4LU5H

Structure of murine igg2a a20g2-fab in complex with vaccinia antigen a33r at the resolution of 2.9 angstroms
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
213
structure length
209
Chain Sequence
EVKLVESGGGLVQPGGSLKLSCATSGFTFSDYYIYWVRQTPEKRLEWVAYISNGGYKTYYPDTVKGRFTISRDNAKNILYLQMSRLKSEDTGIYYCARGMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Characterization of Anti-A33 Antibodies Reveal a Potent Cross-Species Orthopoxviruses Neutralizer.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Immune system
molecule keywords A33R
total genus 37
structure length 209
sequence length 213
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lu5H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lu5H01
4N90E 1MJ8H 5JHDA 1Y6KR 2PN5A 4GMTL 1CXLA 4OLEA 5EBWA 4PJ8C 3TCXA 5JOEA 1BF2A 4DTGL 5JMOC 3NH7L 3H2WA 4ODTL 1AHWB 4XXDA 1NKOA 3TBVB 2SEBB 2ZJSL 4P9HC 3S36H 1CBVH 1EJOL 1TJGL 5DHVB 3RWJB 4N5UA 3VH8A 4JO2L 1ACYH 4HZLA 2D7TL 3SKOA 4H1LB 1NJ9A 1QEWB 5IB1B 2YPVH 5JZ7C 4HKBA 4JHAH 2J4WH 5D7SH 3RVTD 4KV5F 2MCG1 2QADD 3FB6B 1OGAE 2A83B 5EIVA 1P4LA 4PJFA 4D8PA 5EU5A 5I19L 3M17A 4XNUL 4OTXH 2Y36H 3E8UH 4ERSL 1NGWA 4L4VB 4Y4FC 1G7QB 2RJMA 3ARTA 4Q0XH 3SGEH 1KXQE 3WN5C 3ZYOA 3KS0H 4BUHA 4H88L 2YD1A 4G9DA 5FYJH 3RHWK 3R06A 1QFWI 5EUOE 1DQDH 2Z31B 4M7ZC 2Q76A 4P3CH 1DTUA 1VDGA 2VZVA 5DF0A 5E6IB 5JXAH 1ZHLA 1HHGA 3MUZ1 5IHUL 3T3PF 3VDAA 5HD8D 4GOSA 2BVOA 1FSKB 5ADPL 3VWKC 4WDIA 2Z4QA 2HLFC 3UTSA 5T1LD 4OD2B 3NAAL 2AGJH 5AG8A 3QUMB 3NBNA 2YWYA 3NABH 5KSUB 5TGBA 4PJ8D 1OTTC 5AWNH 2V7HA 4GG8A 5F88B 4E0RB 5CD3B 1RZKL 3HE7A 2Q20A 1JN6A 4NQCD 3JWOH 3PG2A 3SE8L 3WCYA 3S97C 3JWDC 2IG2L 3RX5A 3BKYH 3HG1B 4D9QD 3S35L 5GRWA 4QHLA 5K9OA 2APWA 4IEFB 3HR5B 5A3ID 4FQIL 2CSPA 3IXAB 3MBEC 1V05A 3FFDB 4XVUD 1BREA 3TV3H 3UZEA 5JPMB 1FZOB 1SEQL 2NY5C 3FQTB 1JRHL 4PREA 5IJVB 5KOMC 2DQJL 3PGDB 1QP1A 2Q76B 5ID1A 5F6IC 1WFUA 3CVHA 5JDJA 3HC0A 4G7VL 1NGWB 1CQKA 1FNLA 4UIMB 3CXHK 2C1PA 3G5VA 1H5BC 2APVA 4GRMA 5I0ZA 3KPNB 4WU7A 5C0EB 3TLRA 4QRRD 4OZ4A 3L95B 4KWUA 1KJ2B 5AD0A 3D1MC 4JCMA 1SMOA 2NZ9C 3VWKA 5CGYC 4Q9QH 1GGCL 1BBDH 5C9KA 5DHYB 4XX1G 1LP9E 3K8LA 3E6HB 3PV6B 5JW4N 2VLRD 5D7JA 2R1YB 2LFGA 4XP5L 4G9FD 5I71C 3MJGX 3EYQD 4FQ1L 4JZNA 4O9HH 4M48L 1WISA 1AXTL 1MFBH 3QEQA 4WI7A 4PJGF 1JYWA 3UC0L 4Q97A 3UTPD 2I24N 3EDDA 4ZFOB 4BZ1H 4AEEA 12E8H 4O2EA 3CX2A 3WFZA 3PDGA 5LGJB 1RHHA 5D7JC 4M6AA 5FYLE 1WQVT 4HF5H 1X5FA 3DX8B 4AEIL 1R3HB 5C6TH 1GZPB 4W6WB 5I8KL 1VGEH 3PL6B 3BP7A 4K7PH 5DRXA 4UB0H 2ITCA 3GSNB 3ZYIA 1OCWH 1NGYB 4Y19A 1OF2A 5DS8A 1FZOA 2F54E 3SDXE 1C5CH 4DKFH 4BQBA 4JR9H 1I7UB 5LCVL 2E6JA 4XAWL 4MNQB 3KLDA 5ETUA 5J7CC 4XVTH 4Z7OE 1KIQB 5ABDE 1UYWH 5DWUL 3D25B 2YBRA 3MA9L 1S7QB 4QXUH 3DNKA 4NN5B 1BEYL 3OGOE 3IXTA 5FCUH 5IB2A 3QISA 4LSPH 3A0OA 1MCWW 3DURB 4OQTH 2ORBL 4I2XE 4R4ND 4BSVA 2R0ZL 2EIZA 3VFRB 4Y2OA 3MBXH 3WFCL 3T04D 4Z7WA 3SE9L 2ZNWA 4HJ0C 4OI9A 3CDGA 1BM3L 3KPPB 4H5SA 4YUEH 5E2TL 2QHRH 2Z31C 3HC0B 4M7ZB 1NMCB 2O5XL 5I18L 5DQDL 2P7TA 1ZKAA 1U8NA 3BP5B 4WUKH 5KSAC 3F7VB 5E6IC 3P4NB 2FLRT 4WU7B 1CF8H 5C0EA 3PXHA 3IFOA 1V7NH 5BS0A 1GPOH 4JY4A 2VDLH 3VD3A 1AGFB 4JE4B 2QQNH 4V2CB 4LRNH 3NPSC 3QDMA 5I75B 3U4EA 2WQ8A 3Q6FB 4K94H 2D7TH 2WINA 3N1FC 2NW3B 2AEWA 1S5IH 3OAZH 5EOQH 5FV1L 2G5RA 2YUZA 1OVZA 3U9UB 2GTWA 3FCTA 4YHPA 2CIKB 1C12A 3R4DA 2LQRA 5IIEA 1EGJL 4YX2H 3QEGL 4NN6B 3GMQB 1RHHB 1YNLH 2QLVB 1E4JA 4K23H 4LGPB 2CK0H 4ZNEE 4PYHA 1DBJL 1KCLA 4PRHD 5DUBA 4UIKL 2EDOA 2X89A 4R2GB 4F80A 1X5GA 1CDYA 3NPZB 3P11L 2A9NH 5HGBB 2FR4B 1AY1L 5GS0D 5I1GH 5K9JH 1FZJB 2NQCA 5GGTL 4FG6D 2YRLA 1TLKA 5CJ8A 4Z7NF 1T03H 2CLVB 4CDGC 2CMRL 3IETA 1X5ZA 4CMMA 5CEZD 1F3RB 3MYJB 3ARDD 1IFHH 3ZT5A 4W68A 2P1YA 2R9HC 2MTPA 4QRTB 1UEYA 4UTAL 4I9WD 2AERT 3VG9C 5L88H 1DVFB 2J5LB 4F3FA 2XQBH 4YHZL 5L7XL 3PQYD 5B4MC 3RL2A 3VXNA 1FLTX 1MCHA 5F7EL 3VU2A 3FOLA 2AJZA 4UAOB 2ZPKL 1BX2A 3BQUD 4JFYA 2DQGH 1OWWA 2VJXA 5SV3A 1MCRA 2W60A 3WXWL 3MJ7A 4HXAL 1NAMA 1PY4A 1NGZB 4GSDH 2OL3L 4OUUA 1HK6A 2NX5E 3G5XA 1YJDC 4DKDC 1GPOL 3Q48A 1B6UA 1L7TL 4HV8B 3DJ9A 5I66B 1JGLH 4TVPE 1A5FH 2EICA 2A73B 5TDOA 3X17A 3CLEH 1QNZH 5TF1H 4P23C 4FA8A 5K9JL 2VNCA 2R4SH 3MLVH 1IEBA 1AP2B 1A1OB 4L8BB 2X70A 1FL5A 2UWEA 1WWCA 4LVHB 3MV7B 4KKBC 4HH8A 4N9OB 2GIYA 1F5WA 1EPFA 3OTTA 2R2BA 3ESVF 5GS2H 3QEQD 5IK3A 5IVOA 4S1QL 1SEBA 2ESVD 3D9AL 5F1SA 3VGEA 3FN9A 2FECL 2DBLL 4XPAH 2VSDA 3U30B 3V4PL 4CRPA 1WZLA 4NBZB 1K3ZA 5EUKA 1MHPL 3QAZC 6FABL 4UB0L 2WBJA 4UINH 3UDWA 2FX8H 2DQCH 5HYSB 5JLZB 4OZHF 1S7TB 2Q7NA 2DQTL 2K9UA 4LLMB 2NXZC 1RZ8A 3ES6B 2OTUB 3C2AL 4W4OC 2AJSH 5EN2A 1IMHC 3U9PH 4JZJC 5A16B 5I73B 1ORSA 3RTQA 3TCLB 1KLGA 2IFFL 4JKKA 5KSAB 4F58H 1VACB 1RU9H 4HD9A 4XTRD 5EA0L 4ZFGH 9CGTA 1ZT1B 1U58A 5FM8A 2KQNA 4EIZC 4DN4L 3GEWB 4JPIA 4PJCF 1U8OA 2UWEF 5FYKD 1PFCA 1EAPB 4P3WA 3GSNA 3H9SB 3B9VA 1A7PL 5C08B 3BISA 4LSDA 3U6RB 5DRZA 2VDQL 1UWEL 4ZS6C 4NJAH 5D2LF 5ADOH 1IEBB 5FDYA 3VXUE 1RZ7H 1YUHB 4LL9A 2VC2H 4OLXL 1H5BB 5DT1L 3VXTA 4APQC 3HC3H 2IGFH 4H8WC 5FCUL 2AXFB 4HWEH 4OZFG 5D1ZC 1LK2A 5GRZA 4YPGA 3GBNH 5DJXB 1DUYB 4KHTL 1A1NA 2JJUA 3L3KB 3DX7B 2WZPD 5DZLA 4HQQL 2FEEL 1L9MA 4S1DC 5EO0A 1NAMH 1S8DB 1N4XH 1DN0B 4Z8FH 1DLFL 15C8H 1J0HA 4EOWL 2Y7QA 4Y19E 1QZ1A 3QZWB 5DD1H 1LO3H 1BBJB 3O0RL 8FABA 4NCC2 5KSAD 1NEZB 2AJSL 4XNQB 3QDMB 4KJQC 1W0VA 2FGWH 2NZ9D 4DAGH 3SDAA 2IBBA 3QDGA 3WL9A 2NTFB 5C7XH 5DMKB 2DDQL 4XP6H 4BQ6A 5ENWB 3CFCH 4W81A 2CKBB 3JVGC 2HTKC 1KTDB 4Z76B 1U6AH 3VFPA 1H3GA 1A6WH 5JQ6L 1EMTH 3VXSD 5IV2A 1E27B 3FFCD 2PO6B 2MPAH 2CR6A 3CU1A 5F1IA 1CU4H 2ZKHL 3SDAC 5DK3A 5KW9L 3BYYA 2H41A 5SX5K 3QUXD 1S5HA 4P2RA 1FJ1B 2AJUH 4UQ2A 2FATL 1CR9H 3U4BL 1DQLL 2R0WH 4LNRA 1F97A 4RAHA 4OCMC 3LRSA 1JGUH 5I1DB 2GSIB 4PTUB 1PKOA 2CLZB 2EDDA 4F33B 3OX8B 3STBA 5FKAB 2F54B 4KKCC 5GS0H 2BRRL 1CQYA 3WXWH 4IRSC 2VKWA 2XKUA 1SHMA 4JQVA 5EZJB 1RK0A 25C8H 3MFGB 5JHDD 3HCVA 3VFWB 5J3HD 5TQ2H 2VDOH 2FSEB 1PDKA 3F7YA 4JJ5B 3GKWL 1MIEL 1PG7H 4N8VB 4OT1L 1RI8A 2FGZA 3MV7D 3BN9D 5ICZA 1MNUH 1KIPB 5A2JH 1KB5B 1U0QA 1N59A 3C6LD 4MDIB 1K8IB 4Z8FL 3O2DL 2R1XB 4OKVA 1Y6NR 2MMXA 1I7TB 5C07B 5BV7H 4WY7L 5CJOH 2XWJB 2HKHL 4Z7VB 4ZO7A 2P5WD 4JVWA 3QUKA 4R2GC 3MNWB 4XNYH 1A7OL 4PRAA 4LCUA 3C87A 3MCLL 4M6OH 4S1QH 1IZJA 4WHYG 5KSBA 3V7AE 1HXMB 2DQUH 1U8PA 4DGVH 2VAJA 1UT9A 2K1MA 2DWDB 1QFUL 4MJ5B 3ZKND 1I4FA 4UILL 1DQDL 2F53D 3V6OE 4Z0XB 4RGMC 4LSUH 2F54D 3CIQA 1KCVL 4P9MH 2J6EH 4JM4H 1ERNA 5J1AA 1E4XL 3SKJH 5SWQB 4M7LT 3GSUA 4YK4C 5JIKA 3O4LD 4CN4A 4FQXB 3MLTB 5C08D 4JREB 5DDHB 2J88H 4NC1C 1S9YA 5I1CH 5FA3A 4QEGA 5BXFB 5IHZB 1L7IL 4TNWF 4MXWL 1LEIB 3RDTA 1BZ7A 2X4TA 1FP5A 2DLHA 3NFSL 3EJZD 3UTTD 2WBJB 4O58H 4QNPF 3OG6B 4H0IA 4LFHG 2BSED 3H9YA 3SKNA 3VE0B 2B0SH 2HVJA 2XKNB 2EIDA 4YHYC 1GGYA 3BPCB 4PV9A 2A6DB 3DO7A 3MRIB 2DQIH 2MQ3A 4LGSB 1KELL 3ARSA 4Y2DA 4X99B 3MRFB 3LV3A 1XF4A 1ZS8A 5KZCD 2HN7A 3QIWC 4ZFGL 4WHCA 3UPAA 1BMGA 2QR0A 5CCKH 4OCRL 5DD3H 4MAYB 1UM5H 3QDAA 4HK0A 4X80H 4ZTPL 1JHLH 2RAMA 5D6CB 1X4YA 2VDKL 3UBXB 3O6KL 3LH2L 5E94B 4XNMB 3OXSA 4J4PC 3QDME 4Z7VA 2N56A 4OGYH 4NO2B 1I7RB 4AL8L 3D3VE 2CD0A 4WNQA 4XPGL 4N0CC 3L5XL 4JFPB 4NQEB 1YEKL 4K3EH 1D5IL 4S0SD 3RWCA 2PCPA 3GMMA 4JM2A 3L5IA 2LE9A 1HCVA 4PRID 3HMXL 5B22A 4C83A 4HWZB 1YNTA 3PHOB 1S9YB 4JRWA 1XGUB 2R69L 4TVPH 3MRPA 3WKML 1DVFA 2VXQH 3FQWB 1N8ZA 3WSQH 3B9KA 1OPGL 4FZEL 3KYNB 1YEEL 5ECJE 1OGAB 2NR6D 4JZJB 1NC2B 1Q9LB 5EU6A 2DM2A 3P30L 2VRAA 3VXUB 1MWAH 4KVNH 2FH8A 1ZTXH 3KPSB 1VFAB 4ORGA 5F21B 5IEKA 2B0SL 5TGBB 4PGCA 3HRPA 4AM0B 1B0WA 1BIHA 1JMZA 5IBUG 3TPUA 2EDNA 3SDXA 4K3HA 3NA4A 1GYAA 4MXWH 1KB9K 3ULUF 3T0WA 2HTLC 1CL7L 4YC2C 4Y1AA 5L6YH 5KJRH 2B20A 3I02B 1H3VA 3QQNA 3WO4B 4IM8A 3DXAD 1KB5H 1J05B 2XXCB 4JFYB 4U1KB 4P5MA 5SX4I 3MJ9L 3LKNA 4X99A 5HPMA 5DQDH 2OZ4L 1AGCA 3SE3A 4U1JA 3F62A 3IU3B 5CEZH 3GMOA 5HDQH 1XF2A 1NCCH 4HXBL 4JKMA 4O02L 4EN3A 2OZ4A 2IFGA 4ZUVB 2NY7H 1LP9A 1V5JA 2ORBH 3TBWB 1E4KA 3AREB 4UZGA 1RULL 2BP3A 4M5YH 4HS8L 2B5IB 2V9TA 1I7ZA 3LPWA 4TVPD 1RFDL 1AKJD 4QY8B 1CG9B 2C7UA 3RNKA 3N9GH 5IQ9B 4LCYB 5DJ2A 3VFOA 1IT9L 5CD5D 5K9QI 3MRJA 2P5EA 5JXEC 1KTKE 1SYVB 5GRYA 2YA2A 5E8PA 4PJ7E 1FIEA 3C60B 2RBLA 4H20L 5CP3A 2FJFA 3EYVB 5IVZA 4BH8B 1KC5L 1N5AB 5IW3A 2PUQT 5IR1A 4PJBA 4L3ED 2BMKB 2FSEA 3UXFA 1IGJB 3WO3B 4MHHG 4E41A 4GAYA 3CDYA 4DN3H 5L8LB 3QDGE 4EKXA 4DZBA 3OMZA 2BVTA 2H2SD 3WSQL 3AB0C 1GAFL 2UUDK 4MQXC 4YZFE 4YHPB 4N1CA 3CSPA 1YY9C 2CGRL 5I71B 3VJ6A 1RZJC 1VACA 1U8LA 1L0XA 1MOEA 3B9DA 4OFDA 3S88L 5D5ME 4EIGB 2GEEA 5FGBC 1X5KA 4WW2A 3V4UL 4A6YH 1TTFA 2QSVA 4RWYH 2C1OA 3DTXA 2CK0L 2PTUA 4NZRL 1GVIA 1NAML 4XP4H 1LE9B 4NRXB 4XP1L 1KB9J 1CDCA 1I8LA 5AZ2H 3VRLF 1G6RA 4Y88A 4Y16B 4K8RC 1C7SA 2O5YH 3BD3A 5FK9B 2C9AA 1HYSD 5HY9B 4LCYA 5DJ2B 4OJFH 1HH6A 4XCYB 4CMMB 4IRZH 3C8HA 3UPRA 2YA0A 4FG6C 4LAJH 4WO4D 4FMFA 4I3SL 3F8UB 1XIWA 1YPZF 2BY3A 1FCGA 3NACH 4G6JH 1C5BL 4CDHA 5B3JE 1W0VB 2NY6D 3VDCA 1I1AB 4NM8L 4XC3H 3L9RA 4NQED 4I4WA 1FNAA 3B2VL 2DM3A 1JF5A 1R5WA 5CJXA 1G7IA 3MREA 1MWAB 5CEYB 3O0RH 3EIFA 3TC9A 3RZCD 2F8XC 3BH8A 1HIMH 3S4SA 2P8LA 4AK1A 2RGSA 5DJAB 5LAXB 2Q8AL 5TFSL 3U4BH 4TUOB 2QKIB 1GIGH 2XQYK 2CIIB 3LKSB 4P5TA 4LSPL 2F8VA 2HFEA 1CD1B 4U6VH 4HK0B 2YA1A 4WO4C 5HHXH 4P23A 4R4BB 3TT3L 3BP7B 1IZKA 2NY0C 2V2WA 1NANI 3R8BB 4Z7OF 1WJ3A 3WEXA 4MQ7B 4U1SA 1R6VA 4P9HL 1LO0L 1J1OL 1QKZL 3K4DA 5DJZB 1U8LB 1TVDA 3PXJA 1NLBH 2MPAL 4K7FB 4GQPH 1G7JA 5J12B 3S7GA 4HHAA 4KRNA 1OB1B 3VGBA 5KVGL 2NMSA 4Z5RA 1S7RB 4DEPC 2AK4A 4U6HA 3FMGL 3DXAB 3PNWB 3IKCB 2ZOKA 3MOAH 5E00A 4ZS7H 5IK3B 2Y5EA 2BCKB 2WBJC 3QZWG 4J3TA 5BQ7B 1G1YA 3FB8A 3K7UA 1YMMA 4ODBD 3VD7A 1S5IL 3O3EA 4QOKA 2FYYB 3ROLB 3HE6C 4GBXC 5D71L 1VESA 1JFQL 1M05B 3OKYA 4MNQE 5D70L 1WAAA 4HBQA 3QUZB 1T1XB 1TTGA 3HPLA 2J8UE 3SDXB 4ONFH 2F74B 3TO2A 5F9WC 3QDJD 2EC9U 1K2DB 5F7FA 3VG9B 5AEAA 3ZTJH 2CIIA 4HS8H 3B8SA 2ICWB 1Z5LA 3GI9L 1DFBL 1KB5A 4EJ1C 3NIDF 3HUJB 2ZG2A 1YEHL 1UXWA 1BOYA 2DWEA 1ZLUK 2X09A 5IEHB 1T83A 2L7JA 5MHSD 4TUOA 3DX6A 3HNVL 4RAVB 4D0DB 1U92B 1IAOB 1NMBL 2VLMD 1BQLL 5KTEH 3EO0B 3CFEA 1RVFH 5DSCA 2G5BB 1MQKH 1KENH 3SO3C 1DBAL 1LP9B 1XGYL 5E8OB 1R3LB 3TFKD 4NNPH 4LRIA 2XZCL 4QRRB 2X9YA 5JUEH 1QSFD 4HHAB 3KYMB 1CE6B 3RNQA 1CICA 4CU7A 1ACYL 3S5LA 4YXHL 3GMNB 5EFIA 3SKMB 2DN7A 4NPYA 5FM4A 5C0GA 4JFEA 4KTYA 2HJFA 2YD9A 4WCYH 4X4XA 1N64H 1J0IA 4GBXA 4ZS7L 3D69A 1X5YA 3SDAB 4XI5D 4YC2B 5FAAA 4N90D 3R0NA 2XWTA 2PXYB 2FJGB 4LLVB 3QUYB 4LHUD 1BJ1J 3F7PC 5BS0E 1I1AC 4LU5H 5BZWA 4JN1L 1QEWA 5IB1A 2X05A 1RIHH 1MCPL 1F4YH 1AR2A 1CVRA 3WNKA 3B83A 4XVTL 1MIML 4JO4H 1BF8A 3KPLA 3STLB 1AR1C 1DSFH 3V0WL 3WFDH 5I30L 3ZE1E 2J12B 5GGRB 1DBMH 4NZRH 3P0VL 2ADJA 2ZUWA 3PGDA 3KVQA 4TVPL 1AIFB 3T77A 5I19H 5KVDL 1WC7A 3RWCB 4ZTPH 1YUHA 1JTOA 3VXTB 1JWSB 3KXFE 5DMJB 3SDDC 4HJJL 4OT1H 1U95A 2G9HA 3SDCB 1WWBX 3VXMA 5MI0B 2H9GB 4YO0B 1PLGL 1NCAL 2XY2A 43C9A 1G7PA 2PYEE 1P4IL 4KMLB 4J4PA 4TSCL 1OAZL 3ZE0F 2GJJA 2XTLA 4MS8D 5E8OA 3SKUD 2H6PA 5EU6B 3I50H 1S8DA 1T3FA 2JIXA 3LPGA 3DVNB 2DS4A 3QNXA 2F58L 3DGGA 3T3ME 5CD5C 2AQ1A 1DEEB 5BMFL 1TETL 2YKLL 3QUYA 3RIAF 1I8MA 3RVWD 1MPAL 3SPVB 5AWNL 4U3XA 3MRCA 3WL9B 3NFPB 5I8EA 5B38G 4GBXB 1UJ3A 2DQTH 4OKVB 4ZPVB 2I25N 4R96A 2BXYA 3SJVD 2EZ0D 5JZ7D 1G9NL 1OAUH 3PWPD 2BSSB 4HPOH 4WVRA 1HQRA 4XVSH 4ZDHA 3KLHC 4KI1A 4JFED 3GMLA 4JPIB 5D7IE 2F5BL 1XGRB 1S7UA 4Y5XC 3EOBA 2BNUA 4U6XA 1IAIM 3V5DB 3QULA 3RVXD 2F8OA 3EGSA 3S36X 1NQBA 2ICCA 1KJMB 4HX1B 1W72L 3WNOA 4QT5A 5H94B 1UM4H 4OD3H 2YSSA 3JSSA 3SJVE 4WWKB 4QY8A 2ATPB 4PRHE 2A6IA 5KOVC 5I8OH 4LSUL 1JJUA 5JO5B 3B2UD 3MX0A 1ZWIA 4GRWE 4X6BB 3K74B 1F13A 3HMXA 3FHAA 4HT1H 3L1OH 2WBWB 3FT2A 4OFYA 1OSPL 1U9KA 5HHOE 4NQDA 4X8JA 5DQJB 3MLZL 2BOBB 3KDMA 3IF1A 2BDNL 4KDWA 4M1GH 4X6FB 4LVEA 3X12A 5INDB 1I3RB 2ZG3A 3OKKB 3IVKB 4JG1H 3G6AB 5C0CE 5TPWL 3AS0A 1LQSR 1RZGA 1RUAH 3FT3B 2V7NA 4JFHD 4YDJA 4F2MB 3ULVD 2E7LA 3F12A 1A7NL 3HZVA 4KUCD 1WT5A 5DLML 3P0GB 1TITA 1P7HL 1QA9A 2FX7H 3DRQB 3T2NL 4PJIA 1BEYH 4WEBL 1NBVH 1OTUC 2E9IA 3IJHA 1KPUB 3PHQB 3QIUD 3FO2B 4YR6A 1ZA3B 2OTWA 1LGVA 2AI0L 4JHWL 3JTTA 1DFBH 4QOKD 5C2UB 2OK0L 5HHVL 3NCJL 1RURL 3KPTA 5F1IB 2PR4H 2QBWA 1C7TA 4YDVB 4DQOL 4KK8D 4X6DB 3HTLX 5TQ0L 1K85A 2R2HB 1NC4A 4Y4KA 4ONGH 4JANA 1LNUA 3HZMB 3RKDC 4D3CH 3WFHB 1FPTH 1BFOB 1SVZA 5E2WL 3P4LA 3A6BL 4XZUB 4LLQA 4HW6A 1TZHA 2YEZB 3CK0L 3RWDB 3RPIB 3KXFA 3MRRA 1MLBA 2Z92A 1AC6A 3QJFA 2IEPA 3BPNC 2LU3A 2LABA 1FHGA 1DUZB 4ZFZA 3KHOA 3GMNA 1OAKH 2GTZB 3JWOL 1D5ZA 1I1FA 4PJ9C 1ODAA 2IF7A 4N8PA 3D18B 4EUPG 4X4XB 3DARA 2GCYA 3EO9L 4P5TD 4YXLH 4G6AD 1U93A 4CADB 5HHME 1OT1A 5JIPA 3RWHA 2ZUQB 2YUXA 4I1NB 3TNMA 2AJVL 1ZGLM 2AJZB 1JIBA 3PWPA 4Y89A 3TYFA 2MWCA 3BPCA 4PV9B 1F90H 1HN1A 1LO0H 1MHPH 1WT5C 3MJ7B 3FT3A 1EA9C 4PLOB 4AEHH 3DUSB 4WTZA 3EAKA 5AZEH 4JM2C 4HV8A 1UZ8A 3OAZK 5DJ6A 2VC2L 1N7ML 1JE6A 3CAFA 1XGTB 3KPMA 3AGVA 4NNXA 4PJIB 1AGCB 1N26A 1T7ZA 4HXBH 1DL7H 3B9KC 5A2IH 1LK3H 1KCUH 1RK1A 1KCRH 1NBVL 4YIQB 2FEDD 5E2WH 2HAZA 2JIXD 5DURB 4OI7A 3RIFF 1OGTA 5D9SA 3BZFB 5D2NC 2AK1H 5EU5B 1D9KA 3RWIA 3WNMA 5GGVH 5DZOA 4I77L 2FR4A 2JJSC 1U95B 1X7QA 3ARRA 2A74A 3MR9B 3QYCA 4PJXB 4JRYE 1LP9F 2DB8A 1A3RL 4XWOD 2YD5A 2PYFB 1YJDL 1B2WH 2EKSA 4P4RB 1I9JH 1MJJA 1INDH 4IMLB 3QHFL 3S96B 4LGRB 3DYMA 4HXAH 4RFOH 4G80B 1HYSC 3KPPA 3ROOA 3RWDA 3P9LB 3TZVD 2KUTA 4HUWA 4WDIB 1LEIA 4JFQA 2ZSWB 4FZ8H 3UPCA 3S36L 1QRNB 3VXQB 4R0LA 3I3DA 2ADGB 1KNOA 1F6FB 2B8OT 1FVEA 4NO0D 3SPVA 2Y6SC 5B3JF 2P48B 2X1QA 1MAKA 2YRPA 4CL7A 2J8UA 4MX7A 5D93C 1I1CA 5EB9A 4ETQB 1MAML 5IEHA 5KVFL 1T22B 2E7MA 2IPKB 3MJ8B 4PJCB 2VH5L 2CIKA 4ZSOB 3QWOB 5F89B 2EYTA 3QP3A 1DQLH 1SJHA 1NBZA 3D9AH 4J3OC 1TNMA 3D85D 5BW7A 4FQJL 4PV8B 5CAYB 2DLEA 3O6KH 1XGQB 4WJ5A 1QVOB 3QA3A 2BOCB 3DX6B 4ZUVA 1W72H 1AP2A 3T0XA 4O00A 3PIQA 4KJYA 4Z0BH 1EVTC 2ZKHH 2Y06H 4PJXA 1ORQB 3T0EE 3O11A 1XIWC 3Q1SL 4G9FE 1JGEA 3L5XH 2DQDH 4PBWD 3QQ9C 5H35A 4NO3B 4K8RH 5EBGA 1H15A 2E6QA 2P43B 5BVJA 3REVB 5EA0H 5C0AE 3IAPA 1QRND 4NSKB 1WBYB 3IDYB 1OAQH 3OJDA 4WI4A 2XN9A 3LKPA 1QPPA 1B4RA 2HT2D 4OCYL 3G08A 4CW1B 3BPNB 4S1RL 3DVFA 4UV4L 4ENED 3MFFB 3KYOB 5TQ0H 3X13B 4PGCB 2ITDB 5ENWA 4NOBA 2EC8A 4A6YB 1IAIL 2EDQA 1I9JL 1Q38A 1NDGB 4PLJD 1ADQH 2R29H 2FL5A 4Y16D 3PV7A 1M7IA 4XVUC 2C4FU 5CP3H 2GJ6E 2XZZA 2XFXB 3PHQA 1QBLH 3QNZB 4IBLT 4X98A 4TQEH 1UXSB 1MFEH 3S3JA 5HGHA 1MREH 4DGYH 4P2RB 1FJ1A 1I1YA 2W07A 4IRJC 4X5LA 5HJ3B 4U3HA 2EDLA 2W0FA 4BSWA 2FIRT 4UBDD 1HYRC 3ZKMD 2YD8A 1YQVL 2CUMA 2EDWA 1T04B 2Q7YA 1KIUA 4KRMB 3MMEA 4MA3B 5BJTB 2V17H 1MEXH 5FYKU 1C5DB 4DAGL 3QEUB 4GAGH 1T3FB 1Z3GH 1ZHLB 5JPNB 2C7UB 5D2NB 2B4CH 3K8KA 1PZUB 3AC0A 3MUGA 4HKXA 3KJ6L 4JRYD 1XAUA 1U91A 4XGZA 3CH1A 3HI1A 4OLYH 3QZWA 2APFA 2AJXL 5L2KD 4QTIH 1U3HD 4YWGL 5IR1B 4YDKH 1SQ2N 2CRYA 4YPJA 3VXOB 3M8OL 3L3OA 5BCAA 5GS1A 5J57B 1EHLH 5HHOD 4AL8H 3RBGA 1IRAY 4U31A 3N0PB 5IW6B 2IQAB 5C9JB 5L7XH 4KUCF 3AS2A 4GQ9L 4XMKL 5E9DA 2YPLA 2R69H 4PP2B 4FHBD 1QRNE 2ID5A 3OKLB 4YEFA 2BVYA 3O8XD 1TZGL 1SVCP 5T3XE 5KANI 3BUYB 2VQ1A 1D5IH 1TJHH 2JELH 3NFNB 4BSWB 5C08A 3U6RA 1IAIH 1VFMA 1XIWD 3O4LA 1YN6B 3PABA 4MA3A 1A7BA 1MHCB 2QHLA 4FQPA 3SCMA 4AEIH 4O4YH 4Y7MA 1K6QL 2V5RA 2N1KA 4XPFL 3BKMH 5HI5C 4MDJA 2NYYD 3MGTB 4WIQA 3OJVC 3LKOA 4MQTB 2A6IB 4W4NA 1Q9WB 3JZ7A 4XCYA 5DDHA 3X3GL 3ULSA 1ZTXL 2BCKA 1IKNA 2E7CA 4ZPTA 2XT1B 4H25A 4Q9RL 5L2KB 1RZGB 1Y0LA 3OB0H 4F7MB 1IGIH 2P5WA 1C1EL 3BDXA 5K59E 3C09B 3BE1H 4TUKL 4HH9B 3VXQA 3IF1B 4F9PA 2YPKA 2YN5A 5CP7B 3VXRB 4ETYA 2HVJB 4CBPA 5KVDH 4JKPL 1PYWA 3BWUC 4NQCE 4NZTH 1CK0L 2RCSL 5F3HB 4JY6B 5CLWA 3LEXA 2UZIL 4N0FB 1WZ1L 4KMQA 3NPSB 4Q6IA 2IBGA 1IT9H 4DK6A 5J11C 2XI9A 2J8HA 5DHVA 3S3SA 2OR9H 4PJDE 3LN4B 5J4MA 4YFEA 4QRUB 1CGYA 5IB5A 3B3IB 4WY7H 1MAMH 3BP6A 1LO2H 1W0YT 2DWEB 2ITCB 1B6DA 4NQTA 5GJTL 4TNWK 4WW1A 1MHCA 4FQIH 4JRYA 3BXNB 4WNQB 4RDQF 5C0JA 2P5ED 3ECBB 4S1SL 1BPVA 2DWDA 3QO0A 1UGNA 1JZ2A 3WE6A 3L3DA 5SWZA 4Y4KB 2X4SA 1GGTA 1UQSA 2PXYD 3OB8A 5HXMA 4KDTA 2HLAA 1WCQA 3D3VA 5F7DB 1IKFH 4TN9A 4LLQB 3KYMA 1PW3A 4H25B 4NRZB 2AJVH 5CZXC 5E8NB 1DJSA 4JGMA 3FONB 4DN3L 3C8KA 3IT8D 1EXUB 5EU4B 4GRWF 1VHPA 3VXRD 1EJOH 2YKLH 2HJLB 5IMKA 3WDJA 4DVBA 5EO9B 1CFNB 3GJFA 1SJEA 3G6JF 5DA4A 4F9PC 3SKNB 3TT1L 1QLFB 1NBYB 5JMRA 3ARFA 2V7HB 5F7MC 2OCFD 3I50L 1ZLWK 3U4EB 3FQNA 1LK3L 5EC2B 3SDAD 2F74A 2QQQA 4HS6B 5F1NA 5CP7A 1UVQB 3HNTL 5KSAA 5KANG 4ONHB 5ERWA 2BRQA 3HMXH 1KEGL 1ZT7B 1SBSH 3OR7A 3MJ9A 4HUUB 4CNIB 1ZV5A 5I76A 2WM0A 3EGSB 4NN5C 4TQEL 4GG6B 5K9OB 1JYVA 1BD2B 2ESVB 5IKCB 1J12A 2A74B 1KOAA 3WE6B 4LF3A 4HBCL 3KPNA 4KJPC 1O0VA 5CKAA 2IPTH 4HEPG 2R1WA 1OGTB 5D9SB 2H2PD 4UT6H 2YD7A 4X4YA 1YNKH 1HIML 5DFVC 1G7PB 3RFZC 4S1DD 2VLJD 4KDTC 3T4AB 3D87B 3UAJC 2I5YL 3PV6A 4PS4H 3G5VB 5JW4Q 5SWZD 3NVQA 2NY6B 4ZUTA 3FRUB 4AIXA 3BZEB 3H42L 2ENSA 3L3KA 4CJ1A 4X7FC 5AD0B 4F37F 5IESL 4P4KB 4HIHA 5ALBH 4P49A 1CDGA 1A4KB 1T21A 4BFIA 1X5HA 4G8EA 3I3BA 2Y7QB 3FN0H 2XACC 4ONGL 4YGAB 1A7QH 4PG2A 4JDTL 4HS6A 1PKQE 4JB9L 5F1NB 2QQNL 1KYOK 3QQ3A 1CFBA 5FGSA 2VITA 2IPKA 4XCFH 4UMGA 4F37K 2BFVL 1C16A 2OXHA 1G7HA 4O51B 4D9LH 2Q86B 3FO0L 2EECA 3MRFA 5I74B 4R0LC 3OKLA 1CXEA 4JEGB 2HP4A 1U8MA 3KPQA 2F19L 3TBSA 5IFHH 2D0FA 3GJEB 5A2FA 5IKCA 1CD9B 5DJ0A 1UH3A 1I8LC 5IWLA 4UU9B 4CVZB 4OCSH 5C0AD 1FNSH 4X5XA 2B4CC 4PGJA 1DN2A 4CNIA 3BMVA 4O02H 4PJAF 1D5MA 2J2ZA 1G7LB 2ZOLB 4KQ3H 3RKPA 3U0TA 4BZYA 1A6VH 1BZ9A 1JWSA 4PJIF 4JDVB 5HHPB 4OZHA 5HY9A 3CSBA 2I60H 2XRAL 4HFWA 2Q87A 5FOBB 2VSCA 3QA3B 5HYQB 1IEAB 2Z92B 2F53A 4YO0A 2P8MB 5J0BA 5CEXA 4M8VA 2EDJA 2H1PH 4MS8C 1AGFA 4NZJA 3IDMB 1JGVL 4K9EL 3MODL 5D72L 1DANT 3CFJB 3MLUL 3ZLQC 2NCMA 1T21B 3GRWL 5HVHC 3DX9A 5DK2B 3T8XA 1JK8B 3IVKA 1I8KA 4HWNA 2HH0H 3BZEA 3O3UN 1ZEAL 4NZUH 3QUXB 1NDGA 5BS0B 5E2VH 3OJDB 2BNQE 3BEVB 3H7LA 2DQHL 4TSBL 5KS9F 5C0RL 4FTVE 1WZ1H 3CZJA 2Q86A 5IFJA 4LHJB 4DVRL 4LSSH 5E9DD 3MRNA 3UYRH 1P53A 2FX9L 5C0BB 3O4OB 4QF1B 4OLWL 3I02A 4LDOB 2E9WA 4KK9D 3UZQA 4L4TE 4FABH 2ZSVB 3HAEA 3OR6A 3AY4A 5E8DH 2IH3B 1LO4H 3S6CA 1CD8A 3VFNB 1P5VA 4MB5A 4Q2ZA 3RX7A 3O3BA 1H3WM 4HLZG 2ATKB 2ICEB 5CHNB 3LMJH 2A6KA 2BFVH 4U6TA 3QH3A 4FTVD 4JDVA 43CAB 4RMTA 1EO7A 3ORJA 5LKNA 5IGXL 2DJ4A 5D7SL 4IOFD 2P8MA 1IC4H 3MRDA 2X89D 1AO7B 3INUH 1GSMA 1FFNB 3MLUH 1I3GH 3C5ZA 5A2LH 5D5MF 4PJ9D 3QQ4B 2G75A 2CLVA 3C9NB 4TPRH 3FONA 3WV0A 5I6XC 4MA1C 3GKWH 5GGVL 4ODVL 4JFDA 3IFNH 3TA3C 3RI5K 2Y25A 5IVZB 1BX2B 5T5FH 4XPHH 4NIKB 3MOBL 2MOVA 1FZMB 1OPGH 4FZEH 1BM3H 1OT2A 1TZGH 2VXUL 3E3QE 5E2TH 5ID0A 3VXSA 4LCWA 5E9DB 1QFUH 4AH2B 1YJDH 1M6OA 4OF0A 1K8DB 5HVWA 3HLAB 4NHUB 3QDMD 2OL3A 2QQKL 4QHNB 4YDLC 2IMNA 2IC2A 4L5FH 1R5VA 2WQRA 4LFHD 4Z76A 3MCLH 3P40A 1K4CB 3LKQB 3TVMA 3GK8L 4XNMA 3V4PH 1U8JB 1JTTA 2QSCL 3GBML 1ZS8B 4HK3J 1MFAH 4GKSB 4XNXH 3W5MA 4EVNB 2BJMH 1NGQH 4TSAL 4PBVC 3HS0B 1XF5B 3WEXB 4K94L 3EO0A 1MJUL 4ODHH 1UENA 5I1KL 3T2OA 3ARED 3TIDB 4KUZH 1Q0YL 4KJYB 2ZCHL 3BVNA 4A2LA 4NQDD 1K9TA 1A6TB 3QI9C 3ZHKA 4JPWL 3TYGH 3IU4L 3VI3F 1ND0B 1MIMH 5ICYB 2QTEA 4EI5D 2VDML 3BW9B 1MAJA 2UYLA 4MXVE 5DYOB 2JB6B 3V2AR 4ODXB 1H15B 4IRSD 2FO4A 4QYOB 5LBSH 1JVKA 2PYFA 5E6ZA 5TH2A 3CK0H 1XR8B 4UDUB 5GSRB 5TE6H 2XY1A 5T5NF 3QI9A 4RZCB 1YYMH 1HOCA 3GZKA 1RK0B 3FB7A 1EZVY 4LPYA 5EC1B 4JY4B 4ZSOE 1TTUA 1NSNH 3BGMB 1UH4A 1NCUA 3DYPA 4PJCE 1Y0LB 5F8QC 4UT7L 1RAMA 3V4VL 1RMFH 4JFDB 1H8NA 2V17L 3WFEL 1BQSA 5DQ9B 4M6NH 4Y5VC 2GTWB 3FCTB 5EG6C 1IL1B 4K94C 1VB9A 4I48A 4OF7A 5ILTL 1H3TA 4OZGE 1RJZA 1ZHKB 4TRPL 2VZ1A 1XF2B 3QUKB 2VLJE 2Q6WA 4DGYL 5MEPA 1EMTL 4MQXD 1LEKB 1G6RH 2WWMC 5D96B 1YYLL 4PRIE 3RUGA 3LCYA 3O4OC 4HC1H 3LIZH 2W9LA 5C0DB 3RWGB 2YZ1A 4LLDA 4QXWA 3TZVA 1T83C 5FUCE 5E1AA 1NLDH 3CMGA 2WMPA 5D7LE 1INEH 4J4PD 3IDXH 4Z0XA 4C58B 3IGAA 3IETB 4ISVB 4JO2H 4LLWB 1FV1B 1RD6A 4RGNB 1U8QA 3H7BB 3U0PB 4YFLI 1TFHA 3DVNA 1I9RH 5CLTA 3W39B 4MJ6A 3MRGB 1V7NL 3RWFA 3MRKB 3A67H 3MRBB 1BOGB 3ET9F 4MJ4A 3SBWA 1FQ9C 5CJBA 4YXKL 5TDPB 1MEXL 3M8OH 4MD4B 3NA9H 3E2HC 4WGVB 4LCIH 2VDMH 4APQD 2EO9A 2YXMA 2BNQB 2HFFB 3MBXL 4MA1B 2VOTA 2PTVA 3NCYS 2A6DA 1XMWA 1J1OH 5GRVK 2E5EA 4L9DA 4PJ8A 4PTTB 2LV4A 1CFTA 1KGCE 4D9RE 2VKXA 4UQ2B 4NGHH 1OQOA 5HSFA 2YZ8A 4U2YA 1FGNL 1ZMYA 4B53A 5GHWL 3KPRD 3SE4A 1A6PA 3CXHJ 3QFDA 1SJHB 1E6JL 3WUWG 4R90L 1XH3B 3KNBA 4X9HA 4K8RD 1WUNT 1FL5B 4JQVC 4FXKA 4TULH 3T1FB 5FA4B 4PRNA 4EDWL 3FT4A 3R1GH 3BZ4A 4XPTH 5GGSA 3KXFD 1A7RH 1VEPA 1X44A 5A1AA 5FGCE 2Q3AA 4FMKA 4P2CG 2DQIL 3MRBA 5EZLB 3WIHL 3IRPX 4WRLA 3BGAA 1TXKA 4TPRL 1BFVH 5B8CC 5DZNA 2NY5H 2J88L 3CSYA 2GFBA 5CIPB 4YHIB 5I1CL 4KZEH 3OPZH 3SY0B 4CVXB 1MWAA 4BZ2L 4NHCL 1RJYB 4M03A 1AFVH 1LE5B 1QO3B 3NIDE 4XMLL 3OKEA 4N1HB 1P9MA 3GJFH 3KYOA 3B9AA 1RUPL 5J1SC 5ICZB 4QHLB 3QDJA 5KTEL 4QTHA 3JWDH 3V0AC 1JL8A 5ALCH 5I1EL 4CU8A 4WWKC 5GGVY 3BH8B 3KPRB 4AENB 1TVBA 2GUOA 3L1OL 5DRZB 4UAOC 5GZOD 3ARQA 1FGNH 4X6CF 5HGAB 2XOTA 2AKRB 1K4DA 4KXZI 4LVOB 3ISWA 4Y5VB 1WICA 5IJKA 3BXNA 4KQ4H 3GMOB 3PHSA 4WI9A 1DBBL 3IDGA 1ZHBA 1MCDA 1RHFA 3GSNL 4U6HB 2X9WA 5T1KB 4FQQB 1CXFA 2CDGB 3DI2B 3CC5A 4RFEA 4NP4H 1H0DB 4P2QE 1XH3A 2XICA 1ED3A 4HUVB 3QEUA 3DBXB 1TIUA 5I0DA 3QG6B 4WHYH 4Q6IC 3LEYL 3VWJC 4EQ2A 2VDPH 1AKJB 3U36A 4QRTA 3GUTA 4KTDL 2WIMA 4Y19D 4ENEC 2O61A 5AG9A 3HPLB 4S0TD 2WV3A 4M1GL 3O81A 5I75C 3NCJH 4PLKD 1AHWA 4XXDB 3VFUA 2GT9B 5CILL 2E8YA 3BT2H 4OZIE 3RUGE 3KLAB 1MCJA 2IH1B 3G9AB 4ZO9A 3IFPA 5IMMA 4Z77B 4JZNB 4M6NL 1DBJH 5ERWB 4MWFA 2HVKB 4P9HH 1NGZA 1XGTA 3KPMB 1I8IA 3RAJL 1T89C 3JTTB 1MFDL 3MRNB 3D85B 5D7JD 2Y5TA 4LLUB 4MNQD 1I7RA 4R9HA 1RK1B 5H37G 5EOQL 2VZ3A 3KJ4B 3L6FB 2MNUA 4TRPH 2XV6B 3STZB 4QOKE 4E9LA 2XA8L 3EYSH 4K71B 5EOCL 4LOUC 5C0JB 4QRRA 4N0CD 4Z7QE 2AKRA 2FB4L 2E27H 5FK9A 1PX4A 5CHNA 4U33A 4PG9A 1KIQA 1J5OL 3P3YA 2ED7A 4NWUL 1OAQL 5I2IB 3ZSTA 2X42A 3UPRB 3H9ZA 3FB5B 3QO1B 4I0CC 3CFCL 3FRUA 1EX0A 5IBLD 1JP5A 2IPUK 3FO1A 4MCZB 1HILA 5IESH 2QQLL 4OQ1A 4F15B 2RFXB 3H42H 4OV6F 1MJ8L 3WLBB 3O9WB 3HCVB 2XTJC 3UJJH 3D18A 1FLRH 3RL1B 1KNOB 3X12B 2M1KA 1A3QA 2AS5M 1HEZB 4PFEA 2KDGA 3VGHA 3TO4B 1KN2L 5DHXB 4Q9BA 3CVIL 4DW2L 1RPQA 1SMAA 1R3JB 1KJ2L 1OAYH 2GI7A 4GW5A 1UB5B 1UA6H 5DMIH 2R1XA 4HIIA 4XBGB 3QIUC 5ESAB 4AH2A 4XP9L 3SKOB 4Z9KB 3ARGC 3WS3B 1TJIL 3HS0A 4RMVA 3CPLB 2ENYA 4PB0L 5ESQA 2BVQB 3GGWB 5BZWB 1MQ8A 3ELAT 4G42A 3TH4T 1OY3B 2V2WB 4YGVB 1YY9D 3EFDL 5IIEB 3DLQR 3QR2A 1U2CA 3UTSD 3GK8H 2HFGL 2VLKD 1JPSL 4XRCA 2ZOLA 2PW1A 5D7LB 1ZEAH 3MNWA 2FD6L 4NHCH 1RUML 5JOPD 3MNVB 1NFIB 1DDHA 5DC9B 4K55A 1BJ1H 1D6EB 2DIJA 4GAJL 2QV2A 3N85L 1W2KT 5D72H 2UVEA 4HAGA 4LIQL 1FZJA 3DSFH 4NRZA 1A7NH 3CSGA 4JRXD 2VB5A 1BLNB 2VXVL 1EEYA 5DUML 1I8KB 2NX5D 3G08B 5BOPA 5FUCC 3OF6D 3C6LC 4XCNA 2X40A 3QWRA 3BQUB 4X6CA 4X9GA 5AUMA 2BDNH 1N0XL 3UJIH 2G60H 1AI1H 2A9ML 4NM4H 4BQCA 1IVLA 2JK5B 4YX2L 5ESVB 2H2SC 2DLGA 1R3HA 4B5EA 4NKDB 1MCOH 5D1XA 4KPHH 3MRIA 4TTDC 4Y19B 5DS8B 4JY5H 3KPQB 3TBSB 3K4ZA 3MOAL 2WLYA 4KK5C 1CFVH 4EI6B 2BSSA 4ZDHB 4KVCL 4ODSL 5C70A 2HKFL 5EU6D 3CGTA 3ARDB 1A14H 5ILTH 5L6YL 1VFBB 4N8CH 3I2CH 1F02I 1HH6B 4GXUN 1DQJB 3ARBB 4JN1H 3AAZA 3SO5A 1DVFD 1CFQB 4WI3A 5CINH 3OGCB 4NZTL 4S1RH 1C5DA 4G6MH 4NOFA 4BSVB 4G9DB 1NAKH 3OSKA 2YSSB 2FDBP 3EO9H 4YXLL 3NA9L 4JM2D 3CDCA 5E08L 4MA7H 2XPGB 1J88A 4P2RE 1PAMA 1X4ZA 2AK4D 3UAJD 3MZTA 3LEYH 1BQHB 4ODTH 5CJXC 1ZVSB 4HPYL 2Z35B 4MD5A 3IJSB 5T1DL 4LSQH 2W59A 1YNTB 3PHOA 4JFEB 3W39A 1JK8A 2EKJA 2DQEH 4G6KL 3WN5A 1WV7T 3EDFA 1RZJH 3DVIA 5F1OB 2HJKA 1UWXK 3T3MF 5TDPA 1M6OB 4JR9L 4PTTA 1HINL 1B0RA 5J89A 3DVGA 4LDEB 4A6YA 2PO6C 3TYGL 4IRJB 4Q7DA 2AJUL 2BXZA 5JORB 1MQKL 4RWYL 3WMSA 4TOYH 5I8KH 1I7TA 1R3IH 4OFKA 1OM3H 4MYWB 5C92A 1HZHL 4ELKA 3ZDYF 1JWMA 1UC6A 1TCRA 1FBIH 4XTRC 2PNDA 3P9MB 3ARBD 4FFYH 4PY7B 4OAWB 2XTJE 4GXVL 2OXGA 2DLTA 4NC0B 5I17A 3E3QC 3Q5OA 3IDIB 3QUML 2QQKH 2B1HL 5KZCB 1NCWH 3WIFB 5AAWA 3V4VH 4WCYL 3GI8L 1GHFL 3IU4H 1IKNC 1D5MB 3CVIH 3U0TB 1VFBA 1J1XL 5I2IA 4MZ3A 1QFWH 3BAEL 3OJ2C 4LK4A 1DQMH 3VRJA 1CGSH 1RZFL 5DA0B 5GGSB 5SWSA 2NY1C 3HR6A 3ZMRA 2PXYC 1MH5B 1NMAL 1A9BA 3DRTB 4XNQA 2YD3A 3GSWB 2YPKB 2X1WL 5D5MB 5DHYA 3O3EB 4QOKB 1YYLH 1KENL 4FQ2H 4LKXA 4LVNB 4XCCH 4I3SH 4X7TB 4GW1B 3WJJA 5DQ9A 2F5AH 5FYKH 4L8SC 1KPRB 1FGVL 5DI8B 2PO6A 5HYJD 3PWVB 4N0YH 1FBIL 2CLRB 1FG2B 2CO7B 4GUPB 3BKML 2YHGA 4EI5B 1Y18A 3WNPA 3CPLA 1VEOA 4RX4A 5DD0L 1AQDB 3SE8H 4PJEB 2VE6B 3GMQA 7FABL 4HWEL 1VA9A 4WW1B 5C0FB 2VN7A 5JTWA 3WYRA 3D39B 3HC4H 4HUKB 1KJMA 4HX1A 4Q2ZB 2R0LH 2UWEE 3SCMB 1MNUL 2QJDA 3BKCH 4G6FD 1VFOA 4ONOA 5ICYA 1KN4H 4GKNB 2NY2C 2CPCA 3MBED 3BP4B 3F6IA 1IQWL 3V5HA 1AKJA 3L5WB 4HKJB 1A21A 4KMTL 4M7LH 4P5KB 4PTUA 3UYPA 2B1HH 1T5WB 3F5WB 3OF6A 4R4FH 1SJXA 2NX5A 4TSCH 1I3GL 4F33A 2XWTB 1YNKL 4NQXA 4D2NA 4GRWH 4BSJA 4XCEB 5FYJD 1JNLL 3JUYA 4R90H 2KKQA 2E6PA 1N59B 1UKQA 2ZSWA 3CLEL 3MLWH 3MO1A 3LEXB 4MAYC 3CFBA 1PX3A 2RR3A 4XC1L 1XCQA 5I9QC 1WBZB 1YQ2A 1U58B 2RCSH 3O8XC 4ZSOA 1KPUA 4J7RA 3SE4C 4KPHL 1JZ4A 1R5IB 1R5VB 5JR1H 4JHZA 4F7EA 3KR3L 3D39D 1T1ZB 1P1ZA 3UBXI 4MX7B 4N0UE 5DJZA 1CDBA 1B0GA 3MPCA 4FQCL 1UCBL 2A6JB 2XXMB 3GI9H 5IT2L 4JAMB 4PG9B 5DFVD 3FQRA 1A6ZA 4JLRB 4Q74A 4XC3L 4I3RH 1FORL 2LAAA 3B9KD 5MENB 3IS1X 3L3DB 3BRGC 3B8YA 4EXKA 4I8DA 1KBGH 4UT9L 1BVKA 2AJXH 4X6DE 4EDWH 1I7ZB 2YK1H 1GGBL 4F7CB 1G7JB 2VDRL 4ZNEA 3MUHL 5T3ZL 3GRWH 4IJ3B 3TA3D 3SGEI 4OCRH 3TIEB 3PE9A 4Z7QF 5J1AB 1YECL 1J8KA 1JGEB 1MIEH 4HIHB 4HT1L 2OJEA 5LBSL 3QUMA 1E4WH 5J13B 4WUUD 4XI5C 3U2SA 4O2FB 4W6YB 4JFXA 3M1BA 2EH7L 2P5WB 3TP4A 5GJSL 4F3FB 2K3TA 4L8CA 1YEEH 5ANMA 2BSTA 3FQXB 5BV7C 3OKEB 1T0MA 2DOCA 4LVOC 4X0KB 1LD9A 3ARFB 1E28A 3ARYA 3VXSE 3TYFB 1KLGB 4JFFD 4BQ9A 1OSZA 3HG1A 1FDLH 4PIRF 4C55A 3EHBC 3PWPE 3WS6C 4DZ8A 3NN8A 4M6OL 4MMZC 3NIGF 3HI6H 4RQQB 1UZ8B 5DJ6B 4TOYL 1A7PH 2NXZB 1OARH 2HN7B 3VGAC 1Q0XL 4ZMAT 4XT1C 5IHLB 2EH8L 3P9MA 1S9XA 4XMLH 4BM7A 4X4ZA 3TM6A 4D8PB 3VG0L 4KQ4L 5GS0C 1FL3A 1A3LH 3QCVH 1O5DT 2MFNA 1MY7A 4HFUL 5DD1L 1JUFA 4GKZA 1UCTA 2IQ9H 2AJYH 4MGXA 5D70H 3MV9E 4P2YA 4K3JL 1GZQA 4PJAE 4HQQH 1QFWL 3BAEH 3MMEB 3RNQB 1UQSB 2F54A 1C08A 3DMMB 2DD8H 1NC2D 4HZAA 5EO0B 3MNZB 1K5NB 2I07B 2OJZH 4G8GA 5GISL 3VXUA 3G6JA 1S3KH 5D2NA 3OAYH 3D69B 5FUOL 1RZ7L 4G5ZH 4X4MA 3LN5B 4X6DF 3UZVB 3AVEA 3GSRB 3MROB 1MF2H 2DRUA 1U91B 4UT6L 3H0TB 4AZ8A 5HYSA 4NWTL 4H20H 2VLJB 3IDYC 4E0RA 1KFAL 2HFFA 1NKRA 1PJ9A 4JFXB 5GZND 2HKFH 5LGHL 4WFEE 5D1XB 1IM9D 3THMH 3BQUA 3PGFH 1OARL 4WV1A 3RAJH 3C6LA 1OQXA 1MCLA 1AH1A 2QADC 4QCIA 1II4E 5F6IB 2W1NA 2LTQB 1H3XA 4ZO6A 1WK0A 3PQYA 4HSQA 1H3UA 1SYSA 2AQ3A 2OL3H 4FFVD 3UDWC 4PJFB 3C8DA 4PRPD 3LKNB 1MUJA 3HNSL 5JW5A 3OHXB 1OGAD 1KG0A 1BD2A 4HIEB 3TBTA 3Q5TA 2DDQH 2NYYC 4IOIB 4MXVF 3ARDA 4XBEH 5FYJL 1U8KA 4D9LL 2BK8A 4UNUA 3STLA 1JRHI 5KBNC 4HFWB 1PBYA 4GKOA 4HCRH 1TVHB 3S5LG 3S8WA 4H8WH 4UNVA 1P7KB 4JG1L 5TPWH 3UTQA 2NXYC 3EYFB 3QUXC 1YDPB 4D9QE 1LWRA 5HPOA 1O7VA 1P84K 3VXMB 4QHKI 2YD6A 5HYFA 5J6GB 2EDRA 3DIFA 5SX4H 2OM5A 1AJ7L 3B4NA 3TNMB 5EZLA 1FNGB 3TBYB 4NNYB 5C09E 2YUVA 5TQ2L 5HYEA 4HKZB 5KSBF 5GXBB 3B6SB 4M62H 5D7JB 3VH8G 2FCBA 3WFBH 1I3VA 3QUXA 5EIQA 5HHXL 3ZKSD 1AD0B 4U1GC 1QSFB 4OGXL 5E2JA 3EYQC 4KRPC 5LWYH 4TUJB 4WEMB 1K6QH 1CFSB 3FFCA 5LQBL 1CS6A 4FFYL 1B0RB 4J8RA 1Z5LB 4NKMB 1IGCL 2N7BA 5KVGH 5CEZL 1TJIH 2JJSA 3PQYB 5HHNA 3QIBA 4PRPB 3QDGD 4XMPH 4AENA 2X7LA 3LIZL 2VDOL 5BS0D 3OXSB 1LE9A 3ECBA 1OAYL 5HYJE 4YHOL 3OHXA 4JDZB 2VISB 1F8TH 4U6VL 3FN3A 4WW2B 2BNRE 2RHEA 4Z6AT 2MSPA 1I9RL 1KTLA 4JFOA 4JKPH 1A8JH 2DLIA 4OD1L 2VDQH 3QIBC 1S7WB 2YK1L 4FQQA 5D71H 3AMLA 1MUJB 3N85H 2DBJA 5DXWA 3KJ4C 4RIRB 2AAVA 4HIXH 4ODWA 1KACB 2F58H 3M07A 3QQ4A 4K71C 4OBSA 4DJMA 2GK0B 1FNGA 1I3RA 1CN4A 5FKAA 1MJJB 3C2SA 4HJ0D 3BIKA 1TZIA 2FWOB 2K7PA 1AXIB 1T2XA 1INQA 2GJ6B 5EU7E 3GHBH 1YDPA 2NY4B 1VFAA 4G8FB 4HUWB 1Q9OB 5EBMA 2BVUA 3FO9B 1NCAH 1BAFL 1A47A 2J8UB 5IROC 4L8CB 1A02N 1KXTB 1V3KA 5LWYL 3BO8B 5IW6A 2H32H 3NCEB 4NKOB 1S7VA 1B9ZA 1FYTB 5F72S 1L6XA 2C3VA 3QEQB 1RUQL 2C26A 4Y1AB 3ZDXE 4XBGA 2HFEB 1M71A 3CFKB 3L7EB 1QUNA 5T1MB 4AIZB 1VKXB 4ODUB 5IFJB 5C7XL 1BIIB 4O2EB 4ELMF 3KPOA 1H3PL 5T3XL 2FGWL 1R0AH 4LCWE 3RTQD 3LPFA 5C0AB 4XCFL 3MJ8A 3FQUB 4LPWA 2Y5TB 3GSOB 4GO6B 4PRAB 5ACLA 2PTTB 3MXWH 3O6FA 5E5RB 3OKOA 1PZ5B 1U8IA 5SWZE 3WFHA 2Z0BA 3C60C 3VGFA 1YEJH 3PNWA 1WGOA 3U7YL 5GRVL 3EFFB 4WUKL 2ESVA 1RUPH 4HPOL 4XVSL 4L4VA 1NDMB 4YDKL 3RRQA 4X6DA 2CXGA 2AJ3B 1IE5A 5BO1H 4LLAA 1YQVH 3UEZA 4E5XA 3HRZA 4I2XA 1N2RA 4CU6A 3MRJB 4B50A 4K3JH 3H9SD 2ZUUA 4R26H 5L8KB 2M26A 4MLSA 1D5ZB 4KZEL 1YEIL 5FO7A 4OCWL 4RZCA 1Q0YH 3RTQC 1GCFA 4JHBA 4MJ2A 3X14A 3DYOA 5DTFB 2GK0A 2FL5B 4K7PX 3MO1B 3LKPB 3S9DB 5FECB 3IJYA 1YPZE 4PJBF 1N5YL 1I8MB 1KFAH 2C3VB 1V7MH 5HI3D 3RY6C 3VE0A 4WW2F 1QSEA 1FPTL 4GG8B 4YFLF 2X1PA 3FO9A 4LSQL 3RWHB 5E5UB 2AXJA 4YNYA 1JV5A 1T1WB 5IVXF 4KY1L 4J3VA 4NNXB 4YBLB 1S9WA 4NYLA 2CDEB 4XVJL 3GMLB 4OM0L 1J10A 2ICWA 3MLRH 1U8JA 1KT2B 3S34H 3KYKL 3FQRB 1MWAL 4KVNL 3QFJE 1F00I 3GIVB 3RUGB 4L3EE 3S35H 3KNBB 3PWJB 5BV7L 4R6UA 1F11B 5FYJU 3WO4C 3LAFA 5JPNA 4M7JH 3FT4B 2VR5A 2MKWA 1A7QL 4GQ9H 4KROB 4XMKH 4PJAB 3MV01 4HUXA 2PTTA 5E1HB 3ZYZA 5F93C 3K80A 1P5UA 5DVKA 5IQ9A 3GMRA 1MI5D 3EFFA 4QRPA 3SGDH 2FZ3A 5B39B 1FORH 3U2SB 3IAGC 1GAFH 4PJGE 1FVDA 3QG7L 2V2XB 1XR8A 4UDUA 5GSRA 1MHEA 3CX5J 4OQTA 8FABB 1F6LL 2XQBL 4PRHA 5TDNA 3V6ZA 1F6AA 3BKJH 5FEBA 4UTAH 4P4RA 3MRHA 4IMKA 1BD2E 1H9VA 4O4YL 1HKFA 4E41B 4ZNCD 3DX9B 4PJ7F 2FB4H 3MJ6A 5DO2C 4DZBB 5GGTH 1LEGA 1MI5E 4XPHL 4OV5B 5GJSH 2EH8H 4YFDB 4ELME 4WENB 1KUMA 2WSKA 2DMKA 1YEFL 3G6DL 4IRJD 1ZT7A 1DL7L 4BFGA 2BHZA 1TENA 2XWBA 5F70A 4G7YL 3PWJA 1MRFL 2VZTA 1S78D 3PL6A 1QFOA 1GGUA 1EFQA 1JHLL 2G9HB 3SDCA 4N0YL 3GHBL 5CBEB 4KC3B 2OJZL 3UTSE 4HWBA 1CBVL 1YN6A 2XZQH 3OAUH 2DD8L 2ZPKH 1AIFA 4DFHA 1EEZA 1C5CL 1JPTH 1JUFB 4GKZB 4Z7WF 4IS6A 4UT7H 5FDWA 2BOCA 3U79A 1IM9A 2VAAA 1TCMA 3QNXB 5IBUB 4C56A 3BPOB 1SY6H 3MRLB 4MAUH 5MP6H 1YEDB 3O45B 4LRNL 5FUZH 5H8DA 3VFRA 5GJTH 1YA5A 1H8OA 4LIQE 4KHXH 2FEEI 4RWHA 2R23B 1HI6A 5J8OA 4ZTOL 3GO1H 2A77H 3FOMA 4QGYA 4RFNC 4BKLB 4ELMA 4AMKH 4HDIA 4N0UB 2DQCL 4BFIB 4BELD 1U93B 4CADA 1MI5A 2BMKA 1IGMH 3GSVB 4G8GD 5F71A 3PWPB 4K3DH 1UWGH 4RGNC 4QRUA 5CD3A 1G6RL 3JWOC 3MYZA 2AEQH 1T0NB 1T89A 3QUMH 1Z9MA 3VXSB 1G84A 2CKBA 3LKRA 1RUKH 3WDHA 1KIRB 2XN9E 5DMGD 3IFLL 3ILQC 3G5YA 3H3PH 3EOBB 4U6XB 1PQZB 4U1MA 3MLPA 3LKSA 3QXDA 3P0VH 3EDJA 1F2QA 5L0QB 3NGBB 4PJGA 5EORH 5C0AA 3GNML 2VABA 3OV6A 5HI3C 1HQRB 1QRKA 1IC7L 5K9KB 3STZA 2JLLA 2J6EA 3BWAA 1D6VH 2Y23A 2MCPL 4G9FA 3T65B 1QQDB 3PWUB 2ZNXA 1W8NA 4E42A 3PL6C 4OGZA 4KTDH 5GGUB 3BFOA 3QHTC 3X3GH 2XZQL 5E7FA 1JPFB 4I0PC 1ZWIB 5ID1B 5FHAL 3QFJD 4X83A 4ESKA 1NFDA 2YD2A 3UTOA 3I3EA 4LBEA 4NO5A 3BVNB 4MAUL 1UB6A 1GL4B 1VSCA 5KN5A 2X5PA 2XTJD 2ERJB 5TJWK 4JFFA 4M9OA 4HS3A 1RFDH 3OKKA 3V0VA 4NFDA 1OLZA 4M5YL 4JO3H 4P57B 1FCCA 1EBPA 4O2FA 5SWSB 3VXPB 4QRSA 4APQB 3I9GL 3X3FH 2HJLA 1BBJA 2EE2A 5HDQL 3INUL 1BQUA 5T3ZH 5EZOH 4PRIB 1Z6JT 3JXAA 35C8H 4J8RB 4B41A 4MNGE 1LO2L 1Q9KB 4GW1A 1GH7A 2YPLB 1I85C 1MI5B 3ZL4H 3NZ8B 4XNUH 1O7SA 3BJLA 5C07A 4YJZL 4MNGA 2CJUH 4NQCA 3VFPB 4UTBH 1VPOL 1I8IB 3HE7D 3MOQA 2HWZL 1OAXH 1MVUA 5DRXB 4UI2A 1MJ7L 3MCKB 2JF1A 1T20B 1UACL 2G60L 4OZFA 5EU6E 1VERA 4XP5H 5HDBE 1WFTA 3ALPA 2A83A 3OKNB 2Z8SA 4G8IA 1RJZB 4U1MB 1WZKA 5FYLH 2GJZA 4RNRB 3ULVL 1CDHA 5GQBA 4WFHD 5I16A 2Z8RA 3REWB 4K2UH 4NN6C 3W11D 1VGKA 5T1LA 1Z3GL 3KXFB 4RGOH 3KAAA 1ZHNA 4X7SL 1R3LA 5DUPL 4XB7A 4I9WE 4FZ8L 2J3SA 1DUZA 3ARFD 4MJ6B 1BFOA 4JFFB 3GSUB 1A6VL 1NBQA 3N06B 1G0XA 3L5JA 1H0DA 2CKBH 2XG4A 3TWCL 2UWEB 4ZFFA 1D6VL 4NKQB 4M61A 4Z7VE 1HILB 5BVJB 4R7NA 4QRSB 1AQKL 5BOZG 4YLQT 2IQ9L 1JWUB 1OD9A 1A1MB 2NXZD 2QADB 1XFPA 2VR9A 2ARJQ 4J6RH 3HPJB 1G7HB 3BPOC 3GSQA 4H0GA 5EUKB 2YXFA 4XP4L 3NCMA 4U4BA 2D4FA 4XBEL 2EDBA 1JNNL 4S2SB 2HRLA 3BSZH 4FP8L 4IIQC 3HE7B 4FFWD 5DGRA 1U8OB 1WLHA 3CLFH 2DQEL 4U6YA 4ZYKA 1RZKH 1KLUA 1W8OA 1M4KA 3R0MA 1N3NA 3U7WL 1CT8B 3O2VH 4ZOAA 4EI6A 4LSSL 3RU8H 3V5DA 1V3MA 1HQ4B 4JRXE 4OB5H 3T08A 1BIIA 4QHUB 2AEPL 3C5JA 4HWBH 4PGBA 3QIBD 7CGTA 4P2OC 1I9IL 2P24A 3LN4A 4QT5B 5H94A 3FRPG 4ZQKB 4FXKB 4M62L 2P44B 1IGIL 3H3KA 2BHUA 5T1LB 1GIGL 1OHQA 2H32A 1G9ML 1IEAA 3RIFK 3TBWA 3LB6C 1E4WL 4X7SH 1FFOB 4CN1A 4JJHA 1A1NB 2DI9A 2ZG1A 1F4WH 5HGBA 1A6ZB 2OLDA 4C56E 4G8IB 3LSOA 4X6BA 1GGIL 3TVMC 5KS9B 2VMFA 1EO5A 1I4FB 2BNQD 1YY8B 3RGVB 2EYRB 1BVKB 3REWA 4NQDB 4OSUH 5DQJA 3GSNH 3PJSA 5HYJA 1IM9B 1C08B 3BZ4B 3MRPB 2J6EL 4JM4L 2NY3B 4MB4A 3IJSA 4NKIL 5KG9A 1BLNA 4OZ4B 3W0WD 2KBGA 1T4KB 3W9EA 5EFIB 5FECA 3BN9C 3LMJL 3GBNL 1QFPA 4EDXB 4X9BA 1BZQK 1QSVA 1M7DA 3T0AA 1DEEA 4LHQB 1IC7H 2ERJC 4R7NB 3RL1A 1EXUA 3SQOH 5F6HI 3T0BA 3AM8A 5E6ID 2L0DA 2VDNH 4P46A 4ACPA 3P9WB 3QCVL 5HVGB 2Z93A 5J9PA 5GIRA 1RUKL 4NKMA 2PW2A 4BJLA 4F57L 1OSZB 5GZOC 5T3ZD 5E4EB 3ARBC 4XH2B 3DV6A 3QIBB 4PRPA 3P4OA 4KKLC 4MLIA 1CL7I 2B5IC 1MRCH 3G04B 3GGWA 4W70A 2C1OB 3DTXB 2ZSVA 5D6CA 1NJ9B 5D1XC 1S9WB 4U1JB 1HSBB 3ARPA 3ZSSA 4LF3B 4I3GA 3UJIL 4UV4H 4QXTB 4I0PD 3QWQB 1WVZA 2YPVL 2Y4SA 1DQJA 3ARBA 4LLDB 4Y5VA 2B2XH 2VLME 2CLZA 1NFKA 1HHIA 3ARGB 2YPLD 3KYKH 2D4DA 4K9EH 2R0KL 3NCBB 2AEPH 4HWBL 3LHPL 3T4AA 1RVFL 1NFDF 4V1DB 4O2CA 4ZOCA 3T0EA 4Z7VF 4F7TB 2V9RA 5IMOA 4PJXE 5LGHH 4GRLB 2R1WB 4HS3B 5D7IA 2H8PB 1U3HA 2JCCF 5L2KA 5DK0B 1UM6H 1N8ZB 5E8EA 4PGZA 2YOCA 3VFUB 2OYPA 4RGND 3WDIA 2WLZA 1NGXB 3NABL 1NC2A 1Q9LA 5D4QA 1DBBH 3GIZH 1S3KL 1NCNA 4YBHA 3I75B 4N0RA 2ZCLH 3G6DH 4BA8A 2HMIC 2DYPB 4HEME 3JUZA 2QSQA 5ADPH 1HINH 3DUSA 1OW0A 4POZD 4FQCH 5HDOA 3VFGL 4BK5A 1JNLH 1ZT4B 4ZOBA 1X5AA 2OTWB 4U1KA 4I0PB 3RJDA 2EDXA 3MZGB 3QNZA 4QXTA 3OKOB 5I1LA 5C0CD 4PREB 3ARUA 1EGJH 1JPTL 2GJ6D 4PJ5D 4LCUB 3VXME 3ULVE 1S9VB 5DFTA 4Q9RH 1UG9A 3QEHA 3S37X 2D03H 4JVUA 4Z5RB 4UBDC 3ZKMC 4V1DD 4WI6A 5E03A 1FIGL 4UDTB 5DJDB 1TQCB 3U46A 1OL0A 3MGOA 4GRLD 3NOIA 3MC0A 4YHZH 3U30C 3MACL 2MKLC 3BW9A 4QLRA 4S11A 1J1XH 4ZO8A 4OZFH 2NX5B 2XN9D 3QWRD 5EU4A 3K81A 3PUCA 5DO2D 2GAZB 4MD5B 3VDBA 4OLXH 5DT1H 3SY0A 4XBPB 3VWJB 1VADA 2NY3C 5TF0A 5HTSA 1PG7W 2FO1A 3DROA 3BDYL 3ULUL 3RL2B 1ZOXA 1CDUA 1ZSDB 2LU7A 4XPFH 2HLFD 1LDPL 2BJML 4TSAH 5DI8A 3GB7A 4R2GD 3IFNL 4WFGD 2W0LA 1GC1C 2OBGA 4OGXH 4PYGA 2XKNA 4KJWD 1WITA 3F7QA 2IPUG 5B8CA 4GJTB 3SGJC 2D7QA 1NPUA 4PBXA 4PJ7B 2EYTB 3MUY1 3PWUA 3QQ9D 3ILQD 4Y4FA 5IF0B 2A6JA 4HIXL 4ZAKA 1YEGH 3D39A 1X6NA 4Y4FD 3O9WD 43CAA 3KHQA 5BMFH 2WIIA 3MGTA 1DDHB 3GMMB 4JM2B 4LNRB 1J1PH 1KTRL 3DHJA 2KL6A 4JKWA 4RRPA 3ULSB 2AK4B 3E6FA 4PP1C 2CKNA 5HHOB 5D7LA 4NO2A 4Z7UB 3HI5L 3P0YH 3WHE1 4NO0A 5I8OL 4KKCD 4RAUA 1T66C 3QUZC 1ITBB 2DAVA 1NAKL 2EDYA 1HNFA 2WAHA 3DURA 5C2BH 4LPCA 5IM7A 4G80A 3WHE0 4PRHB 3U4AA 4EZMA 2R0LL 3V6OA 5KVFH 1AO7A 5ALCL 1OSPH 3WLWD 4X6CB 5AUMB 4RMRA 3VFWA 1MRCL 1A22B 3GSWA 3ARGD 3T4YB 3CXDH 2V2TA 4XP9H 2HRPL 5EBMB 1HDMB 2W65B 1D5BA 5DJCB 1UACH 4WFED 2LVCA 2AABL 2X2YA 5ESVA 4YBQD 2HWZH 3QPXH 4QXGL 3TJEL 1IARB 4AJ0A 5CEYA 3MLWL 5L8JB 3U9UA 5FM5O 1EHNA 3V6FB 3HC3L 3EJYD 4Y4FB 4PJ5A 4L8DB 1T5XA 3NTCL 4L4JA 4QHNA 1X5XA 4KRPD 4HK3N 1FZKA 3LDBC 2ZUYA 2DL2A 5C0CA 4NM8H 4GLRI 2ZUTA 3TT3H 2VE6A 4G43A 5JNYB 1QLRA 2VDPL 5HHQB 2W9DL 4NDMA 4GMSH 2KQMA 2E3VA 1A9EA 1CGXA 3D3VB 1RIVL 2XPGA 4U3CA 3B5GA 3K1DA 3DSFL 4IS6B 5FO9B 2DTML 1DEDA 3TIDA 2X10A 3VRLE 4FFZH 1WEJH 4R97C 3T2NH 2F53B 4ZXBB 2JJWA 3ME0A 2GFBB 1JWUA 5L88L 1AXSA 4U1LB 2NNAB 2D0GA 3QDHA 4IMLA 4LP5A 3GNMH 2Y9RT 5F7NC 4C54A 4HMEA 1SYVA 4H1LH 4RA0C 3WLWC 3VFMA 5DD5H 1MFNA 1WSST 1CU4L 5GGTA 3JV6A 1MJUH 1N5AA 3MRCB 4M6ML 1QHPA 1M05A 3MQIA 3FB7B 5E4EC 1IQDA 1LD9B 4NP4L 3Q5YA 2XKSA 5FO8B 2C3XA 1IAKA 5K59F 4NQSB 1N3NB 1CT8A 3TO4D 3H3PL 4OV5A 1EAJA 1Q8MA 2R0WL 1QSEB 4LASL 2FATH 1YN7B 4LPUA 4Y4KD 4NQUA 2ICES 2Q6WB 4ZQKA 5GSVA 4NWUH 4I0PA 1IGML 1CTNA 3VWJD 1AGDA 4V2BA 2YR3A 4E42B 4DUXA 1NGPL 3BX7C 1FC2D 5CZVL 1S7XA 2UZIH 3G5XB 2GITB 5D2LE 3FN0L 2H1PL 3GHEH 4Z78A 2DLFL 3QIUA 4FQHA 4OLYL 1YMHB 5FGCB 3UJJL 4RGNE 2P24B 1RIVH 2BVEA 1KELH 5J06A 4FQLL 4LBEB 4NO5B 4XWGH 4F15C 3OAYK 3LKOB 2D03L 3HC4L 1NFIA 3QXWA 4P59L 3NAAH 3R06B 2VL5A 2X4OA 5CWSA 5K33A 5E6IA 4P57A 3MRKA 3LH2H 1CE6A 5I18H 1CE1L 3OX8A 3CH1B 2B39A 4ZXBA 4HH9A 4JQXA 5T33H 4PJEE 1INDL 3D6GA 4ELMB 3O3DA 4OCNC 3K8MA 5DLMH 3W0WA 3QRGL 3ULVC 3F58H 3DROB 1R3IL 1OM3L 1ZLSL 4M4PA 2OTPA 4PRDA 3AXLA 3PDDA 5LGKA 4L29B 1CLYL 4DW2H 2NY1D 4X7DC 3QCTL 2BNQA 3BESR 5F7WC 4PJBE 3K2MC 4R4BA 4HJJH 4FN0A 1WTLA 2OP4H 2W9EH 3C2AH 5IW1B 5JQHC 1JZ5A 4MQSB 3MRMB 4DKEH 4PJGB 3OKNA 5ANME 2XWBB 4CVUA 2P5EE 1MCWM 2EYSB 4JFEE 1XZ0A 2FRGP 1RMFL 5I16B 2HH0L 5IQ7L 4IOFC 5D1XD 1LNUB 3HZMA 5HI4C 3G5ZA 2YN3A 2P46B 2WIIB 4NUJB 4P4KD 5C0FA 5EZIH 2DQHH 4LASH 4NT6B 1CL7H 3DETD 2GITA 4HG4K 3NFSH 5DMYA 2H8PA 3MLXL 3HAEG 5KN5B 5LXGH 1LILA 1YMMB 3GHEL 3QFJB 1I85A 3T8XB 5FB8B 4X7EC 2BOBA 1HHKB 4G7VH 4XWOC 1KCSH 2B1AH 5JW3L 4APQA 4HKZA 3GI8H 5IHZA 1ZLSH 2X4OB 4FNLL 3HPJA 1X3DA 2X4NB 3L7FB 4UOW0 3BZDA 3TO2B 4KHXL 4GAYB 2HRPH 1FH5H 1QG3A 2IMMA 2VDKH 4KI5C 4NC2B 3T0EC 3VA6A 3VFVB 3UCRA 5D6DA 1EFXD 3HZVB 3CVHL 3CFDA 2BVQA 3S35X 4PD4J 1GGIH 1EVUA 4PJ5E 2DQGL 3MOBH 3VXMD 1A6UH 4JGUA 2HMID 2WP3O 3C5SB 3C09C 2J8OA 4XPGH 3C08H 3LKRB 5ESAA 1QO3A 3RBSA 3WNNA 3QG7H 2BY1A 1P2CB 5LGJA 1S5HB 2PF6A 1JGLL 1ZT4A 4JDTH 3OXRA 4F7EB 2CO6B 1KXVC 3RY4A 4RISH 1BECA 4RNRA 4IHOB 5HYIA 5GRJH 5BRZD 5J11B 1IGTB 2FBOJ 3O2DA 3MRDB 1TQBC 2FX8L 4A2MA 4KJPD 5MEQB 1AO7E 4P5TC 5ETUB 5C07D 4AQOA 1CF8L 1FO0B 2CXKA 4AT6A 4WHTB 5H2BA 1A3LL 4N5ED 1P84J 2FHBA 3RPIA 1BVLA 3OQ3B 2O5ZL 3L3JB 2ZWLT 2Z4QB 4FRWA 3P4NA 4MD0A 5DJYB 1JYXA 4QHMB 3LQAL 1R3KB 5A2KH 3CJJA 4LMQE 5E70A 5JW4R 3CDGB 4H5SB 4YE4H 1W72A 1LDPH 1ES0A 4MAYD 5L2JB 4X0KA 5E56A 1OAXL 2B7DT 1HHHA 1K3IA 1U8NB 1CGUA 3OZ9H 1N0LA 2JCCE 3BD5A 2OZ4H 4M00A 1IGFH 4AG4H 1IEHA 5J9PB 2BVPA 3BGFC 1K8IA 5B8CB 2IALA 2XZAH 5HHMD 4NKIH 1U8HA 3S37L 4IRSA 4FTVB 4EN3C 5E8DL 4RMUA 4N0FA 2EDKA 2JK5A 3DRQA 5JW3H 4EI5A 3HE6A 4PUBL 5B38B 5KJRL 5B39G 2NY4D 3LZFL 1FN4A 3IRZA 3CFDB 3GJEA 1FL3B 3SQOL 3GMPB 5I76B 1MHHB 3T77B 1MLCB 4FOMA 3AREA 3FQTA 4IIQB 2D31B 3GSOA 5JXEA 3HZKB 4X6EB 5F9JA 1GGBH 5CMAB 1QFHA 4LOUD 4Y8AA 1FG9C 1ACZA 1NCTA 3E0GA 2VXVH 3NIFE 5TFSH 4D3CL 1U3HC 1RULH 2WP3T 3FB5A 3QO1A 5FUZL 5KSBE 1HZHH 1TZHB 3C60A 3HAEH 1ZVHA 5DK0A 2RFXA 1GGCH 4KGLA 5E4IA 3IDXL 4JQIL 1MCIA 3BGMA 5A40E 3LN5A 2MQ0A 4LQ1A 4QXGH 3TJEH 4JCLA 1NLBL 5F7HA 1KBGL 4JFQB 4UT9H 5EPMA 4M1CC 4JFDD 5DJYA 2ZCLL 4DVBB 5DD0H 4OB5L 1FNEB 1NUGA 4L5FL 4N8VG 1FSKC 3DGGB 1W0WA 4C56D 3UTZA 3QRGH 2FIKA 4NQVB 1TCRB 3WS3A 3V6FA 12E8L 1UM5L 1RJLA 3ZHDA 4YNYB 2MHAA 3KS0J 1FN4B 4AIZA 5C09B 1UXSA 2EE6A 1N7MH 3P4OB 4NYLB 4RA3A 5ITFB 4JN2A 3A67L 2X4QA 4FTVA 4OF3A 3OR7B 1FO0L 4HIEA 4FQ2L 3TBTB 4Q58C 2EEAA 4UOW1 2NY2B 4GSDL 3V4UH 5E08H 4ZUWB 4L9LC 5EWIL 3NACL 4G6JL 5I74C 4J2XA 3SN6N 4GS7B 4YGVA 3ULUC 3QHZL 4MJIE 1P7KA 3G9VA 3UTQB 1AGBA 5JUEL 5LVEA 2Q8BH 4HWZA 4UINL 2ED9A 4JPKL 3TNNA 5TF1L 1ED3B 2EXWC 4H1LG 4JO1L 3Q2CA 2OSLB 3IAQA 3B9KB 4J12A 4LSRH 4WI2A 5MEND 4NQEA 5EDXA 2F53E 2OMBA 5F96L 3BI9X 3O4LE 3REVA 3SDYL 3C08L 1NMBH 1FNSL 3V95A 4C83B 2VLKE 3WIHA 4LLMA 5BRZB 1RZ8B 1A4JB 3ES6A 1VADB 3VFTB 3VXOA 2H3NB 2A1WL 5TE7L 1BOGA 1W0WB 3TBYA 1L6ZA 2CLRA 2IQAA 5C9JA 2ADGA 4LEXH 1EEYB 1NUDA 3KPRE 4BQ8A 1OP5H 1QLEL 1J9CT 5EPMB 3ARXA 2OL3B 1RY7B 4X7TA 4JQIH 4DOHE 2CR3A 1A6AB 1ORSB 4PJEA 3RTQB 3V9FA 3QXDB 3P0YL 1AFVL 2VO5A 4P5MB 3ZE2E 2DYPD 1MCPH 3QHFH 1OP5K 2X4QB 3LOWA 4NUGH 3O6ML 4X98B 4LCCB 3F65A 4M8QA 3DI3B 3N1PC 2IH3A 3MRQA 4K07A 3L3IB 2KH2B 4UOJA 4NKDA 2FX7L 3FZUC 3FFDA 1IJ9A 2I9LA 4HCRL 2IJ0C 2ZOKB 3H9HA 2E7HA 5LJYH 2Q7YB 4WFHE 4P5KA 4WU5B 3E6FB 3WNLA 4PPTA 4M4RA 4ODWB 1GZQB 5BVPH 3AAZB 1KPVA 4UV7L 3RA7L 1NUNB 4TTDD 1TZIB 2FWOA 3BIKB 1RZIB 3EFDH 2WUBL 3MLTA 5BV7B 1HOCB 1D5XA 3QCUH 4G8FA 4HGWB 1WWAX 3J7HA 1U3HB 3BP5A 3HN3A 3LZFH 5CZXD 5LG1A 1T2QL 5EUOA 4LHUG 4YHKL 1F90L 1JNNH 4PS4L 2Q8BL 2XN9B 5DR5L 4LEXL 4AMKL 1X5IA 5IVXE 3NGBC 1F2XK 4PJDB 3LS5L 3EDKA 3MFFA 2ARJA 1MCSA 1PD6A 3Q6GL 4KUZL 1UJ3B 4ZPVA 1SY6L 3ARWA 4I48B 2NLJB 3MRMA 4DUWA 1KYOJ 3BT2L 1KC5H 1C1EH 4MHHI 3LKQA 4YH6A 3VD9A 3NCYP 3GBLA 3NH7H 4Z18A 4LCIL 1MFEL 3L3IA 4JFZH 3BUYA 1QYGH 4NJ9L 5ICXB 3QNYA 3PWLA 1TQBB 1UH2A 3L5HA 1BQHG 4LNVA 3MV9D 1QSZA 5C0IB 3R1GL 4PGDA 4F8QA 2OP4L 2W9EL 3V6OC 1JPFA 5DJ8A 4P2OD 3O6MH 5BVPL 3HB3D 2CH8A 1H8SA 2V5MA 1TPXC 2GHWB 1WEJL 1P4BH 1XGYH 2RQ8A 2PYED 4KK5D 3WIHH 2XA8H 3EYSL 5EOCH 2ZCKL 4KRLB 4MB3A 5DYOA 5FGBA 1KJVB 4JM2F 1VENA 3AFLA 1Q0XH 2XRAH 4XP1H 5DEFB 3VI3E 5DHVH 5F9OH 3HRZB 1UFUA 4QRRE 3K0WA 5I1HL 3CUPB 4OD1H 2GT9A 1ROWA 2Z91A 5ISZA 1RZIA 4G6ML 4M6MH 3BYTA 4KDVA 4MSWB 3IFOB 1JNHB 3VXRA 5ADOL 5L9DH 5GRUL 2Y6SD 4IRZL 5HGGS 4F7PA 5IB3B 3K3QA 2X4NA 2HG5A 3H8NA 2AXHA 4U6YB 1OWRM 3BD4A 4M93C 1BFTA 3L3HB 1IAMA 3WFDL 5I30H 1HNGA 3D3VD 3O3AB 1SY6A 2WUCH 1NAMB 1SEQH 4NHUA 1EAPA 3L6FA 3MREB 1NBZB 3MXWL 4UILH 5T3ZE 3PWLB 1NGPH 3OBAA 3UYRL 1XGQA 4DVRH 1J0JA 4OFIA 1FO0H 2FLBT 3ZYJA 3WIIH 2VISA 1H5BA 5J1TC 1ORQA 1NLDL 2JCCB 3EOAB 4DFIA 4OF5A 3DUUA 3ULUD 1AXTH 1MFBL 4GMTH 1KV3A 3V52H 3ZKQD 1XCTA 4K8RL 4M02A 3HNSH 5DC0A 1K5NA 3C6SB 3PWNB 4RGOL 4TNVF 5IP4A 2N4IA 4PJDF 2FEDC 1FV1A 3D39E 3QXUA 4ALAL 2UYLB 5IGXH 2X4TB 1WBYA 2FYYA 4DQOH 4PR5B 1G9NH 1OAUL 5ISZB 4R7DA 3D2UB 3RDTD 1CLZL 1REIA