4E9RA

Multicopper oxidase cueo (data4)
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the engineered multicopper oxidase CueO from Escherichia coli--deletion of the methionine-rich helical region covering the substrate-binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords Blue copper oxidase CueO
total genus 138
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9rA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9rA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9rA03
4DPAX 1AZNA 4DP4X 3EH4B 4QLWA 2VW4A 1IKOP 4AX3A 3NJJA 2P80A 3WG7B 5B3SB 3RYMA 5F7AA 1TEGA 1V10A 3NJMA 2EIJB 1TEFA 2XLLA 1W6LA 2RACA 3WNJA 2HRGA 4KOCA 5I6MA 4GP5B 2OJ1A 3ERXA 3T6VA 3CZUB 1AIZA 3WNIA 5I28A 1J9SA 2EIKB 2AZAA 5B1JA 4HIPA 2FT6A 4AKOA 2Q5BA 4GXFA 5PAZA 4M3HA 3OMIB 3OQRA 4HHWA 4DP5X 1DZ0A 2GB2A 2CALA 1ZDQA 4W9ZA 2YQBA 3QQXA 1GY1A 3KW7A 1PCSA 2YARA 1SFDA 3NJGA 1PZBA 2PP8A 4DPCX 4BWUA 5B7MA 1BAWA 1ZIBA 2PPDA 1ID2A 5D4HA 1ET7A 1ASPA 1BXVA 4BWWA 4BWTA 1KV7A 1BYOA 2FJSA 2CUAA 3X1FA 1AAJA 3U25A 2YAQA 4E9VA 4YSOA 1BQKA 1CUOA 2GI0A 3ABKB 4W1TA 3T6WA 3KW8A 4NERA 3NJIA 2XX0A 2N0MA 1GS8A 3AG1B 2XUWA 1AZBA 4GP8B 1NICA 5FC9A 4KNTA 1PZAA 2HX9A 1MG3C 3QJRB 5B1KA 1OCCB 1NWOA 1SHXA 2BW5A 3WI9A 2JKWA 1JZJA 4A68A 4F7KA 1ILUA 3OD3A 1OE2A 1JERA 3CVCA 3QJTB 2XV0A 4N4YB 1ASOA 1R1CA 4A2EA 1L9OA 4G7RB 3S3DB 3EH5B 2XVBA 3CDZB 1KCBA 2UXVA 3NJHA 4N8UA 4BK5C 1AZCA 1URIA 2AANA 2AFNA 1QLEB 4X4KA 1PF3A 1SHWA 1F56A 5AFAA 1E5ZA 3CG8A 4F2EA 1XB6A 2DYSB 4AKPA 1HFUA 4YSEA 3SBQA 5I5JA 2IWEA 4YSCA 4KOBA 4F2FA 3IEAA 3NSYA 2JFCA 5AZUA 4E9QA 5I5MA 3TASA 2B08A 4G72B 2W8CA 1GS6X 4E9XA 3PPSA 1CYXA 1ET5A 1L9TA 2HLEB 3X1EA 3CDZA 1JXFA 1CYWA 2CJ3A 4P5RA 3QPKA 4HCGA 1AQ8A 1NIDA 2WSDA 1JZFA 3PCYA 1WS7A 4PCYA 1AS7A 2J57A 5I6LA 1OCZB 2YAMA 1L9PA 4DP0X 2CBPA 2DWSA 2XV3A 3G5WA 3S3CB 1IUZA 1IC0A 4A2GA 1KDIA 2BZ7A 1L9QA 1WA0X 3CVDA 1AACA 3TA4D 1OE3A 3QJUB 3GDCA 2BP0A 1A8ZA 3ABGA 3EH3B 3GYRA 1ADWA 2YAPA 2TSAA 2PP9A 2WO2B 2FT7A 4BDVA 5I6KA 2A3TA 7PCYA 1M57B 1SNRA 3WKQA 4A66A 2IDSA 4BDVB 5B1BB 1OF0A 2TSBA 4FAAB 1AR1B 3IBOA 2X88A 3FYIB 1SFHA 2FQGA 5ANHA 4YSSA 4FA7B 2UXGA 1ZPUA 3H4HA 3TU6A 1BXUA 2IDTA 1WS8A 1J9TA 3D12B 2BP0B 2CCWA 3FU8A 4PAZA 2BHFA 3T6XA 3FU9A 1N70A 4E9SA 1OV8A 1E30A 3FSWA 4YSUA 1MZZA 2H5UA 4KO9A 2AVFA 1KDJA 2BO0A 3ABMB 1JZGA 4UAHA 3X1BA 5B7EA 1T5KA 3DTUB 4BXSV 3OM3B 1NDTA 2XXFA 2R7EA 2HZHA 1HAWA 1ZIAA 2Q9OA 1ET8A 2UX7A 4NAJA 4GP4B 3IN0A 3FSVA 1X9RA 1OE1A 2BP8A 2IH9A 2DWTA 1AS6A 5E9NA 4ENZA 1PNDA 4UANA 3X1GA 1JXDA 1J9RA 1AZUA 3MBWB 1W6WA 1WA2X 1PAZA 3AG3B 3T6ZA 3TBCA 2MRYA 9PCYA 3SBPA 3AG4B 4YSPA 1DYZA 2PCFA 3AY2A 2QPDB 2YAFA 5PCYA 3HEIB 1AG6A 1NIFA 1I53A 3NYKA 1A4AA 4QKTA 1BQRA 8PAZA 2FQEA 4RH4A 2IDQA 3NJKA 2BZCA 3FT0A 4ZK8A 4KNSA 3NJFA 1JZEA 1L9SA 2VN3A 2EILB 4WKXA 1PY0A 2PCYA 2HX7A 4HAKA 4YL4A 2PP7A 1NIBA 2FWLB 2IH8A 1KYAA 2GBAA 4NB7A 1SDDA 4KNUA 2X87A 2BWIA 4DPBX 4HZ1A 4G7SB 1WA1X 1AS8A 1YLBB 4E9YA 1J9QA 3PLYA 4CSPA 3OMNB 5AKRA 1ZV2A 1XMEB 2OCCB 2P80D 4G70B 2ZOOA 2IWFA 1IBYA 4HCIA 6PCYA 1V54B 4DP6X 3NP3A 5D4IA 5A7EA 4GYBA 5TK4A 2YAEA 2J55A 1NZRA 3FQ2A 2XYBA 3PAUA 5F7BA 2YAOA 3AW5A 3EF4A 2FQFA 2Y69B 4G71B 4YVUA 1A4BA 1KBWA 4E9RA 1FWXA 1GW0A 5LDUA 2MTAA 1CC3A 1GY2A 3NJLA 4HALA 3FPYA 1B3IA 1FA4A 1KCWA 3N2JA 1ZDSA 2UX6A 1IBZA 1KBVA 1WAEA 4AKQA 1RZPA 2UXFA 5I26A 4YVNA 1NIEA 3HB3B 3QJSB 4TXVB 3UACA 2YXVA 1RKRA 3NT0A 2E86A 4YSRA 3FQYA 2EINB 3EHBB 4A2DA 4YSAA 2FT8A 4JKNA 3X1NA 3H4FA 3JT2A 2QDWA 1M56B 1ASQA 1MZYA 3NSCA 5EHFA 2Y1AA 1MG2C 2H3XC 2R7EB 2VMJA 2YAHA 2ZXWB 1J5CA 1BXAA 2QT6A 4A2HA 2BWDA 5I6OA 1RZQA 1M9WA 1A65A 3BQVA 1W8EA 3TBBA 1A3ZA 3ZIYA 5TK2A 1PMYA 3ASNB 4Q89A 2DYRB 2XXGA 1UATA 4AI7A 1JXGA 4JHUA 4BXVA 2DY2A 3DKHA 2OV0A 1JZHA 4P5SA 1MDAA 1V55B 1PLCA 1XB3A 2XWZA 2PLTA 2VW7A 3PAZA 3UADA 3T9WA 1E65A 6PAZA 1L9RA 2VM3A 1AG0A 3FS9A 4DP8X 4EF3A 1E5YA 3FQ1A 2HXAA 1BQ5A 2CAKA 3FYEB 1NWPA 2BW4A 3NP4A 1GSKA 3OMAB 1QHQA 3FSAA 2XU9A 1SJMA 4L0PB 2QDVA 4WTQA 3AG2B 3FU7A 3MX0B 1AANA 3CVBA 2GC7C 1AZRA 1SDDB 1JOIA 2I7SA 3SBRA 3AZUA 2JXMA 2HX8A 3X2QB 3BVDB 3DIVA 2VSMB 1EZLA 4M4RB 5I6NA 1HAUA 3WIAA 2AZUA 2GSMB 1JZIA 3N55A 3NJNA 4JHVA 3FPXA 3T71A 2IDUA 1PNCA 2YXWA 2DV6A 1TU2A 5I6PA 1NPJA 4E9WA 3QJQB 3H56A 2VM4A 1NTDA 2UXTA 3ABLB 3UAEA 1GYCA 2XV2A 5D4JA 3ZX1A 2EIMB 2PPEA 4YSQA 3PXLA 1OOWA 4Q8BA 3ZBMA 2HRHA 1QNIA 4G7QB 2J56A 4YSTA 1RCYA 4KO5A 4HCFA 1GS7A 3GXUB 2W88A 3JTBA 2WO3B 1KGYE 4UF7C 1NINA 1E67A 2IWKA 3S8FB 3V9CA 4E9TA 3SQRA 3QJVB 2PPFA 1GR7A 1NPNA 3ZDWA 3UGEA 3S8GB 1OCRB 4A67A 2QPEB 2BP8B 1CURA 4GY4A 4K9JA 2VW6A 4YSDA 1JVOA 4HHGA 1PLBA 4A2FA 1TKWA 4MFHA 2J5WA 1PZCA 1NIAA 2FQDA 4DP2X 1PLAA 2H47C 4KO7A 1OCOB 2GC4C 3S3BB 4DP7X 7PAZA 1X9UA 3FU7B 3NSFA 1BEXA 3UAAA 1XB8A 3IE9A 1AOZA 1EHKB 2GIMA 1N68A 2I7OA 5B7FA 2ZONA 2VSKB 2XX1A 2PPCA 3IN2A 4CSZA 1BYPA 2IAAC 3ASOB 1J5DA 5B1AB 3V9EA 4DP1X 2FNWA 2NRDA 1FFTB 2ZWNA 3FSZA 1ILSA 3PAVA 1A4CA 1JVLA 3C75A 2I85A 2B3IA 2FTAA 1VLXA 1SF3A 1ETJA 2LLNA 4DP9X 5I5IA 5IY5B 1SF5A 5B1JC 4KO6A 3UABA 2IDFA 3NSDA 4AZUA 3WKPA 2GHZA 2PPAA 3L45A
chains in the Genus database with same CATH superfamily
3PWNB 3VD9A 5GGRA 2QKIC 5T1LD 2TRHA 5JHDA 3GSNA 4D2NA 4HK3N 3ZE0F 1I8KA 4QYAA 4M5YL 5I76B 4HW6A 2QQKL 2X6CA 1CF8L 3H7BB 5B3SB 5EZJA 5CLTA 1OCWH 1X5KA 1EO5A 3ZTJG 3IMVA 2NQ3A 1BOGB 3ARPA 2HMIC 2HRGA 4R0LC 4C4BA 2X5PA 4LSTH 1EBAA 1KGUA 4ZFOL 3NIFF 3VACA 2XWXA 3T6VA 1AIZA 1ZMYA 5IV2A 2NNCA 1UURA 4KKBC 4PJ8B 3WLWD 2IAND 4LEXH 1N5YL 4G9DB 5H37A 3UJTL 2BLFA 3BD3A 3VI3F 3LIUA 4W9ZA 1RUAL 3US1A 2YARA 4KI1A 3NTCH 5DZAA 4XXWC 5C0BB 2EIDA 4YPGA 3WTTA 4U05A 5IBLC 3D2UA 5D6CB 3A67L 4YHIA 4JO2H 3T8XB 5AZEH 3WS6A 4Q9QH 1BJ8A 1QR1B 3MO1B 3MRMA 4ELDA 4Z7WB 3HKFA 2CK0L 2WQVA 3HCVA 1J7VR 2E9JA 2NW2A 4OKVA 1KGWA 1E28B 5EDXA 1N0LA 1IAKA 1QFUH 3X1FA 2BVEA 1AAJA 3HBPA 1BLNA 3U25A 4L48A 3FCSB 5F7MC 1G84A 2VABA 1GJIA 3T6WA 1CK0H 1A3QA 2AXJA 2IAMA 3UXFA 3GSRA 2WTPA 4UM9A 4Z1PA 5AKSA 1HIMH 4R5VA 5D55A 4ZQTA 1SOQA 1A5FH 3IJEB 3NFPB 4LFHG 4YHNB 4DTGL 1ORQA 2EH7H 2FECL 1PZAA 1J86A 4HC1A 3DOHA 4F7CA 3OLDA 4HUVA 4EXKA 2B4CL 5DYFA 3UTZA 5INDB 4NZ8A 5EDSA 4LSQL 3AY4C 1FN4A 3B83A 2HKFH 1D2OA 1HHHA 1ASOA 3QCUL 2BC4B 1JNLL 2F6AA 3D1MC 1LO2L 4HCRH 4UQ3B 1KMGA 2QVMA 2XVBA 5IVZA 3EFOA 4FL4C 5AW1B 4PJFE 2VMFA 2Y22A 4B3EA 5ICXB 1K3ZA 2AFNA 1QLEB 3A0OA 5I1HH 3OPZH 1NGYB 4AGLA 4HIQA 1D5XA 3T2NL 4KRMB 3HRZB 1UQSA 2ILLA 4KROD 4JE0A 2DQTH 4Z7UF 1INEH 4HISA 2WTRA 2Q76A 3MLYL 4UQBA 4E41A 4KY2A 4IMKA 3G6DH 2WJ5A 2NTFA 2IWEA 4PRIA 3PHOB 5F3HA 2AK4D 3RX9A 1NDGA 2FEJA 1BD2D 4Z7QB 1P4IL 1QLRA 4BH7A 3MLPA 1WWBX 4JREC 4KH9A 3RJOA 1MCWW 2WXFA 2HYMA 2Q7NA 2YRBA 4L23A 2BMKB 3BWSA 2X2YA 1RUPH 3QG6B 2E3VA 1CICB 4CVXA 1B90A 5A2IH 5CGYC 4U31A 2EDDA 3RVTC 3PHOA 1UUSA 3NK3A 4LIQL 2EAEA 1HQ4A 2WGXA 4NGHH 35C8L 4GRWF 1IC0A 4I1PA 3GM8A 2X4NB 4GI9A 2C9QA 4RAUB 4UYPA 4U1NA 4EUPA 1MCIA 1K5NB 2XJLA 1RQ5A 1ZSDA 2Y0SA 3QC6X 4Z9KB 4RCAA 1RJZA 3RWJA 4BFJA 2SODB 3CFJB 2PO6B 1A6ZA 1U8LA 1BD2A 3OAYH 2ID5A 1TMCB 2VLJD 3APNA 4KHXH 1U8CB 3SE9L 4TSAL 3IGUA 4NNPL 3MR9B 4HS3A 2Q3ZA 1VF5C 2BXYA 2YEZA 2OMYA 1S7UA 3D85A 3D0LA 1OF0A 4JPIA 4NKDB 4WEUD 3SDDC 4QI3A 5IGXH 2WXQA 4RFEA 1FG2A 4IK7A 2CPUA 3FTVA 3T04D 3MRHA 4G9FE 4EOWH 4UUJB 5JW4Q 3O6KL 4PN6A 1OT4A 3S34H 3B2MA 5FLUA 2TAAA 1AIFB 4OJCA 5G5DB 2E8YA 4QHUA 4PBWD 1CQYA 4KTGA 3SQBB 5ES4B 4MJ5A 1XTMA 4N0CD 4YSUA 1DUYA 3MRCA 5TGBB 3U46B 4IRJA 2KUTA 1QFUL 4MHHI 4G59C 3CFTA 1QW8A 1T5KA 2GJZA 1TTFA 4HIJA 1UZ6E 2IPUK 3CQPA 1QSEA 4ZFGH 3HMWL 4AVIA 1G7PA 2O6CA 3TYFA 4S2SB 4NKOA 3PWVB 5CBEB 1AD9A 4LLMA 4MGXA 1A1NA 2DWTA 4NDMB 2BIQA 1QKZL 3JVGC 5J5EA 2F68X 4MJ5B 4C4KO 1JXDA 1GIGH 1O0VA 1YY8B 3OJ2C 2OPCA 1ZY9A 4YZFF 1KG0A 2ZJSH 4Y16B 4H5SA 3F01A 3B9VA 1FVCA 3ARFC 3PQYB 3KYKH 1J0IA 5J06A 4YSPA 5FFGA 1Z0MA 1IC4L 4WEMB 1SLWA 4POYA 4X5LA 1IGFH 1KGIA 3FT3B 4OM1L 4KKQA 3U4AA 2F08A 2X6BA 2DQJH 5KANG 3RZCB 5DRWB 3GF8A 1L9SA 1H8NA 2OR8A 3TEYA 2BNQB 2VN3A 1NC2D 4WDIB 1YMME 1SMDA 4HJEA 5EOTA 4ZX3A 4RRPM 4EI6B 1FLRL 3RWIB 3V5DA 5JQHC 4FFVC 3GSQB 3I02B 5D9SA 2BS8A 2WXPA 4QXUL 3T0DA 2OA9A 4KNUA 4M7KH 1N26A 5HDLA 1LEIA 2C3VB 4J3XA 4X6CF 3G5YA 1N8ZB 1S3KL 4S11A 1J9QA 1ZCRA 3TCXA 3WEXA 4QYOB 4GH7B 1LO3H 3GMRB 1LP9E 1XH2A 3DO3A 4DVBB 2DWXA 4F7PA 2W5PA 2VRQA 2JKNA 2V7NB 1TQBC 4LIQH 3N40P 4FXTA 2CA4A 35C8H 1EPFA 2NUTB 3LCYA 5LXGH 1QSFE 2ITCA 4FFTA 3ARBB 3GXFA 4ZPVB 5DRXB 3RX5A 4L3EA 2FQFA 2OMZB 4F7EA 4XNXL 4FNQA 4Y5YA 1C1EH 4QXVA 3ECVA 3KPSE 4N1CA 2VL4A 5DVKA 5DJCA 5K9QG 1CDBA 3W2DH 1RY7B 5DI8B 4OGXH 2J1KA 3SKUD 3BP4A 3BKCH 4N6QA 1A6UH 3BD4A 4YHPB 3IGAB 5SWQB 1OGAA 1W0VB 2ORBH 1PG7L 3KR3H 3LVEA 5EU7E 4G1MB 2WQWA 2DJMA 2DQHH 4J12A 1CF1A 3GTTA 1SGKA 2WKGA 1G94A 5DQDH 1NFDA 1A7QH 4TXVB 1K6QL 1KCKA 1YECL 4KC3B 1B3JA 4Y4FB 1IGCL 2EQDA 3MRDA 5FIEA 2NLJA 5C0GA 4Q0XH 4WI6A 1JPTH 4KJPC 1BX2B 1XQ4A 1J1OH 1FL3B 1F00I 5ENWA 4HULB 4Y4KD 1H3PL 4OM0H 1MCOL 1WAAA 5C0BE 1HI6A 3ECUA 4F80A 1S46A 2H3XC 2H0PA 3OAZH 2EZ0D 2VLJB 1DL7L 3BI9X 3CMGA 4ATTA 1E4WL 5C0AE 5B8CC 4P2RA 4XP6L 1A65A 2DICA 5BUGA 4Q9RH 3BQVA 5ALCH 1WZLA 4ZFFA 1WBYB 4Y1TA 1A3ZA 4GEIA 3ZDXF 3ILDA 4DKDC 1PMYA 3ASNB 5GGSB 1UATA 1QR1A 3CH1B 4BZ1H 2DD8L 3PWPB 3TA3C 2AK4A 1BWWA 1ONQA 1QUNA 1XB3A 5EPMB 2K0RA 1EZUA 4ADIA 4E42A 1ETZB 4IBTA 2F5AH 1HEHC 3ULAB 3AT0A 4OM1H 2WWOA 3ZKSD 1UADC 4U6YB 5K5YA 2AJXL 2JVUA 4DAGH 3L2MA 1A14L 3SPIA 4JDZA 3OQ3B 4JMXA 2FZ3B 4OLUL 3Q6GL 3GM0A 4N68A 1X5AA 5CP3A 2WCGA 1T89C 1T6WA 2AK4B 2AW2A 1ZSHA 2VE6A 4PWKA 4MXQD 5K9OA 2XKNA 1E9OB 4UTBH 2FJFA 3SDCB 1VGKA 3CSGA 2RFXA 2OCFD 4HJ1A 2F54D 3UDWA 4NKMA 2WZ5A 5J0BA 3CVHH 4ZFOB 5CCKL 2IC2A 4XRCB 5IB5B 5ISZB 2XPGA 1AC0A 1JV2A 3VXUD 1MNNA 4DH2A 3DIVA 4IRSA 4FEMA 4Q74A 2G4EA 2ZP0T 1Y18B 4OLXL 2VLJE 5EZOH 4PGDA 4X4MA 1KXVC 2HPTA 1O5DT 2XQYK 3TZVD 2X4TA 2R56L 1S5IH 2YD8A 4OCRL 1P7KB 1FDLL 3WIIH 1TZIA 1CBJA 3TTYA 1UWGL 3EO1A 3LHAA 2WQRA 5FM4A 4G6JL 3H56A 2A6JB 3QEQB 1CS6A 2P3YA 2VDMB 4PJ5B 3RA7L 5D4JA 1GCYA 5IBTL 3GMLB 2PWEA 3CX5J 3UTQB 1KXTA 5D70H 3VI4E 5LUMA 3JVGA 3BKCL 5T1MA 4ODWA 1UZ8B 1A6UL 4QHNB 1H3XA 1EXUA 2R83A 4ZFZA 5C07A 2CU9A 3SKMA 4K5LA 1PD1A 1KGYE 2IEPA 1YY9D 5DMGD 3MACL 1KPVB 4NNXB 4POUB 1T66D 3QQNA 2B59A 1DCLA 1KXTB 3QUKB 3IRPX 3FXIC 2UUDK 3QDJE 4KKLC 4LKCA 1HOEA 5J6GB 2DB8A 2WLKA 1JPTL 1EXUB 3D6GA 2Y2YA 5IEKB 2VN7A 1H3PH 3BPCB 4OM0L 3FUDA 1TKWA 3SODB 1AI1L 1KLUB 1OAZL 1CE6A 1ND0A 2JJTA 5IP4A 4OJYA 5ANMA 4MBRA 3UG4A 5F1OB 4XP6H 3ULVE 3P2DA 1CT8A 3TN0D 2E0PA 2R2EA 1NGQL 3EYSL 1GW6A 4LEXL 1N5YH 3TWYA 4FF9A 1HKLH 4NO5B 5K9KB 1INDH 4RWYL 3KLHC 2VLRA 4U0RB 4AGQA 4LEOB 2EYTB 3K72A 4ZUSB 3FSZA 4JPKL 3KMDA 1A4CA 3IJHB 2Q2EB 2I85A 4N86A 3VRLE 3H9SD 1QBLH 4PVMA 1WFOA 4RMSA 3SGKA 4HOWA 2LLNA 1B2WH 2FBOJ 5CJQH 5E9AA 5FUCE 1DLHA 4K15A 4K3DH 1BPLB 3WHXA 4GKZB 3I9IA 4P99A 2UV3A 3L8QA 4Q9QL 4BIKA 3RFZC 5M95B 3RDTC 4XVJH 5FYLL 1E6JL 2FJFB 2J72A 3KDPB 2DH3A 4HMCA 1DQQA 2ZAGA 1QQDB 2A9NH 3BEVA 5AVUB 3KGUA 3VXUA 4LU5L 2F19L 2NW3A 3VWKA 1I82A 2YD7A 3QHFH 4U3XA 3ARTA 1MQKH 3BH8A 5DD6B 1UYWL 4CGTA 4BFEA 2DWDB 3IWVA 3NJMA 4HIXL 3U4EA 5L2KE 1W6LA 4YE4L 2G9HB 1A5FL 2JJWA 2RACA 2EDRA 1R0AH 5I6MA 1T83C 1R5VA 4F8NA 2D7TH 2H6PA 3HS0A 3HG1E 5C6TH 4M61B 2O6DA 1DQQB 4P5KB 3T3MF 2H32B 4UV7L 3D51A 2HFGL 3OR7B 1TNNA 1S5IL 2HG5B 1BEYL 3DO4A 4GIOA 1FDLH 3WIIL 1ZVNA 2OSYA 2A6IB 2MIZA 2Y7MA 2GJ6A 1XBDA 1TQCB 2D3VA 3KL0A 4XNDA 3CBKB 3OPZL 4KHTL 5IB3A 1ZV5A 4KRPB 4WW2F 1QPKA 3V0HA 3MOAH 4IGBB 4ENED 4XVSL 3UTSD 4X7SH 5TD4A 4IKLA 3E3QE 4ZW6A 4F2MA 1T6VN 4CVZA 5GRJH 1A6WL 5SX5K 1FVEB 3IJSB 4V1DB 4ZS7L 2FWSA 2CHWA 3MLSL 2FEDD 4XT1C 4EUPB 4E9VA 4RBPK 3H3BC 3CV5A 2ZCLH 1P4BL 2GI0A 3KNBB 3LQAC 4X6FA 4AENB 4WWNA 2N0MA 3MCLH 4YE0A 2XUWA 1FZJA 5CZXC 1CCZA 3BMVA 3QXAA 3WFCH 1F3JB 5FC9A 4GG6F 3EJCA 1BLIA 4K94L 5FUZH 3RNKB 2HX9A 1ZXKA 3IPFA 4GB9A 2LV4A 2F53D 2CIIA 5E70A 4JRXD 4LQFL 4WGVB 4OZFB 4F7KA 1CT8B 1E50A 1F8TL 3FOLA 2V17L 2EDJA 4RFOH 3FQXA 4G5AA 3WN5B 3I9PA 2XV0A 3P3RA 5IMLA 2UZXA 1W16A 3KPRA 5IEHB 1L0QA 2W81C 1BQSA 1QHPA 1WZKA 2ZYHA 5ICUA 4G83A 1FG9C 1SN5A 3ZMEA 3ZZSA 2WQXA 5KVEH 4TQEH 3NQIA 3D85D 1BQHG 2VXQL 3KPRD 4H0IA 3SE9H 4F2EA 4ZXBD 4OZ4B 2WOYA 3PAYA 4W93A 4AEHL 1U8NA 3V6ZA 4ZODA 4JPKH 1S7SA 2X89D 4C83A 2Z31C 2J5LB 2YD1A 5LGYA 1QBLL 4FLQA 4GS7B 4MBOA 3HLAB 3KXFE 5DCCA 3VNZA 4CC0A 1I9IH 2XVKA 3CN4A 3S34L 3TASA 4K3DL 4ANXA 5CJBA 5DHVH 3B43A 4Y16A 4OF8A 3IDNA 5FYLH 4JFFD 1MVFA 5JO5B 3VDCA 4WI9A 2WSDA 4PCYA 5EBLA 4Z3HA 4K5MA 1NAMB 1ACYH 2CRZA 4OJAA 4ZSOA 4HKZB 5C0RH 4BKLB 1U2YA 1BBDH 4KH2A 1M7IA 3NBNA 4FHJA 3HC2A 4HBQA 5D7JC 1IM3A 3WL9A 3OKKA 5E8DL 3CDFA 1IILE 5AAMA 1I3RA 3JV6B 3MFGB 3R1GH 1MW3A 5AD0A 3NGBC 3LXAA 2FR4B 3PXJA 2R1XB 4R4ND 1A8ZA 5I1LA 1HH9A 2IQAB 1UJ3A 2ZJSL 5GSRA 1XF4A 2DJSA 5IIEA 5F0LB 3VSVA 1UXLA 4AG4H 4QY8A 1OTUC 4KROB 3SPCA 1AR1B 3GI8L 3HE6D 5EF0A 2QV2A 3GXNA 3EFFA 1KYDA 3D0LB 1QSEE 3ZHLA 3EJZD 5BV7B 4JJHA 1CD1B 5C0IA 3A6BH 2RTTA 2Z7ZA 4IU2A 2K6YA 1WS8A 1YNTB 1BIIB 5DQ9A 3U1SH 1Q38A 2GCYA 3LRMA 4AYMC 2O30A 4X7SL 4XX1G 3S35H 3RWGA 5F6IB 5I1AA 2Z31D 1KEMH 5EORL 2X3AA 1J8HD 4GIAA 5HI4C 1XBRA 4Y4HA 32C2A 4TL4A 5AEAA 5SX4I 3VD1A 3MRPB 4P5TB 4LLVB 3T3PB 3U9PL 4P2QA 5SX5H 2NY0D 4YHYB 1X9RA 4EBQL 1Q72H 3SBWA 2E9BA 2NY2C 2W0LA 2NDGA 2X6VA 4CU7A 2R9HD 5AENA 4AQOA 5KVGE 3T1FB 5KUKA 5F0JB 3ISRA 3SOBH 1D5MA 4WLCA 2PYEA 4P5TA 3QDAA 4YDJB 1DYZA 3VXNA 3B5HA 5AB0A 5AYUH 5JDJA 4RZCB 4EN3C 3W2DL 2M26A 4PSRA 3SDXB 1D7FA 5I8EB 2VERN 2X41A 5CZXD 1LEKA 3HLAA 1A7OL 2VN4A 4ZZFA 2XACC 2QMJA 4OJFH 2PCYA 3P2TA 4NQDE 2ORBL 3NRFA 4F93B 3SJVB 5E8NB 4W4NA 1WZMA 4NRZA 1JBJA 4LVHB 4PJDE 3VFOA 1NAKH 4Y0GA 4HAGA 1KENL 3C09C 4FFYA 1D9KA 4AWJC 2WP3T 5DO8A 2YWZA 5FF6B 4QPEA 3WHE1 4TN9A 5HPOA 3WO4C 1KJ3L 5EUKB 1B4RA 4OZGF 2I25N 3PJSA 1ZV2A 5AVVB 1MCOH 3ZKMD 4PJGB 1QLRB 4BH7B 4YHMH 1CXLA 5C0RL 4GKSB 3M7OA 5HYQB 2ZNWA 4PJXA 1KB3A 4GSRA 5IOPA 5ALCL 5T1JA 5KZCD 2APBA 1UM4L 5GZOC 4AYSA 5JHMA 2Y6SD 2ROYA 3NUKA 1IIIA 5I75C 5E0QA 5CZVL 1EJOL 1S7VA 2E7LC 1RSYA 4A7TA 5E8EB 4CMMB 1QPPA 4TL5A 3VTTA 4TNEA 4JFQA 5CD5D 3QUYB 2R1WB 1EAPA 1TITA 2X1QA 2I07A 3VG9C 1RPQA 1I1FB 1PQZA 2A6DA 2EIEA 1VEPA 4XO5A 4AGMA 3ARXA 2GK0B 2F5AL 2Z35A 3PUCA 4AKQA 5DHDA 3DOSB 2UXFA 1JG9A 4BGLA 1A1OB 3M1OA 4FFYL 4XNAA 4OLUH 1QABA 2CM6A 2XBTA 4QRRD 3MRPA 2VXUL 4K3JH 2J88H 3FQYA 1H15B 4YHLH 2UZIH 1MCNA 3BD5A 1PJ9A 5GRXG 4F1ZA 5JQIB 4X6CB 1U30A 4XZUA 2F58L 1MW1A 1JZ2A 4S0HA 4CKQA 1U4FA 2G5BB 4ELMF 3F64A 1IGJA 1QBML 4HLJA 2P5PA 5DEGA 3ATBA 1HTYA 1DDTA 1ZANH 3JWDH 2QT6A 2VAAA 1JXJA 5DFVC 3OGCB 4HUNB 5I0ZA 5I74C 4I7ZC 1MCQA 4BFGA 1W8EA 1DUYB 3MRCB 4RDBA 5DVLA 5AVWB 3U46A 4AY0A 3IS1X 3P9WB 1S8DA 2XTSA 1A1MB 3K81A 4AXWA 5MEPB 1T0OA 3UCQA 1V55B 4IMLA 2NX5B 2JCCE 5C0FA 2XKSA 1WGOA 3PAZA 4JHBA 3OB8A 4PRAA 2OJZH 2XCMC 3CLWA 1EAOA 3RA7H 2RBLA 1D6VL 1HSBA 5FYJE 5GGUA 2OL3A 2QHRH 1PKOA 3QJFB 5EC1B 1MUJA 1NUDA 3NP4A 1YNTF 1G0YR 1VAHA 4PBDA 3CCHB 4JREB 4R96B 3O2VL 3V4UH 4B96A 2GITA 3UYRL 4TUUA 4AH2A 4S1RH 3FU7A 5I5RA 3MX0B 4Q9CA 5ISZD 4MA3A 1R5IB 4FQ2H 4JY5L 1DQDH 1JOIA 1KENH 3SBRA 4HUUB 1W9XA 2A73A 1ADQL 2H0FA 2GAZA 2MMXA 3CFCH 4HS8H 4O58H 4L3FA 4EN3A 4PJCF 2OMTB 4NZDA 5IESL 4HPHA 5F89A 4FNLL 1WEJL 1LNUB 4G42A 1FVDA 3DVNB 2HKHH 1ZSDB 4PY7B 4RIRA 3WTSA 2HAZA 3CK0L 2CGRH 4PREA 1F58H 1CFNA 2ZKMX 5IMOA 3T71A 5HVFB 3L4ZA 2X4TB 3PNWB 5I2IB 2BERA 4XPTH 1Q8MA 1D5ZA 3QYCA 2HFFB 4NPYB 3S2AA 2WYTA 2QSCH 4APXB 3IFOA 3JWNG 3UAEA 1PY4A 1L6ZA 1AQMA 3FTYA 5HDBE 2C9VA 1RUKL 4YGAB 2HFTA 1LEGA 2VLKD 3J7HA 4F7TA 5D2LE 4Y5VA 1MJ8H 4ODWB 4PQXA 3ZHFA 4ILDA 4RGNB 4EUPG 4XCYB 4E0RA 2WO3B 4OY9A 3IXAA 5LNGA 1A7BA 3Q44A 4B7IA 1NINA 3P73B 4AJYV 5L4JA 3CXDH 2W9EL 4DUVA 4HIJB 2H1PH 1UG9A 2P48B 2CO6B 4QWWC 1S7RB 1MAKA 3U83A 2X1OA 4K3EH 3ZDWA 1DQJB 3S8GB 3V0AC 1NAMH 4JZNA 2FE0A 5LQBH 4LLMB 4HUVB 3T77B 3HI5L 1S78C 4K9JA 2YC1B 1JVOA 2YBRB 3SE4C 4FTDA 2F8VA 1KTDA 2K6WA 2AJVH 4Y2NA 4YDNA 1ZHBB 1QBMH 1YUHB 2FQDA 5ERWA 1R0AL 2ADJB 4UYQA 3ZE2E 1A6PA 5HGDB 1F1GA 4GOSA 5JW4R 4OZIE 2NT0A 1XB8A 3WE6A 1Q0YH 5EEZA 3FUFA 4V1DA 5C0FB 1E8YA 5E00B 2QHLA 4PJFF 4XAKD 5I1JL 3F62A 3WY3A 5IJCC 2HLAB 2Z4QA 4WJG3 1DJYA 2VSKB 3OZ9H 4ZUUA 2PPCA 3QEGH 2D9CA 3CTTA 3PHQA 2AITA 3FFOA 4ZMPA 5CEZE 3FZUD 1RZJH 5A2AA 3L1GA 2ZXBA 2LOEA 4P07A 1DBBH 4ZUWA 3ZGHA 1IQWL 1NBVL 1PX3A 1MJJB 2OJZL 4NQCA 1G7LB 4JRYA 4K4KA 3RZWA 4XCEB 2JELH 4M62L 3FO2B 3VXRD 4RBPH 3QO0A 5I19H 1HXMB 5AB9A 4FLOA 4U3SA 1TQVA 2ZICA 5HJGA 5AB1A 3EH4B 1OAQL 2BXZA 1A7RL 5EPMA 4J5VA 3C6SB 4JGNA 4D8PB 3MLSH 4AQZA 1KEGH 1KYOK 4U7MA 3V7MA 2P5WB 1TEGA 1M6UA 2FRGP 3D69A 4XWOD 5DD6A 4PJIA 3MNWB 3IETB 4HJ0C 3T08A 5CFHA 3AFLA 3RWHA 3MSPA 1FNLA 1ULVA 3HN3A 5FO2A 3V6OA 2V9QA 1PX4A 4ABWA 1JWSA 3RNQA 2FH6A 1EAQA 4OAWA 4ODVH 3UO1L 4PV1C 3ARBA 1NBCA 3LVTA 4X5XA 4FYQA 3D48R 2UZYA 2XHNA 4QRTB 4ZUVA 3K0WA 1YMHA 5DI8A 1XGPB 2V17H 4KUZL 3UYPA 3OQRA 5JLZB 5IROD 1HSAA 4HHWA 3UTSA 2ZX6A 4MNHB 3FUJA 4K2UL 2OLDA 5GGRB 3ZDZF 1EEZA 4JFTA 2OTWB 1T5XA 2ESVA 2WIIA 3G5ZA 4ZO6A 3FU0A 5TQ2H 1X9QA 4P46B 4BWUA 1HE7A 5T1DL 1WIOA 2K7QA 1XSKA 5FGCE 4X5XB 3MFFA 4FG6D 4WJ5B 1FN4B 1R24A 4BM7A 3IVKA 3SGDI 2JB5L 3CQFA 2HRPL 2DMBA 4AMKH 4Z76B 2Y6TE 4IEFB 4NXKA 4S1DD 5CM1A 1DJWA 3KM1A 1BYOA 2ICES 3V4PL 1E5BA 2P24B 1BW8A 4CJ0A 3FB7B 4YLBA 5HYFA 5TE4H 1SXCA 1IJ9A 4D0DB 3D18B 4NERA 2B9BA 2OULB 4GFTB 4P9ML 3WKML 5IB2A 3LEYL 1IBFA 4B50A 2H1PL 5GS1A 3BUQA 3G5XB 4NQSB 5GGSY 3LXCA 1C12B 2XG5A 2J8UE 2PF6A 2ZD0A 5KAQF 1NAML 2NY1C 3S98A 3UMTA 3VFTB 4EXPX 2R29H 4I0PA 5CCJA 5ID0A 2PUQT 3RHWF 3VD4A 1CD9B 3Q0HA 4AQ8C 1U8OA 3S9DB 2Q76B 2FGWH 4WKZA 5DZJA 4MXVF 3WGUB 1F1DA 1L9OA 2KI6A 4I2XB 3MROA 4HKBA 3P3YA 1QO3A 4KX9A 4KZ0A 3FUMA 3LKNA 4ZUUB 1N0LB 4HWEH 3M17A 2EXYD 1OM9A 4LSUH 4PJFB 2YA0A 2AANA 4ZAKA 2R0LH 5CBAA 4O9HL 1H5BA 4UQ2B 4NQDB 5CP7A 3V7AE 2LE9A 2AGJL 4HK0B 5T8IA 4AQEB 4QRUB 4DZ8A 1XF5B 3NZ8B 3IU4L 5F88A 1SHMA 3MRLA 3GPSA 1U41A 4M6MH 2J12B 1AO7D 4NSKB 4Y5XA 3MA7A 5E2JA 1ACCA 1I3VA 2OMVB 3G6AA 4JFED 4X9GA 1CQKA 4IBQA 3OX8A 4XCEA 2E59A 3TONA 5KBKA 3GI8H 2LLGA 4IS6B 1HYRC 1VB9A 2BS9A 4MAYC 5CKGA 5IJVB 5AOMA 5JZ7C 1DBBL 4MXQC 3CN2A 1ZLSH 5DMKB 1ZT1B 5C97A 3MJ8B 3QZWB 2E27L 4UIKL 3KL3A 3QUZA 4JM2C 2DL9A 4MXWH 3EYVA 1N7MH 3PWPE 1CYXA 3L17A 4OH2A 4ZMVA 4PFEA 4X0NA 4ZUSA 3L81A 2XPGB 4XAKE 2O6PA 4EN2A 4FLHA 4R4FH 3EYUL 5H94A 4XP1L 1Y18A 4H8HA 1ZK5A 3DHPA 5AL8A 2DDQL 2OJEB 4X4XA 5DMKA 3BP7A 3HNTL 4OF0A 2NCMA 3O3UN 4KMLB 3FTUA 2OTPA 4A6YH 4OF3A 1P7BA 3FQRB 1A9EA 4LEBA 2FO4A 2BZ7A 1DJSA 1RJYA 4PJEA 5KSAC 3OKKB 3VGAC 4FQLL 4L1DA 3RWCA 4Z7WF 2XN9E 2V2TB 4NEHB 4NRXB 3VQMA 3BGAA 1JK9A 4S0TD 3SQBA 5GHWH 1X7QA 1E9PA 4XNQA 4KUZH 2IQAA 5AAWC 3RIAK 3WTXA 3WTWA 5F1NA 3F85A 1RJLB 2D2CC 4X99B 1VZIA 1CICA 2IGFL 5KJ4A 2ZYRA 4ESKA 4CBPA 3JBG7 1ZTXL 5BS0B 2UXGA 1OAUL 3RI5K 4B9JA 1BQLH 3MNVB 4U1IA 4DEUA 2MPAL 1M53A 4GRLA 3ROOA 4GG8A 4FDWA 4UCFA 1OV8A 2YJQA 4E9SA 1A2YB 5F97E 4H25B 2AVFA 2ZYSA 4LKCB 1WFTA 3A6OA 4UNIA 3FC8A 2V2XA 1TQCC 1AGBB 5I1AB 4PLKC 1NAKL 3VFPB 3L3JB 4U6HB 3R06A 3HJ0A 5G4OA 3HUJF 5HYSB 2PW2B 3FFDA 4GP4B 1KACB 1NMAL 3GHBH 3LKRA 3NCWA 3MODL 3BP5A 3N42B 5D2NB 1I75A 2IH9A 4JRYD 5E9NA 1PQZB 1PNDA 4UANA 4H7VA 2JV6A 1QEXA 3VSTA 2C9RA 2H26B 4NLHA 4QAMB 3QR1A 1FYTA 1UOLA 1W6WA 2J1ZA 4HBCH 4HEME 4PS7A 4BHUA 3U4KA 2BSTB 3M07A 4M8UA 4XXCA 2BC4A 4LSRH 2VUKA 1DDHA 1XF2A 4HUCA 3QK0A 4OIIH 2UVFA 3BP6A 5E6IB 1GA2A 3UL4A 3MNMA 1NIFA 2YZ1A 1A4AA 5C0EA 1YEJH 2P4AB 3NIDF 1HWHB 4IJTA 1EJOH 4JVWA 3POHA 4DCQB 3APFA 5E5MB 1ES0A 3ARQA 3V0VB 3FQXB 4X6EB 4FOMA 1RU9H 4RISH 5E5UB 4LP8A 1XIWD 1DJZA 4WKXA 1LVEA 4J3SA 2ITCB 4B53A 4ZMZA 5HI5C 4JHWL 3N06B 2R15A 2YGVA 1UZ6F 4MYWB 2V7NA 3INUH 5DJ8A 4AGNA 1BZEA 1JMXA 1Y6KR 3QPQD 1A9BB 4OFKA 1S8DB 2NUTA 1FNSL 4JM4L 2BWIA 3VFOB 3K4DA 1N7ML 3JWNC 3QQ3A 1NDMB 2OMUA 5L88H 2F5BL 2GIXA 1EJ8A 3MBXH 1GGBL 1CLOH 1YMMA 3ZTNL 4YHKL 3V6FA 3BPOC 4KBPA 3CFDB 4X6DF 3VWKD 2G2PA 3ZYJA 4Y4FC 4YLCA 2WYHA 1RK0A 4AW7A 1CDJA 2XYBA 4WDIA 2YMTA 1JFQH 2VXSL 2X4PB 4U1GC 3SYCA 3RDTA 1OAXL 4TVUA 2VDNH 5C9JA 1WT5C 4OD3L 1KBWA 1ZHKA 4HZLB 4WI8A 2YN3A 1JYXA 1HI6B 1IZKA 1GY2A 4UNVA 5KSBF 1G7IA 3FPYA 4F58L 3B2VL 3FTSA 4MDIA 2V5RA 5BVJB 4HJSA 1SBBA 3TGXA 2N1TE 4FGMA 2AJUL 2MQCA 3B2UC 4WFGE 3RTQC 2HTLC 5BO1H 2OMYB 3N1MC 2QR0B 1DQKA 3PWUA 4X6DE 3L13A 1E5AA 4FNTA 5T5NF 1LTXA 2IGFH 1WBYA 5HDBF 2YEVB 1FPTH 3F83A 4N0CC 5CU9A 1D3CA 2UWEB 3F58L 3AGWA 3KVPA 4Z7WA 2FJHA 3SPGA 3TWCH 1JWUB 5FYKU 1TQBB 5IW3A 4YSRA 3O2VH 1AY1L 3IDIA 3KWTA 4AEIH 3BDXA 1GAFH 1FFPB 2FLBT 1RZJC 3WOVA 3D07A 1TKWB 2ARJQ 1BXAA 4HKJA 5F9WC 5CLWA 5IQ9A 3HPJB 5HD8C 3ESMA 3IF1B 2H0JA 1Y0LB 4BQ9A 3CH8A 3GHBL 4BE6A 4AYFA 4G1MA 5D7IB 5DJXA 1WCBB 3KCPB 2YPVL 1P6FA 3BLPX 5GISH 2EXWC 3K6FA 1Q1JL 3P30H 4PWFA 3BUBA 3K8LA 4NI6A 1S7XA 1U93A 4NO5A 4HBCL 5LWYL 3ZLQC 4N2LA 5EOCH 3T3PE 4LEOA 4FQPA 2UY7A 1OWWA 5T5FA 4Z7QE 2P7TA 5C86A 4U6VH 4P2RE 2HJKA 5EA0L 2GY5A 4LPYA 1J1PH 4XWOC 4IOSD 2B7DT 5G2NA 2OCJA 1QEWB 5F1IA 5IW6A 2X70B 2UY6A 3LRLA 4N2EA 5HPMB 5KVFE 3PP4L 2G5RA 4K94C 4L8SB 2X4OB 4RGND 2D7QA 4FQHB 4H4NA 3W39B 5I0YA 5EO1A 5I15L 3WMPA 1UOWA 4RNRB 1IVLA 1MFMA 2F18A 4RZCA 1MELA 3BH8B 4NM4H 2PWGA 1D7DA 5EU6E 5F72S 4LCCB 4LSTL 4J4PD 5EEUA 2O5NA 2EDEA 3X2QB 4TVPH 4EIUA 3WKYA 3QCVH 2E6JA 2F5BH 3ZTNH 5CJXC 3NA4A 3I85A 3UZQA 3BRGC 3NCYP 1J11A 4WI7A 3GS7A 2Z65C 2YSSA 4PG9B 4JMNA 4LLYB 4H1LB 1TU2A 3SGEI 3KPLB 3FUNA 5TDOA 2P28B 3VXRE 1MPAH 4DGYH 4JFXA 4ZMQA 3MJ9A 2A9BA 4GFXA 5C0IB 5EU4B 4KK8D 4DGIL 2VH5L 4LKXB 4HOMA 1KLGB 3LNGA 1RZJL 3BVVA 1AXSB 2DQEH 2CKBB 4PCSA 3JTBA 4LLYA 3DIFA 1CK0L 1K72A 5A2JH 1CE6B 3GINA 2I9TB 2PTUA 4LCIL 2NQCA 1MI5D 2JELL 2W59A 3RRQA 1YYLH 2DRUA 3SN6N 4A67A 1XMWA 4R4BA 1AHMA 2I32A 2LT9A 5IHBA 2WLLB 1MDTA 3I75A 1Z3RA 3CHRA 3MQIA 3QWQB 5T1KA 1WGVA 5MEND 3UGXA 3S37L 2XBZA 1KCSH 5EIIA 3E9UA 4TTDC 1CG9B 1YC8A 3SKMB 5MEOA 2PN5A 3UAAA 2V4LA 4F9LA 5C0AB 4DEWA 2AABH 5EZLA 4FQCH 3MLRH 3L6FB 2EIZB 3ASOB 4MJ6A 3WUWB 2G9HA 2JK5B 4MZ2A 3WYRA 1YEFL 3AUVA 3HPLA 5AKTA 5E8PA 2LABA 1ORSA 2NY7L 4NN6C 4GKOA 5I5IA 5AOZA 5T5FH 1KCRH 2C1PB 4ZQKB 5T3XL 4DOHE 1N4XL 1YEIL 4JFEE 4OFDA 4GMSH 5H4ZA 1GZPB 1WT5A 1DBKL 3PIQA 2WXLA 2XZQL 3LN9A 1M2OA 5EUKA 4DKTA 5FO8B 5I0DA 4P5TC 3PJSB 1G5AA 2VLKB 1VCAA 4MWFA 3UTSE 1OT1A 4UV4L 4PJGA 2EIJB 4H1LG 3QRGL 4A04A 1M1XB 3N85L 3QJFA 5EC1A 2VL5A 4JFWA 4OV5B 4JPWL 4MMZC 2BIHA 1N8ZA 3QEHA 2P44B 1IMHC 4YK4B 2VIRB 3IDYB 2KZ1B 2OAAA 5IB1B 3F7YB 4A6YA 1MFDH 5B1JA 3LZPA 1L5GA 5JDSB 1CO1A 1QYGH 1WDAA 1UD2A 3ULUL 1SRDA 3OLEA 2A7BA 4KRNA 4LO9A 3BPNC 4EKXA 3BPLB 4MNHA 4Y7MA 4LAQH 4BFOA 1CDUA 4GIPD 2ESVB 2VXVH 3WFZA 4QXGH 1F4XL 2AGJH 2NZ9D 2QELA 5FGCB 2V6HA 4DKEL 1JGUL 1X5IA 3IKKA 1OARL 3QI9B 1F90H 1ZTMA 4PJ7E 4UT9A 5ALBH 2V8MA 1NCDL 3BZ4B 5LGHH 2AJZB 3MJ9L 4LPXA 3FTGA 4M7LL 5D7JA 1KCVH 4DOHB 4GUQA 2IFGA 2FJSA 2WVSA 1RIUH 2VR3A 3FB8B 1LE5B 2IAMB 2WLNA 4P06A 3I6LD 4UNTA 4UZGA 1XGYH 3UTTA 4JM2B 1L3NA 2D3JA 5ACLA 5DLML 4DK6A 2V5YA 4X4ZA 4P49A 4XI5C 1IAOA 4P3WA 1J1XH 3F7VB 1XT5A 2JH2A 4MDJA 2V37A 4TF4A 4A38A 4DHLA 2AKRA 2A6IA 4KNTA 3CSYB 4Z3TA 4JAMA 4PIBA 4UQAA 5F93C 4B60A 2VKXA 3AC0A 3EYUH 5CIPB 3O4LB 4D0BA 2JKJA 2BW5A 1KNOB 3IDXH 1CG9A 2Y6SC 4U7SA 1ZT4A 5MEOB 3TO4B 4R6UA 3LKOA 1VACA 2C26A 1MLBA 4OLWL 4UB0L 3QJTB 5KYUA 5EUOE 1SM3H 4L5FH 5C0JB 4ZS6C 3C08H 3RVTD 1RVFL 2VDQH 4RETB 5AVXB 5CWSA 1CTOA 2IVFC 3VCLA 3PWPA 5AFAA 1J8HE 2AABL 2OP4H 1ID5I 4PLJC 4TSBL 5FLVA 3A4EA 3SY6A 3NPZB 2ADJA 2J7LA 5B22A 4KVCH 1KTCA 3HLKA 5AZUA 2JJTC 5GS3A 2AEQH 2E56A 4AQ8A 4BFKA 5E8OB 1I8LA 1PG7X 1BVNT 1TZAA 3QZWA 5IMLB 2DM2A 4P59L 1GC1H 3AS0A 3QIBA 3UG3A 1WICA 1G43A 3QQ9C 4FQJH 5KUMA 2XN9A 1KT2A 3LS4H 2FNBA 5FW8A 4YBQD 4B0MM 5FV2A 5L4IA 3H9YA 1OCZB 1MNUL 2BVOB 5E2TH 4XNUL 4HQQL 1D5RA 3KPOA 3L08A 2JMRA 3HFFA 4MQSB 3U0TA 1CFVL 3QNFA 1JDDA 4JPWH 3VD5A 5T3XE 4XNXH 3V0WH 1FZOA 2ZPKH 3GXDA 1PEWA 4G6AD 4RRPG 4FTVE 4YWGH 5JUEH 1UWFA 5L2KB 3CC1A 3BAWA 4OGXL 1MFDL 2VOTA 3LSOA 2XPYA 3QUZC 5H35B 2BHYA 2WVVB 3FDWA 3QHZH 12E8H 4H8QA 4L9LA 1KN4L 1P7KA 2TSAA 2PP9A 1S7UB 3I3BA 4L4TB 4NKDA 1DQLL 4IIQC 5LBGA 2YPLB 4QHMB 1Q0XL 4Y4HB 4U33A 4I48A 3BO8A 3LNIA 3ZHNA 2OK0H 1Y7VA 4DGVL 2LW3A 4FA7B 2FHFA 1FYTD 1YQVL 4BSJA 2HFEA 2HUHA 4OCYH 1OARH 5C0ND 4R7DA 2BHFA 2GBTA 3GRWL 3O11A 4G6FD 3F7QA 3F7RA 43CAA 1LO5B 2ZSWA 3FRUA 1CXFA 1N64H 3ABMB 3X1BA 4J27A 4HEMA 3IK2A 4YFLF 4YXKL 5TDPA 1VZGA 4J1UB 5DU7A 4IJ3B 4X6FB 3BVUA 4AENA 1AP2A 2XXFA 4KTDL 2Q9OA 4JFPA 2UX7A 1XF3B 3IN0A 3NEXA 1TPXC 3BSHA 4RX4D 3S36H 1HCVA 3OKMA 4AT6A 1DO6A 1DUZA 1KN2L 4ENZA 2CR0A 1GH7A 3SB3A 5AVTB 4XOAA 5FYJU 4UTBA 3VWJC 2YPLE 1F6LL 3PP3K 4JRXE 4XN4A 3O6FD 2ARJB 4LSSH 2V9UA 2HMID 1IGML 1OT2A 3TBCA 3EJYD 3VCLB 1UA3A 5HYSG 2B9AA 3HZ3A 1H9DA 4GINA 3TJEH 1G5GA 5ECGA 2Q7YA 2VDQL 1FC1A 5FB8A 3IDIB 1N3NB 4H88H 4XMPH 5GGTA 1RZKC 3WU1A 2QPUA 3KYAA 2YGQA 2XXMB 3PP3H 4HWNA 1FFPA 4IJ3C 2WXMA 3P77B 2H3NA 3DBSA 3Q6GH 4F58H 1WD9A 2P52A 1JZEA 2I9LB 2BIPA 3E8UL 4CSTA 5ETUA 4U6XA 4MZRA 3X14B 5T1KD 1GYAA 2A9AA 4QO1A 4AMWA 1U3YA 3I02A 3V52H 1KPUB 4JO3L 1V7NH 1Q94A 3W0WE 2QSVA 3IKCB 5IMKA 4G1EB 4NN7B 1SDDA 4Z7VB 4HFWB 4M8QA 4YDIL 4A2MA 4RGMC 5D6DC 3DBXB 3TPUA 4OSUL 3OHMB 4OFYA 3GIVB 2GAZB 1U8KA 4XHQA 5KYXB 5JR1H 3KXFB 1AKJA 4WTZG 5DJYB 2R29A 5CD5C 2AXHA 4IIQB 2V33A 3P4OB 4LXFA 1FNEA 4Y9GA 4I4WB 1M3JA 1NFKA 1YEGL 4MAZA 3P02A 1GAFL 1VADB 3EYQD 1EBPA 3M88A 5D4IA 5JPMC 2DH2A 1HL4A 4OCRH 1OK8A 3QORD 4MQ7B 1HL5A 3Q2NA 1XXDC 2L7EA 4X6DA 1UWGH 4D7PA 4I3SH 4XXDA 1XH3A 2EE6A 3FONB 4OBRA 5DT1H 3FHEA 3OKEB 3QR2A 4HMDA 5GRUH 2HFFA 4F8TA 4DKFL 4JUSA 2C1OB 4KXCA 1KULA 2XDHA 4YHPA 4MZIA 1RUMH 4RGMB 1N6UA 3L5WA 3U4BH 1AHKA 3RDTD 1W72B 4JG0H 2X10A 4Z7VE 3VI4F 2ZOUA 3S5YA 2P8MB 2ZSWB 3VGAB 2FEDC 2BIOA 4LF3B 4F5CA 2MQ3A 1U4EA 4MSWB 1TZGL 2JI2A 2DWEB 1RK1A 5TDPB 3RGVD 1MCKA 2WP3O 4OCYL 4UOW1 3MV9D 3WY4A 1FORH 3AAZA 5IOPB 3ENEA 3MYJA 3MV8D 1XVSA 3ARFB 4O02L 1UJ3C 3KPSD 3MOQA 4LVOC 4ZFQA 4JKNA 4ENEC 4PJAB 2KS0A 3EKCA 1R5WA 4R7NB 1NCBL 4LRIC 2DQFB 3W5NA 2NYZA 1MH5B 1PPIA 2B0SH 5C1MB 4LGRB 1PZUB 1EDHA 1MEXH 1Y0LA 3BVNA 4JCWA 4FA6A 1VFUA 2XXGA 1AJ7L 4XMKH 3RTLA 3WFHB 3DKHA 4AVJA 5D1ZC 3QDMA 3NK4A 4P5SA 2A83B 1MSPA 3NDZE 4MAUH 5HYSA 3RPBA 2FATL 4HDIB 1AO7B 1JCKA 2G3NA 2XTLA 1KSRA 1UM5L 1QZ1A 4EOWL 5AKVA 1RZFL 3O6KH 4MCYA 1E65A 4HV8B 5FGRA 4PW4A 3LZFH 5J57B 3WJLA 5C0NC 4Q56A 4YDKL 5B3JF 2VDOL 1QFOA 1VGEH 3SBWC 1SN0A 4EZLA 1NWPA 3BEWA 1HXMA 4IOIB 3WUZA 3CC5A 3CPUA 1LK2B 2Z34A 4L0PB 3S96B 2WPGA 5IM7B 1TJIL 2BJMH 5TF1H 1F4WL 4QRSB 5FA3A 3WBDA 2WWNA 3V52L 1JPSL 2CLVA 4HIXH 1MN4A 3IAGC 4IGBD 4N9GB 2LU5A 2YMXH 5J89A 1VADA 2D7TL 4JFDA 3KYOA 2ICWJ 4NAQA 4Y19B 5HHOA 1J0JA 1M7UA 2ZUSA 4HXBH 4OGQC 1NAMA 2VDML 3O3BB 3D4CA 2CKNA 1IO4C 3L95B 2BS71 2DLTA 4JDVA 5DZLA 3FPXA 3RG1C 3ULUE 3ABZA 3WEBA 3VW3H 2PWDA 1PNCA 1T89A 2YXWA 1A47A 3GBNL 1M3IA 2OR9H 1SDYA 2QKIA 4JO4L 4PD4J 1DQTA 4JFDB 3QFJA 1GZQA 5DO2D 2BHZA 2ZX8A 1JI2A 1GSMA 2CO6A 2PPEA 1HWGB 5KSVB 2RQEA 3U2IA 3L4VA 1DQJA 1JGEB 1FH5H 4WW2A 3T5WA 3ARVA 4XBPB 3T0AA 4KO5A 1JZ4A 5HGGS 3MLXL 3OV6A 3GB7B 4MQXC 4LGPB 4GEJA 1MAML 5GXBB 4K23H 1NMBH 1GGIL 2XPZA 3O41B 1RV6X 4MCZB 4ZXBB 4CW1A 3UH8A 3D0VA 43C9A 4WU7B 1T3FB 3WIFB 4GY4A 3VFTA 4P48A 2QQNL 3BN9D 4I13B 5HSFA 4P23B 4S1SL 2BSED 2PWHA 4PRNA 4Y4KA 3QRGH 5A16A 3DGDA 4L5FE 3L3KB 3OL2A 4MASA 1PZCA 1QFWL 1PLAA 2CG9X 1TYRA 5AAPA 3S3BB 3FB5A 5IHZB 2X53A 3IB4A 5MI0B 4B9KC 1JN6B 2W0FA 4HDIA 1ZGLP 3IXAB 4TQEL 4WU7A 4EDWL 1QYGL 4NZUL 4G8FA 5IG7B 2VLME 5HJ3B 3MMEA 5HD8D 5EU3A 5JOPE 2JTYA 3EGSA 3P0VH 4B3VA 4JLRB 4AIZA 4TPRL 1OSEA 4XAWH 3GKWH 4Z6AT 1O7SA 4FX5A 3MJ8A 3GMPB 3ZXAC 5GGUB 1NGZB 1A22B 4V1DE 4MYPA 5F7EH 3DX8A 4ONGH 1HSAB 1O7VA 2VZUA 5KYYB 4JANA 4Q0XL 3GBEA 3HBQA 3MJ9H 3LZOA 1KCVL 3B6SB 5EC2B 3HAEB 1G9EA 1OSZA 2C4XA 1XGYL 1E27B 1Q9OA 3MFFB 4E2OA 1T1ZA 4QJ4B 1EEZB 1TEFA 2O61B 1HIML 3QC5X 5E2VH 2HT2C 3DUSB 3WNJA 2CGZA 3AACA 4Y5XC 1GKEA 2OJ1A 3L3OB 3WJLC 1OTSD 3OC5A 2AZAA 2B4CH 3PHAA 4HIPA 4PJ7A 2R23B 4ZO9A 5AWNL 4QXTB 3W0WB 1JPFB 1QLFA 5FKAA 4PJIF 1RULH 4NZFA 1TT6A 2WMPB 3QO0B 3ULVL 2LU7A 1GY1A 1MCCA 2F74B 3QCTH 3PWLA 1USZA 3AU0A 4PWGA 1EXHA 3GBNH 2DJ4A 4OLVH 5E9DA 2G2RB 3RU8H 5KJ7E 1BZ7A 2AJXH 2DQIL 3UEQA 5IWLC 1MIMH 1Z5YD 4YBLC 5L2KD 2HVJB 2OP4L 3FT4A 3WMSA 4HWBL 3D39B 3CD4A 1OP5K 1KV7A 2WZPD 3PREA 5CMAB 4HFUL 4X9HA 1FQ9C 5SWSB 1S7QA 3RHWK 4NRYA 4N2MA 4UM8B 3HZKA 4XMLH 2AJZA 1HXYA 3OWRA 5DS2A 4G8GE 4KVNL 2ESVE 4I77H 5BW7C 4NN5C 1A6TA 1JGLL 3V9FA 3BAIA 1T1YA 1T4KA 2XZCH 4WGKA 4I2XA 1S7RA 3ME0A 3MN8A 4PJFA 4EBQH 1JZ5A 2WXHA 4U0QB 3S3PA 3QIWC 2W60B 4G7YL 5HHXH 3KLHD 2VT0A 3O9WB 1OCCB 3QAZC 5SWSA 3TFKD 4MJIA 3VAEA 3K8KA 3FHAA 4P46C 3R0NA 4G8IB 4OBSA 3QUXB 1QMUA 2VMEA 5FWRA 2X4RB 1WITA 4HEPA 2VZVA 5GGTH 2X2JA 5E95B 2A6KA 4RMVA 3FB7A 2K3TA 5T3ZD 1OAJA 1P5UC 3NA9L 1FNGA 1T04B 5I17B 5IFAL 1MXGA 4D0DA 5CEYB 4KJWC 1NLBL 4J1UA 4TNFA 1T0MB 1KN4H 5F6HI 3LHPL 2JB6B 4NNPH 4JFPB 4PJGF 4HU8A 1I3GH 3SE4A 5KSAB 3DRQA 4IBUA 2VQUA 3B9KC 3WDHA 4ZOEA 1EVUA 3C6LC 3F12A 3ZZLA 1PAMA 1VJSA 2EUWA 4WWPA 4AIXA 4Z0XA 3QB7C 4KFMA 1SMAA 3S5LA 3BGMB 2W8CA 5EULV 5FKPA 5MENB 1FGNH 4G80A 5CR1A 4MJ6B 1Q9OB 3X1EA 3VXMD 3LKNB 3DGCR 1ZHLB 1PDKB 4PJ9D 3VXPB 2R8SL 4ZPTA 4JGUA 3MRKB 2KPNA 3ISWA 2AQ3A 4P5RA 5HVGB 1QWNA 3JUYA 2PCXA 1BD2E 1Z9LA 3ZYZA 1BZDA 3LNDA 1AS7A 1FNHA 1TR7A 1U3HB 3CVIH 3GO1L 3BHBB 4QCIA 3R18A 4G11A 5BMFL 4HUUA 3MNVA 3EGDB 4N2FA 1WAAF 5CEXA 4LPCA 1AIFA 2BSRB 2AJYH 1NFAA 4OAWB 2B1OA 3GTNA 2H2PD 4QTHA 1L9QA 4H25A 5D1QE 3FL7A 3VXPA 3K74B 1B4TA 4AGPA 4TQ8A 5H35A 3HC0B 3QE5A 1IGMH 2AQPA 3F7LA 2GTQA 3AXHA 5DJZA 3AM8A 1A21A 4H20L 3JV4B 5EH1A 3TJEL 4NBZB 3H6JA 4PJ7F 3DVFA 3QUHA 2DQJL 1ROCA 4U1NB 3BN3B 3MTRA 1YNTA 1O9ZA 4MQXD 3EOBA 3BP7B 3PNRB 3BSGA 2EDWA 4PAZA 4JDEA 4KXDA 3E8UH 3U0WL 4FKHA 3FSWA 1QSED 4B9ZA 3ATDA 5J1TC 4KO9A 3MBWA 2OYKA 1ZKAA 1KDJA 1XZWA 5JZ7D 1EXGA 4XMLL 4KWUA 1JZGA 3US0A 4LSVL 4KGJA 3LKPB 2XNAB 4M6AA 1YA5A 2D8KA 4YE4H 3E9TA 4BXSV 1W8NA 1QWHA 3KH4A 5FGBA 1GYVA 1ZLWH 5CFAA 3FCBA 3MCKA 1T21A 3CLEH 4YXHL 1XF3A 3U6XA 3MOBH 1OP3H 5HDQL 2H41A 3IDMA 1J9RA 3JYCA 3SGJA 5LJYH 3MBWB 2YQ2A 4KX7A 3D2TA 3VYNA 2DS4A 3VH8B 3K6NA 1PAZA 5DRNA 3H42L 4MJ4A 5IFJA 5CSZA 3AG4B 3QARA 1JYWA 2AKRB 3I3DA 4KHTH 3NIGE 4IW4C 4NI3A 5PCYA 3FKUS 3O4LA 1DVFC 1URZA 1YMMB 3NA9H 3TO4A 1UD5A 5F7HA 2VDRL 3BH9A 4N8VA 1DBAL 2VERA 4I5BB 3UYRH 2GT9B 5E2WH 4P3DA 4K07A 4FQHA 3DETC 1PG7H 4AM0A 4KKPA 2B1AL 3UP1A 3WFBH 5C0DB 3EAKA 2EE0A 1E3XA 4YL4A 3PWJB 2HTLD 4PLNC 5LAXB 5C09A 3DSFH 1TQUA 2EDKA 4MWFB 2FHBA 1QATA 5DQDL 3QGVA 4EI5B 4F9LC 3QBTB 4WNSA 3TBSB 1V8HA 1U3HA 4G7SB 5TE6L 5BO0D 4E9YA 2OYLA 3LD8B 1KGXA 5LAPA 5ILTL 4M5YH 1I9JH 4GT0A 1XMEB 2WXRA 3KPMA 3QRLA 1ECZA 4PS3A 1JF1B 2HT3D 4HV8A 2EEDA 1ES0B 1V54B 4PRID 5A7EA 2BOCB 5CLXA 3MRQA 2C34A 5L9DL 5D9SB 2YAEA 3IJ7A 5IROC 5ELIA 3LPOA 3QIBB 3T4AC 2IG2L 2QSCL 2VDKH 2Y69B 4JRFA 2HN7A 4OZGA 1IM9D 5DJZB 2V9TA 4R97B 4P46D 4FS0A 3DXAD 4FMFA 4JY4B 4RMRA 3HE6B 3L4XA 3QQ3B 4LL4A 2OTWA 5CILL 2YR3A 5CINL 1ACZA 1CICD 2MKLC 5CP3H 4P46A 1RZFH 1KZYA 4OZFG 4NOFA 3UTPD 1WAEA 1EFXD 4XMXA 3K8MA 3WEMA 4OCWH 4B9IA 1ACXA 5I26A 1U3JA 2XC8A 4K3EL 3HB3B 1EMTL 1NPUA 2ZP9A 4L9LB 1QBAA 4FERA 4RA3A 3SPVA 2NZ1A 3Q1EA 4O2FA 1GPOL 3NIDB 1A2YA 1TJIH 1WJ3A 2FT8A 4N5ED 4GAYA 5I8CB 4HZLA 4PJCB 3QDME 4OV6F 4QRPB 1BBDL 2BCKB 4R7LA 1KNOA 3MJ7A 2YAHA 3B9KA 2Q2LA 2XQ0A 4RZKA 2KT6A 5KSBA 1RHHA 4A2HA 2EE3A 2EDTA 3VH8A 2ZG2A 5EWIL 5CJ5A 2ZUQB 4JHAH 1UT2A 2M1KA 1SVCP 4IHOA 4DFIA 2EYRB 4KKZA 1JNJA 3CXHJ 3DMMA 3EUDA 4OFVA 3BN9C 2OV0A 5EZPA 3FT3A 3STZA 1CE1L 2EIZA 3HUJB 1F86A 3QFDB 3VW3L 3PQYA 4P2CG 1ZD6A 4DO5A 2YUWA 2XWZA 1QRNA 4HIHA 4HF5H 4QRFA 4I5BA 3CDGA 4RMWA 1ZS2A 2OL3B 1W0YT 3QO1A 5FHAH 3U1SL 3E1F1 3IDUA 4B0MB 2WCSA 4EF3A 3GUTB 2VR6A 3CFMA 3G7TA 2OSXA 4N2BA 1CLZL 1R3KA 4RSYA 2R69L 3RIKA 3T3PF 3EFDH 3G6DL 2IFFL 2VR9A 1JS4A 3BIAX 3FSAA 3IXTA 4L1SA 4XCCH 5CAYB 4N2AA 1FI8C 1U8HA 4HA1A 1AANA 3KG5A 4NIYE 2IV9A 2XVLA 4QRSA 5FA3B 5DO2C 1A9BA 5AG8A 2DMKA 4PGBA 2AI0L 5T1LA 3SJVE 5JHDD 1FFQA 3AZUA 4ODVL 3EJYC 1LYQA 2VIRA 5HGHB 2XWEA 1J10A 2V5SA 2VLMD 4BFRA 4QO1B 3D4GA 3BJLA 2FIKB 3LRSB 2QQNH 2N59A 4R9HA 3VI4A 3SOBL 5L4FA 3SDAC 3BQUA 1SYVA 4GW4B 2MNUA 1KPVA 1NA8A 2AXGA 3GXTA 1UB5A 3IJ9A 4G3YH 4NQQA 3GRGA 3U30C 2ICWI 1XCQB 4W70A 4K9EC 3IFOB 2WKLA 3PWNA 5DVPA 2KZBA 1BG9A 1NSNL 1TVBB 1XDTT 2AQSA 4OB5H 4PWEA 1IGYA 1YEKH 5IVOA 4IGBC 4LASL 3ZU8A 3GXPA 4ONOA 3OXSA 4KRPD 3EYSH 5D7HA 4IDLA 5GIRA 1HKLL 4M93B 4M1CC 2CA3A 2WINA 2IH3A 3OJDA 5C08B 3UPRA 3C5ZA 2DYPD 4NN6B 4RRPA 2H9GA 4HWZB 4C47A 4Y4FA 1R34A 4TPRH 3DDFA 2R2HA 1TDQA 5IROA 1EO8L 4ZNCD 4P9MH 3WKMH 3L3HB 6FABH 2Y5TA 5F7EL 4QTIL 2J20A 2EH8L 3D06A 4JX0A 1JPST 4UT9H 2A9NL 4BELD 4LU5H 1RHHB 1S7WA 5J11C 2IJ0C 2Q8BL 2N3JA 1UYWH 1M7DB 4PYHA 1PLBA 4NQXB 3L5IA 3ZTJH 2FGWL 4G6AC 3DURA 5FYJH 1WTGT 4OGAC 4MFHA 1NBQA 2GPZA 4R0LB 1ZA6B 1G7MA 2EKSB 4K3HA 1UM4H 4R4NC 1BHGA 3V10A 4XMTA 4L1BA 4LSUL 1N59A 4A7UA 3WE1A 4PRIB 4PJEF 1E28A 2ATKA 4GG6A 3T65B 2B77A 4LHJB 4WSGA 3GRBA 2K9UA 2J4WL 4YBQC 2AJSL 4O2EB 5AWNH 1JD9A 5C3LD 3LYRA 1UUNA 2OMXB 4I9WE 1RULL 3MXWH 3OJMB 2ZOWA 4R90H 5E6IC 1IZJA 3VXUE 1Q90A 1ODAA 5H2BA 3C75A 4XBEH 5LNDA 3TEXA 5FOBB 1ETJA 4GAJL 1T1WB 1MIML 2GI7A 4WEEA 4IBLT 5INDA 1WHPA 1U58B 2CJUL 3SE8L 2L7UA 4M1GL 3F7YA 3FUEA 4JY6A 1CLZH 4BZ1A 1L6PA 4UQ3A 2IFFH 2CBTA 2C9SA 3VXOA 4P2YA 5GZNA 1HT6A 3JWDL 1JGLH 3PY9A 1NEZG 2WLJA 4TUKH 5CEZD 3LN5A 2XLLA 4A6YL 4LHQB 4EUPH 4IOIA 1MWOA 1D6EA 3Q7JA 1DQVA 4K7PL 1RIHL 2Y9RT 4XP5L 3T2OA 1PFOA 4I1NB 4XPBL 1CFTB 1LO3L 2VAJA 2WHVA 4UQ9A 5G55A 1SEBB 1NDGB 2Q5BA 1EWHA 5AZ2L 2R23A 3QRFM 4NP9A 3H3KA 4B97A 2MHAB 5C0CE 2GUYA 3VI3E 4LHUG 2WMPA 3NJGA 1SYSB 4YPGB 4YX2L 4JQIH 4WO4C 1YEDB 3NOIA 4I2XE 5IB4A 5IFAH 1ID2A 3QA3A 1TJMA 4K5NA 5A2LH 3UTQA 3GTVA 1RZ7H 5AYQA 3MV8E 2ADIA 2CH8A 4J3VA 1D5BB 2BNUA 2P24A 3TC9A 5CJXA 5SWZA 3KR3L 3ZE2F 5SWSE 2IGTA 4CC1A 1TZ8A 2PNDA 5LO7A 3Q05A 1Q4NX 2NZ9C 5D2LF 3QNYA 3DX7A 3OAUH 3A22A 1BQKA 1N5AA 2ZUVA 4HUXB 1HHGA 5IB2B 1B0IA 3QI9D 2A77H 2ZUXA 2BSSB 5LCVL 1K6QH 1MHEB 3KPRE 3S5LG 1MCEA 5J13C 2PTTB 4KK5D 1JHKH 2Y4SA 3O6ML 3BT2L 3VJ6A 4EN3D 2YEZB 2BRRH 4JFDD 2BOBB 3RZCC 2W60A 1T7WA 1XFPA 4RA0C 5C2BL 1DFBH 1F1AA 4AV5A 1I31A 1AGEA 3DX1A 4HUXA 3UTTE 3MUJA 1PCXA 3ZKMC 4A2EA 5GGVH 1HJBC 5ICXA 4HAFA 5E8DH 5EOTB 3VYPA 2MCPL 3LEVL 3MKKA 1MLCB 4WWKD 5BZXA 3RWIA 3V5DB 3R1GL 4ALAL 4MMYA 2WLMA 3N3EA 2NNAA 4WI5A 4XN8A 5DC0A 3B3IB 1HC1A 4QWWD 4RMQA 1QUPA 4N2GA 2FH8A 3ZR6A 3HR5A 3WCYA 3TCLA 4HOXA 3WAJA 4X0KA 2FJGA 2J3SA 4PI2A 2JB6A 1C5CH 3BQUC 4KOBA 4BSVA 3IEAA 3WFDH 2JFCA 5TDNA 1H3UA 2W9EH 2QZQA 3IDMB 5F70A 4ZMAT 3V4LA 1X5MA 3RIFK 4KPHH 3RWFB 2BNRB 2BHUA 1AKJD 2GSIA 2EDQA 1FZOB 4GKLA 2CJUH 3TNNA 3ETBF 3SGDH 3GIVA 3UYOD 4LAJH 2HSIA 4YHZL 2Y7QA 1P5UA 2KYIA 2RGSA 4FTVB 2B8OT 4BFIB 2ATPA 4X0KB 1KEML 5EORH 4XBMA 1JZFA 3PG2A 3HS0B 4OZIB 4L4TA 3P9MA 3MO1A 2FWOB 3EZ8A 3ARRA 4MNGB 4BV1A 1UXWB 3CVHL 5E6ID 1UCBH 4P5KA 4XRCA 5BNXD 3N5AA 1Q9LA 2L7JA 2XN9D 3RX8A 1IFHH 1S9VA 3CZJA 3E38A 2XQBH 3NSXA 1AQHA 1Q72L 4Q2ZB 2CLZA 2FYYB 1DVUA 1DEEB 1M6OB 4OD3H 3RWGB 2CR3A 3QEGL 5D2NE 3BGFC 1MAJA 5IFHH 2HT3C 1N67A 5BO1L 3ZVVA 1NCAH 1SBSH 2C8NA 3M86A 4WWID 5I66A 4IOFD 3JZYA 3PE9A 3WD5L 1KT2B 4BD4A 2EVIA 4TNVF 1E3ZA 4XWGH 4KKLD 2OMWB 3ZHDA 5D1ZI 4JDTH 4QOKE 5H37G 1H3TA 3PGFH 1ZLVH 2KZWA 4P2QE 2E7DA 3C2AH 4PP2B 2ARJA 5DK0A 5C3TA 3RIFF 3RKPA 2DIAA 3BLKA 1N5AB 1KY7A 3IFNH 3P9LB 1HH9B 3EHBC 2VN6A 4RFNB 3TVMD 3T6XA 2OX5B 5DUML 3B5GA 5LN4A 3K3QA 3K5SA 3ML9A 3PWLB 3QNZB 3ZDZE 3D25B 4H40A 3UJJH 1JF6A 1U42A 4GBXA 5BS0D 2I9TA 2Z8VC 2IANE 3O8XD 3RP1A 2YPLD 1ED3A 4XVTH 3T8XA 1N9PA 1C5BL 3ECWA 5KSUB 3PWVA 5CBEA 3T0EE 4KGLA 3O8XB 1YJDH 4WO4A 4MDJB 1KJ3H 2CRMA 3FSVA 3KYMA 2BP8A 1JHKL 3OB0H 4BRVA 4LCWB 4DIXA 3F7KA 4PI0A 5C92A 3HG0A 4U6YA 2F7OA 5BV7C 4YHML 1CL7I 1AI1H 3GD1C 2R59A 1FSKC 1BVZA 3L5XH 2F53E 2XWRA 4J4PC 4MQTB 4NQEA 5GGVL 1CD8A 3ZMRA 2CE6A 5EBGA 3HEIB 1AG6A 3D9AH 2KBGA 3CWGA 3NCFB 1U8NB 4J8RA 1WPCA 4PJCA 4WEBL 2DEWX 4RH4A 3NJKA 2NY1B 2F7QA 3QZPA 1JGIA 5EIQA 2AK1H 1WWWX 1U95A 1I8MA 2YBGA 1JUFA 4HD5A 3SKNB 3QJZA 3U0PB 1I1CA 2AMUA 1JTPA 4HU2A 4QOKB 1DUZB 5CINH 5L0QB 5KYWB 1LL1A 5L4MA 3DROA 1RJZB 4HGWB 2FWLB 2EXSA 1AVAA 3MPCA 4I3GA 4FABH 1SZNA 2P46B 3JZ7A 5F3BB 4U1LA 2GSGB 5D7KE 1TSHA 5I73C 4EIBA 4ZTOL 1A7NL 1LEKB 3QHFL 3GMRA 4KI5C 4PLJD 1M71B 1UHVA 3F12B 5D7LD 4TLKA 4EVNB 2F7RA 2F58H 4HC1H 4G7VH 4P4KA 5FA4A 4OTXH 2G5UA 1T20B 4PJ8D 1JAEA 3NP3A 4V11A 3SDAD 2N56A 3O45A 3QH3A 1IEAA 4JQXA 4XNZB 5I18L 1KFAL 3O6FB 3Q8CA 4LVNC 2BMKA 2G75B 5F7BA 1K4CA 3EF4A 3JWNH 4E41D 5KN5A 4Z78A 3GZOA 2HVKB 4DGYL 2NX5E 2VE6B 4X6CA 4JKMA 3TV3H 5BQ7A 4E9RA 1HEZA 2N7SA 2X3BA 3OKYA 5L8JB 1YO4A 1CC3A 2XKNB 2IWGA 1JMZA 1U3HC 4KK6D 1I8UA 4ZG1A 2QR0A 4B27A 3FJTA 1EFQA 1EO7A 1Z3GH 2BVYA 1BFOB 3NIGF 4WV1A 4AW4A 4ELMA 5B8CA 1SBSL 3VFWB 2NNXA 1PSKL 3IMTA 3MZGB 1PJWA 1BP3B 1IBZA 1N19A 3QDHA 2E27H 4TYUA 5FHAL 1U8PA 4Z7IA 1TTCA 4PJHA 3MOAL 4ZO8A 2PO6A 5F3FA 3RL1B 4JDTL 3RB7A 3JSSA 5HJDA 2J5LC 4AZ8A 3AQZA 1KLFA 1H3GA 1UKQA 3EFDL 2BWQA 4X42A 4ECNA 2DJUA 2R0KH 3HNSL 4YC2C 1YUKB 4XCCL 1EAPB 5E5LA 3VFNB 1A64A 1M56B 3HIZA 4L2YA 3HNTH 2Y1AA 4GAYB 5I8CA 4HJJH 4C56B 3NFNA 1T80A 3GMMA 3PQYE 1J5CA 1I8IB 1QRNE 4F5CE 5GGRY 1Z6JT 2CXKA 2J44A 3ARDC 1ZS8A 3C5JB 1NCCH 3TBBA 1K8IA 1DLHB 1HL8A 4O2CB 2GUOB 1R3IL 2CLVB 1CZ8L 4KZDH 1OAKL 4FFZA 4PJXF 1GJUA 3QWOA 1D9KC 4JGMA 4WO0A 1RK1B 1KTKE 2XT1B 3GSVB 3KPRB 4WTWA 5EN2A 1PLCA 2AXWA 3QXVA 1AD9B 1JNHA 1X5LA 4NFDA 2Q10A 3T9WA 5GJSL 3D9AL 3FT1A 1UWYA 2VM3A 3CVHA 4GMSL 4HUWA 3SJVA 5HGBB 3RB5A 3FYEB 1BQ5A 3P0YH 4U1HA 3VQLA 1HINL 4H8WL 1IC1A 3QXUA 4YR6A 5ABAA 3SY0B 1BF5A 3EJZC 3HBZA 2D7MA 1I9EA 2GSGA 5JXAH 4MNQB 1KGCD 2ZXCA 2VC2H 5EF2A 3RJDA 4JDVB 1N6QL 1EO8H 3DX0A 4Y1AE 4BCXA 1AZRA 4LCWE 5DWPA 3RE0A 5DD5H 4LBEA 1WZ1L 2R4SL 4ONFH 2BSRA 5JOPD 3OKOB 4JVPA 5DJ0A 2LTQB 4GQ9L 1RSFA 3PWJA 2EC8A 4PRHA 3ULUH 1E8ZA 1OOAA 4O5LL 3C6LA 2Y1YA 3BAEH 8FABB 2IDUA 1JJUA 4TTDD 1RMFH 2NLJB 1CGSH 3U30B 4GAFB 2XSKA 3W11D 1NPJA 4JFDE 1WP6A 3IMUA 1T3FA 2GQHA 4F57H 3WTUA 3CSFA 1T2QH 1JCVA 1T7ZA 3QXDA 4O00A 3DUUB 3N50A 3DVNA 3GSWA 5A16B 1MI5B 3C6LB 4GRWB 5K9JH 4K8RD 4F24A 2W0KA 3CFIC 4ELKB 1CXEA 4KDWA 1RIUL 1NANI 1OO2A 3INUL 3C5ZB 4K7FA 3AXIA 1NKOA 5FV1L 1MY7A 4FA8A 1PD0A 3SE8H 4OF7A 3QJVB 4I18A 1E4HA 5L7XH 3J8F7 4ZO7A 1P7HL 3ILPA 4Z95H 1JE6A 1I8IA 3DI2B 1BVLB 1P1ZB 2APXA 2QPEB 4RLDA 1OXYA 4PWIA 1G0DA 2PWFA 1E6OH 4F9PA 2VW6A 1LWRA 2VDLL 3FNKA 2C9AA 3P1VA 4HJUA 5JOFA 5IW1B 3UZVA 2IOIA 1BBJA 1XAKA 2OQJB 1TYEB 4LBAA 1TTUA 1OAXH 1R4XA 3ALPA 4AXWB 3CHXA 3R0MA 3S2CA 1D5BA 2BNUB 2YO3A 4X8XA 4U1KB 4XP5H 3QAZB 3C5XA 1P6WA 3PS6A 3QSKB 1E90A 1CDGA 5KOMC 3QZNA 3FB6A 5B7FA 4LMQE 4MA8H 4P57A 4L4VD 2MPVA 3FHQA 4MXVE 1ZE3C 3HN5A 5CS7A 1EK3A 2E76C 3EJUA 2FTAA 4NC0B 4ZFFB 5E1HB 3O3AA 3QVAA 3IU3B 3WN6A 5EU6D 4G43B 2XQYA 1JIBA 2CO1A 2D0HA 4I85A 5GJSH 3UABA 4QRTA 4ABQA 1B0RB 3NSDA 3NH7H 5KAQG 5E6ZA 1QLFB 4K8RC 4IM8A 5DURB 2NTFB 2YQ3A 3HUJA 4U3CA 3P0YL 2Z4QB 1AY1H 4F3FB 1LHZA 1AMXA 2A74A 1I3RB 3JV6A 4Y7OC 4PJ8A 4JFEB 1MCHA 4Y9BA 3P54A 1O6SA 1S2EA 4HPYL 4LPTA 4W9IC 3UPAA 3UTOA 2NNRA 4X4YB 1F3DJ 3VI3A 1AKPA 4G42B 1ZT7B 4N8VG 1BCIA 1MJ7L 2VDLB 4QHNA 3TBTB 3KM2A 3LN5B 2NX5D 5I1DB 2WM0A 4PREB 1AKJB 1FBIH 4GW5A 2OMTA 5FYKH 1Z9OA 3T3MB 3WNIA 4NN5B 1E2WA 1LNUA 5IQMA 2R29L 5KWYC 4YZWA 2HN7B 3U9WA 1I7UB 4PCTA 1A4JA 4MMXA 4GQ9H 4FYSA 1KIRA 4M3HA 3HW7A 4PJXB 3GGWB 5SWZE 1UM6L 4PGBB 2BVQB 2VO8A 3FU6A 3SYAA 5TH2A 3KEHA 1PZBA 4P9HL 1RFDH 2ZOLA 4Y2DA 5BRZD 1G9NL 1Q9KB 2G60H 5CN1A 5GPRA 4F7TB 1KLUA 5GRVL 4Z7OB 4G8IA 4XP9H 1WISA 3FO0H 1W15A 2DKSA 4YNYA 4BZ2L 4PV8B 2G0LA 3STLB 1CYGA 2CUAA 4DGUA 3IFLH 1X7SA 5EU7C 5FYLE 3T09A 1C8QA 2ZOLB 1JHTA 4Y2DB 3ZE0B 3QNYB 2Q8AH 3ZR5A 1MIEH 4FFYH 4PJ9A 2BSSA 2VXUH 1GL4B 4NLAA 4YDJA 2IH1B 3WNOA 4Z95L 3CZEA 3RGVA 5B1KA 2YA1A 1MLBB 4P23A 1IGJB 3OD3A 1JTOA 4M6NL 4PS8A 5I8EA 4G8GA 5TQ0H 4WNJA 1KB9J 2A0LC 3S97C 5J3HD 4XC1H 3NCYS 4Z7QF 1JXKA 2VQTA 5DJ6B 3UCRA 2J43A 3P9LA 1V5JA 4NRYB 5E6YA 3SO3B 3MLVH 2WANA 1NM9A 1Z0NA 2L0DA 2NY4C 4CADA 3D25A 1Z2KA 1P4UA 4I18C 4JO1H 2P5WE 2WN2A 4JZJA 1T66C 3BC9A 5GHWL 4WVRA 2XVGA 4YHYC 1ZE3H 1R6VA 5BS0E 1TETL 2AF2A 2ETWA 1UT1A 5CJOL 2QMKA 3SBQA 3PQYD 2D3LA 4FMVA 4JO3H 4L4TE 4ADJA 4F3FA 1G4RA 2GEQA 4PB9H 2CO7B 4CADB 2V2TA 1OP4A 1XAUA 4YDIH 2DQGH 1JTTA 3AQDA 4AC4A 3HE7D 4MX7A 5AW3B 5FXCH 4E9XA 4HJGB 4C58B 4ORZC 3ELQA 2MPAH 2VLRB 3D69B 1SOXA 4PJEE 5DUMH 3RDJA 2HWZH 2OL3H 3IJHA 3JV4A 5JIDA 1A66A 4L4VE 5GS2H 1KYFA 4HCGA 1CFSA 1FP5A 1NIDA 2E7BA 3O2WH 2J57A 3OKDA 1AD0B 2YAMA 4HPOL 3WHXB 2G4GA 2CO7A 3KGRA 1AXTL 3K2KA 3P9MB 4DN4L 4BH8B 4A2GA 1OTSC 2GHWB 1CGUA 3RVXD 2ISDA 4CC4A 4QOKA 1FZMB 5FYKL 4C4UA 3JYBA 3O3BA 4XNYH 3NGBB 4KI5D 4QHUB 2Q86A 2QZ5A 3UYPB 5B3NA 3QDJD 4L3EB 2E9IA 4LSRL 4P2OC 4U6TA 1Y07A 3U4BL 5I6KA 2PCPA 3SKOB 3FW6A 4YGVB 4K0OA 2ZSVA 3BPOB 3BSZA 3NFSL 4NPYA 2XNAA 3IBOA 2IANA 4I0PC 4DETA 4JM2D 3ZSTA 5A6MA 4NO0B 1NLDH