4LU5H

Structure of murine igg2a a20g2-fab in complex with vaccinia antigen a33r at the resolution of 2.9 angstroms
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
213
structure length
209
Chain Sequence
EVKLVESGGGLVQPGGSLKLSCATSGFTFSDYYIYWVRQTPEKRLEWVAYISNGGYKTYYPDTVKGRFTISRDNAKNILYLQMSRLKSEDTGIYYCARGMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A33R
publication title Structural and Functional Characterization of Anti-A33 Antibodies Reveal a Potent Cross-Species Orthopoxviruses Neutralizer.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Immune system
total genus 37
structure length 209
sequence length 213
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lu5H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lu5H01
3IJHA 3EZ8A 1W72H 3SDXB 5HHPB 5C9JB 4R2GD 3QPQD 1UH3A 1GZQB 1S9WA 5E9DB 4XNXL 4Q9CA 3U4EB 4KZDL 4PJDB 1OAYL 1MIEL 3O81A 3OL2A 4LSPH 2Q76B 4X6EB 1GSMA 3LS4H 1UACH 3MRKA 1S7UB 4JRXB 1LDSA 5EFIA 1BIIB 1LDPL 4E9LA 1PQZB 3H3PH 4HG4J 2JJTA 2I9LB 1MQKL 3CUPB 3LN5A 3NCJL 4J6RL 5T5NG 2OR7A 4KJYA 3GSXA 4LLQA 5CD5C 1CXLA 4JRYB 1UCBL 4YXHH 1EMTH 4Y89A 4ZUVA 1ZMYA 1MUJA 1FNEA 5GISH 1G1YA 3QCVL 2I07A 4KV5E 4NDMB 4MNQB 5GRZA 5EOQL 4YO0B 4WNQA 3I2CL 1OD7A 4PV9B 1D3CA 1ZT4A 2EDTA 3ZT7A 4KRPD 3ZSSA 2DQTL 1FL5A 5CMAA 2R23B 3VI3E 4JZOA 4EJ1C 2RQ8A 4OD1L 5K9JH 4OFYA 1N5YH 3VFRA 1H15A 1D6VH 5JR1L 3QWQB 4XH2B 4PJEB 4F33A 2MPAH 3NA9H 1NL0H 3SDAA 3BX7C 5IMOB 3T65A 4MA8H 2VLJB 2NX5E 2YXFA 5DK2B 4H20L 4LCYB 2BVUA 3HUJF 2QV2A 3FJTA 3QPXH 2FBJH 4HLZH 3FQUB 5INDA 3D39B 5DJ2B 5KVEL 4Q6IA 3PIQA 3VWJB 4DVRH 2JJTC 4OGAC 5J9PA 4X8JA 4ZFZA 3MQIA 4KK9C 2O93L 3OKOA 4OZHA 3CX5K 5I17A 3G6JF 4J4PA 4K23H 1NDMB 2FL5A 2XKUA 3B3IB 3SHSA 4M7ZB 1LE5B 3HFMH 5HI4D 1M6OB 1H3PH 3NCCB 5IVXE 2R56H 5J6GA 1U3ZA 5J1SC 4OCXL 5I15L 3UTSE 1A6VH 5EC2B 3O2WL 3T2QA 1F4WH 3P4MA 1JHTA 1MHPH 1T3FB 5ALCL 4O2CB 5D1QB 5DRZA 4HH9B 4FQJH 3O0RH 3Q5OA 2XT1B 3I6GB 3VRJA 1F11A 5E1HB 4ZUSA 4EDWL 3QUMB 4S1RL 3TC9A 3SDAC 1Q0YL 2BFVH 2ILLA 1ZHBB 4X98B 1GRWA 5F7DB 3KXFD 1DEDA 2IG2H 4F58H 3QUXB 4F37F 1CBVL 3ZE0F 2ZUYA 3DUUB 2J88H 2C3XA 5F7HA 12E8L 1S7WA 3EHBC 2CKBB 1G9NC 1IARB 3S5LG 3QA3B 2EH7H 5IEKB 5BQ7A 2PCPB 2KZWA 1F4XH 2VITA 4Q6IC 2CRMA 3BEWA 4M8VA 4RMUA 3NFNA 5KVFL 2NPLX 3DUHA 1GYAA 3A6BL 3I6LD 4OGYH 4AQ1B 5I1GH 4J4PC 1IJ9A 4A6YL 4X9GA 1HWHB 2GY7B 4MCZB 2JIXB 5FCUL 2BVEA 1G6RA 1O7VA 3MODL 4WTZA 3TVMA 4E42A 3P2TA 1WK0A 3SE4A 1BLNB 1CGTA 3MBEA 1OAZH 2Y07L 5D2LA 4FRWA 4KU1A 3O2VL 2YWZA 1I1FB 1VADB 3RWGB 2GSIB 2OJZH 4LEOA 3MLYH 3MV8D 5BRZE 4GRMB 2R29L 4Q0XL 1JWUA 3N85L 1R5WB 4Y4HA 3WFCL 5ADOH 1LILA 1ZTXL 5EIQA 4P3DA 5I16A 1MCRA 1X6LA 3QDME 3QHFH 4EN3B 5CCKL 5GJSL 5J6HB 4JCMA 3DSNA 4EVNB 1MPAL 1P6FA 2CDGA 4JZJB 3HAEG 1UKTA 2PYEB 5EZOH 1G7IB 4NJAL 3M07A 1L9MA 4F2MA 1KTKE 1J0HA 1KELL 1PVHA 1PY4A 2I26N 4OFPA 5HDLA 5C6TL 4KVNH 3DUSB 1MCCA 2Y5TB 4LLWB 3BZ4B 5EBLB 4LAQL 4XHQA 4DK6A 2E6JA 2ICWA 5JMOC 4M7LL 1UVQB 4P46A 1KENL 3DVNA 2GJZA 1EGJH 4JREB 1RZ8B 3HR5A 5JQ6L 1DQQA 3TH4T 4U7MA 3SKUD 3WE6B 1J0KA 5HTSA 3BJ91 3TVMC 4GKNA 3KYOA 3SE4C 5JMRA 4RZCA 4W70A 4X9IA 3MBEC 2PUQT 1SJHB 4X4XB 2Y6SC 2VDLL 2EIZB 1RUQH 3C6SA 3VDBA 1V3LA 2VLKA 3EO0B 4OLYL 3ZKND 3MPCA 3TBSB 5IKCA 4Y4HC 4JJ5A 1MI5A 4L4JA 2V5YA 1JGLL 2IMNA 2Z8VC 4HSQA 1Q9WB 3LPWA 3L3KB 2BVQA 4YBHA 1B90A 1KCVH 4YQXL 1PKQB 3VXNA 4PJCE 2VLRB 5I1IH 4NQCE 3MMEB 1QEWB 3O8XA 4XBGA 5J3HC 1J5OH 1OAKL 4RX4D 5FO7B 4JFFD 2E7CA 1FL3A 3VW3L 4ZYKA 3PG2A 3RU8H 3PQYA 4NRZB 4RRPG 5E56A 4XPTH 3BIKB 3RVUD 4Q9QL 4BUHA 4IOFC 3GKWH 4P2QD 3I6KA 5D7JA 2YRPA 5E6ZA 5LBSH 4PRIA 4OAWA 5HDQL 3QQNA 4U6VH 4P46C 5LGJB 2CRZA 4NFCA 5IMMB 4NGHL 3REVB 2BMKB 3W11C 4LLYB 3L6FB 3P30H 4NT6B 1WFTA 5CILL 4FTVB 5C0AE 5SWZD 4ELMF 3QZWA 1SY6H 4DEPB 5E5RB 4A6YA 3ARED 5E2TH 3CXDH 3EYUL 1FPTL 2VC2L 2ZKHH 4G3YL 3DRTA 4AENB 3VXUE 2HJFB 4FOMA 2FATL 4Z8FH 1JPFA 4G8EB 4OBRA 3T1WA 3IXAA 1KCUL 2E9IA 1IVLA 1VPOL 5DC0A 1U6AL 3NCEB 2Q86B 3NGBC 1A1MA 5T1KB 2DIAA 3E6FA 4TUJA 5DWUH 5I1HL 4HUMB 3U9UB 2R69L 4NNYA 2EEDA 1FIEA 3IJSA 5DGRA 5EOTB 4ODHH 3UTZB 3JXAA 3TIDB 4S1SL 1DFBL 1I3GL 1EAPB 3O8XC 4Y4FA 3MZTA 4U05A 1UADC 1NBYB 3KPSB 4L1DA 4JKKA 2B1HH 2ZJSH 2EYTB 3LRGA 1I1RA 3PHQB 3OKYA 1HCVA 5C9KA 4MAYA 3NCBB 1I8IA 1J11A 4L3EE 1ORSB 1OTSD 5BOZG 1J12A 3FO9A 5DQDL 3X12B 1X5HA 5D7JC 2UWEE 3D3VA 3MV9A 2AQ1A 1FG2B 4Q2ZA 2E7HA 5F6HJ 2D4FA 2KKQA 5KVDL 4NRYB 4NZTH 2LV4A 4MMXC 2NY2B 3S8WA 5TPWL 1B4JH 2X09A 5EBWB 4UOJA 1WFOA 2I5YL 2RFXB 3LD8B 3QDGE 3DTXB 4LPTA 5SX4I 4N8PA 4WDIB 3VXSE 3SKNB 1OP5H 2GJ6A 3U83A 1AD9B 1F4YH 4LF3A 1U8OB 3GBLA 1ULVA 2BVOB 2WP3T 4UUJB 3AROA 5FECB 2XZQH 3U0WH 1IM3A 1JBJA 1H0DA 1ZLUK 5K9KB 1IT9H 4DZBB 1K2DB 4DUWA 3ULVH 4FFYL 1UT9A 2EXWD 4GAJL 5HHMB 1IFHL 4HJGA 2I9TA 4OCRH 1CFVH 4R0LB 5DUBA 2XN9A 3IDMB 3MLXL 4Y4FC 3RVTC 2OTWA 4DWHA 2PTTA 5EN2B 3FFDA 4QRUA 1NEZA 4MAYC 1XCQA 4X0KB 3MYJA 1CGXA 2UZYB 2OM5A 4PJ5E 3S37H 1JGVH 4GAFB 1KT2A 4K8RH 3MGTA 3QXDB 5C0FA 1EEZB 1BIHA 4ELKA 1BEYL 2NY1B 2ESVB 4XP1L 1AKJB 4PB9L 2CDEB 5AD0A 1ZGLM 5CIPH 1CD1A 1WAAA 4YAQA 3MA7B 5L8JB 1KIRB 2YD5A 2X70A 1HIMH 3TJHD 3GSNH 3T1FA 4IRSD 4MGXA 3IKKA 2WQ8A 4EUPB 1M05A 3QG6A 1R5VA 4N0YL 3MO1B 1YUHA 1D5BA 3QNZB 5C0CE 4CMMB 5DJYB 4G8IA 4OD3H 4CKVX 4HFWB 2HVKB 3D85D 1BFOB 1J88A 5T5NF 1XGQA 4FNLL 3CLEH 1DUYB 4MQ7B 1D9KD 1NCCL 2DLTA 5IQ7H 1I1AC 4J1UA 1ZA6B 4C4KT 4XPFH 1A1OA 2NY4C 4HCRL 2EEBA 3FFCD 1C8PA 1F58H 1BGXL 3MRLA 3MXWH 1R0AH 5KANG 3QO1A 1DN0A 1XGPB 5I74B 4JR9H 2BHZA 2DM3A 5E8DL 1PG7H 2JJSA 4I18C 2Q7YB 1KTLB 1YY8A 5JIIA 5B39B 4ZXBD 4PGDA 1NMAL 2PNDA 2E7BA 1RZGA 4PP1C 4ORGA 1BAFH 3GUTA 1DLHB 4QRRE 3CFKB 3UO1L 2V2XB 5GRVL 3ROLA 4TQEH 4G7VL 5J11C 3HG1D 4TSCL 4W6WB 1CE1L 2R0ZH 2DQUL 3FT2A 1NMBH 4OZGE 4RGOH 5I1CH 3BE1H 4E41E 4YHMH 2NR6D 1NJ9A 2H2SD 3EGSB 1ZGLA 5HHQA 5ID0A 3KPMA 3FN0L 1NQBA 5H2BB 4OLUH 4OZIA 4ZD3L 1FO0L 3EYVA 3GJEB 3O3AB 2JKXA 4MS8C 1VCAA 2XFXB 5JW4Q 3MRJB 4XNZB 5EORH 4PJIA 1K9TA 4K94H 4XPGL 4WU7B 2VE6A 4RIRA 4TNVK 1OARL 5I76A 2SEBB 1HHIB 1T6WA 4M43H 3ULVE 4D9LL 2FJFB 4OT1L 1TJIH 1T5XA 3OKLB 5IMKB 2NY0D 3K4ZA 5SX4H 3VFPA 3SGJA 4H88H 2JJSC 3V7AE 4KGJA 3PWVB 4K7PH 1FIGH 4P2RE 3C5JA 4L4VB 3LV3A 3O4LB 1A7QL 5IM7A 1K4DA 4R3SB 3F7VB 1EZVX 1A7OH 3VD4A 1EZVY 1FE8L 4QOKE 4QXGH 3WFHB 1AGCA 5C0NC 3HC3H 5I71B 3FB6B 3TBTB 3RKDC 4I5BA 2P24A 4QTIL 1QR1B 3KWWB 2CIKA 2Y23A 4G43A 1TVDA 2VAAB 2HT3D 1HQ4A 2LTQC 4IJ3C 5JLZA 1LO5B 3R0MA 2GKIA 3ELAT 1E6JL 3IJHB 3S3JA 4KI5E 2Z8RA 4JN2A 4UOW1 5JORA 4N90D 1ZGLP 4EXPX 2VDKH 1H8SA 1S9WB 2GUOA 2J6EL 4Z7VF 3KPRA 5D8JL 5J56B 3JVGA 4ZTOH 5C92A 4DKFH 3AM8A 4MA7H 2UYLB 5EFIB 4XCFH 3RAJL 4HCRA 5DD0L 3MACH 3LN5B 5EZJA 4NQEE 3GSXB 4LLQB 4POYA 3VA6A 1B0RA 1X5GA 4ZUVB 1AE6L 3SGJC 3DO3A 1JRHH 1YEDA 1AHWB 5IK3A 1MUJB 2P1YA 3RDTA 3VH8A 3F58L 5FYJD 1FNEB 4ALAH 5IEHA 4N0FA 3RL2A 2BOCA 3MRHB 1AGDA 4WNQB 2RIKA 3OAYK 4PJ7F 1HHJB 1ZT4B 4AT6A 3AMKA 2Y36H 3UTTB 4OD2A 5CMAB 5CD3A 3V6OA 5GS0H 4JY5H 2F5BL 4DAGL 1ZE3C 3VFRB 1KJ2L 1H15B 3PV6A 2BOBB 3MOQA 4F33B 5JA9A 3SDAB 5TDPA 2A9NH 1I3VA 3VXPB 1FORH 2OBGA 2D3VA 4HQQH 4KMQA 1GPOH 3LQAC 4BZ1L 3TJEL 3QEGH 4G6KH 2HTLC 2E27L 2XNAA 5F88A 1AFVH 1FO0A 2YN5A 3JVGC 5T33L 2EDQA 1TITA 4YK4B 1ZK9A 5HDBF 5C07A 5INDB 3AM8C 3ULSA 2WLZA 1RVFH 1XZ0A 3PIQB 1P2CA 4HLJA 5AYUL 4JB9H 5J9PB 4OLZH 4X8JB 5GHWL 5ALBH 1EJOL 3R1GL 3OKOB 2H32A 5I17B 5E9DD 2FWOA 5L9DH 5F1KC 2IAMA 4DN3L 4HJ0C 4M62L 1NKOA 1IC5L 4WEBL 2FEEL 5IG7A 2BY1A 2IANA 3KYKL 4JRXD 3SDDD 1FCGA 3P4MB 1JHTB 3O4OC 1TENA 3IVKA 3KHQA 5DRZB 4E5XB 2R1XA 2R1YA 4MJ2A 1FYTE 3RVXC 2XKNB 1NCDL 3V6OC 2F19H 5JXED 1W0VA 4ZUSB 3GMLA 2ADJA 2RJMA 4QRPE 4UU9A 4NO2A 5JIPA 3PDOB 4Z76A 4MNQD 1T2QH 4P2CG 2J8HA 9CGTA 4G8GE 5BOPA 3QYCA 5DURB 2A9MH 1MRDL 5FGRA 1YNKH 1PFCA 2A6KA 5JHLH 4PJ9A 4X6CE 3U46A 2J6EA 5BQ7B 2H41A 3Q5YA 5SX5H 2BC4A 1T66D 2VITB 5DJ0A 1U3HA 2JB6A 1YEJL 3EJZC 3FAWA 3X11A 5FDWA 2P8LA 3BEWB 3NCYP 1OLZA 1QFHA 2VLJD 3NFNB 4EQ2A 2IADA 3QO0B 4NQDB 3KJ6H 1ZV5A 3N1QC 4JFPB 1OP9A 5DGQA 4YHZL 3B2UD 3TVMB 3D39D 4E42B 4PUBH 3UTQA 2DBLL 4JVWA 1B2WH 4J3WA 5D2LB 5JA8B 3VWJD 5JXAH 5I0DA 4MVBC 2OCFD 1LO2L 4TVPD 4Z7WA 3W9DB 5A3ID 3WFBH 4LEOB 1JWUB 4QWWD 4Y4HB 25C8H 4P3DB 2YRLA 2YA1A 5I16B 1KJ2A 4U1JB 5DI8A 3IFOA 1W72L 1JWMA 5HYSA 2MQCA 2CDGB 4R90L 5B4MC 2VZUA 2Q3AA 4HBQA 5D1QD 3P11L 5KG9A 2AJSL 4B53A 4LPWA 5D7SH 3B8SA 4PJ9C 5IVOA 4LSPL 4WW1A 1UZ6F 4AG4L 4ZODA 4F8TA 1KN4H 3NIDE 3QWRA 4PJBF 1U3HC 4P46B 1WCQA 4OCYH 4WEUD 2AK1H 4O4YL 3DVNB 4YXHL 2GJZB 1V3MA 3HR5B 3TO4C 2QEJA 3EYQD 4NNPH 1P7QA 1DQQB 2CJUL 3RY6A 3JWDC 5GISL 1GC1H 4D0CA 2NZIA 3EOAA 3GMPA 3IDGA 1IGCL 4RZCB 4EUPG 3F7RA 5ID1A 1J10A 4P9HC 4M4PA 3T0XA 3OF6D 1KCRL 1QLRB 4HK3N 3VG9B 4MAUL 3C6SB 4LVOC 1AGFB 2A1WL 3MRBA 3NGBB 3MV01 2ZOLA 4C56E 1JGUL 1D6VL 5IKCB 3BGMA 4FQIH 4JJ5B 4F7PA 1MI5B 2DWDA 2BY3A 1NL0L 2JIXD 2MPAL 2NX5A 3MLTA 4ESKA 2BVQB 2RR3A 2ZNWA 3HI5L 3FT3B 4MA8L 3VXNB 3KVQA 2NTSP 1U41A 1IGTA 4TUKL 4OFVA 3O3DB 3O8XB 4XBGB 1H3TA 2XPGA 2NQCA 4PGJA 2QKIA 1NUGA 4U3HA 1SJEA 2FBJL 4BUGA 2HFEB 1JV5A 4J3SA 4RFNC 2NY3C 4EN3D 3I6KB 4DVRL 4PRIB 3RPKA 3BVNA 3EOBA 1YEFH 2ARJQ 1MCPH 2PYED 4GQ9L 4UIMB 4WJ5A 2D7NA 1F6AA 4L1HA 3UTSA 3HFML 1H3PL 3JUYA 3R4DA 1YNTA 3RY6C 2YUXA 3G08B 1A0QH 5F7MC 1IEBA 1A6VL 1F4WL 5DJ8A 4KGLA 4LQFH 3DRTB 2NXZC 2VR9A 1Z2KA 3T0BA 1JPFB 4PJ8A 3IXAB 4WFFE 5ICXA 4M7LT 1MQ8A 3SBWA 4BH8A 1BFVL 2ATKA 1A1MB 3QQ9D 2Y9RT 4TUJB 1WC7B 5GZND 2R8SL 2MJWA 4BFIB 2BFVL 4ZNEE 3IJSB 3U2SA 3HZYB 4HV8B 4F58L 3DARA 5E5MA 2BERA 2L7JA 2J88L 2LU4A 2AJVL 2XXMB 4Y4FB 5L2KB 1LEIA 2JF1A 4NBXB 3TPUB 3PGCB 4LVNB 3T0EE 1YECH 1I8IB 3NMEA 1F4XL 2X7LA 5F7YC 4JVUA 3MRPA 5JIHA 1DEEA 4PJXE 1MIML 4RMRA 2VLRD 4V2BA 5C0EA 3D3VB 2VDNH 5KZCB 2BP3A 4AK1A 4OGYL 5J1TC 3BW9A 1EFXA 3AB0C 3BFOA 3WLWC 3MBXH 4K71B 3U7WH 2VDMH 1EUUA 5CJOH 1TPXB 5BRZA 2GJ6B 4NPYA 2GCYA 4LF3B 4PJ8C 3C87A 4OJFL 3MLYL 3SBWC 2WUCL 3QDMA 1I85A 3PWLB 3X17A 5ADOL 5CGYD 4FTVD 4PJAE 2ZG1A 3QHFL 1HSBA 1KN2H 1X6NA 4XNUH 3GSOA 2HH0H 1F90H 5E2WL 4HJGB 2I9TB 1G9MH 3BIBX 4L8DA 5KW9H 1LD9A 2IH1A 2NY4B 2DLEA 3WD5H 2OTWB 4KVNL 4J2XA 3THMH 2PTTB 1OGAE 2ICEB 3FFDB 4QRUB 1NEZB 5T1KD 2NMSA 1WZ1H 4M61A 4WFEE 3MYJB 3MREB 1HCFX 2OX5A 5I1LA 3JTSA 1DQML 1XMWA 4HDIA 4HGWA 3D0LA 2FX7H 1QQDA 2F15A 1RULL 3OKNA 1EGJL 1QKZH 3B9VA 4YPJA 5C0FB 3KPSD 4ELKB 4F57H 4X4ME 5IESL 5AD0B 3RJQB 5J11B 1CD1B 3KPTA 4PJHF 1KGCD 3WFDH 3MLVH 3BH8A 4XCEA 2X70B 1I7ZA 4WWID 4QXTA 4F9LA 4ERSH 1NLBH 2IMMA 1M05B 4MMZC 3QG6B 3GSWA 5ERWB 2YPKA 1RUQL 3GI8L 1R5VB 1I85C 1D5BB 4NO3A 2NY2D 2DIJA 2NNAA 1FAKT 5DZNA 2HT4C 3QXAA 4PJCA 4YGVA 4NQCA 4NYLA 2D7QA 3SKMA 1KCVL 4XP9H 2HFFA 2NY6D 3S88H 5I1IL 4UT9H 3LCYA 1FCCA 4WI9A 1Q9LB 4J1UB 2D03L 2FEDD 1A1OB 1A2YA 1QOKA 1PEWA 2JK5A 1V7MH 1LO0H 3PXHA 4XPTL 3FB7B 3QEHB 1GGTA 3RBGA 3GKWL 3DV6B 5H94A 4WI6A 2HLFD 3B8YA 2OK0H 2F74B 5HHMD 1IC1A 4PGDB 4FXGA 5KSVA 3IFPB 3FZUD 3L7EA 4ORGB 3GUTB 1SY6L 4LCWE 3ROLB 3VXUA 3CXDL 3MCG1 3FT2B 4OGZA 4Z8FL 2K1MA 5DD3H 3MFGB 3MV11 3N50A 2LTQB 3IF1A 4IJ3B 5E8NA 1A64A 1NJ9B 1A7PH 4N0RA 4LBEA 1ZGLB 3G9VA 5HHQB 5ID0B 3KPMB 3PXJA 1XIWA 4KKAD 3DETC 1MJUL 1JNHA 5DWUL 4OZIB 2BDNL 2ESVD 1AKJD 4NN6B 4YHOL 3EYVB 5DRXA 4YUEH 4U3XA 1A7RH 2BSSA 3ARFA 3HHRB 2VE6B 1KIUA 5I76B 3UAJD 2VISA 2B1HL 4L3EA 5BW7A 2ENSA 4UQ3B 4HIEA 1L4IA 4UB0H 1T5XB 3LIZH 2APBA 2UWEA 3VFPB 1S9KC 2X9WA 4QXWA 5FV2A 3BKMH 3FHAA 3MLWL 2X1OA 2YPVL 2YPLE 1RJCA 3C5JB 4WTZG 3GIVA 5I30L 5IM7B 4NZTL 3WIHH 1K4DB 3QDGA 3VXSA 4HXAH 5M95B 5FYKH 2MNUA 3KLHC 2R0LL 1AGCB 4MDIA 1KLUB 5DVNA 4NZRH 4R4ND 4I5BB 2P24B 1F4YL 2CIKB 2HN7B 4G43B 2BJML 1NEUA 5SWSA 1TQCC 1YPZE 5JLZB 4O58H 3NIGF 1IT9L 4JN2B 5JORB 3FQWA 3SOBH 5CJ5A 3HI1A 3L9RB 3ULVL 5CBAA 2GUOB 3BO8A 1VGEH 4M6NL 5INCA 4LCUA 3KPRB 5DC4B 4APQA 3NBNA 4OLVH 4OCRL 3ARFC 1NCUA 1CFVL 1RFDL 1BREA 3S3SA 5BW7C 4XPAH 5E8PA 3L5WA 3C5SB 1EFQA 1G7QA 4PJ5A 4D0DA 5EZJB 5D7IF 5DJDA 2V2TA 1B0RB 1BJ1J 4YPGA 4ODUA 4MQXC 5FGCE 3VFUA 4PTTA 1JGVL 5IK3B 1W0WB 3FQNB 2QQQA 5MP6H 3VH8B 5H35A 5ACZB 1PD6A 5IEHB 3C8HA 5H8DA 4N0FB 2BOCB 3IDXH 5EO0A 3O4OB 5FYLH 1D6EB 1SY6A 5EH1A 5CD5D 2V17H 1HIML 2BVPA 2BY2A 3GSNL 1PX3A 5GIRA 1I75A 2AXFA 1W8OA 1ZT1A 1JGEB 5C0CA 1UM4L 3PV6B 3LPGA 4ZAKB 2APWA 4L4VD 2GEEA 3O4LD 5TDPB 4M6MH 3P77A 4OD3L 3TIEA 1QBMH 1VFOA 6FABH 4LCCB 1S5HA 2VIRA 2XNAB 5F88B 1HZHH 1FO0B 1NDGA 3CLEL 3TA3B 1WQVT 4APQC 2D7MA 2M26A 4JFDE 1GGBL 5C07B 5C1MB 1TJGH 1AY1H 3FOLA 3ULSB 4XPFL 3G6AA 1F58L 1XZ0B 1TZGL 3MXWL 2EIBA 1P2CB 4YEFA 1JN6A 3KPOB 4Y5VA 1AXSA 1ACYH 2DM2A 4GG8A 4JR9L 1PG7L 2H32B 4M1CC 2FWOB 4OLWL 3OJ2C 3QZWG 2IAMB 3HPLA 4I9WE 3B6SA 1KIPA 4QRRA 1T7XA 5IG7B 2IANB 1EERB 2PETA 1BAFL 2FX8H 4Y5XA 2OMBA 4TQEL 1DBKH 2JELH 3IVKB 1F2XK 4OGAD 4OZGA 2R1XB 2R1YB 3MGAA 2R0ZL 4KK9D 4E41A 3BHBA 1NMBL 4RGOL 1W0VB 3BE1L 4YHML 1MRCH 2ADJB 3GMLB 5FYKE 1U0QA 4OI8A 1NMCC 3RWJB 1M71A 4Z76B 3H7LA 3PE9A 4RGNC 4ZPTA 5DQJA 4J3XA 2MKWA 3UTTD 3ULUH 2ZCKL 2A6KB 4W4OA 1AR1C 5F9DC 4LCIL 4K94L 4OFYD 5LAXA 4UV7H 1WITA 3NABH 2BC4B 4M43L 5DJ0B 3CFBB 3SDAD 1U3HB 2JB6B 5IIEA 1W0YT 4ENEC 3X11B 1TJIL 2P8LB 4K2UL 3LMJH 5DMGD 1TVBA 3G9AB 2IADB 4P2RA 4H88L 3EHBD 4HGKC 1ZVSA 4K3DH 4OV5A 2X6MA 2Z8SA 4K7PL 1FIGL 3FB8B 5TFSL 4QOKA 4G6MH 3WNNA 1HYSC 1A7OL 4PY8I 4Y5XC 4RNRA 5AG8A 2AS5M 1U8PA 3EDEA 4LVOB 2J5LB 4Z7WB 5MI0B 2X41A 4MB4A 2WZPD 4LPXA 1T5WA 5ICZA 1EVTC 4OZFA 4HKBA 3QHZH 3GSNA 1GL4B 5FYLE 5L0QC 3WXWL 4P9MH 1KJ2B 5F72S 2FYYA 5DI8B 4TSBH 4BQ9A 3BT2H 4YX2L 3IFOB 5F9WB 3QI9A 4YZFE 1JWMB 5HY9A 2VDKL 4HWEH 1UJ3A 2H8PA 4I4WA 2OR9H 2E9JA 2F9BT 4R26H 4BZYA 1XFPA 1SMOA 4CU7A 3ARTA 4W4OC 4ZTOL 2WANA 3ULVC 1NEZG 4WW1B 4O2EA 4BFBD 4DKFL 1EO7A 4MA7L 1UJTA 2P5EE 2DQGL 3ARGA 4I1NB 5HHXH 4RFNB 4XCFL 3V4PL 2Y7QA 3BZEA 2X4NB 3GO1H 3MACL 2PXYB 4GW4A 3GBMH 1DBJH 3MJ6A 3MUZ1 4HBCH 3OJVC 3QNYA 4ODTH 5SX5K 1Y18A 4PRHA 2XG5A 4WI4A 1P7QB 4NNXB 2XZZA 4LDEB 3S96A 2DQDH 3L5XH 4ALAL 3GMPB 3IDGB 2WMPA 2CSPA 4QCIA 3RX8A 2NXZB 2OP4H 3K7UA 1RZJH 5ID1B 1D5IH 3MNVA 1YEIL 4XTRC 1T1WA 2B0SH 4JY5L 3MRBB 4Y1AE 4NQDD 3V8OA 1MRFH 1HXYA 1F2QA 5TF0A 3BGMB 4I2XB 4P5TA 2G5BA 2DWDB 3DBXA 3ILPA 2NX5B 4KI5C 5DMIL 4F7PB 3ARVA 4JG1H 3TVMD 3U7YH 3UMTA 3UTPE 4HQQL 3QI9C 4M6OH 3U36A 1GPOL 3QEGL 4G6KL 1UJ3C 3WXVH 2Y6SD 4GQPH 1GIGL 1CD0A 5BS0E 1AFVL 2HJLA 2QKIB 4JAMB 1F13A 5GZOC 5TJWK 2BX5A 4NUGH 4Y4HD 1AC0A 3ARGC 1JV5B 4JRYE 1RVFL 4TUOA 2R0KH 2C7UA 5K9QG 5HHVH 5ALBL 1UWEL 1P69B 5IVXB 1HNFA 1URLA 3AB0B 4WJ5B 1F6AB 5TQ2H 1FN4A 1YNTB 3HZMA 1UFUA 4ZG1A 4JFYA 3F12A 3K8LA 3NZ8A 4NC0B 1FYTA 5DJ8B 3BRFA 4IOFD 4XP6L 4YDVB 1TNNA 1DQJA 3DYOA 4PJ8B 3NN8A 2QSCH 3BOVA 4P46D 3WL9A 4QRPA 3TP4A 4BH8B 1JPSH 1X5JA 2ATKB 1AQKL 3O3EB 1NCNA 1CFTA 3W11D 5HGHA 4HZLA 3CC5A 4P5TC 4PS4L 2XV6B 4G8GA 4OZHF 5JW4M 1T2QL 2AQ2A 4RWYL 2NY7H 5MERA 5E5MB 4X6CA 4DFIA 4OIBA 1I4FA 1W72B 1YA5A 1YNKL 1LEIB 4KRLB 1A7NH 5HYQA 3CSBA 4BZ2H 2VH5H 2HKHL 4X6FA 1MI5D 4NWUH 1XEDA 2VN4A 5IHLB 2VDOH 2OZ4H 3HC0B 4HKZA 4LSSL 1HI6A 1DEEB 2AEWA 3QSKB 4WFGE 1WWBX 4NQSA 3U82B 2VTFA 5C0EB 3GJFH 3O8XD 43C9A 3RIFF 3KJ6L 5GGRA 5DQ9B 5B21A 4HIIA 2W9EH 2E7MA 4PUBL 1B2WL 5BRZB 1JK8B 4NPYB 2OJEB 5D7JD 3V0WH 5F8QC 2GCYB 4PRID 1XF2A 1TVHA 1U58A 1U8KA 1CDJA 3QFJE 2B4CL 1JI2A 4OFDA 4LL9A 1PJ9A 3Q48A 5C6PB 3QDMB 3NZHH 1RJZA 5L88L 5DZLA 4JCLA 3QIBB 2QSQA 4TNWF 1EEYB 1UEMA 1HSBB 1NCBH 4UT6H 2X4OB 4HWNA 1YNLH 4HUKB 1LEKA 1JGDA 4TVSa 5TQ0H 3VMOA 4L8DB 1LD9B 2IH1B 2IQAA 2X9XA 4M7KL 2FSEA 3EZJB 1MLBB 5D7SL 3IAPA 2AJXH 4W6XB 4KQ4H 3H9ZA 3HC4L 1INQA 4KQ3H 5D2LF 4F7EB 4M61B 3KNBA 5I1LB 1UG9A 3JTSB 4N0UE 3VH8G 4HDIB 4HGWB 1YQVL 3D0LB 2AK1L 1QQDB 3OKNB 2VKWA 2D31A 3BEVA 5E03A 2P42B 4R2GC 4NNPL 4Y4FD 5L2KD 1IC7H 3T04D 3LKNA 5EUKB 4PGCA 2N4IA 2R39A 4MAYD 1GC1L 5C6WH 3O6MH 4P5KA 4QHMA 1P7KA 4YHPB 3BH8B 4XCEB 1TMCB 4LP4A 15C8H 3OGOE 3TESA 4QXTB 3HNSH 5KN5A 1AJ7L 1BX2A 4C56A 5EZLB 1I3UA 3BUYA 2YPKB 3D3VD 5KZCD 4KUZH 4PRDA 2L7UA 5CEZH 4M3JA 2NNAB 2FGWH 4FQIL 4GT7A 3ZZ1A 4PJCB 3QXAB 5GRYA 1T89C 4YGVB 3BD5A 3P0GB 3SKMB 3DO7A 1HEZA 5BVPL 2MQ0A 3V0VB 4GKZA 4HEPG 2GJ6D 3NFSH 4OKDA 2W92A 3ZTJG 3OSKA 4OM1L 3K74B 1A2YB 3HR6A 2JK5B 1EX0A 4NIKB 4WGVB 2QR0A 1VFAA 5H94B 3TGXA 4JO1H 1G1CA 2Z35B 5IW1B 5C0AB 1YMHA 2XA3A 4FXGB 5KSVB 4XCNA 1MCPL 1ZS8B 3L7EB 2NY4D 4AM0A 1YJDH 1T2XA 2CLZA 2X4TA 5JW5A 3VXUB 4JY6A 4K3EH 4ONGH 1A0QL 4CW1B 2P7TA 1H3XA 1RHFA 4PR5A 3PHOA 1JPGB 3RFZC 2FHCA 3PF2A 3S35L 3IF1B 5L6YH 1Q38A 1TQCB 3KPLA 3QCTL 2BRQA 4XP5L 4LBEB 1XR8A 5CJXA 1XIWB 4ZNEA 4TTGA 1JNHB 4PP1D 3UYRH 5GJTH 5IJVA 4P23A 4M4RA 5DHVH 2FO4B 1JTOA 1DL7H 2BSSB 4L9LA 3ARFB 5BMFH 2EE3A 1AR2A 4GO6B 3T0EA 2IFFH 1JHKH 4L3EB 5HI3D 1CXIA 4EI5A 4HIEB 1YECL 4NO0A 1CIUA 1NGQH 5E2VH 4PJXA 3NOIA 4FQXA 4U31A 3EYFA 1R3IH 1YEGL 4MS8D 1FNHA 2ZPKH 3VFTB 1ZXQA 4XAKD 2VDNL 3NFPA 3L3DA 1FNLA 1ZEAH 3E2HB 4QYOB 5E70A 2DJUA 3QDGB 4OF8A 3LKSA 3VXSB 1AD0A 3L3HA 3MBXL 4R4FH 5D6CA 3SGEI 3BIAX 3OJDA 3U7WL 4MDIB 1DUZB 5CJOL 5C0IA 4Y4KA 4HUVA 4XGZA 3ZDYF 4TULH 1XGUA 5C7XH 5B3JE 1GGIL 1N0XH 4BQBA 5CJXC 2B4CC 1MAMH 2FD6H 4MQTB 3FQWB 1NC2B 2DB8A 4U0QB 4P23C 3HI1B 4DOHE 1KN2L 3BO8B 3OKDA 4KTEL 4XNUL 5INCB 2EYRA 3VGAC 4LCUB 2HH0L 1F90L 2CKNA 4KHXH 3QBTB 3RKDD 5F7NC 1CLOH 3OPZH 1G9ML 1NANI 4L9LC 3KYMA 5KVGH 2A6DA 5CZVH 4LHUA 1RI8A 1OGAA 4G5ZH 3T0EC 3MXVH 3WD5L 5BZWA 3AY4A 3RWFB 1GGYA 3P9MA 4JLRA 3BP6A 5E8PB 3L5WB 5IFHL 4JKMA 1G7QB 4JPKL 4PJ5B 4D0DB 1WZ1L 2IALB 3QG7L 5DEFA 1N6QH 4RFEA 2V2TB 4YPGB 4FQXC 4JM2A 4ODUB 1IKFH 3VFUB 4OQ1A 4X7FC 5DDHA 4XC3H 4EIGB 4IMKA 3WUWA 5I73C 4X4MA 5LCVL 2VNCA 1QKZL 2UVFA 4UI2A 4F57L 2ITDA 1HOCA 5D1XA 4BK5A 3WFDL 3MLVL 3VRLF 5DD6A 2WINA 1LE9B 2QSTA 1K4CA 2BVPB 4XVSH 4P2QA 2AXFB 1SM3H 1ZT1B 1NLBL 5C0CB 4Y4KC 3NIFF 5A40E 3P77B 3Q3GA 3VFVA 2CMRL 4M1GH 3TIEB 1FFNA 3INUL 3L3IA 2VIRB 5MHSD 4XP9L 3EDJA 1MJ8H 3S88L 3ARRA 4JG0H 5E7FA 1IBGH 2CO6B 3ECBA 4XMKH 1WAAF 5E94A 3REWA 1VA9A 3G6AB 3AY4C 2DKSA 1T6VN 1JN6B 1TXKA 2N7BA 4Y5VB 1V7ML 1LO0L 4QY8B 1AXSB 3ZKNC 4RWHA 5F44A 5FM5M 3VXME 2CRYA 1MNUL 1PEZA 4OSUH 4JM2C 3FOMA 2OK0L 3KPRD 5HPMA 3HPLB 1YC7A 3B6SB 2YHGA 4WHYG 3GB7A 4G8FA 5D7KD 4IMKC 1KIPB 4LCWA 4BSJA 4PJFE 1BZ7A 2GQHA 1OT2A 1BZ9A 4XZUA 4ZO8A 4Y5XB 5D1XC 1S3KH 5IGXH 3TNNA 4OZGB 4BFGA 4E41B 4JGUA 2EDKA 2HVJA 2MHAA 5I8CA 1Y0LA 1TZIA 3RVUC 5DD3L 2XY1A 5L0QB 4HJ0D 5TF1H 4RMVA 4DQOH 3LY6A 1M71B 3F7PC 4OUOA 3D0VA 3RWDA 1X5FA 5D7LE 5C71A 2AEQL 3HLAA 4YUEL 5EWIL 4M48L 1T4KA 3HMXH 3P9LB 1MJ7H 1MY7A 2WIIA 5GRJH 2GSGA 1A7RL 4RA3A 3RVXD 3WKNA 1E4XI 5LAXB 2P48B 3HN3A 5I8OH 1FC1A 4ZAKD 1CU4H 1OB1A 4POUB 4GMSH 4UB0L 3ILQD 3LIZL 5CGTA 4MD5A 3SGEH 4DTGH 4AIXA 4HC1H 2YPLA 3Q6GH 4P2RB 1VFUA 3CK0H 3VFNA 4JO3H 1FFOB 3BKML 4OV5B 3SQOH 4NQTA 4XVUC 4QOKB 4OZIF 5C07D 1K3ZA 4HF5L 3WIHL 4S0SD 3KGRA 4S1DC 1CN4A 4U0RC 3EJZD 1NLDH 5GS2D 4X9BA 5FYKL 4MSWA 4RNRB 1EEQA 4PJIF 1EHAA 1U8PB 4OCNC 1K8DA 1LGVA 4NZRL 1IGJA 1OTSC 5ICZB 1T5WB 1YPZA 2R9HC 1GVIA 2XQYK 4JFOB 3M8OH 3GSNB 4AMKH 2IAMD 1J8KA 2V7HB 3BKCH 3PGFL 3V4VL 1ZLSL 1R3HA 5K9OA 4BQ8A 4IHOA 2IAND 1U9KA 4BYHA 5MEOA 3QI9B 5D96C 5T1MA 5HY9B 4DW2H 1UB5A 5GRXG 2VDPH 1UJ3B 4MVBD 1S9VA 5K33A 1VGEL 1ZAGA 1ZHKB 4DN4H 4OLVL 1FDLH 4NOFA 2CIIA 3PV7A 4UDUA 4Z77A 4O2EB 4Z7QE 1VESA 3WFEH 4QRTA 2J8OA 3ARGB 4WW2A 1I9IH 4MJ6A 4NQEB 4Z7OF 1QFOA 1UM5L 5C0BE 2DQHL 3UZEA 2COQA 1NCTA 3U6RB 4GW4B 1TZHB 5B4MD 7CGTA 3TEUA 3QNYB 4TTDD 1UA6H 1Y18B 4LSUH 4YXLH 5F9JA 5ITBH 4UIKL 1RIHH 5MP6L 2EXWC 4A2LA 3S96B 1D9KA 3DYMA 2X1PA 1BVLB 3IDXL 4FZEH 4FXLA 1N4XH 4MJIE 4QCIB 5DT1H 1U3HD 3HPJB 5FYLL 4Z5RA 2M2DA 1MHEA 4YHLH 3QDAA 2DQCH 3MNVB 4ELME 1BJ8A 1AGEA 4R9HA 2B20A 2W38A 4U1SB 3WKML 1HXYB 4FZ8H 4P5TB 3ALPA 3ILPB 3O11A 1KLFA 4M6ML 5EBGA 1IAOA 3NA4A 1P4BH 3HNVH 4NQXB 1QBML 6FABL 3O45A 4JFDA 3S37X 3DSFH 2DJ4A 3RP1A 2HJLB 1A6TB 1TJGL 4KZEH 2A0LC 1UKQA 2VSDA 3H42H 4LLDA 1NFDB 4TUOB 4P48A 2C7UB 1ACYL 5CZXC 2ZSVA 1JTTA 2DQJH 2ZUQC 1YEHH 3HE6B 5CAYB 2G2RB 1FN4B 2YK1H 2IF7A 4UQ2B 1RAMA 3IFLH 4FMFA 1D9KC 4JFYB 5GGUA 3NZ8B 2NY3D 3P4OA 1FYTB 2FX8L 3GZKA 3WIHA 1OAQH 4NRXA 1DBKL 2JELL 3NN8B 1P1ZA 2PXYD 2C3GA 2ZUSA 5IFJA 4R7NA 3SY0A 1E4XH 1QO3A 1P7QD 4HZLB 4HK3J 2ORBH 3CC5B 5JOEA 2AERT 4G8GB 1BF2A 3K80A 1A7BA 3RWCA 3VFGL 3S9DB 2J2ZA 1KFAH 2NXZD 1CR9L 1PG7X 4X6CB 1I4FB 2UZXB 4G6JH 1I9JH 1A9BA 4ODSH 1IC4L 1I7TB 1BWWA 3N1GC 4AQOA 4G42B 5HYQB 3UDWC 4H1LA 4UV7L 5EB9A 3NABL 1RSFA 2UY7A 4X6FB 2NX5D 4I3SH 1ORQA 3LMJL 3LQMA 5I19H 1HKFA 4OCWH 3G5XB 5DTFB 2AJZA 1CD8A 2AJ3A 43C9B 4K3DL 3L5IA 4ZFFA 3Q1SL 4IIQA 1INDH 4L8CA 2PW1A 2G60L 4DCQB 4GAGH 1HE7A 5F1OB 3TT3H 1FG9C 5A2JH 1XF2B 2EC8A 1TVHB 4GW5A 1U58B 3BPNC 1U8KB 3LSOA 5EU7E 1OTTD 2NY0C 5GS3A 1DBML 3G5VA 5DA4A 3QHZL 1RJZB 3CFCL 5D5ME 3VG0H 1T20A 4ISVA 3WLWD 5DRNA 3T8XA 3BT2L 3DRQA 4NM4H 4GMTL 1LEKB 4HWEL 1JGDB 3CU1A 5E6YA 4O2FA 3ZL4L 1FZJA 2OR9L 4PJ8D 3FQTA 4R26L 3VMPA 2GAZB 2IQAB 4Y2OA 2I25N 5IW6A 4K7PX 2P5EA 4L5FH 4K7PY 1INQB 1AGBB 2Y4SA 2UV3A 5HHXL 3P73A 3KNBB 1VFMA 5EIVA 4ZUUA 4Z7WF 3GO1L 3EO9L 5CP3H 5AYQA 5DMKA 4EIZC 3GBML 3SO3B 4LGSB 4HBCL 3TF7C 3WS6A 4ODTL 1P4LA 3BEVB 4IEFB 5DJAA 2FHBA 3BN3B 4IIQC 4LASL 2DQDL 3L5XL 3UBXA 4PGCB 4CNIA 2DYPA 5SV3A 1CICA 1FVDA 4P5KB 4QHMB 1P7KB 3L3JA 1FZOA 5FOBA 1RZJL 4DGYH 5KN5B 1WTLA 3BDYH 4Y1AA 1BX2B 1BFSA 1D5IL 1IGIL 4C56B 2EXYD 5JPMA 2DMBA 1FRGH 3GI9L 3ZTNL 2X9YA 3SDXA 1RK1A 4PRDB 3TH2T 1QFUH 4PBWD 1MRFL 4ZO9A 1ZVHA 3NACH 1AO7E 4PJDA 1HWGB 2VXTL 4NKMA 4X6EA 3U7YL 4M93B 3DO7B 1HEZB 4I8DA 5BS0A 2QJDA 4NSKB 4KV5F 1BF8A 4GKZB 5BRZD 2JLLA 3VFSA 5DRWA 4PJGE 3FO0H 2I9LA 3VD5A 1UM6H 5F3BA 1Z3GL 2D0GA 3L1OH 4JRYA 4X5WA 3QDMD 5EUOE 4NUGL 2HT4D 2QR0B 1VFAB 3KPNB 3HKFA 2R0KL 5D93C 2VLLA 2PN5A 4NKQB 3MGOB 4XVTL 5LGHH 5EBMA 4J23A 5F96H 3EOTH 3V6BR 1HKLL 3B5HA 3W39A 4C59B 4XCNB 3FQXB 1PG7W 3WNOA 2O5XH 3BPCA 2CLZB 5JW5B 4JY6B 2GW5A 3C60B 5E00B 2P7TB 1CICC 2LAAA 4H8WH 4U4BA 4PR5B 2QLVB 4PJEA 3PHOB 5ESVA 2MSPA 2W59A 2QSCL 4Q58C 1NH6A 1D5ZA 5IMOA 3DX9B 3KPLB 3DVFA 1BQSA 4QT5A 2DS4A 1JPSL 4N68A 1A8JH 3MUGB 3V8CA 3B9DA 3K4DA 3O3UN 5DYOA 5IJVB 4P23B 3MZGB 4GAYB 2PW2A 3VGAB 3FQUA 3D39A 2AV7B 5DJ2A 2NY7L 2XA8L 4L9LB 1WZKA 3VWJA 3T0EB 1A7NL 3V7AG 4EI5B 3IAGC 2Z8WC 4JFEE 5C0GA 3DETD 3PDGA 4NO0B 3EJYD 3SO5A 4BZ2L 2VH5L 4WCYH 3N06B 5J13C 4PJXB 1LE5A 4FQXB 1M6OA 2HP4A 4LARL 4NQCD 2VDOL 3EYFB 3RZCB 1M7XA 3MUY1 5EC2A 5I73B 1F5WA 3NFPB 2EH8H 3OXRA 2ARWA 43CAB 4U33A 3GNMH 3LKSB 1AD0B 1F8TL 3L3HB 4JZNA 2JCCE 1TIUA 2RHEA 3QFJA 4OZFG 3C6LA 1O0VA 5ETUB 3T77A 1T7YA 3V0WL 1PYWA 3GIZH 4TSAH 5F7DA 5E1AB 1ZHBA 1B3JA 2CR6A 1MCBA 4Y4KB 1ADQH 5C0AD 4C58B 4XGZB 4PJAB 3QUXA 1XGUB 4NBZB 2YD1A 1JZ7A 5DD1H 2VXQH 3TCLA 1OSPH 4O02L 2J7LA 1SVZA 3MLSH 3K2UL 1J0JA 4ODWA 3VXUD 1RIVL 3B2UC 5IEKA 1SEBB 4NKIH 4KKCC 2PCPA 4UT6L 2EYRB 4KXZI 1MFBH 3RHWF 5SV4A 1F3JB 1YNLL 2ADFH 5TQ0L 3KYMB 2A6DB 3GHEH 4LHUB 1OGAB 3VWJC 4DKEH 5BZWB 1E0OB 2XG4A 1ZANH 4F37K 4JLRB 4KQ4L 3BP6B 5A3IC 3P40A 3B5GA 1XIWD 1HH6B 4KQ3L 4N0UA 2LQRA 5DEFB 4QWWC 2JTDA 5HDBE 4JM2B 1U3YA 1KC5H 1EH9A 5DDHB 4M8QA 4GXUN 3ARFD 4U6XB 5DLMH 3BPLB 1GAFL 1QVOB 5ADPL 1I1FA 1OW0A 2ITDB 4L3ED 5AZ2L 1HOCB 5D1XB 1E6OL 3O6ML 5DD6B 2IQ9H 3QIWA 2WINB 3WO4C 1R5WA 1A6PA 1K4CB 1IGML 5EOCJ 5F89A 3C6LC 3HNSL 4LSQH 1OWWA 3IDYC 4MQXD 4AIZA 5EZIL 1KEGH 2WK2A 4MCYA 4G6FB 3QUXC 1S7QA 3WIFA 5M7QA 3OAZH 3LVEA 1G7IA 3QDGD 4XP4H 3VFVB 3EYQC 1EUTA 3VXSD 2W60A 2C26A 3DUSA 2VMFA 2Y5TA 3QRFM 4LLWA 3L3IB 3BZ4A 5HVHB 4PLKD 3H7BB 3MLRL 1YMMB 4U7KA 1G7HB 4U1IA 4OCMC 4FFWC 4P59H 3ECBB 2VQUA 4X8XA 3REWB 5E94B 3SDYH 1YDPA 1JF5A 4OBSA 3RY5A 5FV1L 3W2DL 1NC2D 5CEYA 2FLRT 2HKFL 3WE6A 3OTTA 2Q8AH 3MV7E 3FOMB 4JO1L 1EIBA 1OY3B 1RD6A 2W0KA 4IS6A 3GB7B 4G8FB 4G9DA 4PJCF 5C3TA 4XPBH 4X4XA 1NBZB 3GJFA 4KAQL 1YJDL 4U0RB 3LS5H 1OW0C 2EIZA 1OLLA 1RJLB 4ONGL 3TNNB 5E08H 4PJ5D 1MH5A 4PGZA 1LVEA 3QIWC 4M1CD 2HVJB 2MHAB 5I8CB 1Y0LB 1TZIB 5ESQA 4ZOEA 3U4BL 1MWAH 2A83A 1PKQA 4CVXA 3NH7H 3VD3A 3OB0H 3LN9A 4TVPH 1RU9L 5D96B 3F8UB 2RCSH 5GJTL 3HLAB 3MNWB 4YFDB 3V4UH 1B9ZA 1T4KB 1DL7L 4AEHH 5C08E 5BMFL 4NCDA 5MEPA 4EI6A 1F3DH 2IFFL 5C0CD 5LVEA 2O26U 1JHKL 1N64H 2HMIC 4YGAB 1CLYH 1A6AA 2WM0A 1NGQL 4X7SH 5E2VL 4R6UA 5BJTA 3VFNB 1NGPH 2V5MA 3QUMH 2ZPKL 3S35X 4I48A 4ZMAT 2WSKA 1BD2E 1RURH 3FQRA 1P7HL 3GMMB 1ZEAL 2GITA 4OFIA 1FZMA 1RJYA 4AL8L 5B8CB 3I75A 4ENED 2CKBH 4R4FL 4MSWB 1RZFH 1WICA 3MNZA 3L5JA 4FABL 1MCIA 4KXZH 1IGJB 3U9UA 4JFZH 1YPZB 3WEXB 2VZ3A 4TULL 5C7XL 4QRRD 2UWEF 1R3HB 5K9OB 1HYSD 1EAPA 3WIIH 5MEOB 1MAML 5T1MB 1NCWL 4QXUH 1UB5B 1A1NB 3PHQA 4YDKL 1S9VB 4E41D 2OQJA 1N8ZA 2FIKB 1CVRA 1ORSA 1KNOA 2CIIB 3TV3L 1JVKA 4UDUB 2BXYA 5CZVL 4QRTB 1OGTB 3HB3C 4G5ZL 4WW2B 3MXVL 1UH2A 4MJ6B 4TPRH 4JKLA 3BSZH 1M7DA 1OPGL 2ED9A 1OOAA 1MFAH 4MXVE 5FGCB 1F00I 4F15C 1N6QL 2ZUQB 2AGJH 4MB5A 5EBWA 5HXMA 1IKFL 2GYSA 3CU7A 5F9JB 2BSTA 5L8LB 4MJ5B 4XC3L 3ULVD 3H9HA 3SKNA 2P4AB 1EO8L 4NWTL 3J7HA 4YC2B 5HD8C 5H37H 4FFZH 4KKBC 2WBJA 2VR4A 4UUJA 4Z5RB 3W0WE 4FP8H 1MHEB 4XVJH 1MSPA 3EFFA 1S78C 2IWGA 4DZBA 3Q0HA 4P2RD 4XVSL 1KB5L 1SM3L 3KLAA 4Y19E 4N1CA 1Q1JH 2G75A 3O11B 4CDGC 4QOKD 5I66A 1JZ4A 4R0LA 4UV4H 4M1GL 3A67H 1X5KA 2Z92B 5ACLA 3SE8H 4JFDB 3QIUA 4F3FA 4JPIA 2X42A 1MJ8L 4XTRD 2VERN 1FFRA 3B5TA 1BZQK 5E5UB 2HTKC 2YUZA 3TO2A 5HJ3A 1DQLH 2YKLH 5E24E 3DX6A 1ZHLA 4LLDB 3ARPA 3MYZA 3VXMA 1GOGA 1WF5A 3QI9D 5EDXA 3BESR 1F97A 2ZSVB 4X4ZA 4YDLC 2PYFB 1XAUA 1CDHA 4PJFA 4HIXL 3MA7A 3P3YA 1FZKA 4Z18A 3MLPA 2PKDA 5GZOD 3U7AA 3VXTB 2MWCA 1ED3A 3O6LH 3ARGD 2E9BA 4NQED 3P4OB 2WBJC 1S3KL 5F8RC 4NRXB 4IRJB 5KSBE 4YIQA 1P1ZB 3BPNB 2DN7A 4CMMA 2CK2A 3W9EA 1MCNA 2AKRA 5IFJB 3KR3H 1UXSA 3SY0B 1BFOA 4BSVA 1QO3B 1ZSDA 5TF1L 4DQOL 1EDQA 4JEGB 5IB4B 5D7LA 4MQ7A 2I60H 2R4RH 2IPKA 1L0XA 3RWCB 4R0LC 4Z0BL 4HPOH 1HQRA 2Q7NA 3RKPA 1CT8A 1P9MA 3QIUC 3GRWL 4FQ2L 4Y8DC 1A9BB 4Z7UE 3KDMA 3WNMA 3VD7A 2Q7YA 3OKMA 3LEVH 5GGVY 5I8OL 1X4XA 3JV6A 4P5TD 4OZGF 5FUOH 5BZDB 2ATPA 2C3VB 2A6IB 3IXTA 1CU4L 2QADB 5B39A 4GMSL 4M00A 3U0PB 3IKCA 1ORQB 2W91A 5TH2A 5F1NB 1NGXB 1BOYA 2VSCA 4KKNA 2NY1C 1DLHA 1Q0XL 3Q6GL 3CK0L 2AJZB 2AJ3B 3HI6L 4ZFFB 5HHOE 4L8CB 2PW1B 4IRZH 2VKXA 5LXGH 4XC1H 2X89D 3V6FB 2B8OT 3UAJC 1NLDL 3ULVF 1S7VA 3GMNA 4GW5B 3LSOB 2XQBL 4HH8A 2VAJA 4M02A 3G5VB 3HE6D 3O3AA 1O5DT 3M8OL 4AMKL 2XFXA 3BKCL 1NCAL 4KWUA 3MRJA 1KB5A 1T20B 2WV3A 4FXKA 1MELA 3H9SE 4ISVB 5DRNB 3T8XB 1CXFA 6CGTA 3DRQB 4DW2L 1FYTD 4LHUG 5HYJE 4O2FB 1FZJB 5ITFA 1OCWH 2LVCA 5IW6B 3DNKA 2P5EB 4N1HB 4DN4L 4QRPD 4XX1E 5I74C 4I0PA 3WBDA 4HS6A 5C0BA 3UJJH 3WFEL 5GRWA 3CSGA 4K9EH 3P73B 2XRAH 1CVSC 3I3EA 3PWVA 3IJYB 5D93B 4L4VA 4OCSH 3TLRA 4G8GD 4ZUUB 5DMKB 4ZO7A 3WUWG 4ZOBA 4QRSA 1KEMH 2Y25A 3RIAF 4KI5F 1UA6L 1ZLWK 1P4LB 4LSUL 4YXLL 4XWGH 5ITBL 5L7XH 5IB5A 1KBGL 1RIHL 5DJAB 4MJIA 3TBTA 1A3RH 3VFWA 1KYOK 2FBOJ 3CCHA 1EBPA 5E2UH 3UBXB 4CNIB 2DYPB 3EYOB 1FAIH 1CICB 1G6VK 4JVPA 1N4XL 3L3JB 2YD8A 5IBTL 1FZOB 4KK8C 5FOBB 5DT1L 1MFCH 3GSUA 2DL9A 3T0WA 2HAZA 4Y1AB 2DQCL 3CVHL 5JPMB 1L0YA 3VXQA 2PR4H 1RK1B 2FRGP 3IDNA 3C2SA 4FZ8L 1IQWH 4U1KA 1U8QA 4AY0A 4NKMB 3RDTC 4PB0H 4XNZC 5A2FA 1AXTH 3C8DA 1LK3H 3SGDI 4JQXA 5BS0B 2UYLA 3DJ9A 2IPTL 4NKOB 3VFSB 3ARXA 3DSFL 4Z95H 5DRWB 3EJJX 1QBLH 2OLDA 5F3BB 1M1SA 2V9QA 3GRWA 4X5WB 1WT5A 4I0PC 3QWOA 4QGYA 1KCSH 3FN9A 4MB3A 4KZEL 5J13B 1VKXA 4L4TE 1AHWA 2Q3ZA 5JUEL 1D5XA 1CGVA 4ETYA 4H0HB 2MCPH 1DE4A 2EDDA 2VLLB 1UKSA 1BQHA 3T4YB 3D2UA 3MRHA 2ERJC 5EBMB 4EXKA 3CLFH 5DO2D 2Z91A 1HHJA 3W39B 3UTTA 3LEYH 1MCJA 1QSFE 2O5ZH 5I71C 2YK1L 3BPCB 3TZVA 3SGKA 3IFLL 2BOBA 5ESVB 4JO4H 1II4E 1OAQL 5GGTH 3VXPA 4GRWH 3O6FB 4NM8H 1D5ZB 4I2XE 3MJ7A 4QT5B 3QRGH 1E4XL 3U0TB 5DYOB 1X5YA 3QEUA 4K3HA 1R3JA 2BNRE 2CPCA 2PW2B 4WIQA 4POZC 4JQXC 5CSGA 1KFAL 1Q8MA 5HYFA 1BPVA 5A1AA 1OWRM 2EDLA 3B9KA 4C56D 1I9JL 5DD5H 3BYTA 3BN9C 3B9AA 5C0GB 2ADIA 1WT5C 4PG2A 2ZG3A 1AHWC 1RK0A 5D71L 4I3SL 3ZKXC 4JM4H 1UYWH 3OXRB 4IM8A 1G0XA 5D7IE 3NPSC 4E5XA 1E4JA 2XKNA 3R06B 1VEPA 4JZNB 3TZVC 2YUWA 3SGKC 3WO4B 4X6CF 2EDHA 3TT3L 5TGBB 2R1WB 3QFJB 3C6LB 4YWGH 3T77B 4WI8A 3IDYB 4CVWA 1PYWB 1G0DA 2EIEA 3PDOA 4HGMA 3IS0X 2Q6WA 5D5MA 3JTTA 4MQSB 1GOFA 1Z9MA 3LQZA 1CLZH 3QQ4B 3CVHA 5DMGC 4P57A 3TCLB 1A6ZB 3VG0L 4JKPH 4MXQD 3X14A 2A77H 4ODWB 1OP3H 5I8EA 4CN1A 2FH6A 4YK4C 3GMQA 4WFFD 4NM4L 1FNAA 1C5BH 2EC9T 3LZFL 5C09E 4GJTB 1A22B 1QYGH 3HA0A 2W9DL 3B9KC 4NHCH 3GBNH 4M7JH 5DEZA 4LSTH 2OL3H 2XOTA 2VJXA 3QO0A 1F3RB 4ODBD 4NQDA 3BQUA 4N0UB 4PG2C 4JFPA 4PTUA 4P23D 4JHZA 5F7KC 4NJ9H 4GG6E 3EAKA 3MR9B 3TYGH 4M8QB 4BSWA 3N9GH 4G6AC 3MC0A 2ITCB 4XBEH 3RA7H 3E8UL 3T0ED 3W9DA 3WV0A 4EI5D 2XTJE 2ZUVA 3QAZC 4NO0D 4XWOC 3QIWB 3LRSA 3SGDH 3RPIA 4Y0GA 4FQXD 5F89B 3K81A 4U1JA 2GTZA 5EU7C 3OX8A 4DGYL 1CG9B 1VACB 3BDYL 3LHPL 4AIZB 4EOWH 1EXUB 2YBRB 4MD0A 4MCYB 4P99A 1AO7A 2X44D 8FABA 1S7QB 2FECI 5AAMA 1QFUL 3WIFB 1CFQA 4YH6A 3BUTA 5I1EH 2IPUG 3GSVA 1RUKH 3WNLA 1KTDA 2W60B 4I77H 4GRWE 5M94B 4X6BA 3CVIH 4PJGA 2NLJA 4U1IB 2ICWI 4OIIL 3IB4A 2IBGA 1SQ2N 3UJIH 2FX9L 3MUHL 4FQLH 5EUOA 3FO0L 1UM6L 4Y4KD 3L1OL 1YDPB 3IDJB 3OQ3B 1R5IA 4P4KA 1CK0H 3QUKA 4CJ1A 2GTWB 3DXAE 3BQUC 3NAAH 5CEYB 2VOTA 3DHMA 5HSFA 4UT7H 5LGHL 1L7IH 5F96L 2AEPL 2ENYA 4IS6B 4G9DB 2E3VA 4LHUD 1OGAD 4HD9A 4BH7A 1QLRA 3GJFB 2O5XL 4BKLA 1TTGA 1AGFA 2D9CA 4WFED 5ANME 2XY2A 3TBWA 1KYOJ 1MH5B 4H8WL 2BCKB 3RUGB 4HT1L 4JM2D 3KPPA 4IOIB 5ESQB 3RGHA 1UXWA 4ZUWA 2A83B 3BDXA 3FT3A 2C4XA 1HK6A 4CVXB 1BJ1H 2ZUWA 3O3DA 4O00A 2QQLH 4N5ED 4H25B 5D1XD 2HRLA 4FQCH 3T3ME 3PDDA 5SWQB 2XWJA 4OM0H 2HFEA 4H1LG 2DQIH 5MEPB 5JDSA 3OAZK 4EI6B 3WDIA 1XF5B 4JFEA 3QP3A 2JE8A 1UZ8A 1A6WL 4X6DE 1A6AB 8CGTA 3QR2A 4P4KC 1KIQA 1MAKA 4UIMA 4F15B 4DUXA 5BJTB 1XCTA 2W9LA 1R3KA 3OXSA 1S7TA 2Z0BA 3FO2A 3G08A 1MF2L 1WBXB 4I48B 1YMMD 4KKLC 4ONFH 2RB8A 3DGCR 3FQRB 1WBZA 2J3SA 5ISZE 3IU4H 2JCCA 2GITB 1FZMB 5HGBA 1RJYB 4X80L 4Y5YA 3I75B 3VG9C 1ETZA 1OD9A 3MNZB 4XNXH 4UNUA 4PREB 1J05A 4N8VA 3OR6A 1WC7A 4OB5L 4U6HA 1OAYH 3GIZL 4JQIL 4LHJB 4BFIA 1MIEH 3S4SA 1FVCA 5CLWA 1ADQL 3ARYA 4XVUD 3HZYA 4HV8A 4LCWD 4PJXF 1LDPH 4FA8A 1J1PH 1C12A 5DD1L 4DOHB 1KPUA 4S1DD 3VXRE 5KSUA 5L2KA 1QZ1A 2DKUA 3TPUA 3V5KB 3PGCA 4J7RA 5CEXA 2OQJB 3TBVB 1N8ZB 1G6RH 3OB0K 2R9HD 1KNOB 1WCBB 1OF2A 4B7IA 3IFNH 4OF3A 5EO9B 1EHLH 3QCVH 4DKEL 4HXBL 2CQVA 5EOQH 5EULV 1M7DB 3LEXA 4RGMC 4DUVA 5JQHC 3FT4A 4YDLB 2DQTH 4NUJA 3DURB 1MCOH 3CSPA 2BSTB 5JR1H 3UBXG 1MCEA 3H9HB 3X3FH 5DLML 2CDFA 3MRQA 5T1LA 4NBYB 2WBJB 3O6KH 3WJLA 4Y5YC 1B6UA 1BECA 2YUVA 4EZMA 3PWLA 1BOGA 1GGUA 1BP3B 3LKQA 3EFFB 2XACC 4H20H 4X83A 1DP0A 2YPLD 1I9EA 4X5LA 3KLAB 2G75B 5I66B 2EICA 3O3BA 2DD8H 4NC2B 3I02A 4JM2F 4XP4L 2IGFH 3UZQA 4H0IA 3QIUB 1I7UA 2ICEA 2V5SA 4OTXH 2DI8A 3QUZA 4JPIB 4LVNC 4F3FB 1QHOA 1U91B 4HMEA 1LO4H 4OZHE 3MREA 1RUPH 2FLBT 1KCLA 1K3IA 3TO2B 5HJ3B 4XCCL 3SDYL 4ZNCD 3DX6B 5I15H 1ZHLB 4HKJB 5I2IB 2EZ0C 5FM8A 2APFA 5DFWH 3VXMB 1MCSA 2R2CA 2DMCA 3E3QC 1V5JA 2BXZA 3TM6A 4J8RB 2Q8AL 3T4AA 4KPHH 1BHGA 4PJFB 4K71C 3DI2B 2VQ1B 1C16A 1FZKB 3CZFA 2CGRL 5JHDE 4MHHG 5CJQH 1TPXC 4OZ4A 4XPBL 1JRHI 3QB7C 5FA3B 2A0LD 1I1CA 1ED3B 1Q0YH 1FL6A 3LS5L 5ERWA 2D4DA 3WJLC 5FFLA 2QQKL 1KJ3H 4YIQB 5E08L 2R2BA 4U1HB 5CZXD 3W9EB 2AKRB 3EDKA 3UYPA 4XXDB 1UXSB 4BSVB 1ZSDB 1V8HA 1PY9A 2JJWA 5D7LB 2IPKB 4KTDH 1ADQA 1Q9LA 1YZZA 1WGOA 2RCSL 1HQRB 3BMVA 5C08A 1SVCP 1CT8B 3A6BH 4WWKB 3V4UL 3ETBF 3WN5B 3QUZC 4AEHL 3S34L 3KDMB 3HRZA 4A6YH 3KHOA 3FB7A 3QEHA 4P3WA 5FCUH 3OKMB 3DV6A 5FHAH 1QUNA 3MODH 3JV6B 2F74A 3TWCL 2ATPB 2XTLA 3IXTB 1DQDL 3IFPA 4QO1A 3IKCB 4X7SL 1NAMH 5TH2B 1I1YA 3O2VH 1I9RH 3HTLX 4MXWL 5JW3H 3BPOC 1BD2A 1SBBA 5B38B 4JFDD 4U2YA 2FGZA 2R29H 2JJVA 3ET9F 4X9FA 4Q0XH 4ZTPL 3HE7A 3WFCH 5AWNH 1ZTXH 2EKSA 5GGSB 1EJ6A 1WWWX 5CCKH 2R2HB 1MPAH 2B2XL 1YEEH 5HI3C 1RZFL 1S7VB 4ZSOE 1EV2E 3GMNB 1V3JA 4KDWA 1K8IA 4NJAH 3VJ6B 4I9WD 4JFZL 3QXVA 4OIAA 3VU2A 2ZUUA 3F7QA 4KDTA 3WSQH 4NFDA 3DVIA 4A2MA 1JZ6A 5D2NE 3RDTB 1KB5B 1DANT 4FXKB 3R8QA 1Z9OA 4JO2H 5DHYB 5EU6E 3IDIA 3SQBA 4UTAL 1AXIB 4ODXA 1NUDA 4IRJD 1IAII 4UQ3A 4KY1H 5ITFB 2NZ9C 3X13A 5E6IB 3AMLA 5FYKD 3FAXA 4KTYA 5JQ6H 5E2JA 4I0PB 5I1KH 1EAJA 4HS6B 5C0BB 1AQDA 3NTCH 4KH2A 4TPRL 3WHXA 5DMYA 3BSZL 1J1XH 2CXGA 2ERJB 1YPZF 4RDQG 4QRSB 2AGJL 4FQHB 3W82A 4OLYH 2OMNA 4WENB 5IB5B 4UBDC 1N3NA 4WU5A 1S7XA 1KLUA 2Q8BL 4MJIB 3U4AA 3HE7C 3VFWB 5IV2A 2VLKE 3CCHB 3W0WA 5DEGA 4QGTA 4ELMB 2P8PA 4FFZL 2HN7A 1T0MA 4QTHB 2VYRE 2NY5L 3GSUB 4DKDC 3KPQB 4FP8L 4XVJL 3DYPA 1QHPA 1A5FH 3OBAA 3K4AA 4Y19A 3VXQB 2AXJA 4WW2F 1WWAX 4NN6C 3L9RA 3IDNB 3RJDA 2XZCL 4KDTC 4U1KB 1U8QB 1Q1JL 2YD3A 1IGFH 4HIHA 3PQYE 4UV4L 3BJLA 5J12C 1UQSA 3A67L 4WUKH 1H8OA 4LDLB 3SE8L 3MV8B 2DTML 3MCKB 3HMWH 1H3WM 3IRPX 3UPRB 4H5SB 3C5SA 5GGSY 5FYLD 5HHNA 3QWOB 4KRNA 2YD7A 1VKXB 1DQLL 2YKLL 1FPTH 3I84A 1D5XB 1W0WA 3FQNA 2BVTA 5ACZA 3ZKXB 4U49A 1DE4B 1BQHB 3D2UB 2MOVA 3VWKA 1J1OH 4ZS7L 1FNFA 1KCUH 1CWVA 3ARDA 1A3LL 2Z91B 4FFVC 4ETQB 3PL6B 4N1EA 3NPSB 1F3DJ 1D6EA 4PYHA 5JOFA 2P5ED 1MOEA 4D8PA 4R97C 3TZVB 3FTGA 2R69H 5KSBA 2DLIA 4QLRA 4I13B 1JGEA 4D0BA 4G80A 1T80A 5HYEA 3CXHK 4ZAKA 4S1SH 1DFBH 5F1SA 2DIBA 3SDCA 5HYIA 1HHGA 1H5BA 3GSQA 3KR3L 3K0WA 3MJ7B 2GY5A 4LCCA 1PSKH 5A2LH 4GRLA 5F3HB 3TA3A 5I75C 3IDUA 3IT8D 3QEUB 2R4RL 3M1BA 1R3JB 4G9FE 2DYPD 5DQDH 1CICD 4M9PA 2O5YH 4HPOL 5DR5H 2NXYC 4Z7UA 4UTBL 1DBBL 4Y1AD 1TNMA 3B9KB 3KPOA 3UJTH 3F6IA 5TE4H 1NFDE 3MV9E 5TPWH 5FUCE 2ADIB 4LP5A 4NHUA 4FQQA 2I5YH 1EPFA 4Z7NE 3UTPD 5IOPA 2QTEA 5FUOL 4JHWH 1RK0B 5DSCB 4CADA 2MQ3A 1FGNH 4IDJH 1DCLA 3C5ZA 4L9DA 4X99A 5BS0D 1S9YA 1WEJL 4JN1L 3VWKC 5HHOA 1XR9A 3RVVC 3ARDC 1NGWA 5FYJU 4JRYD 5CINH 3QAZB 1WV7T 4IRZL 5LXGL 4XC1L 1TCRA 1I8MA 3RWJA 4ZAKC 3SDCC 1IAIH 3OAUH 2Q6WB 3CZJA 3ILQC 5D5MB 3JTTB 4QHNB 3LQZB 3CVHB 3H9SA 3CX2A 2H2PD 7FABL 3UC0H 3QNXA 4LCCC 1LO3H 4P57B 2XN9E 4GRLC 3E6HB 3TA3C 3X14B 1JNNH 4U1LA 5HYJA 3FMGH 5I8EB 5BXFA 3GMQB 5F1IA 1JYXA 1MFDH 2P8MA 3CFBA 4XRCB 4B50A 2H9GA 3O6FD 3I9GL 3UPCA 2W07A 3GGWB 1BEYH 3AFLA 1IEAA 3UJJL 3ZDZE 3H9YA 4RAHA 3BQUB 4PTUB 2XRAL 4YLQT 2IAMC 2VL5B 3FB8A 2VUOA 4KKCD 1RZ7H 2K7PA 4BSWB 1IZKA 4GW1A 1X3DA 3LQAH 3H0TA 2QHLA 1A3RL 4LKXA 1E28A 5E2UL 4TOYH 2OSLA 4HIJA 3LRSB 4KJQD 3RPIB 2FO1A 4D2NA 1MFCL 4FNLH 4WFGD 2GTZB 3OX8B 1X5ZA 3NPZB 4MA1C 3T2NH 1MHCB 2NY5C 4MD0B 1AO7B 1HILA 8FABB 1BGXH 1CFQB 4TTDC 3RNQA 3GSVB 5FA4A 1IQWL 1KTDB 4X6BB 2CLVA 2NYYC 1AXTL 5E8DH 3RGVA 1KOAA 5FXCH 3LS4L 1UACL 4PJGB 2NLJB 1CGWA 3QFJD 4OF6A 3C6LD 1X5LA 2F54E 1WBYB 3H3PL 5EUOB 4Z95L 1NMAH 2X4NA 2O61A 3V5HB 2PXYA 1QBLL 1UGNA 4L4TA 3RZWA 3VE0B 3T2PA 2NTFA 3C9NB 3QUXD 1OP3K 1FFPA 3PNWA 1EMTL 3QH3A 4LLMA 3UO1H 1K6QH 1KCSL 1R5IB 1M4KA 1R3LA 4P4KB 4G7VH 3QUKB 4NNXA 4ZFOL 4TSCH 2DLFH 4ACPA 3IRZA 1ITBB 3SDXF 3U48A 1QNZH 1QSFA 2DM7A 3BKYH 5DVOA 1IRAY 4FFWD 5B22A 2ZG2A 2H3NB 4PJDF 3S36H 2PO6A 4BH7B 3LEYL 3FN0H 4RQQB 4OCLC 4LEXH 2RBLA 4BKLB 2J5LC 3ZYZA 5MI0C 5K9JL 4ZD3H 1N5YL 5DHXB 3TBWB 2LU7A 2C3WA 1HSAA 4I2XA 4JO4L 3NA9L 5GGTL 3KPPB 4ORZC 2F53E 1UXWB 2DQEH 4NM8L 4ZUWB 4DZ8A 3ZTJH 5F9WC 2D7PA 5GS2H 2XI9A 3S5LB 2BNRA 5FO8A 2FZ3A 4OT1H 1CI5A 1OL0A 4JAMA 3QPXL 1B6DA 1G7PA 1E4WH 3RGVC 3QIWD 2XWJB 3D18B 1BBDH 4JPVH 2RAMA 2QQNH 4O51A 4N9GB 5JDSB 5ICYA 4QNPE 4JFEB 5DD5L 5B39G 2PXYC 5F70A 2W65A 3QULA 1CQYA 1UZ8B 2XXCB 3CD4A 4RGMB 3D85B 4PJEF 5IVXA 2K3TA 4ZS6D 4K23L 1KIQB 4HMDA 3A6CH 1XCTB 3VGFA 1R3KB 3CMOH 3OXSB 3PWNB 1S7TB 3CMGA 4EDXA 2R56L 3FO2B 1HHKB 1H3GA 5CFHA 4QTIH 4Z7OE 2W1NA 3QXTA 1Y6MR 3CJJA 4JM4L 4BFEA 1MHPL 1WBZB 4YDVA 5DXWA 2JCCB 5T1DH 1GJIA 1KXQE 5HGBB 4FQJL 1E6JH 3O0RL 1EVUA 3JWNC 4Y5YB 2X1XR 5J57B 2HMID 3BISA 1ETZB 5MENE 1IE5A 2PF6A 3O3EA 2J6EH 1J05B 3RY4A 4N8VB 2J8UE 3OR6B 1PW3A 5AEAA 1XF4A 4U6HB 2WP3O 3CXHJ 3KLSA 3S4SB 1KCKA 3EDDA 1FVCB 2IG2L 5FF6A 5C2BH 1H8NA 1CLZL 3U1SH 3RAJH 2Z4QA 3D25A 1C12B 1HXMA 1W72A 1KPUB 3ESUF 2OTPA 3HG1B 5KSUB 5C09A 2EH7L 5CEXB 1AE6H 1CCZA 3Q2CA 3JWDH 1C5BL 1BVKA 3TFKC 4D3CH 1QYGL 1U8MA 2PTUA 2G9HA 1OF2B 5EPMA 1CE6A 3HC0A 1X7QA 4Q9BA 3VFMA 4Y2DA 3GBNL 4M7JL 4Z9KB 4ONHA 4P9HH 1JCKA 4LSTL 2EC9U 2OL3L 1OTTC 3IU3A 5FGBA 3LEXB 2P49B 2QBWA 3N1PC 3N1FC 4GG6A 1K85A 5I1GL 1GCFA 3FT4B 4U1MB 4NC1E 5DQ9A 2EE2A 4KK5D 4NUJB 4NJ9L 2F5BH 2VZOA 4ZFOA 2H26A 1CDYA 1KJ2H 3TYGL 2Z9TA 4DVBA 1OAZL 4GS7C 4XBEL 2HG5B 1JK8A 2CDFB 2OJEA 3HB3D 3MRQB 4RCAA 5T1LB 2R2EB 4RAVA 2OJZL 5D1ZA 2B39A 1E27B 1JTPA 1BOGB 3RIFK 1WIOA 3LKQB 4PRAA 3PUCA 4JHBA 3QIBA 1QBBA 4WI2A 5T33H 1EEYA 4EOWL 3AXLA 3JSSA 2X4OA 5FK9A 2WLYA 3AS0A 3O3BB 5HD8D 5T3ZH 5EZOL 4KKBD 3LN4A 3I02B 3ZDXE 5AYUH 1RUKL 1MLBA 2HRPH 5FUZH 1EJOH 2F58H 4HMCA 3CVIL 1I7UB 4RDQF 3QUZB 1S78D 5E0QA 1GOHA 4F7EA 3UJIL 4DN3H 4TNWK 1IC5H 4C4KO 1LP9E 2XWTA 4Y16A 4Y2DC 1Y6NR 1JJUA 2EXYC 3DXAA 1BQHG 3QXWA 5FGBC 3EUUA 3MV7B 1PDKA 3NAAL 3BPOB 2YR3A 5EUKA 3KAAA 1NCDH 4UT7L 3T4AB 1L7IL 1PZ5B 4O5LH 3RI5F 4YHPA 1C16B 1RUMH 2IBBA 3CZFB 3FO1A 2ZOKB 1CIDA 4L29A 5ANMA 2HTKD 4OZ4B 3OJMB 2DRUA 4LGPB 2XTJC 1UB6B 5EZLA 1FL6B 2Y72A 5IB2A 4NN5C 4OKVA 5D1ZC 5C0RH 2R2BB 2P5WE 3V5DA 3QIBC 2OYPA 3STZA 1QTYT 1AC6A 3V0VA 2ZCLH 3RVWC 3G04A 2QQLL 1J5OL 2DKMA 1YMME 3VI4E 2WBJD 5C08B 1YYMH 4FQCL 3Q6FB 2FDBP 3AGVA 3BZDA 3BGAA 3RU8L 1UWGH 3HRZB 2DQIL 2EO9A 4X6DA 4UMGA 5LBSL 2OTUA 4B0MM 4U6VL 2DWEB 2Z35A 35C8H 5C0AA 3DV4B 5IW1A 4Y16C 3BD3A 4JFHE 2A73A 4W81A 1ZS8A 5GGVH 4YNYA 1I1YB 3P30L 3BDBA 1LO2H 2DLGA 5AUMA 1ZT7B 1BD2B 2C5DC 3QIUD 3WLBB 1TJHH 5E2TL 4CW1A 4LHQB 2ZKHL 5I1DA 3HE7B 2EKSB 2IH3A 3IU4L 4WHCA 1JPGA 4F9LC 5FB8A 1REIA 5KSAA 1N5AA 4BQCA 1U3JA 3VXMD 2DL2A 1U8JA 4R90H 5D6DA 3P11H 3AVEA 1K8IB 3EJYC 2NY1D 1AP2A 2AJSH 4LSRH 4QKXB 5EU3B 2FO4A 2EYSA 3VXRA 3TYFA 4AG4H 1QRKA 3DROB 4ODHL 3L3OA 3SDDB 4UDTB 5DUPH 1J1PL 1XF3B 1R24A 3QUYA 5J12B 4XB8A 3IDIB 2ZJSL 4PV8A 4ODXB 1T03H 3LKOA 4QRQB 4O4YH 2HWZH 5FIEA 3X13B 2DLHA 1G6RL 1ONQA 5T3ZE 2CJUH 4IBLT 3IFNL 1QFWI 3PGDA 1AQDB 1EHLL 1TTFA 3VFTA 3WHXB 2BSED 5D7LD 4L8SB 1IGCH 4QYOA 3SKJH 5FHBH 1YN6A 3DX7B 3EO1A 1KCRH 4LLUB 1EGJA 5B3JF 4MAUH 5E8OA 1B4JL 1MCOL 4WWKD 2A1WH 3ARZA 2GK0B 1JGUH 1N3NB 4R97B 1S7XB 4PD4K 4WU5B 1QSEE 1DUZA 4B5EA 2W0FB 4MNGE 1B88A 3X3FL 4QHKJ 5IV2B 3W0WB 5DEGB 2FECL 4WHDA 1N26A 2P8PB 4W68A 1T0MB 2X1QA 3HI5H 3O6KL 3WMSA 5KSAC 1DR9A 2XZQL 4YBLC 3U0WL 5HVGB 4TUKH 3MRGB 5IBLC 3ZHDA 2XICA 1XIWC 5D6DC 5BO1H 1A3QA 3UP1A 4Y19B 3ZMRA 1NC2A 5ABDE 1MJJA 1ACZA 1QP1A 5FCSH 5I75B 5DJ6B 2XIDA 3OG6B 3AS1A 1MWAB 2DD8L 1P4IH 3I85A 4HIHB 3KJ4B 3QUYC 4KK8D 1VB9A 2NXYB 1UQSB 4B41A 2IGFL 3RWFA 4DKAA 1BVZA 1QG3A 5F7EH 4OTXL 4GQ9H 2IALA 4UZGA 1LO4L 5E4IA 1RUPL 5HHNB 1ZA3A 1T1ZB 1IQDA 1UEYA 4XNQA 3F5WA 3S37L 5KS9E 3V79C 4PRPE 2FHFA 3RDTD 4K8RL 4MWFA 3C08H 3WO3B 4W4NA 4J3TA 2PTVA 3E2HC 3VWKB 1QBAA 1MCWM 3ARDB 5FKAA 5JHDA 2YD9A 1EK3A 4DJMA 5E4EC 1RIUH 4KPHL 5JOFB 1BFVH 3OG4B 5E6ID 4PLKC 1LE9A 4D8PB 4I0PD 1J8HE 2AJYH 5CJQL 3FTGB 1HHHB 1N59A 5FM4A 5C0BD 2AABH 2R8SH 5KSBB 4GSDH 2E8ZA 4D0BB 4G80B 4D9RE 2EDYA 4PLJC 1KJ3L 3SDCB 4X5XA 1B4RA 3BH9A 1HHGB 2YEZA 1H5BB 3GSQB 2AJVH 4K7FA 4YHIA 5L2JA 5HBBA 4GRLB 3TN0A 4MJID 2XYCA 1Q94A 3M1BB 4KTDL 4Z0XA 5IQ7L 4XHJC 4M6AA 1MIMH 4Z7UB 4PJFF 4PGEA 1NFIA 1JYNA 1R0AL 3VFOA 4QY8A 4NHUB 1BBJA 5FHAL 4FQQB 4GFTB 5IOPB 2VLME 5K59E 1AH1A 4HK0A 4CADB 4POZD 1NAML 3C5ZB 4X99B 5JW3L 1I9RL 1S9YB 3MTRA 1XR9B 5HHOB 1YEKH 2C1OA 4OJFH 2V6HA 1NGWB 2WUCH 4NN7C 2B1AH 3BN9D 1N0LA 5AWNL 4M03A 1Z9SA 4N8VG 5I1CL 4V1DE 3N1MC 4ZSOA 1TCRB 1I8MB 5E2WH 3S4SG 4PJHB 5C70A 1YEEL 4MNHA 2DQFA 4MA1B 3F7YA 3D2UD 4OLUL 1WFNA 1YY9C 4LRNH 5D2NA 2MCG1 3PL6D 1B0WA 3H9SB 3OHXA 3QNXB 4HS8H 4ZOAA 1S8DB 3P9LA 1QFWH 3WSQL 2WW8A 1T22A 3RX5A 5EU6A 3TN0C 5D9SA 1X5XA 5EORL 4U1LB 3TZVD 5HYJB 4JO2L 4CVZA 3TNMA 5BXFB 1P6AB 2RGSA 5F1IB 1DQMH 4C83A 1HYRC 2P8MB 1RULH 1DANU 4KY1L 2ICWJ 3A6OA 2H9GB 4Y5VC 1CXHA 1T21A 5I1KL 2KL6A 1IEAB 5IESH 1FFOA 3NTCL 2CK0H 2D7OA 1J1XL 2HYMA 2FB4H 2E9WA 2X5PA 4RAUA 1G7LA 3WYRA 1MVUB 4GW1B 3GI8H 4QXGL 1P5UA 3B9KD 1DVFA 3H0TB 1H3VA 3HC3L 4IOSD 5CIPA 4LKXB 1E28B 3CGTA 4JDTH 2ICES 5IBUB 2OSLB 1JHLH 4JFOA 1KG0A 4HIJB 4Z7QF 1IMHC 2V7HA 4M1DH 1F45A 1A5FL 4WUUE 4G6AD 3ZYJA 2D03H 1J0YA 4OUUA 1HILB 5D2NC 1M7IA 2CUIA 3FB5A 3BZFA 3RNQB 2EDFA 5FA4B 3T3PE 1ZHKA 4K07A 1IGFL 5IROA 2CLVB 4XWOD 3RGVB 3PWPE 4PGBB 3GEWB 4WUKL 4X4YA 5A43C 4NQEA 3HMWL 1I8LA 2IEPA 3DX8A 2O61B 4L4TB 3U6RA 3EKCA 2NTFB 1TZHA 1P53A 4HS3B 2HT2C 1FFPB 3PNWB 2LE9A 3QH3B 4LLMB 5DURD 1R3LB 1JRHL 1MCDA 4KJPD 5IHUH 4NFBA 1JP5A 1BVLA 1J1OL 1QLEH 1QSFB 4K8RC 4M9OA 5F7FA 4JANA 3WNKA 1NAMA 4FQ1H 3HPJA 1ND0B 4OF5A 2Y36L 2PO6B 2ED7A 2Z93A 1DVFC 1MJUH 5GS0L 2BDNH 4PD4J 4JFQB 4U6YA 3T0DA 3ZO0A 4YHOH 3CSYA 3BQUD 4U1SA 4P5MB 4JKWA 3CFEB 1HSAB 5CLTA 3MX0A 4YFEA 2A74A 2KDGA 2A9NL 2F8OA 4DZ8B 1FORL 1FQ9C 2Y1VA 4NQXA 5FKPA 5TDOA 4LNVA 3ZSTA 1PSKL 2BNRB 4G9FA 2FZ3B 4WV1A 5FO8B 5JW4N 1A6TA 2BNQE 1G7PB 5IROC 2O5YL 4HFUH 4ZFGH 2JB5H 2X89A 5DR5L 3O9WB 3MLWH 4O51B 1UC6A 4LMQI 3ULUE 4LVHB 2YPVH 1NFDA 5ICYB 1T0PB 1I8LC 3UJTL 5I30H 3CX5J 4JB9L 4OLZL 5EOCH 5T3XH 2W65B 4OQTH 5TE4L 1AO7D 1FNGA 3QULB 4WO4A 5L9DL 5LGKA 1U8NB 3BP5A 3HE6A 5J1AA 2R0LH 4YDJB 5KBNC 4JHWL 3SPVA 2G2RA 3OWEA 2NY6B 1SJVA 4UQ2A 4EDXB 5I18H 1FGNL 1GGCH 1MCKA 1QACA 4IDJL 4CGTA 5D7IB 1WUNT 1SBSH 3OGCA 2BJMH 4GS7B 5C2UB 1WFUA 1IL1A 5GRVK 4P4RB 3H8NA 5CINL 5SWSE 3ZKSD 1DDHB 2F19L 3QT2A 2CUHA 4P4KD 1JL8A 3HCVA 4HWBH 4M6NH 4J3UA 2CRIA 4BELD 4LPVA 1XF4B 3LB6C 1WVZA 2F5AH