3ZKSD

Bace2 xaperone complex with inhibitor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
112
structure length
112
Chain Sequence
QVQLQESGGGLVQPGGSLRLSCAASGFTFSSAIMTWVRQAPGKGREWVSTIGSDGSITTYADSVKGRFTISRDNARNTLYLQMNSLKPEDTAVYYCTSAGRRGPGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-SECRETASE 2
publication title Mapping the Conformational Space Accessible to Bace2 Using Surface Mutants and Co-Crystals with Fab-Fragments, Fynomers, and Xaperones
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 29
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2013-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zksD00
4YFEA 4L3EE 1QSVA 4KQ4H 4IMKC 2CJUL 1JPFB 5IF0B 3ALXA 4G7YH 2KL6A 5D7JC 4MGXA 1YYMH 5ESAB 1D6EA 1RZ8B 2DLTA 3GBMH 5B8CC 2A6JB 1XGTA 1MRDH 4LCUB 3QPXH 3CX5J 3CDGB 3DMMD 1IC1A 3BT2H 2VC2H 2VO5A 1MI5D 3MGOB 4H0GA 4JDTL 3RL2B 5GGUB 1T7YA 3DX7B 1FNLA 1Y0LA 2CRZA 1GC1L 3C6LD 4LARL 2D0GA 1EO7A 1EFXB 1F58H 2XFXB 3H9HB 4LF3A 4NQDB 3J8F7 3OX8A 3DXAD 4TVPL 3QUXC 5H8DA 4JKMA 3LPGA 1FDLL 4PRDA 1IC4H 4AEIL 1YPZA 1YC8A 3W11D 4DGVL 2C1OA 4DOHB 4XBPA 3KPSA 4MA7H 4K7PY 2LAGB 1QA9A 5CINL 1A7NH 2VZVA 4IMLB 4RAUA 4UQ2A 3FB7B 3AUVA 4LOUC 3T3MF 2AQ3A 4UILL 3CMOL 3VXSE 1NGXB 5EU6E 2VLRB 4J4PD 5LG1A 4Y5VB 1MSPA 3O81A 5I19H 1VFAB 4EN3A 3UC0L 1F4XL 3PG2A 1FYTA 3P2TA 4J3UA 4PGDB 3HPLA 5FHAL 5IFJB 4U1HA 3QQ3B 1EHXA 1B0RA 2CLZB 4AQ1B 3AVEA 4Y1AB 4MSWA 3BP5B 1AIFB 5ESQB 3WFCH 1RZGB 2GITA 3S5LA 1MLCB 1BFVH 1I9JL 4ODHL 4UOJA 5GRJL 5GS0H 3HFMH 1MFNA 4QWWD 3UTZB 1ZEAH 3H0TA 4HGMA 4AENA 1ORQB 5HPMA 4WDIA 3PWLB 1I3UA 3IDXH 2EDTA 1DQDL 5F7NC 4KTDH 5SWSA 3HI1A 3SEPA 4NO0D 1IM9D 3MA7A 2JIXB 5FO9B 1NGYA 1X5GA 1YMHA 1OLZA 3Q5OA 4LEOA 5GGRA 1CZ8H 2HKFH 3QZWB 4HUVA 1N7ML 1NUFA 3T0WA 2PTVA 5SX4H 1CU4H 3KLAB 3K8LA 1YY8B 3PNWA 4YE4L 5LVEA 4P23D 5EN2B 5F9OL 4A6YB 2VDKL 3SO5A 5TDPB 3P4OA 1GSMA 1XIWB 2LU4A 2ZUYA 4X6CA 2MNUA 3HAEG 3ARYA 2ZJSH 1FORL 5C09B 1NJ9A 2WUCL 4PJGE 4MMXC 2J7LA 1V3JA 3EJJX 4YXKL 4OZGB 4BZ1L 1RU9L 2F19L 4NBYB 3J7HA 3EDDA 3O3BA 2J1KA 4EI5B 3O6KL 4K3JH 1MIEH 4YLQT 1HH6B 4IIQA 5EU7E 3WO4C 1B6DA 2OL3A 2YMXH 5DRWB 1RJYA 3ULUH 4HUUA 3A6CH 4NN5C 5F6HJ 3B5HA 2EIZA 4HEME 3UJTL 1MCQA 3QG7L 1HK6A 3G5YB 5FYJL 1G0YR 4PREA 3V4PL 5H35A 1EV2E 1DLFL 5K9OB 5E95B 3SCMB 2W91A 3CSGA 3U4BH 4HMEA 2VITB 4PG2A 4ONHB 5DT1L 3X12A 1QLRA 1YEJH 3RVVD 5CIPH 4FNLH 1FFPB 1VCAA 1RZIB 5DYOA 3VXMD 1AH1A 4HKBB 4O58L 1XF5A 1ZHBA 2QR0A 3NFNB 2C7UA 2P24A 5CFHA 3LV3A 3WS6A 2W9LA 3U30C 4YUEH 5GIRA 2DB8A 5JHDB 4BH8A 5GHWH 2XYCA 4C56E 4JGMA 3WIFA 3IT8D 5DA4A 3L5WA 1DEEB 4JO2L 4MA3B 3BRDA 4JFXA 4YR6A 4M61A 4LIQH 1U8QB 3RVTD 3UTTD 5I8KH 1HEZB 5KVGH 4NQSB 2NY1D 5DHVA 2P44B 4LCWB 4FABL 2VXTL 5GGQH 1NGWB 2UWEA 4KJPD 3VFWA 2Z4QB 2MQ3A 3UXFA 2GJ6A 4P5TD 3BZFA 2XNAA 1QKZL 3ZTNH 3CH8A 5EUKB 4LRNL 1UJ3A 3S98A 5E1AB 2FIKA 3AFLA 4C54A 1Z0NA 1G7HA 4YAQA 5K9QI 3WFDL 1MAKA 5FGCE 1GOGA 4M5YL 4XC1L 4NCC1 3T3ME 3H9SA 2DQUH 3PWPD 2X4PA 3BDBA 2C1PB 2YZ1A 4TQEL 3BP7B 1KCRH 4UTAL 2XACC 3P30L 4CVZB 2DJSA 5KOMC 2BNQE 2PXYC 1WSST 1VEOA 3S36H 5F1IA 4TTDC 3OAZH 3MLWL 4EVNB 4DCQB 1HSBA 4J3OC 5H94A 1S7TB 3D0VA 5HI4C 4ZDHB 1AQKH 3H7BA 4X4MA 4X7DC 3MCKB 1ZA3B 4G9FA 1OGAB 2G2RA 2HLFC 3D85A 4LHUB 1T2JA 3TWCL 5GGRY 1VFBA 4OZ4A 3SE3C 3BH9A 3MRNA 3BEVA 4PY7B 5IMLA 2PYEB 3BEWB 3GIZL 2YD1A 4PS4L 3DNKA 3H6JA 4KKBD 4HD9A 3V4UL 1I9RL 3CPLA 1EXUA 3MYZA 4G80A 5I1HH 4U1SB 3QDME 5IB4A 2VIRA 5KW9H 2VN4A 4NM4H 4OIIL 2UV3A 2VNCA 1K9TA 3CFCL 5JMOC 4MCZA 4MD0A 1DE4B 1Y6NR 1G1YA 3R4DA 4WO4A 3RWJA 2APTA 5J89A 3RP1A 4LVHB 4XPBL 2DJ4A 3EYVB 3OXRB 2DQTH 2QV2A 1S7XA 4JFFA 3UTPE 1MF2L 4AZ8A 1GOFA 2X4TB 4NRZB 3O11A 3VWJA 5ALBL 1U95A 1SJEB 4H8WC 2NXZC 3VWKA 3B2VL 1MWAA 5I15L 1II4E 1GH7A 5T1KD 1A6VH 1NDGB 2WAHA 2HAZA 2HVJB 4PJEB 5GS2H 3FN0L 1K8IB 4L8DA 2O5ZL 2AAVA 1U42A 5HHMB 3SKOB 5BS0A 2V2WB 4UDTA 4JREB 2BSRB 2I24N 3N50A 3KPNB 4Z5RB 5T1MB 4NNXA 2EDBA 1HHHB 5C0DA 3HG1E 1KBGH 1A6TA 3DIFA 3GNMH 5E70A 1AHWC 5BRZB 2QL1A 5D70H 3VGFA 5EC2A 3S34H 2GYSA 2EKJA 43CAB 1C5CL 5D7LB 2BSTB 4R9HA 3T0EE 3SQOL 2VABA 5MEND 1AXIB 1TZGL 4TOYL 3DETC 5IM7B 3E6FA 1IGFH 3GHBH 4EDWH 3OAUH 5J3HD 4XPGL 1V8HA 1WTGT 4PP2A 2YEZB 1U3ZA 4JKLA 4X4YA 1R3LA 4G3YH 3MODL 3PXHA 4S2SB 4MDJB 4NSKB 4X7TA 3MR9A 3GGWA 4KK8D 4HUWA 5KVDH 5C86A 1DANU 4U6HA 3RWCA 2A9ML 5A2IH 1I7UB 3CVHL 1AP2B 5IB2B 2W0FB 4YHML 4YXHH 1A5FL 4MD5A 4L3ED 4X7EC 3NGBC 5SWZE 1NEZA 1TITA 4PJFF 4YHKL 5IROC 2D03L 5CD5D 3VFPA 3MRFA 4ETQA 4DQOL 2GAZB 2GFBA 1U0QA 2XZAH 3MRJB 2OQJA 4NT6B 5H37H 3C2AH 5DD5L 5FF6A 2M2DA 2WIIB 4FQ2L 3I50L 2RQ8A 3ARED 3NFSL 4M7LL 2UYLB 3QDAA 4PUBL 5EUOA 4D3CL 5IF0A 5F7EL 1HH9A 3RDTB 3MRBB 3ECBB 4HJJL 4ZFOL 1JGEA 1VESA 2FHCA 2A6JA 4LCUA 4UNVA 4LMQI 4HIIB 1AFVL 5JIPA 1IAII 3DV4B 2RCSH 3VFUA 1J1XL 1WWCA 3PGFH 1HE7A 2MCPL 1XR9B 4MX7B 3T65A 1EFXA 4D0BB 3T77A 3VXSD 4N9OB 5LCVH 5EU6D 2A38A 5C0NC 1J1OL 1K2DB 1G6RB 2DLFL 1MCLA 1YPZF 2Z35B 5LWYH 3P0GB 2R23B 4HIXL 1GGUA 2X9XA 3FMGH 3JV4B 3O8XA 3SGKC 4YHLL 3ES6B 4O9HH 4DKEH 1IGCH 2OJEB 5DURB 1DBKH 2ED7A 4XMKL 4Y16C 1MRCL 3GMQB 3UZEA 4Z76A 4HWNA 4HWBA 1S9KC 2OTUB 4LHJB 1CDUA 3KPQA 4XT1C 2R69H 4JZOA 1QBLL 3QHZH 1NGXA 4Y5VA 1OW0A 1NFDB 1TTGA 1Z9MA 2KQMA 2R39A 1HCVA 2AEPL 3S37H 3JWOH 3EYSH 2MMXA 3LVEA 4MXWH 3WUZA 1WEJL 4LP5A 3TFKD 4EUPB 3PABA 3DV6B 5F1NB 4UT9H 2P48B 5EO9B 3HRZB 5E6IA 1AD9A 4Q6IB 5DWUH 4AM0B 2DBLH 3H9ZA 4U1KB 1J05B 3X11B 4NC1C 1F11A 1FCCA 2GSIA 3QUMA 1E6JH 1ORQA 3PWLA 2DQGH 1SM3L 5CJQH 5I18H 4K94C 3RA7L 1BZ9A 5IBTL 3ARWA 1L7IL 1YNTB 1D7FA 1INQB 4XCCH 3O9WB 5FO9A 3WNKA 1TETL 1T1XB 1U3HD 3HI5L 3OXSA 4WW2C 1T0MA 1V3KA 2CMRL 5IGXL 4HGKC 1NKOA 1TJIH 3QQ9D 1MVUB 3BGAA 2OZ4L 1CICA 1RUKH 3UTQB 4Z0BL 2YBRB 2ZUTA 1A6WL 4HV8B 1KTLA 1M7DB 4X6CF 1XIWA 3EO9L 2DQIH 3MRHB 1HQ4A 3FT2A 4J1UB 4KQ4L 4XPHH 3WD5H 3QIWB 4TRPH 1UQSB 1MOEA 4G7YL 3QIUA 5HY9A 4KJQC 5C6TL 2YA1A 3GMMB 5EOTB 2DLGA 2FH6A 5MP6H 1T5XA 2GUOB 3GBML 4JREC 3RI5K 4LCCA 5F7MC 3ARFA 4QXWA 1MRDL 3O3DB 5CHNA 3I6GA 5F9WC 2ARWA 4NHUA 3I6LE 4YQXH 4HPYH 2A73B 4U6TA 1JTTA 5JDSA 4Q9CA 3RGHA 2DWEA 3ARQA 3IFNH 1F58L 2Q7NA 4QRRE 2BXZA 4GG6B 2HFFB 3MREA 1F97A 1QBBA 3AM8A 3M1BA 1IC4L 3G5YA 1FJ1A 1HI6B 4F58H 1FN4B 5C0GB 4PJFE 4MA7L 5HHPB 4FXGB 4L4TA 2VLJA 3UAJD 4C56D 3OSKA 1Q72H 1A7NL 2VITA 4WWKA 2B0SH 5JNYA 3WJJC 3K8KA 3VFNA 2EIBA 1ZS8A 5IMMA 1HOCB 1IC7H 3ZDYF 5D8JH 4K55A 3OHXA 4KV5F 4FQHB 2HFGH 3V4VH 3GJFH 5I19L 3DX6B 2G60H 1HQRA 2UY6A 3VRIA 4ELMF 2ZKHH 4FTVA 3WFCL 2AEIT 1YEDB 4FA8A 3OAYH 5D7IB 3IAGC 4W6XB 1BFVL 1MNUL 3SDXB 5GS0L 2HG5A 4PFEA 3HFML 1RK0B 4M3KB 2UWEF 3EYOB 5L2KE 1KJVA 3W5NA 1NSNH 3IDXL 4F57H 4I1NB 4WUUB 2B2XL 3LEVH 3KXFE 2V7HA 2VQUA 4KMQA 3OG4B 5IB5B 5J57B 2A77H 3QWRA 5E1AA 1LDPH 5A1AA 4HJ0D 3TNNA 2BNQD 1CZ8L 2HKFL 1DQQB 4HF5H 2IPUK 2AV7A 3U9PH 3K2UH 3L3KB 1W8OA 3PGDB 2Q8AH 3OTTA 5BCAA 1WZ1H 4RIRA 1ED3A 1FL6B 4OFIA 1R6VA 3WN5A 3L6FA 4OFYD 1F3DJ 5DEGB 2C1PA 4P4KC 5KBNC 2ZJSL 4NKQB 1H3PH 5ERWA 1UCTA 2P8MB 3VXTB 4HXBH 3ZHKA 2IAMB 3WLBB 2YD3A 2CXGA 3WIIH 5DJZB 3TPUA 3GSNB 3HMXA 1DR9A 3BX7C 1NUGA 4K3JL 1MIEL 2NZ9D 4ZODA 4HAGA 3QDMD 1JF1A 2YMXL 1KFAL 3ULUL 2LTQB 3VA6A 2X70A 2WZPD 3TZVB 3A6CL 3ULVF 43C9A 5HGHA 5B39B 3CU1A 3HZVA 1PKQB 4LHUA 1AC6A 5EIQA 4YDLB 1QYGH 2X1QA 3UTPD 5DJCB 5T1DH 3O4OB 3U4BL 4K8RC 4GS7C 2IFFH 1FG2B 5IP4A 4DVRL 1LO5B 3RWHB 4FNLL 3C60B 1IGJA 5JXAH 4HS3A 4ZFZB 3MSPA 2AJYH 3QR2A 5B4MD 5GS0D 3RWDA 1U8IA 1JZ8A 3IRPX 1AGBB 4YUEL 4EI6A 5FYLH 4N0UB 3BI9X 3U48A 4JY5H 2WINA 4G6JH 4CJ0A 3EHBD 4XRCB 3HG1D 4BH7B 3GUTB 2CDEA 4LLVB 2WBJC 4ZG1A 4OLYH 4LIQL 1RIHH 5FUCE 4Z78B 1N5YL 1CWVA 5KVGL 5CEYA 2I9LA 2IQAB 1YEKL 1IAIH 3KYKH 5ACZB 1EGJH 4QRTA 4CUCA 9CGTA 3BZ4B 1T1WA 1NCNA 3FO9A 5KZCD 5EOQL 2HYMA 1G9EA 4QHLA 2AERT 3T0ED 1OHQA 4R7DB 3RX7A 3ZTNL 3OF6A 1EAJA 3ROOA 5IESH 1FGVH 1P4BH 3SPVB 5TF1H 4B53A 5L2JA 1A7OH 3HS0A 4PJIA 4NQEE 4UUJB 4OD3H 4DK6A 1R3HB 3OV6A 2P5EE 5INCA 4S11A 5FDWA 5SX5K 1D9KA 2APFA 5D2LB 2DQUL 1FC1A 1Z2KA 5E6ZA 4P2OD 1J8HA 4R0LB 2P8PA 1N2RA 5ILTH 5HGAB 1FNAA 2BRQA 2GTWB 4OGAD 5IM7A 5F7HA 3KJ4C 1IEAA 1UCBH 3MFFB 5F7DB 3VFGH 3ZSTA 3S36L 1DUZA 1WBYA 2UZYB 4ELME 1FZKA 4I3GA 3E6HB 2IFGA 4RCAA 4LNRB 5SWZD 3STBA 1ACZA 3VW3H 1FO0A 5DRXB 1GGYA 1URLA 4GKNB 3VXOA 2DN7A 4ZTPL 1AQKL 3DYMA 3HZKA 4O2FB 5E2WH 4J3XA 3BJLA 3NAAH 5ICZB 4JM2F 4YHZH 1A7BA 2WQ8A 5SWQA 3CH1B 4MDIA 3K1KC 3WHXB 4LFHG 5FCUH 1Z5LA 2HT2C 1ORSB 4HBCL 2ZNWA 4NWUH 4ZSOA 1FVEB 1QBMH 1YNLL 4MVBD 4QOKA 5I1HL 1NLBH 3I3EA 5KW9L 1I85C 4NM4L 4HDIA 1IGYA 1OM3H 5CD3A 3BDXA 1JFQH 4PGZA 5GSRB 3IDJA 3NFPA 4GRWB 1UEYA 2DM4A 4MWFA 3NCYS 1TZIA 1UENA 3GSVA 4DJMA 4BJLA 1BPVA 5E2JA 2QBWA 3B9KB 2GW5A 4I2XE 4PRNB 4I48A 5ID1A 12E8H 1JWUA 3RKPA 3HZYB 4POZC 5ANME 2VR5A 3LY6A 2G9HB 3H7LA 1FVDB 5IBUB 1HYSC 2GY7B 3N9GL 3BXNA 1D5IH 1A6VL 1T21A 3PHOA 5IJVB 1QFWM 3B2UC 3VMOA 1CVSC 4H8WH 5I8EA 1Q9OA 3ULVE 5DJ8A 4J8RB 1P7QB 1U8LB 1LO0H 4M1GL 5E00B 4WHTA 4R2GB 2DOCA 1I75A 3VA2C 1G6RA 3SDCB 3MLZH 1T6VN 3BOVA 1YN6A 2IANE 3UBXA 1PAMA 1KBGL 4FQPA 1TDQA 5DRNB 3SE4C 3BUTA 1T22A 5FGBA 2A74A 4A6YH 2X89A 2DL9A 3I3BA 5KSUA 1BF8A 2P1YA 3S34L 3FQUA 1KXTB 2IAMC 5FM4A 1W72A 1G1CA 1JN6A 2QQNL 4H26A 1KGCE 1TCRB 3GRWH 3BN3B 2OTUA 2DF3A 1IGFL 2X1WL 3ZO0A 3OAUL 3PWVB 4HUKB 3DJ9A 4KTEH 2LTQC 3RNKB 3UYRH 4LSDA 4RA3A 5DI8B 1SJVA 3ZYIA 1PLGH 1OAKH 4PGCB 3VXRE 4G3YL 2ICEA 3KPMB 3X14A 4GUPB 1IQDB 3IKCA 7FABH 4GW5A 4CDGC 5IR1A 4JFEB 4B7LA 1QFOA 4Q6IA 1LP9B 5F3HB 5KVDL 2C3WA 1FE8H 5C0AA 3SO3B 2EDDA 1KPVB 4W6YB 3TIDA 3EJZC 4N0CD 2FEDC 4YXHL 4JRYA 3C60C 4KY1H 5DQ9B 1T04B 3DROA 5JXEA 1CLYH 4P59L 4J6RH 1HIMH 5EWIH 4FQLH 4XI5D 2BVOB 2R0ZH 4OF6A 2C4FT 2YUWA 4UV7H 5IJKA 5KSBE 3I6LD 4OAWA 2XZAL 2FHFA 5J1AA 1DN0B 3LKPB 1JPGA 4N1CA 1GRWA 5F7WC 3HMWL 3CDCA 4QRRD 5DLMH 5GS2D 4NIKB 4TVSa 5I71B 1KIPB 4KPHH 3LB6D 1G6VK 3PUCA 2BMKA 4QHMB 3QIWA 1UQSA 1GAFH 3ZYOA 3EFDH 3GM0A 2AK4B 4KK5C 5I1IL 1MHHA 5TGBA 5GGVH 3T3PF 3FFCA 5DJAA 3PGFL 3L95B 4Z7WA 2ZSWA 4CVUA 1A1NB 4GG6A 1HXYB 3QQ4A 4X8JA 5LCVL 1T2XA 3MO1B 5KS9A 5EU4B 1A3RH 3ZE0E 4I4WB 2DI7A 3CAFA 1G7IA 2CD0A 5D2NA 5FEBA 3I9GH 4IIQC 5IK3B 5ETUB 3V9FA 2GY5A 3T4YB 4BK4A 4DKEL 1DBKL 1E6OH 1JGDB 5DHYB 2BVQB 1WBZA 5B21A 2NX5E 3FQXB 1T7ZA 4R26H 1AGEA 5CJXA 2VLKB 5BVPH 1P9MA 3PQYD 4YPGA 1DVFD 4HFWB 5AD0B 3PV7A 5L2KD 1PQZA 4RSVA 3WEXB 3JV6A 3QHZL 3IKKA 1CG9B 3ARGB 2AK1H 2VRAA 4PG2C 3KXFD 1UM6L 1E4KC 3S37L 4FXKB 3JWOL 5E8EB 1QFUH 4N0YH 1E27B 4TSCL 3EYSL 3QIBD 3MOBH 4MXWL 4RRPA 5DQDL 2YZ8A 4UT9L 5CGYC 1YEDA 1BMGA 5DWUL 2DBLL 3VD7A 4XCNA 1KIRB 3U0PB 5J6HA 3T0AA 4KJYB 1RK0A 1M7XA 1A3LH 3WS6C 1F2QA 1LD9A 1E6JL 2DQGL 1CYGA 4NQDE 1ZHNA 4BKLB 3PIQA 5CJQL 1WCQA 5I18L 1CXLA 3WIHA 4XCCL 4ODUA 4DOHE 2HFEA 4PBXA 3BIKB 1CGVA 3NPSB 4C59B 4K94H 4E9LA 5L6YH 2XQYK 5DJDB 2FZ3A 1RUKL 5TF0A 2J8UB 4QKXB 1BZ7A 1FL6A 1UJ3C 2DQIL 3CXHK 1JZ7A 5DEGA 4WI7A 2VLRE 5EZLA 3C8KA 5GZOD 5B38B 4TRPL 4ZO9A 4F8TA 3O2WL 3VXQB 4TUOA 1UH3A 1T1ZB 3TBYB 4FQQA 2DM2A 3T0XA 1GZPA 2QKIA 2YD7A 4Y1AE 3CFJB 1GGCH 5F71A 3RAJH 4OZFG 4YQXL 2NY7L 5F89B 4HPYL 2X9WA 5HVFB 3FFDB 3BKMH 4C83B 5KN5A 4DK3A 3V6OE 2H6PB 4RDQG 5HHNB 3D9AH 3TNMA 4OUUA 5B39A 4HULB 8FABB 2A0LC 1BEYL 1BX2A 3ZYJA 4JPVH 3KGRA 4JB9H 4UAOB 1X4YA 2PTTA 2CLVA 1UXWB 1Q72L 3QHTC 3QDJE 1J8KA 1OTSD 2B0SL 1FG2A 3BWUC 3KWWA 1LO5A 3FT4B 1IC7L 4RQQB 3RWHA 5I17B 4HHAA 1CFVH 5EFIA 1A64A 1P1ZB 4F2MA 1HHKA 4ZTOL 2LE9A 1EIBA 2HLAB 1I1AB 2HFGL 1RJLA 3O3AA 5DUBA 2EIDA 1A6ZB 3V4VL 3DUSA 4PJDA 2YRLA 5EBMA 5JW4M 2EH7H 5C09E 1PG7H 32C2B 2FX7H 3SO3C 3GSRB 4OZGE 2H2SD 3HE7A 3ZHDA 2ZKHL 1UA6H 1T66D 1HHJA 4NQED 1YEGH 3WJLC 4X83A 1IMHC 2XOTA 3ARRA 3UYPA 4WO4C 3T3PE 3C5JB 3HCVB 2P5ED 5F9JB 3MYJA 2XY2A 4LNVA 5FO7A 3KYMA 4CN1A 1KULA 4ZUWB 4PJCB 1NSNL 3PL6D 4UMGA 4G43B 1NBZB 4JG0H 3LEVL 3VWJC 3VH8G 3SDDB 1KYOK 3DRQB 1EJOH 2A77L 5IW6B 3NIFF 3SPVA 1LDPL 4AL8H 3ZKMD 4WHDA 2XPGB 4PJIF 4HF5L 3KS0J 5I71C 3K2UL 1QSEB 3U83A 4NRYB 4YHPA 4L4JA 2Q8AL 2O61B 3JWDC 1ZHLB 4JHBA 4S1QH 1AD0B 4PV9A 1A14H 1LQSR 2AQ2A 4AIOA 4Y5XB 2ADIB 4PRPA 1FVCB 4HJGA 3QXAB 4KDWA 2EEBA 3SE8H 3M17A 4KROC 5BXFA 5HGDA 1CXEA 1AR1D 4HKXA 1H3PL 3IDGA 3T2PA 1BQHG 5F88B 5JHDE 1YQ2A 3WIIL 5FA3A 5HYFA 2ZSVA 3TBSB 3BQUA 3ZL4L 2O5XH 4JFDA 4Y5YA 3BKYL 4LCWE 3QUXD 4U2ZA 3DRTB 2X4OA 3FCTA 4U6VH 5C3TA 4O2FA 2BERA 3CC5B 5IUSA 1ZT4B 3UTSB 3PWJA 4L8CB 1BBJA 2A9NH 3NN8B 4P46B 4D0CA 1T0NB 4X6DA 4X99B 1QYGL 3U1SH 3WE6B 1S9VB 5T1DL 3L3JB 3QQNA 2X4QA 3TPKA 2IFFL 5JOFB 4D8PB 4OV5A 2X4NB 4JGJA 1OB1B 4EZMA 3FJTA 4TNVF 4PJ9A 5JXAL 3IU3B 4K8RH 3S4SG 4I0PD 4KKNA 5C0EB 4I77H 4KGJA 2EDJA 2AJYL 3ULVD 4NFBA 3O41A 2R0WL 2ITCB 4NO5B 1Q9KB 1H0DA 2D7OA 5FYLL 4JY5L 4G6JL 4UIMB 4GBXB 2IAND 3STZA 3QRGH 4HWZB 3OB0H 4LCYA 1CR9L 2MPAH 4KMTH 4OLYL 1RIHL 4YIQB 4M5ZH 3TO4D 1IAIL 3F6IA 3KYKL 1EGJL 4KUZH 5DJ0B 4G8IB 5D1XA 3OKNB 4PJ8B 5IJVA 4L29B 4Q9RH 3VXNB 1P4LB 3L5HA 3FKUS 2JCCB 3NPSC 2ITDB 1M6OB 1OGAE 1KGCD 3B6SA 5IESL 3HNVH 4P9HC 4XMLL 1D6VL 1FGVL 2DIJA 1P4BL 1KB5A 1RY7B 5TF1L 3RVUD 3QEGH 1WISA 2PYEE 1A7OL 3BHBB 3CU7A 2HMID 4H1LB 5DJYA 1OF2B 3OKOB 4NC1E 4QRPA 4OD3L 3VXRD 3QDGB 4U6XA 3FB6B 3ZKNC 3EOAA 5EBWB 2Q87A 3U7YH 2J88H 4Y4FB 3D25B 4GH7B 5IWLA 1N5AA 4KRLB 5TH2B 3U7WL 4K2UH 4PRBB 4V1DA 5ILTL 5C9KA 4ZUVA 3O8XC 1UCBL 1NFDF 1ZKAA 3PP4L 4L3AA 5DVMA 3VFGL 1AY1H 3L3DA 4PB9H 3W0WA 3MV8A 5LAXB 2JB5L 1AO7A 4WV1A 1T5WB 4PJEE 4L1DA 4UAOC 5EG6C 5E2WL 3PHQA 5HHME 5FHBL 1OW0C 4BUGA 2HT4D 2ZOLA 3QI9A 2BSED 1FPTH 2G5BA 3HR5B 3NAAL 2HRLA 5AG9A 4YHZL 1MJUH 3EZ8A 3DYPA 2AJZA 1PY4A 3CJJA 2QQQA 5FA4B 5FCUL 3NIFE 4JFPB 5I16A 1ZANH 4ZOCA 4HCRL 1T04A 5DQ9A 3EFFA 4NWUL 1I1AC 4MHHI 2DDQH 3GMLB 1QBML 1R5IA 3QJFB 5CSGA 5I2IB 5E8NB 1Q1JH 3HNTH 4D9LH 4RGNC 1NLBL 4XNZB 4AJ0A 1KPUB 3TN0B 2OR9L 4D0DA 4FFZH 1U8HB 4RNRA 5BRZE 5MEOB 1YNKH 1V3MA 4G6KH 4AEFA 4F7EA 1JFQL 1FZOA 4XP5H 1EZVX 1N3NA 2XG4A 1MLBB 3REWA 5D7LE 4NPYB 4ISVB 1P2CA 3EO0B 5DQJB 4JQVA 4Y4KB 3BMWA 5H2BA 3NTCH 4MXQC 2V5MA 4GXUM 5DC0A 4ORGA 12E8L 2FJFA 1CICC 1S7UB 1DP0A 3EYQD 4GXVH 1A0QH 2GJZB 5HTSA 4HG4K 4JY6B 4Z7VB 1CLOH 3TC9A 1L7TH 4H8WL 2NX5D 3U36A 1R3KB 3QIUC 1KT2A 4K71B 1WZLA 1A1MB 1LO0L 4GG6F 3KPRB 4WU7A 4NRXA 3ARFC 5GJSH 1X44A 4P3DA 3MLZL 2DI9A 1U58A 3BP6B 4Y5XC 3L7EB 1Q0YL 2EDNA 5CAYB 1IAKB 4A6YL 1G7LB 3THML 3SQBA 3QNXB 3W9DB 3AM8C 4WNQB 1EEYB 5I1GH 3FQXA 1AGDB 5JO5B 2HVKB 4TUJB 5IMKB 3HPJB 1CVRA 4TYUA 4LRIA 1YQVH 3ZTJH 5GS1A 1ND0A 4NQDD 1A6AB 3MNVB 4KTEL 4WWKC 2Q8BH 3GMPB 2F54A 5D96B 3UYRL 5HI4D 2WWMC 1PLGL 1OAKL 4FXKA 2Y5EA 5E8EA 1E27A 2JJUA 1PZ5B 3IGAB 2AXHA 7FABL 4P48A 3IJHA 4J3SA 4L8SB 4IRJB 5JMRA 1DUYB 4QGTA 3STLB 3U0PA 2N7BA 1P84J 1FE8L 3U0WH 3RWGB 4NQCD 4ZUUA 3JXAA 1NC2A 3VJ6B 5IB3B 3CLEH 2FLBT 1H3GA 3CLFL 1NGZB 2VLRD 3TF7C 4KY1L 4HS8H 4OCMC 1CLYL 4EQ3A 4J6RL 1U8OB 2XRAH 2Q7YB 1KEGH 3BUYB 3RZCB 2NY6B 3BP4B 5EWIL 4GAYA 2VYRE 4NKMB 3VMPA 4PB0H 2HJKB 3R0MA 1F3JB 2R0ZL 3PWNB 4Y1AD 4UV7L 1U3YA 2DIBA 2VLLB 4GBXC 1L0YA 3ARBB 3I85A 4LVNC 3RL1B 2J8UA 2A6DB 2EDYA 3N06B 1SMOA 3WYRA 3BD4A 4OT1H 2UVFA 3S36X 4KPHL 4MCYB 2XG5A 2V2TB 1NFDE 4JCLA 4AT6B 1GAFL 3WNMA 3CFIC 3EFDL 4RFNB 2JIXD 5DVNA 1T1ZA 4JRXD 3D39B 2AJXH 5GGVL 2OI9B 3QDJD 1OCWH 3OR7A 3OJVC 3GMRB 1CFSB 3BGFB 1BJ1J 4JEGB 3HZMB 4ODVH 1TLKA 3MJ6A 2H6PA 2DYPB 2H9GB 4LBEB 1L6XA 3MUJA 1BFOA 3IDNB 4Y4FC 1G7MA 1RQ5A 2GTZA 4XVUC 5C1MB 5C09D 5DVKA 3I9GL 1I7RB 4NHCL 4F37K 1I1CA 4J23A 1GGIH 1U8JB 3MV11 4ORZC 3IXAA 2PCPB 5FOBA 1F02I 4R26L 4PJXA 4EI5D 3QCUH 3C5SB 3FQNB 5BVPL 4HH8A 2COQA 1X4XA 2LFGA 4P5KB 2BNRA 4Z77A 2JJSA 4O2EA 5CLTA 2AK1L 4PJDF 5DJ6B 4CADA 4N0YL 1RHHB 4ZOAA 3QB7C 5IHUH 3SCMD 4XNYH 1IGTB 1OAQH 4KVNL 4OLEA 1ZV5A 1FIEA 2PETA 1R3JB 4QYOA 5J0BA 3C5JA 5BV7C 5BVJA 2P42B 1G9NC 3K8MA 1I4FA 2FIRT 3LKOA 4ZUWA 2ARJB 3MUHL 2FJHB 4PJCA 3TN0C 4QRUB 1Z9SA 1UZ8A 3O6FC 4XC3H 3WLWD 4X9HA 1JIBA 1PVHA 2GCYB 3L3HB 1NH6A 3IU4H 2J5LB 1ADQA 1U8MB 1G7PA 5JHDD 3JUYA 1LK3L 2XPGA 4LLWA 3BD5A 3HRPA 4RISH 3QUZA 1PX4A 3MZGB 4KH2A 4M7JH 3T8XA 2M8XA 4GRWH 1VDGA 2Z31A 3EO1B 1KV3A 2W38A 4Y4HC 4AMKL 4P4RA 1IT9H 5D2LF 2ATKA 2DM3A 1QO3A 4GFTB 5D7KE 1IQWH 3FTGA 1QLFA 5ICXB 3ARPA 1TJHH 4PGEA 3OMZA 1J12A 3ELAT 4PJ7A 4DZBA 1NL0L 3DUUB 5BZDA 1KB9J 1I8LC 2Q6WA 4KU1A 3ZT6A 1D9KC 4ZMAT 2NY3C 1GGCL 1QNZL 3LKSB 4Y2OA 3RAJL 4N8VG 5DEFB 1J0IA 5DC4B 2W9DL 3DX9B 5D7IE 1O0VA 4JZNB 5TPWH 1I3RA 3QFJA 3SDXE 2YPLB 1D5MA 25C8H 3BKML 1T7XA 4MAYB 3DRTA 1NGPH 2X4RA 2VR4A 4WJ5B 1Q9WA 1ONQB 1IE5A 3D9AL 1ZT4A 3NN8A 1HCFX 1KYOJ 1VA9A 3GB7A 4P46A 4X6DF 4Y8AA 4OCNC 2RB8A 4JPVL 4QXGH 5AUMB 4YNYA 3CNKA 1HDMB 4PYHA 1XGUB 1K4CB 4NO3A 4W4NA 3QNZB 4Y16D 1BIIA 2AXFB 4P2RA 4YDJB 4Z7UA 1W0WB 1YEFH 1MCNA 3AMLA 4CW1B 3GZKA 3VCLB 1CFVL 3LN5B 5KVFH 5J13C 3QEQA 4L8SC 4HUXB 1OGAD 3L1OH 5ELIA 1J9CT 4MNHA 4LK4A 2SEBA 2BVYA 4LSQH 3BAEH 5J1SC 4R7NA 3BO8A 2FX7L 2NY2C 1QTYT 2PYED 5DGQA 3QXTA 1UA6L 1MHEB 1YEGL 1WJ3A 4ZS6C 1A7QL 3HAEB 5I1DB 1XH3A 4ENED 5IEHB 3MJ9A 5DJ0A 2R9HC 5HHVH 2P47B 1HHIB 3RZCC 4PJ8A 1U93B 4L29A 3FONB 1IKNA 1QR1B 4JG0L 5HYQA 4GG8B 1DQJA 2EYSA 3HHRB 2W1NA 5F3BB 1PKQE 3LQZA 4M48H 1EJOL 3ARBC 4UDUA 1MCHA 1CXKA 5B3JF 5J7CC 5GGSB 4AL8L 3DMMA 3OAZK 3SKMA 4MJ6B 4I18B 4H1LA 1MI5A 1OF2A 4P2QE 5DS8B 5CGTA 1LEGB 3FB6A 3C6LA 1MWAH 3EOBA 2B7DT 4S1QL 1JTPA 2AV1B 4RFNC 5IVXB 3MRDA 3DXAA 5EU6B 1A14L 3R06B 4HC1H 2XN9E 4R90H 5HHMD 4JFYA 2OI9C 3ZMRA 2PN5A 4KKLD 4KJQD 3SE8L 5HVGB 4PTUA 3JWDH 3S37X 3S97C 1CXFA 1YEEH 4DGIH 5DRZA 3BGFC 5FGBC 3W2DH 3S88H 2ICWA 4C55A 4N0UE 3VD4A 1X5LA 1F6LL 3MUY1 4LLUA 5KANG 5KSVB 2CK0H 3BYYA 3I6KA 2O5XL 4GMSH 1ZA6A 5EA0H 4Y2DB 4LQ1A 3I02A 5D6CA 4YBQC 1OQXA 4J4PA 1LP9F 1Z9OA 1T5WA 4U6VL 5BRZD 4EKXA 3V0WH 4AEEA 3BWAA 4YC2C 4LSSH 4P0DA 5EU5A 5FK9B 2YPKB 2A9NL 5D7LD 2YRPA 1LE5A 3CVHB 2DJUA 3U1SL 1YN7A 1U8KA 3F5WB 1XGRB 3UYOD 5F6IC 2XQBH 3RUGA 1U92A 2IH3B 3X13A 1FAIH 4JVUA 4EJ1C 4F7CB 3IVKA 5L8LB 3IFPB 3MOQA 1MCPH 4K8RL 4MNGA 3WMSA 1CDHA 5D2LE 1VACB 1JWMA 5JXEC 3TCLB 4MS8C 4NO0A 1IM9A 3B3IA 1BLNA 5DMYA 1F13A 4ISVA 4NCC2 5A16B 4OIBA 2Y72A 3GSWB 2R4RL 3SOBH 3P0YH 3BSZH 1KTDA 4P23A 2MPAL 4AH2A 3W9EB 4ZFOB 4M5ZL 1YDPB 5CLWA 2CR6A 4CU7A 4Q9RL 4K3HA 4K7PL 2GIYA 3QO1B 3EGSB 5K59E 2LVEA 1QBAA 3T08A 1IAOA 1WBXA 3HNVL 1AKJD 1A3QA 3IJSA 3S5LG 4CRPA 1XF2B 3QEGL 1JHTA 3CSPA 1N4XH 2F53E 3IS1X 5GZND 3RDTD 1BREA 4P9HH 1IAKA 3RI5F 5A2LH 2ZUQC 1WFOA 2X44D 1JJUA 3U7YL 3VXPA 2J88L 5HJ3B 5C92A 2NY4C 1WGOA 4P4KD 4IBLT 2E7MA 1AQDA 5CMAA 2MHAA 3NA4A 4GRWE 5DTFB 5D2NC 4C56B 4HIJB 3BW9A 4LSPL 3MNVA 2ICES 4MAYC 4QCIB 5INDA 4DVBA 4HS6B 1JNNH 1G7JA 4PB9L 2KH2B 3MGTA 2RBLA 3D69A 5L88H 3LKQB 5CJXC 4YBLC 4AIXA 4BFIB 1PZ5A 4ZUSB 2H8PB 3VXMA 2E6QA 3QYCA 5DURD 3LD8C 4FQJH 3LRHA 1EUUA 2BOBA 3STLA 1FPTL 3OKLA 5DZOA 4HWBH 5DXWA 4KQ3L 1JE6A 4OLUH 4X6EB 1MJUL 1C5DB 4KXZI 2Y5TA 4OF3A 5I1LB 3ARZA 4JZJA 4OSUH 5EOCH 1NAMA 3MV7B 4ZFFB 1SMAA 3K1DA 4IEFB 3LH2H 4ZXBB 5B3JE 4YK4C 3IFOB 3CSYA 3VI4F 3UTTA 2DDQL 2D7MA 2DD8H 1RVFH 4OKVB 5ADOL 2ZG2A 1Q1JL 5E08L 3HNTL 1S7VA 4O02L 4D9LL 3TBTA 4FFZL 4P5TA 2AKRA 4G6KL 5IOPB 3G04B 4XP1L 3WO3B 3PJSA 4XP5L 2J8UF 4NWTH 3RWFB 4CKVX 3HNSH 2JB6A 4NNYB 1AE6H 2QQLH 3QUMH 1S5IH 3LEXA 3ABZA 4KK9C 3SKUD 5T1LD 4JLRA 3PXJA 4KKCC 3O9WD 1A0QL 4DAGH 2JLLA 3DX8B 4R4NC 5J12B 3JWNC 5CJBA 4H0IA 3PWPA 1CLOL 3TCXA 4JFEE 1L7TL 3IAPA 1LP9E 1UXSB 1X6LA 3DO3A 3MBEC 3MJGX 5FKPB 3HZMA 4NKDA 5DR5H 1SYVA 5ISZB 3P4NA 4Z7NE 5CBAA 2ATPB 3NCFB 5GJSL 4LBEA 1QVOB 3GO1H 4RGOH 4U0RC 2NYYC 5FKAB 2IBBA 4JFOB 1OP9A 1ES0B 3RGVA 3QDMB 1BOGA 4OCLC 5E5MA 4FG6D 1MJ7H 3R8QA 4ZUTB 2NTFB 1EMTH 3RY5A 1FIGH 2QSCH 1SY6H 4PJHA 4MB4A 3Q6FB 3O0RH 4JFQB 1NBQA 3OR6A 2R2HB 1R24A 1VB9A 1QRKA 4JQXA 4CGTA 2VXQH 1YQVL 1E28B 1NDMA 3K3QA 4PYGA 4PTTB 2FBOJ 1MUJA 2Q8BL 3P77B 1VKXB 3O45B 4DFIA 4MD4B 2Y23A 4HGWB 2MKWA 1CGWA 4U1NB 2AK4E 3UBXI 4PBWD 1A4JB 4LEXH 1JK8B 4HK3J 5SX5H 1KIQA 3L7FA 2NXYB 1RZJC 2C9AA 4MHHG 4PLKC 2JKXA 5IVZA 1ZGLP 3K74B 1CDYA 5HYEA 4PJCF 1YJDL 3CLEL 2CO7B 1NLDH 5D7KD 3HE7C 2I5YH 1NMAL 2VAJA 3FB8B 5I75C 3EOYG 1IRAY 5JOPE 2XRAL 4I9WE 1KEGL 1U8MA 3FQRA 5T1KA 2IJ0C 1CXHA 1JP5A 4PB0L 2QHRL 1C12B 2FGWH 4JN2B 4CMHB 5E7BA 4XCYB 1RUQH 3GBLA 5AZ2H 4EDXA 2EKSA 3PDGA 3MNWB 4OZFA 3HB3C 2CUHA 2VLKE 4HIEB 5EDXA 4OT1L 3GI9H 4YPJA 1ETZA 4R3SB 5K33A 4PR5A 5HD8D 1KN4H 4FN0A 2DQFB 3MRIA 5FGSA 3TIEB 1FV1B 3EAKA 1HYSD 4L3CB 4LVOB 3G6JB 1Z0MA 4Y19B 2AJXL 3GIVB 3OGOE 5CZKA 1OCWL 4Z7OF 2AXJA 1CK0H 1D3CA 5DEFA 3QAZB 4P2OB 4NO2B 5MENA 1IM3A 1EK3A 4FMKA 5LGJB 4E41B 1A9BB 3MZTA 2YS4A 1I8MB 2HN7B 4FQXB 4ODVL 1WC7A 2YWZA 4TULL 3P4MB 3ZDZF 1MH5B 3GJFK 4J3TA 1LWRA 3WNPA 2Q86A 3SJVA 3BQUC 5ECJE 3VI4E 3DI3B 3EJYD 4Y5YC 1AXSB 2IAMD 3OAYK 2ZNXA 1GGIL 3WKML 3HMXH 1XF4B 4YDVA 1B0GB 4MAUL 1TVBA 5FO8B 4MNQB 1YYLH 4MZ3A 3P9MA 4LKCB 5CCKL 5JW5B 5ALCH 5CBEB 4FQ1H 3VI3F 1QQDB 4XP6H 3TA3B 1XZ0B 3D0LA 1J87A 1VGKA 1VEMA 1Q38A 2VAAB 3L3IA 4JVWA 1MFAH 2V7NA 4L3EA 3TZVD 3SN6N 1QHOA 3IDYB 3QCVH 2XTJB 2BC4A 2V2XA 1U41A 4ALAL 4YHOH 4PRIB 5DF0A 1S8DA 5IHUL 4XNYL 3HKFA 1OAQL 1DBMH 1WCBA 4F8QA 3EIFA 4ZXBC 4P2QD 3IDIA 2XA8H 2ADJB 2BVPB 1QPPA 5IEHA 2IEPA 3AREA 5ESVA 1JWSA 3QG6A 2F5AL 3EJZD 1HHIA 2FEDD 5T33H 4PY8J 1PJ9A 2NW3B 4R4BA 3SKJH 2ZPKH 2VZSA 3C60D 2JCCF 2XN9D 2F15A 1OTTC 3WNLA 2IADA 2R0KH 5ID0B 2GK0A 2Z92A 5BV7H 3V5DA 3IU4L 1G9NH 3LHPL 1H5BA 3UJJH 5D5ME 2X1OA 2P7TA 2PKDA 2AQ1A 2QADC 3WUWA 5D1XC 4RISL 1BVLA 1FNFA 4XAKD 4M7JL 3CCHA 5DS8A 5E9DB 5IW1B 5KG9B 1RULH 1LEGA 1R5WA 4ERSH 3D5OF 3VGAB 1I1FB 1PGRB 4Q2ZA 2E27H 1ZGLA 3VXSA 1IT9L 5EU6A 4Q74A 1HZHH 1FLRH 5J12C 5D72L 4HMDA 1NEZG 5C2BH 1IQWL 1ZLWH 2FRGP 3VFRB 1BBDL 3DVNB 4P57B 4M6OL 3MXVH 4KK5D 5K9KA 3FOLB 3WSQL 2X4UB 3FRUB 3X17A 4XH2A 2R1XB 5IHZB 4JHAH 4U3HA 4R97C 2FWOB 4IRSB 2D2OA 1UWEH 5IWLC 4RFEB 4ELKB 4GRMB 3S3PA 2EDWA 5I9QB 1EERB 2NZIA 25C8L 1NBYA 4KXZH 3EDFA 5FYKH 3O6MH 2RIKA 5GSVA 1NGPL 4EIGB 3CSBA 1ULVA 1UADC 1ZMYA 1UM4H 3PDOB 4CVXA 4FRWA 5L0QC 1UB5A 3BZEA 4IOFD 4ZOBA 4QXGL 5DDHB 3SGJA 2BOCA 4BSVA 2NW2A 5CSZB 4QF1A 3RUGF 1FZMB 2V9RA 1I3GH 1QSEE 4I3SH 4NQVA 1FO0H 5E8PB 1MPAH 4ZNEE 1N0XH 1VADB 1U91B 3CMOH 5KVFL 4XBGB 3CD4A 1ITCA 2QTEA 4DKDC 1FNGA 2VL4A 3L1OL 4FFVC 5SV4A 4PJGA 3EYUH 1U3HA 4LSQL 3V8OA 3BAEL 2CKBA 1X5KA 5CGYD 5A16A 1IKFL 4IS6B 4U1LB 3ARDB 2F53D 1SYSA 1UB6B 4N90E 3BPCB 4M93C 1I9JH 4PGBB 5J06A 4Z7OE 1T3FB 2P49B 5AZEH 4IOIA 3W9EA 1DBAH 3VGBA 4FZEH 4QRRB 5HHVL 3P73A 5D93B 3BDYL 4JQVC 4M1CC 4PD4J 1TQBB 4NYLB 5J6GA 3ZDZE 4CBPA 1IBGH 4ZAKB 1RJZB 3UTSE 1OAYH 2XZQL 4M48L 2XKSA 4M4RA 2VQ1B 5I1AB 4QTHA 3PDDA 4U7SA 4L9LA 1N7MH 5HI3D 4UINH 1CD1A 4JRWA 3B9KD 3JZ7A 3MRMA 2J6EH 3G5XA 5F9OH 1RUAL 1MWAL 1S7SA 2ZCLH 1EAPB 3DBXB 3VFVB 4G8GB 2E9WA 5F7UA 2VZ3A 4HC1L 5JLZB 3LRSA 4R90L 4H5SA 3P3YA 2BCKB 1X5HA 3BGMB 4TUKL 2CSPA 3V7AE 1X5FA 3JWDL 4DGIL 1FAKT 1FORH 1YEEL 5IMOB 1P7QD 3HA0A 3UPRB 3IJYB 4C56A 3S88L 1RU9H 4BM7A 4R2GD 5F7KC 2EYTA 1QSFB 2VSDA 4GO6B 4HKZA 5GPRA 2R1YB 2CK0L 1UJTA 4GMSL 3PQYB 5EA0L 2E7CA 2FNBA 3AXLA 4LRIC 5L2KB 2Z93B 3F7VB 5GS1C 2H8PA 3V0VB 4MJ5B 2DKMA 3V0WL 1OAZH 1W72H 4LSSL 4WGWB 2A0LD 2JCCE 5FYJH 4N9GA 2HTKC 1R3IH 3QEUB 3TVMC 2P46B 5FM8A 3QIBB 4XX1G 4AEHH 3CFKB 3R0NA 4GMTH 4YHYB 2G5RA 1PEZA 4XNQA 2XQBL 3VXUB 2OTWA 3QRFM 2XTJC 3QDGE 1FAIL 3QBTB 4WFFE 2ZG3A 4APQB 4BZ2H 2B4CC 2RR3A 4XNUH 4GRLB 2VMFA 1H3WM 2ICCA 1KNOB 3GMOB 4JFED 2A6IB 2R2EB 3LIZH 3IF1A 1DCLA 2PO6A 4NNYA 5CKAA 2CO6B 3D3VB 3TYGH 3X3FH 5DJXA 2BNQA 1KG0B 2CRIA 4M9PA 1DFBL 2WLYA 5BQ7B 5JPNA 3P0YL 1R5VB 1N26A 5I66B 4DEPC 3CFEB 3JV5A 2YRZA 3T2NH 2I07A 2JTDA 4OFYA 5MEPA 5FV1L 5JW4Q 4XZUB 3QH3B 4A2MA 1LK2B 3ZE2F 4KRPC 3HC0B 1CGSL 3QO0A 3NPZB 1FYHB 2ADGA 2RHEA 3VRJB 1N4XL 3WFDH 1TJGH 2GI7A 1QG3A 1ES0A 4P9HL 3QDMA 3OJDB 5MHSE 2GSGA 2VISB 2AK4D 3RFZC 4J2XA 3ULSB 2IPKB 2NTFA 3P9LB 3Q6FA 1ZSDA 2IH1B 4IRSC 4X5XB 4TQEH 2K1MA 2FR4B 4TNWK 3CDYA 4UTAH 5KSAC 2CDFA 1Z6JT 1I3VA 1W0YT 1E28A 5I9QC 1MCFA 1FFOB 3E3QC 1JNNL 4FXLA 1VKXA 3U9UA 5DA0B 5JOPD 3H2WA 4I9WD 5L88L 2W9EH 4LLYA 5DMKB 5F1KC 2LVCA 1A4JA 1PYWB 4Z7VE 1S9WA 5C08B 2AS5M 1DLHA 3MACH 1ZAGA 4HWBL 4OLUL 2BNUA 2VZ1A 3FL7A 3Q3GA 1CE6B 2VLKD 3BN9D 1ODAA 2CIIB 4OSUL 5EOCL 3KPRE 4TVPE 3LH2L 2ESVB 4XGZB 3HG1A 1VERA 3NCYP 1JYWA 1CQKA 1J88A 1S5HB 3ARGD 2Q3ZA 3KNBA 3LKNB 2R8SH 5A43C 3V4UH 2DD8L 2EH8H 3MRPA 1RVFL 1I9RH 4NN7B 4N0FB 1N0LA 1T4KA 3D6GA 1JVKA 4KUCF 4OIIH 3KLHC 4WU5A 3QULB 1FNEB 4LHUG 3RNQA 3ROLA 3LCYA 3CZFA 4XCYA 3T0EA 1S9XB 3ARDC 4MLIA 1DDHA 4WFGE 4NWTL 3UJIH 4RX4D 4M8QA 1HILB 4QXTB 3S3SA 3MRLB 1AE6L 2QQLL 4HIEA 3QUML 3SDAB 3MJ8A 4IJ3B 1JNHA 3FOMB 4R3SA 2XIDA 4WVRA 2DQFA 4POUB 3TIEA 3WIHH 3HAEH 2XKNB 4JY4B 3VD9A 2CUIA 1FHGA 3B2VH 5DZLA 4ZAKC 1CFTA 5TDNA 1QFPA 2IGFH 2Z31C 3DURB 4DAGL 4BK5A 4EXPX 2B5IC 3ZKQD 5D7JB 1SEQH 4HW6A 4P2OA 2JK5A 4JDVA 4NO2A 3G9VA 3GHEH 5J11C 5I8CB 2ED9A 5DR5L 5FYKU 1MCOH 5HI5C 3HUJB 4GAJH 1MH5A 4KRMB 1YMMB 1P4IH 2VDOL 4OZIB 3GO1L 4RGOL 5E5RB 5SWZA 4IRZL 3ZKND 2NLJA 5D1ZC 2NY0B 2FDBP 2GT9A 4LLDB 4U1MB 1EMTL 1QRNE 4UQ3A 2FSEA 1FIGL 4XNXH 2QSCL 1SY6L 2QSVA 1ZT1A 3Q6GL 1RFDL 3O0RL 4HEPG 3O3UN 4LKCA 4PPTA 4OGZA 5CIPA 3O8XD 2VXQL 3C6SB 3OGCB 4ONFL 3GI8H 2P8LA 4XPGH 5HYSB 2P5WB 3GJFB 3VFTA 4O5LH 1YY9D 5JPMB 1WAAF 1I7TB 2I25N 5BJTB 4L8BB 2VDQH 3P4LA 4X9FA 3FZUD 4CNIB 2WBKA 4OZHB 4U1IB 4EXKA 4LEXL 4K7PX 2PR4L 3D39E 4HIHB 2X5PA 1UZ6F 3V5KB 1DJSA 1X9QA 3ZE2E 2AEWA 2ZUWA 2NW3A 3MNZA 2FYYB 1WZKA 1RZJH 1I1AD 3OQ3B 2I5YL 1J0YA 4S0TD 4X5WB 2XT1B 4HK0B 5FYJE 4ZQKA 4YHKH 4RGND 3V79C 5EU3A 1MCKA 1GPOH 3VDCA 1KTKE 1HHGA 1MAMH 2FGWL 3VFOA 1FL3A 1RUQL 3FO2B 1FFRA 3HE6B 5AZ2L 5GRZA 5IVXF 5IEKB 4YFLI 2I9TB 3OKKA 1OL0A 4M7LH 2J2ZA 1XGQA 2ZUUA 3WNOA 5CJ8A 3QHFH 5HHOB 4KI1A 1KN4L 5EZIL 3GSXB 3VXRB 4P57A 4WY7H 2LAAA 1E4WH 3BVNA 3CFBA 4GQ9L 3SDDD 1U9KA 1ZVSB 2ERJC 3FRUA 3C5ZA 3HR6A 3MRQB 4JRYE 1JCKA 4K9EC 3MLVH 5T3ZH 4LLAA 1QSED 3DSFH 4XCEA 1J1XH 5D1QB 2ZOKA 5HDBF 4K7FB 1RHFA 4ZPTB 3FT3B 2ZUVA 5FYJU 1BVKB 5KOVC 5EIIA 4Z8FH 1P5UA 1OSZB 2APBA 2D31B 4HIXH 1ZVYA 5C0CB 1GVIA 5DDHA 2E9IA 1KLFA 4YHLH 2MWCA 4J4PC 5DJ2B 4OI8A 3HMXL 4N90D 4I5BA 2ZCHH 3LPWA 5IQ9B 4JAMB 1YYLL 4JJ5A 3O2DH 1CGUA 1I8KA 3C9NA 5ALCL 1ZHKB 4P2CG 1U91A 4FQ1L 4I3RH 2PW1B 4M62L 4XP6L 1T1YA 4E42B 3UBXG 1ZTXH 1QBLH 2UVEA 3VE0A 4WWKD 3OWEA 1BJMA 1MFAL 5DMJB 3O4LB 4S1RH 3R1GH 2ID5A 2WWMD 3QCVL 3KYOB 3UTSD 1D5BB 4JKPH 5IIEA 4LKXA 4PV8B 3D2UB 1U8PB 5BMFL 4XB7A 5T5FH 4H20H 1NQBA 4YHOL 2H32A 1S3KH 1SJHA 2V5RA 3N1GC 3KYNB 1A02N 1DBML 2Y7QA 3ILPB 2XA8L 4NQXB 3VG9B 1FNSH 2YPLE 4QRRA 5T33L 4O2CB 4KJWC 4LLMB 4AYFA 1N8ZB 1SM3H 4HK3N 1LEIB 2R0KL 4HZAA 4NYLA 1D5ZB 2ILLA 4XNMB 1L7IH 5BV7L 4M3JA 1G9NL 1JI1A 2V9TA 3FAWA 4H88L 4PJFA 2BSSB 2IF7A 3U4EA 5CEXA 3QWQB 1P6FA 2CMRH 2YKLL 3FB5B 4ZFGH 3AAZA 3GJEB 2VZUA 5LQBH 1TNMA 4GBXD 4QT5B 2XWBA 2OZ4H 1RULL 2Y9RT 4ERSL 3DBXA 4Z0XB 2OSLB 1HZHL 3GSOB 1FLRL 3RVXC 4XVTH 4XBEL 5C2BL 4H25B 3D48R 2VUYA 5C6TH 1A2YB 1ZVHA 1NBVH 1S7QA 3MXVL 3REVB 3MMEA 1WAAE 3IJYA 1MIMH 2Y25A 3L9RA 4JHAL 4KZDH 5TQ0H 1UWEL 4W6WB 5CWSB 1S7RB 3QUKB 3DHJA 4I0CC 1VFMA 3BPOC 1NMCC 3QDGD 2E7LA 4WFFD 1DVFA 1UZ6E 5L2KA 2PXYB 2Z93A 2ZCKL 3WS3A 1A4KA 5FYKL 4PJBB 1H8NA 3O6ML 4DN3H 2NY0C 3MLRH 1VPOL 4Y4FD 3KXFA 3JTTA 1KJ2H 1A9EA 4LHQB 1UM4L 4XVUD 3BKJH 3QIBA 3V6ZA 4E5XB 2EYRB 4LU5L 1CFBA 1I1YB 3AU1A 1RK1B 1LGVA 1F6AB 3OB0K 1N59A 4XXCA 5C8JA 3QXDB 3ORJA 1I3GL 4I3SL 1FO0L 1MPAL 4NQCB 4QHNA 1N0XL 3VH8B 3PGCB 1DSFH 5HXMA 2CIKB 3Q48A 1ZLVK 4GKZB 2CK2A 5IVXE 3S96A 1F6FB 4JKKA 3GMOA 4P3WA 1JRHI 3MLTA 3QISA 2NY1C 3EYUL 3F12A 1OOAA 4ZOEA 3TH4T 3QEHB 3PP3K 2D4FA 3KDMB 3RWIB 4P5TC 2H3NB 3ZZ1A 1JZ6A 1MNUH 4RZCB 5MHSD 5AZEL 1CE1H 1DBAL 4FZEL 3MRKB 3TN0D 3OBAA 4KDTA 1U8NA 1MQ8A 3O6FD 3MLYH 5HDBE 5ENWA 2B2XH 2VJXA 2NXZB 4U3CA 3TO2B 4PJAB 4ZO7A 1IBGL 1GZQB 4ONOA 4RRPG 1MCEA 5TJWK 4RAHA 3HE6C 1OAYL 4AIZA 2VL5B 4HH9B 4JRXB 2NNAA 2FO4A 3QDJB 1H15A 4Y4KD 3VRJA 4WENB 4UINL 2BK8A 2HWZH 2J6EL 2EDKA 1YC7A 4Y4HD 5C7XH 5I76B 2ZCLL 4X98A 2APWA 4G42A 3W39B 2XV6B 4XXDB 1CLZH 4OLXH 3RHWF 4KZEL 4PRHB 4AK1A 4NDMB 5C9JB 4WCYL 3WL9B 3RGVC 3QJHA 1AHWB 5D1QC 1O7VA 1KLGA 3KPRD 2Q76A 1FC2D 2MOVA 4TVPD 4JPKH 2NY3D 2Z9TA 4ZPVA 1J8HD 5I8OH 1XCTA 3L3GB 1KFAH 3DGCR 3V95A 2CLRB 1OAZL 1W72L 3RPIB 3QUYB 2AEQH 2F74A 4WFGD 5JZ7D 1PFCA 1R3IL 1NPUA 2EXYD 4AEHL 1W0VB 1XCQB 3PF2A 4OM0H 4NQEA 4GMTL 4AG4H 4UTBH 4WW1B 2ICWI 2P5EA 2X42A 4OKDA 4DVRH 4GKSA 4N0FA 4BZ2L 3PL6A 4XNUL 5B39G 3NGBB 3LIZL 4IRJD 2IMMA 2WLZA 4PJ5B 4U6YB 4X6BB 4YGVB 1EVUA 1UM5H 1T0PB 1HILA 1LDSA 3QP3A 2B4CH 3VG9C 2NY2D 3TYGL 3X3FL 4RMWA 4F7MA 4ELMA 3O3EB 1MAJA 3G08B 3U2SB 1N5YH 2XKNA 2CXKA 2VE6B 4ZS7L 3G6JF 1ZWIB 1YEKH 3DURA 4UZGA 3RZCD 2NY6D 3T2NL 2E8YA 2DWDA 3ILQC 2AJ3B 3ALWA 3RKDC 3TT1H 5EOQH 1QRND 4R96A 4BQCA 1BD2E 3ZLQC 1K8DB 3ARBD 3F7YA 5B8CA 3ULUF 4BSWB 3RX8A 1JUFB 3MV7E 3U6RB 4DW2H 2Q20A 5FECA 1TJGL 3QA3A 1UT9A 3M07A 2YSSB 3JTSB 4ZYKA 1UWXK 1FZJA 2W65B 3RIFF 3QUXA 2HFTA 5EO1A 1JV5B 2KZ1B 3HLAB 3OKDB 3D39D 1WQVT 3OKMA 5J3HC 5IKCB 5MI0C 1I8IB 1HXMB 2E7HA 4QRQA 3KLSA 3I75A 4MQXC 5HHQA 1QOKA 3GSQA 5DSCB 1CFQA 5I74C 4HUMB 4U7KA 2X6MA 1J11A 3V5HB 2FLRT 4Y16B 2DYPD 4CMMB 4I2XA 2JELL 3TBVB 5ANMA 5FYJD 5D9SA 5A2KH 5C0JB 2W9EL 3QFDB 4YBQD 4NJ9H 4ZTPH 1XF3B 2FATH 4B50A 4I0PA 2AXGB 2RFXB 4Z95H 3MACL 3INUH 5CD5C 4ZNCD 5E94B 5ISZE 4NBZB 4URTB 2HJLA 2HT3C 3DO7B 3DHMA 1GHFH 2IANA 3PWUB 4HBCH 5E5UB 4F3FA 2FJGB 2R8SL 3FN9A 1YNLH 2EH8L 3TO4A 2IMNA 4TN9A 3TH3T 3MROB 4JCMA 4JRYD 3CUPB 4YHNB 2G75B 1QEWA 3EBAA 4YO0A 1ZT7B 2QQKH 3UJIL 4WW2B 1IEBA 3MRGA 3T1FB 1H5BC 5FM5O 4HQQH 1PZUB 4MQ7A 1A8JH 3L3OA 4HKJB 3VXRA 3WIHL 2VOTA 1ADQH 5FM5M 4RWYL 1E4XI 2IGFL 3U82B 3N9GH 2VXVH 1C08B 5IG7B 4KUCD 3IB4A 3VDAA 1A47A 4IHOA 1SEQL 3HI6H 3T4AB 4PG9A 1B2WL 3GHEL 1AGFA 3QWOB 1NMBH 3DSNA 2IWGA 1MCOL 3G5ZB 5F9WB 4M1GH 5DK2A 4GAJL 1JNLL 1P4IL 2I27N 1O5DT 1QZ1A 4TSAH 1OT1A 4FQIH 2X7LB 1OSZA 1FGNH 3U7AA 2K7PA 1MFBH 1MHCB 1QP1A 4ODWB 3MRRB 3TYFA 5MEQB 2NQCA 1RAMA 3BPLB 5F1OB 4MJIB 5DJ2A 5KSBA 3GEWB 4WFHE 4XNXL 4LQFH 3KPPA 3NZ8A 2QQNH 3GMNA 1HYRC 5IB1A 5LGHH 4ODXB 2F9BT 1A22B 1AGCA 1JRHH 1ZHKA 2YPLD 5JA9A 3C87A 2ZG1A 4RAVB 3ARUA 4MAYD 1OTUC 3SGJC 3FQWA 5EPMB 3GI8L 3IETA 1A1OB 4O5LL 1M05A 2OJZH 1D5BA 1JNJA 2JE8A 3QUYC 2VDQL 2HJFA 3V0AC 3MRCB 3FO1A 3G6JE 4NFCA 4Y19E 4HX1B 2R1WA 5IBLC 3ILPA 4KKAD 4X6FA 1I7ZB 5DEZA 4JM2A 1CT8A 1K5NA 4E41E 1U3HC 4DZ8B 4XVSH 3BKCH 3ULUE 3ZT5A 1D5XA 1OD9A 3MOAH 3MV9B 3QQ9C 3OKEA 5E8OA 1RZJL 2W60A 4P59H 3BD3A 1C16B 1IL1A 5ICYA 2YC1A 2A83A 2BSSA 1FL5B 1GPOL 5JORB 1UVQB 1MAML 3DVFA 5FDYA 2Y6SC 1OGTB 5C0IA 2NX5A 3A67H 2H41A 4Z18A 5IV2A 1YECH 4GW1A 1X7QB 4E0RA 3MJ9H 5JHLH 4MNQE 1AKJB 5C0BB 3I84A 3HMWH 4C57C 2OSLA 3LDBB 3MPCA 1MREH 3GSOA 4L9LC 5MERB 1OWRM 3QHFL 1N6VA 4KK9D 1JPFA 4UU9B 2FB4L 4KKCD 4WY7L 2XTJE 1E4WL 5ESAA 5K9JH 1RZ8A 4OQ1A 5I1IH 1TIUA 4PRIE 1RJCA 1FRGH 3CDGA 4P4KB 2HKHL 3MLVL 5T3ZL 4KI5F 1GGTA 4P5MB 3MGOA 1Q94B 3MBED 3QUKA 3DSFL 1HKLH 1M1SA 4LIQE 3RL2A 3RTQC 5GGUA 3DX7A 4JO1L 1KXVC 3KAAA 2XFXA 3H9HA 4NQDA 3UAJC 2BHYA 4WI5A 3IXTB 5DMGC 4K9EH 2E9BA 2DQDL 2NYYD 5EO0B 1P69B 3A6OA 5BZWB 4Z8FL 3KPTA 1YZZA 1JTOA 3SKNB 3V6FB 3OL2A 2R2BB 4IMLA 3NIGF 1F6AA 4DUVA 3FB7A 3QXDA 1NFKA 2ZCHL 5E9DE 3O2DL 4LSRH 4I3RL 3AC0A 4Y2DD 5HYJB 4OCSH 4RGMC 4GKZA 5JQ6H 1ZTXL 4GS7B 2VLRA 3GKZA 4M8VA 5I73C 1SQ2N 1MHPH 3WFEH 4S1RL 2BX5A 1UM6H 3R1GL 1Z3GH 1VFAA 3EDKA 5E2UH 4JKPL 5C0FB 1EFQA 1NCCH 2KBGA 5IFJA 4PGDA 4TSCH 3KG5A 3QQ3A 5T5FL 4H20L 4RWHA 2CLZA 5DQDH 1S3KL 4Y1AA 3BP5A 1AIFA 5ESQA 1RZGA 4G8EB 5KVMC 1MLCA 3NCCB 4X7SH 4OD2B 3E8UH 1XF1A 2PO6C 4EOWH 1T20B 3UTZA 4DKFH 1FNSL 3P11H 1L9MA 3DVGB 3V6OA 1P7HL 3LSOB 1NCBH 4QY8B 3PV6B 2DL2A 2DTML 3E3QE 2WBJB 4WI4A 3HC3L 5T1LB 2R56L 3WKNA 4N8VB 5E1HB 2JIXA 1EEZB 4IOSD 3I2CH 3QZWA 3C09C 5DD1H 1WUNT 3QDJA 4ZFGL 2R0LH 3KLAA 5LQBL 1YY8A 3O6LL 1IAIM 1BVZA 5EN2A 3HB3D 2OX5A 4S1SL 4A6YA 1L4IA 2PW2B 5TDPA 1TTFA 3LKRB 3B5TA 4XVTL 4NKIH 3SY0B 5AAWA 3GRWA 1KPRB 3W81A 1K85A 1NBVL 5C09A 3O2WH 1RV6X 1CF8H 3TBWB 4GW4B 1MIML 4OZGA 3DPBA 3MGAA 1GGBH 2KUTA 2ORBH 4KZDL 1NFIB 2WMPA 5TQ0L 1TVHB 2VH5H 2NY7H 4EI5A 1QD0A 3RWEB 4JKWA 4HXAL 1HH6A 3JSSA 5DRWA 1IFHH 3KJ4B 3DTXB 1M71B 4P3CH 4DN3L 3MLRL 2CLRA 3BPLC 3RPIA 1KJ2L 3BKJL 4LGPB 1BEYH 4NN6C 4FFWC 3VFSB 4HZLB 4PRAB 5K9OA 3SCMA 1UG9A 2XWJB 5J8OA 1YEHH 4ONHA 1DSFL 1FFPA 4G8GE 4ZTOH 1RZIA 3CX5K 4OF7A 2DM7A 4HKBA 5DK0B 1BD2D 4U6YA 2NPLX 3NFNA 3VFMB 5EC1B 1VEPA 5F70A 5JHDA 1NAMH 5K93A 2I26N 3MV7D 1J1PH 2W0KA 1E4XH 3OB8A 4ZXBD 4UT7H 1DEEA 4MA3A 5C07E 1QSFE 3CMGA 4GAGH 1U8QA 3T0EC 5C2UB 1HEZA 2A6KB 5J9PB 4KI5E 4NQSA 3B83A 3N1QC 4X0KB 1CE1L 4LCWA 3PQYE 3QXVA 4LDEB 5EZJB 5DFTA 1NGWA 1OTTD 2Z4QA 4BYHA 4OM1L 1H3XA 3JUZA 3MLYL 4Z7QF 3BISA 1K8DA 5EUKA 1BJ1H 4OF8A 3MX0A 4TTGA 3LDBC 4OZIF 4O51B 4UI2A 5HPOA 15C8H 5GISL 4PIRF 3NIGE 2HWZL 1D6EB 2QEJA 3VXUE 4KHXH 2VN7A 5C7XL 1XGTB 2YA2A 4DN4L 3MC0A 1BP3B 1CLZL 4OLXL 1CD0A 2BVUA 1YEIH 1I8IA 5DFVC 4WIQA 4Y89A 1LNUB 1Y0LB 3BP7A 3LMJH 3SGKA 2O5YH 4LF3B 3UMTA 4CVZA 5ISZD 3D3VE 3OX8B 4Y16A 1T83A 4JPKL 3EKCA 4PRDB 2ARJQ 1YPZB 4EVNA 4DCQA 1OT2A 2EC9T 4NNPH 3ZL4H 1S7TA 5I8OL 2C1OB 4XBPB 3KPSB 4OZHF 4ZDHA 1QA9B 3BKYH 4RAUB 3WXWH 3MCKA 4UQ2B 1ZA3A 2Q1EA 1OGAA 2DLEA 4OV6F 2AEQL 2R15A 3HC4H 3MV8D 4MVBC 4M7ZC 1NUNB 4JQIH 4PY7A 2PYEA 2Y36H 3PWUA 3BEWA 4OM0L 4P2QB 4AG4L 1AR2A 4QNPE 1OAXL 4UTBL 2FJGA 2OTPA 1IVLA 4EN3B 1F8TL 1L9NA 2V5YA 1FYTB 3HPLB 4U1HB 2BHUA 4U1SA 4D94A 1B0RB 1EPFA 2QJDA 2XN9B 2GITB 2DICA 5J4MA 3S5LB 4OCYH 1DE4A 2NXYD 3CXDH 1MRFH 1UM5L 3H0TB 3T1FA 2R0WH 3EYVA 2B4CL 3OXRA 4AENB 5HPMB 4WDIB 2F8OA 5SWSB 3TEUA 2X4TA 3Q5YA 4NRZA 3HI1B 2EDHA 1CR9H 1SJEA 3MA7B 1NGYB 5C3LD 1YMHB 4LEOB 5GGRB 1B4RA 4HUVB 1NDGA 4PJEA 2HVJA 3V2AR 3V7AG 4M1CD 1K8IA 3TT1L 3SKOA 4WFHD 2V2WA 3PNWB 3MJ7B 5C08E 4RFOH 4DGYH 1BQLL 1AI1H 2BSRA 4OZFH 1LO4L 4XMLH 1RIVH 1D6VH 1NCDH 2ADFL 3P4OB 3KPNA 3MLUH 4X6CB 1EO5A 4Z5RA 5T1MA 3C5ZC 5SV3A 3AB0C 1HHHA 5CZXD 4DW2L 2ESVE 3H3KA 5FOJA 2DLHA 1NJ9B 1V05A 1RURH 2ZWLT 4QEGA 1L0QA 3WXVL 5BRZA 4WFEE 5KSBF 4J3VA 3FHAA 4Y19D 3U7WH 1F4HA 3O3BB 43CAA 4F33B 5L7XL 5D7LA 2BSTA 4Q0XH 4F7TB 4IIQB 4E41D 1RJYB 4H1LG 4FQXD 3ULUD 1P7KB 4M03A 4HUUB 3WJJA 2EIZB 3PP4H 3QPQC 4YH6A 5HGGS 1VENA 1OAUH 4PREB 5H35B 2YEZA 1GXEA 4LLQB 5T5NF 5TFSH 5GGVY 4S2SA 4MDJA 3NABH 2JB5H 4NSKA 4NJ9L 2K7QA 3E1F1 1KEML 5CP3A 4LPUA 2FATL 3D18B 4JJHA 4Z95L 5FUOH 5FHBH 3X12B 3SDYH 3ISWA 1H8SA 3TVMD 2CH8A 3E2HB 3INUL 1JPSH 4MNQD 1X5JA 4Z7QE 1I7UA 1AP2A 5IB2A 2W0FA 5DYOB 3TA3D 3U0TB 3HUJE 1GHFL 3ZE0F 1YMME 2F53B 1XF5B 4HCRH 3DGGB 2QR0B 2DAVA 4G6MH 4OZIE 3DECA 2P24B 2XTJD 2UUDK 3WFZA 5GIRB 4BH8B 2OR9H 3WIFB 5JORA 4PRID 2GAZA 3L5WB 1KLUB 4RDQF 1KOAA 1OGTA 4JFXB 4G7VH 2EECA 4YR6B 3MRJA 4NT6A 2D7TL 5ACLA 2QQKL 4W68A 2WIIA 5DHVB 2F5BH 1AKJA 4LSTH 3JBG7 4HQQL 3VFWB 2UYLA 2GJ6B 2YXMA 3BZFB 2XNAB 3ZSSA 2P5WE 3RDTA 3MRBA 3ECBA 1ADQL 1UJ3B 5L9DH 5E8DH 2FIKB 1NANI 2VXVL 1G7HB 4YAQB 2B1HL 4OZHE 4HIIA 2MQ0A 4P4KA 3HI6L 3DV4A 5E9DD 1UKQA 3LEYH 1QR4A 1XR9A 1NMBL 2X40A 4MX7A 1CS6A 4BQBA 4D0BA 4PJBF 2X4PB 1TENA 1K2DA 4TSAL 2Z35A 4FQIL 2R23A 1Q0YH 1FGNL 5C70A 1MFBL 3JV4A 4LSUH 3THMH 3ES6A 3ZKXC 3TESA 5F1IB 2OJEA 1CL7I 4IRSD 3GMQA 4LQFL 1HSBB 4QTIH 2K3TA 5LJYH 1UWGH 5KSAD 5LGHL 3OKYA 4YGAB 1JRHL 2H2PD 5GQBA 3H7BB 4G9FB 1JYXA 1TQCC 4MQTB 2G2RB 1NFDA 5HHOE 1C5BH 5E4IA 4XXCC 2XTLA 4WI3A 2OJZL 5C0FA 1WWBX 1VFBB 3S8WA 3BH9B 3MRNB 3BEVB 5IMLB 2RGSA 4JANB 4EUPA 1MCSA 1YJDC 3DV6A 5F1NA 4BQ6A 1F45A 1AC0A 5EO9A 3HRZA 4AM0A 5L8KB 4U1KA 4OD2A 1J05A 3X11A 3CPLB 4G80B 2ZUSA 4O4YH 4EN3C 4OCXH 4OUOA 1KF9B 4XVSL 3BKCL 4MCZB 4GT7A 4MD0B 3MOAL 4Y88A 2BVEA 3CLFH 1ZLWK 4PJAF 4WO4B 3RWJB 5I1JH 5T1LA 1LHZA 1YNTA 1INQA 3TJHC 1PX3A 3O9WA 1JZ5A 1T1XA 2CKBH 2EZ0D 5C0CE 4JFFB 3KLHD 1S7XB 3FQTB 3CVIH 3O11B 3VWJB 3MA9H 1FFNB 1U95B 3ARDD 1MVUA 3A67L 1YECL 3VWKB 3UTQA 2ED8A 1MWAB 3MJ9L 5JHLL 2YBRA 4HV8A 1M7DA 1MREL 4L8DB 4RMQA 2Y07L 4F9PA 3MRHA 5BS0B 4G6AC 4UDTB 4J1UA 3SY0A 3NOIA 3O4LE 4UV4H 3GMMA 5EOTA 4ZAKD 5K9JL 3DVIA 4OZGF 2GUOA 4NNXB 5FYLE 3O3DA 1FRGL 3NA9H 4KAQH 4KROB 4LMQE 1A6TB 1CQYA 1HKLL 2B39A 2A73A 3DIFB 2Y06H 5HI5D 1YUHB 4G8GD 5EC2B 3BESR 3DUHA 2HFFA 4K9EL 1M71A 2AJVH 3BPNC 5FUCC 2VABB 3UTOA 2XXMB 5HDQH 1JMXA 1HI6A 3RZWA 4HZLA 5D1ZD 1FN4A 3E6FB 5C0GA 2E7BA 5HHPA 4FXGA 2FECI 4NHCH 5IQ7H 4WRLA 4HLJA 5I0ZA 4PP2B 2B1AH 1QSFD 5C07D 1EA9C 2IBGA 1R3LB 4X4YB 1EHLH 1HOCA 4KI5D 4S1DC 4M6NH 4X7TB 4LSRL 3GGWB 4OCSL 1JF5A 4FQHA 5JQ6L 4HUWB 1CD8A 4LDOB 1T66C 1MHPL 3OZ9H 3WFEL 3DX6A 3RWCB 1Z3GL 5E2UL 1NCCL 1MFDH 4ZO8A 3E2HC 1NC4D 4MD5B 3PL6C 4KVNH 5GGTA 5D7IA 1NEZB 4X7SL 3E8UL 3SDXA 3VXUD 4XCFH 4EOWL 5JIKA 3MRFB 4DKFL 1A7RH 5EZJA 4JO3H 2PUQT 3P11L 4APQD 4ETQB 3EYOA 2Z8SA 3ZKMC 1NCBL 4NZRH 2GFBB 4GRLD 4PJBE 4WUUA 2OQJB 3KVQA 5DMIL 5FF6B 4JR9H 1WFTA 5IB5A 3D3VD 3I2CL 4PLJC 1DQQA 1DBJH 1LK3H 5DD1L 4O51A 2DQCL 2R0LL 5EUOB 1HH9B 3L3KA 3RVWD 3QXUA 1H3VA 3PGDA 1AR1C 4NQCE 1JGEB 2EDQA 4AMKH 3V6BR 1WT5A 3TT3H 2EC8A 1O7SA 5LGKA 4NKIL 1ITBB 3VFUB 1LNUA 3SE4A 5TQ2H 3BE1H 2WNGA 1B0WA 2Q3AA 3T65B 1M7IB 2P8MA 1NL0H 3VXTA 1CF8L 1KENH 3T77B 3NVQA 2IAMA 1WIPA 2OMNA 3WLBA 1GGBL 2ORBL 3ME0A 5DJZA 3GSNA 4NC2B 1QNZH 2V5SA 2VH5L 2W9DH 4N5EC 1UGNA 3ESVF 5E56A 3O8XB 3EDEA 1IFHL 4NZUL 4LVEA 3ETBF 4P3CL 3TZVA 4Z76B 2W92A 4LFHD 5KANI 1PKQA 1TPXC 4PJAE 2V9QA 2I60H 1IEHA 5D5MB 2CGRH 3KPQB 4JZOB 5DO2C 5DJCA 4JRXE 1FSKB 1KN2H 4I0PC 4CU8A 1YEHL 4P2QA 1GYAA 3ULVC 1G7QB 4PP1C 5KJRH 1XAUA 3PABB 3C60A 1GJIA 2XN9A 5CUSH 5E6IB 1AD9B 5EORH 4PRHE 4HPOL 4ZFZA 5C08D 3A0OA 1ZLUK 4WW2F 4Y8DC 1F11B 5FAAA 4RGNB 5HVHC 2GSIB 5EOCJ 3TO4C 3QUMB 1AGBA 1NAML 4N0UA 4X7CC 1J1PL 1NCAH 1E4XL 4XRCA 1NANH 2ESVD 3Q1SH 4BH7A 4UT7L 3GUTA 1BZ9B 4LLVA 1BWMA 4GAGL 1A7QH 1OP5H 4Z78A 2IQAA 2VDMH 3OXSB 4KK6D 5ACZA 2AJUH 4PJEF 1T0MB 4KJWD 4WFED 3BZ4A 2D7PA 3RVUC 1G0XA 1SJXA 3K4ZA 2HMIC 3MJ7A 1SBSH 1CICB 4X4XB 5GS3A 3HN3A 4R7DA 3K81A 1KTLB 3VWKC 3MCLL 3SDAD 2N1KA 1CTOA 2IC2A 1HQ4B 3FT2B 4OBRA 15C8L 4UUJA 2GEEA 3QIUB 5HY9B 1R3HA 1CL7H 1FFQA 1T5XB 2D0FA 4KHXL 4LCCB 3ARFB 1IC5H 1Y6KR 3I6GB 5CHNB 3RVXD 5D2LA 4JFZL 1YEIL 4NHUB 1C7TA 3V8CA 4F33A 2IBZX 3CK0H 5D7JD 1F4YH 5JDSB 4R0LA 4PJ5E 4F7TA 5AWNH 3LMJL 2DWEB 3WUWG 2O5YL 5HGAA 2GTWA 1P7KA 3MREB 4JM4H 1E4JA 3MFFA 3M1BB 5F7DA 1YMMD 1REIA 2HT4C 3E6HA 4RMUA 4LNRA 1FJ1B 4YDKH 4NNPL 5DRXA 4LLQA 1Q0XH 4F7PB 4GKNA 1WVZA 4L4TB 2VLJB 2NY0D 4WWKB 5TE6L 3WXWL 3D18A 5JNYB 3VFNB 1ZS8B 2AP2A 1E4KA 2VZTA 5IMMB 5ICZA 1H3TA 3HC4L 4K07A 3S3JA 5FV2A 1MY7A 3CH1A 3OHXB 4JQIL 3WHXA 3U0TA 1ORSA 2Y36L 2F53A 4LOUD 4XP4L 3DGGA 5F7LB 2P5WD 3I3DA 5D71H 1LO3L 3KPOB 2BJMH 4FQCH 1FVEA 3K7UA 1HQRB 4JM2C 3VRIB 2D9CA 4FTVB 1KLUA 4OCYL 1MCDA 4UNTA 4UB0H 5GSRA 3CXDL 1MRFL 2IQ9H 2HG5B 3EYQC 3RJDA 3CGTA 3FRPA 1KJVB 1JGVH 4M6AA 2R4RH 4DKAA 1KIUA 5IHBA 3B9KA 4LVNB 2V7HB 4PRNA 3H3PL 3K2MC 5B3NA 3HZYA 5JW4N 2G9HA 1FVDA 3TNNB 5HBBA 2FO1A 1ZLVH 2AV7B 4K7PH 3B43A 4RFOL 4RIRB 3HE6D 4J8RA 1P7QA 4DGYL 1AI1L 4RMTA 1U8LA 1ED3B 1RIVL 4LPXA 1NCDL 4OGXH 3NCJH 3WN5B 3L6FB 3MLUL 5E00A 1PSKH 3SDCA 1JHLH 5HHOD 1JMZA 3K80A 3PP3H 2MKLC 4MJ2A 1H9VA 5ERWB 5DRNA 1RURL 3VMNA 4KGLA 5JUEH 4XTRC 4N1EA 4R4FL 3TPUB 3SBWA 2DLIA 3UDWA 3S35H 4JPWH 4V2BA 1F42A 1TCRA 3KJ6H 3RGVD 4Q0XL 5D1QD 1JF1B 4KMLB 1RSFA 5DUML 2X70B 4LSPH 3PWVA 1NEUA 43C9B 6FABH 3RNKA 1I9IH 5HGHB 3HZVB 2VXUL 5DI8A 1OAUL 5DC9B 4PGCA 1JGLH 1P53A 5TFSL 2A1WH 5GRUH 5C0CD 3NABL 3KPMA 4HLZH 4GUPA 1IQDA 4JANA 3VGDA 4N8CH 4JFEA 4RMVA 4XAWH 5F3HA 1LP9A 5FUOL 4Y5VC 1F90H 1FSKC 2IG2L 2FCBA 3SDYL 4KQ3H 4S0SD 1JPSL 2YXFA 1KPVA 1IGJB 3FO0H 4HS3B 3WJLA 3F58H 1RZKC 5E6IC 1XEDA 3O4LD 4G6ML 5BV7B 3RWDB 1J18A 1U8IB 5ADOH 1CGXA 1L0XA 5E08H 3D2UD 4EI6B 4O02H 5IFAL 2D4DA 1JZ3A 5FYLD 2WINB 2H32H 3O6FB 3FQTA 3V6OC 4BELD 3A6BH 2BVOA 4MJIE 5C0RL 1FFNA 2CDEB 4G7VL 4XP1H 1H3UA 3IRZA 1DN0A 2VLME 3LKPA 5CEYB 2I9LB 2GQHA 4QRTB 2F5BL 1T1WB 4LSTL 1PBYA 3FO9B 4HC1A 4XWGH 1KIPA 4LGRB 4QHLB 4P9ML 2XZCH 4QHMA 5E03A 4XB8A 4U0QB 5A3IC 3ROOB 1E0OB 4Y4HB 1INDH 5L9DL 2AK4A 2J4WL 5E8DL 3ILQD 4DTGL 3RKDD 5L2JB 3HS0B 1XIWC 4OQTA 4PJIB 1WK0A 3GSUB 3PHSA 4IDLA 4W81A 4KHTH 3L95A 3LEYL 5INCB 2L7UA 1NCUA 5FDWB 1SVZA 2EO1A 1YUHA 1D9KB 1A1NA 4LCCC 1J0KA 1HXYA 2NY3B 4X5LA 3MV9E 4WTZA 4DFHA 2YPVH 3MO1A 4BSJA 5EU4A 1J8HB 2VSCA 2P8PB 4I4WA 4EI5C 1N2RB 1MCJA 3IFLH 4LSUL 5IK3A 5ETUA 1IEAB 3DOSA 3T4YA 1PEWA 1DUZB 1WBYB 2J12B 1FZKB 1JGDA 5DHYA 4MQXD 2BVQA 4QTIL 1FO0B 4NJAH 1UWGL 3SJVD 1WLHA 2XWTB 2VLKA 3VXOB 4HFWA 5C0BE 5AD0A 2PXYD 3WEXA 3SCMC 4TTDD 1CG9A 3HZKB 3ARGA 2WBWB 3LQAC 1C5BL 1HNGA 5SWQB 4XHJC 4UNUA 4MDIB 4U3XA 3NACH 5J13B 1UWXH 1Z5LB 4N5UA 1HWGB 5D7IF 3WLWC 2HLFD 4ZSOB 3SDXF 3GM8A 4RX4A 1KIRA 1WF5A 4QOKB 4KJYA 4O4YL 2NY2B 3F8UB 4OCXL 4HDIB 1IGYB 1YJDH 2HT3D 5CD3B 5HDLA 4BKLA 3K4DA 1NMAH 3IDJB 3NFPB 5I1JL 1HWHB 4MWFB 1TZIB 3GSVB 2CKBL 2QHRH 1QRNB 3BIKA 3CVIL 3LS5H 3MA9L 3JVGA 4I48B 5ID1B 1JWUB 5DJDA 4NZJA 3BXNB 1T21B 3PHOB 5HYJE 1X6NA 4ODBD 5I8EB 1Q9OB 5B38A 2NXZD 3RU8H 5DJ8B 4UV4L 5EBGA 5E0QA 5DGRA 1M7IA 5E2TH 3VXQA 2DTSA 3UCRA 4WHTB 3TBYA 3LN9A 3MBXH 3WN5C 1OLLA 1YN6B 3UBXB 3CFJA 3NA9L 4KAQL 4PGJA 1XGYH 3BH8B 4GXUN 5F89A 1T22B 1T03L 2A74B 2Y06L 3FFDA 2AJSH 5KSUB 4C83A 4TULH 2VKWA 3FQUB 1W72B 1RPQA 1T83C 5HHNA 1JN6B 4H26B 4PRHD 2AJVL 2YD8A 5JOEA 2EDXA 8FABA 1IGIL 1HNFA 4JO4H 5D5MA 5HDQL 1UACH 3B9AA 4YC2B 1DQTA 1UXWA 5IQ7L