2A 4HQQL 4MJ2A 4YH6A 3O4LD 1D9KC 5H35A 1CDHA 5LGHL 4OF8A 4NO0A 2RAMA 1I85C 4ODWA 1ERNA 2FHBA 5TH2A 5LGJA 4JCMA 2WQRA 3VFRA 4WI6A 3LB6D 1B0RA 3F65A 2AVGA 1FVEA 3C6LC 2Z92B 5I71C 4Y4HA 3U4EA 4OLXH 1NFDB 2CO6B 3K80A 4GH7B 3MROB 3QRGH 3FB5A 3PQYA 3S3PA 3O6KL 1JZ5A 1R5WA 2UVEA 5IHUH 1NGQH 3D9AL 4XP4L 2Y23A 4NJ9L 2DICA 4M6OH 3K7UA 1BAFH 2NTFB 1NMCC 3ULUL 2DBLH 5D5ME 2GITB 1X5XA 2FD6L 2D7PA 3BAEH 4N0RA 5F7FA 2Q3ZA 3HRPA 1YN7B 4TRPL 1KT2A 3GSVB 4K7PH 4PJFB 1LEGA 1HH6B 5DHXB 5E9DA 3DX7B 4K94C 4KVNL 2DM2A 1JPFB 1VFBA 3F7VA 4P5TA 3DX6A 1N26A 4GW4A 5MHSE 1A6UL 2QADB 5JHDE 4PRIB 2V17L 3CFCL 2ZNXA 4G5ZL 4Z7WE 3ILQC 3GMRA 2B2XH 2Y36L 2L7JA 1K6QL 4UIKL 5IMLA 2AV7A 2NR6D 3OHXA 4OCLC 4X7CC 4P2QB 4ELKB 4IMLB 1T5WA 2FCBA 3AVEA 4X7FC 1JGLL 1AXTL 1AD0A 2F58L 3EJJX 2J8OA 1R6VA 5D1QC 1AJ7L 4NNPL 1KPRB 5EIVA 4E5XA 3VI4E 5LQBH 2AJSL 1OAXL 5KVDH 4IRSB 1BP3B 2XTJC 5FA3A 3U0PB 3U2SB 1EUUA 1K8DB 1LO5B 4L29A 4HXBL 4XHJD 4FFWC 4R6UA 3WEXB 2XWBA 3MRFB 1MHHB 1QRNE 1CBVL 3HR5A 1V7MH 1A14L 3T8XA 4MJID 4X5WA 2IG2L 4R2GD 4YBQD 1X5ZA 1N6QH 3EHBC 1KCSH 4QXGL 1XF3A 2QQLH 5HVGB 2PO6D 5CJQL 3O45A 3JWDC 1GHFH 1JGDA 5AZ2L 1V3LA 4LPCA 3SGEH 3EYQC 3K1KC 1CR9L 5C09B 1L7TH 3G9AB 4EIZC 1T2JA 2EDLA 2HJFB 3SBWA 4WTZA 3OX8B 1T20B 4JZJC 4PYGA 4PRAA 2AV1B 3WO4B 2A9NL 1H0DA 4XTRD 2N56A 5C0CD 4U1JB 4M5ZH 2EXWD 2HA1A 2D4DA 3KLSA 1FFPA 1DQQB 1CICD 5FO7B 1R3JA 1YN6A 3CC5B 4GAJL 4R7DB 4GRWE 1UH4A 1RURL 5CWSA 2Y1VA 4WRLA 1LO4L 1A6WL 5DQDL 1Q0YH 3T77B 4DW2H 3O8XA 3PJSA 3PF2A 4JY6B 5JORA 5GS1C 1FO0H 4XVUC 1T1ZB 3I3DA 4Z78A 2HVJA 4PJ7B 3LKOB 2XA8L 3VD5A 2A74B 4WWKD 3P30H 1QRKA 2OMNA 1UC6A 5E8PB 1KULA 5DI8A 4OZHB 3REWA 1KYOJ 2A6JB 2JJUA 1J8KA 5DRZA 1PG7X 3SE9L 3GIVB 5DLML 4KTYA 4ORZC 4DVBB 1E6OH 1FG2A 1F4HA 3KHQA 3QA3B 4PLJD 2PTTB 4HUUB 4NRXB 4H5SA 1IQWL 2ZWLT 5FGRA 3RVUC 4KUCF 4O00A 3CVHL 1FE8H 1OGTB 3VXRE 3B2VL 1UWGH 4N8VG 1KG0A 3RPIA 1J0ZA 1CU4H 2YUXA 1HZHL 2Z9TA 3TVMD 1XZ0B 1P84K 1UQSB 1XR9B 1IARB 5JIIA 2AXFA 6FABH 2EYSA 3AREA 3CX5J 4LLDB 4XB8A 1F90L 1LWRA 4QHMA 4JFQA 4PRPA 2LTQC 3MPCA 4LSRL 1R3KB 2DI7A 1QO3B 1FC1A 4G6JL 5DYOB 4ZOCA 1LP9B 3VXMA 5KS9B 2VTFA 1NFKA 4MQ7B 1UGNA 5GGUA 3MUY1 5IFJB 1RJZA 3ZHKA 3FQXB 1M6OB 2R0KL 3OKDB 3GMNB 4MD4B 2RCSH 4P4KB 4Q9QL 4XNUL 1X4YA 5CMAB 1DVFA 5JOPD 4MQXC 3WLBB 5C0DA 4N0YL 4QT5B 1L6ZA 3ARFB 1BD2E 3C5ZD 4JFHE 1TFHA 4G8IA 5B39A 2YBRA 5FHAL 5I1EH 2MQ0A 2DQCH 1I1AB 3RU8L 4APQB 5B4MC 1NUFA 4TPRH 3I85A 4UUJB 2ZOKA 1F3DJ 2AERT 4P59L 1PYWB 1JPTL 1TMCB 3TZVC 1ZT4B 3WJJC 3WIHL 4MJ5B 5LAXB 4OZGE 5DUMH 2AJUL 2RQ8A 1K3IA 1KXVC 1A6TA 1CFQB 1U8JA 1C16A 3X14B 4JO4L 2X89D 3UTPD 4ZNEE 5FYJU 1BFTA 2F19L 2W59A 5MP6L 2F8OA 3M8OL 4LAJH 5JOFB 4NZJA 5D9SB 5A3ID 3WO3B 2GFBA 3KPMB 1JZ3A 1U42A 3SDXE 5D71H 5SX4H 2ILLA 2V5TA 1OT1A 5TFSL 2C1OB 1JZ4A 3UTTA 4LPXA 5LVEA 5FYJE 1WCBB 4Y19D 1SVCP 4LCUB 1MCEA 2NW2A 1Q0XH 3NFPA 4QXWA 1QQDA 4TSAL 1AXSA 4D2NA 1QLFA 1YEKL 1FSKC 4IEFB 4JRYD 5L7XH 1NC4D 4JHBA 2X44D 4U1HA 1NC2B 1ADQH 4KKLD 4RFEB 1AGFA 2OR8A 3QHFL 3ULVC 4QNPE 3MBEB 4P4RB 3FRUB 2HFFA 4LL9A 4HD9A 4DCQB 1HHJA 1MWAA 2XTJE 3GSXA 1T04B 2OTWB 4N0UE 1N0XH 5CP3A 1DQDL 2FX9L 2NXYC 3LKRB 1E4XI 3RDTB 3QIBB 5I17B 4X6CB 1S8DA 4W4OA 5B8CC 3FQWB 3BMVA 4RMVA 3T2OA 3OR7B 4UQ2B 1Q72L 5IESH 2QQKH 1NCCH 2EDBA 2VH5H 2BSRB 2PW2A 1KCKA 4ZFGH 4AH2A 3VXOA 4JZNB 1CT8A 5J12C 4OCRH 1HQ4B 4MCZA 3BKJL 2J8UA 4NBYB 4AMKH 4LHJB 5I76A 3H42H 3RI5F 1AGBB 1UWEL 1DANT 3QFJA 4Q6IA 1CDCA 5I1DA 5KN5B 1FZMA 5CCKH 1FGVH 2PTUA 4ALAL 2BOBA 4XZUA 5A16A 3ZT5A 1MRCH 4ZPTB 1KV3A 2PUQT 4K55A 3VGGA 1DCLA 3C8KA 5D70H 4HUKB 5I1CL 1MCIA 32C2B 4OZIE 1JF6A 5H35B 3LPWA 4X6DE 1RFDH 1FH5L 2AJYH 4XPAL 5KVGH 3TESA 1QD0A 3CK0L 5KVMC 5TH2B 5LGJB 3VFRB 2ICCA 5D7LA 1B0RB 1S9VA 1FVEB 2VR5A 4DQOL 3CGTA 1UXWB 4Y4HB 3U4EB 3VRIB 4OGXH 5AEAA 3FB5B 3PQYB 1RIVL 4XX1E 5CJXA 2F5BH 5I9QB 4XPFL 1H5BC 4GLRI 3D39E 4PJGF 5ENWA 1WUNT 3JWOL 3TIDA 3OSKA 3GSQA 3L3DA 5CEXA 4LFHG 1UJ3C 5T33L 4YXKH 1TJGL 3QIWD 4MNGA 4AQOA 3H0TA 1JNJA 1T4KA 1KT2B 3RGVC 3NCMA 1LEGB 1QBML 5D2LA 5E8NA 4WY7H 1EO8L 5E9DB 5T3XH 3BYYA 4P9HH 3S37H 1CFNA 2PF6A 5C0BD 2VMFA 1OPGL 3AMLA 1DFBL 3B9KC 3WHXB 3AROA 2FRGP 5D96C 4LIQH 1AR1D 1VFBB 2G5BA 3F7VB 5FKPA 5IT2L 3KLHD 4P5TB 1BZ7A 3DX6B 2FATL 5GS3A 3VXSD 3BWUC 4H1LG 4NQEE 4PS4L 4CDHA 3D3VA 1OAKH 3GMRB 5HGHA 3EOYG 1NDMA 5IMLB 4AY0A 2AV7B 4KI5D 4JJHA 1Q9KA 4BKLA 1NGZA 4N8PA 2FO4A 2NZ9C 1QP1A 1KELH 3WS6A 1BIIA 1QBBA 4NJAL 4PJBA 1T5WB 4QRRD 4HWZA 1T0NA 3BDYL 1M05B 1U3HC 3HNVL 4M7JL 3S98A 4S1DC 5CLWA 3OKLA 4E5XB 4JDVA 1I7UA 1CE6A 3UYOD 4XHQA 2Y06L 1SEBA 1P4IH 3VU2A 4L29B 3VD4A 1JHLL 5D4QA 4FMFA 1KEGL 2XKNB 2XWBB 4JCLA 2XPGA 3UBXA 2K7PA 2OTUA 4M1DL 5B38G 1EFXA 1BM3L 4L4TA 3HRZA 3HR5B 5CZVL 1RSFA 5HHME 4OI8A 1ZLSH 3SE4A 3T8XB 4X5WB 2NY7H 3KPQB 1XF3B 4NZRH 3V52L 4PJHF 4U6YB 3NFSH 4F7MA 5LKNA 4O02L 2DYPB 4X6EA 4K94L 4ZAKA 1EEZA 1WZ1H 3O45B 2UWEE 4PJCF 4YHKH 4AK1A 5DJXA 1FNLA 4FZ8H 5H2BA 5JHLL 4J4PA 2VLRE 2VJXA 4XP1H 4JM4L 4JG1H 3RVWC 2BRQA 5IHBA 3WIFA 2C4XA 3O3UN 1LEIA 5FYJL 4UBDD 3LHPH 3KWWA 4GAGL 4Z0BH 2BNQD 2EKSA 4PRAB 1H0DB 4AEEA 3FMGH 4MS8D 1ACYL 4UTBL 1FNAA 3F12A 2HWZL 4U6XA 3TBSA 3MREB 1V5JA 1R3JB 1YN6B 3P4OA 1GXEA 4WW2F 2JCCF 3ZHDA 2AABL 4DVRH 1PJ9A 3HE7D 1F2QA 4OD3L 4MSWB 2ICWJ 2IANB 3O8XB 3PJSB 3T65A 4IOSD 2DQIL 2HVJB 3PL6D 2R4RL 3FOLA 4NKQB 4NZTL 3PWJA 4PJ5D 1QSED 3REWB 3NZHL 3UTZA 5MENA 5DRZB 3U48A 3ULVE 1E0OB 1PG7L 4P5KA 4AEIL 4Y2DA 1FG2B 3S34L 1MIEL 1AXIB 2WANA 2IAMC 5F3BA 2F53D 4JFDB 1GOGA 1NGPH 2APVA 3JWDL 2MCG1 3OZ9L 4H5SB 3NA4A 3ARGC 1IC5H 2JE8A 4QRSA 1OTUD 2X70A 1EV2E 3I9GH 1KG0B 2AJZA 5FCUH 3IDUA 1VACA 3QIUC 4ZS6C 3ZYIA 5EC2B 3RWCA 4Y4KA 4HEPG 4R26H 1ZGLA 1ZVHA 2XN9E 1DLFL 2GJ6D 3RVXD 5EUOF 1TJHL 1KFAL 2AXFB 4M1CC 3R4DA 4F7TB 1QTYT 1LMKA 2EYSB 3AREB 4WUUD 5ADPL 4QHMB 2NY5H 3Q48A 4JFQB 3V4PH 4PRPB 2Y72A 5IEHA 4HWEL 1EEUA 1A3LH 3O6FC 5CD5D 1RK1A 1EZVY 5IKCB 4MNQE 1TVBA 4HJJH 4PJXF 3GI8H 3VXMB 1C12A 3TEUA 4H20L 2IPUG 2OL3L 1K85A 1NCWH 1K4DA 4HPOL 1RJZB 1FYHB 1DP0A 3B83A 1K3ZA 2IJ0C 3IXTA 5EOCJ 1JNNH 4ODSL 3BT2H 3U7WL 2P49B 4G6FB 5GZNC 5KSBA 1DVFB 1KUMA 4G8IB 4JDZA 5B39B 3BH9A 3Q0HA 3DO3A 2QHRH 5BMFH 1RU9L 4NC2B 2ZOKB 2IMNA 1XFPA 4PUBH 4LSQL 3PGCA 2WWKT 2E7BA 4NGHL 1U8JB 1C16B 5GGQL 4NO5A 1WZLA 4PJEF 4H26A 1A7NH 3CLFH 5I16A 3NGBB 1RUAH 3QUZD 5EORL 2YA0A 3QXTA 5CGYC 3CMOH 5DJDB 4NPYA 5DEGA 2R56L 5IBLC 1ZGLM 3F7PC 1H9VA 4JFPA 3DVNB 4Q7DA 3NTCL 4KKAD 5GHWH 2UZIL 1FO0A 3CDCA 4P5MA 4FNLL 3QZWA 2P1YA 2VXSL 1RD6A 2CPCA 4HIEA 2NW2B 3NFPB 2VAAA 1QQDB 3IDXL 4YBLC 4X8JA 1WQVT 4YQXH 3KPOB 1QLFB 4P57A 3V0WL 5KG9A 2MHAA 4U1HB 1ZLUK 3B9DA 1BVKB 1FFRA 3TM6A 1Q1JH 1AGFB 4PB0L 1KCLA 3F7YB 2HFFB 5I73C 4PY7A 5E8DL 4O2EA 3WV0A 4TTGA 3GSXB 5TQ0L 3BH8A 4LSSH 4GRLC 5J3HD 4N1CA 4NFDA 1C5BH 4RGOL 1Q38A 4LCYB 5I1JL 4DN4L 2YKLH 2ZCKH 3IU3B 1NCAH 4IOFD 2DQDL 3MLWL 2VLJD 5AAMA 4K23H 5E6IA 4AH2B 2IBZY 3VXOB 1CT8B 4FQ1L 3ARTA 4MCZB 3MZTA 3TCXA 2DQJL 3D2UD 1AQKH 4MYWB 5I76B 1NUDA 2H2SC 1MFEH 3A67H 3U82B 1CLZL 4KKBD 4M00A 4P2OD 3QFJB 3CFEA 5HGDA 5GS2D 1FZMB 1FVDA 3MJ7A 4HUWA 1YYLL 2BOBB 4OKDA 5A16B 1VESA 2OJZL 2J12B 1BJ1H 1H8NA 3VE0A 5HHVH 5IBTH 2DTML 4YFLI 5I15L 1CDIA 4L8CA 4ELMF 3TNNA 1HHHB 2N4IA 4M1GH 4W6WB 5D7LB 1NLBH 3QO1A 2A0LC 4AENA 3ULVL 4KROD 1N64H 2WV3A 4PBXA 5I30L 4JKPL 3P0VL 2OXGA 3QCUL 2VZ1A 1IM9D 4ZUWA 4M3KB 4ZTPL 5ENWB 3RHWK 2WWMC 2ED7A 4N8CL 4XPHH 3BKYL 3TIDB 3ZDXF 3N1PC 3GSQB 3L3DB 5CEXB 1B3JA 2H1PH 1G7MA 5BJTA 4YFEA 2QSTA 4MB4A 1TQBB 3PUCA 5DEZA 2J4WL 4CL7A 1JGVL 1U41A 3CFJA 1QR1A 1T66C 4YR6A 5D2LB 5E8NB 4G8FA 4LDOB 3SPVB 5DVMA 4RFOL 5EOQH 4GQ9H 4V1DA 3QDGA 2UZXB 4L3AA 3VH8B 5L2KE 1ED3B 5F6IB 4LLWA 1KB5B 2G5BB 4I48A 5FKPB 1F02I 4U1MA 5E94A 4JHZA 1NFDF 1BZ7B 3DV4A 2PXYC 5DT1L 4NDMA 1J12A 1I4FA 2OTPA 1A6VL 1J1OL 4RMUA 3D3VB 3ELAT 1I3UA 2B1HH 3LN5A 3SQOH 4JO1L 1NDMB 5TF1L 1TVDA 3K4ZA 1NGZB 2K3TA 4YDKH 2FO4B 3VMNA 5IIEB 2VDRH 4ODTH 1BIIB 1ADQA 4GG6F 5IJKA 4I5BB 4JVPA 3QPQC 4HWZB 1T0NB 3X3FL 2AW2A 2XWJA 4OM0L 4XP9L 5E2UH 4YO0B 2ZP0T 1HKFA 2DKSA 1NGXA 4OQTL 5HDBF 3OKLB 4BH8B 1AE6L 1I7UB 3FO0H 1CE6B 4JDVB 4C57C 4KUZH 5TE6H 5F9OH 1SEBB 4JKLA 5ICYA 3HE6A 1Q9WB 4ERSL 2HLAA 2CLVA 2X1QA 1H8OA 5INDA 2XPGB 2OTUB 1KLUA 1EFXB 3U36A 4IJ3C 2EICA 4FQHA 5BW7A 3HRZB 3TWCL 3HMXH 3HUJF 4NSKA 5JZ7C 2PYFA 1D5MA 4GUPA 3IFPA 1FBIH 5KOVC 4GAYA 3MLUH 43CAA 1K8IA 4F7MB 4DEPB 5IVXA 5D7IE 4QRTA 4GBXC 5FFLA 4S1QH 4X6EB 4NFCA 4ZAKB 4KJWC 5DJXB 3MJ6A 3MV9E 1WZKA 1W72L 4M93B 5H2BB 2YPVL 4O4YL 2EDTA 1HXYA 2G75A 1XF2B 3OMZA 2ARJQ 3RWHA 1L4IA 4RFNB 3RX7A 3WIFB 5HVHB 2VB5A 4XWGL 5DMGD 5MEPA 1ZTXH 4XCYA 3KWWB 4AL8H 3SOBL 2EKSB 3U0WL 3VMPA 1ZE3C 4PJ9C 5MERB 3WFEH 4M6MH 3VGBA 3F12B 5J89A 3HZVA 3TBSB 1CD9B 4JJ5A 5KSUA 3SDDC 4OCSH 4EUPG 3LN9A 1I7TB 4LSVL 5DURD 5L6YL 5C07A 4G3YH 5HD8D 1RHHB 4Z7NF 4PRID 4N1EA 4LCIL 1WFUA 3ALWA 1NAKH 3S35L 3SGDH 3ZDYF 2KBGA 1BFVH 4HIXH 3STZA 1MY7A 3MGOA 3V6ZA 3PWJB 1DBKH 2BDNL 4G9FE 4P2QD 3LQZB 4XBEH 3KYKH 3UTZB 2EECA 4F9PA 2V6HA 1ZK9A 4LVHC 1FFNB 4Y2DB 1CXLA 4MQXD 3VRJA 1UZ6F 3SGKA 4BSVA 5EBMA 5F3BB 1F45A 1JGUL 5GGVY 4IRSD 5I1HH 5D93C 4WO4C 3CFKA 3G6JB 2VLRD 2CXGA 2EZ0C 4JPVH 2X70B 1P4BH 4NM4H 1TJIH 2O5XH 2AJZB 5EZOL 1JWMA 1VACB 4PJ7F 1JI1A 2YZ8A 4OGZA 5BZWB 3RIFF 5J13C 3T2QA 3RWCB 4Y4KB 3IKCA 4H8WC 3ZE2F 1CK0H 5IMMB 4EQ2A 3BQUC 3QPXL 2IWGA 1FVCB 3TGXA 2EDYA 4ZO9A 1CGSH 2MPAL 3PE9A 4ZFOA 1DBBH 3AM8C 2ADIB 1GGCL 1TVBB 3GBML 1ITBB 2ADGA 1XCQA 5C09D 4WCYL 4HIIA 5ADOH 1IM3B 3V4UH 4WFGD 1AGCA 4FQJL 1U58B 1CGUA 3IS1X 1J0IA 3UYRL 1K4DB 2GK2A 4HT1H 3MRBA 1GZPA 3IXTB 1EHLH 5TPWH 1OAQH 1PKOA 4QHKI 2KQNA 5ESQA 1X3DA 1HSBA 1H3TA 3ILPA 4GRMA 5KSBB 1MFBH 4P46A 1IBGL 1XMWA 1FN4A 1LILA 4JDZB 2ZSWA 4LP5A 3UDWA 3BIKA 2NXYD 2X4OA 1Y18B 4OIIL 4EI6A 1I9EA 1IMHC 1B6DA 1LP9F 5EO9A 2G2RA 2NTSP 1I1RA 1QKZH 1SYVA 2HMIC 4NUJA 5ANMB 3H7BA 4NO5B 4I1NB 1WVZA 4Y5YC 4H26B 1YA5A 1E6JH 4ZOEA 3VGAC 5CJOH 3JSSA 1BGXL 3VFMA 2FLBT 4NN5C 4NPYB 4RQQB 2OZ4H 2VXUH 5ESAA 5GQBA 3IETB 4XCCL 2DAVA 2OR9L 5FHBH 1J8HA 4G80A 2XKSA 5DR5H 3QZWB 1Y6MR 5KSAB 2DQEH 1CDGA 3LZFL 2VAAB 4PJGE 5IW3A 4X8JB 3QHZH 1TQCB 1QSVA 4P57B 4N1HB 3JV4B 5KG9B 2MHAB 4HBCH 2J6EH 1T21A 4R4FH 3LS4L 4P2RE 4XVJL 3WFCL 1KYOK 1JPGA 3OBAA 2Z8WC 3IDJA 5E70A 2GY5A 3W39A 5I18L 4JVWA 5HY9A 4PRHA 5C70A 1FCCA 4JN2A 1XGYL 3KPLA 4MA8H 5EU4A 5EWIH 4MA1B 1TXKA 2APWA 4F9LA 3FFDA 5E6IB 4JN1H 4DGVH 3EUUA 3RGVD 5D7SH 4JDTH 2J88H 3HKFA 4YZFF 5E2WH 1KC5L 4WFFD 4P4KD 5IW6A 5BRZE 5JMRA 5FO9A 4U1GC 4LCWA 3CFEB 3ARFD 4U1KA 3CX5K 1QNZL 1FVDB 3MJ7B 4HUWB 1I1AD 4XNXL 5DXWA 1EA9C 3P3YA 4JGMA 1UXSA 4A6YL 3QJFA 3V5DB 4X6CF 4X5XB 1G7LA 1TENA 1LK3H 4WI9A 4L8CB 1KCVH 4OCWL 3TNNB 4AG4H 1MVUA 2AEPL 4H88L 5LGHH 2OQJA 1YMHA 4OCYH 4J3UA 4J23A 3V4VL 3T4YA 4XAWL 3O3BA 1DUYB 1RUQH 4S1DD 4LLVA 2MMXA 4HH9B 3RNQA 1NMBH 1N8ZB 1WGOA 2VXTL 4J3XA 4PJCE 3O6KH 2FHFA 4XP4H 3PDOA 5K9JL 5DD3H 4PRBA 1G7MB 1LE9A 1G6RL 2Y7QA 3BN3B 2GTZA 1NGWA 3QWOA 5DS8A 1JN6B 2FD6H 3CFJB 1QR1B 2DF3A 3QQNA 4G8FB 1NC2D 1TZHA 4TRPH 1QPPA 1LO0L 4JRXA 5C6TL 4V1DB 4XMLH 3VWJB 3FAXA 3DHJA 1F42A 4Q2ZA 1KB9J 1AFVL 4WI5A 4LLWB 4I48B 4U1MB 5C08E 5E94B 5CUSH 5INCA 2CDEA 3N1MC 4NDMB 1I4FB 4RZCA 3RDTD 2JCCE 3QIBD 4YHNA 4LVNB 1F3RB 3GNML 1A6UH 3GJEA 2V17H 1ZHLA 3CFCH 4HX1A 4G5ZH 1BQHG 2Y36H 3S4SA 1WITA 3KPSE 1K6QH 4UIKH 2P43B 3MRQA 3U9UA 4K8RC 3HB3D 5F7UA 4O58L 1IZJA 4QRQB 4OFDA 5AWNH 4OV6F 5ICZA 1ZA6A 3MO1B 2VAJA 4QXUH 2F58H 4C83A 4JFXA 1NEZA 1UCBL 3KJ6L 4OJFL 3PV6A 1TLKA 1AJ7H 1OGAA 1X6NA 2J3SA 4JGUA 3T0VA 3TH4T 3HE6B 2HLAB 4LCCA 4NO3A 3EJZD 2FIKA 4LKXA 5INDB 3GJFH 3RKPA 3U36B 4HXBH 4FQHB 4LGPB 5SWSA 5FK9A 5IV2B 1XGQA 1JHKL 4NSKB 3EFDH 2PYFB 1D5MB 1ZVYA 2ZUVA 3QCVL 4GUPB 2GSGA 1MJJA 3KLAA 3IFPB 2LFGA 3IU4H 4RGMB 2DBJA 2IG2H 1ZHBA 43CAB 1GGIL 1NQBA 5IVXB 4MMXC 2X6MA 4BELD 3NPSC 4ORGA 4QRTB 3NIGF 4ACPA 4Y4HD 3T3PF 5EUOE 5IBUG 3UAJD 4D9QE 3OWEA 5DJ2B 3PQYD 5CJQH 4J12A 1M7IA 3ARQA 4Z7UA 1KN2L 2PYEE 5FDYA 2AK4E 1BVLA 3O9WA 1CD1A 1HXYB 2G75B 4MNHA 5AZ2H 3OB8A 4K9EC 3RWHB 1IGCL 2ITCB 2R2HA 3LIZL 3MNWB 1JTTA 1J9CT 1CR9H 4XCYB 4PJXE 1VGEL 4DK6A 5C6WH 2QQQA 1KJ2H 1JVKA 4EXKA 4HBQA 1LK2B 3REVB 2OLDA 2A9NH 3HZVB 4M1CD 4IRZH 4ZO8A 2X1OA 4JJ5B 1VSCA 5I6XB 3AGVA 3D85B 2R8SH 4OFVA 2ZOLA 5I8OH 1ZHKA 4P5TD 2OSLA 5C07B 5I8EA 2P8LA 4I0PA 1RURH 1NEUA 2DLGA 2PR4H 1A6WH 2XV6B 3KJ4C 3SJVA 4OBRA 1QFUH 4R96A 1VHPA 1NANH 3STZB 5C2UB 3MGOB 1U91B 2NY2B 4NQUA 5EN2A 4WVRA 25C8L 1T83A 5GZND 2B0SL 4NBXB 3T3ME 1EMTL 4PJEE 5H37H 1Z3GL 2BJML 4N9GA 4KRLB 3VRJB 3DMMB 1QFWM 4BSVB 3SE9H 4Y2OA 5EBMB 3VXUD 4YWGL 2APXA 1W8NA 3SO3C 4XPTL 3TNMA 1T2QL 4GS7B 3CFKB 3WD5L 2Y4SA 1U8OB 2AEQH 1U8NB 2WIIA 2XZAL 3C60B 2NY4C 1FQ9C 2BNRE 2BFVL 3N9GH 3CVHH 3BUYB 3HZKA 4XPGL 4XRCB 1JWMB 3D69B 1V3MA 4NN6B 2HT3C 2CDGB 3SDCA 2W65A 1A7QH 1VFOA 4N5EC 1HZHH 3Q3GA 2HJLA 4K3DL 1MLCB 3IFNL 1U8PA 2DYPD 3BJLA 4XXDA 2E27L 1QPXA 4ZFOB 1F90H 4JFEE 2IADA 2B5IC 4FP8L 4U49A 5FYLD 1VFMA 3RI5K 3CSGA 4L8BA 4OV5A 5HHOE 1AGCB 4G6JH 3HMXA 4DKEL 3FFCA 2EH7H 1GZPB 1NKRA 3MRBB 4LGSB 1UKSA 5EOCL 4YE4L 4KHXL 5F93C 3CXDL 4G9FD 15C8H 2JJSA 4P2YA 3Q5YA 3MLVL 3NOIA 4MWFB 1HSBB 3QDJE 3ILPB 5IWLA 2R0KH 1AGEA 1FN4B 4Q9QH 4XNUH 3MNVA 3PWUB 2ZSWB 1DDHA 1OP3K 1HQRA 3IXAA 4Y5XA 3H9SE 2V9TA 2IAND 3O8XD 1F5WA 3VI3F 5CEZD 2WAHA 1G0YR 3RU8H 5EO9B 3QEGL 3MUGA 5LCVL 2G2RB 3LQMA 2GTWA 3QUYA 1SYVB 3WIHH 3RA7L 1IILE 1WIPA 3AS3A 3WUWG 4M62H 3S5LG 2AK1H 4G6ML 5D1XC 4WIQA 4FFZH 4UNTA 2HT2D 4H8WL 5FGCE 2H2SD 1MJ7L 3VFMB 5MP6H 2BOCA 3ZDZF 2YC1A 4NQVA 3BD5A 5ESAB 4FFYL 2OI9B 4JFDD 3HI5H 1PLGL 3UTSA 1J8HB 4G80B 1NBZB 2NY6B 2HTLC 4HC1L 1ZHNA 4S1RH 5TDOB 5A2FA 5IOPA 1BREA 5CP7A 4Y8AA 3IDYB 4XAKD 2ZUSA 2YN3A 1MHCA 2ZSVA 2OXHA 1T21B 2APFA 3X17A 3W0WA 5HDQH 2W07A 3JZ7A 5T5NG 1JPGB 1IAII 1MNUH 3DNKA 1HHGA 3Q6GL 5IUSA 2M1KA 1YJDH 3QHFH 1JWSB 2DJ4A 2VZTA 3W39B 2M8XA 3QI9A 5HY9B 3MYJA 1UACH 3MYZA 4KQ3L 4EXPX 2FX9H 5EU4B 3VXMD 1WAAA 1LO2L 5GSRA 4L8DA 2CGRH 3QCTL 3QUMH 1IEHA 4UNVA 3FFDB 1ZT7B 4ZG1A 2JIXA 1AO7E 1B0WA 2AGJL 4WGWB 4G6FD 5J8OA 1CN4A 5I75B 5IW6B 2FIRT 5IB4A 3GGWA 4GG6E 5EOTA 5FO9B 1DVFD 4LCWB 5LWYL 1HI6A 5EU6E 4U1KB 5BZDA 5I2IB 3MJ8A 2Z93A 1EGJL 2P44B 5CSBA 1LHZA 4XXCA 2PXYD 5AUMA 5HDBE 1UXSB 3QJFB 3BZDA 5C0FA 3NCEB 4XX1G 4ALAH 3CPLB 2XKUA 1G7LB 1T1XA 1RIHL 3AS0A 4MB5A 4LLUA 1KLFA 1ODAA 1S7WA 1T0MA 2DWDB 4R8WL 4D0DB 1B4JL 3EOBA 2EDQA 1QR4A 3SQBA 5BO1H 1MVUB 3BFOA 4LEOA 1FH5H 4MJIA 2OS7A 3ARZA 3HUJE 4XPAH 4GKNA 4P2RD 4YLQT 4LPTA 1IC4L 3BIAX 2J8UF 4FS0A 4ZPVA 2DM7A 2X10A 5I1KH 2HKFH 1D5ZB 3UCRA 4DQOH 2PO6A 3DX9A 3ZKXB 3ALXA 2E7CA 4X80L 4WI7A 4WHCA 4X6FA 3BKMH 5AD0A 1RZ7L 3GK8L 3BZFB 3CDFA 3V5HA 3QDME 4NN7B 4XPFH 1PY4A 3JWOH 1LE9B 2Y7QB 5IM7A 2GTZB 3B3IA 1NGWB 3QWOB 1D5XA 5DS8B 2VIRB 4XCFL 2V2TA 3L3GA 5D1ZB 4BK5A 2FB4L 2IH3B 1TJGH 4ZUUA 1T22B 3LSOA 2YS4A 1IEAA 4JRXB 5E7BA 4ODUA 1ZSDA 1FNEA 3WKMH 1ORSB 1QBMH 3LKSA 5C0CA 2OZ4A 4MMZC 5L0QB 4M7ZB 1L0QA 4NM8L 3TC9A 4GBXD 1NCBH 4JFOB 4WW1A 1JZ7A 4KJWD 3KVQA 4EN3C 3WYRA 2ZCLH 2CDEB 1DFBH 4EDXB 3N1FC 4DOHE 5IT2H 3ARDA 1OLLA 1MI5E 3TA3A 1AKJB 1GGYA 5C0RL 4RBPK 5E4IA 2D9CA 3GJEB 4JG0L 1ZHLB 5K33A 4Z7NE 4HX1B 4Z5RA 1AHWB 2DD8L 2J6EA 4GSDL 3MRQB 3U9UB 5J7CC 3ZDYE 2C3XA 4WWKA 1X5YA 1J0HA 1R5VA 5ICZB 3U9PH 1MJ8L 5D2LF 4NJAH 3LQAH 4PGBA 2QTEA 4C83B 3QFJD 3KXFA 2H6PA 5J9PA 2FX7L 1NEZB 4M7JH 3OV6A 2EC9U 2YUZA 3PV6B 1OGAB 4KMQA 1UZ6E 4LCCB 4NO3B 2FIKB 3MOAH 4LKXB 2Y06H 3V6OA 2NY0B 1G9MC 4G8EA 1XGPA 5JIPA 1JHLH 4GT7A 4TVPD 1HOCB 3GSOA 3RRQA 1D6VH 1KEGH 1J1XL 3RNKB 3RIAK 2QQNL 4M1DH 1BM3H 4WU7A 4Y5VA 1MJJB 3KLAB 5GJSL 4PJBF 5D7LD 1Q9LA 3KNBA 3TVMA 4LHUG 4DGYL 1GSMA 1MLBA 4ORGB 3P77A 1S9YA 3I50L 2XQYG 2E9WA 1M7IB 4Z7UB 3B6SA 1BVLB 1CD1B 5D7JC 5C1MB 1BEYH 2WK2A 2VQ1A 3WL9A 3BKCH 5JHLH 2R2HB 4JM4H 2V7HA 4AT6B 4WEMB 3QXVA 4G43B 4NRYA 5IJVB 1G1YA 4XNQA 4HGKC 3VXPA 3O4OB 4LPYA 1PX3A 4Z9KB 2A38A 2Y07L 1YQVH 4GAGH 4K8RL 4QOKE 1K2DB 3I6LD 3TO2A 4NKDA 5E0QA 7CGTA 2DQTL 1L7IH 4TSCL 5FKAA 4UTBH 3INUL 4P23B 4PTTB 3BPLB 2MCPL 4GMTL 4ENEC 2F54E 2HWZH 2ZCHL 5DK3A 1W0VB 4X4XB 3CSPA 3D0LA 4L3ED 1A8JH 1ZHKB 2OSLB 3DRQB 1U36A 2P8LB 4P9ML 4YIQA 1ZANH 4I0PB 2AABH 3D3VD 1H8SA 4OD3H 5HYJA 3P4NA 4GMSL 4X5LA 1UG9A 5JXEC 5J06A 4QRPA 2DQGL 1ZLUH 4OAWB 5EN2B 1UCTA 2D2OA 4H0GA 2X89A 5GGTL 3VD3A 4X7TB 3NFNB 4M9PA 2EEBA 3SDYH 1ZXQA 4N9GB 1WBXA 3NZHH 3HNSH 1RY7B 3S88H 2W0FA 3BP5A 3WFDL 4Y1AE 5EULV 3BGFB 1MIEH 4RGNC 3TNMB 3ETBF 3KR3H 2J2ZA 3B8YA 5IK3A 3JWDH 5EPMA 2NY3C 4NFBA 4K9EL 1EFXD 2R1WA 2Z91A 3FN0H 3HZKB 3PHSA 5C86A 4Y19A 4UINL 4XB7A 1KIRB 2HMID 5TGBA 3SDCB 3STBA 3JTTA 2W65B 3F58H 4JRYA 4N0FA 3SBWC 3LMJH 1MFCL 2ZUQC 1NC4A 3Q3GB 2HJLB 2UYLB 4BQ8A 3P4LA 1DLFH 1U8PB 3BPCA 1MAML 1KIUA 4ZAKD 4XXDB 5JDJA 1ITCA 5I1GL 4TUKL 5HGAA 3HI6L 1SEQH 3VGDA 4YC2C 1KN4L 5ADPH 4C54A 1CFSB 2E7LC 1JUFA 3GJFA 3FO2A 4UT6L 4Y7MA 4OLZL 4L8BB 3LRGA 2WUCL 4OV5B 4NWUL 3T1FA 3VJ6B 9CGTA 1FPTH 2NYYC 1NPUA 2P5EE 4IBLT 3FFCB 3HLAB 4EI5B 4MX7A 4H20H 3H3PH 4XGZA 4QHUA 1A7PL 3BRDA 5DC0A 4HPOH 4Y4FB 2VZVA 4NQDE 1A02N 1QA9A 4PJAA 4ODSH 3U7WH 1AGEB 4YZFE 5JW3L 1EO5A 2BC4A 3L7EA 3MNVB 4F57H 2E5EA 1DDHB 3MACL 2XZQL 4UDUA 3IXAB 3RL2B 2CIIA 2GSIA 2VDNH 1Z9MA 1PEZA 2VDPL 3OJVC 4DKAA 4ZQKA 4JQXA 1F8TL 3MUGB 3LDBC 4WUKL 3LPFA 2GTWB 4YK4C 2NCMA 2X9WA 1KJ2A 1OB1A 1VB9A 4LSQH 3AB0B 3WLWD 3VFNB 3EW3B 3G5VA 5FYKD 3ZKMD 4GXVL 5GGQH 3OXSA 3O0RL 4U0RC 1QBAA 1MCJA 2VXVL 3GSRB 4HKJA 5BV7C 5KSBF 5EORH 2YC1B 1BQLL 4NQVB 3KS0J 2YPKA 2R56H 3IKKA 2BVOA 3O6ML 3UTSB 4C56E 5LG1A 2A6IA 2R0WL 4E0RA 3NTCH 4ZD3L 3MRKB 2UZIH 4FNLH 4ZUTA 2VXSH 3L6FB 1MHCB 3GMOA 2ZSVB 1R3IH 2G60L 1S5IL 2XG4A 5DF0A 3W0WB 1P7QA 4YJZL 2IF7A 2BXZA 4PGDA 4HIHA 4WTWA 1J0JA 4JZOA 3V7AG 2OP4L 4PGZA 1HHGB 4X7SH 3JXAA 3IFOA 4IIQA 1NBYB 4RA0C 3QI9B 4ZFFA 2V2XA 1T1WA 3HC3L 1JHTA 1JNLH 3G04A 4V2CB 5TQ0H 5F7DA 3UJIL 3PXHA 3VXSA 2DIAA 5EFIA 3CVHA 3QXDA 3VFPA 5GSRB 2AQ2A 1A4JA 3FZUD 4L8DB 1AD9A 3GKZA 4RGOH 1IGJA 1WF5A 4YDJA 1UEMA 5I1JH 4HUNB 4YPJA 4HG4J 1XCTA 2JIXB 4XC3L 4P3WA 1I9JH 3C09B 4FQ1H 5IB4B 1JL8A 3GGWB 4ZTOL 2DQJH 2FDBP 2EIBA 4JE4B 4WV1A 1HI6B 4HMDA 3TIEA 1CLZH 1DQTA 5E9DE 3CZJA 3MJ8B 2Z93B 1HWHB 4JKMA 4FFVD 3SCMC 5AYQA 4KTDL 2NXZC 1TZIA 3MOQA 2GCYA 3RWEA 3I2CL 1YYLH 1T1XB 4R7NA 3DXAE 4LLUB 1GVIA 1S7WB 2I07A 4I4WA 3IDIA 2W0PA 1BWMA 2NLJA 5D5MA 4IHOB 3EOBB 2VE6B 4PP2A 4LEOB 5I15H 3IB4A 3LD8B 4EDWL 1EDQA 3OB0K 4JAMA 3OJDB 3OTTA 1TCMA 3N85L 1RVFL 1N3NB 4R4BB 4ZPVB 2DJUA 3DX9B 4R3SA 4NCDA 1HDMA 4JRWA 4X6FB 4L9LC 5D7KE 3MA9L 5AD0B 3T3PE 2LE9A 1T7ZA 2EC8A 3OKKA 3P0VH 4NO2A 4W70A 4ETYA 4QWWD 5I1IL 1NL0L 4PD4J 4XBGA 3QCUH 4S1SL 5FIEA 5KSAD 4ZTPH 3ROOA 2WLYA 4TTDD 3U83A 2BNUA 3WIHA 1A0QL 4ZXBA 4N8CH 3BKYH 4FQXA 1D5XB 4PG9A 4Z7WA 4ONFH 3CSBA 2V2TB 4W4OC 4HIJA 4KY1L 1ACZA 4ODVL 3LSOB 5ESVA 3VW3L 1IEAB 5E5MA 4ODUB 1FNEB 4PJDB 1DQJA 4M02A 3SDAA 3LKSB 5C0CB 4F2MA 2CIKB 3HFMH 1X7QA 1XT5A 3QQ4A 4AIZA 3WN5B 4CBPA 3GMLB 4RGNE 1RAMA 2EEDA 2O5YL 1HILA 4MAYA 4Z7VE 1RI8A 1PZ5A 2FH6A 3ARDB 1VEMA 3TA3B 4AQ1B 1M71B 4Q6IC 5DT1H 4M7LL 2HTKD 5CBAA 1A6VH 5HI4D 1U95A 1J1OH 1S7UB 3K1DA 2Q8BL 4Z5RB 2C4FU 1PSKH 1TETL 2HT4C 5E6ZA 1U8QA 4JO1H 3VWKB 4L5FL 1QRNA 3T0EB 1CQKA 1URLA 5TF1H 2ZPKL 1R5VB 4PJ5A 4RA3A 1E4KA 1KOAA 3EZJB 3W11D 5DD0L 4PGBB 4X9GA 2G9HA 3FKUS 3WDJA 1E28B 5F1NA 4XP9H 3KXFB 5J9PB 2DRUA 3BW9B 1NUNB 5J11B 2NQCA 4YDIL 4NC0B 3HMWL 4K3EH 3N06B 5IB5A 2YXMA 3T2NL 5FECA 4FABH 2F53A 4ZDHA 1J87A 4I3SH 2KQMA 4Z77A 1DR9A 2EKJA 1B6UA 2BRRL 4G8EB 4D0BA 2E7MA 1XGPB 3QUMA 4ERSH 3FAWA 2AJVL 2QSCL 3LCYA 2P46B 3BHBA 1DBML 5B22A 1HHIA 2L0DA 2RR3A 4Y5VB 4OLYH 2BVQA 3BP7A 4DKDC 3CX2A 4FQ2L 3TVMB 4UT9H 1MLBB 2GJ6A 2DIBA 5FB8A 1S9YB 1XIWA 3MX0A 4GKZA 2QV2A 4P99A 4QCIA 1R24A 3B6SB 2FJHA 1S9XA 4HKBA 5E6YA 1F11A 2VQ1B 1W72H 4WFED 1BF2A 4HH8A 3WL9B 2YPVH 2V7HB 4ZOBA 2VLKE 4NRYB 4JR9L 3HTLX 1WBZA 3OG6B 3X12A 3H6JA 3LRHA 5JR1H 3FB6A 2GUOA 2FGWL 3SOBH 1UB5A 1HH9A 3U0WH 3TO2B 2HFGL 4NKDB 3VWJD 4ODHL 4M8VA 3CDGA 1IQDA 3A6BL 5FKAB 3QEHA 4JY4A 5DEFA 4UV7L 2J1KA 5I74C 4RWYL 4XH2A 4KXZH 3SKMA 3D0LB 5KSVA 3H2WA 1H3PL 4AZ8A 5C8JB 3MRPA 3UZQA 3BOVA 4LSVH 1KPVA 5GPRA 5HYJB 4RAUB 4OZFH 5L6YH 3P4NB 3AY4C 2K9UA 3V79C 4BH7A 4LCIH 5FO8A 5ECJE 1G9ML 4U3HA 5CEYA 3E3QC 3VI3E 3S35H 4QRPB 2X1WL 4LQFH 2WW8A 1YEHL 1L0XA 3VXRA 3P73A 3RTQC 2VL5A 4NQCE 3N1QC 1EXUA 2B4CC 5DQJB 2BDNH 3K2MC 5FGSA 3L3JA 5HSFA 3MLYH 2WLZA 1C8PA 3SE4C 2FLRT 3O2DL 3O3DA 1UYWL 4ZNCD 4MXWL 1U8IA 2W0FB 3BP5B 3VG0L 4OB5L 1MJUL 2Z35A 4XP5H 3TFKD 3E6HA 3RVVD 5J1SC 4HLZG 3HCVA 3SKJL 4HUVA 3ZDZE 1JGUH 2YOCA 4HCRL 2Z91B 2R1WB 1RQ5A 4HLJA 1NFIB 1OF2A 4H25B 1JI2A 3DUHA 3RY6C 3H9YA 3BWAA 3WIIL 2BVYA 5DJYA 1D9KA 1R0AL 4JRYB 3ZSTA 2R1YA 2DMKA 1T7XA 1I85A 2I25N 5FUOH 3SY0A 4WI4A 3C6LA 4OUUA 3QPXH 3IRZA 4PPTA 2VITB 2H41A 1BD2A 3GJFB 3FO2B 3DVGB 4IDLA 4JY5L 3EDKA 5KANG 5EZIL 1CG9A 1GGCH 2XTLA 4E9LA 4WCYH 3NCCB 1UFUA 1I3GL 1P9MA 4DN3H 4MX7B 3UTTE 1JK8A 3BYTA 4FQJH 2P8PA 4XGZB 5ALBL 4OZGA 2VLJA 4QHUB 2R0ZH 1PEWA 4N90E 3UYRH 1BVZA 2Q7NA 3ZE0E 5CILH 1GPOL 4X7DC 4PJAB 3D2UA 4ZNEA 2CKBL 5DJ6A 3D85D 2P45B 3KPRE 1IGML 4FQCH 1KJ3L 3TBWA 5C07D 4UDUB 2CIIB 2GSIB 3SDXA 3THMH 5H94A 4F37F 3T2PA 1F3DH 1Z2KA 3MGTB 3L1OL 3HPLB 4Z7OF 3BD3A 2RHEA 1OB1B 1JRHI 4HWNA 1GH7A 4YHIA 2NY2D 3G5VB 2WINA 3B5HA 3OXSB 3ARRA 4WI8A 1B2WL 1UB6A 5I1LA 4HKJB 4KZEL 1DQLL 3DMMD 4Q6YA 4JFZL 4QLRA 5D1QA 1BGXH 2A73A 2J8UE 3ULSA 1TIUA 1RULL 3G6DL 2BVOB 1YZZA 5LXGL 2A6IB 1C5DA 5EO1A 2YD9A 4E0RB 2P7TA 4XCCH 3ARUA 4XVTL 1WWAX 5DA4A 1IM9A 2OR9H 4N0UA 1WV7T 1PBYA 3C60D 3T1WA 3BPNC 3PG2A 2VLME 3EBAA 3MJGX 1X5HA 3LZFH 3GMOB 2ORBL 3RWGB 1P7QB 3MFFA 3RWFA 1A6PA 4PGDB 3LS4H 4LVOB 5DVKA 4CW1A 4F3FA 5F6HI 1Y0LB 3S36X 3UZEA 4K7PX 2WQ8A 4QY8B 1FDLL 1UH2A 5IFHL 4O5LL 4ZFFB 2Q76A 2V2XB 1T1WB 2DMBA 1WT5A 1HN1A 3G04B 5F7DB 4OFYA 5EFIB 3CVHB 4KDTA 3OKOA 5MEQA 4BZ2L 2ATPA 5IEKA 1AD9B 4P2CG 5BVJA 1XGYH 2ZJSH 3A6CL 1IGJB 3BPOC 4U6HA 2EIDA 1WTLA 2HG5A 1F4YL 2CO7B 1N5YL 3WNLA 4OZIA 4X6DA 1ONQB 4EBQH 4MNGE 1F6LL 2VZSA 4TUOA 4WV1B 2A83A 3ESVF 5BV7L 1RMFL 2HKHH 4CAGA 4D9LL 4HK3J 1T89A 5HHNA 5F1KC 3MRGA 3QWQB 2FEEL 4U6VH 1QNZH 2H3NB 5KW9H 3RWEB 1QVOA 4UQ3A 4QTIL 4R7NB 3D87B 2I07B 3O2VH 4A6YH 3D39A 3IDIB 4I4WB 2V5MA 2NLJB 5D5MB 5GS1A 4NKMA 1GL4B 2OL3A 1RZKC 1JF1A 4PP2B 3DI3B 3CCHA 2AJXL 1II4E 3VCLA 2AEPH 1IGIL 3CNKA 4H88H 5EU5A 3PGDA 3TJEL 4PJBE 4R90L 3V4VH 2Z92A 4YHOL 3L3OA 4XAWH 4J1UA 2VDML 1HDMB 1Y6KR 1J8HD 2NY6D 4NO2B 4CDGC 4MHHG 3AXLA 4KRPC 5IW1A 4PJIF 3S3JA 2VXTH 1L6XA 3ROOB 5JHDB 4NQEA 4ZXBB 3E3QE 4FQXB 3NH7L 3LEYL 5K9JH 4PG9B 1WTGT 3RQ3A 4Z7WB 5ACMA 2ZUUA 4PP1C 4EOWL 2BVUA 5JPNA 1G6RH 4HIJB 4HW6A 1YN7A 4LLYA 5ESVB 4L4TE 3FT2A 5J4MA 4PJFA 3SDAB 4FG6C 1DE4A 5C6TH 4DAGL 2QJDA 3R0NA 5SWZE 1MCOH 2BK8A 2E9BA 4AIZB 2OR7A 1S9WB 1JPFA 3GUTA 5KVEL 1YEGH 4MAYB 1AFVH 1PZ5B 3P4MB 3MCLL 3GKWH 2Z31D 4GW1A 2BERA 1T3FB 3WSQL 5CBAB 2EC9T 4F58L 5T5NF 1DBAL 2PETA 3U0TB 1U8QB 2E7HA 3GNMH 4YAQB 5ISZE 2PN5A 1V05A 4NP4H 1QRNB 3GHEL 4JPKL 4POZC 4EVNB 1M7XA 4P3DB 4P2QA 4O58H 4JM2F 1PFCA 2G9HB 5IMKA 1QBLL 4YHYB 4LCWD 2WNGA 2FX8L 2DQHL 5T3ZE 1KPRA 3HAEG 5IB5B 5FECB 3KPNB 1UCBH 2UWEA 4XWOD 2IGFL 4ZDHB 4BFGA 2NY1C 4OJFH 4DZ8A 4CMHB 4Z77B 1LO5A 2IPTL 4D0BB 3STLA 2B20A 1YNKL 2VLRA 1DEDA 2CR3A 3BHBB 3MRFA 1MWAL 5D6DC 5F7NC 1HHIB 4OSUL 5LJYH 2BVQB 3BP7B 5EBWB 5C0JB 3L5JA 3UJTL 3QCVH 4PLKC 5DD5L 3ZTJG 5GRJL 2AI0L 2ZUWA 3P2TA 5AZEL 5IBUB 3QYCA 1S7VA 1GGIH 1XIWB 2YPLE 5FB8B 5DUBA 1OP3H 2H2PD 5MENE 1RZFH 3I3EA 4BJLA 4RGND 1S9XB 4HKBB 4GRWB 5L8KB 1F11B 2X05A 4B5EA 1KN2H 3F8UB 3VXTA 4LFHD 2YD2A 8FABA 1KTLA 1WBZB 5DDHB 1IGCH 4M48L 1I3RA 1CS6A 2HJFA 1NKOA 4ZS7L 3OX8A 3FB6B 5D1ZD 2YRPA 4Z8FL 1UB5B 1HH9B 4OGYL 4JRXD 5FAAA 1MCQA 1IQDB 3C5JA 3QEHB 4NRZB 2DLHA 1A1OA 2W91A 4JY4B 1WC7B 4XH2B 1DN2A 4HXAL 1X4ZA 3PP4L 5F72S 1FFOB 4OI7A 2X7LA 4DKFH 3MRPB 4R7DA 2CK0H 5KJRL 2DI9A 1KPVB 1AKJD 3MLXL 3MRMA 3PDDA 4KRNA 5D2NC 3T77A 4BH7B 5FO8B 3VFVA 5B8CA 5CEYB 5T5FL 1A5FL 1EFQA 3GRWL 3VXRB 3BZEA 1KGCD 1IAOA 2VL5B 3ARXA 2A74A 4MDIB 2A6DA 5E8PA 5BW7C 4OZHA 3L3JB 5L9DH 4FN0A 4M7LT 4W6XB 25C8H 2B0SH 3GIVA 1U8IB 4M43H 1EMTH 3OR6B 2BJMH 5E4EB 2O26U 1JFQL 1U8KB 1OGAD 2Z35B 1EH9A 1VENA 3HCVB 4Y16C 4HUVB 4YWGH 4HUUA 3K2UL 1JP5A 1UA6L 4XPTH 1SQ2N 2HLFD 1T2QH 2NY0D 2F9BT 4WJ5A 4X9IA 1UJTA 3WD5H 1S7QA 4IOIA 1LVEA 3VG9B 1MFDL 1OF2B 2XZAH 4XP6L 2V9QA 4XPGH 5DJYB 1D9KB 1VA9A 3PXJA 1N6VA 1XZ0A 4POYA 2D03H 3SY0B 4KJQD 3DLQR 4GOSA 3V2AR 4K3DH 4RSVA 3C6LB 5FXCH 4OUUB 5I71B 1MCCA 3UPAA 3RKDD 1JZ2A 3CFBA 5K9OA 4IMKA 1BD2B 1WCQA 1YECL 4MVBD 3M17A 2ED9A 4FP8H 1KCUL 1H5BA 1AQDA 1MEXL 1CG9B 1NMCB 1PW3A 3ZYOA 3MODL 3NA9L 4U1NA 5KS9A 5KZCD 1JK8B 2P8PB 4HPYL 4MQ7A 4OZGB 4DKEH 5HYQA 2IPUK 1OM3L 5M94B 4FQIL 3RGVA 4KHXH 1M6OA 3VGEA 2B4CL 4OGAD 3MA7A 3OKDA 3GMNA 1AC0A 4P23D 5HTSA 1P53A 2IQ9L 3R8BB 3TT3H 5BVPH 5DHYA 4JFFD 4LOUD 3TBWB 3B9KA 1OW0A 1W72A 3SDXB 5K9QI 5H94B 2UVFA 4L4VE 1RZ8B 4G6AC 3EJYC 4JKKA 1ZT4A 5LAXA 3MXVH 4XPBH 4AEHL 5LCVH 4CVXB 5GJTL 4YHIB 1X5GA 1CFQA 3X14A 2WINB 2O61B 3C2AL 4OTXL 2VNCA 1PQZA 1SHMA 4G6MH 5I1LB 1QEWB 3MLRL 5DRNA 3D48R 1AP2A 1FL3A 1I9RH 1BFOA 1U3HA 4IS6A 5D1QB 5JOFA 1MJ7H 2A73B 3ULSB 1DEEA 2GJJA 4QGYA 5EO1B 1C5DB 4FFYH 3SCMD 4OZFA 2P7TB 5T3ZL 4DWHA 4GW5A 4RBPH 1KB5H 2XTJB 3DURA 1IM9B 1PLGH 4N0UB 5K9KB 5JUEH 4LMQE 2Y5EA 3QRGL 3IDMB 5IHUL 5DJZA 4M6OL 3IJSA 3IF1A 4NZUL 3SDCD 1DL7L 3M07A 3V95A 3MFFB 1JCKA 3RWFB 5IGXH 1CE1L 3VFOB 4KKCD 4YDLC 1NC2A 1SM3H 3RUGF 3MOBL 4CW1B 4F3FB 3O41A 3S36L 4K7PL 4HDIA 4P4RA 2YZ1A 4M6NL 4F33A 4ZO6A 2XFXA 4J3TA 2PW1A 2Y6SD 3MV7E 3S37X 2XY2A 3CFDB 4P46C 2DQFB 1T04A 1KLGA 2VQTA 3LKRA 5I17A 3QIBA 5MEQB 1J1PH 2WP3O 2YD5A 4KQ3H 2ATPB 5IEKB 3O3AB 5BVJB 1WISA 1MCRA 3FFCD 1LO2H 1QHOA 4EI5D 2V2WB 2MSPA 5E5UB 3QCTH 3TN0C 4QF1B 4P3CH 4OZIB 4PYHA 4X6DB 4Y4FD 5D8JL 1YYMH 5HYSA 4YHLL 4W81A 4UDTB 1AGBA 4GJTB 3SE8L 1HYSD 2I60H 1MIMH 2CKNA 3SGDI 3W81A 1ZOXA