4E9RA

Multicopper oxidase cueo (data4)
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of the engineered multicopper oxidase CueO from Escherichia coli--deletion of the methionine-rich helical region covering the substrate-binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
molecule keywords Blue copper oxidase CueO
total genus 138
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9rA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9rA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9rA03
2UX7A 4DP5X 1J9QA 1BAWA 2XVBA 1KYAA 1JVLA 3CDZB 1OE1A 3WG7B 4GY4A 3WIAA 1AG6A 4E9VA 4F2EA 3WKQA 3X1GA 3WNJA 3OMIB 4HAKA 4DPAX 3QPKA 1CYWA 4DP6X 3T6ZA 4G71B 4CSZA 1JZGA 4NERA 3UACA 3T71A 4KNTA 3TBBA 1RKRA 2Q5BA 1DYZA 3NJHA 2BWDA 1J9SA 1TEGA 2TSBA 3CVBA 2XXGA 4DP9X 1OE2A 1GR7A 2MRYA 5I28A 4N8UA 4AX3A 2IDFA 5EHFA 5B1KA 1AR1B 2BP8B 2N0MA 1NWPA 3T6VA 4A2EA 2DV6A 3ZDWA 2VW7A 2CCWA 2JFCA 4X4KA 7PAZA 3HEIB 3FYIB 1ZIBA 1WA1X 2PP9A 4GP8B 3NJKA 5AZUA 1IUZA 4YSOA 5ANHA 3SQRA 1AG0A 3NJLA 2QDWA 2PPDA 4UF7C 2QDVA 1GS8A 3IN0A 3D12B 1MG2C 3RYMA 3UABA 3X2QB 3NYKA 4YSDA 2AFNA 3QJSB 1JZIA 1AANA 1BYPA 2CJ3A 1XB3A 1NDTA 1NIFA 2HX9A 3BVDB 3HB3B 3FU9A 1SHWA 3IE9A 2QPEB 3PAUA 1AZRA 1V54B 1T5KA 1NTDA 4DPCX 4YSRA 4E9SA 2H3XC 4F7KA 2HRHA 1RZQA 4ENZA 4TXVB 3NP4A 1OCOB 3CVCA 1GYCA 4M3HA 5I6NA 4YVNA 1PF3A 2R7EA 2FT7A 1GSKA 4P5SA 4JKNA 1B3IA 3X1NA 4A2GA 4WKXA 3WKPA 1N68A 2BW4A 3ASNB 1L9TA 2IDQA 3PAVA 3FS9A 2AZUA 2BP8A 2YQBA 2GIMA 3TBCA 1JVOA 1JZEA 2BP0A 2YAQA 4E9QA 2P80D 2LLNA 1KDJA 1SDDB 3UGEA 4HCGA 4YSUA 4KO9A 6PAZA 2HRGA 1PZBA 3PXLA 1GS7A 3AW5A 1AZBA 4HZ1A 4BWTA 1E67A 1ZIAA 5I5MA 5E9NA 2BW5A 3FQ2A 2JKWA 4HCFA 2UXVA 1ASPA 5B7EA 3WI9A 3S8GB 1WA2X 4A2DA 3S8FB 5A7EA 1IKOP 3GDCA 3DKHA 2I7SA 4MFHA 4YSEA 3NSFA 1IC0A 3T6WA 3ABLB 4BWUA 1ASOA 3PPSA 3TU6A 1JZHA 4DP8X 4AKOA 2JXMA 2OCCB 4HALA 3FSAA 3ASOB 3H4FA 1AS8A 1OCRB 4E9TA 3FPXA 3U25A 3NJNA 3AG4B 2EINB 2QPDB 2FT6A 5PAZA 4NB7A 4Q89A 2I7OA 3FSWA 2W8CA 1ASQA 1R1CA 4K9JA 3JT2A 4G7SB 1L9RA 2GC7C 1BXAA 2GI0A 1AOZA 5D4HA 3QJUB 1KCWA 3SBPA 9PCYA 3IBOA 4GXFA 1HFUA 3S3CB 1E5ZA 3QJTB 1ILSA 1GW0A 3KW8A 1V10A 2DY2A 1A3ZA 1NPNA 4E9WA 1IBYA 1E65A 1JERA 2IAAC 3DTUB 2YAEA 3X1BA 1F56A 2J57A 1AZCA 3IEAA 4YSSA 3NP3A 4HHGA 3ABKB 1OE3A 2IH9A 5B7MA 2OV0A 2VW4A 2CALA 4DP0X 4A67A 4KO7A 1AAJA 4BXVA 5TK2A 4UANA 2XV0A 2FQDA 3FQ1A 2P80A 5I5IA 1A4BA 3UAAA 3MX0B 2BZ7A 2IWKA 2VMJA 3WNIA 2IDSA 2XUWA 1URIA 1TEFA 4DP1X 1JZJA 2HX8A 5AKRA 1GY1A 4KO6A 4JHVA 2HXAA 2EIKB 3NT0A 2PPCA 3EF4A 2FQGA 1AQ8A 1MZZA 4L0PB 2Y69B 4RH4A 2BWIA 5I5JA 3X1EA 2RACA 1KBWA 1XB6A 3EH5B 3H4HA 2BP0B 1N70A 4A2FA 2PLTA 5I6OA 1L9QA 1M56B 4WTQA 1E30A 1ADWA 4GP4B 2YAPA 4NAJA 3FYEB 2FQEA 3GXUB 4DPBX 1JXFA 1W8EA 4DP7X 2A3TA 3AG2B 3NSYA 1OOWA 1OV8A 2XYBA 2YXWA 1M57B 4AKQA 2B08A 4F2FA 2IDTA 1J9TA 1BQ5A 5I6PA 2NRDA 1PCSA 1UATA 3V9CA 2I85A 1A4CA 5B7FA 3FSZA 5LDUA 1CYXA 3TA4D 3OMNB 4FAAB 1NIEA 2AZAA 3UADA 3EHBB 2BHFA 2AANA 1NICA 3N55A 1OCCB 3OQRA 4FA7B 1WS7A 2B3IA 3FU7A 3NJIA 2H47C 2XU9A 1JZFA 2XV3A 1ET5A 1X9UA 3SBRA 1PZCA 1XMEB 1NIAA 2VW6A 3DIVA 2J55A 3ZBMA 2VSKB 4E9XA 2FNWA 3AZUA 3ZX1A 1ET8A 1MDAA 3ERXA 4G70B 1J5DA 4PCYA 2PCFA 2PPFA 4YVUA 2WO2B 3CG8A 2BZCA 2IDUA 4YSAA 2ZONA 2E86A 4KO5A 3X1FA 1JXGA 1RZPA 1AZUA 1V55B 1NIBA 4HHWA 1A65A 1L9PA 1AS6A 1FFTB 2ZXWB 4Q8BA 3H56A 3MBWB 4BWWA 3OM3B 2DWTA 4E9YA 4YSCA 2YAMA 2EILB 3L45A 1SFDA 1WA0X 1ETJA 1PNCA 1ZV2A 2VSMB 4JHUA 4YSQA 2MTAA 2FT8A 5F7BA 3PLYA 2IWEA 3NJFA 1SJMA 2YAHA 5B1JA 1A4AA 2XWZA 2GC4C 1KBVA 6PCYA 3AG3B 2VN3A 2GBAA 2ZWNA 2TSAA 1KCBA 2YXVA 1PZAA 3FSVA 1DZ0A 2DYSB 2XX0A 3NJGA 1BXUA 4GYBA 2H5UA 4BXSV 2FWLB 5D4JA 5I6KA 1PAZA 4BDVA 1XB8A 2XX1A 1VLXA 2GSMB 3UAEA 4HIPA 1EZLA 4PAZA 1AIZA 1ILUA 1M9WA 1QHQA 3FU7B 3CVDA 4QKTA 4HCIA 5PCYA 2PPEA 1J5CA 1BEXA 1BYOA 2CAKA 3FU8A 5I26A 3TASA 4DP4X 3OD3A 2YAFA 1HAUA 2WO3B 2Q9OA 1IBZA 1J9RA 1AZNA 2VM3A 5B1JC 4E9RA 1PLBA 1ZPUA 7PCYA 3JTBA 1EHKB 1QNIA 4M4RB 4A68A 3AY2A 1SFHA 3EH4B 1KGYE 1PLAA 2GHZA 1SF3A 4G7QB 5AFAA 1W6LA 8PAZA 2UXFA 2J56A 1NWOA 2AVFA 5B1BB 2IWFA 2CBPA 3AG1B 1CURA 3OMAB 4DP2X 4ZK8A 1E5YA 5F7AA 3N2JA 1PY0A 5I6MA 2CUAA 1BQKA 2DWSA 3V9EA 4BK5C 2UXGA 2YAOA 1NINA 1PNDA 1TKWA 5IY5B 3S3DB 2FTAA 4AI7A 4YSTA 2J5WA 1OF0A 3GYRA 3SBQA 4W9ZA 1GS6X 4YSPA 4AKPA 1AACA 2Y1AA 3S3BB 3PCYA 2UXTA 1ID2A 4KOCA 1CUOA 3T6XA 2PPAA 2R7EB 2BO0A 1L9OA 4KNSA 2PP7A 1OCZB 1NZRA 2OJ1A 3G5WA 3FPYA 4G72B 4KOBA 4CSPA 4N4YB 4G7RB 5I6LA 2UX6A 3ABMB 3FT0A 1SNRA 1ET7A 1RCYA 2DYRB 1BXVA 2HX7A 3CDZA 1NIDA 3NJMA 4AZUA 4KNUA 1X9RA 2W88A 1NPJA 2WSDA 2X87A 1BQRA 1KDIA 1PMYA 4GP5B 3BQVA 1ZDSA 2EIJB 2VM4A 5B1AB 4A66A 1WAEA 3CZUB 1FA4A 1MZYA 1PLCA 2XV2A 2QT6A 3EH3B 4P5RA 4A2HA 2HZHA 1YLBB 4QLWA 1QLEB 2GB2A 5D4IA 4UAHA 1KV7A 3FQYA 4W1TA 1MG3C 2X88A 1CC3A 2ZOOA 3KW7A 3QJQB 3C75A 1ZDQA 1JXDA 3QQXA 5B3SB 1W6WA 4YL4A 1JOIA 1L9SA 1GY2A 2YARA 3PAZA 3ABGA 1TU2A 3NSDA 1AS7A 2PP8A 2FJSA 2XXFA 3QJVB 5FC9A 1WS8A 1FWXA 3QJRB 1SHXA 2IH8A 3T9WA 4BDVB 5TK4A 1HAWA 4EF3A 3ZIYA 2FQFA 3IN2A 1A8ZA 1SDDA 2EIMB 3NSCA 2XLLA 1I53A 3NJJA 2HLEB 1SF5A 2PCYA
chains in the Genus database with same CATH superfamily
3WLWD 1A9BB 3ZK0A 2NY3B 5EOCL 4HXBH 4Q9RL 2H26B 1MUJB 4GY4A 1BZQK 1SEQH 4I9WD 3AM8A 4Q6YA 2WLLB 4AM0Q 4ZG1A 3DXAA 4X98B 3QPKA 3CH8A 4OLEA 4FQ2H 3RVXD 1PZUB 3E3QE 3II3A 4AK1A 2EP6A 4YHPB 5DUML 3IPEA 4NM8L 3OJVC 3B2DC 1HWHB 5HJ3A 1EHXA 2DS4A 1J9SA 1NLDL 2QLYA 3FRPG 3DX6A 1WYJA 2XXGA 5DD1L 4S1RL 2IV8A 3BAIA 1IBGH 4IOIA 1FN4A 1IGIH 3FQWB 5K1VA 3A21A 5F9JB 2YMXH 2EYTB 1R19A 5BV7C 2RR3A 2BVEA 2VWEE 2BP8B 3TYGL 3WS6A 2N3JA 4F57H 4GMTH 4ZD3H 2AJYL 3AUWB 4ZNEA 4JG9A 4PJEA 3E1ZA 5TDNA 4JKKA 3OX8A 4NUPA 5IOPB 3FQ4A 3O0RH 1HH9B 3B2VH 3QI9A 2HA1A 2C9UA 4GXVL 3HS8A 4UV7L 3GO1H 1HSAB 1YZZA 3QIBC 5F0JB 1OCWL 5DRWB 3ZE1B 2YD7A 4UUJB 1LO0H 2WUBH 1SHMA 2NLJB 3EOBA 4H0IA 4RAUB 5H94B 4KNQA 5F1NA 3DX7B 4N0YL 2WNWA 3ZW3A 3QJSB 4W9HC 3GIZL 2GIXA 5HVGB 2J43A 1NSNL 2F0CA 3ZKXC 5F93C 5HDQH 2UVEA 5LNEA 4W70A 4J39A 3FTVA 4F91B 3PAUA 2IANA 1R47A 1THCA 2V8LA 4MB4A 5HHPB 4H25B 2VDPL 3CZJA 1QSEA 1XHHA 5AW2B 4MTMA 3KYNB 4KK5C 3EBIA 1JV2A 3MLZH 3VFUB 4F37F 3E6HA 4N0FB 4ZS6C 3P3TA 4XVJL 4M7LH 2F54B 3LKSA 2YQBA 4GFXA 1G7JB 2X28A 3QIUB 2QGEA 3QZNA 4XX1G 2SEBA 3QDAA 4QRPB 5C0NC 1R3KB 3HLAB 4ONFL 4CSSA 4FA6A 3QRGL 1TJIH 2N4IA 3HHSB 4G5ZL 4D9RD 1CG9A 3ULUD 4XP9L 1T4WA 2WD0A 4OI8A 3IETA 5IB2B 2ZF9A 35C8H 4RRPA 3ZQXA 4KKAC 2RD0A 5CEXA 4HKXB 3OWEA 4NC2B 2UXVA 4NDMA 1U58B 1OGSA 4K7FA 3BSZA 4XMXA 1BFVH 3QA3B 2COQA 4A2DA 2QQKH 3O3AA 1MJ8H 2IAMA 2DTMH 3TVMD 3VRLE 4YGVB 1UOLA 2IQAB 4HK3J 2JJWA 5D9SB 4OD1H 4BWUA 4I88A 3BI9X 3WCYA 4BZ2A 1MAJA 4H20H 1TQBC 3GPEA 1E7VA 4POUB 3TYFB 2ZP9A 2VAAB 4QRFA 2JJUA 5D5MF 2A1WL 3RL1A 3UZQB 1XTLA 3PWPB 5D7LE 1DUYA 4QRPD 3RBGA 3W37A 1H3XA 4OZGA 2HKHL 3ZGIA 4AIZB 4OD3H 3QIUD 5D7KE 1ZSDB 3ALWA 4XVJH 3TPUA 4OKVA 3P69A 3ALXA 5B39B 3RUGB 3N9GL 1ASQA 1U2CA 4UU9A 4FXKB 5AYQA 2HT3D 2OMUA 3CDCA 3CLFH 5FM4A 2XPGB 2NNFA 4NZRH 4XPGL 3NN8A 3U46A 5FECB 1KCWA 5I0VA 3GKWL 3CMOL 3TLRA 4AXWA 5A3IC 3FU5A 6TAAA 4Q9RH 2YEZB 2W5PA 1E5ZA 2MOVA 4HJEA 1YYLL 3X3FH 4WHDA 5KS9E 1U0QA 3VRLF 1A02N 5HHNA 2HUEA 3HHSA 3NCYS 2NUPA 1IBYA 4X9YA 1N5YH 4IBQA 1RK0B 3DURB 5I9QB 3WUZA 1I8MB 3IPFA 2EE2A 1KNOA 4DIXA 1CLYL 4P9HH 4J3TA 1J0HA 1G7JA 3ZKNC 3UJJL 1AZCA 2DLIA 1NGWB 4OCSL 5DRXA 3SBWA 4Y7OC 1RZKH 4ATTA 2HMIC 2YPLB 5B38A 2Y9RT 2BVTA 3UG3A 5BQ7B 3A4AA 1EEYB 2WQUA 5DEZA 5C0CD 3GHBH 5C9JB 2UZIH 1AAJA 4OGXL 2XWTA 1RK1B 4MA7H 1EBAA 5GGTL 5TK2A 3LXBA 4UANA 4YDZA 2E8YA 1DVUA 1KT2B 2HP4A 5AYUL 2P80A 2JQMA 4X5XB 2MSPA 2PNDA 2W95A 2E9GA 2BVPA 2CO1A 2AJYH 3I6KB 1N2RB 3E8UH 3SKJH 2H2PC 3I9PA 3NIFE 4OTXH 4N90E 4ZFOB 3ARBC 4ALAC 1U95A 1U8HA 5F7DB 5ICZB 2AK1H 1JDAA 5AB9A 3BCFA 1HHKA 4P23A 3L3JB 2AGJL 5GJTH 3ZJAA 4YHNB 2VUOA 2WTPA 1IKNA 3ARED 4EMZA 1DE4A 2WSKA 1VCBC 1DBMH 1DUYB 4EBQH 2O5XL 4IW4C 5ERWA 2D31A 4FCHA 1RIVL 1P5UC 3MBED 3MNVB 3WDHA 5IHZB 2OMNA 1BVZA 5AOZA 2JSFA 3SGJA 5DK0A 2F5AH 3I74A 3L5IA 4L9LA 1ZSHA 4PJDE 4Y4KA 3I84A 1G6RH 5KVEL 5IW1B 2Y36H 3TZVC 2CBMA 2NY3D 3HAEG 4NNPH 4WF7A 5JQHC 2VN4A 2IH1A 4C56E 1BQ5A 3JSSA 4IJ3C 1NMCC 3GT6A 3T65A 2GJRA 1TLKA 4JY4A 4QYOA 4LESA 5JZ7C 3WUWA 1ZT4A 2EDRA 1HQ4A 3FT1A 1XD0A 3MROB 4KK9C 2WXIA 4TQHA 1WP6A 4NLHA 4KKZA 3Q44A 2YRPA 2Z93B 2AGJH 4S1RH 1MFBL 5CBEA 3MRFB 5I30L 1EK3A 1PZCA 3ZHKA 3HHRB 2XWJB 3VD3A 5SV3A 2WTRB 3CH1B 4XCYA 4AEIH 3ERXA 3UGXA 4Z7OF 1U91A 4EXPX 3BH9B 1CD1A 1DE4B 1MNUH 3G9AB 2BFVL 3JYBA 4K5MA 1LDPL 4QI3A 1HEZB 4KKCD 4YHKL 2GW5A 3S37X 4KO5A 4R97C 3QXDA 1RZPA 2VDNL 5I8OL 4LZKA 1Y07A 3MV8E 4I0PA 1JJUA 1OB1A 2AJSH 3H56A 3QR2A 3V5KA 3QG7L 4FYRA 4XOAA 3FUKA 3M86A 5AAWC 2WOYA 4KPHH 4XNUH 5FUOL 2EH7L 3NTCH 4Y16B 1EAOA 1FRGH 2H32H 2L7UA 2PO6D 5F3HA 1EVUA 1NMCB 5F7BA 4HWBH 4ZTOL 3FFCA 3JVGC 4NM4L 2XWZA 3CLFL 3IU3B 5CSZB 4HU2A 1PAMA 4WKZA 5DHMC 3LPGA 4BSWA 3O2DH 3O2VH 3K2UL 5C0BA 3TT3L 2ZOKA 1JNHB 4MYPA 3WLBB 2P43B 2LTQB 5EF1A 3MODL 1QNZH 1EMTH 5D1QC 1Z1WA 1RJZA 4JG0L 2E6JA 1QG3A 2KDGA 4ZFZA 1S9YA 3UCQA 1RJLB 3IDJB 2H8PB 3IXTB 4KU1A 1DLFL 3HE7D 4FF9A 2YLKA 1EUUA 1ZAGA 5TH2B 2DEXX 4WGWB 4ODHL 5EEZA 3HW7A 3MN8A 1HDMA 1BDYA 3HR5A 4MJHA 1KPVA 5FYKH 2H32B 2JELL 3DYPA 4N5ED 3CC5B 3ZE0B 1BFVL 5B8CB 5KYYB 3BWAA 1GH7A 4KDVA 4DEPC 1G6VK 3FQRA 4Z78B 3LRMA 3T2QA 3MSPA 1O7VA 4Z7WB 3KPSD 3SGJC 1KBPA 2GHZA 5D1ZI 5F8QC 4P5KB 3BZDA 4QYAA 4B3EA 1W6LA 3T4YA 1VPOL 4CN6A 4QJ5B 3S5YA 2OMBA 2C1PB 2QTEA 3FZUC 3VFSA 1MAMH 4AYBA 3QI9B 5D5ME 3WIIL 4NRZB 4JZJC 3D33A 4JRYB 5DC4B 1VADA 1IU1A 4R5TA 1TO5A 3CFNA 3LQMA 2X4TB 5DI8B 4DVRL 5EMYA 1E43A 5E5MA 3BEVA 1O0VA 2EUWA 2QLVB 4N87A 2J5WA 3ZR5A 1JI2A 1LP9A 4GBXA 5F9AC 1DLFH 4LHJB 3TF7C 4K7PL 4Z0XB 4WSKA 4AKPA 1AACA 1C12B 2AEPL 3SDYH 1K2DB 1TQSA 2M8XA 3H85A 3KYMA 1IAMA 1JRHH 3KPLB 5D7EA 4MCYB 3RFRA 1H3VA 1XO8A 5D2NE 2ICCA 4PJIB 1U9KA 3B2XA 3TX4A 1XH2A 3OKKA 1PD1A 4FXTA 1DO5A 1KV3A 5T1DH 4CSPA 4PJ7A 1P5VB 1NH6A 3HNSH 5I6LA 3DMMC 4JFQB 4F5CA 1A6VH 3CDZA 3U2SA 1OGTA 1YY8B 4PJ9C 5IQMA 4ANKA 3RGHA 2FJFA 3IRPX 2LFGA 3L3JA 3DXAD 1KDIA 5JPNC 1IFHL 2AQRA 2GCYA 2GUYA 2P26A 4B7IA 1D9KB 1YEIL 3G3LA 4DKAA 1FF5A 1S7XA 2XV2A 3SKOB 5ICXB 4EDXB 1PZDA 1CDJA 4OB5H 3P2TA 3ZO9A 3JWOH 4BIKA 4Y4FA 1P7QD 3BKYL 2P5EA 3CLEH 5DDHB 1MG3C 1FL5B 3FSOA 4B6ZA 1VCAA 2DWXA 1ZTXH 1OOAA 3BW9B 1JXDA 4WK2B 1KB3A 4KI5E 4Z7QF 1IMHC 2B5IC 2VDNH 3ABGA 2XN9B 3MUZ1 1ES0A 3F6IA 3SSGA 1YEFH 1XSOA 1VAHA 3MNMA 1KTJA 4ZPTA 4P06A 3ZIYA 5AAMA 2FQFA 2Y6TE 3JWDH 1PD0A 4NIKB 1XSKA 3LVTA 5BRZD 3BZ4A 2DLFH 2BCMA 5EUOE 5I1KL 1BAWA 4Q56A 3L5WA 2YBRB 1R24B 3A4DA 3WNOA 4BSVA 2FJGA 3LPFA 5KN5B 3EO1A 5CZVL 1P84J 2A9CA 1QR1B 1C1EH 3NGBB 5BRZB 4K07A 1QKZH 1I9IL 1KCSL 1PKOA 5IVOA 3ZYZA 4D9RE 4OCRL 2R0ZH 2LAAA 4HEPA 1KJ3L 3QQDA 4PRHD 2EH8L 4OGZA 4PJBB 1IM3D 4L4VA 2H1PL 4QXUL 5IG7B 3N1PC 5FFOA 1ZHBB 5AVWB 4F3FB 4LAJH 1LHZA 1G0XA 3BT2L 2UZIL 2ZSWB 4OGXH 4Q6KA 1T1WB 3LRSB 1PY9A 3F8UB 3FCUB 4N2AA 4GQPH 5DU7A 3FU6A 5JTWA 3KYOA 4EEEA 1KCVH 4B9ZA 5JHAA 3GJFH 2AJVL 4KKLC 1X7SA 3ZTNL 2XZQH 3V8OA 3PE9A 4OFYA 3PGDB 5KW9H 3Q8EA 2APTA 1YNLL 5FPIA 4OF8A 2R0KL 2Y2WA 3HEIB 5LNGA 1AJ7L 3F7VB 3IDMA 5F1IB 1AE6L 3V5HA 1ZE3C 3DLQR 4JDVB 4YIQA 2VLRB 4Z1PA 1NOFA 3I2CH 4FZEL 3O9WC 1G7MB 2C9VA 2G3NA 1YECH 4XGZB 1RZJC 2PXYC 4FULA 2PPDA 5LN8A 4PP2A 2G3MA 3GSRB 5FUZH 4WWOA 1MRFH 4WFGD 2CNZA 5CN3A 3VXRB 1T4KB 3W9DA 1IC1A 3M45A 5HHOD 5LBVA 4GAAA 1N8ZB 4JMNA 4L37B 4ODVH 4ORGB 3ELAT 5JHLL 1NUGA 3HB3B 3MACH 1JUFB 4ZNEE 4XWGH 4F92B 4AV4A 5C97A 2QVIA 1CK0L 4MAUL 3K5RA 1HOCA 2E0PA 5JLZA 3TCLA 1IGYA 1E9OB 4L18A 2VOTA 4N2MA 1RZQA 3DX0A 4PTTB 5HHOA 1UH3A 1SUJA 3T8XA 4AQ1C 4KZDL 4M3HA 3UJIL 1OSPH 3A67H 3VGBA 4YXKH 3MRHA 4FTVE 4H2AA 2D03H 3FCSB 4WUUB 5D7IB 1WAAE 2KZ1B 4FZ8H 4LSPL 2NXZB 1INQA 3US1A 5EFIB 5DJXA 3CZNA 2QKIA 2YAQA 3STLA 2VM9A 2ADJA 4Y9FA 2W07B 4YE0A 2HRGA 4M7JL 5CGBA 1M4KA 1W72H 3IGUA 4GQ9H 4BWTA 2V9QA 4EUPG 2EYSA 2R1YB 3MJ9H 1TU2B 2I27N 1TXKA 4YHZH 1MJ7L 2CO3A 4NZTL 3VQMA 2WOBA 3UBXA 3JT0A 4HUNB 3DIDA 4LCUA 4MQSB 4TQEL 5K9OB 5L2JA 3ARSA 3HE6D 1J1XH 5CN1A 5D1QD 4L0ZA 1MQKL 4X6EA 2ZP8A 3ESOA 5FYJU 3P3YA 3VCLA 2FYYB 2ZXDA 4QRAA 1IM3A 2D9CA 2CHZA 1MW3A 3QUMA 3OG6B 3TU6A 2JVUA 4GS7B 1SEBB 1MQ8A 4JL2A 4HDIA 2OCCB 1PDKB 1S7WA 3FDWA 5IM7B 1CFNA 3QS2A 5D4QA 2GTZA 4RMTA 4WW1A 2QVFB 2WXKA 2FX9L 2UY6B 3ZT7A 1U41A 2FWUA 2IWGA 4I2XE 4FZ8L 4FFZL 2QPDB 4GOSA 1WWCA 5F88A 1I7ZA 5FGCE 1NKGA 3MLRH 4G9FA 2OXGA 3O6FA 5FW6A 2VUKA 5FA3A 4CJ0A 3CFQA 4DQOL 3VYNA 3S5LA 1MLCA 1OQXA 4U33A 1TG8A 3VD9A 4LE8A 3PL6A 3UBXG 5HSFA 1GOGA 1BWMA 3SBPA 4BUQA 1RJCA 4ZMYA 2CRZA 4JG0H 5AOLA 1BEYL 3C6SA 1KCLA 4XMKL 2X6MA 1XF1A 4IIQC 3QRBA 3K91A 1JYVA 2XWEA 3RILA 2AJ3A 2VRKA 1NFDA 4WWID 4KKPA 2RQEA 1IQWH 1Q8MA 3AGWA 5EZLA 2APSA 2LU4A 5DGRA 3TCTA 2J57A 1H6UA 2JJTA 2J1ZA 4HHGA 5AL8A 4CVWA 3CZLA 1F4YL 4PJ5E 4IKLA 1I8LA 3HI6H 2X1QA 4B9CA 3RDTB 1KC5L 4LLAA 1I7TA 1OTTC 3L1OL 5KW9L 4UNTA 5HD8D 2W0KA 3OKNB 3T0BA 4AUYA 1WK0A 2A74A 4IQHA 1OVZA 3ZQ9A 5CS7A 4ZO8A 5BV7B 2IH3B 3UP6A 1I1FB 3AS1A 1KB9J 4JHVA 4CVXB 1H3PH 2XI9A 1T03L 1G1YA 1R3HB 2Z1PA 4Y8AA 4Z3TA 4LCCC 4BZ1A 3C5ZC 2R2HB 5JW5B 5CJOL 4YLBA 1HXKA 1FYHB 2J21A 4UIMA 1BEYH 2Z31B 4KXCA 4RDQF 3HA0A 5D1ZA 2HG5B 1E4KA 2VITB 4ZMTA 5HHPA 3G08B 2B20A 1AGBB 4DJMA 4HPOL 3EFOA 3FYEB 1T1ZA 1TZIA 3AU1B 3AG2B 2JI2A 4AYEC 1S9WB 5HI4D 3RZCD 1A6AA 1OZUA 1S7VB 4YNYA 1F11A 5AAWA 5IT2H 2WBJC 1EXHA 2Q7NA 4H1LH 3O4LD 1OPGH 1EHLH 1NFDB 2Y07L 3CX5K 1KXHA 2Y6SC 2CK2A 5KBMA 2IBZY 3M8OL 4MMXA 2X7LB 4AGLA 3AB0B 3MBEB 5D2LE 3BVWA 4WV1C 5FDWB 1JPST 1D5XB 1XZWA 2C7FA 2F53E 2XTJB 2YD6A 1QI5A 1AHKA 3OJ2C 4JFPA 3LNDA 4OCWL 4P57B 3BEWB 1M7XA 5E2WH 3SDAC 3EYFB 3JUZA 2NY5L 5LN4A 3M46A 3LS5H 2ORBL 3OQRA 2XG4A 2W9DL 3ZL2A 5K9QI 1UT1A 2R2CA 3FU7A 4XMPL 2Z7YA 4N8PA 5LG6A 3HFFA 3EHBD 2OTWA 3REWA 1NGXA 5CMAA 5ECGA 3VFMA 1IGMH 4O4YH 4AQ1B 1E6OL 4MLIA 1F3DH 2IH3A 4FP8L 2C1OA 4M7KH 3GK8L 3B43A 3PQYE 1IC5H 2RMNA 4YPGA 1OGAD 3VWKB 1XCTB 1AJ7H 4H13C 2YPVH 3DURA 2HPOA 1CQYA 4KI5F 1DEEA 1EO8H 4TVPL 2HJKA 4JVPA 4G80B 4HS6B 4Z3IA 1UZGA 5HGDB 3OKDB 2OKMA 3SPGA 4PP2B 1KBBA 3A5VA 1DVFC 4B3VA 3UYPB 1E9PA 4JG1H 4WI0A 3MRQB 3RJDA 4BRVA 5F9WB 4JPIB 4M62L 1XQ4A 4WW2A 1HCYA 4P07A 3MBWB 2VL5B 4EI5A 1WHOA 5GGUA 5ID0A 3LQAL 2BSSB 4OJEH 4K3EH 1Q9KB 1CTMA 3QRFM 2DQDL 3QZOA 4G42A 3AQYA 4D3CL 4CVUA 3MJWA 4Y5XB 5I1GH 2BINA 1JYNA 32C2B 2NX5A 4AYGA 4UV4L 5B1JA 1YEHL 2G4EA 4RFOL 1S3RA 6PCYA 2VN3A 2PXYD 5C0AA 2W07A 4L1LA 3D25A 3O3DB 4J8RB 2X2UA 3C8DA 2VDOH 3HMXL 4YHLH 3WNPA 2V7NB 1VFAA 4X6CA 5LGYA 1NFIB 2ZWYA 4OZGE 5EFIA 3NAAH 5HYJD 4JO1L 5DFVD 3KD4A 3CDFA 4R97B 1JBJA 3UAEA 2YKLL 1TTBA 2LLLA 3T0ED 3TA3A 1ZHNB 1AR1C 2A74C 3D2UA 5CO1A 1NCNA 4L8SC 4NZDA 4QRTB 5EU7E 4UQCA 4NSKA 3O4LA 1BEXA 1U33A 4KK8D 5B38B 3S34L 3BPLC 1DDHA 4KGJA 2Z7WA 5LAXA 4IMKA 4X5LA 1YNLH 1ZV5A 4MZ2A 1OT1A 4N2GA 4YPGB 2OMTA 1C08A 4N90D 5MEQA 4MJID 3QCVH 4F7PB 3Q3GB 5LB1A 1MJ8L 3H2WA 4A7QA 1U6AH 1D7CA 2GTZB 2AJUL 4TQEH 4WW1B 1OM3H 4HFWA 2X6VA 3V5DB 5E4AA 3SPHA 2WWMD 3ROOB 5L6YH 1EFXA 2OZ4L 2HH0L 1U3HC 3QWRA 1UUNA 3C9NA 3RJOA 3SPIA 7PCYA 5J12C 1SFHA 5I1LA 1N8OE 5IM7A 1G9NL 2DH3A 4D0BA 5E1AA 3V5HB 3R8QA 5F7EL 5D72H 5BVJB 1HKLH 1LK2B 4Y4KD 3LMJL 4H25A 3EYSH 4G6KL 1BQKA 2O61B 1IEAB 2D03L 2UXGA 2K6YA 3RKPA 4BKLB 4HD9A 2DJSA 3WTSA 4HPOH 3QPQD 4OLZL 4W9ZA 5DJCB 1EGJA 4ELMB 2ATKB 5D93B 1Z9OA 2EDKA 3ZRCC 2F61A 4HX1A 3FB8A 3G6JE 4NNYB 4X5RA 3UYRL 1V27A 5DJYA 3EIFA 2H32A 3MV01 3N3EA 4IDJL 1YQVL 3GZOA 4EQ3A 2YKKA 3Q8CA 1NZRA 2MEJB 3IFNH 4POZC 3T8XB 5I1AB 5IBTH 1RUKL 3GXTA 5HBBA 3U4KA 2WGXA 1KGJA 4ODSL 5JOPD 2WM0A 1PL3A 2X1OA 1UXMA 2EZ0C 1CE6B 3ZIMA 3KDPB 2HX7A 2CLVB 4GQZA 1JTPA 5AKVA 4PJ9D 3PL6D 4KNUA 4ZFFB 4WU7A 4LSRH 1X9RA 3KLAA 4N24A 2ZYSA 3ULUF 1BQHG 1BQRA 1ZHKA 3FU0A 2VM4A 2A9MH 1JNHA 2Z7UA 4BFEA 1PLCA 1A4KB 1U30A 4A2HA 1C08B 5EWIH 5FV1L 2NXYD 4ZMWA 3F83A 5T5FL 3QNXA 1YLBB 3FT4A 3LMJH 4ZOCA 5DFTA 5F6IC 1R6VA 3HFMH 4UIKL 3VXRA 3S9DB 1WPCA 5CD3B 4UM8A 3IWVA 2O6EA 4DGUA 3EDKA 3UTSA 3OAWA 4D8PA 1I85C 2E9JA 3EFFA 3O8XD 1YHPA 2MCPL 3V7AE 3ZPDA 4BH7A 1HWGB 4JKPL 4JKWA 5L0QB 1FBIH 4FFZH 3FFDA 3GXFA 4JG1L 5HDRA 3MV8B 4JPKH 4IM8A 1AXTH 1WS8A 3L3IB 2JJSA 4LEEA 4QXTA 1KGWA 4OLUH 1KIRA 3ZDZB 3WXWL 1J87A 3PWPE 1UM4L 3A6OA 4F1ZA 4IKKA 5IOKA 3BWAB 3IN2A 5HHVL 4G7VL 4AQ8C 4NQUA 1DL7L 3CMGA 1RZ8B 3AQXA 1A6AB 1XTMA 1S7VA 2XVBA 1HQRA 3CDZB 3U2SB 2DWDB 4N8VB 2MKWA 4PB0H 2WYIA 4TRPH 4O2CB 3UTTE 4F2EA 2LVCA 4DO5A 1FGVL 2CGYA 2EEFA 3IAQA 3OMIB 1QR1A 1JK8A 4NO0A 4OM1H 3FN3A 4HA1A 4RESB 1A64A 5F9WC 5KG9A 1FFNA 3L9YA 4N1CA 4NERA 3BWZA 4OCYL 3SO5A 1NM4A 3TNNB 1QFHA 1V8HA 4ADIA 2IADB 4LQFH 1HE8A 3SCMB 1MF2L 2MCG1 4OJYA 3PGCB 1V05A 3ARTA 3P9LA 3Q43A 4OGQC 3VNYA 3ZYJA 2IFFH 5LXGH 2VDRL 3VFMB 3FTSA 4WI6A 4JBSA 2WANA 4A2EA 2E76C 1MEXH 3VXTB 1GVIA 4J3OD 4XPTL 1FZOA 2CUHA 3RDTA 5D2NA 2CO7B 2VLLB 4IKNA 4TLTA 3GI8L 4YSOA 4PS7A 4R83A 4XPHL 5TPWL 4NI3A 4X0KA 3AXLA 1RUAH 5CLZA 5KZCD 5L9DH 4WY7H 2F6AA 2JKNA 1KACB 2FJFB 4JQVA 5ACZA 4ONGH 4GW4A 4YSDA 4XRCB 3FQXA 1DJSA 4G9FD 1BYPA 3F2LA 3QNZA 1VACB 3CBJB 1YN7B 2CK0H 1XF3B 1S7XB 1T1XB 4NN6C 4BZYA 5C08E 4ODXB 2WNXA 4ONHA 4UOW1 4HWNA 3N6YA 4KVCL 3S5LG 1YVLA 3C6SB 2DYPA 3RTQD 4XNDA 1CLYH 1Q0YL 2H3XC 3FO9B 2CA3A 1TZGL 1LL1A 3H9HB 3G08A 5CUSL 3UIZA 2P5EE 4DZ8A 5ESQB 3KYMB 3LZFL 3CQFA 3GNMH 3FCSA 4WUUA 5FHAH 3UIYA 3L1FA 1QRKA 2VE6A 4J12A 5C0FA 4XR8C 3WUWG 3BKYH 3S96A 5FO9A 5MEQB 2IVFC 4NXSA 2P7TB 3S97C 1ZANH 3PL6C 2NTSP 3MRNB 2D7TH 4W9IC 5DUJA 4FQLL 1RIHL 3CFKB 1PZBA 1QEWB 3SCMA 1EFXB 1PQZB 2X2HA 1MCOL 5AB2A 4TV3A 3W11D 1ZWIB 2K70A 4G7YH 5TDOA 4WFEE 2XNAA 5B7EA 5EUOA 3B5GA 3DSFH 1N4XH 5LCVA 1QWNA 3QEQB 2FL5B 3LNHA 4CN4A 3N1QC 4JFEA 3VG0L 3UZEC 4OZGB 2WZ0A 4AIZA 2VB5A 3SE3A 5DURD 2K7QA 3VW3L 2NUTA 2W65A 3PS6A 5GPRA 5A1AA 1XIWB 2JI3A 4AKOA 4G1EA 3UTTD 3OLIA 2VWEC 3Q13A 1E90A 1MREL 5KBKA 4P46A 3V6FA 5DJZB 3VFWA 1GOFA 1QKZL 5JYLA 5JQ6H 4NNPL 1LTXA 3JV6B 3SYPA 3D39A 4D0DA 1S9WA 3GNML 3EUUA 4RMBA 5IGXH 2FO4A 3CVHA 5EORL 1ACZA 3FSWA 1BD2B 2ITEA 5E4EB 3TBYA 2YXFA 3WFHA 5FIEA 1HHHB 1BM7A 1USQA 3BMVA 3KDMB 3NDZE 4O02B 2QPSA 4MQXC 3TTSA 1Q9KA 1NGPH 1EJ8A 5D4HA 1O75A 1OD7A 3BZ4B 4EOWH 4RX4D 4XBMA 1F3JB 4DGIL 1OKEA 5EOCH 3SE9L 2YJLA 3UMTA 4RGOL 3A4EA 4IOSD 3DNKA 2QSCH 4V11A 1RK0A 5D7JA 3R18A 3P3UA 3V10A 2IAAC 1UB6A 2IGTA 1YUKB 3IPBA 4FX5A 3QXUA 5ITFA 5EIVA 3HKFA 2ZXAA 4JJOA 1TZOA 1E4XI 4PCSA 2O30A 5B7MA 2C1OB 1LO4L 1S7SA 2CALA 4YGAB 5ILTH 1S9XA 5SWSB 5BUAA 3DVGB 1GZHC 4BFIB 1MWAA 4ODVL 5E2UH 3IDMB 3BYYA 5F1IA 1JXJA 5HHOE 2ZUYA 3D51A 4P2RA 1EZVX 4BRJA 4EKJA 1OAKL 2BZ7A 1RXLA 2IALB 2C4FU 3DJTA 4KMQA 5T5FH 1T5WA 3TYGH 2FEJA 2FGWH 1NFDE 2EH7H 3M7FB 2WZPA 3L4XA 4Z7VB 5D1XD 4ZXBB 2OR9H 1P2CA 3IJYB 1FNLA 1XIWA 1RUMH 3HIZA 5F7EH 3U7YH 3COOA 3MR9B 3QJHA 3IFLH 4HBCH 1KXQA 3TPKA 1V3MA 3BAKA 5I15L 2A73A 4L0PB 2XBTA 2HT3C 2Q2LA 1EANA 3ILPB 4QRRD 4EOWL 4UILH 1G87A 2FATL 4ODTL 3W5NA 1JGLL 2SODB 1IZJA 1B6DA 4GLRH 1BVLA 2AQNA 5TFSL 4CVZA 3V4VH 3O45B 4BD4A 4LGPB 2X53A 4FYSA 4JM0A 4IDJH 1NEZG 4FJZA 1F5WA 3KGUA 4Q14A 3BFOA 4U4BA 5IW6A 4HK3N 2Z65C 3HB3C 3ZTDC 3EF7A 1Z5HA 5F44A 4NC0B 1I1AC 2WXNA 3RB5A 4LO9A 3F7PC 3JV0A 5E9DD 3HLAA 4LCVA 2EDXA 2ZCHH 5E56A 1KTDB 1MJJB 5ITFB 3KJ6L 4LT7A 4RAVA 5IB4B 2YRZA 2CDGB 1Z9LA 4LLQA 2W81C 4WEMB 4PMFA 1CYXA 2VZ3A 3TA4D 2BIQA 1SPDA 1WRFA 4ES8A 2J8UA 1CJYA 2W0PA 3RJQB 3SE3C 4X4YB 5EA0H 1MFMA 1UOVA 4OT1L 4BJLA 5LQBH 5F1OB 3SGEH 2NXZC 3KPMB 4M48H 5F3BB 2QQLL 4YLQT 4J3WA 3SKUD 4JJHA 3MLVH 4KHTH 1LWHA 2H47C 4O00A 2YD4A 2RGSA 2ALWA 4LBAA 4UIKH 2CMRL 3VXSD 3FFCD 5L88L 3HN8A 1JHLL 2DPKA 1WTGT 1N59B 3ARGD 4EDXA 5KVGH 3T0EE 5I0XA 5DHDA 4GW4B 4PG2A 1ET8A 4HF5H 2LVEA 5AG8A 3TBVA 3G5XA 1YQ2A 1JPGB 4UQ2A 1D5MB 4TSBL 4Z7VA 4ZXBA 3HI1B 2JQAA 4I0PD 4OR1A 5I73B 4KROB 4D94A 1GYVA 2IDUA 2Y2TA 3C6LD 4XC1H 3K6SA 1JXGA 2YQ3A 1FC2D 1HYRC 3EYUL 2EDLA 3LXAA 5F0LB 4K7PH 4EZKA 2P8LB 5ICUA 1GMIA 1WIOA 2EDDA 1H5BB 3L3KA 2G2RA 2P44B 2XWRA 3IB4A 1PKQB 1ZK9A 5IMLA 4KKLD 4QPEA 4CGUB 1ETJA 2OYMA 4Z7QB 1KNOB 2UY6A 2YBRA 4IKIA 5D7JC 4BSVB 5IGXL 5C2BL 4BA0A 4YHOL 1WF5A 4E36A 3E1F1 4RZCA 3LAFA 4AE0A 1ZOXA 2YAHA 2OTPA 3CFTA 2WIMA 4HUWB 2R39A 2ZUTA 2ZWNA 1WBYB 4TL5A 4F58H 2F15A 1PSKL 3I3BA 4I3SL 5DHVB 1XF5A 3RIAF 4HULB 4N0RA 2IAND 3OAYH 4UTAL 5EOCJ 4Y5YC 3L54A 3GI9L 2X38A 4F7MA 4QT5A 3NIDE 1H6FA 2CXGA 3KPSA 5EULV 1J5HA 1M9WA 5BZZA 3VFVB 4OD2B 5AEAA 3UBHA 4NENB 3Q8FA 5BQDA 3WE1A 2QADD 1CLVA 3CJJA 1J86A 3KS0J 3BIKA 2VR4A 3FUFA 3KYOB 3VXMD 1RZKL 5JO5B 4FI7A 2XXMB 1MQKH 1HAUA 3DSFL 2X9XA 2YMOA 4NJAH 1WBXB 4MJ4A 4PW9A 1DQLH 1DLHB 1TQTA 4AW7A 1JPGA 3MA7A 4UQ2B 1BZ8A 2K7PA 2R4RL 4Y5XA 5D6CA 3NA9L 4WTZG 5T1KD 4HC1A 3SO3C 5FCUL 1FE8H 5HYSG 3ZDZF 2CCVA 1SJHA 1J0IA 4LNRA 4DT2A 1JZ5A 3L4TA 1DVYA 3GBML 5HY9A 5GXBB 5IZ7A 1QR4A 5I76B 5M94B 1EHLL 4S1DC 4R0LA 1QPXA 3VVWA 1KZQA 4KI1A 1BD2D 5CHNA 3SDCA 3CSBA 3KCPA 4GI8A 4KQ4L 3IKCB 3MNZA 4KQ3L 2FX7L 5IBLD 3DTDA 3CLWA 4O02H 2BOBB 3R8BB 5FHAL 3ESPA 2R2EB 4HJGB 1BIIA 2FTAA 1TTCA 4MB1A 4S10A 3BFWA 5GRUL 1Z66A 1DANU 4HMDA 1ROWA 3WS6C 3ZDYF 3ZDXB 2J72A 4H88H 5GGVL 4JY4B 3DI3B 4L3AA 5E8OB 4FS0A 5JIMA 3ZTJH 3PP3K 4F8LA 2EDFA 4NQDA 1AC6A 3C8HA 1L9OA 2ED6A 4DGVL 5DJYB 4Z3HA 2OJ1A 4G6JL 5TGBB 1PYWA 3ZSTA 4Z0BH 4Q9BA 3UERA 5FOBB 1TO4A 4N68A 1DVTA 1PZSA 3WFCL 2APXA 1BXVA 1FUNA 4R7VA 3QXDB 5FDWA 4LLMB 4XMLL 1DQTA 2ED8A 1VFMA 5GRZA 1U8NA 4U6YB 2W88A 4HFUL 4NN7C 5JXAH 4R4FH 3MXVL 2BWQA 4UQBA 4NKDA 2H2SD 5E9AA 5JW3L 5B1AB 1F4HA 2X3CA 5C09B 5KSAB 2A73B 4OW6A 3CZUB 1LO3H 4K8RH 3LOWA 5F6HI 4YXHH 1NBVL 1MY5A 2IALA 2EYRB 2BOCA 2NYYC 4KQ4H 4PJ6A 1MCBA 4DGYL 3Q7JA 4FNPA 2RCSH 4IMLA 4L1DA 2VXUL 1J0JA 4RAUA 4U1SA 5HVHC 5AW6B 2Z93A 4Q97A 2FL5A 3ZMEA 2XFXB 1W0VA 4G8GB 3Q6FB 4GT0A 5HI3D 4OZGF 5B3SB 2CPCA 4XNAA 1C5DA 4EZJA 3K8MA 3O41A 3R4RA 4U3HA 3SKNA 2Z1KA 4L48A 3AS2A 4AH2B 2EACA 3LV3A 4ZPTB 2JB5H 3WHXB 5CLTA 4W9DC 4BDVB 3KHQA 4LBEA 4HISA 4FHJA 5TFSH 3ZDXE 1P6AB 3ULVF 3BKML 2R2EA 4HJGA 3VXPA 4M6AA 5JIDA 4MMZC 3FRUA 4UMGA 1ZHLA 4MQXD 4JFZL 4NQSA 5T3ZE 4NQCA 5E5UB 3BIBX 5IT2L 1G9MC 2XQYA 5J06A 3VFNB 1WO2A 1HKFA 1CLZH 5F6IB 1MAKA 1U8JB 3HG1D 3MV7E 1NLBH 3X1GA 3B2UC 4HAKA 3BQUB 4O2CA 1OM3L 4DPAX 2ZCHL 3OPZL 1CYWA 3A23A 3OXRA 5DEFA 2XIDA 2V3DA 2B2XH 3U6XA 3ARDC 2BPBA 1TSHA 1NCIA 3T0WA 2YEVB 1A7OL 2V7NA 2O93L 1GZPA 2HG0A 3GI9H 1RZJH 4HV8A 5C07A 3MUJA 1DN0B 4TL4A 4NNXA 5L0QC 4Q9QL 3NCJH 1FIEA 4PJFF 3U9PH 4AJYV 2UUDK 3IJEB 1SHSA 1HHKB 2VXUH 4P23B 1GC1H 2FIKB 5FK9A 5C0AE 3K8LA 3CDGB 3AWGA 3IXAB 2PUQT 1DJHA 2X4OB 3EJRA 3UROR 4OZFA 5JIPA 3RA7H 2YPVL 3KJ4C 1XDTT 3R1GH 3ECBA 4TTGA 4HBCL 2KUTA 2XVGA 3V0VA 2B1HL 1JGLH 3UFIA 1CFTA 2YN3A 2G5UA 1L7IL 5C0IA 1BXXA 1AG0A 1D5BA 2WLKA 4XC1L 1ZA3A 3TL5A 3VXSA 3BLPX 3QAZB 2YSTA 2ESVE 1GHFL 5J12B 1O6VA 4PJEF 4ZW8A 3LQAH 1WBYA 1OAYH 4H0LC 1OF2A 1XB3A 1NDTA 3OKMA 4OFDA 1VFBA 2NY2B 4HUVB 1SBBA 5CR8A 1A7NH 1E5UI 1R0AL 1BPLB 1X4XA 4L3FA 3KM1A 4LOEA 4NZFA 5AOMA 4QRRE 4HS8L 3QZWA 3D0VB 3GUTB 1UTDA 4R3SA 1F58L 1DQJA 2FBJL 1LNUA 5IR1B 1GSKA 1G0YR 2OR8A 3P4OA 2WY3B 3ARRA 4MJ6A 5KVEE 2I69A 4K9EC 5E1IA 1RD6A 2X7LA 4L5FE 3TC9A 2D31B 3ZE0E 1MH5A 3NFNA 4G8IB 4FQXA 3KBEA 4FABL 4GG6B 5GS2H 3BEWA 3L5XH 1ZS8B 3R1GL 1WBXA 3CDGA 3RFZA 3ZXAC 5LJYH 2X6CA 3C5JA 4ERSL 3Q2WA 3NCFB 5INCA 5EG6C 3TESA 4PRNB 1WE5A 2OSLA 3FQ2A 2OAAA 3MLYL 3G6JA 3MRDA 4G5AA 4GRWF 3MUUA 4LSVH 3ULUL 2G75A 2A6DB 5J5EA 2FO1A 1Q1PA 2G60H 3A6CL 3PGFH 3S8FB 4Z8FH 1Q9LB 5AW8B 1N0XL 1AD0B 3DKHA 4PI2A 4L4JA 3IVKA 1O7DE 1TJGL 5HI3C 2DWEA 1OSEA 3PIQB 4YDNA 2ZE0A 4BCXA 2ZCLH 4GSDH 3T0EC 1H8SA 4WW2B 3DOSB 4DP8X 2OJEA 4WEBH 1QI3A 1T04B 4JPWH 2CSPA 1I4FB 1V7NH 2O1AA 1S9VA 5C0EA 2Q86B 4YC2C 4I9XA 4W4NA 3OJDA 4AL8C 5J1AB 5KWYC 4WSGA 1CVSC 4FFZA 3D85B 3SZKC 4UQ3A 3UX9B 2JH2A 4ELDA 4OFYD 3SD2A 1D5IL 3BVNB 2QSTA 4A7SA 4QHUB 1JWUA 1UOWA 2YK1H 1RY7B 3KCWA 2CKNA 4GO8A 2YFNA 4L9LB 4O51B 4P05A 4Y4KB 1R1CA 5E6YA 4LLVA 3WL9B 3K7UA 3D85D 5FO7B 2DWDA 1JV2B 2WWKO 1S7QB 3OAUL 5L2KB 2HMID 3L16A 3ZVVA 1RZGB 1HEZA 5DD6A 2PCPB 3W0WE 1JP5A 1R3IL 3Q8BA 2PR4H 3QC6X 5DRZA 3AAZB 1RZ8A 3BDYL 1KLFB 4JM4H 2AJ3B 4G6FD 2QR0A 5B22A 4RDBA 4JLRA 3BXNA 4N8VA 4XN7A 1NCOA 1NPNA 2P5WD 4NC1E 4JGJA 1NGYB 4GG8B 3N1FC 2W0FB 1N0XH 4FP8H 3NK4A 4YDKH 2X1WL 1IM9B 1F56A 3WYRA 4YHYC 5DJ0B 3IEAA 1UWEL 1JAEA 1A7QL 2W65B 1U8NB 2YUWA 1VDGA 3QHTC 2H45A 4G1EB 4RDQG 4Z7UA 5DD1H 4YUEL 1LD9B 5AWNL 3VMNA 4GQQA 1J1PH 3QFJE 2DM4A 5E6ZA 4ZTEA 2ADIA 2H1LM 3PWUB 3G5VA 5EO0B 4MRCA 3DARA 3CCHA 2WKGA 4V1DA 4AY0A 5HYJB 4MNQA 1M1SA 3C9NB 4GRMB 1NC2B 4WO4A 3RWCA 1HL9A 2WCPA 4FI6A 3INOA 1JZ6A 3FQTA 3RVWC 3W2DH 3CPLB 2BP5M 2CR0A 3IGKA 2PPCA 2IPTH 5DUBA 1GAFH 4YDLB 4PJAA 5ESAB 4DK3A 4PG2C 2VABA 3LTVA 3HC4H 2I5YL 2OSYA 1B2YA 2EDMA 2ZUVA 5EC1A 3WELA 1YA5A 3R7QA 1AXIB 4X98A 1R0AH 4H88L 3LNFA 4CVZB 3CPUA 4FMKA 3H9HA 4YXLL 5A2CA 1CWVA 3E0GA 4NCC1 1CE1H 3KPTA 5DJCA 4ELMA 2BIHA 1CD9B 4C83B 2XYBA 2YXWA 5CSGA 4Z77B 3MOAL 4NN6B 5CNHA 1F45A 3T1WA 4QRSA 1ZLUH 4DPRA 5KSBE 5DVPA 4QHPA 5SV4A 3VFWB 5GRVL 4N0UB 2YD9A 5A2JH 2NSXA 4UMSA 4PV8B 1PCSA 4QY8A 4UCFA 4JZNA 2D3JA 5EO1B 3SQBB 4MDRA 3VFPA 3QCVL 2F7RA 4ZS6D 5I19H 3L7FB 4U1HA 3EGDB 5AD0B 4L8BA 3P3RA 3EHBB 2KZWA 3QUHA 2DQ6A 3MU3A 3RX7A 2E6PA 2OSXA 3H2QA 2D9QB 4LSUL 4I0CC 4P23D 1M1XA 4JZJA 5IJVB 4X50A 4LIQE 3NJIA 3TWYA 4RWYH 3NH7L 2Y7NA 2WWMC 5JHMA 3NCXA 3MLYH 1EXGA 3BDBA 2XTJD 5C71A 1DBML 4ZDHA 4EBQL 1QI4A 4YHZL 1R9FA 2Z4TA 1TQCC 1SYVB 5HGBA 4JO8A 4IGBD 4N2FA 1MHPH 3LEXA 3U4EA 1DZBA 2PCFA 1FPTL 1DO6A 2VLKA 4FN0A 4KK8C 4WO0A 3HC3H 4YVUA 2BZDA 2F8OA 4NUMA 2BSEA 4GKNA 4DEPB 1Q9WA 3LEYL 1T83C 1OCWH 4ODUA 1B0WA 3WEMA 4A2LA 3QPXL 1V55B 1LEGA 3OB0H 1YEEH 1S7RA 1JK9B 3RVVC 4JFZH 2X2JA 3OM3B 4P2QA 4LOFA 2OXHB 3L2NA 4HIHB 1G4RA 1KELH 5IMMA 1SFDA 3GXDA 3ZUCA 3CV5A 4Z3JA 2Z31D 4OI9A 3IYLW 3DETC 4OBRA 2FT8A 3EJUA 1FFOA 3KPNA 3BT0A 4PIBA 1VSCA 4HS8H 1EO5A 4JO2H 4Y2LA 4R0LC 2BNUA 5EZIL 2XPZA 5CGYD 3ESMA 3JV5A 1U93B 3BVTA 3KLDA 5DSCB 3K3QA 2R4SL 4XI5D 1XX9C 3AMLA 1PZ5B 3MUGB 3D07A 4PLNC 5EZOH 2E9BA 3G6AA 1YYLH 2FWLB 3AY4A 4X7SH 3UTOA 5DHEA 3VYOA 2QSVA 5DJXB 3BKJH 3HRZA 5I71C 3OKLB 2GSGA 2PTUA 3C2AH 1KLGB 4LRNH 2YPKA 5J11C 1DN2A 1X9QA 1BECA 3LKRB 5DQDH 4MCMA 3DGDA 3GB7A 5EO9A 5I26A 2CO2A 2PW1B 3O8XA 3QIWA 4DP4X 3DMMB 2ZKXA 4OFPA 4WI3A 4UV7H 5LDSA 1BVKB 3ZYOA 4G8GD 4OZFH 4XVTL 4RQQA 3RWDA 1J9RA 3SE4C 3UZVA 1SYVA 5F89B 5IKCA 4LLQB 4XBPB 3PIQA 3WXWH 4E9RA 2XN9E 8FABA 4ZDHB 5JXEC 2VDMH 2IXQB 2VMFA 3QXAB 3OZ9H 2AI0L 4NKIH 1D9KC 4LKCA 4FL4B 1S9VB 1E5AA 2F2HA 3F12B 3TBSA 1L0PA 4HXAL 5FLUA 1MCEA 2F7IA 2MQ0A 5J13B 4MRBA 4PR5B 2E27L 1XD1A 1PVHA 3OHXA 4PWHA 4Y2OB 5BXFB 3POCA 3EJQA 1WLHA 3QZLA 6FABH 1YJDL 4K23L 4Y0GA 2CUAA 3MODH 1BVLB 5LGHL 4NQQA 4FNRA 1A47A 4PJXA 4KV5F 3EYFA 5DQ9B 3LN4B 3WE6A 4DETA 4WGKA 3DJ9A 2GBTA 2OFQA 1BHGA 2D73A 1T7WA 4EI6B 3C2AL 3U6XS 2HWZH 5FUCC 2BSRA 1J12A 2GJ6D 1FHNA 5GRYA 4U1NB 4HH9B 4XO8A 2Z3FA 3KLSA 1FL6A 1MCFA 1X7QA 3BSZL 3LN5A 4R3SB 1RP8A 4URKA 1R5VA 3A3YB 2OMZB 1QPKA 4MMZA 3CVIH 2XWTB 2OTUA 2HTLD 4GFTB 4N4YB 1T1ZB 3QC5X 5F9JA 5KSUB 1QABA 2DYRB 3DO4A 1ORSB 3QNXB 5DFWH 3JV4A 4U1IA 4K0OA 3U36B 5AZEH 1ACYL 1QUNA 5B4MD 4E42A 1A1MB 5KS9A 4RBPK 2BMKA 3WIHH 4NQDE 5CU9A 5T1KB 3EH3B 4KDWA 1MN4A 1PG7L 1W72B 4JVWA 5FXCH 1S5HA 4LARL 1FZKB 3Q9PA 4HKZB 2CDFA 2NZ1A 4FE9A 1VFAB 3A6BH 3VXMB 4U3SA 1KGXA 2XWCA 2IDCA 1TU2A 4MX7A 1BZ7B 1WD9A 3PABA 4X4XA 3SDYL 3HZMB 3SKMA 3TBYB 4X8CA 1BVNT 3OC8A 2XJKA 1ZVYA 3GKWH 3QWOB 4GAJH 1FNGA 2ZXEB 3VFOA 1A6WL 1PGRB 4JFOA 4BQ8A 1C7SA 2MH4A 4EUPH 1H8LA 1K9TA 2EC9T 3WG7B 2OI9C 2EXTA 4WVRA 5IROA 1MCOH 1G9ML 3GMQB 3LQZA 3MKKA 4JO4H 4KROD 4HOMA 4LOVA 5HDLA 2J20A 5KSBF 4JFQA 4LEOB 5L4IA 2I07A 4DP6X 3VI4F 3CN2A 1DCEA 1E40A 3N0AA 3OXRB 2XN1A 3GDBA 4X7SL 5HJBA 2J8UF 5I1LB 2O5NA 4MS8D 1SOQA 2R4RH 1MVFA 2P46B 5K33A 5D71L 2IIJA 2MQGA 3WNKA 1J1PL 2P8PA 4FQCL 4WCYL 3U4EB 1M2OA 2ZUQC 3QUZA 1HI6A 1UXSB 1ZTXL 5T1KA 4F9PA 2D3VA 4C56A 2AK1L 2AQTA 4LL9A 2ROYA 2BHYA 4TUJA 3C60C 4HGWB 4JR9L 4PPTA 1NWPA 1IM3B 1NEZA 5F97E 3S3PA 3TEXA 7PAZA 4I0PB 3L3OC 3RFZC 3M1CA 1UT2A 3KPSE 2ZPKL 3LIZH 3VRJB 4XTRC 4APQC 4GUQA 2PWDA 2I5YH 3IDUA 2NY7H 2WK2A 4PTUB 3NOIA 5C6TH 1E9QA 3W1ZA 1CDCA 3ZHNA 4AV5A 2UZYB 4MQ7B 3KHOA 4FFVC 4XP1L 2GITA 2DKSA 2AFNA 3T77A 1LE5A 2CLZA 5EB9A 3VI3E 1A8JH 3VJ6A 4ODXA 4YQXL 3QWOA 2YD5A 2FB4H 3IM1A 3BUYA 1MHHA 1MOEA 4UTBA 3RIFF 4U0QB 1TVBA 3PU7A 4F80A 2R29H 3AABA 3FBKA 3II1A 4P3DB 2XN9D 1FRGL 1BX2B 3DJZA 4Q58C 1S5IL 4E9SA 2EEAA 2PCXA 5GZND 3QZBA 4WHYH 2EECA 4R4FL 5I6NA 3EOAB 2R7EA 4RISL 5E8EA 4JKNA 1JUFA 4GAYB 4KRPC 3BSZH 3FT2B 3GSOA 2QVMA 2ITDA 2BVUA 2BP8A 2ZXGA 3CUPA 5TGBA 5AOKA 4X7TA 3AC0A 2Z31A 5D1ZB 1M3IA 5CKGA 2ZCKL 1PTZA 1ONQB 4Q4IA 5AZ2L 1CXEA 4QO1B 2X3BA 1TLMA 5DHYA 3HE6A 3MFFB 4KJYA 2P8PB 3TEWA 3G5VB 3WEXA 3NFPB 3PQYB 3REVB 2BY0A 3RY6C 1EV2E 1I7TB 2E74C 1E4KC 2BW5A 4OD1L 4FXKC 4QWWD 5BW7A 4H20L 1KCUH 1BVKA 3CTTA 1FO0L 1LEIB 2YZ1A 4YIQB 3MYJB 2C1PA 1DQLL 1RLBA 1L7TH 1FYTA 1X4YA 4PD4K 5E95B 5J6GB 5D1XB 4ZXBD 1MCPL 1QQDB 5T1MB 3U0PB 1HL8A 1I3GH 1PG7H 1VERA 2YD1A 3T6WA 1G9EA 4EIBA 5IHLB 1HXYA 1E4JA 1UZ8B 2L7EA 5DZOA 4CC1A 4FQQB 3FB7B 3MRJA 2QZ5A 4N6RB 2AMUA 3GZPA 4MS8C 2UZYA 4MQ7A 4K3JL 5IROC 4E5XA 3HZVB 1CF8L 3D25B 1GIGL 2JK5B 4UT6A 2AABH 2TAAA 1RMFL 4S1SL 4XI5C 3KE0A 1LK3H 4HWBA 1A5FL 4NM8H 3AG4B 4N8CL 4K15A 3CXFA 1U8OA 5PAZA 5MEOA 4NB7A 4Q89A 1VKXA 4PJ8B 3N5AA 5KTEL 5ICZA 2P42B 2VDLB 3JT2A 2Y24A 1T2JA 3RKDC 4OAWA 3RB7A 5FO7A 3RP1A 3L2MA 1Z9NA 1ACXA 5LKNA 4G9DB 4G83A 2EDQA 2NZ9C 5FFLA 1VJSA 3QJUB 1AOHA 2BSTA 4AVHA 2L0DA 4WI2A 4F9PC 1E9PB 4WI0B 3PUUA 3JYCA 1DQML 4MD4A 1SZNA 2F19L 4Z7UF 4H5SB 2WJ5A 3CUPB 4IBSA 1OF2B 4R5XA 3K4ZA 5F7WC 4E9WA 3GHBL 2GABA 1G4MA 2H9GB 3QEQD 4LHQB 3CHOA 3WY1A 5DHYB 3VD2A 3V0AC 1JMXA 4JRFA 4ACTA 3KLKA 3D18A 3OSVA 3D05A 4PHZA 1T04A 2CLVA 2XZCH 4RSYA 4PRAB 3B8YA 2J12B 3SDXB 4ABUA 5EU4A 2FYYA 4HEMA 1ACYH 4KO7A 2GSGB 3B3IB 4OBSA 4UOQA 2DLGA 4XP6H 3V5KB 3VU2A 4ETQB 5JR1H 1T2XA 1XIWD 3OZ9L 5FO8B 4OZFB 3NSJA 1K4DA 3MX0B 4NKOA 3GHPA 4R26L 3DV4A 1S2EA 1UQSB 2IWKA 4DP1X 2GJPA 2IMNA 1JZ4A 3EW3B 5DC9B 3RWHB 1Q72L 1I3RB 1ZS8A 2ZPKH 3B9AA 2IMMA 3LIZL 3MNDA 3GJEA 5SWQB 3FB6B 4CU7A 2WXLA 1JNLL 1KENL 3P73B 3D3VE 2Y5EA 2H0JA 4NQED 3SY6A 2ZYHA 2QGCA 5EOQH 4Z7UE 5C0CE 2RACA 4QF1B 4GI9A 5IF0B 4K4KA 5B4MC 5E7BA 3H42H 2HWZL 4YX2L 4AUJA 2BP3A 2WIIB 2ZAGA 1EFXD 3QA3A 3QRGH 2JLPA 2X0UA 2DJ4A 4L3CA 1L9QA 2OL3H 4IU3A 1EXUA 2ZX5A 4N2IA 1G9NC 2YAPA 4G9FB 1OPGL 1LQSR 3D87B 3C6LC 1NM9A 2VC2B 1JF1B 1SXCA 3GSQA 1FHGA 3U6RB 1ZWIA 5B1CA 2IOMA 3CSGA 4PGZA 1KCKA 2YPLA 3QORA 1LP9B 1OSYA 4GBXB 1L6PA 1ZY9A 3NCEB 4TKWA 4HKJB 3MRNA 3ARGC 3DRTB 1Z9MA 2VZ1A 4C56B 5JHLA 4JM2B 5B7FA 1LP9E 4I1RA 4PWIA 1JHKH 3TS8A 1UCBL 4E68A 2DKUA 4DEWA 4EPSA 1NC2A 3N55A 4WO4B 3T4YB 4I5BA 1UOKA 3LVEA 4XVSL 1TFPA 2Y0SA 2R8SL 4YMPA 3EDFA 1IGIL 4OLVL 3KVPA 4NKMB 5T33L 3CHSA 2FHCA 3NQKA 1NPUA 3B1TA 3RTLA 1WT5C 3FHEA 1PEZA 4M1DH 3NZ8A 4L4TA 1VB9A 1KCUL 1IGJB 2VW6A 1QACA 5HJDA 1EO8L 1UM6H 1IEHA 3SGKC 4OJDH 2CRIA 5HHXH 1AI1H 3TZVB 1OTSD 3BAJA 2QQNH 3E7JA 4BQBA 5A3ID 5LCVH 1CLOL 3EUDA 4JNXA 2BNQA 3GMRA 3O8XC 2AEIT 1OWWA 1OP3H 4Z7NF 5FUCE 2BVPB 4TS6A 3U7WH 4Q6IB 2V2XA 4U7MA 4HHWA 4OLYL 1L9PA 3T3PB 2YD8A 1FO0A 1F1GA 2C26A 1EGJH 4GUOA 3ETBF 5C9JA 2DWTA 3EHBC 3L9EA 5KOVC 4P2QB 1Z6JT 1CQKA 1UUSA 2JCCB 1FAIL 1C5BH 3CZSA 1DEEB 3OXSB 3ULUE 4UNIA 1FNSL 1RZGA 4YSQA 2J6WA 5F0MB 3WKYA 3FT4B 3S35X 3WUWB 2DQCH 4M7ZC 1UWEH 4MD5B 2YEQA 4KK6D 2ZKMX 2VLKE 4QGTA 1F86A 2GC4C 2EXWD 4IJTA 3ULAB 3VXQB 2A4CA 1GA2A 2ORBH 3L4CA 4YDJB 1WUZA 4OZIF 3BT2H 2C3VA 4UT6L 5ANMB 2V5RA 3KPOB 2GQHA 5FYKU 4Z6AT 3MRMA 5I74B 4BCYA 3HBGA 4OJCA 3U83A 1I8IA 5KVDH 3L1EA 5D4JA 4G43A 5GGTA 4MZ3A 4MJIA 4I0KA 1RAMA 1TTFA 4BKTC 2BY2A 5DVKA 5LUMA 1J5CA 4AEIL 1EAQA 4Y19E 2WLJA 3QQ3B 2WWOA 1FFQA 4BHUA 3TASA 5L6YL 1N64H 4LDOB 4LOUC 4C58B 5DDHA 3OGCA 3TA3D 4U6HA 2X4QB 5FKPA 5GJSL 5G4OA 4N0UE 3UO1H 2Q9OA 4YBQD 3T2PA 5A2KH 1AZNA 1L7TL 4L4TB 5GS2D 4JB9L 3ZUNC 4DKFL 3BESR 3TURA 1NC2D 4PFEA 3L08A 1UZ8A 1O6SA 3D30A 1O5PA 4WEBL 4U05A 3H0TA 2Q7YB 1V3KA 1G6RL 1SF3A 5E1GA 3L2LA 3DSNA 1HXMB 2W94A 3KVQA 4TUOA 2XQBH 2WXJA 4B9YA 2IWFA 4MA8H 2V7HA 3AG1B 5CZRA 1J88A 1KBGL 4NM4H 4JL1A 5F8RC 5E8OA 5DZLA 2H41A 2R29L 1UZ6E 1R24A 3N9GH 4K8RD 2CHNA 3PXHA 3LSOB 2IPUG 5EF0A 3WNNA 2R29A 4YDLC 4XNQA 4F33B 3KGTA 1JPSH 4UB0L 5LHDA 1MHEB 1A7PH 7TAAA 4ZUUB 5DRNB 1BBDH 2NW2A 3EO9H 4NO0D 2CBOA 3TNMA 2ZNWA 4WJ5A 5C7XL 1E2ZA 5SX5H 3IGLA 4J4PA 2EE9A 1TJHH 1YEKL 4TQIA 2PW1A 4WUKH 4KX9A 4NQEA 2IF7A 2LAGB 5BO0D 1ZLUK 2V0AA 2OMUB 2K4AA 4GMSH 3K6OA 4M5YH 2QKSA 4JDVA 4UINH 1FIGL 2XPYA 4LSRL 1DQQB 2M2DA 2YSSB 4A6YA 4HX1B 4BQ9A 4ELME 3C5JB 1FL3B 1HNFA 4M5SA 2Z0BA 4AOFA 3GO1L 2ZICA 5EWIL 4G6ML 4OLVH 1NPJA 3L3GA 3U0TB 3W9EB 5KSVA 1ZDSA 4PGCA 4XP6L 4LCYB 3T0EB 5I0DA 1NFKA 4ZTOH 1EJ6A 3IJSA 2P1YA 1E6OH 1REIA 1ZHBA 3MV9A 2AAVA 3NGBC 1X6LA 4LP4A 2EO9A 3RWHA 1ADQA 2ITCA 3AROA 4FQIL 2PR9A 1C16A 1X5XA 1ZV9A 2WZAA 2NSMA 3IMTA 4ZMPA 3FMGL 3FTYA 2R69A 2X0WA 1EFQA 3SOBH 4OIFA 3L3OA 4O51A 3E6FB 1K2DA 3VFNA 1GPOH 1KJ2L 3NCBB 4AC2A 3KWVA 3ECQA 4NPYB 5DRNA 1OAXL 1HAWA 3MCLH 2D0FA 2DBJA 3BPNC 3VYPA 4K3EL 1YNTB 3BJLA 4Y1TA 3FRUB 4Q8BA 4WKZB 5GGVY 3WS3B 3HG1A 3LSOA 1IAII 2JELH 3U1SL 3X12A 5E2TH 4G8FB 4LEBA 4UOZA 3D0LB 1A7RL 4N1EA 2EVIA 1AG6A 4MCZB 4PJGA 5IFHH 3V0WL 1FORL 2CGRL 2PXYB 2WPGA 2Y07H 1W16A 2WQVA 5IW3A 5EU5B 3KPQA 3CZEA 4HAFA 2I9LA 4FQJH 3ILQC 3DVIA 4J1UB 4LK4A 2W0FA 4OVVA 1UCBH 4UTAH 4UT9A 1Z5LB 1BM3H 1SXAA 3MO1B 2B5IB 5C0JB 2ZWLT 2R23A 4UT9L 2NYYD 2YGOA 3IJYA 4R96B 3QFDA 4ABWA 2XWDA 4TNVK 2W9DH 4JVUA 4WHYG 4B41A 4N8UA 3L6FB 2HRLA 1X5KA 3FN0H 3MREB 4WEUD 1R5WB 3K81A 5B39G 4Z7WF 5D2LA 1BMGA 2I32A 4NHUB 3MRJB 4WJG3 2C9PA 1FFPB 3DJRA 3RLSA 2V5MA 1XR8B 1JNLH 1KENH 1MPAH 4PREB 1OGAB 3VWKD 5D9SA 1YEJH 2FAUA 3VD1A 3QARA 5JIHA 2QKIC 1U3ZA 4PP1D 3MJ8A 3BPNB 4JQIH 4BBWA 5J56B 4JCMA 1GS8A 1YEGL 4Z7NE 2KH2B 3BUIA 5AVXB 4F7EA 2X89A 1KXTA 4NQDB 5EF2A 1NCDL 2B4CL 1XEUA 1KELL 1VFBB 1QAWA 3D52A 4Q7DA 4YXKL 4JE0A 5E1QA 2X70A 1TZGH 2CDGA 1KB5H 1E28A 3VFTB 3KH3A 5A2IH 3OSKA 3MCG1 1A6ZB 1UH4A 4JREC 3TIDB 1QTPA 4YBLC 2ENQA 1G6RA 3VM5A 5F7LB 1QD0A 1RHHA 1AY1L 1OCOB 5LBSA 4AWJC 5DO2C 2ZCZA 4IRSA 1PU0A 2FT7A 3N04A 2YUZA 3R0NA 4JCWA 4ONOA 5JPMC 1CBVH 3WNMA 4LKXB 5I1IH 2ZD0A 1QFPA 2CJUL 1SDYA 2VJXA 3ISWA 5ETUB 3TN0B 2EYRA 1CIDA 4K3HA 2D7QA 2E8ZA 1JE6A 4MMXB 4P8QA 1RUKH 2B1AH 1J05B 3FO1A 1K8IB 5K1JA 2G5RA 2R23B 1MPAL 1GS7A 2FSEB 2BHZA 2ADFH 1AE6H 1AZBA 2PMZA 2I60L 4RGNB 3QFDB 3TBWA 2AMGA 3U1PA 2EDOA 2MOQA 1DQIA 2VISB 3O6FC 4QTIH 4XC3L 5CCJA 5EDSA 3MMEB 1WFIA 3I3EA 3SYQA 5BV7L 2GUOA 3ZTJG 1ACCA 5E1AB 3QXVA 3DDFA 3EYOB 2FNBA 3MV7B 5A7EA 5JOFA 3WIFA 1FZOB 3P9MB 1AFVH 2VO8A 1ASOA 4ODUB 3PPSA 3TV8A 4X5WA 4HK0A 5DZAA 3OX8B 4I1NB 2NNCA 4HKBB 5E5RB 2JXMA 4XE0A 5GGQH 3RDTD 1JHTB 4ZQKA 3ETSA 3ZHDA 4IRZA 4XVUC 5D70H 1OAUL 3DOIA 4TNFA 1AO7B 3MZGB 4KHXL 1HVXA 1KOAA 1ZVHA 3GMOA 5I1HH 1JI1A 1L5GA 3FTXA 3NZSA 2ICWJ 4OLWL 3KCPB 1X5ZA 4QXUH 4DUWA 4J3BA 4K9JA 2RB8A 5DZPA 3P02A 5ESQA 5EN2B 2GAZA 1QZNA 4FGMA 5E9DA 1XR9A 4APXA 4ANVA 5CINH 1ECZA 4YWGL 2ATAA 3FJTA 1KYOJ 1JRHL 2FWOA 3NRQA 4K5PA 2X89D 4NGHL 3BZEA 43CAA 4MHHG 2D7MA 4ZUTB 5T3ZH 1SRDA 4GXVH 4LP8A 1GGIH 4MDJB 2BVQA 2JE8A 5L7XL 2NSQA 2DY2A 5DCCA 3ARFC 3NVQA 3WN6A 4DK6A 3ZL4H 3FNKA 1NMAH 4WWNA 2YSSA 5AB0A 1E3ZA 2WO4A 3K46A 4QRUA 3W39A 3FZUD 1URLA 5MEPA 2K45A 3UP1A 1N2RA 1JZDC 1F0LA 5JUEL 2V33A 5TE7H 4QXWA 4XAKD 2WXMA 1Q9OA 4OV5B 2WQAA 3OB8A 4GO9A 4JPIA 1IFHH 4R4ND 5TDOB 4F15C 2B16A 1CI5A 4J23A 1OAQH 1NBZA 5CU5A 5HGDA 4JPVH 4K3GA 3MGOA 3EH1A 4F2ME 1YMME 3MLXH 5I5IA 4ORZC 4MASA 4QOKE 2FEDC 2WBKA 4FD0A 3U1QA 2GT9B 4TUJB 5C0GB 3D0VA 3GUTA 4XZ4A 1RQ5A 1QLRA 3HS0B 4ANWA 4WUUD 3S0PA 3AB0C 3MBEC 3SDDC 3HE6B 2EIKB 1GGTA 2NR6C 1FNAA 1OSPL 2ITFA 2MQ3A 1TMCB 4B0MB 3EXLA 2DQFA 2XKSA 4J3OG 5CIPB 3DPDA 2WQXA 3QUMB 4LP5A 5TQ2L 5BVPL 3GSNH 3NSXA 3H55A 4FFVD 1KUMA 4DAGL 5T3ZL 3DSNB 4A2FA 3HB3D 3O2DA 1W8OA 4IS6A 4HJIA 3L1GA 2ZWKA 3LZPA 4DPBX 4QDGA 3N40P 1H5BC 3N41B 2X4PA 1WCQA 5B39A 4QOKD 1HJBC 5AUMA 5D6CB 1QUPA 1M57B 3QW9A 1TVBB 3NPSC 3DX7A 3ZZQA 5H2BB 2GTWB 3G7TA 4OCRH 4X5PA 2VLRD 3HZVA 4R96A 5C0CA 15C8L 3ZDZE 2C9XA 1FGVH 1H9VA 3GM8A 1XAKA 4N26A 2JF1A 3VI3A 3FSZA 3IRCA 1FVEB 1I9RL 1Z5LA 4XMVA 5D7IE 3MUHL 5BO1L 1AGEA 1E0OB 1NICA 4KKNA 4I8DA 3WFDH 2AJXL 2D7TL 1JD9A 3QEGH 1JNNL 5CCKL 3IMUA 5TQ0L 4DHLA 3L5XL 4K3JH 3MYJA 4KGLA 1G1CA 2O4EA 3UTTA 5I18L 1ET5A 4XC3H 5FHBL 5CEZL 5E8DH 3WKMH 1NIAA 5BV7H 2R0WL 3B2PA 4ERSH 2WQWA 3C6LB 2O5XH 4PWKA 2AQSA 4MAZA 3FL7A 4XB3A 2E7LA 2ARJB 4G70B 1MLBB 3HI5L 2E4TA 3CFBB 3OR6A 5JYMA 3SJVD 3KEHA 3ROLA 2WO2B 1E28B 25C8H 3DVNA 1VHPA 1P5UB 1Q94A 3ARGB 3BQUC 3QIUC 3U30C 1QW8A 4GNKB 4FA8A 5IFJB 2VLRE 4MJ5A 3FFCB 1T7VA 4L8SA 1MUJA 4Q6IA 4X6DE 5E2TL 3QQ4B 4XP9H 1U3HD 3P1VA 1AD0A 4J3UA 5B21A 4C4BA 3FTGA 3CFMA 5HHQA 3ARFA 3NJVA 3NIGE 4U1MA 3UEZA 1A9VA 2MTAA 4G11A 3FN9A 1NC4D 1WTLA 2XYCA 3EYQC 4PRHB 4PGDA 1AXSB 1BF8A 1U3HB 3I02B 2TSAA 4ZZKA 4UT7H 4LQFL 3DUUB 4XPFL 1QBMH 3MLWH 1OZTG 1DZ0A 1SMAA 4NUGL 4XP5L 4K2UH 1BXUA 2O61A 2VR7A 1FLRH 1P0SE 5FHBH 5CEZH 3GSWA 3U79A 3PV7A 3UYOD 2IBGA 3EFDH 1VLXA 4UTAA 4PJ7B 4GXUM 1MVUA 4Z7IA 5IOPA 4J4PC 4PV9A 5J0BA 5PCYA 1L3WA 1MWOA 2A9NH 3O3BB 4Y1AE 4AJ0A 1E4HA 1ND0B 4HCRA 1NEZB 1LVEA 4ZSOE 1QTYT 3H7BB 2WCGA 5HGAB 2WO3B 4QUOA 1WC7A 1DBBH 2NY0C 3DX6B 4ODWB 4JDEA 1CTOA 1SJEA 2W60A 1CE6A 5DD5H 2XKNA 4XCFL 3PJSA 1XH3A 3GPSA 4LEXL 4AGPA 1EERB 1X5FA 4JQIA 2YZ8A 3Q6GL 5I9QC 2AVFA 4N2BA 1EXUB 4HUMB 4M5ZL 1C1EL 2F7OA 2NZ9D 1PEWA 1EMTL 1SYSB 4XB8A 4IU3B 3FQXB 1U95B 1JGDA 1NCTA 3APMA 4F27A 5IY5B 2PN5A 3QI9D 4HAGA 1UA6H 4JN1L 4B9FA 1II4E 3GQFA 3L4VA 4Q9CA 3BAEH 4MHHI 2ZXBA 3S3BB 4S0SD 2N0KA 5FGRA 4WK0B 2BNQE 3KPSB 1GYAA 1SY6L 2O72A 5I1JL 2BX5A 3MLUH 5EC1B 5C86A 2MIZA 4NX0A 5F96L 4AC4A 5I16A 2WLYA 4ZFGH 1ODUA 2DRUA 5E2JA 1GTFA 4BFIA 1F6AA 2YN5A 1WH0A 5TDPA 2VQ1A 4I5BB 4NJAL 3EBHA 2AJSL 2JJSC 3HOGA 3O4OB 1MCNA 3U4BH 4HG4K 5AVVB 3VG9C 1W72A 3AT9A 2MJWA 3QUXA 5J89A 1RVFL 4HJJH 3BUPA 4K8RL 4ICWA 4YXHL 3N42B 4J3OC 5HYIA 1A1MA 1PMYA 4GP5B 3HE7B 2XACC 2OMWB 1BW8A 3GJFK 3PJSB 3VWKA 3WAJA 3QDGB 4FOMA 3LPWA 3PWVA 1CICC 5I75C 1CFTB 2XA3A 2PWFA 1TYRA 4Z76A 2GB2A 4ZAKC 4XWGL 5FKAA 3OKOA 3RUGA 1QNZL 4GRMA 1PX3A 5HPMA 3DETD 1UA6L 2R56L 2GK0B 3OKYA 4MLSA 3QPQC 4PH8A 2YARA 4OLWH 4PJ8A 1AS7A 2DYPB 3MLSL 5TE6H 4HMEA 3WJMB 4L4TE 1P1VA 3QUGA 2X2IA 4BGLA 1X7TA 4P2RE 4UDUB 2IH8A 3T9WA 1SGKA 4U6HB 5FKPB 5ENWB 4A39A 3R06A 3AACA 5MEOB 4KKAD 2NX5B 3DROA 4D0CB 1F4XL 4QTHB 1ZA6B 1NDGB 1BG9A 1SEQL 4HUXA 2IQAA 3WOVA 1J8SA 2UX7A 1XL4A 4M3KB 3B5TA 4PRIB 3ISRA 3VX0A 1MDTA 1KXQE 4NQCD 1NANH 1OE1A 1WITA 4P2OD 5EEWA 1URZA 1XGPA 5IVXB 4JFHE 4M3JA 4DNLA 1FQ9C 5EN2A 1AGBA 1E5BA 3LRKA 5DJ2A 1DSYA 3LDBC 4CILA 1BFOA 1X5GA 2P24A 4JQVC 1HJCA 4CSZA 3RTQB 4OB5L 4NQSB 3QXAA 4N85A 5D2LF 2AEQH 1I9RH 3LPOA 3WO3B 4PY8J 3ZRSA 5AOJA 2Z8VC 2XIIA 4QIRA 1KIPB 1AZVA 3GMPB 3IAPA 5C2UB 2VDNB 4BUHA 3HG1E 3MV7D 3RWDB 1TEGA 2RFXB 1BAGA 3UZVB 2K9FB 4K94L 4H7VA 3MLVL 1GR7A 4FC3E 4LPCA 1IQDB 1G7IA 2UWEB 1JS4A 1KN2H 3CN1A 2IFGA 3IVKB 1ZT1B 5KBPA 1T0NB 2A9BA 2WVVA 2WXHA 3CDYA 3MLSH 4ZUVA 4U1LA 5HYQA 2QQNL 1P9MA 3FYIB 2XFXA 3DOSA 3T2LA 4PQXA 1E42A 4Z3GA 4JQXC 1DBKL 1XGQA 4N0YH 4W9LC 4MWFA 4ESKA 1IAOA 1KCRL 2W9EH 4J6RH 1TTUA 4OZ4A 5IEHA 4B0MM 4UF7C 2EKJA 4HIXH 4P3DA 3L7EB 4POZD 5AAPA 4U2ZA 5AL0A 1KZYA 1B2WH 3LQAC 4PJXB 1BLIA 4M43H 3VJ6B 2PWGA 1N6QH 4N0UA 3NG5A 1XVSA 4P4RB 1XXDC 2FX7H 2IAMC 4QHMB 2E7DA 4IBZA 2DDQH 5J6HB 3QB7C 2VZOA 4F7KA 1MLCB 2P5PA 2NPLX 5TE4L 1B90A 3JTTB 1UFUA 4OD2A 4ZTPH 1MIEL 2OXGB 1ZJAA 2E7BA 3FUEA 1L9TA 2X4RB 3GSXA 4Y4HD 3WJJA 1SY6H 3PAVA 3ZTNH 5SX5K 3MOBH 2NOYA 1QO3A 4AYFB 3TCXA 4EZLA 5TQ0H 5ADOH 4ZMZA 2FECL 3LEXB 4JDEB 4YSUA 3E80A 1XGYH 3TVMA 4DW2H 3KLAB 1NQBA 5EPMB 4AVJA 4J5VA 2WAHA 1ADQL 2XVLA 3HAEA 1OY3B 3GMNB 5EO0A 1CGWA 4UTCA 1SY6A 2BY3A 2XICA 25C8L 3OAYK 1SM3H 3O8XB 4FG4A 4NPKA 3WI9A 1WA2X 2IG2L 5HY9B 2DB8A 3GDCA 3NACL 5CJQL 1PBYA 2F1AA 3CX5J 4KJPC 4EUPA 4JY6A 4JFOB 2DKMA 3GS0A 2ERJB 4KVNH 4BHUI 1H8OA 1YAIA 1U8OB 1VKXB 3HUJB 1BD2E 2VSCA 3IJSB 3OAZH 5I1EH 2W0LA 4YFEA 4NZ8A 4JFHD 3SY0B 5BZDA 3DHUA 4OM1L 5DMGC 3K0YA 1BFTA 3ASOB 3CN4A 1CL7H 3V0WH 1KGCE 3PL6B 1Q1JL 4GB9A 4PJ9B 4A7VA 2P49B 4Q4EA 3UDWA 4PJBA 3A4FA 3GXPA 2XIBA 1CFQA 2F8IA 2WMPA 1SXZA 3T1FB 2QSCL 3IDNB 3DYMA 4QCIA 2Z0UA 4QAWA 2FEDD 2GC7C 4MCZA 4XOBA 2FLMA 1QEWA 2C8NA 3UYRH 4LCIH 5JLZB 3CLEL 4ZAKB 4RRPG 1J48A 3Q06A 1JWUB 4I18A 2Y25A 3QJTB 2XNAB 2JTYA 3BP6A 3TVMB 3O6LH 2EDNA 1A2YA 5CP7A 3WFEL 3CXDH 1DJIA 1E8WA 2X3AA 1RUAL 5C0DB 3H2PA 5KJRL 1ED3B 2XY1A 1OAKH 1KIUB 2NYZA 1WFJA 3KYAA 4AXWB 3W3BA 1ORSA 5L9DL 2HLAA 2OV0A 1C8QA 2MPAH 3S96B 4H0GA 4NRYB 1XBRA 1AGDB 1UWXK 3L3KB 1GSMA 2A2QT 4KKBD 3REWB 2A6DA 5E0QA 2ZXCA 1C5DB 4R6UA 2UY7A 3RWFB 3IJHA 1L9NA 1A4BA 3RX8A 5F7FA 2XUWA 5E8NB 1LWRA 3Q1EA 3RNQA 3TO2A 1JZJA 2HX8A 2R0ZL 5GS0D 2CDEB 5FYLH