4E9RA

Multicopper oxidase cueo (data4)
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
489
structure length
476
Chain Sequence
b'AERPTLPIPDLLTTDARNRIQLTIGAGQSTFGGKTATTWGYNGNLLGPAVKLQRGKAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPHQHGKTGRQVAMGLAGLVVIEDDEILKLMLPKQWGIDDVPVIVQDKKFSADGQIDYQLDVMTAAVGWFGDTLLTNGAIYPQHAAPRGWLRLRLLNGCNARSLNFATSDNRPLYVIASDGGLLPEPVKVSELPVLMGERFEVLVEVNDNKPFDLVTLPVSQMGMAIAPFDKPHPVMRIQPIAISASGALPDTLSSLPALPSLEGLTVRKLQLSMDPMLDMMGMQMLMEKYGDQAMAGMDHHMNHGGKFDFHHANKINGQAFDMNKPMFAAAKGQYERWVISGVGDMMLHPFHIHGTQFRILSENGKPPAAHRAGWKDTVKVEGNVSEVLVKFNHDAPKEHAYMAHCHLLEHEDTGMMLGFTVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Blue copper oxidase CueO
publication title Structure and function of the engineered multicopper oxidase CueO from Escherichia coli--deletion of the methionine-rich helical region covering the substrate-binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Metal binding protein
total genus 138
structure length 476
sequence length 489
ec nomenclature
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9rA02
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9rA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4e9rA03
3NJMA 4DP9X 1JZJA 1M9WA 4UF7C 4HAKA 1HAUA 4KO5A 4FA7B 1RZQA 3IN2A 3SBQA 2I7SA 1A3ZA 4DPBX 1ILUA 3N2JA 2P80A 4A2DA 2CCWA 4YVUA 1E30A 2XLLA 1NDTA 3UGEA 3QJTB 4DP7X 1AOZA 2J56A 3NP4A 4F2EA 1V55B 3UAEA 2VW4A 2HRHA 3NJNA 1AQ8A 1GYCA 3KW7A 1GY2A 1NPNA 2R7EA 1J9SA 3WNJA 4PCYA 1PNDA 5PAZA 5B1BB 1NIEA 5B1KA 3NSCA 4P5SA 3WKPA 1L9OA 1J5DA 3S3DB 2YAMA 4BK5C 1J9QA 1PAZA 3TBCA 1XB8A 5I28A 3S8GB 2IDTA 1OCZB 3ASNB 4YSTA 3PXLA 3EH5B 4P5RA 1W6WA 2FWLB 1IUZA 3ABKB 2OV0A 1PMYA 2B3IA 2GHZA 3ZIYA 4A68A 3T9WA 1XMEB 2HLEB 2VM3A 3UADA 3QJSB 3CVCA 3ABGA 4BWTA 2XV3A 6PAZA 3WG7B 1E5ZA 1NWOA 1SHWA 4ZK8A 1NTDA 1BQRA 4BDVA 4YL4A 3SQRA 1PF3A 2Q5BA 2BO0A 1AZRA 1OE1A 4YSSA 1GS7A 1IBYA 2Y1AA 3ABLB 2XX0A 1CYWA 2J57A 1BXUA 2MTAA 3NJFA 1SFHA 4HCGA 2YAHA 1GS8A 5F7BA 1JZGA 2QT6A 2N0MA 3HEIB 1E65A 1KBVA 2A3TA 2GC7C 5D4IA 3FU7B 2VW6A 3T6ZA 3PCYA 1A8ZA 1SFDA 3FQ2A 1N68A 2CBPA 2OCCB 1RZPA 1L9RA 2H5UA 1VLXA 2FTAA 2EIJB 3NJJA 3OM3B 4KNTA 1JZEA 2CAKA 4NB7A 1NZRA 2WO3B 1J9RA 1NIBA 4FAAB 4KNSA 1HAWA 2HX7A 4GXFA 3NJIA 3G5WA 2FT8A 4HHWA 1I53A 2YXWA 1FWXA 1ASPA 1SDDA 1AS8A 3JTBA 4A2EA 6PCYA 1L9PA 3NSFA 2BW4A 3AY2A 1KBWA 4M3HA 4A66A 2BZCA 5B1JA 4UANA 2HX9A 1EZLA 2I85A 2PCYA 2GC4C 1CYXA 1E5YA 3FT0A 4E9XA 2XXGA 5ANHA 3T71A 1A65A 1KDIA 2UXTA 1NINA 2ZOOA 1HFUA 3QJQB 4A2GA 2GBAA 2ZWNA 3H4FA 4N4YB 3AG4B 5F7AA 3TBBA 1J5CA 3EHBB 1AZBA 1PNCA 1OCRB 4W1TA 3ZDWA 4E9VA 1TEGA 4BWUA 1PZCA 4G71B 1N70A 1JZFA 5IY5B 2IWEA 3MX0B 2XU9A 5I6PA 1SF3A 2FT7A 2LLNA 4Q89A 5TK4A 1L9TA 2BZ7A 1OE2A 2I7OA 1URIA 5TK2A 5E9NA 3N55A 2NRDA 3NJGA 4YSAA 2PPCA 2IDFA 5I5MA 2PP9A 3IEAA 4DP0X 1EHKB 1ASOA 5FC9A 3AG2B 1PCSA 1PLAA 2P80D 3FYIB 1BQKA 2JKWA 2QPEB 2YAQA 1KCWA 4NAJA 3NJKA 2XX1A 1GR7A 2PLTA 3EH3B 1W6LA 2R7EB 2EILB 1R1CA 2XUWA 4YSOA 2WO2B 2YAFA 1JVOA 4GYBA 4AKOA 1DYZA 1AZUA 1BYPA 8PAZA 4MFHA 2ZXWB 1WA0X 2XV2A 5I6LA 1L9SA 3PPSA 5B7EA 4GP4B 1TKWA 2DYRB 1JZIA 4YSRA 4G72B 1ZDQA 2PP8A 3BVDB 4KNUA 3S3CB 3UABA 2W8CA 3OD3A 1E67A 5I5JA 2XYBA 3FQYA 4DP8X 3S8FB 2AANA 1M57B 2UX7A 3PAVA 2PCFA 1A4CA 3V9EA 4KOBA 5B7MA 2IWFA 5PCYA 5D4JA 1KGYE 3T6VA 2IAAC 2BP8A 1J9TA 2BP8B 3ZX1A 2XV0A 2BP0A 1SNRA 4G7QB 4HALA 2UXFA 3FU9A 2YAPA 4BDVB 1PY0A 3RYMA 1ZV2A 1V54B 1OOWA 5B1AB 2X88A 2IH8A 1NIAA 3AW5A 1KYAA 4DPAX 1BQ5A 3AG1B 1JXGA 1MG2C 4Q8BA 1JZHA 1GW0A 4JHUA 1JXFA 1ASQA 4YSPA 1BXVA 1BXAA 1AIZA 3ASOB 2DWTA 2BHFA 1TU2A 2H47C 5EHFA 5I5IA 4YSDA 2VMJA 3OMAB 1BEXA 1OE3A 3V9CA 2DWSA 5I6MA 3FSWA 5D4HA 1OCCB 4HHGA 2J55A 2TSBA 2JFCA 1ZIAA 4G70B 1W8EA 2PP7A 4F7KA 3NJLA 2DYSB 1GY1A 2FT6A 1PZAA 1PLCA 1WA1X 5A7EA 2PPDA 4GY4A 2UXGA 3X1BA 4AX3A 4YSCA 1SDDB 4E9SA 3GDCA 3DTUB 3EF4A 2ZONA 4PAZA 2TSAA 1GSKA 3HB3B 1F56A 3ABMB 2UXVA 3H56A 4ENZA 2Y69B 4YSQA 1QLEB 3FSZA 2VN3A 2YAEA 1BAWA 2HRGA 2FQDA 5AZUA 3ERXA 4KO6A 1WS8A 1ET8A 1T5KA 2FNWA 1FFTB 2PPAA 5B3SB 2QDWA 4DP6X 4BWWA 3QPKA 4QLWA 4E9RA 1XB3A 4A2FA 4QKTA 1A4BA 2AFNA 4K9JA 3GYRA 2E86A 2IWKA 1AZCA 1AR1B 2YAOA 7PAZA 2IDUA 3QJUB 1WS7A 1QNIA 2PPFA 4L0PB 4BXVA 2AVFA 1BYOA 2CJ3A 2WSDA 4BXSV 5I6OA 3NSYA 1KDJA 4G7RB 1WAEA 2CUAA 2PPEA 5B7FA 3ZBMA 7PCYA 1ID2A 1M56B 2VSMB 1AANA 3JT2A 3PAUA 5B1JC 4JKNA 4NERA 4DPCX 1ILSA 1SF5A 3FSVA 1JXDA 4AKPA 1FA4A 1UATA 2QDVA 3FYEB 4UAHA 4HIPA 3C75A 3IBOA 1DZ0A 3X1GA 1AG0A 1AS6A 2BWIA 4DP5X 4M4RB 3NT0A 3OQRA 1KCBA 4HCIA 3CZUB 4HZ1A 1NIFA 4E9QA 4KO7A 2EINB 4DP1X 2XWZA 4A67A 1IKOP 3X2QB 3DIVA 1V10A 3NYKA 3FSAA 3GXUB 3TASA 3T6XA 3WKQA 2BP0B 1TEFA 2VSKB 9PCYA 2J5WA 1X9UA 4F2FA 3NSDA 3KW8A 2B08A 1SJMA 4E9TA 4DP4X 2GB2A 2VW7A 4WTQA 1QHQA 2XXFA 4CSZA 4KOCA 3SBRA 1MZYA 1JOIA 1RCYA 2X87A 2YQBA 1AS7A 3CVBA 4E9YA 3CDZA 3CDZB 3TA4D 3WI9A 2DY2A 4AKQA 1SHXA 1CC3A 1CURA 3CG8A 1JERA 3T6WA 4X4KA 1PLBA 2FQGA 2FJSA 2IDSA 2IH9A 1IC0A 3AG3B 2Q9OA 1X9RA 3S3BB 1MG3C 1YLBB 1AZNA 2UX6A 3PAZA 1OCOB 2AZUA 1OV8A 1ET5A 3WIAA 3WNIA 4RH4A 3CVDA 5AKRA 3QJRB 1A4AA 1XB6A 1AACA 3BQVA 4YSUA 4HCFA 2XVBA 2FQEA 2CALA 4AI7A 3EH4B 2GSMB 2YXVA 3FU7A 3MBWB 2HX8A 3OMNB 2HXAA 2EIKB 4YVNA 3PLYA 2VM4A 3U25A 2BWDA 1NICA 1NPJA 2QPDB 1MDAA 2DV6A 2JXMA 3QJVB 4WKXA 1KV7A 4GP5B 2FQFA 4KO9A 3X1FA 2OJ1A 5I6NA 1CUOA 1JVLA 3D12B 2MRYA 3FU8A 3IE9A 2W88A 4TXVB 1ETJA 3UAAA 1NIDA 4EF3A 2IDQA 3IN0A 3NJHA 2EIMB 1IBZA 3FQ1A 4A2HA 3OMIB 3QQXA 1AG6A 3L45A 3UACA 1GS6X 3X1NA 3H4HA 3FPYA 4W9ZA 2AZAA 4YSEA 1AAJA 4JHVA 5LDUA 1B3IA 4DP2X 1NWPA 4AZUA 1ZPUA 1MZZA 5I26A 2HZHA 1ADWA 1ET7A 3X1EA 1L9QA 3SBPA 3AZUA 3FS9A 3NP3A 1WA2X 4G7SB 5AFAA 3FPXA 5I6KA 1ZIBA 1PZBA 2GIMA 2YARA 3TU6A 4N8UA 2H3XC 1OF0A 3DKHA 1RKRA 4CSPA 4E9WA 2GI0A 2BW5A 4GP8B 1ZDSA 2RACA
chains in the Genus database with same CATH superfamily
5GGRY 2E9BA 3LQAC 3T3PE 5BQDA 4K3EL 1RZJL 4PW3A 1BEYH 1F13A 4X4YA 2VOTA 2R69L 1J8RA 1GZHA 2VITB 1F41A 5E5RB 1RV6X 1ZS2A 3WDIA 1YEIL 2NW3A 1UM6L 4AT6A 1KB5H 1BM7A 3K1DA 4TS6A 3FB5B 5SX4I 3UGEA 1AOZA 1MHPH 1ZY9A 4PRBB 4XVSL 1G7PB 4J4PC 4XMPH 2J56A 1LTXA 3MLZH 1OGAB 3QR2A 4RX4A 3V8OA 2WQAA 1AQ8A 5HYEA 1GYCA 4ANUA 3WJJC 2CKBL 3NA9H 2CRMA 2YO3A 3QWRD 3ULSB 2AXWA 1WBZA 2NR6D 1A4KB 2OMWB 3FQUA 3JV0A 3Q1SH 4K5MA 1NIEA 2NZ1A 4NZ8A 5DK0B 3ZSSA 5E5UB 2GJZB 4WHDA 2OX5B 1SBBA 3B9VA 4AOFA 1R5VB 3RG1C 4ZFOA 5CKAA 3T8VA 2XWCA 1I8KA 4L0YA 1JCVA 3NJXA 4HXBL 1KYDA 2CLZA 3UAJC 5HYQA 2UV3A 4X4ZA 4MS8D 1DCLA 3ASNB 3FB6A 3FBQA 4L8DB 1MVYA 1RUPH 1UACH 4ESKA 1EA9C 5B1CA 2CHWA 5LCVL 5CCHE 2JKTM 4GKZA 2BVQA 3LY6A 1A14H 1C5BH 3KPRE 3VXUE 3QDGE 3CJJA 3IJEA 3R1GL 1RVFL 5JZ7C 5F89A 4KK9C 4XZ4A 3K8LA 4FFWD 3DPDA 3P77B 4OD1L 3E9UA 3FQ4A 1NWOA 1ZA6B 2V4LA 4K3DL 4APXA 1Z5YD 1S7SA 4ZQTA 3TYFA 3AU0A 1F1AA 1FAKT 1RIUL 2Q5BA 4KV5F 5I30H 2EDLA 4X4MA 1G4RA 1VPOL 2QBWA 3CZEA 3LEYL 4HUMB 5ISZA 3UJIH 1FVCA 4NO0B 2Y7MA 4M1CD 1PW3A 2DZEA 1F4XL 3LQMA 4Y8DC 4D8PB 3MRNB 4Z7VE 5KZCB 4YDIH 1J1OH 1SXSA 2J57A 1BXUA 1N12A 1LGVA 5L2KB 1J0KA 4X9HA 2BRQA 1RUAH 1ZJAA 2P8LB 3HEIB 4MHHG 5FO9A 1NAML 3D30A 2KZBA 2X89A 2YD5A 4LCCA 3EYQD 5ELIA 4F8PA 5IOPA 3EJJX 1VADB 3UJTL 4RGOL 1CIDA 2YJQA 3G6JB 4KX8A 3WO3B 3S48A 2DWYA 1U91A 2WQVA 5IW3A 4Y7OC 4MYPA 1NKOA 2FTAA 4LCYB 4V33A 4KITB 3O45B 1NIBA 1S9WB 4EI6A 4AW4A 4PVNA 2RGSA 1G1YA 32C2A 4GXFA 3NJIA 3G5WA 4OIIH 4UINL 4HHWA 2J5LB 4HIQA 4HIXL 4I48A 1S3KH 1KBWA 4QT5B 2R2BA 4EBQL 4UANA 5CJQL 3UTZA 1PFCA 4MA7L 1DLFL 1ESOA 5I1DA 5KS9F 4Q9QL 2VUKA 3S2CA 4HLZG 1QTPA 5CJOL 1TCRB 1U6AH 2XWJB 4EZJA 4S1SL 4K8RH 5DD3H 4NC0B 2OZ4L 1UA6L 2GT9A 3M8OL 2X4NA 4Z0XA 5E1GA 3LEVL 3QAZB 1AKJA 2MH4A 3L5HA 2FX9L 1Y18A 1ZLVH 4RA0C 1ZANL 3Q2WA 2BHUA 1AFVH 5DXWA 5EU6A 5JDSA 3WNPA 2C9PA 5T1MB 1EFXA 4DEWA 4LVNB 5DVLA 1INQB 4NXSA 3B5GA 1EJOH 2FJHB 1JZFA 1YEKH 2DYPD 2VDQL 3N50A 3MNWA 1Q1JL 4F2ME 2V17H 3GD1C 4Y5YC 1LK2B 3N40P 1L9TA 3MJGX 4FFYA 4K8RC 4X4YB 1OAYH 3H9YA 2CGYA 4IKLA 5G4MA 5KANG 4QWWD 2GSGA 5KG9A 4XMLH 2ICWA 4JW3A 1LO0H 1PLAA 1MY7A 3HZVA 3GSVA 5GRWA 4PS4L 4N8VG 2MHAB 1U3YA 4HDIA 3WL9A 1ZT7A 4X8GA 3TNNA 3MCLH 4E0RB 3K5SA 1NDMA 1E0OB 1WBZB 4NM4L 3FZUC 1G7HB 1JN6A 5F0LB 4WGVB 4L4TD 5KVDH 5C0BA 1K3ZA 5C09E 3WEBA 2VSDA 1RP9A 2QVKA 3VI4E 3BCFA 4I85A 5BCAA 1SOKA 4NQED 4J6RH 2XN9A 4XN9A 5FO2A 4TM9A 3U9PL 2ZPKH 3K6SA 1FV1A 2LTQC 4P4KD 2W8CA 5KJ4A 5TFSH 4LHUD 3UABA 4NOFA 1P9MA 5LGYA 3WN6A 4GO9A 5DSCA 3SDCD 5BS0D 2UX7A 3A5VA 3V10A 1NCJA 4OH2A 3RAJL 4GKZB 2BVQB 2WLYA 2ZCLH 3OJ2C 3LXBA 3BAEH 4JPIA 1UVQB 3U7AA 3T6VA 1PZDA 2VDLL 4JZJC 4DJMA 2FNBA 4Y0GA 2B2XL 3EDDA 3JSSA 5F89B 2YIHA 2PETA 4HALA 4HPYL 5EEXA 1E6JL 4APXB 5JXEA 3KPMB 2NPLX 4F9PA 1S7SB 4QTIL 5F6HJ 5E2WH 3TYFB 4OCXL 1ZV2A 5AAMA 1OOWA 4M3JA 4OLXH 1HQRB 2F8XC 3P11L 3N41B 1J1XL 2NNFA 5GSRB 4C4BA 1GW0A 4Y16C 5E4EC 2ZAHA 3OAUL 2NY0D 2WBJC 3SGEH 3STBA 1S5IH 1MVFA 5CZVH 5GJTH 1XF2A 4Q6IC 2NYZA 3GHBH 6FABH 3V9CA 3KVPA 5GZND 5JNYB 4WHTB 5IOPB 4K2UL 1OCCB 1ZRUA 3H54A 5D4HA 5EIIG 4AIEA 2R23B 4WHYG 2MKLC 1TQBB 5AVWB 3L3OB 4HYTB 2E7MA 4IRJA 4MS8C 1AO7A 4WNQB 1U91B 1AQDA 5MENE 2VQUA 5AVXB 3NJLA 2A77H 1I9JH 3EYSH 2Q6WA 4FTVE 3WV0A 1DN0B 4P5KA 32C2B 1AH1A 2BVTA 2NCMA 2R0LL 4LRIC 3QUYD 5JHDE 5T1JA 5E6IB 7FABH 1SXCA 2R0WH 4I48B 2DM3A 3U30B 1I1RA 1TZGH 3DTUB 2E7LA 3UTZB 4K94H 4MNGA 5D96C 3KBEA 1FP5A 1D7CA 5I1DB 4XGZB 4H8WL 2O5ZL 4KTDH 1ZGLA 3V52H 2HA1A 4OFYD 4H13C 4JDVB 4M1CC 1VB9A 1NGXA 2GT9B 4Z0XB 2DD8H 1Y18B 2PPAA 4PN6A 1H5BC 5LG1A 4TUOB 1WUNT 2QDWA 5EU6B 4AUUA 2NY1C 2WJ5A 4ZUUA 4TSCH 1EFXB 2YUXA 5DMIH 3STZA 4K94C 4RRPA 4A2FA 4L3EA 4QKTA 2AFNA 4DZ8A 4S0SD 4DAGL 2QTVA 3MNWB 4QOKB 4XXDA 1AR1D 1WT5A 4H0GA 5SX5K 4U31A 2X3CA 2IGTA 1OO2A 4OAWB 5DJ6B 4MQSB 4HCRH 3QJXA 4V1DA 1WAEA 3D4GA 3IMWA 4WTZG 4F9LC 2WLNA 2WGXA 1NOLA 2CO1A 2GSGB 5KG9B 4WEEA 2ICWB 5E94A 5ITBL 2FR4A 4X99A 3E8UL 5TE6L 3MFGB 3L1OL 3LVTA 1U8PB 1LQBC 2ITEA 3WFHA 3VSTA 3L9EA 1AANA 3WL9B 4HDIB 3VD4A 1ZT7B 4TN9A 4PJHF 3TNNB 4TSAH 4LK4A 2CE6A 1FA4A 1R24B 1NDMB 3VFVA 1UATA 1MWAH 4U1KB 1JN6B 3D39D 2QQKH 1OAQH 4UT6A 4MCZA 3IBOA 5C0BB 4N2DA 4XMVA 3RTQA 4KHXH 4ONGL 1EWHA 3T3MF 2W91A 2VDOH 1PFOA 2JK5A 1JK9A 3D51A 5D1QD 4WV1A 2XN9B 3QPQC 4PJ8A 3K6SB 4M7JH 1FV1B 3V4VL 4FJYA 1E28A 1CF1A 3HPLA 2YPLD 4KDTA 1A6WL 2C3GA 2KERA 1XIWD 4F1SA 1E5UI 3HNSH 3GXDA 3RRQA 4QTFA 1T1WA 5A2LH 4LDLB 3D25A 3VI3F 3MXVL 5D1XA 4YQXL 4I1NB 1LK3L 1YUKB 4LOUC 1LEKA 1R47A 1Z3GL 4JJHA 4CVWA 5E24E 4XAWH 4H25A 3GEWB 3SCMB 1A1NA 2KKQA 1UKQA 5E99L 4S1QH 1G87A 2YJLA 2KYIA 3BVVA 1LDPL 4YDVA 2GB2A 2ZYHA 2WXJA 2ZXDA 1Z6JT 1F6AB 2OPCA 2Y07L 4HKZB 4AWJC 4BFJA 2YRBA 5GRUL 3LKNA 4AYFB 1MZYA 1IT9H 2GHWB 2J8UE 4OLUL 2R56H 3CVHL 5DWUL 4E9YA 1JTPA 3VGEA 3CXFA 3C5SA 4AKQA 4XCNA 3WAKA 3C60D 3NRQA 4NZFA 4XI5D 3T6WA 2X70B 1XF2B 3KPSE 2WN3A 1YYLH 1BVOA 3FUKA 4DZBB 2PNDA 2VL4A 1GIGH 3FN9A 3OB0K 2BNRD 2P46B 2P5EA 5GJSH 3MLPA 4IRJB 1NGQH 1VAHA 3X14B 1ADQL 2FYYB 4LSPL 3SDCC 4QYOA 4F80A 2BSTA 2WXIA 1U3ZA 2AEPL 1S8DB 1JD9A 3D52A 4DGVH 2WANA 1FLRL 4P5KB 3WMPA 1JI1A 1AIFB 3FB8A 5LN4A 3UFIA 4YZWA 4AYID 3BX7C 4XOBA 2A6IA 3HRZC 2Z64C 2P47B 5IW6A 3SGEI 2XTSA 2JKXA 3MBWB 3O6LL 4MD4A 4MNGB 3HE6B 3MZGB 2A4EA 1ZGLB 1KCSL 5CEYA 3U25A 5ECJE 3GXFA 4P2RE 1EX0A 1HHIA 2ZWLT 3IKCA 4XP4H 5C6PB 5CCKL 3LKSA 1HNFA 1NGXB 3WNLA 3TN0D 5FDYA 2K70A 3W39A 3NAAH 3QH3B 4JHWH 5IQ9B 2XZZA 3WLBB 5L9DL 1JFHA 4ZUUB 1FCCA 4YR6B 3W9DA 4XVOA 1P7QB 3IN0A 2AJZA 3SDXA 7TAAA 4NZTL 4G8IB 1O0VA 4L3EB 1IU1A 3KG5A 3BN9D 1PG7L 1MQ8A 3H4HA 2AZAA 4XXDB 3QE5A 3QNZA 4UDTA 1SJEA 2WXRA 2EEFA 3T0ED 2BNQD 3DOIA 1D6VH 4EDXA 3AADB 5I26A 2DQUL 1ADWA 4H0IA 4ZTEA 5FUZL 3A4EA 4N3TA 4MGXA 2WVUA 1E9PA 1BQHA 1G0YR 3L5XH 5FW7A 4BUQA 1EEYA 1CE6B 2D7MA 3FS9A 5E94B 3BKYL 2FR4B 1S9XA 3ZKND 5AOKA 3D8MA 3RDTD 4BFGA 3WFHB 3I9PA 4G8FA 1OM9A 4IOIA 3LN9A 4XC3H 3AU1B 3K2MC 1CU4L 1TPXB 3GLDA 4YEEA 1AD9B 1HXYA 2ED9A 4CDGC 4UNVA 4ZMWA 1A9EA 3Q6GH 3LRGA 3VFVB 1L3NA 2DF3A 2BVOA 1SQ2N 2W07A 2VLRD 3FMGH 3V4UH 2H32H 3KJ4B 4YXKH 3VD5A 5DA0B 4FFZL 2RA1A 3TJEH 5D1ZC 4K7PX 5DUBA 4X9YA 2P80A 1IJNA 1JK9B 1YJDL 1ZT4A 1SN5A 1CZ8H 3SKOB 4PJ8B 5EV7A 1E28B 2GITA 3GMPB 1AGCA 3HPLB 1JHKH 4WWPA 1TJIH 1U8IB 5FYKL 4XBEL 2VZOA 1T2XA 1IGFL 4EOWL 1AR1C 3D2UA 4QHLA 1PNDA 3MREA 2K3HA 3D25B 4PJXB 1KLFB 5D1XB 3OJDB 5ACLA 3LKOA 5E4IA 1MFDL 5DVPA 2IPTL 1XZ0A 3VFNB 3WGVB 3KPRA 3RJOA 5JHMA 4PGZA 4YDVB 3WGUB 3VXUA 1QSFE 3DROA 3QDGA 4GEJA 4JO5A 3K6IA 4EI5C 3PXLA 1ZV9A 4Z3EA 1FG2A 5BVPL 1M1XB 3HFML 4B9PA 2BY0A 4O5LH 3C5SB 3S8WA 5EO9A 3CWGA 2J12B 2CMRL 2B9AA 5F3BA 1G4MA 3CSYA 4ZMZA 3VCLB 1E5ZA 1KGJA 4WHYH 5D1QC 2P5EB 4OD3L 4PJDF 4YL4A 4JZOA 4NQQA 4ZXBD 3RURA 3WY2A 5I9QC 5CU9A 1ZVYA 2UZPA 4HBQA 4NQCD 1SY6A 4AGMA 5JW3H 4XO3A 5TTRA 2VO5A 1OAUL 1I4FA 1OT2A 5C1MB 3QYCA 2YAHA 2PW1B 4TTGA 2A6IB 2VRAA 2DEXX 5LAXB 3LS5L 5IW6B 3L2MA 2ADFL 3ZTCC 3IDMA 4WUKL 5K9KA 3QDMA 4ODTH 1AGFA 5GGSA 3VG9B 3U0WH 5CEYB 3FULA 3PFQA 2X42A 3GHEL 3WY3A 4AJVA 5IFHL 3RU8L 4NOBA 1WO2A 3CFKA 4R26H 3ZRFC 4OD2A 4NRYB 3I2CH 3QCTH 4G5AA 1NZRA 4RMWA 4JJ5A 3SYPA 3GJFA 2CK0H 1IGIL 3L4YA 4H88H 3W39B 4D0DA 1MJ8L 1OGTA 5CKGA 3E8VA 3C60C 4IIQC 1KJ3L 6PCYA 3NSFA 3OKEA 1D5MA 3SDXB 2AJZB 2ZJSL 4TQIA 2JIXD 1GGIL 3QCUH 5HYIA 4LSDA 4X9FA 4G11A 5F8QC 1N6QH 3WXVL 1JHLH 4NIYE 1I3GL 1XL4A 1YEFL 2VZVA 4P59H 1DO5A 4MQXD 1A65A 3QNZB 4UDTB 1SJEB 5HD8D 1AP2B 2Z31B 4TSBH 5J13B 2MNWA 3F7YA 3TJHD 3X3FH 2HWZH 4L4VE 3CXHJ 5F7AA 4AL8C 4RCAA 2XTJC 4P99A 3BE1H 2Q2LA 4F2MA 1BFOA 1EEYB 5KEZA 2HT2D 3O6FD 3C2AH 1S9XB 4FXGA 4UMGA 4ZRGA 3T3PB 2FEDC 4YIQA 4H26A 1HIMH 3ZDXF 3OXSA 4Y2NA 2Y7NA 4W4OC 5I8EA 5H4ZA 3L17A 1NFDE 1HXYB 2CQVA 3S35L 4MD5A 5HDQH 5T1LA 3S98A 4KI5D 1A9EB 1URIA 4D94A 5F1NB 1ED3B 1T1YA 2BVOB 2KDYA 4KXCA 4PWJA 4J2XA 4D0CB 1X44A 4PV1C 3TN0C 4YSAA 1GPOH 1DHKA 3NCCB 3QXAB 3E3QC 4JDTL 4Y19E 4J39A 1JNNH 3MXWL 2W92A 1ZT4B 3AS2A 2BVPA 1M71A 4WUUE 4F5CA 4KTEL 5JMOC 2OJEA 1NAKL 2QPEB 3NCYS 1HSBB 2ZAGA 1UTDA 3HUJE 4QTHA 4GRLC 5C09A 1XCXA 1UYWL 4U3XA 1MCOH 4NZRH 1RZGA 4PJFF 1HN1A 3BMVA 4PCTA 1N59B 4GYBA 3T0EC 5C6TL 4QXGL 1P7KA 4ANWA 2EDDA 2OW6A 1EEQA 2I9LA 2DQTH 1DUZA 3LKOB 3RL2A 3UTSD 4B96A 1DBBH 5L6YH 1AI1H 1DBJL 1L7TH 3ZKNC 3HOGA 1TXKA 3RDTC 4U0RC 3VXUB 4NZDA 3QDGB 4LIQE 3BQUA 4HH9B 4PRPD 4JL2A 1R3HA 2A9AA 1F00I 2F74A 1DBAH 5JPNC 4NN7C 4ORZC 1Z32X 3VVWA 3LNIA 1P4UA 4IRZL 1M53A 4V2CB 4MMXA 2EO1A 4TQ8A 4R2GC 2DRUA 4YE4H 3REVA 3ARGA 5EO9B 2CJUH 1PTZA 3E0GA 3RILA 4PJIF 1MNNA 4W4NA 3CSYB 3QQNA 5F3BB 4YDLB 5FCUL 4UIMA 1O9WA 1LO2H 2DOCA 2LFGA 4Z7VB 4AMWA 3LQZA 5KSBE 4UTBL 4JZOB 4JM0A 1HU8A 1C8PA 3ET9F 3DURA 3LXCA 2KZ1B 3AG1B 4LEBA 1T03H 2YZ1A 4GI8A 5CD5D 4OLZH 3BEWA 3EOTH 4XVTL 2MOVA 2B77A 3OV6A 5BS0B 3L9RB 4Z7IA 1UXSA 3BKMH 3V6ZA 3PWUB 3BD3A 1INDH 1TTBA 2OFQA 2Y3NA 5EHFA 1J0YA 1VEMA 4X9GA 5MENA 4WI0B 1C5CL 5I6MA 5GGVH 3EZJB 4LKCB 3G9AB 5F3HA 2Y23A 5K9KB 4RMVA 5JHDA 5HYJD 1OK0A 1XSOA 2A9ML 1TTRA 3MNMA 2PP7A 4FFVD 1XL6A 5T5FH 4MCYA 2WJ7A 2DYSB 3FUJA 3Q8FA 3CFKB 5D7JD 3WFCH 4PP2A 4MMYA 2Q86A 1M3JA 1OD9A 1RERA 2EH7H 1T04A 1OGTB 4AX3A 4D0DB 3GMOA 1D5MB 4AYGA 3QSKB 2FO4A 1XCQA 2W65A 4LCUA 5I0ZA 3QG7L 5F21B 4AMKH 4PJ6A 2GJPA 2FH6A 3H56A 5H35B 4PI0A 4Z3TA 5JORB 5L88L 3DMMA 4OM0H 4ZXBC 3F84A 5L7XL 3CIQA 1QQDA 1YUHA 4NKIL 4WI6A 2HRGA 3RUGF 5ACMA 3BH9B 1ET8A 4QY8A 4Y7MA 2FECL 4WI4A 5CLWA 1P4IL 3IFPB 3QG6B 4JPKL 4F2MB 1BFOB 4FXKA 1WP6A 3PJSB 1UKTA 4NQDD 3SQOL 2VN5A 4I77H 3CK0L 3QPKA 4DP6X 5MEQA 4G8GE 4YIQB 1X7QB 2QQQA 4R5VA 4YHOH 3AXHA 3OXSB 2VXQH 1FZJA 4CN4A 5JUEL 3GXNA 3I3DA 3EFDL 4MD5B 4L9LC 3QZOA 5TE4L 2WLIB 4F15C 2N56A 2VC2H 3N43F 1T1YB 4OCSL 3OZ9H 4KFMA 4HGKC 2V2WB 2NX5E 3VB8A 4F3FA 4RZKA 3LV3A 3HC4L 1U8MA 3BDYH 2BVPB 5B7FA 3HG1E 2OJEB 1M56B 4FABL 5H4YA 4B9ZA 4CC4A 5C09B 3GIZL 2I5YH 1JWUA 3VI4B 1NEZA 3QORD 3KLAA 1KXTA 2RFXA 5JW5B 5J56B 5FUOL 5GGTA 4HUWA 3TJHC 4UAHA 2FLBT 2I9LB 1DUZB 4JFVA 4OGXH 1DZ0A 1HK6A 5JA9A 4BZ1H 1H9VA 4MA8L 4RGMC 5A1AA 1ZAGA 3CFCL 2WXNA 2B5IC 1EGJH 1KELL 5K5YA 2WXKA 4ELMA 3HMWL 1KIPA 1R3HB 4KO7A 2F74B 4HHAB 1KGWA 1NBVL 2EKSB 5FV1L 2X4SA 2Y1ZA 4YO0A 1B9KA 5DJXB 3FFCE 4BFKA 4TVPE 2OZNA 5J3HC 1NCTA 1U8QA 4XE5B 1J5OH 3ARGB 3G5YA 1RZFL 4KPHH 1QRNE 3K6NA 5AYQA 5BPPA 3FRUA 4JEGB 3LIUA 2J8UA 2E59A 3N06B 5EC1A 3ZHKA 3IMVA 4G1MB 1MAMH 1YSOA 4YFLF 3LQZB 2R4SL 1QFWH 3Q2LA 1JNLH 1A7QL 3NQKA 4C57C 4ENED 3BRGC 5I71B 4G6ML 5CMAA 2APVA 3KPSA 2XXFA 3PHAA 2NY6D 4NUGL 4OZGA 5KVEE 4KDWA 4PTTA 4QRQB 1YY9C 3BEWB 1HSAA 2DDQH 1PIGA 3NZHH 1CD1B 3PWJB 4OR1A 3BUDA 5I15L 1UXSB 1YEDA 4YBLC 2VXSH 3NN8A 4BV1A 5MENB 2EXSA 2I60L 1LO4H 4Z77A 4QRPE 1IKNC 2W1NA 3ESPA 4FTVB 2I24N 3L4ZA 1V05A 4DEPC 4IM8A 5KVGH 4MB1A 2PO6D 3AQYA 5JHDB 1N5YH 2Z1KA 4JE0A 3EGSA 3TPUA 2OL3L 1KIUB 4Y5XC 5GRYA 3MZTA 1KG0B 3T8MA 2BIQA 1HHJA 1XGYH 4OSUL 4I88A 1DN2A 1OCWL 2VE6B 3C6LC 4RH4A 3B9KD 5EO1B 4AQEB 1UZGA 3B2PA 4MMYB 3IRPX 4RWYL 2ESVE 2Y22A 2XWBA 1U8NB 3QQ4A 4U49A 1T04B 2AGJH 1MIML 3ARDD 4P2RA 3GMOB 4LKXB 3JBG7 2G2NA 2FO4B 4O51A 5E0QA 4FQ1H 1HE8A 1K4CB 3WY4A 2PXYA 3ZT5A 1OALA 2HXAA 2EIKB 1QBML 4BSVB 5FW8A 3ATBA 3C08L 1QQDB 2QPDB 2CLRA 2VH5L 2VXVL 2MWCA 3ALXA 1P1ZA 2LV4A 4HWBL 5CD5C 4R8WL 2OYMA 4QY8B 4ABQA 1I7RB 2QSCH 2IH1A 3IJ7A 3QS2A 4YK4B 4LVHB 5MEQB 3DX7A 1OANA 1QBLH 3MNVA 1BAFH 1RPQA 3MLSL 1EHNA 2Z8WC 5F7MC 2YEQA 5F7EH 3SDDD 4GIAA 4WWNA 5AYUH 4Z7NE 4EO5A 5D4QA 3T1WA 2XY1A 4XO5A 5BRZA 4FQ2L 2DKUA 3MCKA 3TT1H 4UAOC 4JFWA 5D7JC 5CJ8A 5EF1A 2PWDA 4DUVA 1MXDA 4ALAC 3LV3B 5DMGD 5DHDA 1TCMA 1I7TA 4RFEB 3KPNA 4M5ZH 3HHMA 1DJWA 1U8MB 3CFMA 3X13A 1PZBA 1AMYA 3SPHA 4RETB 1ORQB 4N8UA 4YJZL 2M1KA 4GRMA 3QUMA 4AEFA 1JWUB 1Z0MA 1MCPH 4ZMAT 2JKJA 1UEMA 3GS4A 4KY1L 2VAJA 4M62H 3ZTDC 1ACCA 3GSQA 4UIKL 2FATH 3GSNA 5I1KH 4R96B 4YVUA 5K9QG 1R9FA 2FGWH 4XNXH 3WAJA 3AT0A 3MODL 4X8CA 3CFEA 3S37H 2VW4A 5FGBA 5F93C 1KIPB 5DQJA 1FNHA 2W38A 1LE9A 4J12A 2IC2A 4HS3B 1J9SA 3DDGA 4OZFB 1CLZL 5A2CA 1QSFA 3TH4T 4B5EA 1IARB 4G7YH 2ZUQB 2Y2WA 1JXJA 3G5YB 3WKPA 2YSSA 3FRUB 2J8UB 4K0OA 2ODIA 3H3KA 5EC1B 3CHOA 1HYSD 2R51A 1FRGH 4D9LL 3O2VL 4YDKL 2J71A 4XP9H 4I0PC 4QEGA 5CMAB 4AYDC 3KPSB 3Q2NA 4EKJA 1KZYA 3MJ7A 1HSAB 4G1EB 2BXYA 2W81C 2OV0A 5GGRB 4WSGA 2I25N 2VUYA 2GHZA 3ZIYA 1F90L 2XTLA 4BFIB 2VM3A 1WHPA 3H9SA 3WIHH 4YLCA 4Z77B 5GRVL 6PAZA 5BV7C 3QIBD 1SHWA 4ZK8A 1F8TL 4KXBA 2Y1YA 4U1IA 1WD8A 5SWSD 1AZRA 5EC2A 3L95A 4F8OA 1HHJB 1JNHB 4Y4KD 4PJCF 2NYYC 2VCOA 3BZ5A 4DUWA 4XB7A 3Q05A 1M4KA 1NMBH 1K5NB 5AZ2H 1JZGA 1NQBA 2ZF8A 4P2RB 4Y5VC 1OKEA 3HNVH 3V6OC 1WYJA 3FUIA 3RGVA 1NLDH 3JTTB 1TQSA 4JQXC 2IG2H 3L3DB 4M7KL 2FBJL 2X2UA 3K91A 3ME0A 5TH2A 2BIOA 2DLGA 3UTTE 2NY6C 2CLRB 3GSOA 4M43H 5L8KB 1P1ZB 4HT1H 4QRRD 3SN6N 3A47A 4DGWC 2J4WL 4JFDE 3DX9A 3HZKA 2FT8A 3ULAB 2VQ4A 2WYHA 4A2EA 2WTOA 3P4LA 3I50L 4JFPA 3UTQA 1I1CA 2AAVA 4ZUVB 5TF1L 3MNVB 4FXTA 2HT3D 5B1JA 2DQHH 3DBXA 3P4OB 2I85A 4L4VA 3F00A 4JPWL 1QNZL 3QIUB 4UT7H 5SWZD 5T3ZD 5J11C 1UB6A 2XZCH 4QXWA 1KNOA 3R4DA 3O6MH 4UOW1 3RWFA 2WUBL 2E8ZA 4WI7A 4DKFH 3TBBA 4IJ3B 2DLFH 1NFDA 5CUSH 4FN0A 3ARDC 5BZDA 1I7TB 2BFVL 1ZA3B 4Z7UF 3KPNB 2E46A 1L9NA 1DJXA 4NJ9H 4S1RH 1MRCH 3SPIA 1N2RB 2LOEA 4DTGL 1ONQA 1PZCA 5D7LE 5IKCA 1KJ2B 4ZO6A 5IY5B 4QRSA 1BJ8A 1O6VA 2AI0H 3DVGB 4GRMB 2TRYA 2VLLB 4Y19A 5JIKA 1IV8A 1EO8L 1X5XA 2FT7A 2LLNA 4U33A 2BOBB 4OCWH 2CCVA 2VDRL 3DX8B 5KUKA 1ZWIA 4FNLH 4OGZA 2NRDA 1R4XA 2Q3AA 3IEAA 3GSNB 1ASOA 3L5WA 1PJWA 4LSQL 4JRYA 2XA8H 3BLKA 3PG2A 3CFDA 4IKJA 4MSWA 1K8IA 3CXDH 4JFSA 5EU3A 5I19H 4JG0L 3WN5A 2D7OA 4MJHA 5EOCL 4AG4H 3TO4B 4ZD3H 5I16B 1LE9B 1KGCD 4ERSH 2DMBA 1EXHA 1WFJA 3VH8G 1QSFB 4R0LC 3P69A 4QRTA 1R3LB 3I9IA 3GTTA 5TE7L 2FJFB 3ZIMA 4ETYA 1L0QA 4AQAB 1OSEA 2IGFL 5JHLA 5F7YC 3AWEA 3V7AE 2EE6A 3MR9A 2H2PC 4XP1L 2A38A 5H37G 3S3CB 3IFOA 5KOMC 4UU9A 4XPHL 2Z7UA 5KWYC 4N8PA 1YEEH 1A8JH 3W82A 1NC4D 1Q4NX 1F4WL 4P07A 3FUFA 4DGYL 5I8CB 3WIIH 4HPOH 1CGUA 4MAUH 3WFBH 4YUEL 2IAAC 2J72A 3LSOA 2YD0A 3B7YA 3WEXA 1S46A 3CH1B 1QFUH 3H42H 2ZG2A 1JIBA 3VFSA 1XTLA 4LLYA 3U9UB 4CW1A 3PE9A 4JK0D 3S34L 3L95B 3MRJA 4ZZFA 4B9GA 2OXHA 1MFAL 3TV3L 1JGVL 1MG2C 5DZNA 5AVQB 3RBGA 4G3YH 4KH9A 1YMMD 4YSPA 1BXVA 1VFBB 3LQAL 4GAGL 4JO4L 3L1FA 1G6VK 2DWTA 1BMGA 4J8RB 4KROB 4C56E 4Q6YA 1T2QH 3FO1A 3T8XA 3ECBA 3T65B 3W5NA 3P2DA 2N1TE 4FLRA 1KBKA 3BSGA 3VXQA 1WVZA 2VERA 3AY4C 4PRNA 1GTFA 1HYSC 2Y7LA 1OSYA 3AUWB 3KBFA 2VDNL 5I2IA 5SWQA 1BV8A 2J55A 2FUQA 4U2ZA 1ZIAA 4NXKA 3CN2A 4J1UA 5TH2B 2ZG3A 2NNRA 1OQOA 2IBZY 5ERWB 1A7OH 4MD0A 5K39B 4LARH 3U2JA 3HLKA 1BEYL 4WK2B 4DKDC 3DX9B 4ZFFA 2G0KA 3BIAX 2N59A 2UXGA 4YSCA 1LILA 2QZ5A 1A9BB 2WGNB 2YLKA 1TJMA 5TDNB 1QSVA 3UTQB 2UVFA 1KB5L 2ZSWA 1MEXH 3DBXB 3FT1A 4I13B 4U1GC 1F56A 1MHPL 4L4VB 3TA3A 4UM9D 4XMPL 5CAYB 1CQKA 3MLZL 2XOTA 4V2BA 4ZAKC 1UD6A 1IBHA 3VMOA 4G8GA 1KNOB 1S7QA 3ERXA 2HFEA 2IPKA 3B9AA 3ESUF 3NA9L 3PS6A 5F6HI 3RWFB 3LXUX 3HAEA 2Y2YA 4RFNC 3Q1SL 4Y4FA 1NFDB 1GHFH 2LU7A 3K46A 5DS2A 1UD4A 5C0FB 3HW7A 3O41B 5D6CA 1ONQB 2NXZD 3KPQA 1A4BA 2XFXA 4QRSB 2VJ8A 4PRHA 5T3ZH 4KMTL 5F7FA 3C5ZD 5CGMA 2YBGA 4RSVA 4Y19B 1UACL 4IYKA 1FYTD 5AG9A 2PPFA 2BRRH 4WUUB 1LQSR 4MA3A 3SPCA 1C5BL 3KGUA 4N2CA 3HUJB 5I1HH 3D69B 3EYOA 4MJ5B 2CDGA 3SPVA 4EQ3A 3L5WB 2R8SH 3QIWD 1FL3A 4WSJA 3TURA 4ZMTA 5CGYD 3EYFA 4MSWB 3CFDB 5EU3B 4A7SA 1K8IB 4TPRH 2XVGA 4NBZB 2DJUA 5AZEH 3WN5B 2OMYA 4L8CB 1LL1A 4X6CE 1SF5A 3T2PA 5ALBH 3D05A 2NY2D 3FRPA 4KZ0A 4WTXA 4LP4A 4YNYA 2Z91B 4HJ0D 4QRTB 4YDIL 1J1OL 1NCBH 3TBWA 5HPMA 2Y5EA 5GGVY 1HHKB 3PHOA 3HJEA 5ACZB 1RUAL 2HFGH 2A74A 1A2YA 3R06B 4Z7WE 5C0GA 2DTML 2JJWA 4O58H 3GM0A 4M7ZB 3IFOB 4OZIF 2NNAA 1MCRA 5J6GB 4UU9B 1A3QA 2WCPA 3DXAE 1IE5A 2EIEA 2Q87A 1VACB 4JQIA 3LNGA 1RK1A 4OTXH 1MFCH 4A67A 1A1OA 4X9IA 2HTLC 2JMRA 5KSBB 3ARBD 3ZYJA 3FH5A 1QPXA 5FYJD 4ECNA 4AQ1C 2VLMD 4QUOA 1HH9A 2X12A 3WKQA 3BKCH 5J12B 1J9CT 5CJ5A 1S3KL 5GHWH 2AKRA 1J0IA 5ESVA 4E9TA 3VFSB 2VW7A 3UPCA 4CW1B 3H2WA 4GAYB 4JANB 2OXHB 1B0WA 3PJNA 4C55A 1RCYA 1U6AL 4TNFA 3TH2T 4GQQA 1XR8A 1QG3A 4K8RL 5DD3L 3ALPA 5IROC 5TGBA 1Z66A 3T8XB 4AIOA 3VTAA 5MEOB 1AFVL 4GQZA 3VXQB 3ULUH 4PRNB 4X2UA 4PWEA 5AVSB 2QMJA 5FKPA 5SWQB 1D9KC 1EJOL 1YEKL 2LVEA 2ZUUA 3N0AA 2ADIA 4CMHB 4J1UB 4N3UA 4H8HA 1NEPA 3TYGH 1E90A 4MJIA 4MYWB 2V17L 4HBCH 2KLSA 4G83A 3HG0A 4ODSH 4D2NA 3WNIA 1BWMA 5J1SC 4IRSB 4EZLA 4ZFFB 3W3BA 1NUDA 4JFZH 4WDIB 1IL1A 2Q8AH 5DHYB 1AYOA 1LO0L 3ULUC 2ZSWB 1E50A 2RHEA 3JV6A 5FKAA 5K1NA 1DTUA 1SJXA 2DLHA 2ZUWA 3TA3B 4R7VA 3U48A 3MU3A 3MRQA 1HESA 4YBQC 5L4FA 4G8GB 3QJVB 2IIJA 3HS0C 2IPKB 4YPJA 3MCLL 1UURA 4WNJA 3HAEB 3HE7A 3T0BA 4Y4FB 3MN8A 5KVDL 4TXVB 4NO3B 4DKAA 3ULVD 1WWCA 3KLDA 2EIMB 1L3WA 2BP5M 2CRYA 4WWKA 2ZPKL 4DGIH 2XFXB 2NX5B 1P2CA 3GUFA 5AOIA 1MH5A 3X1NA 4F37K 4W9ZA 3UPAA 1EAPA 1J05B 5C07E 3HMXH 4GQRA 1U93A 3VXOA 4MA3B 3HG1B 3Q1EA 1JYNA 1IIKA 3DVFA 2ZCLL 5LBVA 4OGAC 2HZHA 3BAEL 4PR5B 2EEXA 2UWEE 1NKGA 2E0PA 3EYOB 1CBVH 1B6DA 1L9QA 1UXMA 2C7FA 2CDGB 3SPVB 3QZLA 1JZ3A 1WA2X 5DF0A 1R19A 3DX4A 1T7WA 1ZIBA 2E6JA 3OKLB 3MRKA 3RE0A 5GZOA 3SODB 5E2WL 2FE0A 3R4RA 2OMYB 5K69A 2DTSA 2KBGA 4GXVL 5AW0B 1ZDSA 1DLHB 2PCPA 3BSHA 3MPCA 3LPPA 1WC7A 4YNYB 5FCSH 1M9WA 1BZEA 4F92B 4HWNA 2XC8A 1QX1A 1QYGL 3NACH 5HPMB 3VVVA 5A2FA 4Z76B 2VIRA 2YXMA 3PHOB 1JZ5A 1MCWW 5GJTL 2P7TB 5CZVL 3OWRA 2WM0A 3GHBL 2CCWA 6FABL 1UM4H 4PJ7F 5C0GB 3FFCB 2B1OA 2NXZC 2DPKA 3QQ9D 1OGAD 4Y2OA 5FB8A 1QRNB 2WIIA 1ZT1B 3C5ZC 3KBPA 1A1OB 5C86A 3MRPB 3DUSA 5HJ3B 3TZVD 5IHBA 2A77L 4CVZA 1YDPB 3RHWK 4GW1A 2ENSA 1UH2A 3HR5B 3L3HA 4CILA 1WAPA 1XF1A 1GSMA 1HH9B 1ERNA 3B6SB 2R0WL 2NW2B 4PG9A 1IFRA 3AM8A 1TZGL 3GZOA 1CD8A 3NGBB 3ZMRA 4K94L 5CGYC 5EZOH 3ELAT 5MERB 3L7FB 1CL7L 2C1PA 1P6FA 3IETA 4P5RA 1I1AC 4QRPB 1XR9B 2VNCA 4Y1AE 2R69A 2H0JA 3QVAA 3K1KC 2BIHA 3PAYA 1R33A 5FHAH 3ZN6A 4HJ0C 5FYJH 3QJSB 1X6LA 2ILLA 3IJHA 2Y6TE 2WZPA 5FGCE 3WG7B 1IAIL 2CUMA 2LGNA 4RGNC 5DMIL 2AXJA 4N2EA 1DVFC 2ESVB 4AIXA 2GVYA 2CKBA 5LXVA 5EMYA 1KT2B 2ADIB 4LL4A 4PJBA 5GIRA 2DQCH 1GS7A 4RMUA 4LBEB 4NO0D 3IF1B 4XOAA 1NH6A 5KZCD 3UYRH 3H6JA 3ARBC 5F88A 1HWHB 3ULUF 2AJYH 5L2KD 4HCRL 4AGOA 3GJEA 1HEHC 3UTTA 3FT4A 1RLBA 4MCMA 2KT6A 1AC6A 3JV6B 3PV7A 4JFDA 5FKAB 5K33A 4BE5A 4YDZA 4OCMC 2CBPA 5LCVA 3ZZLA 3VG0H 3BDXA 3N1MC 4FI6A 3MRQB 1K85A 1JK8A 3RGHA 3EJUA 3QDAA 4GUCA 4JY4A 4TSAL 5CCGE 4YHYC 1HZLA 4L0ZA 4JZNA 1LEGA 4UYQA 5FUCC 3CQFA 3BSZA 4N2OA 2KPWA 3QEHB 35C8H 3BUPA 2FSEA 4Z7NB 1R0AH 3U7WH 2F54E 4KHXL 4BCXA 4PG2A 3UYOD 4KDVA 2VDOL 1LO5B 4B9YA 4WWKB 1JL8A 2GC4C 4M7JL 1PLGH 1TTGA 1P2CB 1VKXA 2IALA 5I1LB 5D7IE 2MCG1 5CEZE 5FGSA 1J5IA 3HNSL 4IS6A 1DVXA 3DARA 1DDHA 4N87A 3WKMH 5JQIB 2ZWNA 5D7LA 4LEXH 4N4YB 4K5NA 1NANH 1DANT 1HILB 1NAMA 1YMHB 3ZXAC 3I02A 3IMTA 4JREC 3EHBB 3ULVH 3SO3C 1J8SA 1T20B 4W1TA 4S1QL 3LD8C 4XAKD 4Z95H 5GRJH 4OUOA 4WCYH 3F12B 3U4BH 1IT9L 3GMQB 3GSUA 1RPUA 2VSCA 2I7OA 3NIFF 5IHUH 5IOKA 2R56L 1Z9NA 3Q3GB 5CLXA 3PHQB 3G5ZA 2IADB 4BH8A 3ULVC 1REIA 3PABA 3BUIA 1GIGL 4LLWA 4JO3H 3DRQA 4HEME 4GJTB 4RX4D 1HNYA 3IDGA 2WIIB 3KR3H 3EH3B 1T21A 2ADYA 3V5HA 2YAFA 1FNLA 2KH2B 2Q1EA 2Z8RA 1AZUA 3WUZA 2UZYB 2EZ0D 5E2VH 4DGVL 3DSFL 5TDOA 4X6FB 3GRWA 1CD9B 5B7EA 3FTYA 3P73A 4RNRA 2NUTA 4KBPA 4PG9B 4D9RE 2PABA 4XXWA 5HGGS 4YSRA 3MCYA 5DHXB 4KZEH 1NCNA 5HY9A 4HUXB 2C1PB 3KH4A 3QFJA 3IETB 4JPVH 5ICZA 2Z4TA 3VTMA 5LGHH 3FQWA 4DGUA 4XP4L 2X41A 1CFTA 1FFOB 2XJKA 5IB3A 3GSXA 3IJHB 4OVUA 2JVUA 1KB3A 3HI1B 2KZKA 2YAPA 4U2YA 1CFVH 3RYMA 5KSUB 2IFFH 3ORJA 3ARFB 3QQ9C 5GIRB 2FEEL 5HGAA 3VJ6A 2J1YA 4XO8A 4LVOB 1XH1A 4KY2A 1AIZA 3ASOB 5F88B 3JWOH 5BUPA 2EUZA 4PGEA 2JCCE 4UBDC 3SE4C 2P5WE 1P6AB 1WQVT 4EN3A 3UTTB 3L5XL 3FT4B 2Q8BH 1W16A 2OMXA 2V2TB 1IGMH 3QUKA 4AUYA 4Z7OF 1BLNA 5HHME 1BZ7B 5ETUA 4H8UA 1RZKC 4U3HA 4JHAL 1SGKA 4PD4J 4L23A 1SZNA 1HXMA 1M7XA 4R6UA 4XC3L 2AABH 3GSRB 1JK8B 4R3SA 4JY4B 1I82A 2XG5A 1ORSB 3FN3A 4GB9A 4JZNB 3Q6GL 1PLCA 3BZFB 3JWOC 2PPDA 1FGNH 4TVSa 3US9A 2FSEB 2K9UA 3V4UL 4YXKL 3VDAA 2DJ4A 3GDCA 3TJEL 5IIEA 2OMUA 1H6TA 3DX1A 4RAVA 1R3IH 5FECA 4QMEA 3V4PB 5LBSA 4D9QD 1CZ8L 3EFOA 3BN3B 2RCSH 4AVHA 1VKXB 1JHKL 1VENA 5E8EB 1TJIL 5CZXC 2AEOA 5KVFE 2B15A 2AMGA 2X7LA 4KKAD 5D7LB 4ZODA 1A3RH 1X6NA 1NAMB 4WEMB 2DQGH 3I02B 4JUSA 1MJJA 5EU6D 5LGJA 3RWEB 4KQ0A 1EFXD 1FFQA 4KTGA 4KRPB 5KJ7E 3U1PA 1BG1A 3FONA 4O02A 3MGAA 3UDWA 3GYRA 3PNWB 3STLA 3C6SA 4DOHE 3QJUB 4CSSA 1QNIA 4L3CA 2G5UA 1NBQA 3C8KA 4TNEA 3ULVF 4XCFH 3EDJA 1L0XA 4O5LL 4L18A 3Q2CA 4GBXC 2HN7A 3G5ZB 2D03H 3PABB 3CHXA 2J5LC 1ZHNB 1EAJA 4GG6E 4CKQA 4ZYKA 2C8NA 1RMFH 1SUJA 2L7QA 1R5WA 4MB5A 3PWLA 4G7VH 4RMSA 4XWGH 3DRQB 5DZLA 1HEZA 2H41A 3GXPA 4U1JB 3IDGB 4NERA 3JT0A 3MYJB 1IAOA 4Z7WA 3FF8A 3KPOA 3V5HB 1BSIA 2X9XA 1GCYA 2H2SD 1TYJA 3FFDA 2XZAH 3DXAA 5TDOB 2LFEA 1HXKA 5C0BD 3VGFA 2PR4H 2EVJA 4LPXA 3P73B 4RNRB 2NUTB 3RA7H 3VWJA 2D0GA 2P8MB 3IGFA 2CO3A 2XN9D 3OQRA 4Z8FH 4LVNC 1WBXA 3UMTA 1CICB 3U0WL 3RTLA 3ZTNH 5F7HA 2AQRA 5BXFA 4QRBA 4CU6A 3FQWB 1NLBH 2AVGA 3G6DH 4R26L 4MJ2A 3I2CL 3QCTL 1CFTB 4C83A 2F8VA 3DWTA 4AL8L 2CK0L 3UEQA 4R4ND 3QO0A 3SCMD 2J5WA 3DJ9A 3IAQA 4FG6D 1DBMH 5JXED 3QCUL 4C56B 1B0RB 3GBNL 4AM0B 1N6QL 1ROWA 2YKKA 3P2BA 4H20L 3UTPD 4P59L 3VJ6B 4C4UA 3HFFA 3K6OA 3DO3A 4TSBL 3PU7A 4G43A 2BH0A 5ANME 3VM7A 4ADIA 1AMXA 2EZ0C 5CR1A 2PYEA 2HWZL 4PGEB 5DUPH 3SSGA 1Q8MA 1U4FA 3IDJA 2CO7B 2H1PL 2E7HA 3BE1L 5AW1B 3VU2A 4QYAA 5DC4B 3V2AR 2F6AA 3WKYA 2FJSA 3E1ZA 1CXLA 3MTXA 3L13A 3C2AL 3KWTA 3V4VA 1FFNB 1BXXA 1BLNB 1TZIB 3AG3B 5ES4B 1HIML 4OJEH 5IJKA 3NCFB 1X9RA 4X5QA 3NDZE 3S3BB 2XBDA 2GK0B 3ZYIA 1HXMB 1GZQA 4GAAA 4IRJD 3MRLA 1NKRA 4K23L 1AO7D 3O3AB 5DJ8A 4R3SB 2VJ0A 2E3VA 5HDQL 2XG5B 5HP5A 2L8AA 4K15A 4A2MA 1QUNA 1M7UA 1UOWA 2YGVA 3HVNA 4OFPA 3X12B 1HNGA 4FNQA 4QGYA 3CZGA 4WI2A 4FZ8H 1AZVA 1GPOL 3KM1A 2YGNA 2H1XA 1WAAE 3HTLX 4RAVB 1JNNL 3MOBH 3QYNA 2GAZB 3GJFK 4ZFZB 1USZA 2X6AA 2XKNA 3RVUD 3LMJH 1PJ9A 2BWQA 3BP7A 1PZUB 4JVPA 4LLVB 2XXCB 5DUMH 1MCOL 4NZRL 2YA2A 4CJ0A 4NKDB 1JPFA 2X7LB 4XZUB 2IGLA 3DGGA 3QZWA 3UEZA 4OB5L 1VIWA 1WLHA 3D12B 5C08A 4MXVF 3ZL2A 5HYJE 1H6FA 2DQTL 2P8PB 1U95A 2C9AA 2VN4A 2X4TA 4BUHA 4YFDB 4OW6A 1DBBL 2J43A 5C07A 1AI1L 1P7QD 1L7TL 3G6JF 1MAJA 4MXWH 2JELH 3TGXA 5IBUB 5DO8A 1ADQA 4O02B 4FDWA 4L3ED 1F3JA 2VMDA 2UWEA 3C6SB 4F93B 1KTDA 1TQBC 3R0NA 1AAJA 3L3OC 4P3WA 5BUAA 1RD6A 5KYYA 1D5RA 3C8KB 3BP6A 1DBAL 4Z1PA 1OTSD 4Q9BA 3CFJA 4V1DD 4YE4L 4R84A 3IGKA 2HN7B 4X6CB 1CR9H 4YH6A 3U36A 3EYUL 3UZVA 4PV9A 3OAYK 5E6IC 1U8LA 4ZFQA 3TFBA 5AFAA 4ZYKB 1LO2L 3U30C 3PWNB 8FABA 3N44B 4ZUSA 2MIZA 3NUKA 2H3XC 1HEZB 1O7DC 3MX0A 2R1XA 2E56A 3FTVA 3OLDA 3ZK0A 1T03L 4Z7WB 1MWAB 1IFHL 3GF8A 4OLZL 4KVNH 3EDEA 2XDHA 4FFYH 4KKAC 2K8MA 4PJ9B 4WI9A 4X7DC 3O6KH 2Y7SA 1EBPA 3BKML 4BFRA 1KIRA 1KTBA 1INDL 1DQDH 4BFFA 2ATPA 1JPTL 4M1GH 5EU7C 1E30A 1KFAH 2BHYA 2K4WA 1HJBC 5GGVL 1LHZA 4PJ8D 4AE1A 5HDLA 4WF7A 1E4HA 4R7XA 1GYUA 2CNYA 5BXFB 2NNXA 4P5TB 5T5FL 3SKNA 4JFQB 5I8OH 4F7EB 1WV7T 5D1XD 2WY3B 4P5SA 4HEPA 2EH7L 1XT5A 4MJ6A 3QO0B 1X5YA 4Y1AA 1TENA 3ZSTA 3OPZL 2XACC 3V95A 3S7GA 4LHUB 4AMKL 4NCC1 1XSJA 3AREA 3G5XB 4NHUB 3FCTA 3Q8EA 4JFFA 4G43B 2O6DA 1NM9A 3EGXA 3L5IA 5KYWA 2CXKA 5HVHB 1C08A 1WCBA 3JWNE 5BOJA 3GNMH 4J3WA 4Y4HB 5KSAB 1DQJA 3CC5A 4JM2A 3TTYA 3HI5L 3QUZA 4I77L 2CLVA 2P5ED 4YHOL 4YXLL 5GS0C 4FLQA 4OQ1A 5BOZG 1CN4A 1GZQB 4H2CA 3NG5A 4ZNEE 1SUHA 5AEAA 5LQBH 5DQDL 2Y1AA 1FORH 1O75A 1I1FA 1SPDA 3E1F1 3F7KA 2O26U 4YPGB 5C0CE 3WCYA 3ZTJG 3KS0H 2NY0B 2VC2L 4EKXA 5I18H 2WUCH 2NQCA 3QUXA 4PRDA 1KGUA 4YHIB 1G0DA 2N0MA 3THMH 2A9BA 2DEWX 2PTUA 2OSWA 1CXIA 3SCMC 2VW6A 3BDYL 3F05A 5JXEC 1JCKA 2R4RL 5FK9A 3ZZ1A 3N41F 2UZIH 1RJYA 4HXAH 2F54A 3RX8A 5DJDA 1J0ZA 2HT4C 1G1KA 2I5YL 4B3VA 5DFVC 4CGUB 1EEUA 3AWGA 5E1AA 1RZJC 4ABVA 1JZEA 3W37A 4HKBA 1D5ZA 1T0NA 3DGGB 3QUYB 4X80H 4PD4K 4FEMA 2E7BA 1U95B 4OGXL 2X4TB 4GXUM 2WB7A 4PTUA 5HHXL 5C07B 4BZ1L 4KJQD 5D72H 2HX9A 1ZLWH 3B5HA 4RMTA 2C4FT 1EGJL 4JJOA 2UWEB 1AHKA 4NI6A 3ZQ9A 5ANHA 4F58H 2GIXA 2ZICA 5HI4D 5I73B 3ARVA 2A0LD 1N4XH 3LCYA 4FQQA 1TZHA 5BMFH 4K5OA 1E27B 5CBEA 5KSVA 4X7CC 5F1KC 1L6XA 2A6JB 3F85A 4GQPH 4KPHL 3U36B 4Q0XL 3UZVB 4PV9B 1PNCA 1U8LB 3HZMA 1S7VA 4E9VA 1CTOA 2AXGB 4OLYH 8FABB 4WENB 1MAML 4WU5B 1QLFA 5JYMA 4QHKJ 4ZUSB 2E7LC 1QFWL 3W0WE 1PZ3A 3WLWD 2IWEA 1JNLL 3KPPB 3MX0B 1UQSA 2VZTA 3HE6C 5HHPB 5I6PA 4AY0A 5ID0A 5FEBA 3UBXG 1CGSL 3NIDE 3NOIA 1OE2A 2XIBA 5C0ND 3RVTD 2DDQL 3MJ8B 4ZO7A 7CGTA 3NZHL 4HEMA 5CCJA 2PPCA 1OSZB 2VXSL 2X53A 3MRMA 2VZ3A 2P80D 1PDKB 4XE0A 4XX1E 2YAQA 2NT0A 2BP3A 2W0FA 2WQUA 1N5YL 3A0OA 4PW4A 3KYMA 1JHTB 4XVUD 3SD2A 3MLTB 3D2UD 1XGYL 4DKEH 5K59F 4GUOA 1WT5C 1NCGA 3APDA 3EOBA 3O3EA 5IHZA 1ID5I 3HCVA 4OZHF 2DMHA 1XGTB 4UT6H 4N0YH 3Q5YA 2AGJL 4MJ6B 5I74B 1MCHA 5IWLC 1A5FH 4Y1AB 2AXHA 2AQQA 2WAHA 4J3TA 5F96H 4MJ4A 4G72B 3NJVA 4NBXB 3KPRD 3RY5A 3UZEC 5H94A 3VXUD 3QDGD 4UDUA 3KMDA 4QNPE 1QSEE 4HJTA 5J06A 3NA4A 3PAVA 1LWHA 1TPXC 5FGCB 1PIFA 1UCTA 3GRBA 4OCYH 1KPRB 1KGYE 1C08B 1WCBB 2GBVA 4JFTA 3ARSA 2QSCL 2BP8B 3F62A 2XV0A 3PWVA 5CBAB 4KV5E 1BFSA 3QDJE 4D8OA 3QUZB 3WNMA 1P5VA 3FU9A 1QBLL 5BJTB 5MHSE 1BAFL 1B4JH 1UD8A 2EO9A 1FVDA 4I9XA 1XF5A 2JCCA 4PJ8C 4KKRA 5F7EL 5B1AB 3RX5A 5CWSB 1YN7B 5AYUL 1NIAA 3LNEA 1PEZA 1BQ5A 3RZCC 4GW5A 1KCVL 1JZHA 1I1FB 2YGPA 2WLLA 3AQZA 1KBGH 3UBHA 2DIJA 2ZOLB 4QXUH 1TU2A 4PRDB 5JPMC 3W9EB 1NBZA 1S9VB 5D1XC 1K5WA 2QFRA 1QFPA 4KU1A 5I76B 1E9OB 4M5ZL 3II3A 3JYCA 1P5UC 1RJYB 1TLMA 1KY6A 4QRUA 2F54B 5CINH 4R7DA 1NCAL 4Z9KB 2HG0A 1MCPL 3FUNA 4IRZA 5E1AB 1BECA 1D5ZB 1Y6NR 1T2JA 2EP6A 5EOQL 2R2HB 5DFAA 1FI8C 4M62L 4XWOD 4PLJC 4MB4A 1OP3K 4MDJB 3VFGH 1LD9A 2E7DA 5D7IB 4LPYA 4PTUB 5DURB 2EVIA 5I1KL 3W38A 2Q3XA 4OV5B 3NSJA 4K7FA 4NUQA 5E6ZA 3RIAF 1N64H 2FGWL 5CNHA 4NUMA 3U1SH 3MRIB 3S37L 3KLKA 4ONHB 3ZO0A 1ZD6A 3QNFA 1BAWA 2SEBA 1XAKA 2CM6A 4FQQB 4OJFL 4FA8A 2DMGA 2IMNA 1KIQA 4BFOA 5CBEB 2RTTA 2P42B 4IGBA 1DE4A 1FVEA 4LOEA 5BV7L 3IFNL 4HX1A 4QLWA 1QLFB 3IKKA 1BZOA 4K9JA 1QWHA 4HOXA 1FZMA 2HLAA 2GJJA 1UQSB 3L3KB 4IHBA 4M3KB 4XP9L 4H2AA 3VG9C 1G9HA 3BFQG 5ID0B 4BCYA 1K3IA 2W80C 5JIHA 4GG6A 1TSRA 2WSDA 3KWXA 4I1RA 5FFLA 2B9BA 4FQHA 1BDYA 4JVWA 1L5GA 1ML0A 2XG4A 3P3RA 1VESA 4DW2H 3R18A 2PPEA 1F4AA 3WIHL 4N0CC 1UZ6F 3ZBMA 3VAEA 3T4AC 2W0FB 3BAIA 3KVQA 5C09D 1T5XA 3KYMB 5HI4C 2Z34A 3RWHA 4X6DA 1AGDA 4ZX4A 2IAMC 4JG1L 2Z31C 2CA3A 6CGTA 3QR0A 5J13C 4XRCB 1IZKA 4K7PY 2ENQA 5L8JB 1WTGT 3POCA 5C2BH 4F1ZA 4M5SA 4CADA 1MRFH 4EE2A 1VDGA 2XHNA 4BJLA 4IKNA 1RZIA 2CO2A 3GM8A 2FZ3B 2EXTA 3VXPA 2ZKWA 2YQ3A 1NLDL 4XMKH 2NY3D 1KCBA 5H94B 4H4NA 5ADPH 4ODBD 5DVOA 5AAPA 5GXBB 3MGOA 5DJCA 4JUTA 3VWKA 4HT1L 3PWPA 5C0NC 1GTNA 2DKSA 3ARGD 3PWVB 4JX0A 4M02A 1Z5LA 1CGWA 1HZHH 3VXNB 3MROA 1X9UA 2Z7YA 1P5VB 2YXFA 5ANMA 2FIKA 2DQHL 3VD3A 1GVIA 4AE0A 2EXWD 2C4XA 1FVDB 3LH2L 2JCCB 5GGQH 5JLZA 3ETBF 4UT7L 1QHQA 3OKYA 2P5WB 2YD2A 3AGWA 4PJXF 4GW5B 1OM3H 2XZCL 4XVUC 1IBGH 2OQJB 3VFUB 5E5MA 5I1JH 3GGWB 1AS7A 3O6ML 2XWXA 1MF2H 3FDWA 5A2BA 2ZG1A 1TU2B 4PY7B 3UGXA 1IQDB 1NBZB 4DKFL 4OZFG 2EABA 5E56A 2DLFL 2BLFA 2GCYA 2ICES 4MNHA 5CUSL 5MEND 2KQNA 1YEGH 2PYFA 4FC3E 2JJVA 3HI6H 3O8XA 4NJ9L 4S1RL 4B9FA 2LT9A 1CVRA 1IM9A 2KLTA 3SEPA 4QRUB 5JHDD 2AI0L 3IDUA 4N5ED 4G6JH 3D48R 4U6VH 1U3NA 1OV8A 3U0TA 4N68A 4OCWL 3LRKA 1BVLA 1SXBA 4JE4B 2VZUA 5E08H 1A0QL 1LD9B 3U2IA 4FNTA 4PU2A 1CTMA 1T0OA 1YMME 4O2FB 3FU7A 4YDLC 5E0FA 2XA8L 3PGCA 4YOKA 2HX8A 2E9IA 3CXDL 1TVHB 3ESOA 1VRSA 2EC9U 2HYMA 4GT7A 1MCEA 4AG4L 2X2YA 1NICA 1NCDH 1NPJA 3C09B 3FF7A 4PB0H 2SEBB 3E6FA 4ZD3L 1W91A 2QHRH 3LKPA 4DF9A 1TMQA 1CXKA 1G94A 3DDFA 1YG9A 1T83C 3NH7H 1FFRA 3FU8A 3GJFH 4HWZA 1G84A 1Q94A 1QI5A 4DOHB 3Q5TA 4DVRL 4HX1B 2VDKL 1KXVA 3EFFA 3QJZA 3IT8D 2OL3A 3RI5K 1E5CA 4GSUA 1FZMB 2HLAB 2ZE0A 2B7DT 1VF5C 1YEEL 4WU7B 1AKPA 1K2DB 4JHVA 4PRIA 1R46A 1RJCA 4IU2B 4NP4L 3WYRA 4GG6B 4F7PA 5IB2A 1OGSA 4TKWA 4FQHB 3WIIL 4A7GA 3MRFB 4JY6B 4HPOL 4W6YB 5DMYA 3QRBA 4H44C 3MGTB 2XG4B 1K6QH 3WFBL 5DHEA 3OX8B 4Y1TA 1QTSA 4CN1A 2F1EA 3O6FB 1ZHBA 4P2QE 3AZUA 1YYMH 5C9JA 1MLBA 1HQ4B 3H42L 4QHMA 4OU3A 5IM7A 1XXDC 2QPSA 2PWFA 2OW7A 5D71H 3LH9A 1RKRA 3DHUA 2H9GA 4EUPA 4ZSOA 1RI8A 3RWHB 3K3QA 4AMXA 1AGDB 3IS1X 4UWQB 1HI6B 4G3YL 2XQBH 3T3ME 5FR3A 2JF1A 3ZL4H 1JRHH 2G3ZA 4MBRA 1SXNA 4DN3H 3IK2A 1ND0A 3BWAA 4M7LH 5AYTA 3SOBH 3DHJA 5HDWA 3IM1A 3ZRCC 1OIOA 3QNXB 2X1WL 5E00A 5KAQG 1KB9K 1NPNA 3RY6A 5DJCB 2C9XA 3VWKB 4LARL 2KMWA 1GOGA 1WWAX 1JWMB 2A9NH 2JJUA 1SEBA 2Y6SD 3NSCA 3ZLQC 4F7MA 3D7PA 4TVUA 2Z4QB 1A6PA 1Z5LB 3T1FA 1SLVA 3EO0B 3TBCA 1ZGLP 2FIKB 1MEXL 3S8GB 5JLZB 3SBWC 1S7XB 3L4TA 3BCDA 2FL5A 3DJSA 4O9HH 3KPSD 2FX8H 2QR0A 5INCA 3DX0A 2FWLB 2QKIA 5IMLB 3EO9H 3PIQA 3VFTB 4B9CA 4HKXA 1X5LA 4XNUH 1CPUA 1XGQA 5HI3C 1J1PH 5AVTB 2LU4A 5L0QB 3T9WA 2PTTA 4IIZA 4IMKA 5HDBE 3WY1A 4ZNEA 1U8OB 2GCYB 1BF2A 1U2HA 1GHFL 5ITFA 2PYFB 5C0CA 1RL1A 1HKLH 5C3TA 4MNQA 4KHTL 2XNAB 4FNPA 3SPJA 4F24A 1FBIH 1IEBB 1OE1A 3A21A 4Z5RA 1FGVL 2AQTA 5T3ZL 1IBYA 2F8OA 1OHZA 4HF5H 1ZHLB 4R90H 4E41A 3F6JA 2O61B 2BRRL 4HWEH 5IBTH 2H26B 3ZO9A 1BQUA 1RHHA 3B2UC 3NRPA 1BVLB 2MTAA 1ZSDB 1SFHA 4PP1D 3S96B 5AOJA 3RVWD 5I1HL 5IQ7H 4Z7VF 4P2RD 3QFDB 4WSKA 5CSGA 2R8SL 1BIIA 3FU7B 5J89A 3D3VE 3PGCB 4WFHE 5HYJB 4QD2E 3FQ2A 1E8XA 2ZWYA 3GKWH 1FIEA 5I71C 4IKKA 2FX7H 3CFBB 5G4OA 1C16A 3E6FB 4MJJA 4MMZB 5ALBL 3P3SA 1FPTH 2IXQA 3SD5A 1NCBL 4DWHA 1Q94B 4NNXA 1Q0YH 1YJDC 1LP9F 2HFGL 4AVKA 3AC0A 3MRGA 3EO1A 3VA2C 3NZSA 2OL3B 3LN4B 4O58L 1HJCA 1PG7X 3KYKL 4LLAA 3CC1A 3QGVA 1IO4C 2AHIA 3QIUD 1AXTH 3PRZA 1B3JA 3U6RB 5EUOE 4KK8D 3RWDA 1OAXH 1YO4A 4X5WA 2WKOA 1MFCL 4OTXL 4F7PB 2X2IA 1OB1A 1JF6A 1KF9B 3EUUA 1JYWA 1GAFL 4JKPL 3L8QA 5KN5B 3VXTA 3BFWA 4OCLC 2BS9A 3BKCL 1E4XH 1TLKA 1PZ5A 4DO5A 2XIIA 5C9JB 2BINA 1MLBB 4ZTPL 5GHWL 4QHMB 3EJZD 3OR6A 5IM7B 2Z35A 5JIDA 3UPRB 2ITCA 4I3SH 1NOAA 2VR3A 4HMEA 1SF3A 1RH8A 5I1GL 3V0WH 4XH2A 25C8H 5KYUA 2J88L 4QCIA 5TK4A 4N90E 3TC9A 2AEWA 3WFEL 2DBJA 1XF4A 3VXSA 3PL6A 3NJGA 3ZE2E 1UCBH 4P9HH 2IOIA 4U05A 3AG2B 4LVHC 4YK4C 4HLJA 1PCSA 3KWVA 1AXIB 2EDBA 5J9PB 1HVXA 2X0WA 3ECWA 3MLUH 1LYQA 4PJGE 3ULUL 2ROXA 1W0VA 3W2DH 2R29H 2O93L 5E00B 5EWIH 3QORB 5F2FA 2ZUXA 2EILB 3G6AB 1R1CA 3TYGL 4HBCL 3BLPX 4ODSL 2Y06H 4PGBA 3D18B 1QSFD 3I9GH 4MFHA 2ZXWB 5GGTH 1SEBB 4IMLA 1QSEA 4JFZL 4QAWA 2Q8AL 3HZ3A 3QAQA 2MCAA 1OF2A 5EF0A 1KCRL 1SDAB 1W80A 3VI4F 5FO8A 5FHBH 3RFZA 4WGKA 4DP8X 3N04A 4L1SA 1UT1A 5INCB 3BUYA 5I17B 3QDJA 1ZJBA 4UB0H 3MACH 4HKXB 1KJVA 5PCYA 5DC0A 4JAMB 4KNQA 4OZFH 2J6WA 2PTTB 3B2VH 4PJDE 2AW2A 2EIZA 2HPOA 1SNRA 3P0YL 4NNYA 4OZ4A 2OSYA 4M6MH 1JP5A 2FWUA 3T0AA 1JGEA 1M2VB 2OXGA 3AB0B 1KCLA 1GJIA 2X6VA 2ZXGA 3L5JA 3MV8A 1H8OA 1BVKA 4DGIL 1CI3M 4P46C 4Q8BA 2ZSVA 4HUVB 3HMXL 5T33H 3DUUA 3SDYH 4ZI8A 4KROD 2QZQA 3WSQH 3OF6A 3VRJA 1EMTH 2ZUQC 1CBVL 3APMA 4L8BA 1BIIB 2XPGA 1E8ZA 1AY1H 4G80A 1OARH 3RJQB 4XMUA 1IEAA 2JFCA 4LCWE 1T3FA 2D3NA 4LNRA 3OG4B 3SQBA 4X0KA 3FU0A 5KS9A 4WEBH 4M9PA 1A6AB 3P0VH 3B9KB 1PZAA 3O3BA 3IPEA 4DO6A 1WA1X 1NCUA 3QBTB 4U3SB 2IXQB 4UILL 3VX1A 3NACL 2UY7A 3FAXA 5FYKU 5HGDB 4M48H 4W70A 1H3TA 4NZUH 3SPGA 4YZFE 3TPKA 2XZQL 1UM4L 2TSAA 3UIYA 3G5VA 2BS8A 2Y69B 4L4VD 5A6IA 2QV2A 4NJAH 3U6XS 1BBJB 5FF6A 3TWCH 3K72A 3BLBA 1TF4A 1C12B 5HDRA 1FYHB 4I5BA 1KPVB 5JMRA 3W0WB 2N7SA 3CN1A 3L9BA 2CHZA 2EDKA 5CN3A 3BT0A 3ML8A 4PBVC 5B3SB 4IBTA 3VXTB 1H3GA 4KUCD 1O5DT 3MBXH 1PZ5B 1GMIA 4FP8L 3NIDB 3MUJA 2WB1A 4J4PA 4E9RA 3CPLA 1XB3A 1MRDH 4POYA 3SDDB 1OPOA 4W9LC 2Z35B 4NWTH 5I6XC 1KCUH 4K71C 1EO5A 1FDLH 2ITCB 5CIPA 3WJJA 3N3EA 3S35X 4L37B 2ERJB 4XH2B 4Y19D 5KYUB 3FXIC 4HFUH 1TVBA 3ZDZE 4YHLH 5I0VA 3LYRA 1R17A 4FTDA 4WUUD 3UX9B 1XF4B 5LJYH 2AJSH 2J21A 5FHAL 4U1NB 4ZDHB 2VDPB 2Q10A 3TH3T 5FYJL 5I0YA 2PR9A 3HAEG 1BZQK 3UAJA 3HG3A 3QWNA 3SKMA 1SVZA 3TXAA 2VSMB 5DJYA 1ACXA 1FAIH 1HHHA 1W0VB 5LKNA 1A7PL 3NEOA 4JKNA 1WTLA 4PHZA 5DEFA 3QIUC 2ZYSA 3QUMH 1IC5H 2DQCL 4KK8C 3U2SB 3U9WA 4A38A 4ZG1A 4XAKE 5HBBA 2R59A 1EAQA 4LSRH 2C26A 3GT6A 3V0JA 4Q56A 4IMLB 1QSEB 2EDHA 4X5XB 2AJYL 3MSPA 4XN4A 4NRXA 3NCXA 4PVMA 4NRZA 4GW4A 2P52A 2NY4C 1OF2B 3GSNH 1OQXA 4M4RB 3NT0A 3CDCA 5FO8B 3EJZC 2V5MA 4MX7A 2WXFA 3EXLA 2G30A 1PX3A 3F7RA 3QHFH 2L7UA 3QDJB 2JQMA 4KMLB 3SE3C 4PJIE 4FFTA 1LEIB 1YY8B 4FYRA 1D5IH 3QWOA 3WO4B 3KLSA 4FCHA 2R27A 35C8L 4OZ4B 2VSKB 1R0AL 4URTB 4P9ML 2ZP0T 4C8XA 1MCKA 2ZTBA 3W56A 2F1BA 4L8SB 3GMMB 2P44B 4N2KA 2BNUA 1PYWA 1JSYA 2WNGA 1KULA 3QEUB 4WTQA 2XWTA 2HH0H 5LLIC 4LT7A 1PLGL 2Y7QA 4NQSA 2XBTA 4I18A 4FKHA 4Z3FA 3TO4C 3WTWA 2YQBA 3AGVA 3CFIC 1VFAB 2M2DA 3CVBA 3WKML 4DCQA 2M26A 4KXAA 1OZTG 3PP3H 4LEXL 3WHXA 1U92A 3HN3A 2J8UF 4X98A 4OQTL 3RKPA 3IDXH 3FT3B 2D8KA 2IQAA 4UT9H 5ICUA 2JKSA 2ZKHH 3DVIA 3ENEA 3ULVL 4CMMB 1F3DH 4L8BB 4TQEH 3IAPA 4YHZH 5DO2D 5DR5L 2GG1A 1VFMA 2OJZH 1MCLA 5EORH 4LNRB 1OPGH 1Z3RA 3SDAC 1WITA 4Z95L 3SQBB 5GRJL 4WCYL 5MP6H 1ET5A 2V5YA 3U4BL 3CVDA 5IHUL 2HTKD 4IRSD 1AACA 2AK1H 2UY7B 1T6BX 2XVBA 5ISZE 4OUUB 2FQEA 1DCEA 4KKPA 2GEEA 2CIKA 1R3KB 2GSMB 4QDGA 5DD5H 5DEJA 3BVNA 1JZ7A 1P4LB 2HJKA 4WI3A 3RL1B 3G5VB 2XTJE 4ATWA 2XRAH 1FO0A 3MV01 5EBLA 4JO3L 3TA3D 4RDQG 3B3IB 3CX2A 3K6FA 4Y5YA 3K4AA 4YVNA 1QFWM 3IJSB 3K72B 3KR3L 4P0DA 4GXUN 1CXHA 2DQ6A 4G8GD 3PUUA 3F64A 4JFOB 4OCNC 4I5BB 1EDYA 1EVTC 4TULH 1N26A 3MBEC 4MWFB 2CCLA 1B2WH 4Y4FD 5K93A 3B2DC 4UUJA 5EB9A 1HOCA 3NJHA 2NUPA 2AF2A 2ORBL 3CPLB 1CK0H 4ZNCD 1BYNA 4NC2B 4P2YA 1NJ9B 4KZEL 3PXJA 5CIPB 3UACA 2NX5D 3WTSA 2XXMB 2D0HA 5FM5O 2OKMA 2ZX9A 3QHZL 3QP3A 4P2QA 4F8LA 3QC6X 5JO5A 5IB5A 1TVBB 5LGHL 3BIBX 4JO8A 4Q97A 2AJUH 5CP7A 4UQAA 3IU3B 1UD3A 4ZPTA 3P3UA 4L1HA 4HVBA 4HJGA 3SKMB 3UOAB 4NPYB 3GZKA 2N0KA 2WWNA 5IK3A 2WINB 2AV1A 2NY5C 5DJYB 1HHHB 2NZ9D 1OF0A 5CSBA 5E7BA 5KBKA 1T6VN 1QVOB 2O30A 2R1WA 5DEFB 3P0GB 4TNWK 1UT9A 1TQCB 4U1MA 5FFOA 1E5AA 4HSCX 4DP9X 4JZJA 3U4EA 5ICXA 4FA7B 2E47A 3SBQA 3JWOL 1H15A 2YFOA 3VI3A 5BQ7A 4NRXB 4RDBA 4RZCA 5KAQF 4NRZB 2K45A 2OK0H 2Q8BL 1N7MH 4G9DA 1SOQA 3LTVA 3PGDA 3ILQC 4OFVA 1IGML 3FFCD 4J3OD 3R8BB 2OP4L 2PUQT 4TVPD 1DEDA 4MTMA 4ZW3A 1V55B 2UY6B 2NT1A 2ZXAA 4Y16A 2V37A 1HYRC 2AEQH 2AABL 3FHAA 2FBRA 1DJGA 3PP4H 5LXGH 2WBJA 3TONA 1PQZA 1OXYA 3L54A 3EGDA 4Q6IA 1ITBB 3QPXH 4LIQH 1FGNL 1SYSB 2ZD0A 3QUGA 1WZKA 4BK5C 3NSXA 2VABB 2KPNA 1PYWB 1IAMA 3OJVC 3VSVA 3FH8A 5GGSY 1DBKH 2XWTB 3QO1B 5INDA 3L3GA 2Y7QB 3KE0A 4I18B 2XICA 4NSKA 3OKMA 4QRPD 1M2OA 2HUEA 4XNMA 2BVUA 4A63A 4DCQB 2HMID 1F6LL 1A3RL 1U92B 2WXHA 4X98B 1AD0A 2HLEB 3AFLA 4IBYA 5E8OB 1IILE 1WEJH 2X4QA 3KCPA 2DQGL 3OKKB 5EPMA 4BQ8A 4PYHA 1JPGB 1INEH 1A64A 1F3RB 3QS3A 4WO0A 2DWEA 4BDVA 1Y07A 3B9EA 2ESVD 2V9RA 3QXTA 1BREA 4M7ZC 2ZOWA 4TUKL 3JWDH 5FA3A 2YEZB 2EE2A 2EUWA 5HI5D 2MCPH 1YMMB 4MJID 4ODHH 5IVXE 4NN5B 1Y1DA 3D3VA 2J8OA 2BVYA 4XCFL 1H5BA 1GOFA 1O6SB 2V8MA 1DVQA 4S2SB 5IMMA 2D03L 5J12C 4W9JC 4P8QA 3BVNB 1SFDA 5EBLB 1FO0B 1I31A 8CGTA 4G7VL 1LWRA 2HVBA 4Y5YB 2QQLH 2APBA 3JWDC 5IGXH 5E6UB 4AGQA 2BSRA 4L2LA 3MOQA 4BHUI 1IGCH 2WO3B 3DI3B 1BW8A 3DX6B 4LCIH 1FZOA 3FJTA 5EUKA 3T4YA 4F9LA 1AQMA 4FAAB 3HE7D 2XZAL 1TJHL 5JQ6H 1BF5A 3H7BA 1AO7E 1CDCA 2BW4A 2PR4L 1IBBA 4A1RA 4UUJB 1HOCB 3RA7L 3P4NA 5EG6C 3GUTA 4M8RA 4N24A 3T2QA 1V27A 2PCYA 4CRPA 5DO2C 2WCGA 1CYXA 4WWKD 4Z8FL 2F7PA 3GWJA 3PPEA 3QEQE 1KDIA 4JN2B 4P2QB 4CMHC 5JO5B 5EIQA 5IB5B 3KM2A 4ICWA 1S7WA 2NQ3A 3HS8A 4IBWA 3G6DL 4HCRA 1G7LA 5CP7B 1KPUB 4IRSC 3N9GH 3HAEH 3PF2A 3UG5A 5IMKA 2GEQA 4ZPTB 4QI3A 4AVIA 3EHBD 3WE6A 3C2SA 1E3FA 2CR0A 4G8EB 2LTQB 3T3MB 5IK3B 2MPAH 1S7UB 4BRVA 2AV1B 2DYPA 3TBYB 5GZOD 1L7IL 2Z7WA 3OSVA 4NDMB 5IF0A 9CGTA 5IBLD 4H5SA 3HVDA 3EH1A 1KJMB 2EYRA 1TFPA 1QOKA 4NQVA 3U4EB 4KFZC 5ICXB 1TJGH 4NKOA 5SX4H 4LLQA 4S1DD 5DC2A 4FA6A 2K3TA 4ZT1A 5EF2A 2HRPH 3QIWB 4RZCB 2D2CC 3OXRB 3R8QA 1BQKA 3PGDB 1F1GA 5CEXA 3BZEB 2EDRA 4NAJA 3NJKA 4V1DE 4K3JH