4E9RA

Multicopper oxidase cueo (data4)
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
489
structure length
476
Chain Sequence
AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Blue copper oxidase CueO
publication title Structure and function of the engineered multicopper oxidase CueO from Escherichia coli--deletion of the methionine-rich helical region covering the substrate-binding site.
pubmed doi rcsb
source organism Escherichia coli
total genus 138
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9rA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9rA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9rA03
1TEFA 2FT6A 3KW8A 2IDUA 3NJLA 2XX0A 1NWOA 3ABLB 2GC4C 6PAZA 1CURA 1T5KA 1XB8A 1AACA 1A4BA 4E9WA 4BDVA 2HXAA 5A7EA 9PCYA 3NSFA 1E5YA 4FA7B 2WO3B 2GC7C 4YSQA 1BEXA 4DP0X 3CVBA 1EZLA 3QJTB 2EIJB 2XV3A 3CVCA 2UXFA 4AX3A 8PAZA 4KOBA 3NJMA 4G7RB 4QLWA 2BWDA 2DY2A 3FU7B 1GYCA 1RZPA 1A3ZA 3NYKA 1VLXA 3IBOA 3IN2A 4A2FA 1J9SA 1QHQA 2WSDA 1IUZA 2VM3A 2FJSA 3NJHA 4DP4X 3WNJA 2XXGA 1J5CA 2UX7A 3NSYA 4DP2X 3HEIB 2X87A 3SBQA 1TEGA 4HHWA 1OF0A 3SQRA 2FTAA 3NJJA 5F7AA 2TSAA 4DP5X 1OCZB 4E9RA 3FU8A 2XWZA 2BWIA 2LLNA 3QJSB 2IDFA 1ID2A 2FNWA 1NIAA 2PPDA 4TXVB 4A67A 2VN3A 2UX6A 3L45A 2FQEA 1WS7A 5B1BB 1IC0A 3WKPA 2XYBA 4DP9X 3QQXA 3H56A 2QPDB 1J9QA 2ZWNA 3X1EA 4F2EA 5D4IA 1L9SA 2BP8B 1OV8A 2PP8A 2XV0A 1L9TA 2XU9A 4UF7C 1N70A 3UABA 4ENZA 3PPSA 3IEAA 2Q5BA 3ERXA 4E9QA 3CG8A 2IH9A 3NJKA 4DPAX 3KW7A 4BXSV 2J5WA 1HAUA 2PPAA 3V9EA 3WIAA 1L9OA 5I6LA 2HLEB 4WTQA 2B08A 5E9NA 1KCWA 2I7SA 2PPCA 1ASPA 1V10A 3CVDA 2FQDA 4KO7A 1AR1B 1UATA 1AANA 3AW5A 2YAPA 1WA1X 1KYAA 2PP9A 4YL4A 3UADA 4KO6A 1SHXA 2FT8A 2BP0A 1JZFA 2CUAA 1JZGA 4DP6X 3SBPA 1PNCA 3H4HA 3T9WA 1AAJA 1IKOP 1JZEA 3NP3A 3TBBA 5B7MA 4A2GA 2UXTA 2YAMA 2R7EB 1WA2X 2W88A 1XB3A 2XVBA 2GI0A 3ZBMA 4YSDA 3X2QB 3D12B 1URIA 1KDJA 2YXWA 5IY5B 3OQRA 3FSAA 3NJGA 1NPNA 1ZIBA 3FYEB 1CYWA 2YAHA 1AZBA 2YAEA 2YXVA 3X1NA 3EH3B 4KNTA 1OE1A 1TU2A 1A4CA 1E5ZA 1N68A 2AZUA 3FSWA 4GP8B 4KNSA 4UANA 1ILSA 1GS6X 1ZIAA 2JKWA 1NIBA 3PXLA 3PAVA 1JZHA 1YLBB 1NINA 1M56B 4DPCX 4A2EA 1GR7A 2ZXWB 1M57B 1BQKA 4WKXA 3UACA 1A4AA 1JXDA 2QDVA 4YVUA 1ZDSA 2YAOA 4E9VA 5PCYA 1RZQA 4YSUA 1SDDB 1SFDA 1F56A 3CDZB 5I6PA 1AS6A 4KOCA 4CSZA 4GY4A 3ZDWA 2DYSB 3UAEA 1KCBA 3NP4A 3S3CB 4E9YA 1J9RA 1BQRA 2IWEA 3MBWB 1GY1A 1JERA 3DIVA 2A3TA 4E9SA 2QDWA 3FQ1A 4BDVB 1ET8A 1XMEB 5B7FA 3DKHA 5I6MA 1ZV2A 1HFUA 1GY2A 2IAAC 3DTUB 3OM3B 4HAKA 3T6ZA 5LDUA 3N2JA 3S3DB 3C75A 4DP1X 2OJ1A 3NJNA 1L9PA 2PCYA 4KNUA 4Q89A 1SF3A 2HX9A 3WG7B 1X9RA 1NZRA 1ADWA 3WI9A 5I6KA 1ILUA 4AZUA 2ZONA 5PAZA 2HRHA 5B1AB 1WAEA 4GP5B 4YVNA 1ETJA 3AG4B 3PAUA 5I5MA 4GP4B 1QLEB 4BWTA 1AG6A 3AG2B 2H47C 5I26A 1BXVA 1E30A 3OMNB 1NWPA 3S8FB 4FAAB 1ZPUA 3OMAB 3NSCA 1KDIA 1QNIA 1KV7A 1B3IA 2CCWA 2FQFA 3EH5B 1J5DA 2P80A 3EH4B 3FQ2A 3JT2A 1AOZA 3U25A 2VMJA 3FSVA 5B3SB 2EILB 5I5IA 2BW5A 2UXGA 1V55B 3NJIA 1MZZA 2AANA 3ABMB 1V54B 4M3HA 3HB3B 3FU9A 1BXUA 2EIMB 1JXGA 2OCCB 4X4KA 4AKQA 2B3IA 2AZAA 2J56A 3OMIB 1X9UA 2XXFA 2H3XC 2FQGA 2X88A 4JKNA 1NTDA 1CC3A 2QT6A 5F7BA 3IN0A 1AS8A 4PAZA 5TK2A 4YSSA 4QKTA 1GS8A 4HCIA 3BVDB 3AG3B 1PLBA 2GSMB 1PZBA 2IWFA 3FT0A 3T6VA 1PLCA 1WS8A 2JFCA 2DWTA 4E9XA 2W8CA 5AZUA 4YSPA 1AZNA 3TASA 4RH4A 1E65A 3FSZA 1AG0A 1RKRA 4G70B 2EINB 4HZ1A 1NIDA 2MTAA 1OCRB 1BYOA 3BQVA 2AVFA 2BP0B 2GBAA 4NERA 1IBYA 4F7KA 1PZAA 3FYIB 1OE3A 5B1JA 1MZYA 1PZCA 1PF3A 2IDSA 3NSDA 4GXFA 5EHFA 1TKWA 4CSPA 3TA4D 4G7QB 4PCYA 3EHBB 1J9TA 4HHGA 4AKPA 2IWKA 4E9TA 3PLYA 5B7EA 5TK4A 4DPBX 5I6OA 1AZUA 4YSEA 5I28A 3NT0A 2YQBA 2CBPA 2AFNA 2YAQA 3AG1B 1HAWA 1NIFA 2UXVA 3TBCA 4JHVA 1SDDA 3OD3A 3UGEA 7PAZA 1I53A 2HX7A 1OE2A 2CJ3A 1MDAA 1W6LA 4BK5C 1GSKA 2QPEB 1IBZA 2HRGA 3FU7A 3UAAA 3WNIA 3ZX1A 4YSRA 4AKOA 1JVOA 4YSOA 2HX8A 4HALA 4N8UA 1MG2C 1MG3C 3QJVB 2VSMB 2BW4A 3G5WA 1AZRA 3MX0B 2DWSA 4HIPA 2JXMA 3H4FA 4L0PB 3TU6A 1BQ5A 2VM4A 4N4YB 4F2FA 2VSKB 3X1FA 3PAZA 5D4JA 2N0MA 1SF5A 3EF4A 1WA0X 2PPEA 3PCYA 5AKRA 1KBWA 2PP7A 1AIZA 1OCOB 1SNRA 2PLTA 1W8EA 1L9RA 1W6WA 1KGYE 1NICA 2XV2A 1BAWA 6PCYA 2GB2A 3ASNB 4G72B 2BP8A 3S3BB 3WKQA 3T6XA 4NAJA 1R1CA 4MFHA 1DYZA 5D4HA 1ASOA 2GIMA 4A2DA 2E86A 3T71A 3X1GA 1AS7A 4A68A 2BZCA 1PNDA 3AY2A 3GXUB 4NB7A 2CALA 4DP8X 1SFHA 3FQYA 1OOWA 1SHWA 4Q8BA 3ZIYA 4K9JA 4YSAA 4M4RB 3T6WA 3GDCA 1AZCA 4HCFA 1OCCB 3X1BA 1NPJA 1JZIA 4W9ZA 2J57A 3ABGA 1JVLA 2OV0A 5B1JC 2VW6A 2GHZA 5ANHA 2IDQA 2ZOOA 3AZUA 4P5RA 1GS7A 2FWLB 1RCYA 4BWWA 3SBRA 4BXVA 4YSTA 1AQ8A 4BWUA 4GYBA 4A2HA 1FFTB 2PPFA 3QPKA 2IH8A 2Y69B 2R7EA 4G7SB 3S8GB 2PCFA 1JZJA 1PY0A 3GYRA 2XUWA 1A8ZA 2YAFA 5I5JA 4A66A 2YARA 2DV6A 1SJMA 5AFAA 1E67A 3QJQB 1JOIA 1PAZA 5B1KA 5I6NA 1DZ0A 2Y1AA 3JTBA 3NJFA 4AI7A 1XB6A 4HCGA 2H5UA 2DYRB 4DP7X 4YSCA 4JHUA 2FT7A 1NDTA 3FS9A 1BYPA 3QJRB 2I7OA 1PLAA 1NIEA 1KBVA 4G71B 2TSBA 4KO9A 4KO5A 7PCYA 1ASQA 1M9WA 1ZDQA 1GW0A 1L9QA 2MRYA 4EF3A 1ET5A 5FC9A 3CZUB 2EIKB 2BZ7A 2CAKA 3IE9A 3N55A 3FPXA 2WO2B 3RYMA 2J55A 4P5SA 4UAHA 1ET7A 2HZHA 2VW4A 2VW7A 3ABKB 1FA4A 3V9CA 1FWXA 3FPYA 2Q9OA 1PMYA 2XLLA 1CUOA 1CYXA 4ZK8A 2IDTA 4W1TA 2BO0A 1BXAA 2RACA 3QJUB 3CDZA 1A65A 2I85A 2XX1A 2P80D 1EHKB 3ASOB 2NRDA 1PCSA 2BHFA 1JXFA
chains in the Genus database with same CATH superfamily
3ZOAA 5FW7A 2EDYA 3VD3A 2X41A 3HZKA 2X4NA 1XEDA 2P1YA 3IPFA 4JG0L 5IBUG 1P9MA 1Z66A 4LEOB 5HGDB 1U93B 4ANKA 5FYLD 3KEDA 2C9SA 4U6HA 3RDJA 1XAUA 2GUYA 3B4NA 1P1ZB 3PABA 4FMFA 3GLZA 3JXAA 4JR9H 5M94B 1KFGA 2O6PA 5DVNA 1VFAA 4TRPH 3S5YA 3KM1A 3A22A 5DA0B 4IU2B 4LSSL 3PL6A 3Q8BA 4ANXA 4U1IB 1C5BH 1UWGH 5CKAA 1BHGA 3A4EA 3E6HA 3IN2A 3QRGL 3RNKB 4Z95L 5IQ9A 3ROOA 4MVBC 4OIIH 4M5TA 1A1NA 4JFDD 5CLXA 3SBQA 4MD5A 1TEGA 5LGJB 1OF0A 4EAEA 3U1PA 4CBZA 4KNQA 1IAIL 4HT1L 1INQB 3E7JA 3GXPA 3LN9A 1ZHKA 2FATL 3MLXL 4YR6B 1JDCA 1ZLWK 3GXNA 4XMLL 1R5WB 5E6IA 4MNQD 5IF0A 3WKPA 5I73B 1WYJA 3ATAA 4PLOB 1NAMH 3ENEA 4M1GL 4QHKJ 1OP5H 4YFLF 4G7YL 4V1DE 5L8JB 2DD8H 1A7QL 1SM3H 3CFBB 3GBEA 3T1FB 5ABDE 2AQ3A 5IMOA 3QHZH 3UBXB 5HVGB 5I15H 2J7LA 3OWEA 2XU9A 3ZTEA 3RY6C 1RVFH 1RAMA 3IEAA 2G60H 5CJ5A 4M7KL 2HPTA 3S5LB 3WFHA 1JDDA 2AV7B 1MRFL 3IMTA 1Q1JH 2ZCKL 4N85A 4BXSV 3BVVA 1D5ZA 2J43A 1YY9D 1FN4A 4L29A 2AQNA 4QXVA 2K45A 3HG2A 1OTUC 4IEFB 1A0QL 3ZKXB 2PTVA 3EUDA 1QFWL 4JKMA 4MB3A 2VAAB 4WKZB 3VX1A 4GBXC 3IVKB 5D71L 2DRUA 4KJQC 4NS0A 4TUKH 1W0WA 3JVFC 5DSCB 1BEYH 2L04A 3KJ4C 4WGWB 3I02B 2IGFH 3TFKD 3MYJB 1N7MH 1FDLH 3IK2A 3PWNB 3WV0A 1T0MA 3TT1H 1P9MC 4RAVA 3CFMA 4Z7WA 5DC2A 3MREA 4DP6X 4G80A 4JGJA 1AI1H 4XPGH 2D3NA 1XCQB 5K39A 1F3DH 1NGZB 4L8BA 2XKNB 4M1DL 4CVWA 5AOJA 1A14H 3GBNH 4I85A 5MEOA 3NRFA 4L37A 3QXDA 4O2EB 1LEIB 1CI5A 2W88A 5FGRA 4L9LB 1T4KA 1UWEH 2AXJA 3OBAA 4OZIF 4PHZA 3LXBA 1KMGA 1DJSA 5TFSH 3PL6C 1CE6A 2OL3L 1D7BA 5C0RH 4XP9L 5F9JA 4HVBA 2DS4A 3NJGA 3NRQA 4TF4A 5L8LB 4NQVB 1FNEA 3KXFE 4KHTL 5E00A 4DQOH 4HFWB 4HJIA 3UCQA 5I1KH 3UTQA 1LO3L 4AM0A 3L3IB 2X6MA 1M2VB 2P9RA 5K1VA 4MWFA 1EJFA 2BVOB 3DIFB 5DC4B 3BSZL 5T1LD 4FXLA 3HI5L 5I30H 1J5OH 1A64A 3STLB 1WUNT 3DO4A 2DF3A 2HLFC 2EEFA 3B3BA 3BP4A 2RBLA 4ONFH 5IP4A 2CHNA 4BQ8A 3KZ8A 3RJQB 3IMBA 4UM9D 3LIZA 5J9PB 4OD2A 5J06A 5DMGC 1DR9A 5E6IC 3IU4L 5I76A 2DBLL 4JY6B 4Z7QE 2NY6B 3FSOA 4QF1B 2IOIA 2F53D 1NDGA 2XBTA 4MQSB 2AEPL 5C09B 1HHKB 3CZNA 1OTSC 2PYFB 1HZLA 4B0MM 4FCAA 3BGFC 4GY4A 3FU6A 2O5NA 3GDBA 4BKLA 5I8KL 2MIZA 1BQRA 4F57L 5JXAH 4HUUB 2N7SA 3C6LA 4A6YL 4HOZA 3QEQE 4KZDL 1DJZA 3HNTH 3P0VH 3LNGA 4HK3N 3S4SB 2EXWD 3HA0A 4PBXA 2OMZB 2WIIB 5ID1B 3DTUB 1U8QA 4BINA 2QHLA 2F5AL 4LOUD 5F88B 3BZEA 3P0GB 2AEWA 2R1YA 2ZYRA 4M8QA 4HIHB 2H2SC 4Y5YB 4ACPA 5J4MA 2RGSA 2YHGA 2DQEL 1A4KA 2OMUA 3HHSB 4DVRH 2C9AA 1ZMYA 2Z8WC 5HYSG 3AG4B 4D3CL 3OF6A 4ZODA 2GJ6B 5FDYA 5H4ZA 4ZRGA 5CBAA 3LQZB 5IHZB 5J6GA 4OCRH 3EYVB 2MCAA 4NI6A 1PVHA 2N7BA 3VWKB 3SEPA 5EO9A 3DHMA 1FVCA 1JWMA 4F7PA 1UXSA 3RILA 4PWGA 5ISZD 5EZLA 4FP8H 1OWRM 2EKSA 2XPYA 1OOAA 2RH0A 3KPPA 4W4OA 4F9PA 2HFGL 5D1QA 4RSVA 3P11L 4LNRA 4AQEA 4YXLL 3FAWA 5D7SL 2XXCB 3OKKB 1NMCB 4GQRA 1A6VL 1RUMH 2ZCHL 3WBDA 1FIGL 1KCKA 5BRZB 3VJ6B 3GS4A 3K91A 5I0WA 1T04B 4FTVB 1BWMA 2YPVA 4ZXBB 2ZOKA 3KAAA 1QFHA 1MZZA 1NMAH 4JG5A 3RVUD 3OB0H 2EE0A 4YZFF 2YGOA 2Q76B 1BZQK 4Z7UE 3RBGA 2JTDA 2GCYB 1E9PA 5LWYH 4M4PA 3QCTH 2O4EA 4H20H 2FK9A 2E6JA 1S3RA 2F68X 4MXVF 5FKPB 2EYSA 3CFDA 4CSSA 2AERT 3FL7A 1YEHL 3AG3B 1JK9B 4P2YA 3FT2A 4ODWB 3WIFA 1WC7A 4PS4L 1R3LA 4DUWA 1JI1A 1UCBH 4M7ZB 1WTGT 1JGEB 3QUZD 2C9UA 1CFVH 1AG0A 4NQTA 4FOMA 4FFWC 1C16B 2BXYA 4P59L 3WJMA 5FA3A 4MXWL 2VCOA 3C6LC 3B5GA 1U8LA 1S9XA 2M26A 4NRYB 2BSSA 4YBHA 1FYTD 5INDB 2DOCA 5C2BL 3UFIA 4MNQA 5CMAA 3BCFA 4X8CA 1CU4H 3GJEB 3APCA 3MLWH 3ZZSA 4C83B 4PCYA 3CHOA 1AXSB 2IPUG 4FQQB 3QZMA 1Y18A 4GKLA 4HHGA 4UT9L 5T3XL 4AKPA 4APXA 3EZJB 4AYGA 2WJ5A 3QNZA 1GYAA 3Q5TA 2Y07H 2GJZB 3KNBA 4XGZB 3L48A 1ECZA 3LRGA 3PAYA 2CXKA 2J6EL 4X5XB 3I6GA 3CN1A 1UB6B 2UXVA 1VADB 3OD3A 2ITDA 3QWQB 4TSAH 5DJXB 4OV5A 4UTBH 1AYOA 2VISB 3WNPA 1SDAB 4B97A 4EPSA 2CA3A 4JO8A 4BBWA 3BAEH 4XCNA 3AREB 3RPBA 3U9WA 2YPLD 4W4OC 5DD1H 4F9PC 1I4FB 2G3ZA 3HBGA 5D1QC 5DRNA 2DQJH 1F6FB 1N9PA 4ICWA 3G5WA 3KHOA 2BSTA 4AYFB 4F8OA 4K3JH 2X1XR 3GRGA 5JDJA 3CLFH 3NH7H 1AD0B 2NLJA 4X50A 2TRHA 1SBBA 3ZGHA 2ODHA 3EF4A 4NN5C 2PPEA 3BIAX 2BSRA 4IBVA 1NFIB 1ZE3H 2MOGA 1PD0A 4P05A 1HQRB 5HHMB 4CU6A 3IJSA 3EXLA 1FFOA 4JM2F 4UQ9A 1P4LB 5FXCH 3CVHL 1VEPA 3GSNA 1FPTL 4N2HA 4ODTL 4Z7OB 3VFOB 4Y2DA 4HBQA 4XO4A 4GKOA 3UJTL 2X4SA 3MV7D 4UQIM 1WG3A 4HUWB 4PI0A 1FNFA 4CC1A 1I1CA 3OB0K 4JFVA 4WHDA 1FJ1B 4X6DB 4AGPA 3L1OH 2A0LD 3FTVA 5HVHC 2P24B 4A68A 1PNDA 4XH2A 4O02L 5HHPB 3P3TA 1JZ7A 3G7TA 3GMMB 5E4EB 2HKAA 2H1PH 2D73A 1AFVL 3QZWA 3U0WH 3N50A 5KBNC 1EHLH 4Q9QL 2KQMA 1G0DA 1DVQA 3LNEA 4FJ6A 5T1LA 4X7DC 5IROD 1NCOA 3ES6A 4YJZL 4PD4J 4IBSA 3L3DB 2Q3XA 5DLML 2X4RA 1UWXH 1UH4A 3CSGA 3GLDA 4UM9A 4UOJA 1BIIB 4JO4H 1WBXA 3U4KA 1PS3A 4LRNL 3RWFA 5DHVB 2F53A 4I5BA 4UDUB 2KI6A 4BCZA 1U3HB 3ULUH 5DI8B 5EFIA 1JHKL 4BWUA 1UFGA 5E5MA 2P52A 4UQEA 5C0IB 3KPSE 2H0EA 3WS6A 4BUQA 4Y4FD 3BX7C 1TEYA 4JQXA 3MGAA 3N0AA 1IL1A 4P5KA 2O93L 1NCCL 1JZJA 1U8NA 4HC1L 5LGHH 4LDOB 3ZMEA 1FFNA 3S37H 4UQ2B 2XA3A 2X9YA 43C9A 2BRQA 1YY9C 1F4YH 4ADIA 3R4DA 2PW1B 3GSQA 5EU4B 2D2CC 1KIRB 5IEHA 3HG4A 5I6NA 4OFYD 3QH3B 2ENYA 2G2PA 3LKRB 4BFIB 5DS1A 4OFPA 2GY7B 1TQVA 4UQDA 4H8WC 1R5VA 3SSGA 3TFKC 2QR0A 4X5WB 3HG3A 1ORQB 1KACB 3NCFB 2WVUA 1MCOL 5GXBB 2EKJA 3DBSA 1R33A 4NLHA 5D2NE 4C47A 4Y8DC 4NRZB 2EECA 2N3JA 5F89A 2HVKB 1U8PB 4HS6B 4EUPB 3VFTA 2X2UA 3INUL 4HG4K 1JZ6A 1F4HA 4H8PA 2OMNA 2NY4B 3M17B 1B9KA 4EDXA 1BQHB 1DQJA 4NQQA 4G8EB 4OZHA 3N9GH 1KB5A 1UWYA 3QCVL 5GS1B 2R4RH 4JO1L 1AGFA 5CNHA 1PLGL 1ZLDA 4KKLD 4JL2A 5D5MF 5ISZA 4Y2DC 2NT0A 2V17H 5AOMA 1KCUH 1QLRB 3K5RA 3ME0B 3EOAA 3QR1A 3CFEA 3K81A 4WEBH 5LJYH 3GO1L 3H0TB 1AGBB 2Z92A 4QPEA 5E51A 3UMTA 3T0EE 2XN9B 2YUVA 2APTA 4ZYKB 3DUHA 2GABA 4PB9H 1XTMA 4HJJL 1IAKA 2CKBL 5A7EA 4RGMC 5GRJH 3O6MH 3DOHA 4W9LC 4RGNB 1OP4A 4GRWE 4LLDB 3QJTB 2WIMA 2XV3A 3CVCA 3FO0H 4NBZB 2W0KA 1E5BA 3NA4A 1G9NH 4E41D 8PAZA 1AMYA 5BO1L 1TTCA 2XWRA 4KKAD 1BPVA 1IRAY 1Q9KB 2CM5A 3VQ2C 1RZIB 2MPAL 2XNAB 1IUZA 2VM3A 1PYWB 1OF2B 1T21A 3PFQA 3QUZA 1AXIB 4I2XB 4QRRD 3N43B 3M7OA 1MREL 3WS6C 5IJVA 1UWXK 2EEDA 4JQXC 4I18B 4XBPB 3SQRA 3KPMA 2ORBH 1SJHB 4J5VA 1AP2B 3BH8A 2RFXB 1HSBA 1RZJL 3QJSB 1XT5A 2OR7A 1FYTA 1AO7E 5CP7B 1NIAA 4NENA 3V8OA 5I1DA 2D31B 4NGHL 4PGDA 2EXWC 2VN3A 5C0GB 5TH2A 4WGKA 1H6EA 1M05A 3QRFM 2UY7B 2P5EB 4LOUC 3EJQA 5DCCA 2AJYH 3CNKA 5DUMH 1CYGA 1DQMH 3GK8L 4ODXB 2BFGA 1A2YB 1FZKA 1Q72H 2P43B 3H85A 4ODHH 5F7EH 4DW2L 1HE8A 3P4MA 1JIBA 2YUZA 2XWBB 3FQXB 3E3QE 3IJHB 4R2GB 3HKZA 5KYUB 4QLRA 4WU5B 3FO1B 3IAPA 2RHEA 2XVLA 3OKEA 2VDRH 3PP4H 5D72H 3QARA 4KKZA 3D69B 1EGJA 4UU9B 2ZOLB 3L08A 1ACYH 1P7KA 4HF5L 3VH8B 5E9NA 3RI5K 1KY6A 2FYYA 4IRZA 5HVFB 1ASPA 3MRFA 2YPLA 3ZHNA 3D2TA 4U1HA 4DHLA 1QKZL 3AGWA 5T5NF 1AANA 4Z7VB 5FYKL 5L6YL 3T2NH 3FTXA 3DVIA 5HD8D 3BLKA 4Y2OA 5ESAB 2EDTA 1KF9B 3MA7A 3RVUC 4AY0A 1UVQA 5DVPA 3RZCB 1NBZA 1LO4H 1OB1A 2V37A 4Y7MA 2ADYA 2FJGB 1AH1A 2UXTA 3H6AA 5BV7L 2G75A 3QGVA 3G08B 4K7PH 3AT9A 2KKQA 3MV7A 3O3AA 1ZV9A 4YHKL 3X2QB 3WN6A 4EVNB 3CSPA 4OZGF 5I1EH 4MA3B 4JFHE 5JOPD 2DIEA 3TOPA 3UTZB 5HGAA 2Z31D 5HYJD 2OR8A 5K1JA 4CJ0A 5EF2A 1FNGA 5E6ZA 3EH3B 1AGCB 3HNSH 3QUZC 4EQ2A 3W0WB 3GHBH 3DBXA 3WD5H 1S7UA 3VTAA 4UANA 4XWOD 2WZPA 2JKWA 3OXSB 3PXLA 4LOEA 3QO0A 1KPVA 2HAZA 4S0TD 1W72L 5IROA 3QZLA 3VXPA 2XQBL 3B7RL 3PQYD 4YC2C 5TDPA 5GS0C 1H3GA 1DHKA 3RWIA 1RLBA 4P4RB 1ZA6A 4NPKA 2AJUH 32C2B 1W72B 3K0WA 1R24A 4D0DA 1L0XA 2CBOA 5C0CB 1I3VA 1T3FB 4YN3A 1GIGL 2NY7H 2OLDA 4JRXA 3UBGA 4F7CA 4LEXL 5IGXH 2UY6A 3FW6A 3MUZ1 3JWOH 4XXCC 4DK5A 3HB3C 3DC0A 4LVNC 4OT1L 1H3TA 4Y4FA 5SWQA 4LAQL 4N3UA 4MJ5B 1PQZB 4DGYL 1F1GA 2NX5E 1B2WH 2WANA 1H6UA 4GUQA 5GGVL 3CZSA 5KJRL 1I8MB 5FDWB 3HPLB 4PRNA 5LQBL 3BZFB 5I5RA 3TN0D 3C8KB 4JG9A 1T5WA 1F97A 2A73A 4H0GA 5KZCD 4DKDC 5EZJA 3H9SD 1E5CA 5C0DA 3S96B 5KVDH 1FL6A 4OFYA 3RWEA 2CLVA 2IVFC 1GY2A 5H37A 1IFGA 4AGNA 4UBDD 4B9IA 3HBQA 3N2JA 4XBMA 2ZX5A 2WP3T 3RNQB 4OM1L 5E0QA 5FCUH 3EJSA 1OHQA 4J6RL 2PKDA 1QBMH 1ZEAH 4YDIH 1EMTH 4B9PA 4LLQA 1YNTF 5IVZA 4M4RA 5H8DA 1PG7W 3PGDB 3RX5A 3AITA 5IFJB 1QSFE 2IWGA 3KVQA 1LILA 5HI5D 1TJHL 1FG9C 3K7UA 1XGRA 1AG6A 2N1KA 4XNZC 3RDTD 4PJEA 1WWAX 1PX8A 4WHTA 2H6UA 1F2XK 2JIXD 2EVFA 4UWQB 1TETL 4ETQA 3KMDA 1UM6L 3RGHA 3JT0A 5K9KA 4CBPA 2VABA 5JHDE 3T77B 1R3JA 2J2ZB 2A0LC 1LWJA 2QPSA 3AFLA 3NK4A 3ILEA 4GINA 1Y07A 2IEPA 4OLXL 2VITB 5I1JH 4YXKH 4JJOA 2CSPA 1YG9A 2YK1L 3LKQA 2R8SL 2ESVB 3MLSH 2GJJA 3MV8A 4DFHA 4KZCA 2ICWB 4GW1A 4JLRA 3DX7A 2NQCA 4X7SL 1EV2E 5IROC 2IH1A 3D0VB 3L4WA 1P4BL 3P30H 4ELME 3T65B 1J0JA 2WINB 3PWUA 3QWOA 2ZXAA 2G3MA 1DBML 1WWCA 4OAWA 5TK2A 4X6EA 4D94A 1KYDA 3RWHA 1PLBA 1CO1A 1NEZG 4QDGA 3IJEB 4OI8A 3L3GB 1L5GA 2VDMB 4N0UE 3DGCR 1PLCA 1WP6A 3HCVB 4PS7A 2GFBB 4NRXA 5EPMA 2ENQA 2NY2D 2BNRD 3WLBB 3LX9A 4QRRA 3P2TA 5DEJA 2IG2H 3B7UX 4RH4A 4Y4FC 1B4TA 1NOLA 2UUDH 3IDXL 3KL3A 4NN7B 3KCWA 2AEIT 2W07A 4HGWA 5GGSA 4O2FA 4V33A 3GMOA 1U91A 4PJXE 4Y1SA 3V0AC 4NZUH 5DYOA 3QDJE 1JK8B 1S7QA 1FORH 4KXZI 4M7LT 5JOFB 3BLBA 5L88L 1HKFA 1OE3A 1BAFL 2Y22A 4BKTC 2FRGP 4FERA 5AB0A 4ZOEA 3ARPA 5IMMA 3OC8A 4LVHB 4ZFGL 3MRDB 2VR9A 5E4OA 5F71A 4MS6A 5I19H 4D9RD 4AGMA 5HVWA 3G3LA 5C0EB 4YSEA 1F2QA 1KJ2H 4DCQA 3B9AA 4YO0A 2D7TH 4Z5RB 3QDGE 4CW1A 1HAWA 4K3EL 3WJLA 5DQDL 3X13B 2AK4D 2ZOWA 3N1GC 4K5NA 4JY5H 2UVFA 4ZS7L 4Q4IA 4DETA 4DF9A 1OL0A 4YDLB 3D85D 3G6DL 1MSPA 3O4LB 2CHDA 3MJ8B 3HC0B 3L2NA 2DQ6A 5C86A 4O51A 1JVOA 4KKLC 1TNNA 3VFNA 4U31A 2DLHA 1DFXA 4HALA 2F1EA 3KE0A 1IX2A 3TF7C 3O2DL 3ULVD 2WTRB 2E6QA 2QTVA 1MCSA 5ANME 5LXGL 2XACC 3OVUB 3OTTA 4L0PB 1VZIA 2XG4B 4CVZB 4XMKL 5F70A 2F0CA 5AZEL 3WFEH 3PAZA 2JB5H 1WZ1H 4GFXA 3WTSA 4L4JA 1XGZA 4FMVA 5E2TL 2HJLB 2EDEA 5DD0L 2EH8H 2C7UA 2CBQA 2HLAB 3AS0A 4WJG3 1SNRA 4YDVA 1JYNA 1PIFA 3DXAE 1K2DB 1JGVH 2WTOA 1DVZA 3GZOA 4JRWA 4JZJB 4NN6C 3AXLA 4G5ZH 2GB2A 5AKTA 2XFXB 5I74B 2NNFA 3L3HA 3VI4A 5IKCA 3QQDA 1JPFB 1JBJA 2EDOA 4KKAC 3T6XA 5B39A 2Z31A 2E8YA 5HYJA 2BIMA 25C8H 1RJZA 3GGWB 2YO3A 3T71A 1WH0A 1N64L 2VLRB 1TO4A 2ZKHH 4TMPA 2ALAA 2CIKA 3I50H 3MAWA 4G59C 4K9JA 4KUCD 3OHXB 3MRRA 5EU6E 3PQYA 3FCUB 3K72B 3O3BA 2WXOA 2JI1A 5A2AA 2M2DA 4RFEB 2WLYA 2ZUQC 2MOQA 4PJFA 1D5XB 2F74B 3ABGA 4URTB 3X3GL 1DJIA 1M1XA 4XZUB 4U1LA 5MHSE 2B1OA 1U95B 4PJ5E 1FGNL 5CINL 5DYFA 4A39A 2BERA 5EU5B 4KV5E 3IU3B 3F7LA 2CCVA 5CXPA 3R06B 1E7UA 5B3JE 1J1PH 2PCXA 1P6WA 4NQDE 4BSVB 3QUKA 5EH1A 1AQDB 2MHAB 3V4PA 1Z3GL 1AZZC 3WMSA 5DD5L 4I9XA 1NGYA 4BXVA 1OAKL 3PHQA 1E40A 4ODUB 3VD7A 4QOKB 4RVBA 2LLLA 2YMXL 3N85H 5KAQG 2B4CC 1ZLSH 1VGEH 3TA3B 3WJLC 2IANE 3S8GB 3BPOB 4YE4L 2AJVH 5EC2A 1J87A 2CDGB 4MD0A 3TN0A 4XN5A 1ZV5A 2ZUTA 3H9SA 1DLHB 1NGQH 4TLUA 1IQDB 1MIEH 2QMKA 3VG9B 4AMXA 5JLZB 2X42A 3MRLB 3KS0H 5IQ7L 3WS3A 5FA4B 4ZDHA 1NCIA 1UM4H 3BW9A 3BXNB 3MUGB 5CU5A 3NZSA 1EBPA 2FIRT 3QUGA 5D7JB 1P4UA 1F3DJ 3VI3E 4A04A 1JHTA 2AKRB 2APXA 2VDNL 7PCYA 3NFPB 1MFVA 5HD8C 1BMGA 1L9QA 3WIIL 3TNMB 4EF3A 4GEIA 3D3VD 3RFZB 1S7SA 2YC1A 3BZ4A 1MCEA 3N55A 3TH3T 5CSZB 3TV8A 3B9EA 4I88A 4DPRA 4JFXA 3RDTA 5JYMA 4WFGD 1VSCA 4YHZL 2HZHA 1CICD 3HRZB 5E8PA 5HJ3B 1WK0A 2OP4H 3QG7L 5IG7A 1KTDB 5SWSD 4C8XA 2BO0A 1RZFH 3RL2B 3US0A 2OAAA 7CGTA 1DVFD 4OM0H 1GC1L 4CADA 2Z31C 4X4MA 4LGRB 3GJFA 4PGCB 2BHFA 2JELH 1U36A 2K9UA 3LS5L 2XA8L 4K5PA 4YDNA 5T1DL 3EJYC 3QFJD 1BG1A 5GGRA 4BV1A 1R0AL 1CURA 1OXYA 3TYFA 3U9PL 4XWOC 4PR5B 3GI9L 5FB8B 2Q6WA 2DIAA 4Z78B 5F96H 3O2WH 2E7MA 2RALA 3HHRB 3V52L 3LKPA 1U92B 2WXNA 3P4NA 2NUPA 1JNLL 5JPMA 5C0FA 1G6VK 1CBJA 1EZLA 1ZHBA 2J1WA 3CVBA 3FK3A 3M1BA 3PP3K 5KBDA 3D51A 1PZDA 3EDEA 2AITA 2VLME 3FU7B 1R3KB 1GYCA 1QAWA 5I66B 1MI5B 1IBFA 2PCPB 3VNYA 3KBEA 4Y1AB 3ZYJA 1K6QH 5GGUA 4X6BA 2BNRA 4H7VA 2Y36H 4F7EB 2DI8A 2WYHA 4PHXA 5HXMA 2KBGA 2A6JB 3COOA 4NZTL 1ZHLA 2O5YH 2QZQA 5F0PB 1F0LA 2JXMB 1G6RL 4FHBD 3PGFH 5G5DA 3ZE1B 4M03A 1LP9B 3PY9A 3LRMA 4FQJL 3L9BA 1NCWL 3SPVB 4YIQA 1FG2A 4KMLB 4MAYA 3TN0C 4LRIA 2A6IB 2JI2A 3QIUD 3LEYH 4MNHA 2VDKH 3BQUD 4HK0B 5AW8B 4F9LA 3VU2A 3UGUA 1RZKL 1A4JB 1WS7A 3L7EA 4NNYA 3NACH 2ZPKH 3DETD 2EXSA 4UBDC 4M93C 4WJ5A 3UDWA 1O9VA 5IFAH 2XPGA 4YZWA 4WWID 3QVAA 1E0OB 2X09A 4R9HA 4DKEH 1SQMA 3GQFA 2BP8B 4BH8B 5AW1B 2PP8A 2JLLA 2XWTA 4F37F 1HHGA 1MFBH 3NIFE 1L9TA 3BP5B 2HFTA 5HI5C 3WKNA 2A77L 3HPJA 5DHDA 2E59A 2AK4A 5CZKA 4P5TD 3G6AB 1T7WA 1CT8B 2WLHA 5C0AE 5EBMB 3RDTC 2PPAA 3VXSD 4JRXE 4K94C 4L3AA 5IQMA 3C6SB 2FJFB 4TOYH 1BQLL 3WOVA 4R7VA 5IVXE 2K4WA 1RURH 1ZLUH 1WVZA 3UTSD 3QUYD 4L8SA 3FB6B 2FQDA 5MEND 5D2LA 4I3RH 4U2ZA 4FABH 2F8OA 3DX6A 1O7DC 4DVBA 1SYSA 2JV6A 4QRSA 4AQAA 3U7WH 5E94A 5DR5L 5BMFH 1CTOA 4V2CB 4YL4A 3OAWA 3MACH 1CXIA 4CNIB 1EXGA 3U6RB 2WVVA 3R4RA 1Q9LA 4KZEL 1EK3A 5KS9B 4MZ2A 1CZ8L 3EADA 4YPGA 1TVDA 1KLGA 15C8H 4J1UA 3U2SB 3QNYA 5EUOE 1TJGL 3FUNA 3S6CA 2I9LA 4PJGE 1KIUA 1OAZH 1BJ8A 1VRSA 2EE3A 2P8LA 4MMYA 5ESVB 2NQ3A 5JPMC 2YMTA 2X4TB 1QRNB 1EQWA 3OPZL 2GI0A 4R7NA 3VD0A 4JHBA 2ADFL 2YXWA 3H7BB 2ADGB 4J6IA 2VUKA 3BFWA 3EJZD 1OARH 4JO2L 5HYQA 3OR6B 4PJEE 5JORA 2JCCA 1HZHH 1WFOA 4M9OA 1IGJB 1QX1A 3DI3B 2H32B 2R29H 3HC2A 4YHML 4GP8B 6CGTA 3NK3A 4HPYH 4JZOB 1CTMA 3E6FA 1CGSL 4LSPL 4PBVC 3ZDZE 1HK6A 5FYKE 5E6RB 2NDFA 3U9UA 1VEMA 2ZXWB 1U4EA 4UT7H 3CN2A 4MAYC 4QY8A 4LRIC 2DLFL 1IEBA 1SBSL 4J12A 1TQTA 1G87A 3APNA 4F9LC 4ZPTA 4CKVX 4HD9A 4DUXA 5E2WL 2X9XA 4Y5XA 1HHJA 1NANH 4WNJA 3UDWC 3MV8E 4ORZC 4LKXB 3OC5A 1E3XA 1JJUA 4OVVA 2C4XA 1J1OL 2WSKA 4GBXB 4NNXA 3DPBA 4EDWL 2YBRB 3HG0A 2R1WB 4K2UH 5HDWA 4ZMZA 2JKIS 4LVEA 1O6SA 1CGXA 5AZ2L 3BGAA 4ABQA 3U7YL 1D2OA 4PJHA 3RB7A 1YJDL 4FLHA 1X4XA 3HZKB 4DWHA 2X4NB 4FKHA 4A7GF 1I7RA 5CIPA 5K9OA 5ITFA 4U6HB 2CJTA 3BSGA 1R5IA 2CIIA 4EIUA 3PABB 4J3VA 4XX1G 1P4IH 3OGOE 3KPSB 2CGZA 4L8SC 3CQPA 4S2SA 1UC6A 2J88H 1IFHH 5E0FA 4X8GA 4U3CA 4JPKL 3ULVC 4EE2A 1WZLA 1VFAB 4YNYA 3ZZQA 5CGTA 2VERN 3PL6B 4S1QH 2Y2TA 1X9RA 4UZUA 5I6KA 3O41A 3LZLA 4GOSA 1J1XL 3E6HB 4XPTL 1HT6A 3CBRA 3IXAA 1JZ8A 4GP5B 5HYSA 3D3VA 4QRTA 3ROOB 5I5MA 2E75C 2OFQA 5IQ9B 2YRBA 3MOBH 1A1NB 1R17A 1N5YL 4ELKA 4MJJA 4B5ZA 4NQSA 4MD5B 1CICA 5GRYA 1ZPUA 1HVXA 4K7PX 5CFHA 3T0DA 2VMDA 5SWSA 3L7FA 1JRHH 2FB4L 1CDJA 1ZHKB 2K78A 3L4UA 2ROXA 2YD6A 4B95C 1KPUA 1WIPA 4PJIE 3FQ4A 5FO7A 3C8DA 5E6IB 5IF0B 4KH2A 4JM4H 5B3SB 2EILB 3U4BL 3QFJA 5L2KD 1MHHA 4OI7A 3UO1L 3GRWA 1HJCA 1V54B 1TVBA 5IMOB 2AZAA 2BFVH 1NBYA 4XWGH 3BGFB 3MU3A 4XOAA 2O30A 2FQGA 5D1ZI 4N2IA 3WFHB 4I0KA 1QVOA 1IQWH 4OUUA 1D5ZB 3ATDA 1FN4B 1KIPA 4L29B 1L3NA 4BE6A 4AMWA 4KRPD 4Y5XC 3MGOA 2LT9A 4ERSH 4HZAA 2VN7A 1BOGA 4X9BA 3LTVA 4NFBA 4E9XA 1YMME 3CSBA 4N5ED 2V7HA 1W0WB 1QZ1A 4LSTH 4GRWB 4PB0H 3OZ9L 2AK1H 3LY6A 1ODAA 1TZHA 3PDDA 4U4BA 3T6QC 1T0MB 2XVGA 2AJXL 2Y2YA 5JQ6H 4RAVB 4Z7WB 2CGYA 3MREB 4G80B 4FHKA 3BQUA 3CVIL 4ALAH 2YA1A 3DTDA 5K39B 2LU5A 4L8BB 5IESH 2ADJA 2K3TA 5ID0B 5MEOB 4L37B 3QXDB 1BW8A 4L4VE 1OAUL 3WNNA 3WNMA 4L0YA 1T4KB 2VDOL 3CK0L 4YFLI 3KWUA 3X3FL 3F64A 2XQYK 3QI9A 1SOXA 1CE6B 1UZ6E 4IQHA 3F83A 3FUHA 1E4HA 5F9JB 3TJEL 1F45A 1AO7B 1J7VR 3Q8EA 4HWEL 4PJDA 1X7QA 5E24E 2H0JA 4P5TA 1FNEB 5E00B 1QOKA 5GRWA 3VXSA 5HHQA 3UTQB 2JKJA 4AM0B 4LVOC 1CICC 1IBZA 4MWFB 5BOJA 2VSDA 3ECBA 3GSVA 4LU5L 4KI5D 2MNWA 5C08E 3UTSA 3V55A 2AJSL 3QUYA 2PXYD 2VC2L 3QQ9D 4F2ME 3WJJA 5MENA 3BP4B 2B77A 5EA0H 2I24N 1D5MA 2FVNA 4OD2B 1DVUA 1DSFL 1UKSA 3GXTA 1J8RA 4BFGA 5I76B 3K8LA 3X1FA 5D4JA 1NDGB 3CIAA 1MNNA 1MWAL 2CGRL 4M48H 1MHEA 1SVCP 5FW8A 1CR9H 3SDAD 2UZPA 4PV9A 4FADA 4G6KH 1F11A 5E8EA 4PWJA 4XVSH 4JHZA 4BKLB 4JQIH 1B6DA 2YSSA 4JPIA 3B1TA 3C6LB 1YCSA 3NCBB 3HJ0A 2CO7A 4O4YH 3O3EA 2W9LA 4JR9L 4MFHA 1E4KA 2EIEA 3FF7A 2GIMA 4A2DA 2E86A 3MNDA 1CLYH 4PJCA 2BZCA 1U8QB 1DQTA 4TRPL 3UPAA 3RL1A 1UZGA 2OTWA 1UWGL 3FTZA 3BZEB 2VMEA 2R1YB 5ALCH 4M8QB 5D1XE 5C70A 1CD9B 1T5XA 3B2UD 5CP3A 1A4KB 2OMUB 4OIIL 4QO1A 2KERA 1RLWA 5IQNA 3X1BA 5J8OA 1IIIA 5CBAB 5J6GB 3BQUC 3ETBJ 1XR9A 1XF4A 1OTTD 4ONGH 4KQ0A 2IDQA 2KT6A 5CEZH 5EO9B 5FLUA 3GXIA 1FVCB 1H19A 1JWMB 2B15A 4LLUA 4F7PB 1RCYA 3APDA 5EZLB 5C97A 2EKSB 3KPPB 4BRVA 4ELMF 4NT6A 5D1QB 3QI9C 3B8YA 1YQVH 4LNRB 1NAML 4AQEB 3AUWB 2ROYA 1EWHA 2DD8L 1EVUA 3C8HA 4P0DA 5JW5A 4NKDA 5D7IE 2QSTA 4P5TC 2ZWZA 4TLSA 1UEYA 3QHZL 3HNVH 2ZOKB 4D9QE 1CIDA 2PR4H 3JZYA 4NN5B 1ED3A 1RVFL 3UYPA 2G60L 3MXVL 5AFAA 3T4AA 4L4TD 5E2UH 3T1WA 1E9PB 4FN0A 4MBOA 3QUYC 3IWVA 4PS3A 3O4OC 3WJJC 4UT6H 4C58B 1DQIA 1MJ8H 2EYSB 3CFDB 4JHUA 4XZ4A 4PJXF 3U83A 2BCKA 2EACA 3FT2B 5DD6A 5DMYA 1JGUH 3WIFB 1I7TA 1WC7B 3L16A 1ASQA 1R3LB 1TFHA 2JJTA 4TUKL 1DJXA 5HVHB 5L4FA 4NCC2 3GHEH 1MF2H 2F5BH 2IGFL 3IE9A 1RUPH 3JWDC 3EYQD 1FDLL 1Q90A 2O5ZH 3FB7A 2E46A 3LNHA 2E56A 3P69A 2YD1A 3LPWA 2HPOA 2P45B 4NCDA 1G7IA 3UTTD 3FPYA 4UTCA 4XPGL 2FWSA 4HBCL 3WJMB 5FA3B 1FL5A 1YZZA 3QJUB 4WWOA 1U8LB 4UNTA 1S9XB 3WFBH 2BSSB 1NA8A 1A14L 3GBNL 5L9DH 1EHKB 1E4KC 4MNQB 1BPLB 1UWEL 1BVLA 2G4EA 5TFSL 2AMGA 5L2KA 5C0RL 1Y18B 2GC4C 4KK8D 5LB1A 4APXB 2IO5A 3QNZB 1SEBA 3D2UA 3ETSA 4RNRA 4G43A 2NNXA 5EORH 4DZ8A 2VLJD 4L3EE 2OK0L 2G0KA 4W70A 4E42A 5A6LA 1MUJA 2A9DA 3C5ZD 3I6GB 3IWUA 4KKCD 1ZY9A 2ITDB 2ZUXA 5F6HI 4FX5A 1J10A 4B27A 4PTUA 3LPOA 4OV5B 2UXFA 1P6AB 5I30L 1J5OL 4P2QD 1D7DA 3MRQA 2I69A 5EOCL 3WEAA 5HDBB 1SEQH 4OD1H 4ONFL 5SX4I 4YHPA 3UMNA 4XCNB 4C55A 3UXFA 1BQSA 2RCSH 1YEFH 1QBLL 1NDMA 3OAUH 5DRNB 2EDRA 4JVPA 2BVQA 2IPKA 5BS0D 2FE0A 2BSTB 2A6DB 4EZMA 1IM3D 3JYBA 1T0NA 4I1PA 3I9GH 2TSAA 2NLJB 3QDMD 5CEYA 4PGBA 1BLNA 3L4YA 4Z0BH 1BF2A 2BSRB 3GF8A 3T4AC 3MNWA 4M61A 5DQ9A 3IJSB 2BIQA 2FQEA 2JCCE 3CHSA 1FFOB 4NLAA 1BJMA 5ILTL 3KEHA 3GSNB 2MQGA 1HWHB 2UZIL 2W92A 3HNTL 2MTPA 3MUHL 4Y2DB 4OY9A 2X4SB 2QKSA 3FKUS 4ONOA 4WHYH 3WSQH 3IJ8A 2H7WA 1NMBH 3ZL1A 3VXUD 3W39A 2JJTC 3PPSA 2X4PA 4NO2A 3ZHLA 3W5NA 2WQAA 1MJUL 4KV5F 4R6UA 4XH2B 1CFNA 3PWLA 4Z7OF 1KXVA 4DVRL 3QZWB 1XTLA 2CJUH 5AEAA 4RGMB 1HH9A 4BYHA 3FAXA 5JW4R 5CSGA 5T1LB 3U46A 4WTQA 3ES6B 4X0KA 2PXYA 3SCMD 4OJEH 1NM9A 1N12A 4F80A 1V10A 2BS9A 4JS7A 2GJRA 5CZRA 5FF6A 2X4RB 5HHOD 4UM9B 1OGAE 3MLPA 1JPEA 1WBXB 1KYAA 1KXQA 4FP8L 3H2QA 3RWFB 4PY7A 2BVYA 2P8MA 3GD1C 4PIBA 5E56A 1LK2A 1I85A 2F53B 3DECA 2YEQA 4I5BB 4WW1A 4XMPH 4TTGA 1A02N 3L5XH 4XVTH 1V3KA 1E43A 5EFIB 3SBPA 4DGVL 1MQKH 2XZAH 4FNLH 1I1RA 4NZRH 4F93B 3AVEA 4HGMA 3RVVD 1IL1B 1NMAL 4P5KB 4WCYH 1FE8H 1UHVA 1U8NB 1P7QD 4Y9FA 1FFNB 1JNHA 43C9B 4IRSD 3GSQB 4XP6H 3QCTL 2BVEA 1G1CA 3B7YA 2XOTA 4H20L 3S2CA 3U0TA 5F0MB 5IEHB 3CX2A 2P48B 1A5FL 5D7KD 3G5YA 1EAJA 3VCLA 4DO6A 1C12A 3BWZA 4HWUA 5DK2A 5GISH 1XH0A 3Q9PA 4KTYA 1U8HA 4XRCA 5TE7H 5JHLA 1R5VB 3NGBC 4G9DA 2QR0B 4KNSA 4M43H 1ZIAA 3TXAA 1JMXA 3ZUCA 4ZX3A 4LSUH 2B5IB 4MGXA 5C92A 1NINA 4G7VL 2B1HH 5F89B 4A2EA 5EIQA 2R56L 2ED8A 3VFTB 1CFVL 4IKNA 1B4RA 4EDXB 5FUCE 3SIKA 4NJ9H 1RUQH 1OQOA 2EDLA 2LQRA 1DQJB 4OZHB 2KYIA 5AAWA 1KB5B 2HJFA 1DUYA 1YAIA 5LCVA 2LAGB 1AGFB 35C8H 5ISZB 4YUEH 1XCWA 2OZ4A 2QELA 1KN4L 2B16A 1CU4L 4LQ1A 3S35H 2APFA 3V6OE 3EOAB 4WTXA 2JKLA 4JO3H 3CFEB 2PABA 2B39A 3KR3H 5FLVA 5BJTA 2Z92B 2QGDA 1KXVC 3LZFL 4FQCH 2VZOA 2G9KA 2F54D 1IAKB 4HXAL 3VO0A 4JNXA 3L3OA 2HSIA 4JFFE 4L4TA 3MDJA 4TSAL 2R2EA 4UTBL 2KZ1B 2B0SH 2PXYC 3QQ9C 3CHQA 4PRPE 4QRPD 4WI4A 3L5HA 2F1AA 3ZTCC 3P0YH 3WG7B 1H9VA 1C5DA 4J3OH 1FNSH 3MLVH 4AJWA 4ZFZA 5DD1L 2ZONA 1T7VA 1VESA 4NOBA 5B1AB 1I85C 3WTYA 1WGOA 2DQJL 1PZ2A 2CLRA 4HS8H 3O6LH 4YVNA 2VAJA 1T21B 2ZP9A 1D2PA 3KPLA 3QUZB 2VDLL 2P26A 4Z7IA 1AR2A 3OJMB 3RWJB 2XDHA 3MYZA 3NH7L 4GQ9L 5IJVB 5JXED 3UZVA 2VXQH 1NFDE 4FQ2L 5F93C 3PS6A 3KPMB 4Q14A 3UTTA 4FAAB 2BS8A 2APBA 3D48R 2VDLB 4YC2B 3NIFF 3BH8B 1R3HA 1HSBB 3QA3A 2NNRA 1FYTB 3F7YA 1RU9L 2BHYA 4NENB 5I1DB 4PGDB 3DGGA 5FGSA 4Q58C 3VRIA 4PYGA 5TH2B 1M05B 4LF3A 4BZ2H 1WT5A 2R0ZH 2UXGA 5IHHA 3RIFK 1LLAA 4OCLC 1YPZA 1IMHC 3HB3B 3L1OL 1FZKB 4LVNB 3B2UC 2VLJA 2WZ0A 4GO9A 3P4MB 2CDEA 2H1PL 5JR1H 3C5ZA 2CUHA 4U1JA 3IN0A 1QRKA 5DZPA 5EIIG 3ZMRA 4MMXA 3TP4A 1EHLL 4IRZL 2QVKA 3OKEB 1OTTC 3MNMA 4RA3A 1JMZA 1NEZA 3OLEA 5AAWC 1XZWA 3I85A 4ORGA 4P3WA 1P7KB 3BHBA 3V6FA 1ECYA 1IIKA 1WS8A 2FYYB 5DD3H 3ASWA 3MRFB 2YPLB 3ZSSA 3MQIA 4PJGF 4U1HB 4AGOA 4JO4L 1HCYA 1THAA 1UOVA 4IOFD 4WEUD 5KUMA 5BS0A 3BKCH 1GYVA 4X99A 3ULUL 3TLRA 2W60A 3QDMA 2BDNH 4Y2OB 2NSXA 3MA7B 2XJKA 1A1MB 1UVQB 1THCA 1OSZA 1NBZB 2WTPA 1OB1B 1WCBA 3DWTA 3L3OC 4XNZB 3R7RA 1WLHA 2OQJA 4OVUA 1U33A 2BPBA 5LLIC 5AB1A 1F4YL 3FFCE 2G75B 4JRYD 1O0VA 1KGUA 3ZJAA 3DDFA 3BPCA 3N44F 3MV7B 3ZDZF 3O3AB 3A4AA 3UP6A 2VDQB 3VXUA 2EC8A 5HGAB 2FLMA 3VXQA 4WF7A 1V7MH 1IFRA 2D7QA 3UEQA 3AG1B 4MAUL 5GGQH 1FNGB 3SE9H 3ZTJG 3EDKA 4UNVA 4OLUH 1P7HL 1I9JH 2FJUB 2O61A 2BHUA 3DBXB 1OE2A 1S9VA 1PZSA 2FEEL 3EYQC 4NC1E 1S7UB 4PV8A 1JZ3A 1KYOJ 2CRMA 4NQCD 4U33A 5TE4H 2JQAA 3QO0B 1KPVB 1BX2B 4HS3A 3SPIA 3SDXF 4AIZA 5CEXA 1ZT4A 4AKOA 4I1RA 4YSOA 3SCMA 2ZKMX 3VXPB 4LHUD 5TDPB 2ENPA 2EO9A 3RWIB 4G6FD 4WNQA 1ZA6B 4HJ0D 5HHOA 4D0DB 3W5MA 1R24B 1JFQH 4XI5D 3TPKA 4M56A 1WT5C 5E99H 2V17L 4N4YB 4F7CB 4JRXB 2E8ZA 2EDWA 4TQHA 2D03H 3MO1A 4KK8C 2UY6B 1X5YA 5B8CA 1SLXA 2H0FA 2N0MA 3PJNA 4WEBL 5T5NG 5IVXB 4OCWH 3KPRE 4WUUD 1E7VA 3FH5A 1MEXL 2K70A 4Y4FB 3ZDYE 5SWQB 3C5ZC 1IE5A 1P7QA 2A9AA 4KKCC 1C8QA 1BD2D 2O6CA 4MMXC 4JL1A 4IRSA 4PRNB 4G72B 5JMOC 3GTTA 3NCYS 5GIRA 1T5WB 1Z9LA 2A73B 3NCWA 3O6ML 3LZOA 5DWUH 1KELH 4KKNA 3PXJA 4KY1L 4L05A 5EZJB 5C0DB 1FL6B 1TXKA 4M7JH 2CLVB 3RWEB 4L3FA 1IBDA 4UB0H 3X1GA 1G9NL 3AY2A 3QC6X 4LSRH 5CHNA 4EEEA 1MKFA 5IBTL 2J1ZA 4U6VH 4DN4H 3E1ZA 2C9QA 4DP8X 5IEKA 5TDNA 4NWTH 1QHPA 2OMWA 4MMZA 1DANU 3WO4C 5GHWH 4LLQB 3LDBC 5IVZB 4M4RB 1WAAE 1SOQA 3PE9A 1IE4A 1UXLA 3F6IA 1A66A 2VR6A 4FA8A 1UADC 4PJIF 4MNGE 3NABH 5MEQA 1TLKA 4LBEA 2BHZA 1XGRB 4DOHE 4WY7H 6TAAA 5ITBH 5JMRA 4GKSA 3S34L 4PJEB 5LVEA 5DVLA 4WHTB 1K5NA 3TYGH 4ETQB 3T2OA 2DL2A 1FRGL 3KCPA 4BWWA 5K9KB 2XZQL 4OZFG 2VABB 2IFFH 1R3JB 1MJ7H 2AJYL 2BY2A 3JUYA 5DUML 1DQML 1PBYA 2OCFD 2JJUA 4ODHL 3G6JA 3PU7A 5JPNC 5KSBA 3NESA 3LKQB 3QCUH 1TMCB 1VERA 2F54A 3MV8B 4N8CH 3KH4A 5F7YC 4GW1B 4JLRB 2YZ1A 2Y1AA 3DX7B 4XP5H 5B1KA 2IH1B 3ATEA 4WV1B 4NC2B 5KBMA 3SCMC 2PTUA 3PP4L 3DX0A 4QRPA 1XB6A 1RUAH 2I07A 3FH8A 3LRSA 3PWUB 3QWOB 4NN6B 2DYRB 2VLLA 4OAWB 1QW9A 2Q8AL 5BUAA 2DLTA 2E9GA 1HSAA 4X6EB 5B22A 1DSYA 3RWHB 3NN8A 4IW4C 1L5GB 4OJDH 5CJQH 1M9WA 2Y7SA 4LARH 4BZ1H 2IGLA 3II1A 3NPSC 4NRXB 5FC9A 2H4EA 5EPMB 5B8CC 2CAKA 3T2NL 5LNEA 4Z76A 5SWZD 4QRRB 5JXEA 4JG0H 2J55A 4P5SA 2J8UE 3HLKA 5GGSB 1ET7A 4QEGA 2W07B 4HGWB 3RVVC 4O2FB 3EYOA 3GMOB 2A9CA 4KVCL 1UZ6F 2Q9OA 3MV9E 1LO4L 1X5IA 1YECL 4IRSC 1IC5H 2ZUQB 5DYOB 3SKOA 2CKNA 3OGCA 1S7QB 3ZQWA 3RA7H 2Y7LA 1TUPA 2M1KA 4K7PL 4UOW1 1GGIL 1ESOA 2NRDA 3ASOB 2AS5M 1JXFA 1TO5A 3W3BA 5IMMB 3MBWA 2OMTA 1P0SE 1PIGA 1S9KC 2QBWA 1O9ZA 4Z95H 4MMZC 3WENA 1LXMA 2YWYA 2F9BT 3VSVA 4DCQB 3HNSL 3LRHA 4YO0B 1E5YA 4XO3A 4YFDB 4CW1B 4M5ZH 5ENWB 4FA6A 1JE6A 5EDSA 1D7FA 2BY3A 3EFOA 3OG6B 4FXTA 3NQKA 3U4EA 4QD2E 5D1ZD 1R47A 1RZPA 4FE9A 4N2BA 4O51B 3ISWA 3E9UA 3L5JA 4XMLH 2AJUL 5AB2A 3VFNB 1BREA 2BINA 2DTMH 2X0UA 3H55A 3HRPA 1FCGA 1M4KA 1HNYA 1J5CA 2C3VA 4XNUL 2CR6A 2NY7L 3GT6A 1QYGH 3V6ZA 4N0FA 1OSEA 3JWOL 2QHRL 4FZEL 1ZSHA 2KC0A 5E4IA 2FJHB 3TESA 2MNJB 2WNWA 4M7KH 5AENA 1L9MA 4KRNA 1ZANH 1B2WL 1MW1A 1MRFH 4A67A 2P5WA 2C7UB 4YDVB 1NCTA 2J72A 5CGMA 3GTNA 3ZRFC 4JRYA 4N68A 1J0HA 3AXLB 5C7ZA 2LABA 3X1EA 3L3HB 3VI4B 5IKCB 3QQDB 4P07A 1OV8A 1KLUA 3TVMA 5D71H 4NPJA 5B39B 2Z31B 5HYJB 5FCUL 1RJZB 2NY6D 1Z5YD 4E68A 1E4WH 1QBML 4WHYG 4YDIL 1EMTL 3KW7A 2J5WA 3ESVF 4NQCA 4YHNA 4NNPL 3FQWA 5JXEC 2CIKB 2F2HA 4H1LH 4YBLB 3WIAA 3RUGA 5I6LA 4W81A 2J44A 3MRRB 3PQYB 4LHUA 3O3BB 4JJHA 4D7PA 3IB4A 3BEVA 4RRPG 1GGYA 4M1DH 1E8YA 4PJFB 2B9BA 1OD7A 5D7IF 1OB0A 3V4PL 1M1XB 4XVUD 1MXGA 4U1LB 2A4CA 2YD4A 3ATFA 2EEBA 2XWXA 3MJ9A 5H4YA 2PR9A 4ZNEE 1OP9A 2Z65C 3PXHA 1TITA 2CR3A 3CSTA 3QUKB 1G94A 3V4PB 2V5SA 4X5PA 5IZ7A 4TTDD 4HEPA 1NGYB 3NAAL 1JZGA 2M83A 5CGYD 4WUUA 1DVSA 4Z7NE 2V3DA 3PHQB 4KHTH 5D70H 2ZWKA 1LO3H 1ZGLA 4A2GA 4ZFOA 3BUYA 2AQPA 4PRHD 3MLSL 3LNFA 5J0BA 5JNYA 2ZG2A 3BSZH 5E1IA 3EJPA 4MD0B 5CR8A 3TN0B 1CLZH 2GAZA 3P30L 4FNSA 5KZCB 3BD3A 3H9SB 4RISH 3RG1C 1AXTL 3DURA 3QXTA 4JX0A 3IFNL 1PTZA 4IK6A 2HVJA 3FDWA 3IU4H 4M93B 5TQ2L 3RWDB 3WS3B 4ZDHB 3WMPA 3DOIA 4GW4A 4YGVA 4IOFC 3BW9B 4JN1L 1TYJA 1XD0A 1E2VA 1K3IA 2WLLA 5IW1A 1WD9A 1JHTB 4BA8A 2WKLA 1OPGH 5E8NA 3Q2LA 1ML0A 1S7SB 2YC1B 3BZ4B 5I8KH 2R4SH 3V4VA 4JFXB 1FZOA 3QR2A 3RDTB 4YVUA 3OHMB 4KZDH 4XB3A 1A9BA 2KUTA 3IDIA 2H1XA 4MS8D 4NZUL 5E8PB 4AV4A 4EI6A 5AVXB 5CLTA 5F44A 1FORL 3OKNA 5AVVB 1T7ZA 4KXAA 2X6CA 5IG7B 3FN9A 3CHXA 4L5FL 3PRZA 3IDYC 4LNVA 4O58H 4HCRH 3UZQA 1AHKA 3TVMC 2ZYIA 5CFAA 4CADB 5GRVK 3GJFB 3QT2A 4JFYA 3BPLC 3DHPA 1WHPA 5CUSH 3UAEA 4F92B 1J9RA 1JSYA 1LMKA 3N1PC 4FKKA 5AW2B 2DEWX 2DQEH 5AKVA 3DGDA 3ARRA 5IBUB 3ZE2B 1KJ2L 3RU8H 4S0SD 5T5FA 3QJXA 4GG6F 3TYFB 4B60A 4D3CH 1EZSA 4G11A 4Z3HA 1QUPA 2Q6WB 4JREC 1ADQA 2EC9U 3LKPB 3P4NB 2NUPB 2EUXA 5LDUA 5JPMB 2VYRE 3QEHA 5C0FB 1VHPA 3SD2A 1OO2A 1ZHBB 3LHPH 4HJ0C 3M1BB 1L9PA 2D7NA 4JKLA 4S10A 2PCYA 2GTQA 2QL1A 4XI5C 3WNOA 1G4RA 3ARWA 4K9EL 4ZMAT 2WCSA 2YOAA 4YXLH 4U7SA 3FNKA 5D7SH 5GGUB 3SKJL 4X6BB 2BNRB 1A6VH 5AWNL 3HTLX 5SWZA 3T1FA 4ES8A 2NNCA 5F7WC 5I1AA 1GGBL 1EZUA 3WFEL 3EBIA 3J7HA 1ZHLB 3FUEA 1MW3A 3FRUB 1WZ1L 1JXKA 5LBSA 3NIDB 4XNBA 5G5DB 5C0BE 1ZRUA 5AAPA 1KFAL 1TZ8A 3HLAA 4YIQB 1FG2B 2EH8L 4MAYB 1J0ZA 2FQFA 1JGVL 4MNHB 3WLWC 1S4IA 3FQ2A 1TT6A 1M71A 4NNYB 3L7EB 1YEHH 2CBMA 2YGQA 4RAHA 3P4LA 4J2QA 3VA6A 3TPUA 3DROB 4WJ5B 4P3CH 1WITA 3HN5A 5EV7A 3ZE1F 4AZ8A 4PFEA 2XPGB 1P6FA 2P8PA 3LN5B 3VSUA 25C8L 3JV5A 5EC1A 4GXUM 3EJTA 4TVPD 5G4NA 2XWTB 1IB5A 5C71A 1HHGB 5JIMA 1I3RA 3OMIB 1FNHA 2X28A 3UC0H 4LGPB 2ZKHL 1P53A 1R19A 3IRPX 4FFZH 5C2UB 1AGEA 1ZLEA 3HPJB 2JVUA 3BPNC 2AK4B 3I50L 3WEOA 1ZXQA 3W1ZA 3L9EA 4P59H 2NYYD 3FQTA 1OGPA 4MXWH 5D1ZA 3ULVL 5KJ7E 2GSMB 1EDYA 3K6NA 4L9LA 4L8SB 4U6XA 5AOLA 5EF0A 3DRTA 1FCCA 1X5JA 5D2LB 4ZSOE 2CK0L 5GRUH 1AZNA 4PUBL 5DJ2A 5T3XH 3P1VA 3DX6B 4DVBB 4HJTA 1TDQA 1PKQA 1SYSB 3SQBA 4QRSB 4AQAB 1NIDA 4FNRA 5E94B 4QHLA 2OMBA 1RIVH 3RE0A 2W0LA 3I84A 3WN5A 4OFDA 4ZTPL 4R84A 4KVPA 2WVVB 1Q9LB 2K4AA 5AVWB 4YPGB 1CE1H 1KLGB 4J1UB 4IBLT 3QNYB 5B1JA 5IJDC 2AJVL 3RJDA 4Y4HD 3Q7JA 2I9LB 1KIUB 3ILQD 2P8LB 4MMYB 2VLKD 5KSAB 2E27H 4R5XA 1SMOA 1YC8A 4RWYH 2XZZA 1DQLH 1NGQL 5TDOA 1MIEL 3SZKC 4WSKA 4G8GD 4R7NB 4NAQA 2R69H 3ZO9A 3NVQA 1N6UA 5I73C 3VGBA 3NT0A 1XSKA 3TBCA 5HYQB 5HJDA 3WFDH 3UGEA 5JORB 7PAZA 2JCCB 5I0XA 4JRLA 5IUCA 1OW0A 1TQCC 3E6FB 1FI8C 5KYWA 3AXIA 1WV7T 3U9UB 3ZT6A 3GNMH 3EXJA 2WLMA 4QY8B 1MG3C 1FPTH 3UEZA 1IEBB 4K3GA 4XNXL 5E1QA 3ULUE 2W1NA 2OP4L 3KL5A 4OUOA 1DQKA 1AZRA 4ZPTB 3OSVA 2DWSA 3O3UN 1OEZW 1RZFL 3T2QA 4Y5XB 5LN8A 1HHJB 4TLTA 1J0YA 3HC3H 2Y72A 4OM0L 1PZUB 4NNXB 1AKJA 2JELL 3DPBB 2ZX6A 1G5AA 1MAKA 1MLBA 1VGKA 1PZ3A 2O6DA 5CJOH 5AKRA 3D9AL 1AFVH 1OCOB 3VGAC 1J5HA 4PRHA 5I2IA 2ZX8A 4Q9QH 4PJHB 4G82A 7FABL 3LN4A 2DEXX 3SE6A 1I7RB 3EHBD 5F96L 5CIPB 3ASNB 5K9OB 5ITFB 3O2WL 1Z0MA 2VKXA 5D1ZC 5DHVH 2YR3A 4R7DA 1QR1A 1CDBA 1IEHA 1C08A 1R5IB 2CIIB 4JM2D 3QFDA 5GGTA 4FDWA 4L9LC 4S2SB 1SXSA 4OIBA 3ML8A 1WUZA 2D4DA 4YNYB 1NFKA 2F8IA 1K6QL 1OOWA 1XX9C 3D0AA 4N26A 3H9HA 2Y36L 4GSRA 4XN4A 3O41B 5HPMA 3WN5C 3IXAB 5HYSB 1UACH 3D3VB 4G9FA 2FEDD 4OJFH 4QRTB 4GIOA 2A2QT 2GK0A 3QWRD 5AVUB 3PGFL 3V0GA 5B1JC 4ELKB 4LVOB 4NQSB 1CICB 4XCYA 2GCYA 1F58H 5SWSB 3IDNA 2VDKL 3QXVA 3L7FB 4KX7A 3JTSA 4NM4H 4BJLA 3NTCH 2ZF9A 4WI6A 4B9GA 2B20A 1KPUB 1JWUA 4JFEA 4I87A 3GRWL 4LCIH 5DT1H 5IFAL 1BBJA 2C9RA 2NY6C 4GT7A 5FO7B 4EUPH 2HVBA 5CCKH 2R7EA 2EAEA 1PY0A 1MCOH 3QFJB 1MHHB 2P5PA 3D7PA 1CL7I 1KGCE 4TLKA 1MFBL 1OW0C 4IOIA 2XXMB 3GSWA 1TVBB 1GCYA 4DK3A 4IOSD 1HTYA 4JFQA 1Q0EA 1NBYB 2DIJA 4FFYA 5KBPA 5C0ND 4L48A 5KVEH 4GO8A 4TOYL 1QVOB 2Y24A 3VA2C 5AVSB 2BIHA 4XVUC 4DP7X 1YYCA 4OUUB 1PLGH 1S7XA 1ES0A 2YGVA 4NIKB 1KIPB 2A4ZA 1XDTT 4WI2A 4JB9L 1HINL 2LLGA 2FLBT 3MGOB 4G71B 2TSBA 3U0PA 2NSQA 2DQTL 5EO0A 4I3RL 1BOGB 1RJLA 2HTLD 4TTDC 4FABL 4GKNA 4CC4A 5CGYC 2P5WE 3OKLA 1G7PA 2V7HB 2BIOA 1Q38A 3NZHH 4WO0A 5IOKA 3H6JA 5IM7A 4XGZA 1JYXA 1QMUA 4P06A 4MZRA 4K8RD 3KWXA 3LKSA 3DX4A 1UB6A 1FWXA 3Q9QA 15C8L 1TZHB 4X9YA 4Z3TA 4W1TA 5HDRA 4PIRF 4DQAA 1OAZL 4UI2A 3BQUB 5C1MB 3B9DA 3D39E 4F58H 1QLFA 4AWJC 4BFFA 2ADJB 3VACA 5T1JA 4LCWA 4N1CA 5E7BA 2XX0A 2OXGA 4OBSA 2EDBA 4TM9A 1H8NA 5DGQA 1WFMA 4M8RA 5F8RC 3QI9B 1OARL 3ZDXE 2VB5A 2Z7YA 9PCYA 4JFSA 3GSUA 3JWNH 1HZHL 3NZUA 2Z4TA 2R29L 4XNYH 4PJDB 1X7QB 4RMSA 1UD6A 4HPYL 1IAII 4P5TB 3ORJA 3PWJA 3VXSB 5HHQB 4DIXA 3RZCD 5EO1A 1RZJH 2PYEA 4X2UA 3J27A 1JF6A 2DY2A 2RAMA 4MS8C 4URKA 3GSVB 3ECBB 3BP6A 3Q1SL 1J9SA 1QHQA 4DAGH 2I25N 1RZGA 3UTSB 3QUYB 1E4JA 2FJSA 3O4OB 1S46A 5MENB 5LAXA 4BFKA 3QG6A 2P28B 1T66D 1T2JA 3GK8H 5CAYB 1D5MB 2J5LB 3SB3A 4A7QA 5AALA 2R0WH 2YRLA 2AP2A 4QTIL 1EBAA 2OI9C 2CJSA 3B3IA 4WNSA 3C5XA 4K2UL 3ZMNA 1MHEB 1ZD6A 2IDFA 2PPDA 4PV9B 3L4ZA 1F11B 1AE6L 4Y4HA 5E8EB 3L45A 4N2MA 3LRKA 1A7OL 2MFNA 2VLKA 5DVKA 3KLHD 3H56A 2YSSB 1B4JH 1QFWI 4XR8C 2DMCA 4JANA 1WAAF 4HF5H 4JPIB 1T20A 1G9MC 2R59A 4G8GA 3FQRA 3KGUA 2WQWA 4AYSA 1QKZH 3GFUA 3O3EB 1IFHL 1KJMA 4ENED 4PJCB 3PDOA 2WUBL 3CG8A 3NJXA 3P02A 3RL1B 2AAVA 2XV6B 4S1QL 5CJ8A 4CC4C 4MJ6A 2OTWB 3KYNA 3KYAA 2J8OA 2E7BA 2Y0SA 3K6FA 5A6IA 3AABA 4DEUA 1LQBC 3EIFA 2WXPA 4XP1H 2HLEB 3C08H 4M6MH 3QUHA 4QO1B 5IJBC 3MOBL 1BBDH 4H1LG 4X9GA 1ID5I 3C6EA 4LIQH 2V33A 4J27A 5D7EA 3VTTA 2K8QA 5MERA 1I8IA 4Z77A 3BESR 3BUDA 1XR9B 3GMQA 1XF4B 4UCFA 4N3TA 2BNQD 3ZE0E 3SYCA 1T1WA 3P9MA 4LLUB 2PUQT 2FX8H 4NT6B 3LS4H 4XX1E 5IB2B 2IAMA 4JJ5A 1JZEA 2VIRA 5CWSA 2X5PA 3T9WA 4H2AA 4GXVH 5KVDE 1LWHA 1QSED 4J39A 1BZ9B 2JKRM 5JW5B 4WUKL 4PRIA 2BRRL 4NKDB 1W72H 3HG1D 1PCXA 4KKQA 4ZO8A 4CAGA 2BFVL 2XVBA 3H9ZA 5CN2A 5DUPL 1FUNA 2NYYC 5FGCB 3ZBMA 3APMA 1ED3B 1RPQA 4G8EA 3UYPB 5F97E 1KJVA 4W93A 3T4AB 3V5KA 5JIHA 4JM2A 3FT9A 3N42F 1SXZA 3LVTA 1NAKH 1IQWL 1GOFA 1YEDA 1UD3A 1QI5A 5J12C 2J8UF 3ZDYB 3SGEI 4ZS6D 2JJSA 4NC0B 4XHJD 5C0JA 1BGXH 1GS6X 3KGSA 2BCKB 3IDJA 5DD6B 2Y1YA 1I7TB 2WYIA 4OT1H 3NOIA 1XXDC 3T0WA 2VO5A 2MEJB 2X1QA 4LSTL 2IGTA 4U05A 2AK1L 5GGVH 3QWRA 2W80C 3WY3A 2FYVA 2SODB 3NCXA 4Y4HC 3FB7B 3ILQC 3DK2A 5DFVD 1X5LA 4PJBE 3RIAK 3X14A 3BWUF 3CHRA 1FL5B 3F00A 4PJAE 3QHTC 2Y7OA 3K6SA 5IESL 1Y1UA 3DHUA 4P3DA 4PVLA 1FH2A 4OM1H 4GLRI 4HX1A 2AQTA 3GHPA 3WTVA 2VXUL 3ARVA 1BVLB 2YA0A 5L2KB 1GY1A 4F1ZA 3VD2A 5BZWA 2Q86A 2BX5A 3LCYA 4IOSA 3HMXA 5CLYA 1SEBB 3D2UB 4RNRB 4G43B 1ET8A 3ATBA 4DZ8B 1U8MA 3DKHA 2NDGA 3D4GA 4NQEE 3PPEA 4KDWA 4C4UA 4E42B 2IAAC 1MUJB 4GI8A 5I8OH 3JTTA 3NJNA 2DICA 4PTUB 3PHAA 3CX5J 2B8OT 3MRQB 4HKZA 5DRXA 2GITA 3WI9A 3H54A 3EO1A 2YXFA 1MFCH 4YHPB 1WAEA 3TEXA 2WY3B 1H8LA 3FZUD 5DS8A 3U6XS 5BVJA 1EO5A 1NDMB 4OQTA 2IAMC 4OLXH 3NGBB 2BVQB 2IPKB 4N8VG 2K1MA 4LCVA 1JV2A 2EDXA 3ESMA 3L6FA 4M48L 1T0NB 3B7TA 1CR9L 5CZVH 3EHBC 2GHWB 4L2LA 4G6KL 1A7NH 1GMIA 1M7IA 5CEYB 1I31A 4XVSL 4PGBB 1BLNB 2VDMH 2OKMA 4JQIL 4V1DD 3MLRH 3EH4B 3MNWB 3EF7A 1Z9MA 4JM2C 2HFEA 2HWZL 3OV6A 4M61B 5DQ9B 3I75B 4OCXH 4C4KO 2NW2A 4N20A 3AWFA 4O4YL 2JJSC 1OM3H 1Y7VA 2DQGH 3RY5A 1A3QA 1XIWD 4HUNB 4OU3A 2K3HA 3H8NA 3FU9A 1N4XL 2EIMB 1JXGA 4PCSA 5CZXD 5KTEL 3WIHA 2J56A 5I0VA 4WRLA 4AXWA 1X9UA 2H3XC 3W39B 3A21A 4S0HA 1SRDA 2WWOA 2X4PB 3IDXH 4NO2B 5G2NA 1NBVH 2FEDC 4TNVK 1CFNB 5HYIA 3PWLB 1AS8A 2R2BA 3RZCA 4PYHA 3MZTA 5DJYA 1PY4A 2H3NA 2V0AA 2VR8A 4UYQA 1WIOA 1BA9A 2SEBA 1HH9B 3F12A 4Z7NF 3U46B 1PZBA 2JJVA 1MRDH 1GJIA 4X0KB 2PXYB 4PG2A 3T8VA 1U58A 3VDBA 4ONGL 4LXFA 5FF6B 4RMQA 3BUBA 2WLNA 3FUDA 3WTTA 1QBAA 2VR5A 5CEZL 2ODIA 4QXTA 1DN0A 1N26A 4RMUA 1FL3A 3HE6A 4G70B 1A8JH 3K6OA 2VKWA 4PY7B 3W2DH 2P8MB 4APQD 1MFAL 1LK2B 1EDHA 1YQVL 4WW1B 5LN4A 3RTQD 3ZU8A 4CA4A 4K3EH 3HJEA 3R8QA 5DQDH 3E2HC 3AWEA 2X2IA 3NG5A 3HNVL 4D0CA 1HH6A 4GAJH 5C0NC 4OZIE 5JW4N 3BKJH 1V3MA 3FB8A 2X4UA 1HNGA 1JNHB 1J9TA 2OTUA 2QFRA 1N0XH 2YD7A 3B9KD 4E9TA 2IOMA 3MHZA 5D9SA 5E2UL 1GOGA 2VO8A 3KXFD 4G9FE 1CMOA 3CDGA 5C8JA 5JHLL 1M3JA 2R27A 5HYEA 4UT6L 2YQBA 1N0LA 2HTLC 2YAQA 5LXGH 3G5YB 1A3LL 4NAMA 3TNNA 5IW6A 3KLLA 4HP5A 1C12B 3VCLB 4AC4A 5DK2B 1ND0A 5AZEH 1JGUL 1U8HB 2HT2D 4MA1C 4XRCB 5D4QA 4GIAA 3IGKA 4AYEC 5HGBA 4G9DB 3Q2VA 4K8RC 3SJVE 4R90L 5KOVC 3T3PE 3GHEL 5E2TH 1MF2L 2F5BL 2XY1A 2ZCLL 1RUPL 1MCQA 1NKOA 5DD0H 1SJVA 2HX8A 3ZO0A 3K6IA 2NY5C 4I89A 5IHWA 3BISA 4BZYA 4P46D 5LCVL 2O5ZL 2VWEE 4FFVD 4U6YA 2BNQA 1YQ2A 4HOXA 2HJFB 1DUYB 2FCBA 3E80A 3TU6A 3WFBL 5HGGS 1O5DT 2YA2A 4UQCA 4N24A 4L18A 1AJ7L 3RTLA 2X4QA 1Y0LA 5AYTA 1LVEA 1QSEA 3QEQD 4F5CA 4HQQH 4YDJA 4ZTEA 1KGYE 5BJTB 4ISVA 3HG1A 3EOYG 3S0PA 3OKOA 1UD5A 3CDYA 3RZCC 4KJPD 2DQIH 3GSOA 3WCYA 3ZRSA 5JW4M 1I1FA 1JTTA 3L3OB 1R1CA 4L4TB 1FGNH 5CINH 2R2EB 4NUMA 5F6IC 4PG2C 1T66C 2Y25A 1SEQL 3HG5A 5DD5H 4OZGA 5CM1A 3HE6C 5EEVA 1C5DB 1CGUA 4ZFZB 4HCFA 1GTFA 2CLRB 4DFIA 5K59E 1LHZA 3C09C 3O8XD 2YRPA 3KPLB 1OIOA 3HFMH 1G0XA 1U3ZA 4LCWE 4PWEA 5ANHA 3N06B 5E1HB 3UZVB 2VTFA 3UTTB 2KLSA 3ZW3A 1IZJA 4LPTA 4AL8H 3QA3B 4OZFA 5IQ7H 2Z91A 3F7YB 3GUTA 2BS71 3IJEA 3DGGB 4ENEC 3SKMA 1UH3A 3VRIB 2V5YA 2Y69B 4LF3B 2ALWA 4RBPK 5FYJE 2PYEE 1QSVA 2I26N 4MRBA 3WSQL 2COVD 4EUPG 1NMBL 1YPZB 1CJYA 5E95B 4OF3A 1SJMA 1EZVY 4FULA 1JOIA 2X6BA 2VLJB 4TNEA 1DZ0A 3WKYA 2CDEB 4IIZA 4JO5A 5BW7A 3C5ZB 4U1JB 5DRZA 1YN7A 4MMXB 2YUXA 4IKKA 1WISA 4DK6A 4RZKA 1HXYB 2HKFH 3SPGA 1CDGA 2VL4A 1PEWA 2J4WL 1NEZB 3QJRB 4ORGB 2DAVA 2YXMA 4FQLH 1FIEA 2N01B 5ACLA 3BHBB 1GC1H 3V6FB 1NBCA 1GW0A 4XOCA 3R19A 3ECWA 3I9IA 2WO2B 2XA8H 5TF0A 5BS0B 3FC8A 3NBNA 4W9KC 1YNTA 3WO4B 1H5BA 1J05A 4F1SA 3U9PH 3L5XL 4XVTL 1XHHA 4X99B 3WE6A 4AEEA 2W60B 2V9UA 2XLLA 1CYXA 3D06A 3QDMB 3V52H 2XZAL 1RIUH 1JNLH 4NZRL 4QHPA 4TNFA 5IW3A 4F24A 3S5ZA 3MJ8A 4V1DA 4N0CD 4WCYL 1UJ3A 1WCBB 1ZK5A 3L2LA 2OQJB 3V4UH 1IV8A 4Q6KA 3BDXA 4ZS6C 3CXHK 4XP6L 4OFQA 1XIWA 4XAKE 4XHJC 1T5KA 3BPCB 4IBZA 4TL4A 4HXBH 1NH6A 4F33A 3BFQG 2EVGA 1D5BA 3SKNA 3VXUB 4L3CA 3ULUF 3AY4A 3VXQB 5GISL 5TE7L 3HW7A 3T4YA 2WO3B 2XETA 3V0EA 3RKDD 5EF3A 4M43L 4Z3FA 4KQ4H 4BE5A 3GLEA 4MVBD 3JWNG 4AX3A 5JPNB 1LEGA 4PV8B 1S9VB 5L7XH 2O61B 4AJYV 2YN3A 3M86A 2Y5TA 2B1HL 2A9BA 1A3ZA 4HS3B 2WBXA 4AIZB 2DDQH 4UTAA 5CEXB 5DFVC 1ZT4B 4NJ9L 1RZKH 1LO0H 2MQ3A 4WNQB 5I71C 4PRIE 5HHOB 4LLWA 3NCJL 3IE4A 1V05A 2FWOA 35C8L 1WZMA 4MX7A 5HHVH 4Y9BA 4APQA 3S35L 1U41A 1MJJA 3RTQA 2IMNA 3MO1B 3NPSB 4KVNL 3RI5F 4I7ZC 2J3SA 4JO3L 5B8CB 1N67A 4LDLB 4LASH 5B3NA 3FT3A 3KR3L 1ZT1A 3HE7D 3QW9A 3OG4B 2K6ZA 1VCAA 2YS4A 3K2MC 3D09A 5BW7C 4ZSOB 3VH8G 1P7QB 3HZYA 1CGVA 5BQDA 2WAHA 3B9KA 4IRSB 1WEJL 1I7UA 2HT4C 4RGOL 1BLIA 4F2EA 5GIRB 4G5AA 3KXFA 3SGDH 1OTUD 2F7PA 3UABA 2MHAA 1BM3H 1SN5A 2QQNH 3FZUC 5FKAA 5DR5H 4GBXD 5IEKB 1FNSL 3ECQA 3MLVL 5TDNB 3FMGH 2FECL 2OMWB 4KZEH 4MMZB 4P9MH 2HH0H 3V4LA 1H5BC 3B5TA 3X11A 3ZVVA 3O6LL 3IAGC 4UMGA 4XAWH 1OVZA 4JRFA 4UQ3A 1TJGH 5L2JA 2BC4A 3VG0L 4QRFA 5MEQB 1D6VL 4P46A 3ARDD 4LBEB 4KITB 4NBYB 4BFRA 4HV8A 3VFVA 4RMBA 1IGYA 3FT4A 3E38A 1UJ3C 1TTRA 2Z0UA 4GKSB 1DZBA 3OPZH 1D9KD 3LKNA 1K5NB 2ADFH 1MY5A 4IU3A 2J71A 2H32H 4UYPA 3KPSD 1SY6A 4LFHD 4WK2B 5JIKA 3ZL4H 3KCPB 1XIWC 4RFOH 1JZFA 2CUAA 3MUGA 4WENB 4UINH 5CZXC 4BZ2L 2GI7A 1PNCA 2R0ZL 3H4HA 1XH2A 3RVTD 5B7MA 3N41B 2ZG1A 3AY4C 3QEQA 3QZNA 2CA4A 2XN1A 4YHIA 4QCIA 2LVCA 1ZHNA 3EUUA 3TTSA 3RB5A 3G6JB 1CGSH 1JZDC 3QO1A 4YMPA 5KSBB 3MRCA 2F54B 5JR1L 4YH6A 4H13C 4P23D 1URIA 3DO7A 4YHOH 5AUMA 4MCZA 4PJ9A 3OB8A 5E9DE 2WYTA 4LSVH 4QRPB 2I07B 3LRSB 1F4WH 5KVGE 1DBKH 1GAFH 3HAEG 5CD5D 2VLLB 1E27A 1FV1A 2O6EA 5TF1L 2H45A 1HSAB 3ECUA 3FSWA 4XPBH 4ZFQA 3BYTA 1J1OH 3BKYL 3NN8B 4X42A 5E6ID 4EDWH 4APQC 4LLVA 1BF5A 3RWCA 2EUZA 3RTQC 1A7PH 1OSYA 2BJML 3N04A 3K3QA 3GRBA 3O8XA 2YJQA 5AZ2H 2VZ1A 3QHFH 4Z76B 3BKCL 5DURB 4Z78A 5D5ME 3MX0A 2BDNL 4QXUH 3EOTL 3ZR6A 2MCMA 3EYOB 2W94A 1HL4A 4Q97A 1DVYA 3B9KC 4I13B 1NGPH 2C9PA 1BP3B 1EUTA 4P9HC 3II2A 3SKOB 3OGCB 1ZSDA 4GMSH 4R5TA