2A6IB

Crystal structure analysis of the anti-arsonate germline antibody 36-65 in complex with a phage display derived dodecapeptide klasipthtspl
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
219
Chain Sequence
EVQLQQSGAELVRAGSSVKMSCKASGYTFTSYGINWVKQRPGQGLEWIGYINPGNGYTKYNEKFKGKTTLTVDKSSSTAYMQLRSLTSEDSAVYFCARSVYYGGSYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSANSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differential epitope positioning within the germline antibody paratope enhances promiscuity in the primary immune response.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Germline antibody 36-65 Fab light chain
total genus 42
structure length 219
sequence length 222
ec nomenclature
pdb deposition date 2005-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6iB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6iB02
5HTSA 5D70H 2QQKH 5TDPA 4GFTB 4DAGH 2NY3C 4JY6B 5DHYB 4AL8L 5GPRA 2E7MA 4P49A 4NM8H 1Z0NA 2XN9A 2VUOA 4JZOB 5F96H 4PJDF 4KKLC 4JY5H 4JO2H 4K2UH 4ORGB 1JF5A 4NHUA 2PO6D 3NABH 4ZDHB 3O4LB 4N8VB 1IGFH 2ZJSH 3FB7A 4I18C 5EUOB 3AAZB 4NSKA 1JHKL 1T5XA 2OTWB 1IM3B 1DLHB 1UQSA 4ODTL 1R3JB 1S7WB 2ZOKB 1UACL 5IMKB 2M26A 4ZFOB 3MA9H 5BCAA 3IAGC 3QIWD 3BZ4A 2DLTA 1HSBB 2C5DC 4CU7A 9CGTA 2DBLH 3HUJA 4JPKH 1DCLA 4OFYD 3VFPA 3X3FL 2XN9D 3KHQA 3MV8A 4KVNH 4QXUH 5KVEH 3ELAT 3RWDB 4NKQB 1X5LA 1NFDE 3O6FA 2IQ9H 1C8PA 1KF9B 3VCLB 3OHXA 4WTZG 5GXBB 4BFIB 1NCAL 3ESVF 3NZHH 4YXHH 3LKOB 1OSPH 3ECBB 3FT2B 4L9LA 3VFRB 5DUMH 2D03H 5HI5C 5E8DL 1X9QA 4PTTB 4U6YA 3P77B 3VFVB 2V7HB 4ZUTA 5L0QB 4WY7H 2AEWA 4XAKE 1QBMH 5T3ZE 4JFDE 4ELMB 1WZLA 2BX5A 3VXSE 3MXWH 2OL3L 4U1IA 4OB5L 3O2VL 5ILTH 4YX2H 3H42L 1F42A 4PRBA 3DX8B 3VXNA 1J7VR 3V52H 3SDCB 4PJGE 4QRRD 2OTUA 2H45A 3DETD 2CJUH 3BXNA 1OQXA 4E41B 4G8GA 1PGRB 3H9SE 5K9KB 4U3XA 5HPMA 3GO1L 5CWSA 1KB5H 3CDCA 1DUZB 4MZ3A 2JB6B 4PRHB 3VFPB 4Y19D 1MRCH 2VXVL 1NAKL 1TQBB 2VC2L 1T5WB 3RNQB 2WBKA 4JHZA 1F11B 2WANA 4M3KB 4OM1H 5DD0L 2AV7B 3G6JA 2CDGA 4OF6A 3PP3H 1E28A 4CVWA 5JZ7C 5AYQA 2YXMA 2NY3B 5TGBB 2DYPB 4PG9A 2XICA 2JTDA 2P8PB 4OZFG 2VNCA 4P5KB 4IBLT 4PJAA 4NP4L 3U0TA 1FYTE 4M4RA 2VLKB 4H25B 5F1OB 3WKNA 3GB7B 4JKWA 3H7LA 3R4DA 2D2OA 3TIEA 5EBWA 2PW2B 3RTQC 3IXTA 1SM3H 2CKBL 1ZAGA 2FB4H 4NQSA 3Q6FA 3D5OF 4JFQA 2R0WH 4Z78A 3PWNB 3QDJD 3ABZA 2C3VA 4M00A 3HPLA 2F5AH 4YX2L 1MCRA 4XZUB 4HSQA 4EUPG 3OKYA 5K9JL 3MRFA 1DJSA 2VABB 4PLKD 2QR0B 4LNRB 2O5XL 5D7IA 4C4KO 5CWSB 2DQJL 5F9DC 4UT7H 4GXVH 1KIRB 4K07A 2A1WH 2A38A 1XCTB 1D5IH 2UV3A 2P8PA 1QBLH 1YMMB 4IOIA 1MQ8A 1TZHB 4L8BA 3MJ6A 2FZ3A 3FTGA 4RIRB 3AREB 4APQC 2KZ1B 1EJOL 3G08A 1S7TB 1J87A 2QJDA 4G6KH 1RY7B 5C9KA 1G7LA 3RZCB 2C3VB 5C0FA 3TN0C 3NIFF 5C2BH 4YHOL 3PDGA 1Y6KR 3VGAC 2A6IA 1T80A 3I9GH 4OLWH 1WAAA 3FQRB 4UBDD 5ALCH 3RQ3A 2EYRA 1S7UA 3LCYA 1LEIB 1U6AL 1FE8L 4PLJD 4WFEE 5F7YC 1CDIA 4PRPB 4G9FD 4C58B 2CKBA 2WBJA 3BVNA 5KTEL 5FYKH 4Z7NF 3I3DA 5T5NG 1UADC 3OAYK 1OHQA 2RFXB 3HAEG 3IXAA 1I1AD 2OBGA 4YHZH 1WC7A 1OAYH 1X6LA 3GMQB 2DF3A 2IBBA 2FATH 1H3PH 3CSBA 4F7EB 4HIHA 2EKSB 4DFIA 1QSVA 4PFEA 4DVBB 4X99A 3B4NA 3IAQA 1T83A 5I1GL 4ISVB 1AC0A 3FCTB 1YEHH 5DA0B 5IHLB 2NPLX 5DF0A 5I2IA 3IXTB 2PTTB 1IKNC 4CL7A 2FEEL 4G6ML 5ESVA 3MRLB 4K3DH 3WE6A 3GHBL 4MX7A 4PGZA 3BPNB 3KYMA 3RWGB 5HGHB 3REWA 1MWAH 3L95A 3VDCA 4PJXA 5EZJB 3F58H 4Z18A 1MJJB 5C0FB 1OCWH 1GOGA 3NPSB 3KXFB 3PQYB 4YHOH 1RZJH 1TZIB 4I9WE 5DHVH 3BGMA 1HXYB 1BZ7A 1MSPA 1HI6B 4EDWL 2FYYA 5KN5A 1JTTA 4NQUA 5FO7A 2BVPB 4TSCH 4X6EB 1KLUA 4U2YA 3C08L 1XCTA 5JLZA 4DZ8A 4YZFF 5D5MA 3P11L 3SDXA 1UYWL 3ALWA 5C0IB 5HHOB 4NWUH 5FK9A 4WFFE 4ZTOH 5K9QI 1MJUL 3B6SB 5JW4N 3VWJA 4AEHL 1BEYH 1URLA 5D1ZA 3FCTA 2VDLL 4TSCL 4RMSA 2ED9A 1NFDA 5F70A 6FABL 2HMIC 1WJ3A 3BDXA 3GSVB 5T1LA 3BH8A 5HPMB 5GRVK 3LEYL 2A6KB 5IEKA 1KPVA 4JB9H 1MFAH 1A6TA 1EFQA 4JFPA 3BZEB 4WFED 1AQKH 4KGJA 1HILA 3PP4L 4JAMB 5DK2B 1NCUA 1IFHH 5HYSG 2OJZH 4XCYB 3HNTH 4FTVE 1G9ML 2PYFB 5BV7H 1XFPA 2KPNA 3HC0B 4L29A 3VMPA 5SWSE 5JW5A 4LSVH 4EN3D 1XGQA 3D39E 4PRDB 4MA1C 4IOFC 5DHXB 3K4ZA 1FG2B 3NACL 5DFVD 3BO8A 3UJIH 4TRPH 1ZEAH 4HT1H 4LHJB 4X8JA 4G80B 3S35L 4I5BA 1BVKA 4Z7QE 1D5ZB 1CDCA 2HN7A 1G7IB 4ODBD 3RPIB 2A2QT 2DM3A 5DUBB 4YHPA 4NDMA 5F8RC 4ELMF 4M5ZH 5ID0B 1A4JB 4L3CA 4X0KA 1I4FA 4JKKA 1ZOXA 4RGOL 1T1WB 3QAZC 4M8QA 5J3HC 5MEPA 5FCUH 3UCRA 1TPXB 2FIKB 5JIKA 1FDLL 3LEVH 5J8OA 1JL8A 2O5ZH 1CFNB 1LP9A 2H32A 3I3BA 1MH5B 2PW1B 3QIBC 4PRPE 4RSVA 3CH8A 4ZG1A 2UUDH 4KJWD 4OKVB 2I07A 1UFUA 1OOAA 3QWQB 2JELL 1CFQA 3JVGC 3X11B 1VADB 4Y4KA 3V4PL 1EO8L 3CCHB 2IAND 5TQ2L 1NLDH 4PJ8D 1X44A 5LAXA 3VU2A 1PSKL 1MJ8H 3BIKA 4OZFA 1CT8B 3PGFH 1X4ZA 2DMBA 2XQBH 3WHE0 3LV3A 4XPAH 4OV5B 2VAAA 1NBYA 5SWZE 1T21A 4YDJA 1KULA 4OF3A 3GI9L 1H3XA 1NBZA 4QXUL 1T5XB 32C2A 3ZKXC 5KAQG 1XGTB 2AXFA 5C0BD 3HS0A 4NFCA 2GJ6A 4NHCL 2P45B 1BF2A 4NQED 1DQDL 2X4UA 1VPOH 2BNQA 3RUGB 4Z77A 5D7IE 5GSRB 4O9HH 4MB3A 2JJTA 5D2NC 2OSLA 1DN0B 2GI7A 4NOFA 4DWHA 3QDJB 5D4QA 4BM7A 2N4IA 4POZD 2OZ4A 3VCLA 1WSST 5ETUB 1EVTC 1JTOA 3DI2B 3V6FB 3P4MA 4F80A 4JZNA 4OD3H 4UTAL 1EEYA 5ID1A 4X5WB 4JO2L 4K2UL 5DJXA 4JFHE 5E56A 2VLKD 3DV4B 1U8LB 1TLKA 5DQJA 5C2UB 4UIKH 4L8SC 2I9TA 2B7DT 3G5VA 3MCG1 3QB7C 1BWWA 3D3VA 1TXKA 4LLMB 5C08D 1KJVA 3M17B 4JE4B 4JQVC 4HIJB 3VXSA 1EJ6A 1NMBH 4QT5A 3MRLA 3ET9F 5FYJL 4WW1A 3T65A 2ZKHH 2DDQH 3NIFE 2OLDA 3ZTJH 3H6JA 2V5MA 3VXMD 1K85A 3TYFB 1Q9WA 1HYSC 3RY4A 2OM5A 4UDUB 3H9SA 1DEEB 5IROC 5T3ZH 1FYTD 3LD8B 2XIDA 4N8PA 4P0DA 4M6MH 4P48A 4Q2ZB 1YC7A 3QIBB 1N5YL 5D7KE 5GSRA 1I7RB 3MLWL 1N59B 2I07B 3SDYH 5L2JA 4XPTL 4WW2C 5SWSB 1IGTA 3I85A 5CBAA 4PJFE 2I9TB 4LGPB 1OAKL 2R9HD 3MGOA 2A73A 4S10A 2EE3A 3MRQA 5I18L 3SQOL 5C0IA 3MLTA 1IGJB 4NQDA 3IDXL 3DIFB 3QUZB 3PP4H 4K7PH 1AGFB 4U05A 2BSTB 4XXDB 2VDMH 4HKBB 1BJMA 5JOEA 3OAZH 2FL5A 4L8SA 5BXFB 2J8UA 3WV0A 5HYSB 5CBEB 1TTUA 1OSPL 1AXTH 2VDNH 4ZOCA 1B88A 3WKMH 4YIQA 1EHLL 3AGVA 4MGXA 4OGXH 2R8SH 3C5ZC 2VWEC 3BJ91 4QRSA 3OXRA 2NTFA 3B5TA 5E2WH 2V9QA 4APQD 1IJ9A 4M9OA 3J8F7 3TV3H 4KPHL 3QIBA 3QHZH 4JDTH 2Y6SC 5D1QD 4ENED 2YOCA 4OZ4B 5E03A 5K33A 2AV1A 1EMTH 4JZNB 5HHPB 4O2EB 5J1AA 5E2TL 5I1CL 3TVMA 1NFIB 1XF5A 2EYTA 5D7SH 4Y8AA 2XWTB 4G6AD 3TLRA 4E41D 1MRDH 3EDFA 2MQ0A 4UQ2A 1ORSA 2IC2A 3H8NA 4K3GA 4OIIH 4XVSH 1DQML 5DD3H 4YHPB 1DQLL 2JKXA 4FXGB 3F58L 1RURL 5GQBA 2AAVA 1G6RH 1JVKA 2QQLH 3FONA 5IVZB 4YDVA 1P84J 2H6PB 3AVEA 3CGTA 4QY8B 3HE6C 5DJ6A 2NZIA 2XTJB 1NFKA 5TQ2H 4MLIA 5IFAH 5ISZE 4UAOB 2V9RA 5HHXL 1K3IA 5DHVA 1LEGA 4U6HA 1D9KC 1MCDA 4PJEA 1A7RL 3RUGE 2BSSA 3DETC 5CZVH 4N0CC 4V2CB 4NCC1 2AERT 3VFSB 1V05A 2AXGA 1KTLA 3MRRA 3X11A 2P5WE 1M71A 1I8MB 5LJYH 1U9KA 3FB6A 4QO1A 2P4AB 1A47A 2WWMC 2IGFL 4WUUA 3DRTA 4J3WA 2X7LA 3TN0A 1IARB 3THMH 4NQVA 2ZWLT 3OAUH 4LDEB 1RFDH 4KMLB 4EXPX 4OV5A 4HKJA 3DXAD 4F7MB 3EO0B 3TT1H 1AR1C 4WDIA 2DQDH 3TA3C 4M6OL 5IMLB 3HC3L 3QHZL 8CGTA 4WV1A 5L8JB 1R3HB 4HUMB 2BNQB 1R3KB 3SDXF 3EYQD 1RI8A 5D5MF 1DBKH 3M07A 2GAZA 5E4EC 4Z5RA 4UUJB 3L3HA 3FQWB 4LLVB 5KBNC 4EI5C 1A7PH 2HKFH 5D9SA 1KTLB 3MRRB 2IMMA 2XQBL 3BUTA 5ID1B 1M7DB 5B39G 5F7UA 2HLAB 5F3HA 5HSFA 3SE8L 5CD5C 1QFPA 4QRQA 2AK4B 1VGEL 2YBRA 3VXPA 5EU6E 5DJ8A 3CFDB 3C5ZB 1OTUC 1CI5A 3MV8D 3EUUA 4P3DA 2AS5M 3W39A 2JIXD 5E6IC 1PQZA 4GG8A 1SMOA 2AJZA 3C60D 5FA3A 4XBPA 2GJ6E 2ZNWA 5IM7A 4XBGB 5D6CB 1NGQL 1ZT1B 3K4DA 2VDQL 5D1XD 2AJXH 4DGVH 4OF5A 1UCBL 1R0AL 2X4NB 3IYLW 1D3CA 1KJ2L 1FLRL 1UB6B 2XZAH 4YWGH 3DYOA 1MIEH 3LKSA 2NXZB 4U6HB 1FVEB 3OKOA 1DUYA 2DKMA 3V4VH 4QYOB 5I71C 2FECI 3G6DH 4UQ3A 5FUCC 5I1DA 5FYJH 2Q87A 1OAYL 4PGBA 4R0LA 4U1SA 5C08B 1VKXB 2NY5L 3NCYS 1MFCH 2ATPA 3QI9A 4PYHA 1VGKB 2G75A 4PRDA 3RVUC 4LSPH 4JGMA 5EWIH 2DQIL 1A5FL 5DK0B 4RGOH 2L7JA 3VGDA 5CKGA 1TJIH 3CX2A 1ZHKB 1J8HE 3AAZA 15C8H 1OT2A 3M45A 2EYRB 3TGXA 1KT2A 4G7YL 1U36A 2VTFA 4D9LH 2VOTA 1V7NH 4X5XA 2X4NA 5F97E 3WO3B 4BK5A 4Z7WF 2IQAA 1FIGH 3A67L 3GBMH 4HQQL 2CLRA 4K3JL 4OZGF 3JV4A 4JN1H 4M48H 3QJFA 4YO0B 5L7XH 3F6IA 5F7MC 3TM6A 4Y16C 5D9SB 3KJ6H 1OAZL 3IKCA 1O0VA 4HK3N 4PJDE 5GJTH 2DQUH 4E42A 1U8KA 2G5BA 3VFMB 3ULUH 4UQ2B 4TYUA 5TE6L 3GEWB 2V2XA 4NM4H 3LN4B 5GS1A 3DGCR 1S3KH 4NO5B 3NVQA 3EHBC 4GS7C 3BRFA 2W1NA 2ZUSA 3V6OE 1Q0YL 4QNPF 3UYRH 4MNGB 1P4IL 4R0LC 4Y5YA 2APVA 1OP3K 4WU7B 2LFGA 3KLHD 2YA0A 5FOJA 2DICA 2Z92B 3B2VH 1EZVX 3PNWB 3IDGB 3KWWA 1JHKH 4XP6L 2F5AL 5DR5L 5GRJH 3KXFA 2B1AL 5EO9A 2PXYB 3FFCE 5I1HH 1S7VB 4YDKL 4YDJB 3HI6H 1MHCB 1MEXL 4XVJL 4D0BA 3HZMA 1KCRH 3BDBA 1SM3L 4IRJD 5GISH 1BPVA 4I3SL 1UM5L 2FECL 4KJPD 1W2KT 5J4MA 4WWKB 1DL7L 4Y2DD 2B1HH 2IFGA 4OAWA 4OLYL 3U0PB 4NO3B 5DI8B 3D69A 4RAVB 4LRNL 3W0WD 3QDJA 5D2NE 1NEUA 3I75B 3FAXA 2I26N 4MXWL 5I1GH 1S78D 2W92A 2EXWC 4Y89A 5FYJD 3ORJA 4YHML 5GGUA 3WDIA 3VXUB 4X7SL 1CG9A 4Y1AE 4HT1L 1MLCB 4L4VB 3A6BH 5KVDH 1A14L 1B0RA 4K3DL 4YDIH 4XHQA 1HXMB 4Y2DA 4S2SA 1I1YA 4XPHH 2BOCA 2V2WA 1NEZA 4LU5H 3WFCL 2AEQL 5IHUL 4YHIB 1ZHKA 4RMVA 1JPGB 2R9HC 4Z78B 3K1DA 1FNAA 1HQ4B 5JHDD 3P9MA 2FBJH 4U1MA 3G6DL 3HMXL 3WS6C 4YGVB 3VRLE 2WM0A 4JM2D 4MJIB 3SDAC 4HFWA 2VABA 4FHBD 5E5MB 5C8JA 4RWHA 4MXVE 1UB5B 3PWPD 4S0SD 3GSQB 1OWWA 3JV6A 3LY6A 4OLZL 3UTSE 3KLDA 4Y16B 5LQBL 3B8YA 5F1SA 2ZCHL 5I1LA 1G9NL 1MHHA 1CFBA 2RHEA 2B4CL 1BJ1J 3REVB 1UCBH 1R0AH 5MENB 2FJGA 1D5MB 3NCJH 4KMQA 2VQUA 4I4WA 5GGSB 5D7JD 4TQEL 1F4AA 5CIPH 2ARJA 1N6VA 1U3HC 4TULL 1UJ3A 1BZQK 5IBLD 1NFDF 2MMXA 4MD4B 5BZWB 3ZSSA 6CGTA 2DTSA 1ZA3B 3WHXB 1I7TB 4LSTL 1QBML 2OL3A 4LVHB 4WHDA 1JNLH 5E2JA 1VA9A 1U8OA 2GJJA 2P7TB 3DGGA 4FQ1L 1WITA 2HFEB 3FL7A 4CUCA 4BQBA 1UXSB 1JZ6A 5HI4C 2HJFB 1F4WH 5DEZA 5BJTB 4Q6IC 5J11B 2B4CH 3X13B 1AD0A 2DOCA 4JG1L 4GO6B 3QXAA 4YXLH 1QRKA 1LGVA 4KZEH 2PR4H 1CXIA 2ERJB 5ADPL 5E8OA 1EX0A 3CZFB 3EW3B 1OAXH 4J3XA 2DLFL 1YN7B 2VDKH 3D69B 3T4AB 3WNOA 5AAWA 4LAQL 3I75A 3VXRE 3PGDB 1RZGB 4M7JH 3X3GL 1S9YA 3MMEA 2VLME 4PJAB 4O2EA 2EKSA 5DK0A 1TVHA 4LEOB 4DJMA 4XMKL 1QO3B 4FFWD 4IMLB 1CE6B 2VIRB 5MENA 5I1AA 2KDGA 4MNGE 4EKXA 3EYUL 1RFDL 1JHLL 1MAJA 1YJDC 3EYOB 3GMLA 3P30H 1BBJA 5F9JA 3F65A 3BQUC 5D1ZC 3TF7C 3L5IA 4MX7B 3B9KD 5JR1L 3IDIA 4C83A 2BNQE 4FRWA 5KW9L 2GSGA 1FN4B 4Y4HB 1CICD 1A9EB 4FZEH 4N90D 4Z95L 1CU4H 1ZS8A 5TDNA 3PUCA 2E7CA 3L5XH 4HAGA 1WIUA 3CZFA 4LVOB 5HBBA 3H3PH 2DYPA 3MCKA 4MAYC 2ENSA 5KN5B 4RNRA 4MA3A 3MUGA 4JG0L 3L7EB 1N64H 3QXAB 2ICEA 2E3VA 2D0GA 1ZVYA 3PG2A 5IVXF 3O4LE 4AENB 3RHWK 4GKOA 3VXQA 1W72A 4KV5E 1C5DA 3OKMA 2F54A 2R69H 3GSWB 1HHJA 1FG2A 1M1SA 4FFZL 5DZNA 1E4WH 4HUXB 1NKOA 3ULVF 4P2CG 4JFQB 4QRPB 4H20L 4P4KC 5EU3B 2JCCE 4I48A 5BS0B 5BVJB 5MHSE 5JHDB 4BSWA 1LNUA 2EDHA 4G6JL 1QFWL 5FHAL 3MLPA 4GBXD 4LGRB 3AMKA 5BVPL 1DQTA 2A6IB 4L8CA 4P5TB 4JM4L 1JRHI 1XAUA 2DD8H 2JK5B 3ULUL 1KIQB 2HKFL 4Q97A 1H8OA 4NJAH 3MA9L 3STLA 1A6TB 1CFVH 3HPJA 5AYUH 5TQ0L 1HK6A 3G6AA 5E8PB 4PTUA 4Z5RB 5F1NA 2AKRB 2B5IB 4RNRB 2XFXA 4YBLC 1H3WM 2X9WA 1DQQA 4NNYB 2ZJSL 4HV8A 4O2FB 5H8DA 3G04A 1UWEH 4U6YB 1KJ3L 4QOKA 5DRZA 1JNNL 1U8HA 3IF1B 4WWKC 1LP9F 2ICWI 3D39D 3CDGB 4F15C 2X4OB 4NO0A 3QCVH 2W9EL 3WSQL 1K5NA 1DBAL 4I48B 4JPKL 2Y5TB 2FH6A 3VMOA 1Q9LA 4FQLH 2H9GB 4S2SB 1QEWB 1A21A 1PJ9A 2NY2D 3ULSA 4PRNB 1BVKB 2DIJA 4YIQB 4FFYH 2RJMA 4ELMA 4FTVD 3IFPB 4NJ9L 5DD0H 1HKFA 3QA3A 3KPRA 3SKUD 3N0PB 4U7KA 2GJZA 1S9XB 4DKFH 1MJJA 5AG9A 2FDBP 4HCRA 5GHWL 1IZKA 1OT1A 2RCSH 2BFVH 5SWSD 5J7CC 4PG2A 5KVGH 4YHMH 1PLGH 4J3VA 12E8L 3ZTJG 3ZMRA 1FZMA 2CH8A 5C09B 3ZTNH 1XF5B 1FZKA 4U49A 1HWGB 4PJBE 4V1DB 5GGQL 4P46A 5I6XB 5ADOH 1F11A 5EUOE 5ITBH 5IR1A 1RZIA 5JXEC 5E9DB 4TTDC 3WJLA 4FABL 3PP3K 2DQFB 5DQDH 1BGXH 5HVHB 1G1CA 2H9GA 1M7XA 5KVGL 4P9MH 1TPXC 5H2BA 1DBBH 1Z3GH 1NMBL 2DQHL 3UJTH 5E1AA 1Q1JH 5B38B 1K9TA 4DN4H 2X1WL 5KS9F 4ZPTA 3JWOH 5IB5B 3DSNA 1VDGA 2B2XH 1WCBB 1ZTXL 4JR9H 4XX1E 4AM0A 4QHKJ 4KZDH 4KK6C 2NY5C 5CUSL 4RFOL 4MHHG 4W4NA 3QUML 2GJZB 4NQXB 1FBIH 1A7NL 2WWKO 4NRZB 1JRHL 3ZE2E 1CQKA 1MUJB 1T20A 1F97A 5DDHA 2OSLB 5SV4A 5MEOB 5I1JH 4IRZL 4KI5D 1SVCP 1UACH 4LSUL 3OKLA 1QYGL 3QRFM 1W0VB 3N9GL 3PWPA 4JO4H 5F1IB 5H94B 2IF7A 5GZOD 2R0ZL 3TV3L 3DXAA 5DLML 4AH2B 1I3GH 3PDOB 5DEGA 4XVUD 3WXWH 5EZLB 4LEXH 1EBPA 1H15B 4OLUH 1ZLVK 2O26U 1X5HA 5KSUB 1P1ZB 4P5TD 3MXVL 4M6OH 1T0NA 4L4VE 1G7IA 3BN9D 4TNVK 2W9LA 2ZSVA 4HKBA 4HS8H 1E4KA 1WT5C 4CKVX 3VFUA 3FRPG 4P2RB 3ULUD 1VEPA 5I74C 3VJ6A 2FJFB 1S7TA 4OLXL 3RGVB 4LMQI 2HYMA 1NSNL 1JWUB 2HVJB 2BRQA 2CRIA 3P4OB 3BKCL 4LCYB 2OR7A 2LQRA 3V5DB 5I8OL 4NQXA 5HYJD 5J57B 3HB3D 3FT2A 4PJHE 5FAAA 4X4YA 1S7QA 5AUMA 1YYLH 3OB0K 4YNYB 4L4TB 4ODSH 3LQAL 1YEKL 2AGJL 4QHUA 5CZVL 2C3GA 5HHPA 3NCCB 2HT2D 3VXRB 2YR3A 2VLLB 4CN4A 4G7VL 1OY3B 1CICB 1KOAA 3EJZD 4IRJA 5CJOH 2CMRH 3MRQB 4BH7A 1RULL 2CIKA 2A77H 3BHBB 2Y23A 1WZ1L 1CU4L 2CDEB 2QQLL 3HI5L 1FNHA 2A74A 4JQIL 4L8CB 1A22B 4M7ZB 3EYVB 2BFVL 3HR5B 3DBXA 5B3JE 4P5MB 1HWHB 2VYRE 2MTPA 1JGUL 3R8BB 2Y72A 3MLRL 4TVPE 4Z7QF 3MLZH 3T0BA 1YPZE 3VRJB 4IMKA 4IIQB 4D9RD 3VMNA 1OLZA 4LMQE 3TNNA 3T04D 5C07E 2UZIL 3WNNA 5C0CA 1YMME 5E6YA 5DRZB 1MY7A 5C08A 1VKXA 1REIA 3WN5B 5ESQB 1UKQA 3EOTL 1EGJA 1WZMA 4PJIB 3V4UH 2CRZA 3QCUH 1JPTL 4UT9H 5ACZB 2AQ3A 1KCLA 2R1XB 5FGSA 4BH7B 5IIEB 43CAB 2ICWJ 1IZJA 3I50H 1JHTB 2F53E 4NYLB 3PGCB 3WFBL 5JA9A 3TBVB 3KDMA 4BZYA 3O41A 3LH2L 2BVYA 3ZHLA 3BJLA 1YNKL 1QYGH 2MSPA 3PWNA 5TQ0H 4D0CB 2C4FT 2R2BB 4KDWA 4MSWA 3C6SB 3QXVA 2VDML 1F3JB 5L0QC 1ZGLP 1AFVL 1JRHH 3J7HA 2BVTA 3S37X 1FBIL 1JBJA 4OTXL 5E6IB 3E3QE 4YO0A 2NY6D 3KLHC 1IC7H 2V17H 2V9TA 3F8UB 3K2MC 2PN5A 1MCCA 3RWIA 1EH9A 1G9MC 3BEVB 4DVRL 4XWOC 4EQ3A 3L5HA 3L9RB 3FMGL 3LKOA 4L1DA 3CX5J 1GSMA 1YN6A 2P5WD 4JHAL 1MVUB 1ODAA 5IBUG 1GPOH 4CMHC 3D3VD 5FB8B 2Z31C 5D72L 5IW1A 3QH3A 1FDLH 2XI9A 1AGFA 4DKFL 4G43B 2EH7H 5JOPD 3TT3L 3DOSA 5BRZB 3DPBA 3RDTB 4MAYD 2CDEA 2XA8H 1E4KC 5IB3A 4NUGL 3FB7B 2OJEA 3KXFE 5CFHA 4MZ2A 1QBAA 1X5KA 3TJHC 1OARH 2NX5D 4PP2B 4DOHB 4DUXA 3U9UA 2RCSL 2C3WA 4FQJL 2A9NH 5DJYB 5E6ZA 1RJYA 2YD3A 3SOBL 1QBBA 3OV6A 1A9EA 2BDNL 3BKYH 4HXBH 3BUYA 1ZHBB 2DQGL 4GBXC 3V6ZB 4NRXB 1BOYA 2A73B 3GJFB 4K7FA 3GMPB 4ACPA 2O61A 1F4YH 1G7PB 3RX5A 5ITFA 1U8JA 2DRUA 1CTNA 1QD0A 1T22B 3QQ9D 2VQ1A 3GI8H 3MV9A 3WN5C 5TGBA 2NLJB 3L1OH 3AS0A 5H37H 1RMFH 4P9HC 2YSSA 3GHEH 1V7ML 3FJTA 5C0DB 4OJFH 2VLKA 4H25A 5BVPH 3C5ZA 3QH3B 3AMLA 4PJCF 4YC2B 5FF6B 5HGHA 4M6AA 5I1HL 3QULA 3O2DH 4ZS6C 1CF8L 3LZFL 25C8L 4N9GA 5IVOA 1TVBA 2FH8A 2FEDC 1S8DA 1R5IB 4MNQA 3KGRA 2Q7NA 1OF2A 1RUKH 3Q3GB 4JZJC 2D7NA 4XAKD 1KJ2B 4EUPA 1MRFL 3D39B 5FM8A 4IHOB 5DS8A 1DQJB 4PRID 2BY1A 4JPWH 1ZE3C 4Z7WA 1T2QH 4EOWH 2CGRH 3ULUE 3LN9A 2ESVB 1J12A 3NA9L 4EDXB 3DV4A 4GRMA 4LHUD 4KK8D 2Y7QB 4WRLA 4FFZH 1ZHLA 3LN4A 4RRPA 5HI3C 5GS1B 4F7PA 3EKCA 3P0GB 3TPKA 1S5IL 4XPHL 1K6QL 2FR4A 1YECH 3MA7B 1A6WL 2R4SH 3P0YL 5E2UL 3QFDB 3BDYL 4ZUWB 2LVCA 2X9YA 2AW2A 5FECA 2GK2A 5IEHA 1ZVHA 2YD7A 4ZFGH 4LAJH 7FABL 4KKBD 1LE9B 2V2TA 3QCTH 5EH1A 3PHOA 4LHUB 2M1KA 3H0TA 1BD2A 4KRNA 4XAWH 4OCSL 3HG1E 4UDUA 1JNHB 5I16B 1FNSL 4QXWA 4HXAL 2JB5L 4OLEA 2IANB 3BPCB 4H0GA 3TYFA 5BV7L 5FM4A 2PYFA 1LO2L 1DL7H 2X70B 1I9RL 1VCAA 4KK9C 8FABB 1A64A 5C0JA 5E2UH 1JNNH 5IESL 3KLSA 5CBAB 2XT1B 2DQTH 4BQ8A 3MUJA 1P9MA 5J6GA 3KYOB 3QUYC 3MO1A 4MD0A 2VQ1B 1JP5A 4UT6H 1D5ZA 3PWLB 2G9HA 5EUOA 3MRHA 3ZLQC 2MKWA 5E6ID 1CLOL 2VXSH 4P3CL 3VWKC 1UQSB 5BRZE 2PNDA 3B9VA 5SX4H 4KQ4H 2J8UB 3MNVB 3BN3B 4NZRL 5D1QC 4Q0XL 3W9DA 4K94H 5GRZA 1NCCL 5JO5B 3NCYP 4O58L 1AY1H 1FNGB 4ZUWA 3RWGA 4L8DA 4AEIL 3A6OA 3E1F1 5JPNA 3CH1B 4OGAC 4YXLL 4HGWA 4LFHD 3QUKB 4P5TC 5GGSY 1PSKH 4K3EH 4XP1L 1Y0LB 5C0CD 4C57C 1TCRA 3HZMB 3JWDL 2JF1A 4JPIB 4IS6B 5CGYC 4MJ5A 3D39A 5EFIA 4M48L 1XCQA 3S88L 3JV6B 5A3IC 1NCCH 5I1IH 1U42A 4Z7WB 2XNAB 3MV01 5JZ7D 2NXYD 5BOPA 2VLRE 4WO4C 4WNQA 3KJ4C 1T2XA 1GVIA 1CXLA 4PGDB 3S3JA 1HZHL 5IBLC 3SN6N 2Y7QA 3WD5L 2O5ZL 1MHEB 4LLWB 1DDHB 1X5ZA 5K9JH 4CNIB 3FQXB 5J6GB 1MIML 2HRLA 5DEGB 4M1DH 3LH2H 5EU6D 1H15A 4XCNB 1F4XL 4KJQD 3NABL 5T33H 2NY5H 1JPFA 4WUKH 5AZEH 2X4UB 1IQDB 1LO5A 4KQ4L 3DX7B 3ZZ1A 2O5YH 2FJFA 3GDBA 2I27N 1BD2B 3T0EC 5DJ6B 3LN5B 4EN3A 3TNMA 4LQ1A 1A1MA 2WUBL 3SKOB 1CDGA 1P2CB 3NACH 3OAUL 5FO9A 4LK4A 4S1RH 1WISA 1WF5A 3AY4C 4OZIA 3SJVD 2EXYC 1KCVL 4X4YB 1HKLH 2ZCLH 4WNQB 1BJ8A 2EC8A 2FEEI 5MERA 3QIUA 4U6VL 2YHGA 3DVNB 5F3BB 2R4SL 3P0YH 3D0LB 3EYQC 1NGXB 3I9GL 4OLWL 3GSRA 4JVUA 1ADQL 4UNTA 1JTPA 1OP9A 4NQCD 4ONGH 5DMGD 1WQVT 2CUHA 2YN3A 4OIAA 2MPAH 4BSJA 1K2DB 7CGTA 4DGIL 2D4DA 4X7FC 4HK3J 4IMKC 1Z5LB 4N9GB 1VENA 3HKFA 4QTIL 2PYEE 4ODXB 4PY7A 4N9OB 3CH1A 3ZYJA 5DD5L 4GMTL 3SKOA 3W5MA 4Z7UF 1CXKA 4P5MA 2AQ2A 1OTUD 1YEGL 1I1RA 3HUJE 5DS8B 2V5SA 3CXHK 4O02H 4OAWB 1V3LA 1BVLA 2EIBA 3MLYH 5FO8B 1YMHA 5E8OB 4EN3C 1JNLL 2J6EL 3RL2A 2XG4A 4TUOB 5CEZD 5E08H 5C3TA 3AB0C 4XGZA 3OKMB 5FDWA 3NZ8B 3IJYA 4ONFH 4OLXH 2FLBT 1OGAB 2H2PD 3MNZB 5E00B 3AY4A 1AGBA 3TO4A 3BP7A 4PJGB 1AQDA 3RIAK 1IGFL 3OG4B 2OR9L 1BREA 3L7FA 5LXGL 4OGYH 1HNFA 2HT4D 5IJKC 3F7QA 3CNKA 5GRYA 5KSBF 3MJ7B 3KPSA 2XZCL 1B9ZA 4OGXL 5JXEA 2LAGB 4I77H 3U0WH 1KC5L 3BZDA 1JN6B 1MY5A 4HXBL 5ICYA 5IBTL 4LVEA 1MFCL 2BNRB 2ERJC 4P2QA 4Q74A 3UBXI 1KIQA 1XF2A 4J1UB 2ZUXA 4OD1H 4NZTH 5IMMA 5E5MA 3PV7A 1FRGL 1CFNA 2P8LA 1IT9L 2ADJA 1PX4A 1TJIL 2CSPA 3E3QC 1L0QA 3T3PE 4GKSB 4F37K 4XC1L 3G5XB 3ZHKA 4HWBA 3IS1X 4HS6A 3VFTA 3MCKB 5ADOL 5D70L 3P4MB 1H9VA 3GBLA 1I85C 1FYTB 3HRPA 4N0CD 1VFAA 1G7HB 4WO4A 1P1ZA 2EZ0C 3I2CH 3PL6C 1C1EL 1YN6B 1I8IA 3BAEH 4KDTC 3K0WA 3MJ9A 4AMKH 1KCSL 1K8DB 3RA7L 3UJJH 3KPOA 1N6UA 3VD7A 1T1ZB 1JPGA 4HLJA 5JQ6L 4NKMA 4F33A 4X80L 4JFDB 3LQAC 3MNZA 5E00A 1GC1C 3BRGC 4JQXA 4GW5A 3TO4C 3QA3B 4LCWA 4IRSB 2AP2A 2VXTL 4AIZB 5CJBA 4M43H 2ZSWA 2VAAB 3MLUH 1A6PA 2ZUQB 5HDBF 5DXWA 2NZ9C 4P3WA 5D2LA 4HKZB 5DD6A 4R97B 4BQ6A 1P7KB 3TZVD 3UXFA 4PJHA 2N56A 2ESVD 2IANE 1AHWC 4LSQL 4PRHE 1DSFL 1JUFA 4LLQA 1CGSH 4G9DB 2D7TH 4TTDD 3W0WA 3LIZH 4NNYA 3GIVB 2VR9A 2K1MA 2FEDD 1J0YA 1CZ8L 2X42A 1L7TH 4LIQE 1CQYA 3T3ME 3GMPA 3OZ9L 4OUOA 1KENL 3IKCB 3L3KB 2COQA 1HHIB 4FS0A 3HHRB 2A6JA 1RZIB 4Z7UE 3OKDA 5GIRB 3FTGB 3TESA 5DQJB 3WJLC 4IMLA 4NKMB 3CMOH 1FO0B 2DMCA 5MEQA 4Y5YB 3QNYB 1I8IB 4RGNC 3VGFA 3GJEA 4WV1C 1NGYA 5LKNA 1XIWD 2V7NB 5F6IB 1CGUA 3FO9A 4LPVA 5EIQA 1MLBB 2IG2L 2P42B 4HKZA 3Q1SH 5DRWB 2QV2A 3MV8B 2X4RB 1CR9H 4ETYA 1PD6A 3TBWB 3FHAA 4JFHD 2CK0H 3SDDD 3O6FB 3MLWH 3OZ9H 1IAIL 1QSED 2ADFH 3AU1B 5D8JL 1U91A 5EOQH 3U6RB 3O3BA 4ZD3L 5L2KB 1CLZL 4X4ZA 5C08E 1XGQB 3FO2B 5D71H 4I2XE 4N5ED 4KKBC 1Y18A 4I0PB 1J0HA 3O4LA 2VLRB 3VXPB 4NO3A 2ORBH 5I73C 1P5VA 3PDOA 4UDTB 2DB8A 3KPNA 1XR8B 1A3LH 1B4JH 1A7QH 5CZXD 5C0EA 5IFAL 4ISVA 4BSWB 4JRXB 3VD9A 4GRLB 1RSFA 1FV1B 3SE9L 2JCCA 3GJEB 1IGJA 2GFBB 3ZL4H 2GSIB 3LEVL 3S37H 4DCQA 4WHCA 5H2BB 1C08B 3SDDC 1TTFA 5E6IA 1R3IL 4QRRE 4HD9A 4ZS7H 4F7CA 3FT4A 5F8QC 1NGWA 4MJIE 1DQMH 4XCCH 3H42H 1OLLA 2APFA 1IM9D 1QLRB 4MNHB 1LWRA 1XGPB 5ITBL 3H9YA 3BE1L 3VRLF 4X7CC 3S97C 1LMKA 1JZ4A 4HS3A 1I9JL 4WGVB 4ZO8A 4U1NB 1OW0C 1U2HA 4JFDD 3O8XA 4ZXBA 4QYOA 1CDUA 1CFQB 2IFFH 2YC1B 4HUVA 1D6VL 12E8H 5CD3A 2AGJH 2EDTA 2X70A 1IAIH 1GOFA 2ADFL 4X8XA 2NXZD 5CHNA 1ZXQA 1I8KA 2W0KA 4DZ8B 1AGBB 3TO4B 1IEAB 1CLZH 3OJMB 1G9MH 3BIBX 4U1LA 4AH2A 2Y36H 5T33L 2IG2H 1YNKH 4P4KB 4RISH 5GRXG 4MDJA 2YRLA 1KFAL 4WHYH 2RIKA 2PR4L 5GGTL 4PJXE 4I77L 4J7RA 3U0WL 2XTJD 4N8VG 3C2SA 1MIMH 5E2VL 4G8GB 1BP3B 4NT6A 1KG0B 4XNUL 2NW2B 1I1CA 1BM3L 1X5GA 5IMLA 1MQKL 3WO4B 5IB4A 5HGDA 1CK0H 1IAKA 4ORZC 1I3VA 4O51A 2IEPA 3SDDA 5C0RH 4ONFL 3IRZA 5KJRH 4B7LA 1E4XL 1ZTXH 4JR9L 3CSPA 1QLRA 2W60A 5FHAH 3MCLL 1KENH 5JW4M 3O6MH 4UZGA 3EYFA 3CDYA 3GNML 2EDXA 3IJHA 4NQCA 3CMGA 3NTCL 5B39B 1JGDA 3I6LE 3MMEB 1ZHNA 1M71B 3B9KB 1BIIB 3ZT6A 4OQ1A 1ZLWK 4NHUB 4NQSB 3T4AA 2SEBA 1WWBX 3BP4B 1XGUA 1PZ5A 2Z35B 3PGDA 2C1OA 4Q0XH 1JGEA 5J6HB 5I30H 4L3EE 5J13B 2VLJE 4GAFB 3ARTA 4XP4H 4LLWA 1OCWL 3CSGA 4X4ME 4R2GC 1QRNE 5HI3D 1BBJB 3MV7D 5GRUL 5FV1L 4QRUB 1NL0L 4U1HA 1NANH 1T7VA 4DGYL 4E9LA 4AJ0A 1IILE 5I9QB 1Z3GL 2DQHH 3QUXD 3UJTL 3SE9H 2K7QA 2D31B 3B5HA 5F89B 4OLZH 4ZFOA 1UT9A 3RBGA 1A9BB 4U6VH 4HHAA 5M95B 4GUPA 4IIQA 4L9LB 4CRPA 1HYRC 5C0GA 2WLZA 1U8IA 3VD5A 5CD5D 2FZ3B 1DANU 1ZHLB 5HYJB 5E4IA 3QUYB 5JMOC 4ZYKB 3DXAE 4JREB 5IQ9B 4ZNEA 4XCEB 3PHQA 1ACZA 1NC2D 2YPLD 1O5DT 1OGAE 2CUIA 3MX0A 4X5LA 5KSAD 2BVEA 5L8KB 3VA2C 1GYAA 3TA3A 4AENA 2ATPB 3QI9B 2PXYD 3W82A 4F9LA 5IEHB 1H5BB 2FCBA 1WCBA 3E6HA 1KACB 4O4YH 3T4YB 5A1AA 3W39B 1T21B 1I9EA 1XIWB 1BFTA 4HMEA 4QRUA 4TTGA 2GITA 2C1OB 1GIGH 1LK3L 4U1MB 5CP3A 4PRPA 4JDTL 5GS2H 3P3YA 1MCJA 3PF2A 5D7IF 2I60H 4IM8A 1D9KD 3U9PL 2CRYA 5DJZB 4X6DB 2AKRA 1J05A 2E6PA 4JM4H 2X2YA 2HFGL 4HUUA 4AG4L 3LQZA 2ARJQ 2PUQT 5GGVY 3M8OH 5F93C 1QNZL 2F19H 2WWMD 5IQ9A 4GXVL 5C0BE 4I3RL 1T66C 4UQ3B 2DJ4A 2CIKB 4JPVH 4ODVH 1CXHA 3TIEB 5F7EH 2YN5A 3S3PA 2AXJA 5E70A 1T6VN 4PJXB 5I18H 5I73B 3C87A 1T3FB 4GMSH 4HQQH 1Z0MA 4WU5A 5JA8B 4DZBB 4N1CA 5CAYB 1RZ8A 5F9WB 3DYPA 4NM4L 4Q6IA 2YKLH 3T2OA 5GS0D 1VSCA 4HG4K 3PABA 3HE7D 2WBJC 4OZHB 2QSCH 2QHRL 4FG6D 4JFPB 3BZEA 4Z76A 1KYOK 2GITB 4M6ML 4IS6A 3KJ6L 4MCZB 4D3CH 4HKXA 4B5EA 4CJ0A 3UDWC 3MZTA 3ARBD 4UB0L 3LSOA 2AJSH 3QXDB 2BNRA 4XI5C 4N0UA 3TBTB 3PJSA 3BISA 5DD1L 1NAML 1HKLL 2ZCLL 4ZQKB 4XPBL 4JJ5A 3HRZA 3UTQB 4LDLB 5HHOA 4FQ2L 3AFLA 4WUUE 1H3PL 3HTLX 4XMKH 4QGYA 1JHTA 3CK0H 1U8QA 4Z7UB 1H3VA 3MRNB 4FP8H 5EBLA 4EUPH 4HGMA 3QI9C 5ID0A 2YSSB 2VLJB 3UZVB 5JOFA 2DQFA 2YD8A 3BZ4B 1IKFH 3QG7H 4AT6A 2H2SC 1PX3A 4PJ9A 4GSDL 2DMKA 2QADC 1IKNA 4FFVD 1S7RA 4UBDC 4Z76B 1A6AB 3MODL 4TN9A 1DE4A 1LP9B 1QQDB 4OUUA 1KEML 5EZJA 4BFIA 3C09C 4QRTB 4GRWH 5CILL 2R0KH 1JNJA 4A6YH 4NBZB 4G3YH 1EJOH 3LMJH 3DX9A 3IDNB 3NFPB 5DJCB 1RQ5A 1E6OL 3L3DA 4LPXA 4JO1H 4EEEA 5J3HD 4JFEA 5I1LB 1MEXH 3MODH 1PQZB 2R2HA 5HJ3B 3NCBB 2H2SD 3C2AH 5F7NC 4NPYA 4JRXE 2A6DB 3CLFH 1GH7A 2R2EA 4LCCC 4KTDH 1JE6A 4HH9B 1G9NH 2X4SB 3DV6A 1KPRB 1T2JA 3WE6B 4ODXA 4X6FA 3S5LA 4PGEA 2J8OA 2KUTA 4M03A 4M7LT 5IFJB 1UB6A 2FJHA 3UMTA 1N3NA 5FOBA 4MNQD 4TPRL 3JTTA 3O0RL 5T3XL 4LSSH 4LQFH 5DMKA 3STLB 2QTEA 4RGMB 4PJ9B 4BELD 1ZLWH 5INDA 1KPVB 1UH3A 2P5WB 5CJQL 5ACLA 2C4FU 2CXGA 2XWBA 4K7PY 3D2UD 4N90E 1HCFX 3HI1A 4YGVA 5E24E 3RBSA 1MCEA 2A83A 5FDWB 3WFCH 3GBNL 5DVMA 3EDEA 3KPQB 5MI0B 1RJZA 2H8PA 1U3JA 5IVXA 3RZCC 1HE7A 2ZNXA 3HC0A 4OZGE 2G2RA 1AQDB 5KVDL 4MA1B 4Y4HD 1J1XL 5FYLD 5EBWB 1MHEA 3MRKB 3D3VE 4G7YH 2F9BT 2R2EB 4ZDHA 4POZC 3VXOB 3V5HA 3QFJB 3RUGF 4WW1B 2ILLA 4HPOL 4L3ED 4JEGB 5JXED 1AI1L 1A6WH 5MHSD 3CXDL 3RUGA 4Z77B 4WHYG 5C70A 1PEZA 1JPFB 3JV4B 2VITB 4R97C 4XNYH 2W91A 4BFGA 4M1GH 1K8IA 3S4SA 2YK1H 4F7CB 2BZDA 3DGGB 3TO4D 2CK2A 1SJHB 3SKNB 1UYWH 5JIHA 1NCTA 3M8OL 2NR6D 2NXYB 3UX9B 5DO2C 1FZKB 1TCRB 2P5EA 5ILTL 3WFEL 5D6DC 5DSCB 1A7OH 4GW4B 4F37F 5A43C 4KKNA 3ARPA 4YK4C 3GSNA 2F53B 3KVQA 2DIBA 5LCVH 1XF3A 2VDLH 1A1OB 5ANMB 3UYRL 2N7AA 3HI1B 3QIUC 1UWGH 3UYPA 1UKSA 4Y4FA 4ODTH 5EIIA 4I5BB 5HJ3A 2C9AA 2NYYC 4YUEL 4NZUH 1F13A 1IGCH 3GMRA 3GRWL 1TIUA 5SX5H 1AH1A 1R5WB 4LOUD 4TUJA 2YD5A 1P69B 1F4HA 2DQJH 4Z8FL 2J8UE 1CVRA 4XCNA 5IM7B 4AG4H 4OT1H 4FMKA 3O2DL 4LKCA 3CSYA 1WWAX 3P9LA 4HDIB 2BJMH 5CJ5A 2NR6C 4RGND 3QSKB 2K9UA 4RQQA 3BP6B 3VXRD 4J3OC 4QOKD 2HFFB 5KVFL 3RI5F 3TBTA 4RGMC 5EO0B 4NFBA 5L2JB 1WBYA 5T1DH 1QPPA 5B8CB 4WCYH 5C1MB 3DX6B 3DO7B 3PWPB 2JJTC 1D6EA 5D2NA 2H2PC 3HAEH 5E2WL 2DS4A 3B2UC 5JXAH 4GRWE 3ZT7A 3OKKA 2A6JB 1T83C 1GZQA 3CLEL 3EYFB 1CG9B 3MBEA 2XWTA 3L7EA 1LO2H 1F90L 1U8QB 4Z7UA 1X3DA 2OTPA 5EWIL 5HVWA 2C7UB 1N6QH 2G60H 4RAHA 1HOCB 1WCQA 3SOBH 5KZCB 2BK8A 5I2IB 1T0PB 1BBDH 3RKPA 1FO0L 3IFNH 5ESVB 2WIMA 5TJWK 5JIPA 2OJEB 3D0VA 4U1JB 1GZPB 1OWRM 3GMRB 1F8TH 2AXFB 2JJUA 4UIMA 1FP5A 1WBXB 2VITA 1MCPL 4U0QB 3QNZA 1XMWA 5JPMA 2RB8A 1RHHA 1S5IH 1RV6X 4YBQC 4MB5A 1Y0LA 4XNXL 5ERWA 5T1KD 5I8CA 1ITBB 1NCWH 5J1TC 3EGSA 4WEBH 3VFOB 1F6AA 2HH0H 2NX5A 3SCMD 1FFNA 2DYPD 1F02I 2QADB 1NFIA 2EYTB 5L6YL 4Z7OF 1AGDA 5ETUA 3ARFB 3V52L 5DJYA 3MGAA 4WWKD 2WMPA 4JPWL 4NQEA 1RUQL 4H5SA 4ZOAA 3CFCL 4XNZB 4MAYA 3KPLB 1KIRA 1WIOA 1A4KB 4JDZA 4CDHA 2GW5A 4MD5A 5SWSA 1CWVA 1LK2B 3X3FH 3G5ZA 4HWUA 3IKKA 1Q94B 1OGAA 1AXIB 2NY2C 2H6PA 4EIGB 1NLBH 3WL9A 4YQXL 4R4FL 3G08B 5LWYH 3TA3B 5F9OL 3EJYC 4GW5B 3U46B 1BAFH 4JRYB 4GAGH 3MCLH 1F45A 5F7WC 5BJTA 1NC4B 3KWWB 5E5UB 3T0ED 5EPMA 5IB5A 1L4IA 3SKJH 3RGVD 4ZXBB 2Z8SA 4RAUA 4NN7C 1A6ZA 1I75A 1FVCB 3BPOC 4NM8L 3VFOA 1AO7D 3V79C 4I9WD 3QNXB 4JN1L 4WWKA 4HIEA 4OI7A 4OZIB 3DVFA 1KPUA 4R4FH 5LWYL 3TA3D 2EDQA 1T7XA 1N59A 1JPTH 4I3GA 4F57H 3QQ4A 4L5FL 4EUPB 4MCYB 2V5TA 4NQVB 1GGIH 4HBQA 4RFOH 3HZVB 3RPKA 1QO3A 1CD1B 3SO5A 2BRRL 2ARWA 5I1AB 5GGRY 4Y5VB 5GS0L 1YPZF 3VXOA 3VWJC 3VH8B 2J7LA 1CE1H 5GZND 4WFFD 1TMCB 4HG4J 4JRYA 3QUMA 2BSTA 2P43B 5DURB 5DZLA 5IJVB 4ZSOE 4DN3L 1ZSDA 3IU4L 3MUZ1 3PIQA 3SBWA 1RIHL 4JHWH 1B4RA 1QP1A 1GGBL 1K4CB 3KPTA 5D2LB 5DD6B 2EDBA 4J12A 2DL9A 1WGOA 2Q20A 3AU1A 1T89A 1BOGB 3FT3B 2PCPA 4PLOB 5E99L 4LHUA 4KI5C 5CJOL 4LVNB 3Q6GH 2YPKA 5B21A 5C0JB 5D71L 2GHWB 2Y6SD 2ATKB 3L5XL 2QKIA 3GSQA 2AK4A 3W81A 2E7LC 1CLYL 3MREB 4OQTA 4KUZH 5CZXC 3GSRB 4ZAKA 5FXCH 4BJLA 5DJ8B 3SO3B 4HIEB 5FCUL 5IUSA 3DUSA 1KLUB 4PV8B 4OZ4A 4UV7L 4ZQKA 4UDTA 4FOMA 4X6CF 2XXCB 2BSRB 3O3DA 1SJEB 2EH8H 4QHMB 5BOZG 4JFXA 4PRAA 3RWFA 3TVMB 1CFTA 2MOVA 3AC0A 4TUJB 3V6OC 3OAYH 3W9DB 4ZFFA 4AZ8A 1NDGA 4NJ9H 4Y5VA 4DQOL 3DHMA 1RVFH 4U1GC 3KPSE 3PXHA 3W2DL 1R3LB 2JK5A 1AHWB 1XZ0B 1LO4L 5ICYB 1DBJL 2Q8BH 1OW0A 3MRPB 4YHKH 2HFEA 3O6KL 3WXWL 1KB9K 2ADGB 4PJ7A 4TSBL 1NCDL 3NAAH 1WBYB 1X4XA 1G9EA 2DIAA 5C0GB 2FX8L 3ZE1E 1W8NA 5TH2A 4X7EC 2R8SL 3QNXA 2FX7L 2BVQA 3WKML 3I6GA 1NBVH 2P24B 2BSSB 3S34H 5BW7C 4WFGE 1YN7A 5DC9B 3QPQD 1DVFB 2KQNA 5LGKA 3STBA 4K8RC 3LB6D 3KG5A 3W2DH 5JW3L 2N7BA 3VI3E 3HMXA 4JFEB 4XB7A 2A9ML 2XNAA 5F7HA 3V0VA 2C3HA 1KFAH 1L7TL 3K8MA 4F33B 1FNLA 1SEBB 3HNSH 4KZDL 3BSZL 4NQDE 2MNUA 3FZUC 4GRLA 1U93A 5FYKD 4U33A 4TULH 4XPTH 2WLYA 5CJXC 4IDJH 2CLRB 2X6MA 4WFHD 4LLDA 1KG0A 2RGSA 2PO6B 3RA7H 3QUXB 4JHBA 3WJJA 5C6PB 2ADGA 4F9LC 2QR0A 4WEBL 4QTIH 4Y4HA 5IFJA 3EHBD 3MRGB 2OK0H 3MJGX 1NLDL 3VXUD 4NN6B 1OVZA 1IEHA 4LLVA 3MRPA 4A6YL 4M43L 4E42B 5IF0A 2W60B 4F9PC 3W0WB 3IDUA 2DDQL 4F7TB 1B0WA 3FN3A 3ZDXE 1FCCA 4OKVA 5CMAB 2EDJA 2DLEA 1PG7X 2Q76A 2VQTA 4ZD3H 3P77A 1MWAL 4U31A 3ZT5A 4XVUC 2VLKE 2P24A 4R26L 1BWMA 2PTVA 3ISWA 3BPLB 1GGCL 2G60L 3CFDA 4LF3B 1OAUL 5T5FH 5MERB 1ZKAA 1NEZG 2R1XA 5JHDA 3WS3A 2FL5B 2MCPL 1JCKA 4XP4L 2GK0A 1B4JL 2PYEB 2Y9RT 5I30L 2G5RA 3TH4T 4OI8A 3P9WB 3D2UB 3FN9A 4BZ2L 1DLFH 2FBOJ 3V0VB 5LGHL 2F8OA 4LVNC 2VXQL 2F5BL 4C4KT 1AHWA 1MWAB 1U92A 4LIQL 4JRWA 3BEWA 5F6HI 3TBWA 3BW9A 3UJIL 4YLQT 1N26A 5JW4R 4GQ9L 1KPUB 4E0RA 1RZJC 4CVZB 3QDMA 4Z7OE 5ECJE 2GCYA 3L3GB 3PWPE 1ZHBA 3V6ZA 2P5EE 4URTB 4HWEH 4O2FA 3HZKA 4H1LA 1YNTA 3CUPB 1AXSB 4AEFA 2HT2C 1A7BA 1QLFB 1IGCL 1FGVL 3BZFA 1IC5H 1EK3A 4Q9QH 5HVGB 4P2YA 5EBMA 1MI5B 4NHCH 4H8WL 3V0AC 4EVNA 1ZV5A 2BJML 3ZKSD 2OL3B 3CFBB 1BD2E 2HVJA 1H8SA 1HQRA 5DT1H 1EFXB 2F74A 2J5LC 1QBLL 2IQAB 1CL7L 3MRCB 3KPRE 2AJ3B 2FX9H 2B0SL 1MJ8L 2X4PA 4ZUUA 3O11A 4AMKL 1J5OH 1JMXA 2BXZA 3I02B 3IDYC 1RUPH 2ZP0T 3RX7A 1NCWL 3QZWB 5EOTA 2VLJD 1GGYA 2R0KL 2R23B 3QJFB 3OKEA 4Q6YA 1AGCA 1RAMA 5MEND 4LRIC 1A0QL 1D6EB 3GSNL 1V3MA 4QHMA 5BO1L 4WENB 4M7KH 4UI2A 2EXYD 4FQIH 3K2UH 2XTJC 2XYCA 2GUOB 2DWDB 4HJ0C 1UVQA 1KCVH 3HE6A 4H88L 1F2QA 1CD0A 1MCFA 4P2OD 4LSPL 4AIZA 1YC8A 3RTQA 2JE8A 4KROD 3HUJB 1SVZA 4O2CB 1LE9A 2V2TB 3EYUH 3TNMB 1PEWA 5DFVC 2OR9H 2R1WB 1F5WA 3QEQD 4X7SH 5A16B 3PHOB 3O3UN 2Z92A 1HZHH 4ONHB 4N0YL 5J1SC 3GSNH 1LO0L 4KJPC 2AK4D 2IMNA 2NQCA 1SYVB 3T0WA 3GGWA 2APTA 1Y6MR 2VL4A 3U82B 1B3JA 1KCKA 4GAYA 5F7LB 3ETBF 3GSXA 1E6JL 1RUPL 3ARFA 3UTQA 5DRNB 1YNTB 4HJGA 4OT1L 4K55A 4KJYB 3DUUB 2Z8WC 4DVBA 5D7JA 4HCRL 5EU3A 5BS0A 4P2RE 1FFQA 4U1IB 2ED7A 3FOLB 4GAGL 4NZUL 3ARFD 3MLVH 4ZNCD 2EDWA 3H7BA 3QIWB 4MQSB 2DQCL 2AJUL 3PDDA 4CDGC 2QADD 4FFVC 3VFUB 5DYOB 2EC9T 1WTLA 4L4VA 3DURB 4NZDA 2J6EH 1UZ8B 5IW3A 2NTSP 3VJ6B 3JWDH 2GUOA 4E41A 2NMSA 1X5FA 3D25A 3F7RA 1RU9H 3BD3A 1DUYB 3MUGB 4WI3A 4ZUUB 4EI5A 1HCVA 4FZ8H 3AUVA 3FOMA 3IDYB 1HHHB 1KTDA 4HV8B 4YNYA 3IAPA 3T0AA 1AO7A 2Z0BA 3DSFL 5A40E 1U91B 1MJ7L 5HYEA 4RMQA 3CD4A 4AL8H 4GLRI 2EE6A 2OXGA 5D1XB 4RBPH 4M5ZL 3EJJX 3MO1B 4MD0B 4QRRB 1IAOA 2BOBB 5KS9A 2GTWA 1U3HD 4H1LH 2HT3C 4MS8D 3QDMD 2VXQH 1C08A 3FO0L 5KSBB 3IJSA 3VH8A 4JKPL 1NAMH 4ELME 3GHBH 1JHLH 2D3VA 1BHGA 3ROLB 1SY6H 2AI0L 1JPSL 4J23A 1QVOA 5JO5A 3O4OC 3NFSL 2X1PA 5HHVH 4CAGA 2AK1H 4YDIL 4WUUD 3EO9H 4QEGA 3DX6A 1GCFA 4M62H 4P59L 1CD9B 2YXFA 3QUYA 1AKJB 1I8LA 3HZKB 1IGYA 5BRZD 3BE1H 1CLCA 4WEUD 5IROA 2DM7A 4EJ1C 4TOYL 4Z9KB 1Q9OA 5HHXH 1HYSD 2M2DA 4L8BB 2G2RB 4QNPE 3V5KA 3INUH 2OMBA 3IGAB 1FFOA 1H0DA 3DSFH 3VI4E 4ZODA 1TNNA 3ULVC 1CE1L 4TSAH 2UWEF 3O6ML 1N8ZB 1FPTL 1HQRB 3PNWA 3VDBA 3LKPA 4ZOBA 2ORBL 3TCLA 5BMFL 1NDGB 5J12B 1RK0B 4MNQE 1TQCC 4WWID 1R3LA 4PBVC 2GYSA 3I02A 3U9PH 3ROLA 2J5LB 2VLRD 2WZPD 3IDIB 1FVEA 4OM0L 4C83B 5K59F 4PJ7B 4PJ7F 3SEPA 4EDXA 3DMMC 4R2GD 4WVRA 3WXVL 5GGTH 4PTUB 4HCRH 5D6DA 4PJFA 3GMQA 4MA8H 3MLTB 3NCFB 2APXA 1FNEA 3U30C 2VUYA 2CDGB 3QCUL 1CGWA 1BQHG 4Y5VC 4QRPA 2X5PA 2QLVB 1MQKH 3CPLB 5CJ8A 3A6CL 3RVWC 1HXMA 1D6VH 2IH1B 5F88A 4K71B 1HHJB 1EHXA 5CBEA 4X6BB 4XAWL 1QSFD 1QLEL 1EIBA 3GB7A 5CEYB 4OZHA 1L6XA 3V5HB 1SBBA 4J6RL 2EIEA 4AM0B 1BD2D 2R0WL 2VZSA 3PWVA 1EERB 1KELL 1OP5K 3HG1A 4LLUA 1UA6H 2IANA 3BPCA 5L88L 3M1BA 5MP6L 3RVVC 2IGFH 1A1NB 3BN9C 4LCUB 4G8FA 5BO1H 1DN0A 4YPGA 3GGWB 3RWHB 3S36H 4ZMAT 4PY8J 3MOQA 5I8EA 3DXAB 5HHQB 3RI5K 3G6JE 2R39A 1DQQB 1FNFA 4OFIA 3JVGA 1WIPA 3K1KC 3QDGD 1YYML 1CD1A 4P2QD 4GRLD 4OF0A 3GSNB 3MACL 1A7QL 5HYQA 2VJXA 1KJ2H 5EBLB 1FYTA 4IRJB 3BH9B 3IFOB 4OCYL 3BQUB 4WUKL 3LRSA 2IBZX 2Y5TA 3D6GA 5D72H 4OZGB 3GKZA 4WTZA 3IGAA 4NUJA 4S1SL 4PRIA 4U1KB 4NOBA 3DHJA 5E7FA 3MGTA 5C0DA 1AD9B 1CN4A 1JF1B 3ZE0E 3BP7B 4K23L 3P73A 1XIWA 1CF8H 4M93C 2DLHA 1A6AA 5DWUL 4YBQD 3MYZA 5CSZB 3C2AL 5F88B 4OF7A 5IB2A 5J89A 1EAPB 1ORQA 1IGML 3BH8B 4XNMA 4UIMB 2HJLB 3X14B 4GAJH 2YKLL 2ZSWB 4ZTPL 1R5IA 2HJKA 3AXLA 4RWYL 1A1NA 1YMMD 4POYA 1MRFH 1FH5L 1L7IL 5DJCA 4YPGB 4RQQB 3WO4C 2MJWA 1INQA 3DARA 3OGCA 5C86A 4D2NA 1M4KA 2DLGA 3M1BB 1YY9C 2B39A 2EIZA 3U0PA 4PJFF 3OWEA 4RFEB 5IVXB 2ESVA 4MA7L 5HYQB 3O2WH 5IHZB 5TE7H 4K7PX 2JIXA 2E8YA 3OKKB 1GHFL 2ICWB 4P57B 5CEZL 5IIEA 1PDKA 2BOBA 1WBZA 1QRNB 4NQEE 5KJRL 1ETZA 3Q1SL 3HC3H 4K94L 2HN7B 2GJ6D 3ARBC 2HAZA 2ZCKL 2XRAL 1PYWA 4R7DB 3QFDA 3FO1A 3GMLB 2W0FA 1AXTL 3EDKA 2EEAA 1M7IA 3RWEA 4QXGL 1F3JA 4PJCA 1T1ZA 1S5HB 1OTSD 2V7NA 3WIHL 1NGPL 4ODWB 3MBXL 1JF1A 3VRJA 3PWVB 2VDOH 1MLBA 5IV2B 4O51B 1X5YA 5IQ7L 4PB9L 1JNHA 4M6NH 1FLTX 1X5JA 2XKUA 1XR9B 1KNOA 4ESKA 3CVHA 1G6RB 4IRSD 3V5DA 3SHSA 5BV7B 1UM6H 5DMIH 5TFSL 1KEGH 4TVPD 1J0ZA 3FO2A 5GZOC 3OF6A 1JUFB 1LVEA 3JTSA 2BHZA 3WCYA 3Q2CA 2QQKL 2VDRL 5EA0H 1GAFL 4NGHH 1Q8MA 2EE9A 2MQCA 1BFOA 2CRMA 1LILA 4HEPG 4WW2A 4G43A 4JDZB 5KSVB 1CT8A 5IHZA 4XWOD 1T1WA 1HEZA 2YWYA 2E5EA 3VRIA 4PJAE 5MEPB 1G9NC 4ONGL 4O5LH 3MNVA 3FQTA 4UV7H 3TH2T 5JUEL 3LQAH 3SCMA 3N50A 3VFGL 3N1FC 5D1QA 1INDH 1ZANH 3ARXA 3C60B 4R7DA 1NGYB 3DECA 3CFEA 2D31A 4JO3L 1NMCB 3P4OA 3MLXL 4YBHA 1J86A 2VXUL 1YEJL 3ARDB 1NFDB 1TZIA 5LBSH 1XGRA 3RGVA 4WI5A 1N2RA 5EO0A 1HI6A 3ARFC 4U4BA 2YZ1A 4FFYL 3HB3C 4HC1H 1YMHB 5IMOB 5CSBA 3EFDL 4LRIA 4Z7VA 1A1OA 5ANMA 3SE8H 4KVNL 2XY1A 2ZOLA 2XKNA 4BSVB 2NY2B 3T1WA 1QZ1A 1NDMB 3QO0A 4JHWL 1IQWH 1Q0XH 4QRTA 4Y4FB 1D5BB 4GKNA 2DM2A 3SDXE 3O0RH 2RBLA 4OD2B 3U36B 5FM5O 1OGAD 1R5WA 5F7DB 2XN9B 3C6LB 2FGWL 1IC1A 4XP5H 3T0VA 5E08L 3L7FB 4NKDA 4CBPA 4U6XA 2R56L 4HIJA 2WNGA 5DJDB 3R1GH 5T1LD 3WYRA 2VN4A 4QT5B 1EEZB 3T4YA 4G80A 1JFQH 3HAEA 2MQ3A 5TE4L 5C0RL 5KSBE 4Z8FH 1GZPA 1RMFL 4X9BA 3H7BB 3V4UL 2UWEB 1N0XH 1CGSL 3O6KH 3O3EA 5E8NA 2Q8BL 4JFZL 4JVWA 1YUHA 2CLVB 5IV2A 1IL1A 2IFFL 4MXQC 3G9AB 3T09A 1HHKA 4LLYB 1RIUL 1CBVL 2F8XC 3VXMA 2NX5E 4PJ7E 4DN4L 1BOGA 1MPAH 1Q9KB 3TO2B 3WDJA 3GKWH 5GRVL 4ZNEE 3GRWA 1RZJL 1WK0A 4PJIA 1JWMA 4FQXC 4NN6C 4NQCB 3D3VB 4PS4L 3U1SH 1FL6B 1IGMH 4XI5D 4DUWA 5C0CB 1N5YH 4PRPD 4JDVB 3AREA 4NN5B 3OR7B 2VZ3A 3GSWA 3KPQA 2DLIA 3S37L 4CW1A 3MA7A 1XT5A 1BQHA 1EEZA 1F6LL 1FCGA 3Q6GL 3RIAF 5KS9E 3D48R 3UPRA 2VDOL 3H2WA 4MSWB 4D0DA 1DBML 4OFDA 3BT2L 1I4FB 3I6KB 4W70A 5HVHC 5JDJA 3E0GA 4Q7DA 3VGHA 1Z9MA 5KSAA 2QEJA 5ICXB 5EU7C 3EIFA 4NZTL 5DMIL 3L6FB 1G0YR 1RHFA 1DQJA 2IALA 5EOCJ 2D7OA 1SJHA 3SKNA 3GM8A 2IBZY 2R23A 5IMOA 1MFBH 2UVFA 3CC5B 5FA4A 5DEFA 2P47B 1FNSH 5EU4A 3RVXC 3QJHB 3FFDA 3BKMH 2FO4A 3B43A 4ZPVA 1DVFA 1OSZB 5ALCL 1WBZB 4LASH 4W68A 1AC6A 4CADB 1AFVH 3CDGA 1NUDA 1N0XL 4J6RH 4JCLA 1KJMA 2UZXB 4PJBB 3ULVL 5CP7B 5HYSA 1G0XA 1VEMA 2W0FB 4A6YA 3QIWC 4RWYH 3MBED 1VHPA 4PR5A 4XPFL 2VDNL 3O9WB 5FM5M 1P4LB 5H37G 3T8XA 3N9GH 1FC1A 5L9DL 4K3EL 2LTQC 1MWAA 1TCMA 2W9DL 1F58H 2EDYA 1OQOA 3QUZD 1L6ZA 1H8NA 5CEXA 4PJEB 4XC3L 1DSFH 1IQWL 1Q0XL 5C8JB 5GGVH 3QP3A 4LGSB 4HWBH 1DEDA 5DD5H 3MRGA 5I19L 4XP9L 5I1IL 3GJFA 5A2LH 1B2WL 2BSED 2GCYB 4N1HB 4KI5E 4GKSA 1T4KA 2HWZH 5EC1A 2AEPH 3MLRH 3LZFH 1JWSB 3MC0A 5C0NC 1INEL 5EOCH 1RUQH 3MJ9L 5FKAB 3WUWG 4B41A 4LLMA 1PVHA 4ZS7L 1GZQB 4PJCE 5I75B 1BFSA 3PHQB 3D85A 5D1XC 2IPTH 3LRGA 4Y5XC 3P0VL 5DJ2A 3RZCD 2X1XR 3UBXB 3QQ3A 3QUKA 4OCRH 2NNAA 3HMXH 1J10A 3NH7L 1HH9A 3TBYA 1TVBB 1ZEAL 2HT3D 5DVKA 1FO0H 3H3BC 3RVTD 2VN7A 1YQ2A 2QSTA 1A7OL 1TENA 3FQRA 2QKIB 2QQNL 1ZT4A 3V7AG 3ZSTA 5EZIL 3OXRB 4FQ2H 4MCZA 4PS4H 3VD3A 1RZFH 3HNVL 4KJQC 1DP0A 1HINL 1MOEA 2IADA 3CC5A 4M5YH 5FA4B 5HHNA 5JW5B 3VW3H 4RDQG 3RDTC 2I9LA 5I8OH 3LS5L 1PY4A 4Y19E 4IIQC 1XF4B 2OQJB 3LQZB 4GXUM 5D7KD 4Z6AT 4S1RL 5F9AC 3WLWD 3MYJA 4JB9L 4X9FA 4N8VA 4YDLC 3N85H 5FYLE 3TBSB 5EZOH 4NQEB 1KN2H 2MHAB 3IJSB 4QHNB 1OTTC 3C6SA 1RJLA 1TZGL 5INCA 1J1OL 4PRIB 4U1KA 4HUWA 1Z5LA 1GRWA 4HLZG 2IJ0C 2NY4D 1MCQA 3ULVD 5F7FA 3HI6L 4PB0H 1A2YA 3WFHA 4AEHH 3PGFL 5K93A 3O4LD 3U4EA 5FECB 4PPTA 2DI8A 2NY3D 2LVEA 3B9DA 3UTZA 5EORH 4KH2A 4YXKL 3QDJE 3CFKB 5HGAB 2DI7A 1KLFA 4ZAKC 3RZWA 3UEZA 3QIUB 3DMMB 3D0LA 4LSTH 5C07D 2W0LA 3NFPA 1BIIA 5KVEL 4I0PA 1P7QB 1OAQH 1N7ML 1AR1D 1H0DB 5L8LB 2RQ8A 4WFGD 3GZKA 3KNBA 5DTFA 4UMGA 3FFCD 1U93B 3RX8A 4R96A 3MLYL 1NC2B 2YPLB 2GY7B 4KUCD 4PGDA 4ZO9A 4PRBB 3RDTA 2OQJA 1CVSC 2YK1L 5IWLA 2PXYC 4P57A 2CIIB 4HK0A 3SDCD 5DA4A 1PKQE 3QIWA 4DCQB 1I1AA 1CDJA 3MOBH 2VL5A 4DKEL 1JPSH 5M7QA 4R2GB 1UVQB 4HMCA 3IDMA 4K3JH 5D96C 5GGRB 5K9KA 4X9HA 1AGEB 3BP6A 5F96L 1NH6A 3TBYB 4H1LG 4JFOB 1TZGH 4R8WL 5HDQH 1OARL 1VB9A 4I2XA 3CFKA 4FP8L 4G6FB 1FNGA 43C9A 5BW7A 1JZ7A 2ZUWA 4KGLA 2P1YA 4HS3B 4X6CA 5I71B 2Q76B 4PLJC 2ADJB 2NY1D 4XGZB 4ALAH 5FHBL 4NO2A 3UDWA 4D8PA 1FNEB 2IADB 3ZDXF 4Y0GA 3UZEA 3MBEB 4RMRA 4JPIA 2D9CA 4K8RH 3SDCC 3RY6A 2FHBA 1EHNA 1ND0A 2IPKB 2VAJA 2GTZB 4QRPE 5CJQH 3LEXB 5DRNA 1SJEA 3ZDZE 3KPSB 4LCWD 1EUTA 4WI7A 3PGCA 1YNLH 1AR2A 1T1YA 5GSVB 3NA9H 3FAWA 3A6CH 4W6YB 1FVDA 3VFNB 3LD8C 3DUHA 4HF5L 5F9JB 4G7VH 3LB6C 4RMUA 1S9VB 2WBJD 3K4AA 5A2IH 3IETA 3BGAA 3EGSB 1A1MB 3VE0B 4NKIL 1NJ9B 1GHFH 3SGEI 3ZDZF 1YYLL 5I76B 3U1SL 1CYGA 2AJSL 4IHOA 2B1AH 2XV6B 1QHOA 5KVMC 5EOTB 4KTDL 3WLBB 1OAZH 3UO1H 1EDQA 1JMZA 4PB0L 3ROOB 1J0JA 4NO5A 3BWAB 3NPZB 1YEIL 2YBRB 1J8HD 1S3KL 4JN2A 2VKWA 1D5BA 4GKNB 2J3SA 4YBLB 5IK3B 5DFWH 4LCCB 3CFBA 5LAXB 1G7LB 3V8CA 1FO0A 1PZ5B 4ZSOB 2GTZA 4MQXC 2CIIA 1VGKA 2G75B 3GIZL 2UZIH 5KS9B 5CILH 3LKRB 5ESAB 4XNMB 5IKCA 4NN7B 2H1PL 5IB3B 3TCLB 4N0RA 4EI6A 1MFBL 4FMFA 1U2CA 4MAUH 4OFYA 4P23A 1A6ZB 2CKBB 2WBJB 1ZVSB 4K94C 2HFGH 1S9WB 3OKNA 2OZ4H 4N0UE 3PJSB 4QHLA 5CIPB 4OM1L 3L1OL 3BGFB 2JB5H 5H35A 4PGJA 4UILH 2WIIA 2Y07L 3T3PF 5JQHC 3UTOA 3RL2B 1NAMB 2GEEA 1A8JH 4EIZC 3NZ8A 3FB5B 5IT2H 3QXTA 5DJXB 4XCEA 4XPBH 1S7SA 3TZVA 1JGUH 3O2DA 2ZSVB 1I9IH 1YDPB 4JO3H 3WNMA 1FV1A 3K2UL 4JANB 4C54A 4ODUA 2E6JA 3D87B 1Q9LB 2VERN 4B53A 4MD4A 5BZWA 2Q7YB 2PW2A 4NC2B 2RR3A 3KYMB 1PKQB 5I6XC 5EZIH 4JQIH 4IRJC 4WI4A 3P9MB 4O5LL 5LGJA 3PE9A 3B2VL 2VMFA 4JFFD 2ZG2A 1EUUA 3RNKA 2DJUA 1CFSB 1LD9B 3VXTB 5D93B 1I7ZB 1LEGB 4U3HA 2CGRL 3O6FD 3UTZB 1S9WA 3FT3A 2R4RL 2VH5H 1G7QB 1II4E 2DLFH 4G8GD 4I3SH 4LKXA 1PBYA 5DRXA 2NY7H 1G6RL 4DOHE 4C59B 4WY7L 5GGVL 1K6QH 2ID5A 4EQ2A 4PJ8C 4Y4FC 3SGDI 4P4KD 1NAMA 4QHLB 5CIPA 1I7RA 1FZOA 5TE4H 5J9PB 1G7HA 2D03L 3FQUB 3TC9A 5DI8A 4CMMB 3GNMH 5H35B 3QUZC 3JBG7 3L3GA 1DDHA 1HEZB 2GSIA 5HXMA 3ZYZA 1WTGT 3I50L 3MV11 1C16A 2UWEE 2R15A 4H1LB 2X4SA 3UTPD 3MROB 4HZAA 1TJGH 2EYSB 5KANI 1MI5A 5GIRA 3OQ3B 2C7UA 3WIHA 5EU6A 3HR5A 5IGXH 4PRIE 3KPSD 4LCWB 3QHFH 1QSEA 4P4RA 4TSAL 3X13A 1QFWI 4GJTB 5DVOA 1IM9B 2GAZB 3VG0L 3QXUA 3FZUD 4Y8DC 2Q6WA 1ZMYA 1YEJH 4F15B 4RAUB 5C07A 3I6GB 2H3NA 5C0CE 4KTYA 4WI2A 5EBGA 3F12B 1OGTA 4MXQD 2YA2A 3BGFC 4LIQH 5D2LF 4DQOH 3S36X 1IC4H 3OKLB 4NIKB 2XZQH 5L2KA 3BO8B 4Y19B 1AGDB 3LPGA 5E95B 2F54B 1ONQB 4RMTA 3ARGD 5J13C 1JV5B 2EO1A 1DTUA 3HZVA 3TFKD 1S7SB 4R4BB 3HG1D 2OTWA 4ZFGL 3ZKQD 4G6JH 4ONOA 3HCVB 5HHOE 5HDQL 4V1DD 3HLAB 5ICZB 2VLJA 4KMTL 1A3RH 4YHYB 1AD9A 3QDHA 1E4WL 5E7BA 2J2ZA 3P73B 4AIOA 3FFCB 3QNYA 4ZXBD 2QQNH 3WUWB 1BQSA 4JHAH 1I8LC 1QG3A 2EO9A 4QRPD 3MSPA 1CLYH 3FHQA 1NQBA 2A77L 1A6VH 5C07B 5I1CH 4IOFD 4GUPB 1JGDB 2XFXB 4FTVB 5JHLL 3T2PA 2PCPB 4ONHA 4PJIE 2UZYB 1Y18B 3SY0B 4BKLB 5HPOA 1P5UA 3W9EA 2LU3A 1ONQA 3F7VA 3F7YB 3U6RA 1FYHB 3UYOD 4GXUN 1A7PL 5JLZB 4FQHA 3QQNA 4GH7B 2NY4B 4BA8A 5AZEL 1ZLSL 3BQUD 4QF1B 4LEXL 3UPRB 3E8UH 1UWEL 1T03H 3JXAA 5B4MD 1TETH 2XA3A 4CNIA 1AP2B 1RK1A 3MOAH 4HH9A 1A3LL 1DN2A 3TWCH 1U95B 3O9WC 4PG2C 3DV6B 1IC7L 3KPRB 5EC2B 1JK8A 1V5JA 4D94A 2HG5A 5E2VH 1MNUH 2CPCA 4FQLL 1BVZA 2W07A 1C5BH 3CAFA 1MCOH 1S9XA 3VGBA 2VZOA 3T08A 2ZUTA 1BM3H 3RWCA 3RWJA 4RA0C 3SQOH 1F58L 3DURA 2EDEA 2NY0D 4ENEC 3SPVB 2F15A 5IMMB 3S96A 1YEIH 5F6HJ 4KKAC 3EFDH 4HH8A 3GUTA 3T2NL 3ARWA 2O61B 4D9QE 3MOAL 3GJFK 1UM4L 3PV6A 3EZ8A 3CVHH 2UY6A 3LOWA 3WHE1 2WBWB 1AXSA 4LCIH 3QPXH 4UV4H 3OBAA 1S9YB 4NJAL 2HVKB 3MREA 3U4BL 3TT1L 4X6BA 5EIVA 5JIIA 4LASL 3WFZA 3F7YA 3B9KA 3HE6D 2V7HA 4ZUTB 4NUGH 3RKDC 5IJKA 3NFNB 4DFHA 4HUXA 1OL0A 1X6NA 3ARUA 4XRCB 1JK8B 1OP3H 4P4KA 5FA3B 4DN3H 3WEXA 1YNLL 1CZ8H 4LCUA 5T3XE 1IAKB 1U95A 4I18A 3RP1A 1J05B 2IAMD 3O11B 1PG7L 5E99H 3ZKNC 3QAZB 1MCPH 4YR6B 4JFOA 4OCWH 3RY6C 1A3RL 3FQNB 2BRRH 3G6JF 4RBPK 3SGJA 2PYED 3EJZC 3UTSB 3L9RA 1RZKL 1VFBB 2FGZA 3OKEB 1U8PA 3UAJD 1YYMH 4F57L 4KK5C 5JNYB 3W9EB 4PLKC 3MRDA 1C5DB 4YHYC 2D0FA 4FQXA 4XWGH 3TVMD 3OKDB 3G5YB 3UTTE 4DW2L 1VPOL 2ADIB 3F62A 5D8JH 1HSAA 1VFUA 5IW1B 1KIPB 5F7DA 4DZBA 3BIKB 4OZFB 4MDIB 1NMCC 2HVKA 3SKJL 3E2HC 3BIAX 3RFZC 3QEUA 3DVGB 1YY8B 4D0DB 2SEBB 3BP4A 4KHTH 2UUDK 2YRZA 2BHYA 4J8RA 3BKCH 5HDLA 3SE3C 4W6WB 2Q6WB 3N1MC 3QXDA 1F4WL 3P4NB 4LSRH 3ARYA 1KBGH 2FHCA 1WFNA 4JFZH 4OCXH 4QXGH 3U48A 3LS4L 4MJIA 3HPJB 1NBVL 2FYYB 3MRMA 5DZOA 4H26B 2B4CC 2VISB 1QOKA 4Y7MA 3WMSA 1Z9SA 4HC1L 5D2NB 1T04B 3V6FA 4B50A 1DFBL 2B5IC 3KJ4B 5KSUA 3DUUA 1R24A 4JRXD 4K9EC 4LSQH 2ZUYA 2XKSA 3SDXB 1RU9L 1IAII 4RZCB 3U2SA 1KIPA 5IFHH 3GIZH 5FYJE 1S78C 3H3KA 4W4OC 4TOYH 3E6HB 4Z0XB 1UZ8A 3QG6B 4Y1AD 3PIQB 2J8UF 3THML 2WK2A 4G42B 1NGWB 1J1OH 3BT2H 4TNVF 4GRLC 3T77B 2YD2A 1A6VL 1UEMA 1FL3B 1HIMH 1V3KA 2ITDA 4KXZH 4NWTL 5DMKB 2OYPA 1JYNA 4LFHG 4NRYA 4KTEL 4TVPH 5A2JH 3SDAA 4J4PC 5GGTA 4PV9B 2X4PB 3A0OA 1FZMB 2DQGH 5C09A 4NCC2 4RMWA 2Z31B 3BKYL 3L3OA 1A6UH 2Q86A 3NIDE 1CIUA 2VR4A 4KXZI 2P48B 4UTAH 1I9IL 1MHPH 1YJDH 5JXAL 3NGBB 3JUZA 5ACZA 3BI9X 5D1XA 4NQCE 4N1EA 3SO3C 5IR1B 1CFTB 5JORA 3DTXB 4NKDB 3K8KA 5FKAA 1RUAH 1UC6A 2FBJL 1T7ZA 4HIHB 1HHIA 5EO1B 2L0DA 3OAZK 1ZGLM 5DUPH 3GMNA 1DQDH 1N3NB 5FOBB 4Z0XA 4D0CA 1DLHA 4UOW0 5JTWA 3PQYE 4IDJL 2ZCKH 4S1QL 4G9FB 2NW2A 1QFHA 4FNLH 1UM5H 2V2WB 2UYLA 3FN0H 4JAMA 5DK2A 5IB4B 3U7WH 1WFOA 3FO9B 4G8EA 3TPUB 1U8NA 1K8IB 5CEZH 3R1GL 2C1PA 3NPSC 2ZUVA 3WXVH 1EFXA 2E27H 1P4BH 2NTFB 1ULVA 3ARRA 4MXWH 5MEOA 3X14A 4Z0BL 1G7QA 1BZ7B 1CXEA 4YEFA 1T2QL 1MIEL 4YAQA 1T0MB 3QUMH 1W72B 1EZVY 3QQ4B 2IBGA 3V5KB 3PWJB 4HJJH 3GSXB 3O41B 4XVJH 4C56A 2V5YA 1NGQH 3SKMA 4ZFOL 2D9QB 4KHXH 1KYOJ 5C0AD 5IP4A 3FQUA 4CMMA 3HRZB 1XR8A 1KIUA 2MHAA 4JJHA 1Q1JL 1J18A 2XY2A 4XRCA 3VXNB 2YD1A 3DTXA 2ARJB 3C9NB 1LE5B 4X98A 1NLBL 4YQXH 2DQEL 2A6DA 3LVEA 4AT6B 1E6OH 5DJAA 2X1QA 3GJFH 1RK0A 4ODWA 1NBZB 2NCMA 4MWFA 3CFJB 2H32B 3QWOB 1NJ9A 4RA3A 1M7IB 3RWEB 4JRYE 3WFDL 3WFHB 5TPWL 2IALB 2XQYK 1WEJL 4KRLB 3SDYL 2OR8A 5CINL 2P8MA 1E4JA 1M6OB 3CJJA 1JWMB 4GOSA 1ERNA 5DWUH 5AUMB 3HZYB 4X6EA 3OTTA 1U8HB 2R1YA 3MTRA 1UJ3C 5L7XL 1FZJA 3GBNH 3GMOB 4PJEF 1UXWB 4KI1A 1X4YA 5FYLH 1YEHL 3MNWA 4XPGH 1JGVH 4WTXA 4FNLL 4YAQB 5KSVA 2CO7B 3MJ8A 1I1AC 5JHDE 3R8QA 2EXWD 4XCFH 5FGCE 5IQ7H 5EO1A 1E0OB 5IW6A 4HK0B 1KN2L 1NAKH 5IWLC 3QEHA 3IFPA 3FQTB 1EXUB 3FOLA 5AZ2L 4F8TA 3HPLB 4JZJA 2BY3A 1LDSA 3C60A 4U6TA 1N6QL 4HUWB 4X9IA 3ZHDA 4L3CB 3B3IA 4JM2C 1R3HA 4XXCA 1KPRA 1OAXL 3BUYB 5I8CB 2NY6B 5FYLL 2B0SH 3VGGA 2LAAA 4CVZA 5FYKU 3LKNA 1WAAE 3MOBL 1GGIL 1FFNB 3KAAA 5ITFB 3X12B 4L3AA 2ZOLB 4B0MM 5TPWH 2G5BB 2P8MB 3LRHA 2KZWA 2YUVA 1QLEH 4D8PB 3FMGH 2E9BA 2VZ1A 2QSCL 3QO1A 3DLQR 5IOPA 4PJ8B 1JWSA 3VA6A 1B6DA 5SWZB 1FLRH 1ZA6A 2GT9B 4PR5B 2DKUA 2PETA 4ZTOL 3VGEA 1X7QB 2AJUH 5CJXA 4M4PA 1B6UA 3TBVA 5DUML 1IC5L 3KYKH 4MS8C 1FORL 4NDMB 4JLRA 3DJ9A 4QF1A 5D7JC 1QSFA 4QXTB 5SV3A 5BXFA 3GRWH 4PP1C 1DR9A 3MJ9H 3R0NA 4KAQH 1INEH 3UC0L 2EDOA 5T3ZD 3IFLL 3FRUA 1OF2B 2J88H 5CGYD 2NX5B 1DBKL 3K3QA 3L3JB 4GQ9H 4PJ9D 4W81A 3H9ZA 3T0EE