3ZKSD

Bace2 xaperone complex with inhibitor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
112
structure length
112
Chain Sequence
QVQLQESGGGLVQPGGSLRLSCAASGFTFSSAIMTWVRQAPGKGREWVSTIGSDGSITTYADSVKGRFTISRDNARNTLYLQMNSLKPEDTAVYYCTSAGRRGPGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/immune system
molecule keywords BETA-SECRETASE 2
publication title Mapping the Conformational Space Accessible to Bace2 Using Surface Mutants and Co-Crystals with Fab-Fragments, Fynomers, and Xaperones
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2013-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zksD00
2VZVA 1H15A 3SHSA 2ED7A 3SKJL 2ENSA 2YKLH 7FABH 3GBNL 1FL3B 4AT6A 2Z8RA 3VGHA 1D5MA 3WKML 3ULVF 3AGVA 1FIEA 3D69B 4Z0XA 1UH3A 5EBLA 4BQCA 5DA4A 3NABL 1LHZA 1M7IB 2AERT 4HIHA 3FB7A 3TM6A 3CH8A 1MAMH 4P2QD 4JFYB 1I75A 3NIDF 1OGTA 5EZOH 3WL9A 4S1RL 4KKBC 4XP1H 5CEZL 1UB6A 3RVTC 3SKUD 2DS4A 1K2DA 5EUOE 5GGTA 5D6CA 3WE6B 4KJPD 4FXKA 4WI9A 1HQ4B 5JQ6L 3S88H 3QJHA 3QA3A 3B43A 1YNKH 2X4OA 3HC3L 5JW5A 4OZIF 2H2PC 5C2BH 1C5DB 1F58L 3UJTL 3WIIH 1R3KA 4JY4B 4RGNE 5BOPA 4KTDL 3RWIA 3TA3C 2W0FB 1VACA 2P5WE 1DQDH 2VQ1A 3F6LA 3KPQB 4JKPL 3TFKC 4LHJB 3MV9D 4M1DH 4JFPB 4URTB 3DMMC 1ZK9A 2HKFH 4OBRA 4UT9H 4KRNA 1D9KD 3MLUH 3V5DB 3QXDB 5JQHC 5MI0B 2DWDA 1BZ9B 1B9ZA 5GS2H 3IJYB 4GKNB 2I5YL 2AJYL 4WI6A 5I6XC 5DMGC 4NQEE 1UWEH 1FE8L 5F97E 4NN5C 4OZGE 1Q94A 3MRRA 5HYJA 3FT4A 4UOW0 3CK0H 3RVUD 5E24E 3PP4H 5C0RL 2CIKB 4GLRH 2AEIT 3FQXA 4I3RH 5DJAA 5J6GB 5F8QC 5IVXE 1N26A 3E2HB 3FN0L 5ANMA 1U8IA 5L8KB 1T5XB 2APTA 5FKAB 2IPKA 4NQUA 4ZO7A 2YMXH 3F7YB 5IB5B 3ELAT 3P0YH 3V6OC 1NC2B 2NY3C 5C07B 1EMTL 4BSWA 1SY6L 4L4JA 1TJHH 2VLJA 4RFEA 5JXAH 4YHNB 5FYJD 5BJTB 2HN7B 1JK8A 1ITBB 3B5GA 1QPPA 1IM3B 1NLBL 2XOTA 3QDJD 2QHLA 2EDTA 3VFGH 1CXLA 5FAAA 1CGUA 4JHBA 2O5XL 3ILQC 3MXVL 2R2HA 3V8OA 5FUOL 1UENA 5I1KH 1QO3B 2DMKA 3D0VB 1A3QA 4M6AA 1TDQA 1AGDA 3BQUA 4KJWD 4BKLB 3WNMA 1L7TL 3B9KC 5DF0A 2DLFH 2VLLB 1YPZB 1J1PL 1K8IB 4L9LA 1CDHA 4HMCA 1U36A 4XCEB 3UTQB 1RZJH 2YEZA 1CLCA 3Q5OA 4ELMA 2NY0C 4LNRB 5E0QA 4IJ3B 3QQ4B 2VMFA 1GGTA 5B8CA 1DTUA 3O8XD 1H0DA 2ZUVA 1MF2H 2IC2A 2CLVB 3MRLB 3QIUD 3ZT5A 5K9QI 5M95B 5KJRH 4HUXA 4FOMA 3GI8H 4FZEH 3GB7B 3GSXA 3CSBA 3PXHA 5J9PB 4KKCD 3OAZK 4Y4HA 3A67L 1J0YA 3QT2A 4PJHA 3IXTA 1DLFL 1S7UB 2XZZA 5JTWA 3K8MA 2R4RH 2H8PB 2J8UF 5FO8A 2BNRB 4ZS7H 5B22A 3HG1D 3B9AA 3VCLB 1LO2H 2C3HA 3QCVH 4L4TB 4C55A 1A1MB 1F02I 4HWNA 3FZUD 1EEZB 4JPWL 1E27A 4OCXL 1OAXL 2XA8H 4NQDE 5SWZD 3PF2A 1OD9A 4N0YL 4B7IA 3RJDA 3HFMH 1S9XA 3STBA 3MFFA 3EOYG 4XP5L 3HC4L 5IFHL 4OF3A 4PRNB 5HTSA 4LSPH 2Z91B 3C6SB 1J5OH 2R69L 5DLMH 1NBZA 4ERSL 2FHCA 4UINH 3ALPA 5IT2L 1F4YH 3NFSL 1F13A 1MELA 2NXZB 3QQNA 1KJMB 2XQBH 1MHPH 4HBCL 1GCFA 1U41A 3LS5H 1RZ8B 3SDYL 3LKNB 2DQFB 4M43H 1X5YA 2UZXB 5JW4N 2R0LL 3VXQA 4MJIA 4U6YA 5EORH 2W59A 1ZEAL 4XNQB 5D96C 5KVFH 1TJGL 3SDXE 3S35H 3QXAA 3QHZL 3W39A 3DX6A 3C60C 2Q8BH 4PGEB 4CVXA 4A2MA 5AUMB 4KXZI 1CF8L 1YEFH 2VABB 4QRRD 5GGRY 4JM2B 4ZAKB 1ZT1A 5CWSB 3KDMA 1A7OH 1E4WH 4JREC 1FGVH 2X6MA 2AK4B 5IK3B 4JFED 4U0RC 5D7JD 2CK0L 4WW2A 4GAYB 25C8L 1RJCA 4HUKB 2BXYA 1F3DJ 5D2NE 4Y5XA 4F37K 4Z7NF 2ZNXA 1OTUD 4PLNC 4KDTA 4TUOB 5C0AB 3C5JB 4ZUUA 5TE6L 2XWTA 5FO7B 4NO0B 5DUPH 2D3VA 5T1KA 2OZ4A 1DE4A 4X83A 3UTTB 1RUPH 1I7ZB 4G6FB 1T1WB 5I15L 4QRTA 5FYJE 4J1UB 3QUYC 1HWGB 4HV8B 1OAQL 1HNGA 3QI9C 1S7SA 1PKQB 2XN9D 3QDJE 4FNLL 1SM3L 4M1CC 4TUKL 2YD1A 3T0EB 3AS1A 2E6QA 4JQVC 5EFIA 1U8LA 4U1GC 2D7PA 4YDLB 2OJZH 5BS0B 3LV3A 3FQNB 3ARYA 2XNAA 4RCAA 4LCWE 3MV11 5DGQA 2P42B 4LPCA 4OLWH 3STLA 2ESVD 4AM0A 4L4VD 5F7DA 4PRHA 2G9HB 2GT9A 3DGCR 5C3TA 3OKOB 1P2CA 1N3NB 4NT6B 1MQKL 4G8FA 4U1KB 1LO5B 1NBYB 1PSKH 5BQ7A 3VI4F 5E1AA 3Q3GB 3K2UL 3HI5H 4I1NB 2IAMB 3UXFA 4YPJA 4FP8L 3VXSD 4NWTH 3EDJA 4HT1H 4PY7A 3OXRB 3H9ZA 4I77H 1MFCL 4IMLA 2IBGA 2X4NB 2AJSL 2BVTA 3TPKA 2VDQH 4RRPG 4DQOL 3GSWA 1DUZA 4OQTL 4JZOA 4XMPH 1Q9WA 4QGTA 1GC1C 3H9HA 4UT7H 2CDGB 4F57H 1RJZA 3PWPD 1K4CA 4DTGH 1RZGA 3C8HA 1X5LA 3K74B 4NOBA 5I8KL 3HG1E 3PWUA 5DRZA 3TNMA 2XZQH 5KN5B 1H15B 5HGAA 4MYWB 4OGYH 3K4AA 2VO5A 3H7BA 1RAMA 3HUJE 1VADA 5SWZE 4XPBH 2BOBA 4AT6B 1D5MB 1ZE3C 2DLGA 4M61A 1NGZA 4OM0H 4PB0H 4NP4H 1M71B 2EDRA 4Z0XB 4RWHA 5EBLB 1AXIB 3EO0A 2GJ6A 4HIHB 1EO8L 1FO0A 4R0LC 4Z7VF 1IAKA 2R9HD 3FB7B 4ODUA 1H3PL 2KDGA 4P4KC 2BVYA 2YD2A 1OGTB 4LFHD 3D9AH 3WL9B 2FYYA 4HUNB 2FD6H 1CE6B 3LH2H 3UYPA 4ZFFA 5IF0A 1B6UA 1UB6B 3JV5A 5F7LB 1K2DB 5A3IC 4LPUA 5D6CB 5FYJL 3FFCB 4FXKB 1IAMA 3QA3B 4OSUL 5A2FA 2X4OB 3KS0J 4XT1C 5JW5B 2UZIL 3S34H 5A2IH 5EU5B 3J8F7 4H8WL 4Z76B 1A0QL 1DSFL 2IMMA 4JJ5A 1DQMH 1R3KB 1XH3B 3LHPH 3QQ9D 4K8RD 4NC0B 4BELD 2UV3A 3RKDC 1XIWA 1VACB 5C09A 4QRRE 4MNQA 2QSVA 2X41A 4JRXA 3BKYL 3MV7A 3WS6C 2DWDB 3B83A 3H0TB 2K7PA 4F9LA 3OQ3B 4K23L 2HH0L 1KPRA 5FGBA 5GRWA 3WDJA 3ZSTA 4K3DH 1Q94B 3MRRB 5HYJB 3FT4B 1CI5A 4F7PA 4OT1H 35C8L 1PW3A 5DD5L 1V3KA 3E3QC 3ZDZE 2OZ4H 3FQXB 1QBLL 5DJAB 3CIQA 3X13A 3IFNH 3KNBA 4XVUC 5ANMB 1HKFA 4U1LA 1U8IB 1I1YA 2XA3A 2IPKB 4ODWA 3KPPB 3DO3A 3SE8H 1D5XA 4QXGL 2DQHH 5C0ND 4PBWD 3WLBA 1A02N 1MCFA 5C86A 1ZTXL 1QFWI 3PWVB 3MA9H 1CLOH 5TQ0L 3MJ9L 5CP7A 3OAUH 4BSWB 2X05A 4TOYL 2VLJB 1G9MH 4RFEB 2A9ML 1DL7H 1T1ZA 1JK8B 1KCSL 5GGVY 1B2WH 1QD0A 3MUJA 3TT3L 1AR1D 2ESVE 3KHQA 5L7XL 5M7QA 1X6NA 1HXYB 4G7VH 4JFDA 4S0SD 4I48A 1JJUA 3TBSA 1NGPH 3CZJA 4FQJH 3U0WH 1ZA6B 2R2HB 3PE9A 4BH8B 3L3IA 1VFBA 3IRPX 1I7RA 4WRLA 5FOBB 2G75A 4RGNC 1QLRA 4I0PD 5D6DA 3BQUB 4IM8A 2PTTA 3VXSE 4ODXA 4M7LL 3PIQA 1XMWA 2ZUWA 4P2CG 4X9IA 4XGZA 2XRAL 2V2TA 1CXEA 5ICXA 2ICES 2BNUA 2YEZB 2X1WL 2JK5A 1IAIL 1ZHNA 4ELMB 1DP0A 4XVJL 2I07B 3H7LA 3BPNC 1GOFA 2APBA 5B8CB 3EJJX 1I8MA 3L3DA 4S1DD 5DUML 4I5BA 4IS6A 1CK0H 3PWPE 1JNLH 1XGPA 4EXKA 5IHZA 5SWSE 1HSBA 3IDJA 4LLUA 3UYOD 5TDOA 2XTLA 1V5JA 5E4EB 4HUXB 3FOLA 3GSXB 3G08A 3TPUA 2Y7QA 4F80A 3F6IA 4Y4HB 1KC5H 3SDDD 4U1HB 3P30H 1TPXC 3IXTB 2FJGA 3LIZL 3MXWH 4EZMA 5CJBA 5FO8B 1NCBH 1P4LA 1JIBA 1G7LA 4GRLC 4ZDHA 1FRGL 4XP9H 1C1EL 1FFRA 1KTDA 1F3JA 1Q9OB 3GM8A 3BDBA 4G5ZH 1E27B 4KKAC 1X5IA 2F53E 3IFOB 1L4IA 3SGJA 4N8VA 1RVFH 4HLJA 4ENEC 4NFBA 1FVEA 4AEIL 1KBGH 5KANI 3BDYH 2FATH 1S9XB 3SCMB 3MFFB 1PFCA 5L0QC 1JRHL 3Q6GL 4M93B 3H3BC 3TBVB 4Z7UA 3SGEH 1A7NL 1IGCH 1NBZB 2NXYD 5ALCH 4PD4K 2FB4H 3LPWA 2CRZA 1T7YA 1NL0L 1QSED 2N1KA 4EBQH 1KXQE 4I0CC 3Q1SL 4LDOB 4RISL 1U8OB 2AJXH 1KLFA 3RVXC 5CJOL 4XAKD 5INCA 5CBEB 3ET9F 2QQKH 3HI6H 3VXQB 4MJIB 1T83A 3EOAA 1A7PH 5DS8B 2FX8L 3T0BA 3MRGB 4MD0A 2A74A 3QUXB 3JV6A 3DX6B 5DFVD 1KB9J 4FQPA 4NC2B 4R97B 4WVRA 5C0FA 1P4IH 3MLZH 1ZT1B 4WGWB 1MWAL 3KDMB 2NYYD 4PUBL 4AK1A 5IJKA 1I8LC 3RWEA 4ZTOL 4XCCH 1OP9A 1U58A 1FG9C 3LDBC 2R0ZL 5DT1L 4ESKA 1X5HA 3EYVA 3KPOB 1LO3L 4WW2B 5EU7C 1MJ7H 3JWNC 5B38G 2OL3L 3CFCL 4Y5XB 1NQBA 1T03L 1BF2A 5I8EB 2DQIL 4LSDA 3KYMA 4OLUH 4X9BA 3WN5C 2AK1L 1ACZA 4Y4KA 4PV9A 5T1KB 1FH5H 2FJFA 2AJVH 3R0NA 3G5ZA 2BSTA 3AY4C 4MNGA 4QRTB 1T20A 4UTBL 3VW3L 3HB3C 2HMID 1XR9A 2RAMA 1XF4A 4LU5L 4OCWH 5F7MC 1S7SB 2B4CH 4LDEB 5I76A 3QCTH 5T1DH 3FOMA 1R3IH 3WXVH 5EFIB 3DPBA 1U8LB 4IRJA 3LV3B 5E8EA 1FNSL 1SJHA 4R4FH 2XNAB 3GSRA 1P4BL 3HHRB 3MRCA 3MTRA 4LP4A 4ORZC 3STLB 4WENB 1CICA 3F65A 5F7DB 4PRHB 3UJJH 1MIEH 2GT9B 4Q9CA 3VGAC 3ARDC 1P2CB 4G8FB 5H35B 4BZYA 4O2EA 1QBBA 2EH8H 5BQ7B 5E1AB 2P5ED 3F62A 1S7RA 5CEYA 3HMWH 4APQD 3KLHD 5KSBA 4PY7B 4ZUTA 2Y23A 4IMLB 3NCYP 2GK0A 3ROOA 4LCCA 2EDBA 3WD5H 3DNKA 1JHLL 1RIUH 2HFGL 43C9A 3GSWB 4JFFA 1I7UB 3MUY1 4JZOB 3D18A 1DJSA 1Q9WB 4ZOAA 2CO6B 2Y6SD 2KL6A 3H9HB 4J4PD 4N8CL 1K4CB 4LLYA 2JJSA 1G0YR 1XGRB 2FEDD 3B3IA 4MJ4A 4YHOH 5IQ7H 1I1AD 5DRZB 5HYIA 3TNMB 4JDTL 1T2JA 4LQFH 2DL2A 5HGAB 5T3ZH 1G0XA 1Q9KA 3SDAD 3QXUA 3I50H 2MQ3A 4PIRF 5I1HL 1VADB 1OM3H 3VU2A 3AREB 3MOQA 4UBDD 2BOBB 5JHLH 5LXGH 3GM0A 5KAQF 1DVFA 1CG9A 4M61B 1NGZB 3CH1A 1XF2B 2BY3A 4ORGA 2XPGA 4RAUB 1GGIH 1ZLVK 1DBBH 3QULA 3EO0B 1V3MA 3LEXA 1XFPA 1AXTH 2GJ6B 4M7JL 1IAKB 4JQIH 4YDJA 3FT2A 4ODUB 4PRPE 5HDQH 3VGEA 4NO3A 1EBAA 1D5IL 2FECL 1QFUH 3GNMH 2FYYB 1QSEE 4JLRA 4OZIA 5I74B 1Q0XL 4JKMA 4ZFFB 5IF0B 4YBQD 1GGBL 1ZLUH 3TVMA 4F9PC 3EO1A 4KI5D 4CW1A 2CXGA 4XAKE 3WJLA 2EYSA 4XPGH 5DD3L 2YRPA 5EN2A 2DMBA 3I9GH 3HE7C 4R3SA 1YDPA 5GZOC 2CRIA 2WQRA 4QXUL 3WFCH 3DUUA 2E8ZA 3QDGD 1KEML 3KPNA 4JJ5B 4J3XA 2GK2A 2VH5H 5KW9L 3T77A 4WV1A 1XIWB 2NY4C 2VZOA 4X8XA 1XT5A 3HN3A 2IBZY 1ADQL 5TE7L 1NFDE 2O5YH 4LEXH 4D9QD 3W0WD 5I0DA 3MCLL 2R2CA 2A6KA 1EHLH 3TO4A 4LP5A 4DKDC 4YHML 5EWIH 3MV7B 4ZSOA 4HFUL 5IB4A 1CVRA 3R1GL 4NHCH 1S9YA 2X42A 1PZUB 2EEBA 5BV7L 2YUWA 1HILA 3OSKA 2EXYD 2Q7YA 1A1NA 1KPRB 4YE4H 5F7FA 3H6JA 3LQAL 3VDAA 2AVGA 2NPLX 3DECA 3BRFA 3SE9H 1P7QD 4AIXA 5F7EL 1YEEL 1C5BH 3JWDH 1CCZA 3FB6B 3HAEG 3DARA 5ABDE 4JR9H 4G9FD 4PJGF 3OF6A 3X13B 3KNBB 5E2TL 4U1LB 5LKNA 1I1YB 4ODWB 3RVVC 4PJ9C 4JO1L 2OXHA 3CX2A 4ZO8A 2WBJA 1D5XB 32C2A 3WLBB 3QZWG 2VIRA 5DUBA 4P46A 5FM5M 5CP7B 4LRIA 4Y4FD 4IRSA 3EJZC 2Q7NA 4M3KB 5DRWA 1YEDA 4HQQL 3B9EA 2ZWLT 3C87A 4JFDB 4MAYC 1AD0B 4XNXH 4L1HA 3TBSB 3RA7H 1TLKA 2V9RA 3KPRD 5IEHB 3L3IB 1DBKH 1VFBB 4UQ3A 1I7RB 2X40A 4LBEA 1CN4A 2G75B 2P5EE 4OB5H 1QLRB 4XB7A 4XXCC 1KPVA 1D5ZA 2PTTB 4ODXB 3PIQB 1QLEH 4XGZB 5J11C 2M2DA 1YEGH 2V2TB 4FFYH 2EE3A 3NCEB 2VERN 2BZDA 2BNUB 3PWNA 1ZHNB 1JWSA 3V5HA 5KG9A 1AKJA 5JXED 5H8DA 1A22B 3MLTA 4L3CB 5DJYA 5GS1C 1OWRM 1I8MB 1K6QH 3O2DA 3L3DB 4Q9QL 4I5BB 4IS6B 4Y5VA 3FN9A 1NGWA 4RA3A 1XGPB 5IHZB 1A1OA 5CBAA 3P0VL 1HSBB 2RR3A 3AM8C 5L9DL 4LLUB 3RGHA 3QXVA 4F7CA 4G6JH 5TDOB 3FOLB 3I6GA 5T3XH 3TPUB 3G08B 3O11A 3VFVA 2Y7QB 2B2XH 2J8UA 3HNTH 3LZFL 3S6CA 2I60L 1OTTD 2B1AH 3ULVH 2FJGB 4JPKL 1CTNA 3KYKL 2D7TH 1PKOA 1PD6A 2BRQA 3LS4L 3DGGA 2QSCL 4MQSB 4PRAB 3CVIH 4ISVB 1ZSDA 1G7LB 4PRID 4ZDHB 1RZIA 3ZSSA 2O5ZL 4AENA 1KTDB 2BNQD 1F3JB 1UKTA 5E8DL 5IVZA 1JGDA 3ZE1E 2AV1A 1G7HA 4H1LG 1FVEB 3O4LE 3G5YA 3UBXB 1X9QA 4DEPB 4RDQG 5ILTH 1I4FB 4K2UL 4AY0A 4FQ1L 2AJZA 4H0GA 2QHRH 3Q6FB 4TRPL 1C7SA 2OP4L 1U3HC 3HPJA 4JVPA 2PO6A 3VFNA 1NDMA 3QEUA 1BEYL 4YHLH 4OGXL 3ZTNH 3QDGE 1IL1A 1CL7L 1EUUA 1G7MA 1QNZH 4RMVA 1F11A 3MNVA 3MYZA 3UO1L 4WIQA 1R24A 1INQA 2NY1B 5INCB 4TTGA 5IESL 3EIFA 4D9QE 3W0WE 1A2YA 2WV3A 3PQYD 5JW3H 2WWMC 3O3UN 4G7YL 4MD0B 5CS7A 1FIGL 3EYFA 3JV6B 1UM5L 1F90H 4E9LA 4LGRB 2FH6A 2ERJC 1MLBB 1RURL 2X4PA 2BJML 1MCEA 1MCOH 1QBMH 3OR6A 5CINL 5HD8D 1HYSD 3OJMB 3RWEB 1HEZA 5F1IA 1E4KC 4LAQL 5DVLA 1P9MA 1BVKB 3EYVB 4G9FE 2Y9RT 3HMXA 2A83B 2AJ3A 2ZKHH 5BXFA 1PGRB 1F42A 2KPNA 2R8SH 2YPVH 1IMHC 3KYMB 1FVCA 4YXHL 4Y4KB 4PV9B 2IPTH 2FJFB 4OZGF 2PUQT 5CILL 2FX9H 5E7BA 3LSOA 4XPTL 3G5ZB 1LWRA 3MBEA 4MNGB 2Y4SA 4NOFA 4D8PA 4EI5C 2DBJA 1YJDC 1LVEA 1T20B 4ZTPH 4B53A 2GY5A 1QKZL 1UT9A 5JHDE 3EJYD 1ZV5A 1EIBA 1XF4B 2DYPA 4PJFE 5IVXF 1JGVL 2LQRA 3RX5A 3GHEH 3U48A 4HWBA 5E7FA 4XMLL 3AU1B 3KPRE 5A2KH 2C4FT 4L3EE 3MLVH 4MA3A 4IRJB 4WFED 5E8EB 1E6OH 2CD0A 2IAND 2I27N 1SJHB 2VXVH 3ARGA 1WC7A 1EZVX 3GSRB 3MRCB 5D7LD 2D0HA 5JIKA 5KSAC 1CICB 4HEPG 4JFZH 4W4NA 3WXWL 1BBDH 2AQ2A 4PJXF 1NCWL 4MD4A 3OGCB 4E41D 1BJMA 5J3HD 4OLYH 2EDWA 4O2EB 2VUYA 4EN3D 4OJFH 3UZQA 1U8MA 5IQ9B 1JZ2A 1S7RB 2Y5EA 1FBIL 4FQLL 5CEYB 2Z35A 4HIJA 3MNZA 1LEKA 2OCFD 5ADOH 1VFAA 5CCKH 5KSBB 4ZUTB 2AABL 3ROOB 4LCCB 3LMJH 2OR9L 3WFDL 4X80H 3IFPB 5L88H 2VLRA 2VXQH 5EOCJ 5J8OA 4XWGH 1A47A 5AZEH 4JFFB 2FO1A 3D18B 5LJYH 5MI0C 1AGBA 4C56D 4HZLB 4LLYB 1KCKA 5HGGS 4QF1A 1JYVA 5C0NC 5L6YH 3B3IB 1JPST 3QPXH 4PRIE 2LU4A 1FL5A 4EXPX 4Z7QE 1RUMH 4KPHH 1K9TA 4UV7L 1N5YH 5C9JA 2YN3A 2BNQE 5B39G 1EK3A 3U1SL 1Q9KB 4X0KA 5FDWA 1HZHL 2X5PA 4HS3A 1OAKH 5L2KD 1QEWA 5E2VH 3QG7L 4Z7VA 3QEGL 4AG4H 4RDQF 1DVFB 1CG9B 2HJFA 5HHOA 3CH1B 3RHWK 4XH2A 5EO9A 3BT2L 4ORGB 4FQQB 1OP5K 4HPYL 3RWJA 2W92A 1YY8A 3QULB 3LEXB 4KKLD 3EZJB 3QIBA 4YDJB 3FT2B 1UEYA 4PJEE 3AS3A 2PTUA 3PGCB 1INDL 2DQTH 4NO3B 2IFFL 3ETBF 4MA8H 4MHHI 4JLRB 2CRMA 2GCYA 4HGMA 5HGHA 1QRKA 3KXFA 1WF5A 4PG9A 4DK3A 3TVMB 3EO1B 4CW1B 4Z8FL 3JUYA 5GS0H 2EDNA 1RFDH 4I18A 5EN2B 2V7HA 4R3SB 1YDPB 3PQYE 4Z0BH 4ODSH 3U83A 3DUUB 3KPNB 2VXTL 4U7KA 5KVGH 3GSVA 4M4RA 3T77B 1Y6NR 4WV1B 5TF1H 2PYED 4Q0XL 4ODTL 1SHMA 3HNSL 1MVUA 1QSZA 1OCWL 3C6LD 4IJ3C 1MCHA 5CKGA 3RY5A 3SDDC 2EEDA 2AJUH 2VC2L 4HUWA 2A6KB 1JI2A 5HDBE 2OTUA 1RZFL 1IC1A 1KB5L 4OKDA 4KK6C 4ZSOB 3V79C 3F58H 5HGBA 5IB4B 4ETYA 1TZGL 4KGJA 4U6XA 1JNNL 1S9YB 3SDXF 3GBMH 4LVHC 1HILB 3HMXH 2Q7YB 1A1NB 3VFUA 1S3KL 1I9RH 1MCRA 3N1FC 2EH7L 3QWRD 4IOFD 4OZ4A 4QRUA 1JFQH 3CJJA 2HRPH 5BVJA 2WBJB 1BQSA 32C2B 1I85C 3CX5J 5EULV 2VIRB 5DUBB 4P46B 4XBGA 1ND0A 3J7HA 4HWBH 5EU3A 4WFEE 4M5YL 4S10A 2IANE 4IRSB 5TQ2L 2APVA 1KFAH 1WZMA 1YEDB 3WNLA 5D7LE 4BH7A 3PP3K 2R0WH 4NUGL 1C08A 4X7SL 4U7SA 3U30B 2R1WA 2EECA 4YHIA 3AROA 3CCHA 3CLFL 5BW7C 4DVRL 2XZCL 4E41E 1INEL 4UQ3B 1NSNL 1AO7D 2BERA 4LBEB 4OLXL 5DFVC 5JLZA 5FUZH 1KPVB 2CQVA 1OB1A 2WW8A 1QFOA 5FHAH 3D85A 1VA9A 3TEUA 2VLKD 1B4JH 4RAVB 1DEDA 5IMMA 1VFOA 1T3FA 2E27L 5CJQL 1A3LH 3V5HB 4CDHA 5KG9B 1AKJB 2AKRA 3BEVA 4PGBA 3SQBA 5DJYB 4C56E 1JE6A 1W2KT 4GKOA 2CR3A 2R39A 4Y5VB 4JPVL 3LPGA 1NGWB 3EHBD 4MA7L 1FZOA 3TA3A 1A1OB 1QSFD 4FS0A 4HIXH 4JM2C 4ZAKC 5CBAB 1FPTH 4HJJL 1CDJA 4F7CB 3RFZC 4HK3J 3ARFD 3O11B 3TZVB 2J8UB 3GJFK 1KJVA 2MPAH 5I1JH 4WTXA 3QRGH 3T2PA 1UB5A 5E2UL 1FLRH 4LPXA 1BZ7A 4POUB 2OK0L 3BRDA 3ZDXE 5L2KE 1SEQL 1EHXA 2QR0A 4FQIH 3DGGB 5DWUL 2CPCA 2YSSA 1QG3A 4PREA 1ZSDB 3MJ6A 4K3EL 1OP3K 1RZIB 2UZYB 1WFNA 2A77L 1W8NA 4AENB 1KENL 2HJLA 5IVZB 1JGDB 1YC8A 4LSUH 2AV1B 1CGTA 4TSCH 3D0LA 4BK5A 4AMKL 4R26H 2VDMH 4NZDA 2YN5A 5ESAB 5IBTH 2Y72A 4LGSB 3QG6A 2H9GA 1RIHL 3NIFE 5T5NG 4WY7L 4BZ1L 2AJZB 5JPMA 1C7TA 3H9SD 1A6VH 3VFTA 1ZOXA 1H8SA 4KK8C 1KELH 2FX7L 3HPJB 3CMOL 1N6QH 2DQDH 2PO6B 4TVPH 3VFNB 5IUSA 1NDMB 3QEUB 4YLQT 4HD9A 1S8DA 1F8TL 1NGYB 1PG7L 3W5MA 5JORA 1G7MB 4JANA 1CYGA 3LOWA 1F11B 4LCUB 3MNVB 4LFHG 5CGYC 5ADPH 4NJ9H 1UXSA 4O58L 2ICWB 1OW0C 1U6AL 3BKCH 5CJXC 3MFGB 1R24B 3DXAA 1EHNA 3SGKC 2A0LD 1INQB 2VR4A 3RWGA 2Z93A 1QZ1A 2SEBA 5I71B 5EPMA 1A2YB 2IAMC 3U9PH 2VDLL 1VGEH 4M3JA 5BO1H 3EYFB 3OV6A 5E6ZA 1RZJC 2IF7A 5EOQL 1UACH 4PLJD 3V4UH 5JMRA 4XWOD 3R0MA 5EBWB 3BP6A 2X4PB 2XY1A 3GGWA 3JWOL 4JQXA 3OR6B 3VD5A 1CGYA 4P2OD 1FCCA 5F1IB 1FG2A 4F37F 3QIWB 4PP2A 4DUXA 2VSCA 3BDXA 1KN4L 4X4ME 2AJ3B 1U9KA 4CJ0A 5BXFB 4N1CA 3ULSB 1R0AH 2FBJH 1FNGA 4NC1E 1UKQA 1ZHKA 4S2SA 1FVCB 1ZANL 1FFNA 3NA9L 5LG1A 3BD5A 1SVZA 2P45B 3LSOB 1HDMA 3MBEB 3RVWD 1J0KA 4D8PB 3VXTA 3CC5A 3ZDZF 3L5XL 3NCMA 5BVPH 1FFQA 2DYPB 2FIKA 2AEQL 3K3QA 4Q97A 5D93B 4YGVA 4RNRA 3F5WA 5GGQH 2WZPD 1XF3A 3S96A 4FQXA 4R90H 1AO7E 4MA3B 1T0PB 3VGBA 3PNWA 1WC7B 5ERWA 3H42H 3A6BL 4EUPA 1YMMB 4WNQA 4AIZB 3VRLF 2EDJA 2VLKE 5GZNC 1Z2KA 1A7RL 4MD4B 3WLWC 4MMZC 4JPIA 1U8MB 5D7IE 4D9RE 4YHZH 3G6JB 4WUKL 3VG0L 1MFAL 2Z35B 4HF5L 1R3LA 3MNZB 1LEKB 2EXYC 1VFAB 5DD1H 4JY6A 4JRYA 4OBSA 4F33A 3SPVB 5ICYA 1QSFE 4HC1A 3U7AA 2VLRB 3BWAA 1UCBL 4UTAH 4ZFOL 4QHMB 5DJ2A 1AGBB 3G5VA 1VERA 3FRUA 4Y2DA 3U4AA 2IQ9L 4OI9A 3ILPB 2K9UA 4JAMA 4OI7A 4QF1B 3BZFA 4KUZL 4JCMA 3ZE0F 5JW4R 1FL5B 1JF1A 4XBEH 1UM4L 3ZL4L 5C9JB 4L8CA 4YXLL 1IILE 5AD0B 3MLXL 4X0KB 4P2RA 5FDWB 4HXBL 4HS3B 1CWVA 2W38A 5D8JH 4Z7VB 3KPLA 2HJFB 5HHOB 4OZFA 5ALBL 5EO9B 4KY1L 1A6UL 2QQNL 2BDNL 1LMKA 4W6YB 3RWJB 5BZDA 1YY8B 5DFTA 1FAIL 3EDDA 3H9SE 5D1QD 1MFDH 4XX1G 1T5WA 1NMCB 3QIBB 4HWZA 5DJDA 2F58H 1HHIA 4O51B 3PGDA 1NGQH 1U8QB 3NN8A 3QUYA 3L5JA 2GCYB 5HGHB 1BX2A 3KXFB 1JTTA 4PG9B 4AEHH 3HR6A 4M6OH 4RMRA 4TNWF 5I19L 4I18B 3S36L 2EZ0C 3BQUC 4UOJA 4YQXH 3NZ8B 4I2XA 3OX8A 3NA4A 3QFDA 5F9WB 3ZYOA 1RUKL 3GSVB 3HNVL 5JA9A 1PQZB 5EZIH 3V52L 1NCUA 3C9NA 3AXLA 1T0NB 3SE4A 3UTZA 4OTXL 4K3JL 3MLSL 2BY0A 4HUWB 5B8CC 1F5WA 2OTUB 3LN4B 2Q6WA 2AQ1A 4MSWA 1EJOH 1JGUL 1S7QA 1PEWA 5HGBB 1B0RB 3HR5A 2WUBL 1OGAE 4QGYA 5B3JE 3M45A 3RPIA 2ARWA 5E4EC 4YH6A 1IGIH 3VFUB 5DD6B 4H20L 2AGJH 4Y4HC 5F7KC 5H94A 3E8UH 2C3VB 5E5UB 3L3GA 1GIGL 1W0WA 2UY6A 1CFVH 1WT5C 2E5EA 3DVNA 1MCCA 4MAUH 3V5KA 2LE9A 3T2NH 4Y5YC 2RJMA 4OZ4B 3VFSA 4QRUB 3SO3B 5FYLH 2C1OA 1Y6KR 1FN4A 5BVJB 1NJ9A 3O3AA 3PGFH 1IARB 4P5MA 3RTQC 3RPKA 1BGXH 4X6FA 1Z6JT 3P9WB 3OJ2C 3INUL 4IDLA 4WI4A 1Y18A 4XBGB 1ND0B 4Y1AD 1P1ZA 4XPAH 4UI2A 2ORBL 1BVLA 1XEDA 1VCAA 5EU3B 3ZKNC 5IHUH 4OM1L 5EZLA 3SCMC 2CUMA 4JN2A 4M7KL 4M93C 4BH7B 1ES0A 1C08B 3AFLA 5IM7A 3IAQA 4PGCA 1PAMA 2R1WB 4PJ7B 1OAZH 4EIGB 4YHIB 2YWZA 3VFPA 3CCHB 2F54E 4DN3L 4FABH 4R0LA 1EXUA 2Z31D 4PYHA 1PBYA 3N1QC 5MERB 4KV5E 4P4KA 4X8JA 3Q5YA 5JLZB 1KGCD 4EEEA 5IGXL 1RK0A 3I02B 4ZXBA 3P77A 5I17B 4KK9D 5A1AA 1EO7A 1CLZH 3D85B 1F6FB 4D3CH 4RMQA 4XTRC 1KSRA 5IMMB 1T3FB 1JPTL 1G84A 4G8GE 4V1DA 5JMOC 3C08L 1CR9L 2AKRB 4HH9A 5EA0H 3ESVF 4PGBB 4KVNL 3QUXC 5CGTA 1CU4L 4JDZA 1BWWA 3PL6D 4R97C 2NXZD 3THMH 1FZOB 4R4NC 3TA3B 1AFVH 2NY5H 2Z0BA 2G60L 5GGSA 3WMSA 2CKBL 3LKPA 5ACLA 1MCPH 3D25A 3P4LA 1C5CH 5I30H 1BD2A 1E4XL 1VPOL 1WWBX 1YPZF 4PJ8D 5CEXA 1KJVB 3TBYA 1U95A 4X6EA 4JVWA 4XC1L 1IGTB 3LPFA 1UB5B 4J3VA 1CGVA 1BZ7B 2YA0A 3S3PA 3GO1H 5BZWA 1SY6A 5I6XB 3WO4B 4O4YL 4KDTC 3WHE1 2QR0B 1ROWA 4C4KT 1T4KB 2WINA 3BIBX 2YSSB 4PREB 4NN5B 5F7HA 4HCRL 3DVFA 1Q9LB 2WM0A 4G6KL 2XWJB 4OZFH 4DGVH 1OPGH 4QXTB 2OI9B 5DHYA 4GQPH 5HPOA 1B3JA 1EFXA 2J4WH 1Z3GH 3D0LB 3KPTA 4OV6F 2B20A 1R6VA 5FYKE 2MCPH 1L0YA 3MROA 3QG6B 3ARRA 2W07A 5B4MD 2H9GB 4NKMA 3D39A 1R5VA 5GRYA 3W11C 5I1GH 1CT8A 2E7HA 3T3PE 5DK3A 2RQ8A 4QTIH 5JPMB 4F7TA 1G9MC 4LLDA 3VFTB 2NY3B 2VDNH 2ATKA 2VKXA 5D2LE 3O41A 4MXWL 5FCUL 1N0XH 3OG6B 5E99L 4DN4L 4GRWE 4FQHB 4G6FD 1S8DB 2VUOA 3OKDA 3R4DA 4PTTB 5JORB 4B0MM 2YRLA 4JANB 5EIIA 2R29L 5MEPA 4HJGB 3B4NA 1WTGT 4YFDB 3UMTA 5DMIL 3DXAB 3MMEA 1MRDL 2NY2B 3D1MC 4N68A 2Z93B 4JCLA 3RWGB 2SEBB 3QHFL 1J86A 2NY6D 4HXAH 3T0ED 4XNYL 3M17A 5GGVL 1WZ1H 1KJ3L 1DN2A 1YNLL 3O6FD 4GAGL 4LKXA 1JI1A 2P5WA 5F72S 1FYTB 2VXSL 4PLKC 5GJSH 1JGEA 1MI5D 3FAWA 4U6HA 3BP6B 4G3YL 3GGWB 1V8HA 3HTLX 3GBNH 5EOCL 4P48A 5LCVH 4QHKJ 2J88L 3WKMH 2NY0B 3VG9B 4GAJL 1FG2B 1NFDF 1GGCL 4U0QB 4PP2B 4NQEA 1FLTX 4W81A 1K3ZA 1GC1H 4G8IA 3QZWA 5L8LB 4XHQA 4OZGA 4Y16D 3BZ4A 2DTML 1FNGB 4KKLC 4LHUD 1ZHKB 4S2SB 4NQCD 4S1RH 1FFNB 4NRZB 3G6DL 4FFWC 4KK5D 5F89A 5IVXA 1XGYL 4Y1AE 1NEZG 3AREC 5JZ7C 4CU6A 4OUUA 5JQ6H 2E3VA 4LPYA 3VXTB 3CC5B 3HC3H 3BAEL 1V05A 1N8ZA 2W0LA 2YK1L 2FIKB 1F58H 4RNRB 3RU8L 4U49A 2IPUG 1XF3B 3O6LL 1P5VA 4FQXB 2GITA 4PJXA 3ZHLA 4JKPH 1KGCE 3PNWB 2QKIA 5ERWB 4WNQB 1BJ1H 1S5IL 2BSRA 5DA0B 2I5YH 2IH1A 5J7CC 4RFNC 2EDQA 3JSSA 4X6CE 4HAGA 3X12A 1FE8H 4BSVA 4XP4L 4BQ8A 4ONFH 2IMNA 4JY6B 1XIWC 4JRYB 1M6OA 2HTLD 5D5ME 4F33B 3ARWA 5ICYB 5C0RH 1U8HA 3NZHH 1G0DA 3M1BA 4GMSL 4LPWA 4QTHA 3BWAB 1A7QL 1KCVL 4NCDA 1UA6L 1A9EA 4QRPD 2V17L 4U6VL 5MP6L 5DJ2B 1WISA 5TE4L 3CZFA 5D96B 3G5VB 2C7UB 2HFTA 1RQ5A 3FRUB 4Y2DB 2GJJA 4V2BA 2BHUA 5T5FL 1HCVA 1BLNA 4MXVE 1EMTH 5GXBB 3QWQB 5M94B 3QUZC 3BZFB 4B50A 1G6VK 1SY6H 4JKKA 4H1LA 3DRTA 1I8LA 1JF1B 4GW1A 1SBSL 4JREB 4L8CB 4N9OB 5I73C 5DEGA 1KJ2A 1NLBH 2F8VA 4TTDD 4U0RB 2HLFC 4F58L 2O5XH 1RIVH 4H26A 5FUOH 2YXMA 4FZ8H 3KPLB 5HYSG 4OZFB 4DGIH 2YD8A 3OHXB 4K94L 5HYFA 5CZXC 5BZDB 6FABH 2FR4A 4GG8B 1L7TH 4NZRH 3WN5A 4NQDA 2FWOA 1T5WB 3MUHL 4HWZB 3RX8A 1J1PH 5HYJD 5FOJA 4JHWL 5DVOA 1HHIB 5K9OA 4WO4B 3PGDB 2I9TA 2VB5A 4OI8A 5LWYH 2H3NB 2B4CC 3C5ZC 3L3JA 3FB5A 3MJ8A 3ZE1F 3NN8B 1QBAA 5IJVA 3QUYB 3B8SA 5AEAA 4HWEH 5LGHL 1F4WH 3RDTC 1BX2B 4LMQE 2M1KA 5IWLC 3MJ7A 2NX5D 4P49A 1ZVSA 2JJTA 2WUCH 4XCFH 5GHWL 3GHBH 4NZTL 4RMSA 4U1GB 3WIHL 4XHJD 3U7WH 3I3BA 3I3EA 2AXGA 4OQTA 1YEHL 4I2XB 3CVHA 3OX8B 5HHXH 4PB9L 3DROA 3QFDB 1DCLA 2K7QA 2VLJD 3CXHJ 5K33A 3IXAB 4UU9A 1PG7X 4OIAA 5F7UA 3HRZA 1MI5E 3RAJH 4QNPE 2YKLL 3HRPA 3C9NB 3AXLB 1UZ8A 3UTZB 3BN3B 4Z95H 4ZNEE 3SDXA 4HG4J 5B38B 3O81A 3OMZA 3ESUF 2Q6WB 4MSWB 5I1CH 1BHGA 4KQ3H 3CDGB 1S7QB 3FB8A 5F9OH 1T66C 2IEPA 3HR5B 4OCXH 1ONQA 3RPIB 3ARTA 2OXGA 4NQCE 2HG5B 2YPLD 4K9EH 5H94B 4XP5H 4GG6E 3L3GB 1W0WB 3HC4H 4XP1L 3DVNB 4KJQC 3V5KB 2J1KA 5TPWL 3VFSB 4S11A 4ERSH 3BEWA 4TNVK 3S88L 2C1OB 1YNKL 4OGAD 1NJ9B 1QOKA 3O3AB 4P5MB 1J8HD 4I9WD 5C2BL 5DZLA 4X6FB 3SKMA 1YZZA 1WFTA 1MPAH 4HBCH 4HLZG 1Y18B 3W9DA 3OKMA 1KULA 1P1ZB 3SDYH 1AH1A 4L3AA 5IEKA 4QWWC 1MCSA 5EC2A 5EZLB 1F6LL 2NLJA 4ZS6C 3TBTA 1IQWL 1MJUH 4M1DL 3IFLH 1RUAL 3QDJA 1ZEAH 1DLHA 1ES0B 1TJGH 2VZSA 5IM7B 5DURB 4UT9L 5JOPD 2X9YA 4BZ2L 1S9WB 2EE2A 3VFPB 4PJFF 1EXUB 1TTUA 3CSGA 4LCWA 5DGRA 4P4KB 2PTVA 4X8JB 4KZDH 1RK0B 4ZXBB 5CGMA 3P77B 4ZUVA 5FIEA 3CK0L 4GLRI 4P9ML 2BY1A 1NCAH 2DQJH 2CK0H 3O4OB 1ZKAA 3PABB 4I3RL 1OT1A 25C8H 3QWOA 2IWGA 2GIYA 4QRPE 3O8XA 4V1DB 3EYSH 3V7AG 2AEPH 3HE7A 2M26A 2OTPA 4HH9B 4OCRH 3QIUA 2A6JA 3C09C 3P0YL 5F9JA 4AH2A 1BQHA 3B9DA 2R1YA 5E5RB 2GYSA 5GGSB 1TJHL 5I15H 1ED3A 5T33H 3D25B 1BD2B 4PJ5D 4P59L 4H1LH 3X17A 1U95B 4X6EB 3MZTA 5AYUH 4MLIA 4BQ9A 4TUKH 4KMTH 2FCBA 3VWKD 5IFJA 4RMWA 1KJ2H 5BZWB 3LVEA 2HRLA 2NNAA 1TMCB 1TCMA 2WINB 2QL1A 1KTLB 5I1KL 3MR9A 5LBSL 5J1SC 3JWDC 1FZJA 4LSQH 4Y4KC 1MHHB 2EIEA 5DHYB 1YECH 3VI3E 2MKLC 2YWYA 1EFXB 5D7SH 4OIIH 4LCIH 1RZJL 3MROB 4YHYB 4RX4A 5BOZG 4NKMB 1UADC 3T0XA 3RIAK 4PJ9A 3PHSA 1QSVA 2YUXA 4FP8H 3ZTJH 3BD4A 2EIBA 2NX5E 2D4DA 4LLDB 4F7TB 1FFOA 3MA7A 2AJSH 2ATKB 4IRJC 1Q38A 2AEWA 4IIQC 1LE9A 4F2MB 4JGMA 1KCRL 3O41B 1AGCB 5KJRL 3H3KA 4QT5A 5I66B 3WFBH 4DQOH 3FO2A 1BVZA 4PJEF 3AVEA 1CICC 3GI8L 4FZEL 4OQTH 3OKDB 4NWUL 5EUOB 3CVHH 3GRWA 5EIIB 4RIRA 5MEPB 1NDGA 2KUTA 4HMDA 3MMEB 5JIIA 3QO1B 3BP4A 4R7NB 1FAKT 2R4RL 3S36X 3M17B 4RGNB 4ZS7L 4XXCA 2D7NA 5DO2C 5I8KH 5FV1L 1WSST 1DBAH 3GMQA 3QEQE 4LKXB 3QISA 1AGFA 4LCCC 2P5WB 2I9LA 3QCVL 4QRRA 2XTJE 1JGEB 3ROLA 4U6HB 3MRNA 2XA8L 4BK4A 4CDGC 4R2GB 3UAJC 2YPLE 4X4ZA 4NQEB 3VMOA 1IC7L 5C0BA 5JOFA 2QQLH 2VR9A 4G8IB 3QZWB 1EO8H 3ZO0A 4OZGB 3BZ4B 2VL4A 5GGTL 5EU6D 3G5XA 4UINL 1F4YL 1N0LA 3PDOA 3QCUH 5C1MB 1HQRA 1EERB 3ULVC 1J8HE 2HT4C 3O9WD 2P46B 5E56A 3T0VA 5HHQA 1MHPL 1S5HA 1J1OH 5IVXB 2OQJA 3LS5L 1TPXB 4OD3L 4QYOA 1GAFL 4OUUB 4AQ1B 3OPZL 5FYJH 4PJHE 4RZCA 2ADJA 4K3GA 4MDJA 2Y36L 1Z5LA 1YA5A 5EORL 1BF8A 1N8ZB 1IAOA 3MGTA 5KVFL 3VFOB 1NFKA 5CSZA 3UYRL 3S35L 3VDBA 1H5BA 1AD9A 4MZ2A 1P6AB 1F45A 1KLGA 2GITB 2X4SA 1S78D 1YEFL 2FGWL 3L5WB 2B5IC 2L7UA 2ESVA 3NCFB 2QKIB 3LQZA 1E4WL 3TVMC 1FGVL 3BKYH 5GSRA 5GRXG 3QSKB 2BSRB 4KHTH 2CLZB 2IH1B 4MB4A 3REVA 3S4SG 1MWAA 1S7XA 3VXSA 3X12B 2GJ6D 5ISZE 5HHMD 2BX5A 3VRJA 4C54A 1NAKL 1RJLA 4BSVB 3OAZH 3UJIL 1IM9A 1LQSR 1M6OB 5DD5H 2X4QB 3M1BB 4QTHB 4U33A 1A9EB 2X4RA 4PJ5E 3IVKB 3P4NA 3CZFB 4UDUA 3PWPA 4HDIA 5SWSA 3SKNA 3KJ4C 2XY2A 1BLNB 2R4SL 5TQ0H 5HJ3A 4TOYH 5T1LA 3C8KB 4XVSH 2VZ3A 4H1LB 4A2LA 4GW1B 4ZPVA 5C09D 3M8OH 4HKXA 4OLWL 3VH8G 3RBSA 4J12A 4ZOEA 1KJ2B 1QLFA 2MWCA 4MNQD 3K2MC 2CGRH 4HKJB 4JRXD 4H26B 3ULUD 4S0TD 3MV7D 3IJHA 4RBPK 5DJXA 1PSKL 2WBJC 5HHVH 3ZDXF 1T22A 2UYLA 3HI5L 5FB8A 4BJLA 2C26A 2F53A 1F4HA 4P46C 5K59E 3WN5B 4NWTL 2O61B 4NQDB 2FWOB 4PY8J 3RWCB 3RY4A 4LRIC 3MLYL 4IRSC 4NM4L 4OCYL 5K9OB 2H26A 3BUYA 2VDQL 4M5ZL 2I9TB 1IAIH 2JLLA 3L3JB 3FB5B 3MJ8B 4EI5A 5F1OB 4XVJH 4C57C 4BQBA 3GIZH 3U30C 4XMPL 3KLDA 4UT7L 3GRWH 2EDKA 3MLRL 3DRQA 3MJ7B 3NIFF 3P73A 1ZVSB 5F96L 5FUCC 4AL8H 1U0QA 2FO4A 3BPLB 4JFYA 4QKXB 5C3LD 5F8RC 3S3JA 4RMTA 2AXGB 3CVHB 4LIQE 3DROB 4GKZA 4Y8AA 2EYRB 2J12B 2XZQL 4O5LH 3JUZA 5E2JA 2BHYA 5KSAA 4UU9B 5E03A 3HRZB 3WE6A 3RBGA 4OGYL 1M4KA 2D7OA 1UZ8B 5IMOA 3SDXB 4JFDD 4HSQA 3TN0D 4DOHE 1HH9A 4PB0L 2ZG2A 4NP4L 4Y5VC 3FB8B 4OCNC 1MCBA 5CSGA 3QPQC 2W0FA 5IW6A 4NYLA 2D7MA 3WYRA 2FEEL 1ONQB 3DETC 5EU6E 4JFPA 1FNEA 3TZVC 3GKZA 4AEIH 4KHXL 3U4BH 3D9AL 2GW5A 3BO8A 2Z9TA 3LH2L 5KTEH 1TFHA 3IJYA 5DQ9B 2CRYA 5D2NB 5B4MC 1RPQA 5MEND 3WFZA 5C92A 5E8OA 2VQTA 3GK8L 4JRWA 2C5DC 4XAWH 3S34L 1FZMA 1XCTA 1NL0H 4OLVL 1DQML 3LHPL 3W9DB 4RA0C 4PJDE 3OKMB 3SDCD 5J6GA 4RISH 5IEKB 2PF6A 1CFQA 1U2CA 1AP2A 5EC2B 2NLJB 2QQQA 3TBTB 3TH2T 3QDJB 1UGNA 3F7YA 2MKWA 4HAFA 1DLHB 1NC2A 2FX8H 5C07A 1UQSA 1BAFL 1VDGA 1ZAGA 5CEZD 4P5TC 2PO6C 4CN1A 1ADQA 4PP1C 3O6FC 4LCWB 2QSTA 4YHNA 2HFEB 1I9IH 1MWAH 5HHME 2G5BA 1UCTA 4K3DL 3ZKMC 4ZUVB 3MREA 5GS0C 2ZSVA 1ZLSL 5DT1H 5TF0A 3P2TA 1LO3H 5I71C 3Q0HA 5CMAA 3QWOB 4WFGE 5CD3A 1GL4B 3IFNL 3CFCH 3O8XB 1FP5A 4MVBD 4XPFH 4NM8H 3PWLA 3QIUB 2A6JB 2F19H 5C6WH 2DQHL 2AK1H 5F9JB 4AH2B 2ADIA 1CQKA 5D7IF 4GSDH 3PHQA 2R1YB 5B39B 4JG1H 2YZ1A 4HBQA 4J2XA 5TFSL 1CLOL 1FORL 4N90D 2IFGA 3OAUL 4KRPD 4MXQD 4QHKI 2B8OT 4XCYA 2CXKA 1ED3B 3MGAA 3QQ4A 1DL7L 3SDDA 3P4OA 3VW3H 5C09E 4MCYA 3QIWC 1B2WL 2FJHA 5J56B 2CLVA 3CPLA 4Q9RH 4G7VL 4MNQE 4KKNA 3TGXA 5IFJB 1NGPL 4JRXE 3U0WL 4GJTB 3ULUE 3HZMB 2ICWJ 2ICCA 2NNAB 3MR9B 3GB7A 1FNSH 4GBXC 1FZJB 3HUJB 3KJ6L 5AZ2H 1N2RA 1F00I 3ZKSD 2ED8A 5SWZB 5GJTH 4PGDA 1X5ZA 5DZNA 3NAAH 2BRRL 4HIIA 4KFZC 2P8LA 3SJVD 5CSBA 4PJ9B 3MLWH 2VRAA 4W4OC 1I85A 4U3CA 3VGGA 4NCC1 3GMPB 5JPNA 1JF5A 4PRPA 1FFOB 1CK0L 3MA7B 1CXHA 3I85A 1JNLL 1LE9B 5BRZD 4NKIH 1NCCH 1NUFA 4KROD 1A5FH 1QSEA 2ZUQC 4QT5B 2HFGH 5J13B 1E6JL 4K8RH 4AYFA 4Q58C 1SYVA 4RIRB 1NDGB 3OKNA 1HINH 3IETA 5BW7A 1MQ8A 4KU1A 2VZ1A 3BP4B 4JFHD 4JFDE 1MCKA 4P4RA 4WEBL 1ORQB 2V5RA 1MH5A 1NCBL 1NC4D 1U2HA 2BSSA 3GMQB 2MTPA 1CDCA 2I9LB 1XF5B 4PS4L 4QRRB 3ISWA 4RSVA 5EO0A 5J11B 2OLDA 1NFDA 4G5ZL 3ROLB 3UDWC 4QLRA 4KUCD 2NZ9C 3MRNB 5I1HH 1FO0L 1RVFL 1FDLL 4WCYL 2XQYK 3IS0X 1OSPH 4MJ5A 1KBGL 3BDYL 2FATL 3DUSB 4BA8A 1IVLA 1YY9D 2D03H 4NSKA 2DJ4A 5JOFB 4M7JH 5MENE 4HZAA 5J57B 5FK9A 5IMLB 5CWSA 3O3EA 1IAIM 5ALCL 3G5XB 4WI8A 5GGSY 2DQCL 3PDOB 3B5TA 1HQRB 1D5IH 5B3JF 3FRPA 1L6ZA 5IK3A 5HHQB 1Q0XH 1S5HB 4J23A 3IDYB 4CKVX 3MBXL 1BOGA 1GGBH 1VFUA 4GAYA 4HUUA 4QYOB 3L3KA 1OLZA 1P53A 4HKBB 4RZCB 2QQKL 2V5TA 3HI6L 4MDJB 4Z7WE 1KYOK 1Z5LB 1A7PL 3MGTB 4QXUH 4HJ0C 1G9NH 5CSZB 4TSBH 1NMCC 1H5BB 3QIBC 5KW9H 3UTTA 2CSPA 4YIQA 1AD9B 1JTOA 5CEZE 1KLGB 2X4SB 3JBG7 2OTWA 3KR3L 1P4IL 4J1UA 1ADQH 3LRHA 2ESVB 5TE7H 4JFXA 5E95B 3MCLH 2HTKD 3LQZB 4TPRL 5GSRB 3BX7C 4Y89A 1DVFD 2F8XC 4EI6A 3ARBD 2Q20A 3GSUA 2CK2A 2P5EA 1WAAE 5BS0A 2VKWA 3REVB 4APQA 1MWAB 5JUEH 1S7XB 3VXSB 2VDOH 4Z7UE 1N59A 5F9WC 2XTJC 3VRJB 3BH9A 3LQAH 5DVKA 3RIFK 4KV5F 1IM9B 2G9HA 4LVNB 1FH5L 3REWA 1CVSC 2AJVL 3BVNA 2BHZA 4L5FH 4N90E 4NT6A 2MCG1 3SGKA 2X1OA 2E7LC 3SE3C 2X4RB 4J4PA 4UDUB 3X3GL 3PWPB 4HDIB 4OCWL 5SWSB 3SKNB 3QCTL 2H6PA 1R3IL 3IAPA 3O0RL 5L2JA 3DSFL 5HJ3B 1I1AA 2ERJB 1JNHB 5IG7A 1TVDA 5T1LB 4M9OA 1PX3A 1LEGA 3S97C 4ZPVB 1EGJA 4EDWH 2C3WA 4WWKD 4HKXB 3LB6C 1DFBH 1QLFB 5TDNA 3SO3C 3TO4D 1Z9MA 1MIEL 5CP3A 1I3GL 3ZYZA 3IJHB 3HE6D 5DJXB 3SJVE 3O6MH 2EH8L 5EIQA 2IBZX 1T22B 2UYLB 3QRFM 5GISH 3DO7A 3HMWL 5FB8B 5C0CD 4PG2A 2F53B 1TXKA 3O4LA 3WD5L 5BRZE 4J7RA 1KIRA 2H26B 3BUYB 4EI5B 3CDYA 1M71A 2N4IA 1FCGA 3OF6D 5F1NA 1RMFH 3DRQB 3P73B 3SOBH 4DUVA 5A16B 3VXMD 5L9DH 4JFHE 2FO4B 3QDGA 3TO2A 1YYML 2BOCA 3T04D 1YQVH 5HPMA 1R3JB 4N5EC 3LQMA 1CE6A 1ZA3A 5IQ7L 3E0GA 5D2LF 4GKZB 3ARPA 5JDJA 2VITA 1JZ4A 5KSAB 1WBXA 4GRWF 4HFWA 4X7CC 1B88A 3W0WA 3FFCA 1M7XA 4W6WB 1OM3L 5IMOB 2M8XA 3UBXI 1VEMA 4EOWL 1FSKB 3LS4H 5EU5A 4EVNA 5JHLL 5LXGL 3T0AA 1HH9B 4Z76A 1BBJA 3NVQA 3KYNA 1XH3A 3TYFA 1DBBL 2J5LB 5E8DH 5IW6B 4NYLB 3FO0L 1LO4L 4JQIL 1I1CA 5GRJH 4NQSA 4GXUN 3DX8B 4K71C 1FNEB 5HVHC 5HDQL 1PZ5A 4O2FA 1RSFA 4M00A 4ALAH 3KAAA 3BO8B 2OMNA 3ALWA 3MCKB 4J3TA 1X4YA 5IBLC 3H0TA 2DF3A 4FQ1H 2NTFB 3WO4C 5GPRA 3WKNA 5E8OB 1I8KA 5D72H 1HYRC 4OF5A 2VDRL 4XZUB 3I9GL 3GMOA 1HHJA 1K5NA 1PX4A 1FZMB 4LRNH 1XCTB 4NN6B 1EVTC 2OI9C 2VDKL 5E9DA 3WFCL 2XI9A 2EC9T 1A4KA 1CL7H 4NFCA 4LHUG 4Y4FA 4DVBA 3VFRA 4OCSH 5JHDA 1CFQB 1AP2B 1F4AA 1GVIA 4Z6AT 4PJFA 1FNHA 4M8QA 5HI4D 3KPPA 1UJ3C 1RU9L 2VLMD 5E6ID 3NH7H 3T1WA 4BM7A 3KPRA 4L3EA 1AQKH 1SJXA 3PWVA 1NH6A 1UQSB 1UM5H 3DTXA 1OAYL 2FBOJ 5ESQA 5CINH 4YE4L 2G5BB 1KB5A 1HXYA 3MREB 3SE9L 2Z8VC 3OKLA 2MQ0A 2ZSVB 5JR1H 1TQCC 3JWDL 1ZA6A 2E6PA 2NY2C 1HHHA 3FHQA 4BH8A 5JXEA 4OZIE 4FMKA 4Q7DA 5CMAB 5CD3B 5KVDH 4I3SL 4N0UE 5FOBA 5CD5C 1X6LA 1ZWIA 3PWLB 2KZWA 2EKSA 3RX7A 4X6CF 1WFUA 2WP3O 1AI1L 2ADIB 4ZMAT 5CILH 3PHQB 4ZO6A 4I8DA 3PWJA 4XPTH 1OTSC 4JQXC 5IW1A 5EOTA 4TYUA 3P3YA 4XCYB 1MSPA 2F15A 2I07A 5D5MF 3SDDB 3VG9C 3P4OB 4OZHE 4MCYB 2FJHB 1ZLVH 3LEYH 2ZG3A 3CPLB 3F8UB 1EGJH 3BI9X 1JGVH 3OKKA 4PGJA 5CKAA 2JCCE 2V5MA 4XCNA 3JV4A 4LVHB 2W0PA 2YD7A 5CP3H 1P84J 1RZ7L 2CDFA 2ITDA 1NEUA 2BNQA 2X44D 4JFQA 1ZGLB 4OB5L 5I1LA 4MDIA 1R3HA 5HHNA 5C0CE 4JM4H 2A38A 4YR6A 4LLVB 4U1HA 1QLEL 1SMAA 1N2RB 3X3FH 2DDQH 1YEGL 3WXWH 3NIGE 1WT5A 4PJIE 4PGDB 4RGMB 3S98A 5JW4Q 1K4DB 4Y5YA 2YUVA 1Q8MA 4HIIB 2P8LB 1JPGA 4N0CD 1FNFA 1AJ7H 4KRLB 4FQLH 3RTQA 4JG0H 3IDXH 1Q9OA 1X5XA 1X4ZA 4PJEA 2NXYB 3TF7C 4FQXC 3QQ3A 4PRPB 5JPNB 5J12B 3IFOA 2AABH 4LSVH 3SQOH 4LLMA 3VXME 2DM7A 4P2QE 1DN0B 4NNPL 1QSEB 4LDLB 3FFDA 4IDJH 3SCMA 2AXHA 2DN7A 3MBED 3R8BB 1J11A 2B2XL 3HNTL 2P7TA 1SYVB 1LDSA 2B1AL 3TBVA 4DGYL 1V7MH 1ZGLP 3ULVL 1EPFA 2DI9A 3OKNB 4XI5C 3PQYA 4NO2A 3IETB 5D1ZC 2D7TL 4HULB 4P4RB 4U2ZA 1MH5B 4JE4B 3CVIL 1ZGLM 3EYQD 2BSSB 4UV7H 4B41A 1SYSA 5EO0B 4R8WH 3ARGD 1U8OA 1T6WA 1NFDB 4NNXA 4R4BB 1HZHH 5CBEA 3MV9E 4GXVH 3QEGH 1JV5A 4J3UA 4MJ5B 2NQCA 5DS8A 3W2DH 4QNPF 3ZLQC 3MRGA 4Y2DC 2NY5C 3QUXA 4NSKB 3Q48A 3FQWA 5EZJA 3OBAA 4C58B 3WHE0 1J18A 3JXAA 5FK9B 2EXWD 3MRKB 3O3EB 5CJ5A 5DC0A 5C8JA 4YHLL 3ZTNL 4DKEL 1MRFH 2Y07H 1BOGB 3KPOA 2Q1EA 4HUUB 3ARZA 3L3KB 4GG6F 1GOHA 5I8EA 4U05A 3OL2A 1AY1H 2VLME 2GUOA 3TH4T 5TH2A 4PY8I 1OLLA 3UEZA 4YIQB 1F90L 1F2XK 2IANA 5JIPA 4Q0XH 4WO4C 4Y19D 5D7LA 2OTWB 2PETA 1OCWH 4LK4A 2GTWA 4JFXB 1ZS8B 1I9JH 2ARJQ 1RZFH 1TTFA 1KB5H 5SV3A 4EI6B 1TZGH 2AI0L 1N6VA 4PJCE 3TWCL 3GSUB 2P5EB 4APQB 4CU7A 3RGVD 4YBHA 1N59B 4WI2A 2XXCB 3BH9B 5E8NA 4MLSA 3WIFA 2EDXA 1YEKH 2P8MA 1Y6MR 5FO9B 2FLBT 3REWB 2IPTL 2W0KA 1OY3B 3FL7A 2EH7H 1FL6A 2FX9L 3BVNB 3SE4C 3HZKB 3CDFA 4K7FA 5H35A 4WTZG 2XKSA 4ZTPL 4GAFB 1A14H 3L7FA 1BECA 4YEFA 3TIDA 2ZCHL 4ETQA 5HI3C 2UUDK 4X7TA 3MV01 3FAXA 3GHEL 5HGDA 2H6PB 5L2JB 3G6JF 1I1AB 1N7MH 3MLVL 4BFEA 5IG7B 1XGUA 1I7UA 2VXVL 1LEGB 3JTTA 2AQ3A 3SDAB 5D71L 3QHTC 4FQ2H 4JN1H 5L2KA 3VA2C 2HT2D 5TDNB 4JFZL 3GUTA 4DVRH 4AEFA 1XGRA 1INEH 4XB8A 2DQGH 3MC0A 4J6RH 3DO7B 3AS2A 3DV6A 5FGCE 5BMFH 5GGUA 3O4LB 3O2DL 3LMJL 3AREA 2DB8A 1B4RA 3O3DA 1KIRB 4X80L 5L88L 2VXQL 2E27H 5I1EH 5CJQH 1MJ8H 2L0DA 1XF2A 5IFAL 3TLRA 5AZEL 1PYWA 4RAUA 5DDHA 2Z4QB 5F1NB 5I1AA 3S3SA 5E08L 4M7ZC 4JPVH 5IB1A 3T08A 4MA7H 1MHEA 2MOVA 1P69B 1MJJA 4MWFA 3V0WH 4HJJH 4CVZA 3QDGB 3TO2B 4OF8A 2BOCB 2HT3D 2DLHA 4ZXBC 5HPMB 1ZA3B 5ITBH 4PJBE 1RUML 4KPHL 1WCBA 2VITB 4KRPC 1N5YL 3O4OC 1WBXB 3C6LA 4XMKH 1LK2A 1I3RA 4HFWB 3VDCA 5DJZA 3W0WB 3BMWA 2OK0H 2WBKA 3VI4E 3U36A 1OAKL 4U2YA 2JB5L 3OB0K 5E2VL 4EVNB 4M48H 4AG4L 4LMQI 5DWUH 5EB9A 1BBJB 3GMRA 3KYNB 3TYFB 2A77H 4PFEA 4U1MA 3ZE2E 3BKJH 1BM3H 5HI5C 1Q1JH 4UQ2A 1P7HL 4AMKH 4NQSB 4KKBD 3WS3A 3NPSB 4POZC 1PZ5B 4O2FB 3RVTD 1N4XH 4G9FB 4JFEE 4X4MA 5HDOA 1BJ1J 1I8IA 4HPOH 4BZ1H 4LSTH 1XGQA 4JO4L 2ICWI 3QDMD 1I8KB 5GS0L 1RFDL 3QUZA 3GMOB 1HHJB 1K5NB 2PXYC 3QNYA 4Z0BL 4LOUC 2ZNWA 3TA3D 5E9DB 4CNIA 4OF0A 1F8TH 4S1SH 1A4KB 5KSUA 1PG7H 4OQ1A 3TFKD 3FB6A 4Y4FB 5D1XC 1EX0A 1HOCA 3A6OA 1UH4A 4Y19E 3VFRB 4DVBB 2FNBA 3DMMD 4YHYC 5JHDB 4QOKD 1O7SA 4PJFB 4M8QB 1Q0YL 4YWGL 3EOTH 1ZHBB 3AS0A 2VDLH 2XN9E 7CGTA 4G6AC 5DMGD 3KPRB 4L3EB 3F58L 4NZJA 1AO7A 5D4QA 4MZ3A 5F44A 4DZBA 3DTXB 2EDEA 4FXGA 2E9WA 2ZSWB 1QFWL 3GBML 3JWOH 5ESQB 4NBYB 2ARJA 1W0YT 3C5ZA 4D2NA 4OFYA 1KB5B 1WCQA 2VLKA 3EO9H 1I9RL 4L4VE 4KC3B 4YUEH 1AD0A 1L0XA 4YHKL 4OF7A 3OKLB 3RDTA 5IWLA 1QR1A 1HHHB 1DQLH 5IEHA 3VWJC 4CVWA 1IT9L 5D7IA 5H37G 3RWHB 1LDPH 4CGTA 3RKPA 4HEME 1ZWIB 3GJFA 1U3YA 2HRPL 2NY3D 3KLAB 4PJ7F 4IHOA 4KAQH 2EKSB 1QSFA 2XKUA 5CZKA 1OF2A 3P4MA 3PWJB 12E8H 5C0JA 3ARFA 4NCC2 4HWBL 5EOTB 5IW1B 4R2GC 1Z9OA 3M07A 4KQ4L 4L3CA 1KFAL 1F2QA 3DXAD 3ILQD 2R23A 4WHCA 4FFVC 1G9EA 3OKKB 3B2UC 4G43A 4O9HH 5F3HA 4C59B 3GKWH 4XCNB 3JV4B 4PRIB 4K9EC 1FZKA 1QP1A 4XC3L 2ITDB 2CDFB 3B9KD 1BQLH 1MFEL 2BNQB 4JFQB 1DQJA 4U1SA 5I1LB 4MDIB 4L8DA 4P3CH 1R3HB 5HHNB 4H25A 4YR6B 1NFIA 1UM6L 1OAUL 2YD3A 5FHAL 5I0ZA 2IG2L 5FA3A 3DVGA 1U93A 4OFDA 2NY0D 5IMKA 4ZYKA 3I3DA 4Y5YB 1DDHA 2NR6C 4PRAA 2VZTA 4ISVA 1JPGB 2H2SC 3H9SA 5DQDH 3RTQB 1MFAH 2D2OA 1JPSH 5CLWA 4PJEB 1VB9A 3ORJA 3K1KC 4MQXC 3QQ3B 2VYRE 4LLMB 4MS8C 4HIXL 5C7XH 5DHXB 5K59F 1FPTL 1IC4H 4I0KA 1CBVH 3UBXA 5C6TL 4XP6L 1GZPA 1I4FA 3FFDB 1I1RA 4DZ8B 2P7TB 3OGOE 5I1JL 4O02H 4YHPB 4G80A 5ETUB 3Q6FA 3QRGL 4JY5H 4OCMC 1OD7A 2RB8A 3JTSB 3PQYB 4NO2B 2UWEE 2DD8H 2GTZA 4KUZH 3BN9C 3E1F1 4FQIL 3EFFA 1UM4H 4YXLH 1SYSB 2VAJA 5HDLA 1NLDH 3TJHC 1JP5A 4ZO9A 4TSCL 4NNXB 3UPCA 4HXBH 4R26L 5DQJA 4P2OA 3FO9A 2DBLL 1YUHA 5F6HJ 3GIVB 1JV5B 5IBTL 3TV3H 4J8RA 1A6UH 2QQNH 4GQ9L 5I18H 2BDNH 4LLWA 1OGAA 4F3FA 3I6LD 5I2IA 3FQWB 1NBVH 5EZJB 1BWMA 1A6VL 1SBBA 3B9VA 3EYUL 1MLBA 3QDME 4M1GH 4QEGA 1FHGA 2X09A 1KELL 4TVPL 5C8JB 2DQEH 3BHBA 3UZVB 1DANT 3PP3H 1EH9A 3L95A 4JDVA 3QUML 1BVKA 5ADPL 2OR8A 5HYEA 2A83A 4NJ9L 4Y8DC 4QOKE 3S36H 4W6XB 4LKCA 5ICZA 2GUOB 3C60D 3AB0B 1ZXQA 5TH2B 1VGEL 3D2UD 1LO0L 5BO1L 3IU4L 1ZVHA 1W8OA 2F5BH 2IANB 2VTFA 1L9NA 1TNMA 3V52H 3V4UL 4M6NH 2VWEE 5A40E 5D7LB 2ZCKH 4PJDF 4OTXH 5FEBA 3MLSH 2GTWB 4GMTH 4P2RD 4TQEH 4KJPC 2F54A 4G42A 4RFOH 4X5LA 1JGUH 2JJTC 2JE8A 2Y06H 3AU1A 4EN3B 3SGDH 3BPLC 3MO1A 3B2VL 4IIQA 3V6OE 4JHAH 1R0AL 1MEXH 1AC0A 2JJUA 3MRFA 2GEEA 5E8NB 3GJFH 3WIFB 2P8PA 1JN6A 2EDDA 2P8MB 3B5HA 2D7QA 1MNUH 1IGFL 4G8GA 1FL6B 3OGCA 4QCIA 4KZEH 4N8VG 4K7FB 1D9KC 1XCQA 3QI9D 4C56B 5IQ9A 4M1CD 4LSSH 3BGFC 3W9EA 3L7FB 3DXAE 1OP3H 3OAYH 3TIDB 4ETQB 4X7TB 4UV4H 5HGDB 4Y0GA 5LGJA 5GGQL 3IFPA 2DI7A 3RVUC 2ORBH 4R90L 4PRDA 3MUGA 4M6MH 1XGUB 2GFBA 3JTTB 2DIJA 2EDYA 3H42L 3MRIA 4JKWA 5D2NC 4CADA 4HZLA 5L2KB 2BVUA 5A2JH 1XGTA 3GFUA 3CU1A 5I75C 3GUTB 4OF6A 3NTCL 3QXTA 4XX1E 4ZG1A 1I3VA 4C83A 2Q86A 3ULUF 1CS6A 5D1QA 5IGXH 3H9YA 3MV8D 4HK3N 3DV6B 1AGEB 5GGUB 1T2XA 1IEAB 3O3DB 4U31A 4ZPTA 1KN2H 4UTAL 4LAJH 4FQQA 1PYWB 1CR9H 5DDHB 1KT2A 3WJJC 1WUNT 5I1AB 4KVNH 1MREL 5D2LA 3FCTA 2N7BA 5IB1B 4KJWC 3PGCA 1MHEB 4OD1L 5DK0A 1MJJB 4MWFB 4CVZB 2DLEA 4ZFOB 4NRYA 5EG6C 4YX2L 2CKBH 1IE5A 1E4XH 1VPOH 4N0FA 1WCBB 1WICA 1WWCA 4XC1H 2I26N 1MAKA 3C6LB 1LK2B 3O2WL 3FQUB 1I3RB 2XZAH 5DHVA 3D6GA 5DJZB 3O8XC 3U36B 2HWZH 4Z78A 1J88A 5DURD 4RFNB 4ODVL 3QIUC 3LRSA 5CZVH 1U92A 4HCRH 3GMRB 1JGLH 3IJSA 4U1MB 4P4KD 3N0PB 1MFDL 2XQYG 3BESR 5JW4M 4UQ2B 2PW2A 1PDKA 4KKCC 2F58L 4W70A 5INDA 3BKMH 4NIKB 4ZUWA 3WS3B 2DOCA 1FFPB 1NPUA 1W72A 5A3ID 5ITFA 1I8IB 3T8XA 1XGQB 4AEHL 2LU7A 3BSZH 4M6OL 1T1XA 2DJUA 4Y7MA 4K3HA 4WU7A 3IKCA 3QUZB 5DC9B 5HY9A 1CE1H 1U91A 5D70L 3FZUC 3QNYB 5FCUH 4MMXC 4YQXL 2DRUA 3U82B 2LFGA 4CNIB 4DN4H 3RKDD 4X4YB 4Y1AA 2ZG1A 4OLZH 5KSUB 3BPCA 5I73B 4Q6IC 2AW2A 1HIML 1HOCB 5C6PB 2ZCLL 2Y25A 1KXVC 4P2RE 5DFWH 5I1IH 2B0SH 1YNLH 1KJ3H 3P9MB 4Z7WF 2Z31A 1AO7B 1TVBB 3DUHA 4DZBB 4FXGB 3EYQC 3RUGE 2IPUK 5J13C 5J06A 1IGIL 2ARJB 1EFXD 1ACYH 3C5ZB 2P43B 4KTEH 2VLKB 4G6ML 4HS8H 3CXDH 4P23D 4GAJH 3RDTB 4XVUD 3TC9A 1CFVL 1QR1B 4X6CA 3D39D 3FT3A 4NKOA 5D7IB 1GRWA 3Q5TA 2ADFH 5F88A 3GJFB 2BK8A 3VXUD 2H45A 2VN7A 4FFZL 1CLYH 3PL6A 4IHOB 1WAAF 5D5MA 1PLGL 1QSFB 1MVFA 4UILL 1PY9A 3G6DH 1X7QA 1NANI 1OF2B 5BCAA 4K55A 4RAVA 1XGYH 3P4MB 2J6EA 4XNMB 5C0JB 4XPAL 3ARFB 2MMXA 5IHUL 5D7JC 1MRCL 2AXJA 2R23B 3T3MF 5DEZA 3V0AC 4KVCH 1OTUC 1GHFH 2EE9A 3QB7C 4G43B 5F3HB 4EIZC 2HKHH 3ZMRA 4FABL 1FZKB 2P5WD 4IRZH 1G6RA 5F1KC 4TVSa 3TZVA 1DQJB 4U1SB 1J1XH 4M8VA 4L8DB 3IDYC 3MV8E 4H25B 1NFIB 4PJGE 5HVWA 5FA3B 1S5IH 3DVGB 1U93B 4ZYKB 5IMKB 5FYKH 4X6DE 1DDHB 4HWUA 4HC1L 2EC8A 5DJ8A 2DTSA 3H9SB 4X99A 4TULH 4X4XA 4G9DA 1H5BC 3PV6B 4XP4H 1TZHA 1C16A 4OD2A 5ESAA 4GMSH 1A7QH 1GZPB 2DL9A 1KCVH 4GRWH 1UA6H 3UPRA 2V17H 5MP6H 1C5CL 5I30L 6CGTA 5TE4H 2BXZA 2P1YA 1OVZA 4JB9L 2APWA 4G80B 4KI5E 1BREA 4X7FC 2DLTA 5T5FH 3GO1L 4GRLD 4P5TA 5DHVH 3MRBA 2GTZB 2CKBB 3O6FA 3X14A 1NGYA 3EFFB 1JPFB 4KKAD 4LVNC 1MI5A 1SBSH 4H5SA 3QEHA 2LU3A 4OFKA 4LCUA 1QACA 3C8DA 5JO5A 4ENED 3BP5B 2ICWA 4ZNEA 4NJAH 2J4WL 1CFSA 1Z3GL 4YFLF 3TJEH 5AAWA 3N9GH 3BIAX 5DQJB 2MCPL 4P2OB 5HXMA 3FO9B 1YUHB 5EUOF 2A2QT 4J8RB 4YXKL 1I9EA 2JF1A 1W72H 3BGMA 4K94H 4LLWB 1OGAB 4F3FB 5I1GL 4Y16A 1KCUH 5I2IB 2ENYA 3C09B 5EBWA 1KB9K 1UWXK 2VDNL 4MJ6A 4A6YL 4NQCA 3N50A 4GG6A 3BHBB 3T2QA 5E00A 1N0XL 1U3JA 3L95B 3RVXD 1C12B 2DWEA 4JDVB 3QIWA 4WHTA 3WFEH 3MODH 5F1SA 1IKFH 3IF1A 3G6AA 4UT6H 4DFHA 4X9HA 3VXPA 3K4DA 4LKCB 5ICZB 2R9HC 3DYPA 3VE0A 4GBXA 3DV4A 4YDIH 2HT3C 1FC1A 5GJSL 2VR5A 2EO1A 3CFJA 2FLRT 3UZEA 1JHKL 3ZHKA 5LCVL 1Z9LA 3E3QE 2IGFH 4WJ5A 3F12A 2F54B 4G42B 4W4OA 1FVDA 4WUUD 2DLIA 4HK0A 1L9MA 3D39E 1GC1L 3MO1B 3WBDA 3QQ9C 4IIQB 4K8RC 3MZGB 3RIFF 3S37L 1IFHH 4NQDD 3VXUE 3MRFB 3WNOA 1YMMA 4KJYA 4AIZA 2P8PB 1JN6B 3KVQA 5LQBH 4FTVD 2XIDA 1T04A 1PY4A 3LKRB 4G8GB 1CD0A 4QCIB 1FGNL 4QRPA 2R56H 3HB3D 1BFTA 1Q72L 2ZPKL 1FSKC 2J6EH 2XYCA 5TPWH 1XCQB 1JWUA 4FXLA 2HP4A 5FF6A 3G6JA 3W9EB 2J5LC 4OV5A 4ZD3L 5DR5L 3SPVA 4QO1A 3WUZA 5LGJB 2D9CA 3UDWA 1A8JH 1CFBA 5DTFB 4PRDB 2VSDA 4QHMA 3MUGB 3WNPA 2GFBB 1I7TA 1IQWH 1IGMH 1RUAH 1G6RH 4H0IA 3MRIB 3V4VH 3ARDD 1REIA 4CADB 1XGTB 4IMKC 4BZ2H 3ILPA 4OZHF 1GJIA 2DI8A 1IZJA 2ZOLB 2BFVH 4NN6C 2H1PL 2JCCF 3I84A 3WUWG 4C83B 2BVPA 2Q86B 2VISA 5D1QB 3ARQA 1KIUA 4K7PL 3V4PH 4FQCH 4P2YA 4JO2H 2VWEC 4JO3L 5AD0A 4ONFL 3GI9H 3IRZA 4P9MH 2OX5A 1AR1C 3NZHL 3NMEA 3TCLA 5FGSA 4U1NA 1G9NC 4ZPTB 3NIGF 4PJIF 2X89A 5AWNH 1KT2B 2NX5A 2G5RA 2R2BA 4UNVA 4PLOB 4LASL 5D2LB 3FCTB 4I0PC 2EE6A 1AIFA 4O51A 4HGKC 5DK0B 4GRWB 4NRYB 1U8QA 1LD9B 1CZ8H 2B5IB 4N0FB 4P59H 4PJXE 2FGZA 1YN7A 3NACL 3RRQA 5BV7C 4EQ2A 2X1QA 5DHVB 1MCDA 2HYMA 3MQIA 1RIVL 4Z78B 3LQAC 4S1DC 1H3XA 4FZ8L 3T65A 3QEQA 3LRSB 3NZ8A 5LBSH 4P57A 5LAXB 1L0QA 4DGIL 1U92B 1LE5B 5DZOA 3IJSB 3QXWA 6FABL 3HCVB 4LCWD 1PQZA 4NZRL 3ZKQD 2CLRA 3KPSD 2Q76B 2PW2B 1T0NA 1HSAA 3VFMA 1MFBL 2YPLA 2W9DH 3N85L 4ZUWB 5INDB 5EIVA 5GQBA 4YFLI 4BFIA 5LWYL 3RZCD 1A6WH 2E7LA 3SE3A 1W72B 3LN4A 4KRMB 3BZDA 3UTSD 4HWEL 5ITFB 1F4WL 1B0RA 4YC2B 3VXRD 3QFJD 3OJDB 4B7LA 3T8XB 4GKSB 4TSAL 3HE7D 1CQYA 1J7VR 3CLEL 3KJ4B 5GZOD 1T1XB 2KQNA 2WUCL 4WU7B 3LEVH 3HI1A 1J8HA 2A1WH 3GHBL 3IKCB 4XCFL 1KCRH 5HY9B 5DD6A 1U91B 1FNLA 3U7WL 5FXCH 2C3VA 4Y1AB 2NY4D 5HHXL 1EAPB 2IH3A 4NWUH 5C08D 3BPCB 2BY2A 4RGMC 3ECBA 3W82A 4HKZB 3RL1A 1YNTA 1QA9B 3K46A 3RAJL 4LARH 4M4PA 1NUGA 3BWUC 4Z95L 4U4BA 3TYGH 3GMMA 1TCRA 3MX0A 2NXYC 5EU7E 5I1CL 3MOBH 5J12C 4KQ3L 4LPTA 2Z31B 3BMVA 4WUUE 5F9OL 5SX5K 1FV1A 5F7WC 1NGXA 5KANG 4R6UA 4WTZA 1TQBC 2E7MA 3F7VA 2W65A 4K9EL 4FTVE 4PYGA 4RWYL 2MNUA 3V7AE 4PJ7A 4MCZA 4RX4D 5DYOA 1IC7H 4X6CB 1CGSH 3FT3B 3RVVD 1G7IA 4PJ9D 4NKOB 5ISZA 4PD4J 1FC2D 5MERA 5GGTH 4RRPA 5F88B 4PJCF 3I02A 3PL6B 1X5JA 5I17A 5D5MB 5DXWA 1H8OA 3VD4A 2NYYC 4MB5A 3QDHA 1X7QB 1MPAL 3EJZD 4OD3H 2A9NL 3ARSA 5F6HI 1GAFH 4PJ5A 2O26U 1BIHA 4PJ8B 4S1QH 1HKLH 3OPZH 3OTTA 4DCQB 2EEAA 5A43C 4MJ2A 4MAYD 2Y36H 1MJUL 3IFLL 3U7YL 4YDVA 3VWKA 2V5SA 1QRND 3UYRH 3MNWA 2CR6A 2QADD 1ZLWK 1G6RB 2FGWH 5C0GB 4KI1A 3DI3B 4KZDL 1BQUA 1IGTA 2QJDA 5EO1A 1GOGA 2HMIC 3KLSA 1NCAL 4PV8B 2DQJL 1IKNA 2J3SA 5J4MA 1T4KA 1RULL 4KDVA 5DJ8B 5C0BD 1Q9LA 3EYSL 2XWJA 2AEPL 4X99B 4OCRL 2HLAB 4QXTA 4X4XB 4G9DB 1NAKH 1TZHB 4YO0A 3UJIH 4H88L 1SEBB 3MACL 1C16B 2RCSH 4OD2B 5SX4I 1UZ6E 2YPKA 3UPRB 3HUJF 5T33L 4CRPA 4JZJB 1UJ3A 3UX9B 1T1YA 2JELH 4NKDB 3T4AA 4HX1A 5AYUL 4DKFL 2D0FA 2JIXD 2GI7A 4KMTL 4J3WA 2NY6B 4APQC 3KLHC 1KJ2L 2QBWA 4I4WA 4P5TB 4CMMA 3MRBB 2R4SH 5K93A 3BIKA 1LK3L 1SJEA 3O6FB 4M62H 2DM2A 4FQHA 3IDNA 3X14B 4LSQL 4NZUH 5DK2A 4PTTA 1MI5B 4H5SB 2QEJA 3QEHB 1YECL 3EFDH 5JO5B 2PYEE 2R0KL 3AMKA 4HJGA 3KPSE 1LP9E 2JKXA 4PJBF 1CFSB 5D7SL 3IT8D 4HHAA 1URLA 2A6IA 1EO5A 2ZUYA 2Y6SC 4NBZB 4OIIL 4J4PC 4LCIL 4UNUA 2ZUSA 3UTSE 2YUZA 2E9JA 2YHGA 3BGMB 1U3HD 3VXRE 2XACC 2FEDC 3QFJE 4NPYA 2C4FU 4Y16B 5ID0A 1FYTA 1DEEA 5EU6A 1V7NL 4GS7B 1I1AC 1BPVA 4LHUB 3OXSA 4MJ6B 3MLYH 1HE7A 4NM4H 4NQCB 3O9WA 4OCYH 2PKDA 3ZE2F 1IM9D 1A64A 2X2YA 4M5ZH 3SDAC 4GG6B 5E00B 2WQ8A 3E6FA 5DD0H 3WNNA 1E28A 4GT7A 5KSVA 3WFBL 1EDQA 3K81A 3MRQA 2K3TA 2DWEB 1H3UA 3CFIC 4MD5A 4UBDC 1BFVH 4WHTB 5C08E 3CVHL 1PG7W 1RZKH 1CDYA 1A7BA 2F5AH 3MLRH 1PJ9A 4UB0H 5F96H 2WWMD 3NGBB 3IF1B 3G6AB 3O6KL 4HW6A 3VXPB 5SWSD 2C1PA 4MGXA 3D3VD 1I3UA 4PG2C 3VE0B 4GBXB 4PJDA 4NRZA 3DV4B 1LEIA 1DBAL 3EDFA 3CMGA 5CFHA 4N1EA 5T1LD 2I24N 3CFJB 4U7MA 3ZKXB 1VHPA 3ZZ1A 2CMRH 4YBQC 2H32A 4KI5C 5F93C 1RJYA 5KZCD 4WJ5B 3ZYIA 3F12B 1UWGH 5C70A 1FVDB 4HK0B 2JB6A 5IVNA 1EAJA 2VDPH 4DW2H 4X6BA 2QQLL 2LTQB 15C8H 3OZ9H 4XPHH 2F53D 5E8PA 3IDIA 2ZUQB 1WIPA 1KTKE 3QCUL 3GSNA 1DUYA 4KHXH 4KJYB 5KS9E 4ZFGL 3NCJH 4AZ8A 3IKKA 1T04B 4EI5D 3TBWA 1J1OL 1WQVT 4QRPB 4WFFD 4ZODA 5TGBA 3GMLA 4YZFE 5D1ZA 2WK2A 1GPOH 1JWUB 5E1HB 5FF6B 3QJHB 3GK8H 4TNWK 1D6VH 1QRNE 1HH6A 4OV5B 4OLVH 4QHLA 1HI6A 2YA1A 4WEMB 1QQDA 3RWIB 1N64H 3NPSC 2VQ1B 5KSAD 4UIMA 1I7TB 2C7UA 3SKOA 4WGVB 3SBWA 5E2WL 2HJKA 1D7FA 4NQVA 1T2QL 4JVUA 1BAFH 4XRCA 4KHTL 2X9WA 4ONGL 2C3XA 1NAMA 5C0BE 1M1SA 4N8PA 2BVPB 1UG9A 2VISB 2EIDA 4Y4FC 3E6HA 2ZOKA 1ZLSH 1VGKA 2N7AA 1K8DA 5IKCA 3TCLB 4P23C 4U1NB 5DC4B 5T5NF 4CN4A 3OHXA 4JGUA 1JWMA 3C2AH 2WWKT 2NX5B 1ZT7A 1WV7T 2R2BB 4GG8A 2O93L 2GSGA 3BP7A