2A6IB

Crystal structure analysis of the anti-arsonate germline antibody 36-65 in complex with a phage display derived dodecapeptide klasipthtspl
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
222
structure length
219
Chain Sequence
EVQLQQSGAELVRAGSSVKMSCKASGYTFTSYGINWVKQRPGQGLEWIGYINPGNGYTKYNEKFKGKTTLTVDKSSSTAYMQLRSLTSEDSAVYFCARSVYYGGSYYFDYWGQGTTLTVSSAKTTPPSVYPLAPGSANSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Germline antibody 36-65 Fab light chain
publication title Differential epitope positioning within the germline antibody paratope enhances promiscuity in the primary immune response.
pubmed doi rcsb
total genus 42
structure length 219
sequence length 222
ec nomenclature
pdb deposition date 2005-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6iB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a6iB02
1A1MA 4U2YA 3OAYH 3FO0L 4Y8AA 5CD3A 1F4YL 1KPUB 1ETZB 1FNEA 1KGCE 4QOKD 4HJGB 1AGBB 2G5RA 4K8RC 3UYOD 2XRAL 5HVGB 1FO0L 1CLCA 3U30B 1MFDH 3MREB 1FV1A 3HPJA 4RBPH 3GSOB 2W9EL 2E9IA 5IQ7L 3AROA 3NIGE 1CXEA 2CRYA 2ZG2A 2W0LA 1LD9A 3GSUB 2XIDA 5BXFA 2PXYD 5CJ8A 1U3JA 5IKCA 3CFKA 4ZPTA 1P7QA 4PB0H 2PETA 3NCMA 3G9AB 1JIBA 1MJ8H 5IBTL 4IBLT 2FWOB 4XPHH 1IGFL 1C7TA 3SDCB 2DM2A 4LGPB 3KJ4B 3KHQA 4RGNE 3BP4A 4LLQA 2FLRT 4R96B 3BGFC 1N7MH 5MEPB 1I1YA 4YHKH 4Y19B 1DN0B 1FN4A 4MGXA 1BOYA 3O4LB 1G7JB 1OARH 3R0NA 2APTA 1JFQL 2OZ4L 1QQDB 1TMCB 3MUY1 3QULA 2BDNH 3GHBL 3DPBA 3O9WB 2OL3B 3P9MB 5GISH 2IBBA 5DC9B 3QRGH 2VN7A 1YNTB 1Y6NR 3F5WB 5BJTA 4I0CC 1AP2B 4RZCB 4XGZB 3SPVB 5DHXB 3WL9A 3ILPA 3NACL 4YDIL 5I1DB 2FO1A 4DQOH 1JV5A 5SX5H 4UOJA 5F21B 4PRIB 1M7DB 4XI5C 1KBGL 4QY8B 1HCFX 3VXQA 5FA3A 5IBLD 5FFLA 1IC5H 1MHPL 4XCFL 4ZUUB 4PRAB 1G7IB 1MVUB 3WXWL 1KCSL 5TE4L 3JVGC 5GRJH 2LTQC 1AHWA 2AQ1A 3FT2B 3FL7A 3S3PA 3D3VA 4QXWA 3H42H 3SE8H 3P9LB 5KVDL 3SJVB 5IFAL 2C3VB 1T03H 3GSNH 2WV3A 5EOTA 4L9DA 5DRWA 4UQ3B 5KSUB 3GZKA 4MJ6B 4JM2A 3BIKA 4IRZL 5GS1C 2NQCA 1CFBA 3ZHLA 4LHUD 3OR7A 1KN4L 5LBSH 2VDMH 3VW3L 1LO0L 2KZWA 1KB5B 2R23B 5FK9A 43CAA 3EYFB 3O2WH 3TT1H 4Z7WB 2R56H 3BMVA 1OWWA 2VISA 4QRUB 1FIGH 4APQB 4N0UE 4HT1L 3VD5A 3BAEH 1BIIB 2Z93A 3QG6B 4UQ2A 4YGVA 1ZTXH 4UAOB 1WAAE 2PW2A 4AIOA 5I30H 4P23D 5SWZE 2MMXA 5K93A 1CE1H 5KVEL 1XR8B 3E2HC 3LV3A 2AJZB 4L4VE 6FABH 5DJ8A 3HR5B 4PY8J 2HRPH 5T3XH 3B83A 4KJYA 1T21A 2FBJH 4X7TA 5ESAB 1EZVY 3DHMA 2MQCA 1D5BB 5I1GL 3VD4A 3E1F1 2P44B 1GYAA 4PYHA 1SM3L 5EZOL 4NCC2 4DK3A 1MFAL 5K9KB 4ZXBA 4M02A 4X0KB 5C9KA 1Y18B 3JV4B 3BKCL 3IXAB 1LE5B 2VKXA 1A3LH 1ZLSL 5EC2B 5E6YA 3O41B 1A2YA 4A2LA 3BWAB 3CGTA 3HG1A 3QPXH 2HFTA 4PLOB 4GKZA 5FA4A 3ROOA 1A14H 4OTXH 5IHLB 5DHYA 4BQCA 1INDH 3EDKA 4LARL 5MI0C 3DYMA 4MA1C 1A9BB 3X11A 1I3RA 4ZFGH 4CADB 1HSBB 1U95B 2EDFA 3FRPG 4KDTC 4X4XA 4X7DC 2NY7H 3P11H 1CDCA 3PHOA 2L0DA 4HWBL 4JO3L 1EO8H 3BD4A 3HE6A 3K46A 4OD3L 4G8FB 1DCLA 2IBZX 4JFXB 1XZ0B 2DQIH 5IG7B 5FECB 3K4ZA 2MHAA 4OZGF 1KT2A 2BVPA 4ELKB 4JJ5B 1D9KD 1TNMA 2R0WH 3QNZB 5I66B 1GGUA 1CQKA 4MXVF 2R1WA 4ODWA 3MRLA 5BO1L 3PWPE 3OKDA 1JK8B 2EKJA 4GAFB 5DJZA 3SE4C 3VFTB 3VRIA 5CBEB 3H3KA 2NX5B 4BQBA 3EO9L 2BHUA 1FFQA 3MQIA 5I1EL 1AD0B 1ZT4A 2HN7A 2CXKA 1T20A 3LVEA 4FOMA 4U0RB 2V2WA 4XVSL 1MJJB 3MV7E 3T0XA 1FVDB 4JFHD 4KXZI 4PG2C 3TJHD 1YUHB 4FQPA 4TNWK 1L6ZA 3L95B 3EO1A 1QZ1A 3ORJA 5L8JB 5FGSA 1LE9A 3TESA 4HJJH 5E4EB 1K6QL 2OJZH 4HH9B 4DN3H 3HFML 2RGSA 4FABL 1MCRA 4LQFH 3AY4C 4GLRI 1H15A 1K2DB 5EO0A 4U1KB 5HGGS 2X89A 4HK3N 2NY5C 4J6RL 1FO0B 3OPZH 1JGVL 1G7QB 2X9WA 3GI8L 4NUJB 5E03A 1WFOA 2AJUL 3UTPE 3FB5A 3HB3D 1JYVA 4TRPH 4LLMB 1KC5L 2VQ1B 4K8RH 4NGHL 1A1OA 5CGYD 5IROA 2OK0H 1WFNA 1X9QA 1OAYL 3L5HA 3JV0A 1WBXA 3B4NA 1S7UB 1MCFA 5FCUL 5KTEH 4Q9BA 4TUOB 4BQ9A 1GGBL 4XP4L 1NCCH 3VGBA 1BOGA 1E6JL 1IAII 3NFSH 1CGVA 4HUWA 4LPTA 1P7QD 4YWGH 5I1CH 3VGGA 1S9KC 2NY0C 3ARDB 4U6HB 4LAQL 5L7XH 4WI6A 4P46B 1YZZA 2DBLH 2GFBB 1D6EB 2EE3A 3GIVA 4WDIB 4H20H 4D2NA 4R9HA 4M8QA 4MJ5B 3RDTC 3HHRB 4ZOBA 1HXMA 4HBQA 1OF2A 1RURH 1ZHKB 2FIKA 3P77B 3UJJH 2BNQB 2A77L 1A21A 1A7QH 2R2HA 3UPRB 4WTWA 5KVGL 1GZQA 4Q7DA 5F96H 4E5XA 5IM7B 5LVEA 4WEBH 1DQQB 4DKFL 1ZHNB 4HKJB 4PS4H 2NMSA 4FXKB 2VDPH 1WUNT 3QP3A 1CS6A 1DQML 1WZ1L 5GS0L 4DFHA 4I2XE 4JZNA 3KPSE 1HILA 2VL5A 2ICWJ 5E8DL 3IDGA 5IJVB 3MR9A 4PJGA 4DGIL 3C5ZA 4S1SH 1PG7L 3V6FB 1FZJA 3VDAA 2NY2C 1A8JH 1B0GA 3R8BB 1MCSA 4LSPL 4F2MB 1J18A 5C08E 4F9LC 5B3JE 1BQLH 4P2OD 3D3VD 1PKOA 1CDHA 2Y5TA 2V7HA 1Q1JL 2FH8A 2NY3C 4JM2D 4XVUD 1FCCA 1KLGB 4JDVA 3F58L 1OL0A 3ZT6A 5K59E 1YN7A 2XPGB 5AAWA 4XPGL 5KW9L 3BD3A 1NLBH 4AENA 1LO4H 1MPAL 1UM5H 4NYLB 5BVJB 1HXYB 1M6OA 4XBGB 2GJ6E 3CXDL 1LP9E 3BX7C 4LRNL 3LKPA 1TITA 1ZSDA 1A22B 4CDHA 3E3QE 3QEGH 4WNQA 4YHYB 1T3FB 1XIWA 5C0AE 4ZYKB 2WUBH 4JFEB 3DROA 3MBXH 5DD1H 1Q9KB 3AXLA 1G7PB 2A73B 4ONFH 4OBSA 2HVJB 3VDCA 3VRLF 2Z92B 4HDIA 4L9LB 2J5LB 3VA6A 2R9HD 4P59L 3G6JE 4ZXBD 2AJYH 3EGSB 3QYCA 1EBPA 2O5XL 1UKQA 1OQXA 1KENH 3QEHB 3U0PB 5JHDE 2Q7NA 4KZDH 3GSNA 3HG1D 2FO4A 3BE1L 1XF4B 3GMOB 3VXSA 4ZUTB 5A3IC 5CINH 1N64L 1U8MB 4O58H 5KS9A 1OSPL 1L9MA 1QYGH 3L7FB 1FP5A 5JQHC 4LRIC 1MHCA 1MCIA 2RBLA 1A1NA 1RUKH 1JF5A 1CGSH 1DLFL 1RJLB 3HE6D 4GG6F 4XH2B 4KKBC 2E7LA 2WNGA 4PGJA 5CJOL 3SGEH 1RK0B 5GRZA 1IL1A 3K8LA 3DNKA 2NR6D 1GXEA 2EDEA 3HUJB 4Q2ZB 4CMMA 3KPQB 3VMOA 4Z6AT 2CIIB 2ADFL 1B90A 2PR4H 2P8PB 3F6IA 4L8SA 5FM5O 2G60L 4L1HA 4OCSL 3TA3B 2R15A 3U9PL 2X1QA 3O6FB 5EA0L 2PCPA 3HC3H 5GRVL 2VDNL 2WP3O 4JRXE 1I7ZB 2IFFL 1RJYA 2AJVL 4CVZA 1UH3A 4G3YH 4IDLA 4LSTH 3BZ4B 4KKAD 4LVEA 1MQKL 2LQRA 1JBJA 1ED3B 5DRNA 1IQDA 5TF1H 4E9LA 4NNXB 3MLYL 4HXAL 3WN5B 2RAMA 4GRMB 2IADB 4F57H 1Y0LA 3RL2A 2FJGA 4G42B 1NGWA 2B1HL 2HFGH 3PQYB 5ETUB 4GG8B 4GSDH 3EZ8A 3T77B 2P7TA 3TFKD 4KC3B 1QSEE 3T0EC 4NKIL 3EJYD 2X89D 4QEGA 1HH6B 4YC2B 3HZYB 5DUBA 4NOBA 2NY5H 4CRPA 3TN0C 2CQVA 1ZLVH 2DQHL 4U05A 3CAFA 5HI3D 1KLFA 1NC4B 4H88H 4BUGA 3MACL 3O4OC 4NO2A 4OZHB 5F7UA 3GGWA 2DOCA 3CX5K 3MTRA 4CVWA 4WI8A 1B9ZA 3TH3T 4MQSB 5I6XC 2A6JA 5FB8A 2X05A 2CRZA 5DD6A 1Q0XH 3T3ME 5I75B 1J1PH 4AH2A 3B8YA 3KYKL 5T5FL 1E28B 1RIUL 1SYSB 1WSST 2DM4A 1RU9L 1JZ3A 5C07B 2B5IB 3B9AA 1GPOH 3ECBA 4JFZH 4I5BA 4PB9L 4HJ0C 4X6DA 3LQZA 4P9HC 4KU1A 4YXKL 2ZUQB 4OGXL 4LASL 4NM8L 1R3HA 3WJJC 2C3WA 3P9WB 3FTGA 2HKFH 4YZFF 1DJSA 1IC1A 1QVOB 1H3PL 4HS6A 2XG5A 1F4WL 4K3GA 3L3KA 4FQIL 4PP2B 4CL7A 1ZVSB 1Y6KR 4V2BA 5MENA 4K9EC 3LDBB 4HUKB 2VDLH 2CKNA 3U6RA 3JWNC 3QDJB 1UYWH 1OSZB 3ULUF 4FFZL 2D9CA 4Z8FL 4U3XA 5HYQA 5H37H 1IGTA 4QT5B 3C5ZD 3K2UL 35C8L 1JWMA 3UCRA 3MCLL 2ARWA 3MOAL 4X6FB 4PJCB 4Z7QE 2IH3B 1X5HA 4YHLL 5GGSB 2Z4QB 3NABL 3FOMB 4OLVL 5BQ7B 2DLGA 3PL6B 4MA8H 2DD8L 4JGJA 4YHOL 1PQZA 2FX8H 3RZCB 4EVNB 4XNMA 3VFOA 3T2NL 2H3NA 4ZOCA 4ORGB 1BM3L 2HFFA 4U6VL 4HKXA 5F7KC 2CK2A 4R0LB 1BBJA 4J3VA 5CKGA 3OGCA 4EI6B 1NDGB 5EWIH 3S8WA 4NT6B 4JY6B 2G75B 2WUCH 3MLVL 2R2CA 3A67H 1JZ7A 2IPTL 2AKRA 3K2MC 3BUTA 2P8MB 2IF7A 3HI1A 5FIEA 1CXKA 1VGEH 1KJ2H 3TEUA 2KH2B 2VDOL 3OAZK 4J3TA 4Z78B 1S9VB 2VE6A 3PV7A 2BXYA 3LKRA 4G7YL 3GSXA 4P2RB 3HC0B 5FOBA 5IB4A 5EG6C 4Z77A 2CO6B 3RGVC 1OQOA 1ACYH 2PYEE 5DUMH 3P0VL 4GKNB 3GMNA 2X4TA 1DEEA 2PYFB 2OP4H 5IW3A 2NLJB 1I8LC 5EZLA 2DLHA 4F7CA 4M9PA 4Z7VE 1BD2D 4JRYE 1MFBH 1UGNA 2I60H 1S7XA 1D5IH 4HS3A 4PJ7B 4LCUB 1ZMYA 5I1AB 3GRWH 4YLQT 3BPLC 4ZO9A 4AY0A 1HHKA 3JVGA 1EVUA 1JVKA 2VQUA 4NC0B 1JHTB 1SY6L 2F8XC 1QSFE 3D0VA 1R5IA 1P7KA 2IAMB 5SV3A 3VXSD 5ID0B 5FUZH 4Y1AB 2RFXB 2VOTA 2RR3A 3VXRA 5GS1A 3G08A 1RZFH 1QACA 3RWHA 1NCDL 4LIQH 3RKDD 4YXHH 1UJ3B 3ZDYE 5SWSB 1LILA 4HZLB 4LGSB 4CBPA 2MQ3A 2NY4C 2WLZA 1KLUB 3LS4L 2NW2A 5C0JA 3CH8A 4KVNL 4HFWB 1INQB 4HWEL 1TZGH 2R4SH 5FYJH 4FTVB 4UU9A 5I71B 4MS8C 4BFBD 3WFEH 5FDWA 3G5ZB 5D1ZB 4LFHD 2QSCH 2GTWB 5AYUL 2R2BA 1NCTA 5DQ9A 5T3XD 3ARFC 2AXJA 1WGOA 2HT4D 4NQSA 5EORH 1A02N 4M6MH 1PAMA 2XA8L 3I6KB 1IE5A 1Z9OA 5E70A 3GMMB 5GRUH 5EBMA 5DQDH 3OKKA 1L9NA 1X7QA 4KMTL 2GT9A 3LIZL 4YNYB 3AVEA 5D4QA 4HSQA 4PV8B 5IMOB 2ORBH 3VXME 4EN3B 1U3ZA 5JZ7D 3RAJL 1CFSA 1FORH 4MNGB 1UB6A 4KROC 3W82A 4BH8B 1U91B 4XNXH 5I17B 1TIUA 4NNYA 2E7HA 2PUQT 2E8YA 2CLZA 4NO0B 4J7RA 3SGEI 1EZVX 2IFGA 4KDTA 1B88A 4OF3A 1PEZA 2R29H 3I9GL 3V5DA 1ZA6A 1C08A 3KYNB 4OCRH 2QKIA 3D9AL 5EULV 4E0RB 3KXFB 4ZS6D 1WICA 1NAKL 3QIWB 5EOCH 4D0DA 2YR3A 4TUJB 3FHQA 1HEZA 3HKFA 4G6MH 3DXAD 1XGRB 2FGWL 2GUOA 3PWNA 1F00I 1U8HB 4YDKH 4MJIE 2JJSC 4AL8L 1T7VA 1P4IL 3U46B 5DT1H 3SE4A 1YEDB 2ZSWA 4FXGA 1EXUB 1V3JA 4YHZL 1IGYA 5L8LB 1A7NL 4P9HH 3IKKA 1BFOA 1T1WA 4HGWA 3RIFK 2ZKHH 4PG2A 4KKCC 2XN9A 3VXUA 5JXAL 1HDMB 4WHTA 3DYPA 5IB1B 5DQJB 4JN2A 1JZ8A 4QOKB 4UV7L 3IF1A 5JOFA 5MEND 3AY4A 1D6VL 4HHAA 3UC0L 2I24N 5DVLA 3NPSC 4K9EH 1C5DB 1B2WH 2D03L 1CGTA 1U93A 1VACA 4QXTA 3OKLA 1BF2A 1T83C 2QADC 3LCYA 4BSVB 2ZNXA 3VWJC 4FZ8L 2PXYB 1XGUB 4K8RD 3ESVF 2V2TB 4TPRL 3PDGA 2ICWB 2BFVH 3GK8H 4RFNB 4Z18A 4XCEA 1AQDA 4ZTOH 4PRHE 3HAEH 1NJ9A 2N1KA 4JO1L 3RX7A 1GC1C 1DE4A 2XZAL 1DQJA 4U3HA 4UUJA 4Z95L 5JO5B 4XB7A 5C2BH 5C6TH 3TH4T 4GT7A 1XGTA 2X4NB 4MHHI 3S35L 1U58A 4N0RA 1FSKC 5BMFH 4XPTL 4QXUH 1NCBH 4C83A 4UBDC 3KLAB 2AJ3A 5IF0A 1AQKH 5IGXL 3FT4B 2PO6C 4PRBA 3RDTA 1U92B 5D6CA 4M48L 1HYRC 3GO1L 4HIIB 5ITFA 5T33H 4D3CL 1LNUB 5DFVC 2YKLL 2XT1B 5IHZA 3QXDA 2GQHA 4JJHA 1CU4L 1RUAH 1RUML 5JDJA 3S3SA 3WDJA 2OYPA 4YBLB 3ARVA 1SJHB 3UTZB 5FO9B 1DFBL 3VA2C 1IBGH 4FMFA 5EFIB 3E6HB 1J05B 1NANH 4WY7L 1OGTB 3S88H 2A6IB 2MCPL 2R0KL 3MNZA 3BUYB 5CUSL 4OLYH 2ITCA 3QFJE 3PDDA 1B0RB 2FH6A 2WBJC 4XI5D 5C6WH 3AGVA 3WJLC 1KCVL 4MZ3A 3ZDZE 4BH7B 5IR1B 1OCWL 1PSKH 4WUUE 3OZ9L 3I3BA 3MOQA 3RWIA 4HKBA 4NZRH 4E41A 4XP5L 4LHUB 3L1OL 5INCA 5I16B 2ZCHH 4PJ8C 4F9LA 4JKPL 4W4NA 5HHNB 2X4QA 1XGQA 1MRDH 4RFEB 1L4IA 1KIRA 1DQDL 1BWWA 1N59B 4K3JH 5HDBF 1ADQH 2WAHA 3MZTA 3IJYB 3QO1B 3S3JA 2X5PA 3ULUH 2VLJE 2Z8VC 1G7HB 5FO7B 3TBSA 5GSRA 3RWDB 3SKMB 3ALXA 5KSBB 1S7VB 3PABA 3A6BH 1CFQA 2V7NB 4P23B 4TNVK 3WIIL 1O5DT 2JB6A 3O45B 5C0GA 1X5GA 3GHEL 1KJ2A 4QF1B 4ZDHB 3S4SB 5CJXC 3VFNA 3FO1A 3RWFB 3V4VL 1J8HE 3MJ7B 4IRSB 1KNOA 2EDTA 5IB2A 1ZLUK 4ZAKC 4I9WE 2ADGA 3FT3B 3C60C 1U6AH 3QQ3A 3UO1H 2F8VA 1FDLH 1ZANL 3FFCA 4XZUA 4MSWB 3MRRB 2DICA 1I9JL 3ARZA 3BGMA 4AYFA 5M95B 4OFIA 4DAGL 5C0RL 1WBYA 4ZOEA 3DX7A 4JPWL 4ODVL 3Q48A 1XGYH 3GRWA 2KKQA 1NGZA 2A6KB 3EJZD 4NKOB 4K23H 4M6OL 3MCKA 3UXFA 3H7BB 4EDXB 3SDYH 2ZOKA 2AXGB 3TYGH 4N9GA 1H8OA 2W9DH 4ZSOE 3V0VA 2VXSH 3B5TA 3FQWA 5C0BA 1KULA 4RWHA 5DLMH 1JGDA 3C8KB 2WW8A 3V0AC 5HYEA 5EU3A 5D9SA 1RZJC 3LQAC 1AR1D 1XT5A 2ATPB 3UPCA 2VLRA 2K7PA 1N5AB 2P8LA 2R69H 5DJYB 1S8DA 4N8VG 4KUCF 2G2RA 1I85C 4LRIA 3TBYB 3HZMA 1AH1A 4JN1H 4LLWA 1IAIM 4YHIA 1D9KB 3SGDH 4KTYA 2BJMH 4MAYC 4RQQA 1ZGLB 2DB8A 4J4PD 1JNLL 3W2DH 5GGSY 1V8HA 3WXVH 2IALB 5ESVA 2X1XR 3OJDB 1FBIH 5KAQG 5F1OB 4XCNA 1QKZH 2ZUYA 3T4YB 1J11A 4PRDB 5JUEH 4LSSL 4NJ9H 4GKSB 3RPKA 4L3EE 2YZ1A 5HGAA 2HTKC 1ZA3B 2MNUA 1FZMA 4F15B 1K3IA 5B8CC 2AP2A 4UDUB 4KK6C 1IGMH 1UZ8B 5ESQB 3NIGF 2D7NA 3E6FB 3SDXE 1A1MB 4WHDA 1YEGL 3LEVH 3VXUD 5CD3B 2OQJA 4BSWB 1FNEB 4M4PA 3IFOA 2DQTL 4O2FB 1BZQK 1ZT7B 1X6LA 3T0EA 4Y5YC 3I50H 1FV1B 3HPJB 3RL1A 3TN0A 4FG6C 3VG0L 1LD9B 1X4XA 1ZK9A 5IKCB 4QYOB 3CFKB 4ZPTB 2DL9A 3LEXA 3NIDE 4G8GE 1P7QB 1QEWA 3W9EA 4M43L 2XQBH 1IGJB 3VXTA 5C6PB 4WWID 3HMWH 3HE7D 1RMFL 4RMVA 1TQBB 4LSVH 1GC1H 2BNRA 1I8IA 4LLQB 2D7TL 3L9RA 1GZPA 1J7VR 1I1YB 1FQ9C 2NY0D 5EZIH 4U1GC 4DEPC 1S9XB 1FFPA 4LSUL 1IAIL 4Y4KC 2UZYB 2P45B 1T22B 4BYHA 3JZ7A 2DMKA 3CFIC 3TC9A 4W6XB 3IDIA 3QQ4A 1GGCH 5I19H 1NCWH 3O6ML 4GG6A 3RDTD 4J1UA 3WKMH 3WJJA 1W8OA 1DBJH 1FFOA 5BJTB 3WL9B 5ICXA 1DUZB 1I9RL 3MPCA 4GW1A 12E8H 1ZOXA 5FA3B 4PJIE 4TTGA 5TFSL 5E2JA 4OUUA 2KBGA 2VR4A 1J0IA 1AHWB 4ISVA 1VADB 1MFDL 2HP4A 4P2OB 3D3VB 3BD5A 4B7LA 1HKFA 3TO2A 3HAEA 2I9TA 5EOTB 2D0FA 4QRPA 1WAAF 2NY2D 3O2VH 3BIKB 1NBZB 5HVHB 3BIAX 4E41D 1BZ7B 3KJ4C 4PB0L 3C5JA 1MJ8L 4RGNC 43CAB 4PGBA 4LMQE 1YY9C 1MCHA 2FYYA 2OLDA 4TVPH 1FPTH 3UJIH 1FAIH 4MQ7A 1WC7A 2VISB 4HV8A 2NY3D 5I76A 3H9ZA 2Z93B 4UQ2B 4YGVB 1P6FA 1A4KA 1DZBA 4OD2A 2PW2B 2DWEA 5HHOA 3L5IA 5BZWB 1EUUA 2BDNL 5IMLB 1HNFA 3LV3B 3LMJL 3K81A 4MLIA 4NQCD 5DJ8B 5GISL 4FQ2H 1NANI 4JFFA 3FN9A 1AGDA 4Y5XB 3VFPA 3BYYA 4Y16C 3BH9A 3TYFA 5LGJB 1PZ5A 4DQOL 2FX9L 3RGVA 2YPLD 1AR2A 5B38B 1MY5A 4ZXBB 2WZPD 3LZFH 1I8LA 1A2YB 4PLNC 2V9QA 3HG1B 3C5SA 3FRPA 2P5WE 5FA4B 3ISWA 4G8EA 5GRJL 3VFSB 2YD8A 3IDNB 3ME0A 2KQNA 2B8OT 4YJZL 5D7IA 4OLUL 3H42L 3SE8L 3WHXA 1T03L 3GSNL 4TNWF 1HE7A 4POZC 3JTSA 1ADQA 5A3ID 1RZJH 3X12B 3V0WH 5LBSL 3HE6B 2VLRD 2VDML 3LPFA 5ALCH 5JOPD 2WBWB 2MHAB 3O2WL 1KT2B 1BLNA 2BVPB 4FQHB 4UAOC 2R56L 4GBXC 5E0QA 5T1DH 3BAEL 2R1WB 5DMKB 4GW4A 1ZTXL 5HYIA 2NZIA 3OKDB 5DJZB 4KKBD 3VRIB 5I30L 5FYKU 3N1GC 1E4JA 5FYJD 5DK3A 1CE1L 3F7VA 1MCBA 4JFQA 6FABL 1ZT4B 2HN7B 4P4KB 1T20B 2HRPL 5ANMA 5T3XL 1T2JA 5ISZE 5CJBA 3BOVA 4PGEA 3ARFA 1N8ZA 2ZOLA 3F7PC 1RV6X 3EO1B 4MDIA 4XNYH 1LE9B 3AREC 3PNWA 1WFUA 4BFGA 4YIQA 3S5LA 1EHNA 1H15B 1MLBA 1IKNC 5EO0B 1A3LL 4EUPG 3CK0H 9CGTA 3QPXL 1A14L 1MHHA 1WISA 1YQVH 1IAKA 3Q2CA 4OTXL 1B3JA 4XC1H 4DK6A 3T0ED 3H8NA 5F7NC 3UYRH 4Z0XB 3G04B 1INDL 1A1OB 1AY1H 4NIKB 3I6LE 2SEBA 3IDYC 1Q9OA 3TN0D 1ORSA 1CIUA 1SJEB 2NY7L 3P11L 1J9CT 4FQXC 4PJDB 1BOGB 5IMMB 1EO8L 2J8UE 1X5JA 4UT7H 3OB0K 1A6TA 2DQIL 2PW1A 2YMXH 5L0QB 5AG8A 2WK2A 2A9NH 2R2EA 4OAWA 2R0WL 4MB3A 1HQ4B 2BNRD 4OT1H 3QIBC 5K33A 5ILTH 1FL5B 5B4MC 5BS0E 3GIVB 2DL2A 4P9MH 1X6NA 4HEME 3D2UA 3MJ9H 2JJSA 5L2KE 3JV6A 4OZIE 4RFOH 2C3XA 4HJ0D 1GIGH 3CDGA 4RX4A 4X5LA 4PLJD 3T1FB 5IOPA 2YK1H 3V8CA 1HHGA 4NPYA 4ZMAT 1GZQB 4X80H 4E5XB 4P2QE 5DD5H 5HDQH 1EIBA 5DRZA 3IJSA 4HJJL 5B3JF 1QFHA 2OJZL 1KV3A 4DN3L 1FFRA 4LQFL 4JZNB 4YK4B 3OJ2C 4MCZA 5FYKE 4JANA 1HILB 1M05A 2VL5B 4CVXA 5HVWA 1VB9A 1A9EA 2JCCB 3H9SE 3IDGB 4TTDC 5KAQF 4PJHE 3BQUC 3MR9B 4PJGB 3BVNA 3C5ZB 1MFCH 3OWEA 1DVFC 1FZJB 1N0LA 4N68A 2DI7A 1B0GB 4TRPL 3AU1A 1T83A 5K59F 1UENA 4K8RL 3VWJA 2OK0L 4HZAA 5D1XC 2F53E 2Y06H 5F9DC 4A2MA 1A4JB 2Y5TB 1C8PA 3MJ6A 3HR6A 2YRPA 1DQTA 2V7HB 3PDOA 4QRPD 5KTEL 3V6OE 1ACZA 1Z9SA 1NCCL 2I07A 1X5KA 3NFSL 3FO9B 2V5SA 4JRWA 1XMWA 4YWGL 5I1CL 1OAZH 5I73B 3Q3GA 1QLFA 2AVGA 5L7XL 3OXSB 2B7DT 4JPKH 5FGCE 2EEBA 1T7YA 3QEUA 2DBLL 1YPZE 4YX2H 3UTTE 4H20L 4JPIA 4XPAL 3IDXH 5CSZB 5E2WH 4AENB 4S2SA 3MXVH 3ARRA 1YEIH 1M6OB 2DKSA 4M61A 2BVQA 2PO6A 3G6JF 1RURL 3LKPB 1OLZA 3UJJL 1WIPA 5EO1B 3NN8B 1A7QL 4NQXA 4KQ3H 1NCAH 3UJTL 3DROB 3U82B 4ERSH 2YD1A 5F96L 4JFFD 3AXLB 3VFRA 3WNMA 4WEBL 3T04D 4JQIH 1RJZB 4PS4L 5GS2H 4KJQC 2QJDA 1BD2B 2VDPL 3ZTJH 3RGVD 4WU5B 5HYSG 3MRJA 1XCTA 1A6ZA 4MWFB 4DOHE 5HHME 3VFUA 4DGVL 2XZZA 4QHNA 2BCKA 2WBJA 3GSNB 1F8TH 1AO7B 2PNDA 3WJLA 3VXSB 4QWWD 1BQLL 3M07A 1CDJA 5KS9B 3V95A 2EDOA 2AEQH 4PJ8A 1MHCB 1JHKH 5E99H 3MLSH 4RISH 3TBVA 1A1NB 2IC2A 3JUYA 2VDQH 4L1DA 2EDHA 1KB5H 3OXRB 4LL9A 4L8BA 1O7SA 3ULUD 4PTUA 1U8JA 3MJGX 3OSKA 2VUOA 1VFAA 1YEJH 2H6PA 2FDBP 2IEPA 4UINH 2CDGA 2D4DA 1G9MC 2XQYK 4LBEB 1LEIA 1IL1B 2GSGA 1BQSA 1MHEB 1W0WA 4CMMB 1J0ZA 3QUYC 1NLBL 4R26H 3CUPA 1UCBH 1MREH 2Q3AA 1UM5L 3E3QC 2NY4D 4L8SB 5CJXA 1MCWW 4DUVA 5E2VH 4P3WA 2MSPA 1OAXL 3QEGL 4ZAKA 2D7MA 1XF1A 3QUMH 3C60A 4MS8D 4CVZB 4WCYL 4AEHH 2WUBL 1VEMA 1F3JA 3MBXL 5DD1L 1TJGH 1MFEH 3ARFD 5DRNB 1IQDB 3GEWB 5IHUH 5AD0A 2IANA 4ONFL 5DTFA 5EC1A 2EZ0C 5K9QI 2FHFA 3RL2B 2FJGB 5I9QB 1NGWB 3P4OA 1C5CH 3ARPA 2AJYL 3F12B 2P7TB 4JHWH 4CNIA 2ATKA 1KENL 3SCMC 1UCTA 2JELH 4KZDL 4ZO8A 1IM9A 4EZMA 3OQ3B 3DV4A 5CINL 3DVGA 5AWNH 1WZMA 4O58L 4GQ9H 4I3RH 1QYGL 4KROD 5L2JA 3GGWB 3KPPA 2X4RA 4UIMA 4KFZC 1RUKL 5DJAA 1CGSL 4FFWC 4J12A 1I85A 1SMOA 4NWTH 3MLZH 3PXHA 1SMAA 1TVBA 5FB8B 3QDGD 1M71B 5DD6B 3DXAB 4MAYA 2X10A 4AH2B 5GRWA 3LS5H 4S1DC 2WP3T 3IJHA 2FECI 2XYCA 4UOW1 3QIUC 2E8ZA 3TA3C 3ECBB 4I5BB 1JF1B 2IQAA 1K8DB 4X6DB 2AK4E 3LQZB 2PR4L 2G5BB 3L3GA 4WW1A 3D87B 3G5YA 3S37H 3EYOA 1JGLH 1R3HB 3D2UD 4J2XA 3HTLX 2DRUA 1WLHA 3HC3L 5MERA 4HS6B 1NEZG 4NQUA 5HYFA 5ADOH 4G3YL 4LSTL 4RX4D 3L3KB 4AMKH 5B8CA 1I1RA 1NGYA 1TDQA 3S6CA 3KPOA 4KK8C 4ODHH 4UMGA 5MENB 3EOBA 4Z7QF 4F57L 2C5DC 2HFGL 4KKCD 4KY1L 3QSKB 2FHCA 4GSDL 4EI5C 3ZO0A 2VSDA 3Q5YA 3PHQB 2UZIH 2EXYC 2FBOJ 4ZOAA 1JWSB 4NQDD 5GGQH 1EHAA 2NY5L 4GS7B 4Y5YA 1JWMB 2YD5A 4PJEA 1G7MA 1EDQA 3KJ6H 3AS3A 4YR6A 1X3DA 4H88L 1WIOA 5JHLH 3VWJD 4X6CE 4ONHA 3SQOH 1CXHA 4XNMB 3VFOB 5E4IA 2H3NB 4XCCH 4HKXB 4O2CA 5C0IA 2B5IC 3S98A 2Y4SA 2ENYA 3CIQA 3GMPB 3OGCB 4Z5RA 3CSYA 3BGFB 4LF3A 1QSVA 4DFIA 5JPNA 4N90E 2QEJA 1J0KA 3MJ9A 4WHYG 4LVOB 1GPOL 3EBAA 3F7QA 1RIVH 3BZDA 2AKRB 4L4TE 4Y4KA 2DBJA 3QEQA 3ZE2E 3S9DB 2NTFA 1BVLA 3HI1B 4UBDD 3GMQA 3IGAB 4M7KL 1FNGA 3MUZ1 5T1LD 4AEEA 2E7BA 2D7OA 2HKFL 2VE6B 2GAZB 3LY6A 3U0TB 3LKRB 3GSXB 5FOBB 5IB4B 1UWXH 3O81A 4HC1H 1EEYA 3LDBC 1GHFH 3OG4B 4HPOL 2GKIA 2VXQH 1NGQH 4KWUA 5DFVD 3TIEA 4O2EB 2YN3A 2NYYC 2X4TB 2DMBA 1KPUA 5GJTL 1FYTD 4OFDA 5EZLB 2JIXA 4EIZC 2VDLL 2EDXA 1WITA 3FAWA 1UYWL 4HS3B 1FFNB 1FLRH 2OR9H 3T1WA 3ZDYF 3C8HA 2Q6WA 2LTQB 1JPGB 3HRPA 1TCRB 3NVQA 3WE6B 3D0VB 1FC2D 1R5IB 3VFWB 2JJTC 1P7KB 3ULSA 3D0LA 4RAVA 2DQFB 2FWOA 3VXNA 4MA8L 3G08B 3J8F7 4NN7B 2FX8L 4RSVA 2FCBA 5DMIH 3NCEB 2WWMD 3V6ZA 4R96A 4TVPD 1HSAA 1S3KH 1ORQA 2DN7A 4JZJC 2DTMH 3QZWB 1ZVHA 1EJ6A 3P40A 1KTLA 5EWIL 1I1AB 2CK0H 3BJ91 1KJVA 2NW2B 4PYGA 2VAAA 3X3GL 1JTOA 5C0JB 7CGTA 2WUCL 4OCXH 3A67L 1P53A 1G9MH 1QR4A 3DX8A 3P9MA 4YFLI 1WCQA 4HLZG 4UU9B 4QCIA 4WFFE 5FDWB 2H2SC 1BQUA 1VGEL 1KJ2L 3F5WA 2R2BB 5DQ9B 3SKOA 4NQSB 1I3UA 4XGZA 3WEXA 5I1DA 2X4SB 4ZAKD 5EBMB 3C60D 2YWZA 5DWUH 1ACYL 4Y16A 3S97C 3OKKB 2OBGA 1MJUH 3CMOH 4PRIA 1M7DA 3LRGA 1X7QB 3CU7A 4PGCA 5CZVH 2IAND 2GT9B 2ZG1A 2AJSH 2F54E 1Z6JT 3IDJA 1MFBL 2I60L 3RX5A 4JFOA 1UACH 2E7MA 1QFWH 1D5IL 4HS8H 3GRWL 3TF7C 1CFSB 3SJVA 2C3VA 2W0FA 3MLXH 1UB6B 5MHSD 5KSUA 3CPLB 4MJ6A 3RIFF 4NNYB 1IM9D 5IV2A 4MA1B 2UUDK 2CLZB 4K7PX 5FUZL 4ESKA 2QLVB 1HKLH 2F74B 1KB5A 1Z2KA 2DQCH 3TBTA 5GGTH 2CJUH 3SKNA 1RZFL 2APBA 4Z7WA 4LIQL 1CE6A 4ORZC 4QRUA 3V5DB 1ZA6B 1AJ7H 4YXHL 2QKIB 4N0UA 2X70A 4D0DB 5K9JH 1HEZB 4GBXA 4J3UA 4CVUA 1WIUA 5E8PA 4MAYD 5I71C 1X5IA 2ZUVA 1N3NA 5SWZA 3PWNB 1DP0A 1EFXA 2X4UB 3MV9B 1IEHA 1TZGL 2R4SL 5FYJL 3DVNA 4S0SD 5IK3A 4NBZB 2NNAA 1HHHA 4KJPC 2ZSWB 2AI0H 2VXVH 4FXGB 5ESAA 3QUMA 1LO2H 2QSCL 4LVHC 5J8OA 2GJZA 2EEDA 2EC9T 5EORL 5DI8A 1G7LA 1BFOB 5I15L 4KVCH 3IVKA 5EU7E 4MD4A 5GRUL 1IFHH 1IC7H 3DRTA 4NP4L 2UY7A 5DQDL 2HTKD 5K9KA 1MIEH 4RA0C 3VXUB 4X4ME 4YDVA 5J56B 1LE5A 1SEQH 2YRZA 4WHTB 3UEZA 4JN2B 2CUMA 5EC2A 3AREA 4EN3C 4KK6D 3IF1B 5JOFB 4HHAB 3C6LA 5GS3A 4RCAA 1IKNA 3UBXG 1TNNA 2ORBL 5A16B 4BKLA 1VACB 4WENB 1QR1A 3SGKC 3EOAA 5FYLE 2I26N 5F7LB 4X7FC 3QXUA 4XNXL 3KPRE 3LHPH 5JR1H 3PWLA 4XPBH 4ZUSB 4CADA 3D5OF 4XCEB 1AQDB 4LPYA 3TBWA 4BFIA 1ZEAH 2V17H 4FG6D 1NJ9B 3HE7B 3GSQA 1DE4B 4UUJB 1DQJB 4XP6H 4JFXA 1XZ0A 2YZ8A 5FECA 2BVEA 4FQXA 5KN5A 2R29L 1XGTB 4KQ4H 2DLFH 4OCRL 2NY0B 5DZNA 1U58B 2X40A 5EOCL 3DRQB 2MPAH 3QDMB 4Z7UE 1JK8A 4OLWH 4WO4D 4G6ML 3PWPA 3I02A 2AJ3B 3QIBA 1KXTB 4YDKL 2RIKA 4PRBB 1K5NB 5D6CB 5DT1L 3ETBF 1MJJA 4KUCD 4Y4KD 5ITFB 3QEQD 4LGRB 4OZGB 1UEMA 3MV7A 5D2NE 1YUHA 4P9HL 5CKAA 5IHZB 3QXDB 2LVCA 3ZDZF 2EYRB 2ZKHL 1W2KT 2LU3A 4HH9A 1BFVH 4K7FA 1F4HA 4U1KA 3DARA 4TNVF 4D9QE 2VMFA 3CZFA 2P43B 3MNZB 2BSSB 4IDJH 1KGCD 4K9EL 1CBVH 1KB9K 2JIXD 1B2WL 4UT6H 3MRIA 1WWAX 4NNPH 3BQUA 1CFNA 3ZYIA 2Z8RA 1H3XA 1SBBA 1DVFA 5DA0B 3GKZA 3HCVA 4P5TD 3WYRA 2NY2B 3RWIB 3PJSA 4HKBB 4E41B 4WUKH 4P48A 2EDRA 5INCB 2BFVL 4ZPVB 5DR5H 5D1XA 4ZTOL 4PD4K 1OGAE 3NCBB 2X4QB 5JA9A 5GZNC 2EYTA 4NKMA 3G6DH 1KIRB 4U6HA 3FMGH 2C1OA 3IAQA 1LGVA 5C6TL 3S34H 3O11A 3TBSB 5GSRB 4M1GH 2GFBA 3OAZH 4RGND 2FZ3A 1F42A 4PFEA 3QCVH 5BMFL 4JO4H 1NCBL 4FA8A 3O0RH 1KJ3H 4AQ1B 1AQKL 5C0GB 1PG7W 4F37K 4NQCB 1KJ2B 1CCZA 3FO1B 2YXFA 3FB7A 5FOJA 1R0AH 5ACLA 1QO3A 1KNOB 5HDOA 1WF5A 2ADGB 5D5ME 5T33L 3QQ3B 4WI2A 1IRAY 5C0CE 4YBLC 5T3ZH 3O3EB 4ZNEA 4NDMA 3KS0H 4XZUB 1RUAL 2YPLB 3BIBX 3BKMH 1KELL 3PGDA 5GS2D 3TNNA 4KK9C 5IVXE 1HH9B 1JZ2A 1F97A 3TNMA 5C09E 4I2XA 5CBAB 4QXGH 1IBGL 4Y16D 3KPSA 1WBYB 3PP4L 4K3EH 3DX7B 4MX7A 4PJXE 1HOCA 5IJVA 3S88L 4OLYL 3V6FA 3WO3B 3MCKB 5I18H 3PXJA 2ZOKB 2MJWA 4N9GB 3V0VB 1NMAH 4F2MA 1MEXH 2JB5L 3U9UA 2VKWA 1PSKL 5EU3B 3E8UH 5D9SB 3SJVD 4NZRL 5DF0A 1K4DB 2ZCHL 1U8KA 2XTJE 2VLRB 1MSPA 4KDWA 2P8LB 1MRDL 1B4JH 1JGUH 4K3JL 3QG7L 4POZD 1IT9L 1UT9A 3HZMB 1ADQL 4LLWB 4YHIB 1F58H 4PJAE 4X99B 4P23C 4FRWA 4ONGH 1T04B 3FCTB 4CJ0A 4ZUWA 1S7WA 3A6BL 4YHPB 5I8OH 5ESVB 1II4E 4DKAA 3MUHL 5FM8A 4IRSC 4GBXD 3VD9A 3SDXF 3JTTA 4ZD3H 1LP9A 3QUYA 1MI5E 5SWZD 3FONA 1EFXD 4M6NH 4L4VD 1T3FA 4KKLC 5HGAB 1RUPH 5E6ZA 1U6AL 1NFDE 5GSVB 3UO1L 3QHFH 5JIHA 1FDLL 4OLXH 2BRRH 5KSVB 3ZSTA 3HNVH 3HA0A 3HLAB 4IOSD 4R8WH 4JHZA 1QFWI 4DCQB 4HW6A 4C55A 3V2AR 3WHE0 3BO8A 4HPYH 3G6JA 2OQJB 1MCLA 3NIDF 4XC3H 4MNQE 3ARED 1XGYL 2YHGA 3EFDH 3QEHA 3U0PA 5FDYA 3I3DA 5HXMA 4K23L 1VSCA 3C6LD 1CF8H 5JHDA 3SDYL 4EDWH 3T0EB 3TYGL 2FSEA 2W9DL 5I1LA 2VXSL 3SCMA 5DLML 3TN0B 4OCLC 2ILLA 4R7DA 2EE2A 5GGTA 1D9KC 3LEXB 1NAMH 4TN9A 1QEWB 3CCHA 3O4OB 4OCMC 3W39A 4DVRH 5J1AA 5BOZG 2R69L 5CFHA 3VXTB 1RJLA 3WV0A 1QPPA 4Q9RH 2XQYG 2BJML 5MEOB 4FQXD 1CFTB 1GGTA 4XRCB 5I6XB 3L9RB 2IG2H 5E5UB 3W2DL 1GZPB 5HPMB 1NL0H 4N0CC 3WS6A 4Q2ZA 3WXVL 1FBIL 2AS5M 4K7PH 1EO5A 2C26A 3QIUA 1QKZL 3PWPD 3TA3A 3TJHC 3IDIB 3QIBD 5JUEL 1YJDC 4YXLH 5B4MD 3QQ4B 4PJIF 3OBAA 1CI5A 4JRXA 4GG6B 4R3SA 1FFOB 4P4RB 2JE8A 5KVFH 1NC2B 3MV7D 2X44D 4NHCH 2KL6A 1OHQA 1IGML 2E6QA 1QBMH 4XNZC 5DRXA 5ETUA 4F7MA 4L8DA 4MJ4A 3T77A 4LNVA 5LGKA 4PGZA 5DMGC 4GRWE 1QSEA 3N85H 4ENEC 4KKNA 3K4DA 1A6WH 1KCRH 2QSQA 3RTQC 3UP1A 1DBMH 1DDHB 2QQNH 4EI5A 2RB8A 4ISVB 1OAKH 3U2SB 3I50L 3UTPD 1VKXA 4XX1E 1EHXA 3MRKA 4HIXH 5I74B 2P47B 3BQUD 1OLLA 4OF8A 1G9NC 1DVFD 2I9TB 3DGCR 1BF8A 4QRPB 4MA7H 3MLPA 5C8JA 3EO0A 1TQBC 5D1XD 3C5JB 2XQBL 3VH8A 3HMWL 4YEFA 5DA4A 1GCFA 1BVKA 4LSVL 4MQ7B 1GC1L 4HV8B 3EOYG 5I76B 3IETA 4UV4H 3C6SA 5C07A 3LD8C 1VHPA 5E2TH 5EZIL 1A4KB 3NCJL 1XFPA 2DWEB 1G6VK 3QDHA 4G5ZH 5E95B 1OT1A 3GJFB 3QO0A 5E5MA 1NUNB 2Q87A 3BGAA 1GGCL 3BXNA 4TQEH 5I19L 1NCWL 3KPMA 2EH8H 4LKXA 3WKML 4CDGC 4JFFB 4R90H 1AGDB 1DBJL 2OTPA 2GY7B 3VFPB 3VRJA 3LB6C 3SDAC 2Y9RT 5B39G 3BH9B 3TYFB 3B3IA 2DF3A 1ZVSA 5DZOA 4F80A 1PZ5B 1MH5B 3RGVB 4E42B 1LDSA 4D9LH 3CFDA 2HKHL 12E8L 2H8PA 2N7BA 3N1PC 4OV5B 5I1IH 4GJTB 1AFVH 1MNUH 2HJFB 4KJQD 3KPSD 1CT8B 1LK2B 1NGXB 4P2OC 3C5SB 3IS0X 4HH8A 1AE6H 2W65A 1YEFH 1YYMH 3MLWH 3BPLB 4PJCA 5HVHC 1A0QL 5GGSA 3WHXB 3UX9B 4U3CA 5C08D 2JJTA 1I8KA 3JTSB 3O2VL 4EVNA 5F7YC 1NUFA 3NZ8A 4ORGA 3SGJC 2CIKB 4JREC 5IFHH 5KANG 5A40E 1U8QA 4LCIH 4HWUA 1H9VA 4TVPL 1FPTL 3UJIL 1BLNB 1NDGA 1FAIL 1YEEH 1ZLUH 4F7TB 4JZJA 4N5EC 3NAAH 4X7SH 1TFHA 2NY1C 4GW4B 3MOBH 2NY4B 1XR9A 1QNZH 5E94B 1TLKA 1T1XB 3GKWH 3F7VB 4JFQB 4Y5XC 3S7GA 3QUYD 4GAJH 4JY5H 5ANMB 4FQ2L 5GGUA 3EYSH 1J10A 1I7TA 3LN4A 4PGEB 3ARFB 5J06A 2ZOLB 1RZKC 2D31B 2IBZY 5ICYB 2YC1A 2YA1A 2PYEA 5C0AD 1UEYA 4MDIB 2EICA 4R4NC 1K3ZA 3PNWB 4WI7A 4N0FB 2F5AL 2Y36L 3S5LB 3LZFL 1MCPH 1MLBB 4Z7VA 1NBYA 1KTKE 1ZLWK 3T0DA 4OIIH 3GIZH 4LCWE 2EZ0D 3MLTA 2DJSA 2J8UF 4P5KA 4AQOA 4MAUH 2Q76A 1UQSA 2ZNWA 5JHDD 3H3PH 1QSFA 3PHSA 1VERA 4W4OC 5ID0A 3SCMD 2FX7H 1Q9OB 1R24A 3U1SH 1QHOA 1UM6H 4X9FA 5D7KE 1PJ9A 1RZJL 3L5JA 3LQAL 4OZIF 3QDGB 3P0YH 3UTQA 3OKEA 4M7JH 5ALCL 4CU6A 3QCUH 1NPUA 4WHYH 1A6TB 4P5MA 2CR6A 3RUGE 5FF6B 2R2EB 4OAWB 1JPSH 5C9JB 4FFWD 4HFWA 5T1DL 4B5EA 4IMLA 5JQ6H 5CP3H 4FTVA 2R1YA 3HRZB 4PY7B 1OB1A 5JNYA 4OI7A 4P4KC 2CPCA 2L4OA 3G5ZA 5D7LE 4OGYH 3D2UB 4S1DD 2C4FT 2K7QA 1JHLH 3QIUD 2YD6A 4NM4H 3CSGA 2DM7A 3I6KA 3BPNC 4PJHF 3UROR 1T66D 2FECL 3GMMA 5IOPB 1HHGB 2N4IA 1YJDH 1DBKH 4JDZA 4JRXD 4NPYB 1JGEA 3QR2A 3OHXA 2HWZH 1MVFA 4XNYL 1Q0YL 3EJYC 3K0WA 3IJSB 4IMKC 1ITCA 1RFDH 4KRLB 4MCZB 4JANB 4V1DB 1M05B 3ZTNH 4CVXB 4EN3A 4OLEA 4KK8D 3VXMA 4NRXA 4NQDB 3T0AA 3CK0L 3BVNB 4ODXB 1PZUB 1QSED 4NCDA 4FHBD 5J9PA 4BH8A 1YQVL 1U91A 1MAMH 4GXUM 4EI5D 2XY2A 3SGKA 3BI9X 4XC1L 1N6QH 3UYRL 5JW4Q 2EXYD 2XG4A 3VMPA 3VWJB 1NAMA 4NFCA 2HAZA 3SE3C 1YPZF 2KPNA 1TENA 3L3OA 2XWJA 1G9NH 3PDOB 3Q5OA 1KEGH 3D39E 2ZP0T 5H94A 5F93C 1DANT 4O00A 1UA6H 2I5YH 4UT7L 3TCLA 3Q3GB 2YMXL 5HHVH 2A9NL 4M62H 3OAYK 4HLZH 2EC8A 1FSKB 3QEUB 4OT1L 5ILTL 4MJIA 3N1QC 5E5RB 1FE8L 3U46A 3IRPX 2UWEE 4JPIB 3R1GH 5D2LE 3VE0B 4P9ML 4S2SB 1EXUA 5T1LB 1DTUA 5F7FA 5J7CC 3MJ9L 4M61B 2BVQB 4J3XA 2XWTA 1RSFA 1GIGL 5T1MA 4JO2H 2VC2H 4JGMA 5HYSA 4NQXB 2YK1L 4PJFE 1T7ZA 3BJLA 1EJOH 1ROWA 4X80L 1T4KA 2VXTH 5ERWA 3VFRB 3WNLA 2DKMA 5IB1A 3P0GB 5DD5L 5DQJA 5E8EA 4CU7A 5HDQL 4YK4C 1FYTB 4QOKA 4TULH 3RVVD 3FN0H 4MDJB 4QKXB 1RUQH 1MCNA 4M9OA 2Y5EA 4G9FE 2CDFA 1C5DA 2LE9A 4LHQB 5F9OH 3CSPA 1XCTB 2XA3A 3BRFA 2X1WL 4BA8A 1MFCL 4GMSH 3L5WB 3VFUB 4QHNB 2BCKB 1HCVA 3QNYA 2V2TA 5L8KB 4YQXH 3V6OC 4PRHA 2Y06L 5ABDE 1L6XA 1WBZA 5JO5A 3MRCA 3TBVB 5I73C 4GXVH 2X4NA 2W9LA 4QHUA 4L8BB 5DJXA 1FNAA 2Y72A 5J4MA 3NBNA 1U8JB 1OAZL 1VFBA 1VFAB 5SX5K 2BY0A 2H6PB 2XZCH 4JPKL 3NCYP 4MD0A 5FGRA 2GSGB 2CKBH 2Y23A 1W0WB 4LOUC 4R4FH 3VI3E 4YX2L 1N5YH 3CUPB 3IDXL 5E2WL 1CD0A 3MXVL 1YEIL 2Q8BH 3VGAC 1UH2A 1LNUA 5F44A 4ZAKB 3TGXA 4UDTA 3KWWA 4ODBD 5T3ZD 4KQ3L 1NCAL 2H2SD 2YBRB 1F3JB 4ERSL 1PKQE 3RHWK 4GRLC 3CNKA 5AD0B 3T0WA 2IANB 4NHUA 4DW2H 3E6HA 3RQ3A 4LSQL 4JQIL 2PYED 5EC1B 1RZKH 4X83A 1BFSA 5J1SC 3BUYA 3P4OB 3WLBA 5F6IC 5T3XE 3FO2A 3QFJA 5J1TC 1SEBB 4UTBH 5C86A 4OGZA 4PBVC 4WUUA 2W92A 3UYPA 2UY6A 4LDOB 1U8IA 1F8TL 1IM9B 3ARSA 5I16A 3TZVC 3NCCB 4U1IA 1QSFD 5MP6L 4RFEA 2UYLA 3KR3H 1X5ZA 1P4BH 2AEQL 5L2JB 4P2CG 5E99L 1JHKL 3MLSL 2JF1A 4RISL 2X4RB 3DSNA 5I0DA 2VDQL 4HULB 3NFPA 3LAFA 5FO7A 2VLJA 3RWDA 1KB5L 1S7VA 4HMDA 1TVBB 5HGDA 1FZKA 3FRUA 4MAYB 1K9TA 4UNVA 4P23A 4Y7MA 1YEJL 2P4AB 4UINL 3O45A 4EXKA 2QQKH 3IJHB 4PIRF 3GB7B 2EH7H 1YQ2A 2LV4A 2WQ8A 2DLIA 2IQAB 4IRSA 4R26L 1J8HA 3L3GB 1UJTA 1UCBL 1MREL 3MRQA 4FTVD 4WW1B 3G5YB 1E4WL 5LWYL 3FT3A 3EYOB 4LCYA 1C16A 5TF0A 4X7EC 2W59A 5E2VL 4OF0A 5MERB 4F7PB 1GH7A 4CAGA 1N4XH 4LHUG 3QUML 3MRRA 5JW5A 3DECA 4AEHL 4BK4A 5E00B 5JW4R 3MRGB 2J4WH 1TJGL 1MFEL 4EEEA 1HI6A 5DMYA 5IHUL 1NGYB 3KPOB 4M5ZH 2R0LL 3EOBB 1S9YB 3KPNA 4GFTB 1Z0NA 3MNVA 2A6KA 4X6CF 4JG0H 1C5CL 2OJEA 3O2DH 2YD7A 5I1HH 5IUSA 4JHWL 1AC6A 3QPQC 3RY4A 4EN3D 4ZSOA 1KIQA 2WIIA 4I0KA 3C8KA 3VXMD 4DZ8A 1PG7X 2JELL 2W60B 3OB0H 5IEKB 4PJEB 1NLDH 2F58H 2E9JA 4YR6B 5FKAB 4GUPA 5AWNL 1C7SA 1N5AA 4GQ9L 4I3RL 3OKYA 4NBYB 3ZE2F 4P3DA 1D9KA 2HJKA 2GK2A 4HBCH 2UVEA 2XRAH 3WDHA 1ZGLA 1A47A 1G6RH 1A7PH 3MLZL 4KAQH 4O2CB 5C0IB 4KHXH 4WO4B 1JZ6A 1AD9A 1T7XA 4LAJH 2A9MH 5CP3A 1S7QA 3LS5L 3IFPA 5T5NG 3S36X 3CSYB 4LF3B 1ZE3C 3DGGB 1JPFA 4PRDA 4U1GB 4PUBH 3DETC 4OSUH 1ZWIA 2V9RA 3QEQB 3QQ9D 1U2HA 4MJID 1BVLB 3S37L 4L3EA 2DJ4A 1ZA3A 1FNGB 1JGLL 5LAXA 5LKNA 3T2OA 3EUUA 4M5YH 4KGJA 4UDUA 2RCSH 5ADOL 3ARXA 3QWQB 4AMKL 4U7MA 2XXCB 1EEYB 3TIEB 4OCYH 4ODHL 5D1QC 3G6AA 4BSWA 4XAWH 3BISA 2JIXB 2ED7A 4Y2DB 4O2FA 5FAAA 1ZT7A 5FYKH 4GS7C 4EQ3A 1T2XA 3VFVA 2UZIL 1JNHA 1B0WA 4P5TB 3RTQA 5IT2L 5KVMC 5GGQL 4EOWH 2Q6WB 3NACH 3L3JA 2FJFB 3NTCH 4QYOA 2OR7A 5C2UB 3ULSB 1QD0A 3D0LB 4RAVB 4G8GA 4K94C 5BVPL 2ZPKH 1IGJA 2GK0A 2HJLA 3WDIA 3K3QA 5BOPA 5JHLL 1A6AA 3VXNB 4PRHD 3MCG1 3SQOL 2OCFD 3TO4B 4RGNB 5F7MC 4XCCL 1EAJA 3CLFH 3V6ZB 4F8QA 1HSAB 5GZND 1ORQB 1DSFL 4LVOC 5TDPA 2EDYA 4GMTH 1I9EA 1S9XA 1KTLB 2DLEA 3VJ6A 1T22A 1KJVB 2VAAB 3QCTH 4IRZH 1GRWA 1FIEA 3RY6C 3QB7C 3DX8B 1RIVL 1NDMB 3DJ9A 4QCIB 3VW3H 3RRQA 3VXRE 3X13B 2R1XA 4UIKH 4AM0B 5D7SH 3SKOB 1CTNA 3W5NA 2VIRB 4XWOC 3G5VA 5L6YH 1DUZA 3WEXB 3HNSH 4BZYA 1CD8A 4MZ2A 4LLDA 1FC1A 3SDAA 3OG6B 4Y16B 1T0MA 3RGHA 1GHFL 2VXQL 1QFWM 1NGQL 3CSBA 3ZHDA 1JNJA 1K85A 1QLRA 4PGCB 4Z9KB 5E8NA 4PJIA 3CJJA 3MRDA 4KK9D 3IDJB 1B6UA 4JFOB 2X6MA 3FB6A 1VADA 3ARBC 3QFJD 2NY6C 3U36B 4P2OA 5HYJE 4U1SA 1WJ3A 1FLRL 2OR9L 2W0FB 3H3BC 3QHTC 1WV7T 2VR5A 4WUUD 5E7BA 1H3GA 4K2UH 5E24E 1NBZA 4LMQI 4NN7C 3PV6A 3JUZA 1BZ7A 4JKLA 5IV2B 2B0SH 4OM1H 3TBTB 4XX1G 2ZSVB 3I75A 3SKNB 4NC2B 5DMIL 3SGJA 1CE6B 5DC4B 1I1AC 4N0UB 2X70B 4NFBA 2AEWA 2VLJD 2AEPH 2DTML 1X4ZA 4H26B 5BV7C 1UWGH 4LPCA 4GBXB 5FM4A 3JXAA 5E8PB 3B2UC 2CK0L 5F3HA 3WFCH 1N3NB 5SWZB 5BZWA 5DD0L 1IZJA 1EFXB 4OCXL 4TSBH 5IMLA 1KFAH 4L4VB 1G9ML 1KPVB 3DVNB 5IK3B 2NNAB 1HHHB 4HF5H 3C2AH 2BX5A 4IRSD 1J8HD 3QUMB 2GJZB 4N0YH 1EAPA 1U3HC 4Y5XA 4I9WD 2E27H 5DI8B 3VD3A 1G7LB 5LGJA 4KGLA 3SKJL 3IVKB 5IJKC 2OM5A 4MD4B 4HFUH 4OIBA 5BO1H 4FQJH 4KKLD 3DRTB 1PLGH 3KNBA 3EJZC 5B38A 5DWUL 3TV3H 4YDVB 3RJDA 3KLHD 3CMOL 1KYOJ 1MJUL 2EIZB 1YNLL 3QI9D 3GI9H 3D85A 5CZVL 3AREB 3KPLB 1IKFH 4LEOA 1LMKA 3C6LB 2DLTA 1MCOH 3IXTB 4JE4B 3TWCH 2AJSL 1I1FB 2P5WA 3VFSA 1UACL 3IDNA 4BKLB 1NFIB 1AR1C 1QFWL 1FVEA 1E4KC 1QSZA 2V2XB 5JLZA 4HS8L 1QR1B 3EOAB 2BVTA 3MLXL 5BRZE 2HVKA 3Q6GL 2XN9E 4Z7UF 3PWLB 3RBSA 2ZUSA 4W4OA 3TBWB 3X12A 4J4PC 4BFIB 1N26A 3IDYB 1D5XA 1GGYA 2F9BT 1HKLL 3GSQB 3LRSA 2DQCL 4NQEE 5GGTL 4XVJH 5TDNA 2CJUL 5EOQH 2LU7A 4FQXB 4FQHA 5KN5B 4UILH 1Q94A 2AJXH 1AJ7L 1IMHC 5DMKA 1RZGA 5C0EB 5K9JL 1QG3A 1QLEL 5E6IC 5SX4H 3PWPB 3I02B 1F5WA 3FFDB 3QIBB 2GTZB 2M26A 4H0HB 5J12C 1GGBH 4N0CD 5IEHA 4P4KA 2I9LB 5L9DH 2AI0L 2VXVL 5ISZA 1ZLVK 1LO2L 2YSSA 3TP4A 3MV7B 5EU7C 4L3ED 2Y25A 1NCNA 1MCJA 3MGOB 3UPAA 4KVCL 2DIBA 1IFHL 1IC7L 2C1PB 4Q6IC 3EYUH 3GMRA 1QRKA 1MIEL 2BC4B 4K7FB 1SEQL 5BW7C 4IRJC 5C3TA 4RRPG 3O2DA 4IMKA 3RY5A 4JLRA 1CN4A 4JGUA 3CZFB 3P4NA 4F37F 2EIDA 4PTTA 4R6UA 5EBWA 5A2LH 1I4FA 3MRIB 3P30H 5DMGD 3BQUB 1EERB 1CFNB 4Z0XA 1DVFB 3G04A 4ENED 1R3IH 3HCVB 3RTQD 3PJSB 2IJ0C 3ESUF 3HE7C 3LHPL 5JR1L 4XPBL 1DQMH 1SJEA 5D1XB 3SO3B 2AW2A 4NN5C 4PJDA 1CR9H 3SE3A 1CXIA 3ZKMC 4AIXA 1ZEAL 5IMMA 3QXAB 2V17L 2EYTB 3EOTH 4NKMB 3STZB 4G8GD 1G6RA 4ETQB 4XP6L 2C1OB 5C0DB 1PG7H 4K94H 1ZKAA 4I13B 5D5MF 4I1NB 3PE9A 4KQ4L 1EA9C 3O11B 1TXKA 1HQ4A 2DLFL 2FZ3B 1FL5A 4ELME 3KYMB 5FYJU 2MPAL 5BS0A 5E1AB 3IB4A 4OLWL 1OP5H 4R7NB 2H1PH 5IVXF 3D25A 3WUWG 5L2KA 4OZIA 3FB7B 3ARYA 4N1EA 1QO3B 4PJXF 3FHAA 3CLEH 3T1FA 1QFUH 4NWUH 3F58H 2VZVA 1MFNA 3U7WH 4HG4J 1SYVA 4U1JB 5IWLC 3S36H 1FL6A 4TUKH 4HWZB 2ADIA 4NDMB 2OXHA 2ZUWA 4XPGH 5DO2C 2VITB 1KIPA 1BFVL 3PGDB 1G9EA 3TNNB 3T08A 3TNMB 3LB6D 4I2XB 3SDAD 2FATH 4XP1H 3KPSB 2JCCA 4LRNH 4MX7B 2X41A 1HOCB 4PJHA 3ULVE 5T5NF 1XF3B 3ZKSD 4H0GA 4IDJL 5LCVH 1HZHL 2YD3A 3U0WH 2QL1A 4UT6L 5E56A 4PJAF 2W07A 4NNPL 3AS2A 4IJ3C 3U9UB 1NBVH 3W11C 3FFCE 5C08B 1UZ6E 3A0OA 1A4JA 4WUKL 3ZYOA 5DR5L 1U8KB 3V6OA 1CIDA 5HSFA 3FO9A 2C3HA 3I85A 1EVTC 3G6DL 1RAMA 3B9KB 4YAQB 3FMGL 2VQTA 5CLWA 3OXSA 4G6FB 5IQ9B 1NMCB 5DVKA 3S34L 3WD5H 1NFDF 2DS4A 1JTTA 3BE1H 5C0BE 4M1GL 4ZUWB 1S7WB 3LN9A 2VH5L 5F7DA 1YPZA 3QCVL 4JO4L 5CSZA 3O0RL 1KJ3L 2ID5A 3HS0A 4N5ED 2GJ6B 3JTTB 5BV7H 1LP9B 3QUYB 4LSRH 4NZTH 2NY1D 3L7EA 4KMLB 3NN8A 5EO1A 3FONB 1R0AL 5E9DE 1J87A 4Q58C 5C0AB 2P5EE 1IQWH 3WCYA 2XKUA 4X5XB 5T3ZL 1RJZA 1LEGA 1K4CA 3BKML 1BD2A 4GRLA 2UVFA 5FYJE 5EU6E 3AC0A 4WU5A 2VZSA 1UXSA 3BO8B 4QXGL 3G6JB 1L0QA 2G60H 4K3EL 1EEQA 1UC6A 3D85D 4R4ND 4MWFA 2DIJA 3WIHH 2DKUA 2UUDH 2VDNH 3OV6A 3A6CH 5EB9A 5IFJA 5I18L 2MTPA 5JHDB 4RDQG 5E08H 1AO7A 2FSEB 1RZ7H 2P5WD 3W9DB 5I1LB 1NMAL 4OGAC 2M2DA 1MEXL 3SCMB 3MLYH 1ND0B 1I75A 4BJLA 5MEQA 2XTJC 3TCXA 5KJRH 4R7DB 3TZVA 1JZ5A 2WQRA 1TVHB 5ADPH 3CCHB 3W39B 2BY3A 5J1AB 3OXRA 1B4JL 1UKSA 1JGUL 4XPFH 1F58L 2DWDA 4LBEA 3QHZH 4ZUVA 2HMIC 4PGDB 2YEZB 1MHEA 1NMBH 5I8OL 4PRPE 4LEXL 4XP9H 3IFNH 4CMHC 3QIUB 1J0JA 4QTHB 4XBEH 4ZD3L 1Q9WB 4MCYB 1UFUA 4J8RB 4GRWF 5F8RC 4U6YA 4F7EA 4M6NL 4JRXB 2RJMA 4P4KD 4R3SB 1RUPL 4S1RL 2GJJA 5ISZD 2BNRE 3QHFL 3QUZC 2BRRL 3HNVL 3AAZA 4I18C 4R8WL 1MCCA 3RU8H 1UH4A 5DRXB 3VGFA 5HGHA 4F7MB 4L8DB 4HPYL 3F12A 4YXKH 3QDAA 4NM8H 1QSEB 4XC3L 3MV8E 3KDMA 15C8H 3EFDL 2A1WL 3H2WA 2AV7A 4EI5B 1CF8L 5KSAC 3IRZA 4EDWL 3K4AA 1F3DH 5F7EH 2DQGL 2GSIA 1VKXB 3BP5A 2W91A 5DHVH 4HMEA 25C8H 3MRKB 3MYJA 3D6GA 5FYLH 1TQCC 4U1NA 4G6JL 4LLAA 3WFHB 4L8CB 1JE6A 4HX1A 2X1OA 5C8JB 3EO0B 1NAML 1FYHB 4JM2F 5SX4I 3T4AA 1X5LA 1VENA 3MRMA 4DVRL 3W0WE 3VH8B 5HGBB 1JN6A 1M71A 1AKJB 3DXAA 4Q9RL 1OAQH 2R4RH 1BVKB 2VAJA 1MCDA 2BOCA 3IETB 3C6SB 2IG2L 3QUKA 2ADJA 1NL0L 2V6HA 4QNPE 4G9DB 2VUYA 1JF1A 1K8DA 4K7PL 3NABH 1X4YA 2G5BA 2XFXB 4PLJC 5B39A 5BS0D 3JBG7 3CFEB 5KOVC 3QO0B 5E5MB 1NGPH 1XF2A 2J1KA 3T2NH 4YXLL 2YUZA 3BXNB 3KPMB 3QUXC 5L2KD 1YNKH 2IPKA 4PV9A 1RD6A 1UB5A 4LKXB 3VGHA 3CC5B 1S7RA 3QNXB 4FQ1L 3VRJB 5KVFL 2CLVB 5LGHH 3B3IB 3BPCB 1W8NA 4NHCL 3MLVH 3NFNA 4P2QD 4XAKE 2WBKA 4RGOH 5DK2B 2IPTH 4RAUA 1QBML 3CFDB 2CUIA 2H8PB 5HHOE 4M1CD 4X6EB 5D1QA 5I1KH 3PHQA 3MNWA 1T2QH 4MQXC 3N85L 5FYKD 1KCRL 1JWSA 4R2GC 1YDPA 5I74C 1DBML 2QQNL 2W65B 2AABH 1S5IH 3IDUA 4LLUA 3GBMH 3DMMC 3EDFA 4X6CA 5TGBA 3WIFB 4MA7L 3SDDC 2F53D 1I8KB 1UVQA 5TH2A 5HJ3B 5TDOA 2BXZA 4RGMC 3NZ8B 1U8QB 4RNRA 5EUOE 1BBDH 4JCMA 3GM0A 1K8IA 4OD1H 4AEIH 3GMPA 5CS7A 1HK6A 3UTSE 4JZJB 4UV4L 2K9UA 5D7IE 1DQLH 2JK5B 3DUUB 5E2TL 5I2IB 1XR9B 3QFDA 4HIEB 5GGRY 4L4TA 4Q9CA 4PJBE 4G5ZL 3UTTD 1NFKA 4KDVA 5IVOA 3IGAA 4KI5E 4WWKC 3CZJA 3MGTA 1RVFH 3RY6A 3R0MA 2F5BH 3ARQA 4LOUD 2GAZA 4TQEL 3AFLA 1YEHH 3U0TA 1V3MA 1IEBA 5GGUB 2EH8L 5DJ6B 1I7TB 3LN4B 4EUPB 4R90L 1UWEH 3FQTA 5H2BB 2YC1B 5C70A 2PYEB 4O2EA 3RWGA 4H1LG 1L7IH 4RMTA 5F1SA 4X9IA 4Z76A 3CVIH 4IOFC 4IIQB 4D9LL 4GAYB 4GRLD 2W1NA 4Z7VB 3UZQA 3U4AA 1NBYB 4JRYB 3TPUA 5I1IL 5SWQB 1AFVL 1MNUL 3EFFA 1GL4B 4QWWC 4XNQA 3MLTB 4PREA 1FFNA 3IS1X 3JSSA 4P5KB 1AE6L 1JPGA 2EIEA 1YEFL 1TCRA 3ARBA 1YYML 2Q76B 2X4PA 3RUGF 1UQSB 3WE6A 3FQRA 3VFWA 1QSFB 1J5OH 5EU5A 1AO7D 1WT5C 3X17A 1UM4H 3MODH 5C0FA 2DQFA 3ULUC 4OF7A 2NXYD 5EN2A 1R24B 3C2SA 1ZGLM 5F9JA 1AC0A 1DR9A 1RZ8A 1KCLA 3M1BA 3TZVD 1MCKA 4FQCL 2A2QT 2BSED 3BW9A 5IFHL 3UTQB 3OKEB 4GW5A 3LEYH 3QZWA 4K07A 4P5MB 1YEEL 4R4BA 1H3VA 1I1AA 3V4UH 5IBUB 5TJWK 3NAAL 4X7SL 4IMLB 4M7LH 1JPTH 4X8XA 1BQHG 3MOBL 1NH6A 2R1YB 1OWRM 3LH2H 1QNZL 4NQTA 1OB1B 5JNYB 5EIQA 2OR8A 1OTTD 5IB5A 1EV2E 2VLKE 1ULVA 3RVWC 4C56E 4QRRE 3GKWL 1CDYA 4GAJL 4JY5L 5DD3H 2X4SA 3EYSL 4LVHB 2PN5A 5CZXC 4JDZB 1U3HA 4OKDA 5CP7A 1JGEB 3OHXB 4U1HB 2BERA 3MRNA 5IJKA 2A6DA 3DUSA 2ICES 4HMCA 1N6VA 1WEJH 3RNKB 3WIHA 2F54A 2WIMA 1MCPL 4YHZH 1ZHLA 2BRQA 3MMEA 4FN0A 4OIIL 3V52H 3VXMB 4NRXB 3GIZL 2O26U 3F65A 2NW3B 4MAUL 5J9PB 5HHXH 1E4KA 4PJ9C 3CPLA 3LKNB 3H3PL 2H45A 3QPQD 3BN3B 2EDBA 1NAMB 2F74A 2FX7L 4K71C 2WM0A 5ENWB 5D2LF 2UWEF 3U1SL 1UM6L 3L3OB 2XWJB 4R97B 4J4PA 5H94B 4JVWA 3P0YL 4M7JL 3TCLB 5J6HA 4DN4H 3QCUL 1I7RB 5F1NB 4PJFF 4Y4FC 4BQ6A 1MCEA 2X4UA 3MV9A 2FR4B 5IB3B 5EIIB 5JQ6L 1MQ8A 4MJIB 3PIQA 5E6IA 1VGKA 4RDQF 5FM5M 2HT3C 4KV5E 4KTEH 1OTUD 1JHLL 2XWTB 4NM4L 3DETD 5T1MB 4POUB 5HYSB 2BVYA 1YJDL 1DBKL 3ZE0E 2PTUA 4QHKI 1T4KB 5ERWB 4X4MA 1QPXA 5E8EB 2HWZL 4M00A 3G9VA 4N1CA 4OCWH 4O02H 4Q6IA 5DK0B 5FCSH 1YMME 1RFDL 4M7ZC 5BW7A 1YC7A 1QRNE 3MJ8A 4YE4H 4IRJA 1OP3K 2CDFB 5A16A 3ZTNL 4GRWH 5D1QD 2Y7QA 3LKOB 1EMTH 4WIQA 5DHVA 4YBQC 5JOEA 2K3TA 3V79C 1Q72H 3QNYB 2CXGA 1T5WA 1MAML 5FV1L 3ES6A 2DQUH 4ZUSA 3KPRA 1N6QL 4W68A 3RHWF 4PRHB 3VI3F 3HE7A 1RPQA 1WBZB 3U4EB 1MCWM 2R0ZH 5CUSH 3MRCB 1G9NL 1KEGL 3NA9H 4G6KL 4M93C 5D70H 2BNUB 2MWCA 3SE9H 4QHUB 2ESVE 1PW3A 4O4YH 1XF5A 5DJXB 2I5YL 3RFZC 2V9TA 3KVQA 3DRQA 3QDMA 3KAAA 1VFBB 3PP3K 5HHVL 4F58H 1YYLH 4Z7UA 4OFYA 4M62L 3HZVA 4JVUA 4CKVX 4MD0B 2OTUB 1QBLH 4KUZH 4FS0A 2J2ZA 5EBLA 1K5NA 4YHMH 4N90D 3R1GL 3U7YH 3GJFH 2KQMA 2W0PA 4L4TD 4OZGA 5CWSB 1AI1H 3C87A 2C3GA 1OY3B 3MRFB 4PP1D 5FO8A 4KZEH 4UDTB 5CEXB 2VC2L 3ZKQD 3KWWB 2EYRA 4DKDC 3ALWA 2OXGA 5IWLA 1EJOL 2VXTL 3WIIH 4KPHH 4C57C 4XWOD 4NCC1 4NHUB 1PX4A 5EPMA 4KJWC 4TULL 3FN0L 3TPKA 1RUQL 2E9BA 2BSSA 5J11B 3WLBB 3CMGA 2OI9B 4KHTH 3FO2B 3QFJB 5F9OL 4OF5A 5CIPH 3N9GH 4OV6F 4YHNB 4O5LH 4OB5H 3VXOA 4LPXA 3QH3A 4JR9H 4GMSL 3REWA 4MHHG 4WUUB 1U8IB 1P69B 3ARBD 4ZPVA 2WWKO 2NY6D 5GQBA 2WWMC 4U1IB 4YQXL 4NUGH 1LHZA 1OGAA 3D69A 2UYLB 2AAVA 3WFBH 1Z9MA 1LO3H 4GXVL 3T8XA 2ARJQ 4PJ5E 3NFPB 2VLJB 2B1AL 3MA7A 5IP4A 4HGMA 3HI6H 5ID1A 5HGDB 1FZKB 2QV2A 2MFNA 3FRUB 5MHSE 5CAYB 4P3CH 2XZCL 3DX6B 1NUGA 1G0XA 3GBLA 3DBXA 4NQCA 1I1AD 3BZEA 2Q86B 1KJMA 3EW3B 4R4FL 3TLRA 1N5YL 1J8HB 2Y07H 1IGIH 4H5SB 1GJIA 3MRQB 4XMKH 2Q8BL 3B2UD 4LCYB 5D5MA 1C16B 4L3AA 4YEEA 4WFFD 3UAJC 5C0CA 2ICEA 2GIYA 3O3EA 1S78D 1EK3A 1ZLWH 1PEWA 2YPLA 1CICC 3MRPA 5JW5B 2QQLH 3SQBA 1AIFA 5GIRA 3QI9B 1HH9A 1U3HD 1HI6B 5CBAA 5LXGH 3Q5TA 4DW2L 4KH2A 4JFDE 1RZKL 3KPNB 4U6TA 3MNVB 4PJXA 2C4XA 2VLLA 4QO1A 2C9AA 2OMNA 2OJEB 1D5MA 2F54D 4LLVB 4UTBL 4XNUH 3SBWC 1T1YA 4ZSOB 2BOBB 1KIQB 2WIIB 4DZBA 4DZ8B 1VPOH 4NQVB 1K4DA 2VXUH 1XGPA 5DS8B 1RK1B 5LQBH 4GUPB 1JYWA 3S96A 3SHSA 3HPLB 3KR3L 5H8DA 1P4BL 4GH7B 3EZJB 4P3DB 2WMPA 4X99A 2HJKB 2Z0BA 3KLSA 4JFYA 2DQTH 4PJAA 4Z7OE 5JMRA 4I77H 5DJ2A 4WTZA 1T04A 3QBTB 3FCTA 3PGCA 4HIJB 4YHPA 1AD9B 1S7QB 3NZHH 4ALAH 2Q7YB 1BMGA 3IFPB 4G8IA 5J13C 2QQKL 1JPFB 2EH7L 3GNMH 1MI5A 3OKMA 1ZWIB 3MV9D 4M43H 2GYSA 2GY5A 5E6ID 4ETYA 4L3EB 3WSQL 5DJ0A 1LWRA 5GSVA 2D4FA 4LU5L 1P4LA 1ES0A 5LAXB 5KSVA 5JIPA 3HLAA 1KSRA 1N4XL 4DCQA 6CGTA 1ZHBA 1C1EH 4DJMA 3N1MC 2J4WL 3QUZA 4LSUH 3SDXB 4XXDA 4D9RE 2EDNA 4I18A 4U0QB 1MELA 4M5ZL 3X3FH 4HGKC 3G6AB 4XNZB 1EHLL 4MNQA 4JG0L 1SJXA 3O2DL 4YH6A 1A6UH 4IRJD 2VZTA 3VFVB 5FUCE 1JNHB 3RTQB 1I8MA 5KSAA 3L3JB 4Z0BH 5FYLD 3NIFE 4ZQKB 4JZOA 2A83B 2Z91B 2F58L 3KPRD 4G8GB 1G0DA 2FL5A 2GK0B 2HJLB 1A6AB 4Q0XL 5TFSH 3GSWA 3FAXA 5A1AA 4WO4C 4HBCL 3B9EA 5MEOA 2AXFA 1CFTA 4XRCA 5F3BB 3ZKMD 3SEPA 1G6RL 1A7PL 5HPMA 1CVRA 4KAQL 4NKDA 2O93L 4KHXL 2D3VA 3CVHH 5TDPB 4FFVC 1V7ML 2A9ML 4NJAH 4X98A 3QDMD 5C0NC 3VJ6B 5JPMB 3OKNB 3LD8B 5HY9A 4OFYD 5C3LD 4PUBL 4OSUL 5C71A 5FXCH 2R39A 1Z3GH 3RNQB 1IZKA 2R1XB 2CRMA 3MBED 3QAZB 2YPVH 4HWNA 4P4RA 4NRYA 4N9OB 3PUCA 5JXEC 5J89A 3G5VB 1NC2A 1A7RH 3QUXA 3W81A 4M5YL 4OM0H 4Y19E 2RCSL 4LLDB 3O4LE 5JMOC 1WTLA 1CK0H 3H9YA 3SDAB 1PVHA 1T0MB 1U42A 3KPTA 2N7AA 4Y2DC 4OCYL 1QLRB 2IQ9H 4QHLA 5E8NB 5GZOC 2FNBA 4PJIB 3J7HA 1CGXA 3LMJH 5DO2D 1J1OH 4XAWL 4D9QD 4P5TC 3MRDB 1DDHA 1JYXA 4D0CB 5FYKL 3U2SA 3FB6B 1S5HA 3M17A 4LVNC 1BREA 3AB0B 4U1SB 3TH2T 4PRNA 4EOWL 2VDRH 3H7LA 2FX9H 2VN4A 3ZYZA 1OTSC 3NTCL 3H6JA 4TSAH 2APWA 1I9IH 3DMMA 1D5ZA 4PRIE 3PV6B 3CXHJ 2BP3A 3TO4C 3W11D 2ZPKL 5EO9B 3WNPA 3DI3B 3SDDA 1OGAD 4OLZH 2XI9A 4XPHL 2OX5A 3I75B 3BZFA 3L3HB 3BYTA 3MO1B 3TIDB 4JREB 4MXQD 1C5BH 3CLFL 1N7ML 3CU1A 4YHKL 3SJVE 2CKBB 4OLUH 4UNTA 1OARL 1SVZA 1A7OH 4GMTL 1LDPH 3DO7A 5F3HB 3QCTL 3GJFA 2NY1B 1MRCH 4LPWA 3QRGL 4K7PY 4WWKA 4UIKL 4Y5VC 4Z7WE 5D7SL 1EAPB 3HAEG 1O0VA 4BZ1H 1JRHH 5L6YL 1J88A 3VXPB 5KZCD 1F90H 3HNSL 5ALBH 3UBXB 5C0CD 1MH5A 3WNKA 1GOHA 3ZKNC 1ODAA 3TT3H 5IESH 2O61B 3DLQR 3KNBB 4E42A 4ZFFB 3IDMA 5JW4M 3K1DA 3MSPA 4OV5A 5C1MB 3D85B 1IC5L 1BHGA 2HJFA 4PG9A 4PLKC 5CIPA 5C09D 1CT8A 1LK2A 4LEOB 1NGXA 4V2CB 2P5WB 5I8EB 2M8XA 5GXBB 2M1KA 1FVEB 1URLA 5JLZB 3BP7A 2GITA 1JI1A 2HVKB 2AGJH 4K2UL 1WT5A 3PF2A 5CHNB 4XHJC 3H0TA 4OGAD 3O3UN 3DI2B 2CIKA 2B0SL 4WFHE 1D5XB 3LRHA 3W5MA 4LNRA 4OM1L 2XTJD 3LRSB 1YN6A 5TDNB 3L5XH 2KZ1B 3TT1L 1ZT1A 4MA3A 5DEGA 3ROLA 4F7TA 1U8PA 1FIGL 1Q94B 2HTLD 4WFEE 1RZGB 2AEPL 2VDKH 1UWGL 5CEZE 4C58B 2FEEI 5E94A 3MLUH 3WFCL 1T1XA 2HMID 2EC9U 4TSBL 1KFAL 5IEHB 2XY1A 1HWHB 4HF5L 3C2AL 1MI5D 2FBJL 5ISZB 3NPZB 5L88H 4RRPA 2F19H 2YSSB 2D31A 4N0YL 3BN9C 5ICYA 4HLJA 2Y6SC 2E27L 3BPNB 3OX8A 3A6OA 2HA1A 4NFDA 3V7AG 2I25N 4HFUL 4N0FA 4FQJL 2GI7A 2L7JA 4HXBH 1PLGL 2Z8WC 2DAVA 3GMRB 3C6LC 2MKLC 3TV3L 5DVNA 1VCAA 2NX5E 1CVSC 3QUZD 3L3IB 3GI9L 2VL4A 4JLRB 1IKFL 4LCWA 3P4NB 1MCOL 4CU8A 4PTTB 3TWCL 4RWYH 5EBWB 4GQPH 4MNQD 4PR5A 1H0DB 5DEFB 1I4FB 1IGCH 8FABB 5IW6B 4WI9A 3ZSSA 1T7WA 3F7RA 3SGDI 1TTUA 3E0GA 3CDFA 2E6JA 1FNHA 4ELMF 4PJ9A 1MCQA 5KSAD 4ZFGL 4MXWH 3QJHA 5D7JC 3ZHKA 4WW2F 2X09A 3BHBA 3P4LA 3QDGA 4P99A 3RX8A 2J8UB 1G6RB 2ZJSH 3JWOC 4XVJL 5EOQL 3WUWA 4HKZB 5FF6A 3RUGA 5EDXA 4L3CA 5C9JA 4UILL 2AJXL 3OAUH 3S5LG 3HC4H 1YY8A 1KG0B 5DVMA 5BS0B 3ARTA 3HRZA 4PY7A 4Y4FA 3U4BH 5IMKA 2VNCA 5DFTA 5DGQA 5D7LA 4HCRH 1E27B 3D25B 3NGBC 5L2KB 4OZIB 5SV4A 1KXQE 4KK5D 5L9DL 2PF6A 3ARGB 4H1LH 4Y88A 3ULVF 3VG9C 4CN6A 2CRIA 4QHKJ 4U1MA 1SYVB 4JQVC 3B6SB 43C9B 1FL6B 4P2QB 2ADIB 4IS6A 1NC2D 3QUXD 2ZWLT 1F3DJ 2FEDD 1KIPB 1BJ1H 1UZ6F 3EYUL 4XPAH 1BEYH 3ILQC 4V1DA 2H26A 3PWUA 2EYSA 1R5WB 2BNQE 3OPZL 1CL7H 1U36A 4KRMB 3H9SB 3I84A 4NQDA 4ZO6A 4PJHB 4ODXA 3V5HA 2KUTA 1XAUA 3P30L 3UJTH 4NSKA 4MQXD 4ZNEE 1R3IL 3SO3C 4R2GD 1T0NA 2F53B 4RMSA 3GDBA 3L6FB 3CD4A 1T89C 1BJ8A 2A0LC 2J6EH 3D39A 1CR9L 5KOMC 3DMMD 1QP1A 3EOTL 1GOFA 1UWXK 4BK5A 3SDDD 3CVHA 4K94L 4WGWB 4DGVH 4I0PC 5FGCB 3LSOA 4MMZC 4NO3B 5F7DB 1U8LA 4WW2C 1YPZB 4YFDB 1PYWA 2PKDA 4XMLH 1KB9J 2DDQH 5GGVY 3UTTB 5D2LA 2UWEA 3VE0A 5GHWH 4QRQA 5T1LA 3WS3B 4OFVA 3HS0B 1HIMH 2H1PL 2ZUXA 1YMHA 2I27N 3L7EB 1AGFA 5F1IA 3CLEL 3OTTA 4U49A 1J12A 3VGAB 1QFUL 5DJDA 5CD5D 4PJFA 4NWUL 4PD4J 4WWKD 3U7WL 2A38A 3S36L 4TUKL 1FYTA 5FUOH 4MDJA 4OZFG 1LEGB 1K4CB 1AXTH 4GRLB 1ZAGA 5DFWH 1UXSB 4IHOA 4G9FA 3ULVC 1A3RH 2FATL 2WINB 4XP1L 3U79A 1JMZA 2NZ9C 1JUFA 1OAXH 4S1SL 4XMPH 4WI5A 5F6IB 4IOFD 5D96C 3L5WA 5LCVL 5IFJB 4DOHB 4JFEE 5HHMB 3RI5K 1KACB 4WCYH 3U0WL 2CSPA 2HT2C 5TPWH 2UZXB 3QWOB 2NXZC 1U8NA 1NBVL 2NXYB 5MEQB 2EO9A 2Q20A 1KCUH 5HHQA 2LABA 3B9KC 3T0VA 3TZVB 2LFGA 5H35A 4N1HB 1NMCC 3O8XC 4ONOA 4FZEH 3ZKXC 1KCKA 1MUJA 1AXIB 1E0OB 1F6LL 1QTYT 2DWDB <