5ITBH

Crystal structure of the anti-rsv f fab 14n4
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
220
structure length
220
Chain Sequence
VESGGGLIQPGGSLRLSCAVSGFTVSSKYMTWVRQAPGKGLEWVSVIYGGGSTYYADSVVGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCASRLGVRATTGDLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords anti-RSV F Fab 14N4 Heavy chain
publication title Structural basis for nonneutralizing antibody competition at antigenic site II of the respiratory syncytial virus fusion protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2016-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5itbH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5itbH01
3VFMB 4GXUM 5MI0B 1KTKE 4EXPX 5CEZD 5CSGA 3S96B 1WIUA 2PF6A 3MODL 5ALCL 3P4MB 1MCFA 2ICEB 4QWWC 5IG7B 3BPLB 4Y4FC 1U3ZA 3FZUC 1U92B 3H3PL 2VH5L 4P5TA 1P84K 3C5SB 1RZKL 4K7PH 1H0DB 1T04A 3DVNB 4QHNA 1AQDB 3BE1L 2GQHA 3ARRA 2H41A 1I7RB 1QBLH 3DWTA 4LPVA 3PHQB 1Q0XH 3C5ZD 2HJFB 1A7NL 3S7GA 4F7EB 3W39B 4QHMA 5FYJH 2CRZA 3KLAB 1C5CL 3FONB 4CDGC 2DICA 4E5XB 5FYKE 1A21A 4ZTPH 1KIPA 4R2GD 2V2XB 4HHAA 2ARJA 3MRMB 5D7JB 3RPIB 1MUJA 4LGRB 5LCVH 5ICYB 2MHAA 3CAFA 4X0KA 2WQ8A 1J1XL 3AM8C 2OP4H 4EI6A 4X6FB 3MRLB 2V2WA 3U83A 4HWUA 1WICA 5D7KE 2VLME 4L8BB 1WZMA 4DOHE 3IKKA 1BOGB 1YEEH 4C56D 3FT2A 3OHXB 3TBSA 3TN0D 3NIDE 3CFJA 3WNNA 3BHBB 1H3VA 2W65A 5BVJB 2IQAA 3WIIL 3MREA 5AZEL 4XAKE 4AQ1B 1OPGH 2IPKB 2DQIH 3U9PL 3QFJB 4JFYB 2JCCB 2Q86B 1T7WA 4NBYB 5IV2A 1NGQH 5C0GB 4O2FB 5GRWA 5HVHB 3QRGH 1NCUA 3JTSB 2ERJB 2VLRE 1OD7A 3FOMB 5DHVH 4PJFB 1CS6A 5TQ0L 1QKZH 1PZ5B 4KQ3H 3WNLA 4UQ2A 1EFXA 2K7PA 5J3HD 5IKCA 3SOBL 2VXQH 5IHUL 3ROLA 1BQLL 4BELD 1WC7B 3DXAA 5FOJA 3OKYA 3RBGA 4UT6H 3O2DA 4AENB 4FZ8L 3JVGC 3PWLA 1QQDB 4JPKL 2WBJD 5JW4M 1CFVL 5JORB 1NMCC 1V8HA 4RSVA 5EOCH 1ACYL 3OKOA 4R90L 1CLZH 4XX1E 1SMAA 4O00A 5HDBE 3BZFA 3UZQA 4DZBB 4UTAH 3GB7A 2B1HH 5TH2A 3HPLB 3MUHL 5JDSB 4RWYH 2CLZA 4YHYB 3ARXA 4HKJB 2IH1A 4FMFA 1MIEL 4HDIA 4F9LC 5EB9A 1JGLH 2D0FA 4R96B 2DL9A 1FFNA 3KYAA 1VKXA 1II4E 4ZTOL 2W0FB 4MNGB 1A9EA 3UJTL 3SCMA 2DQEL 1QFWM 5DRZB 3RIFF 1JP5A 2FB4H 3BZEA 4URTB 5D1ZC 4MA3A 4PGEA 4LQFL 4OT1H 1FL5B 3WUWG 3VXPB 3RAJL 3CSPA 2FNBA 2CRMA 3T3PF 4WO4B 5K59E 2G75A 4F7PB 3TO4C 2YZ8A 4MA8L 3VWJB 1P7KA 2Y07H 4YHLH 1LVEA 2P8PB 4JHWL 5MEPA 1I1CA 2QJDA 5IM7A 1Q1JL 1ZLSH 5KVGL 3LS5H 4OGZA 1VERA 5E00B 2AK4D 2HMIC 4ODVL 5JW4R 3PGDA 1N5YH 4NGHL 4JM2F 1C08B 4XPFH 5EPMA 4L8SA 3MA7B 3RDTD 3PG2A 5E99L 2J8UA 3GK8H 2V5SA 3HR5A 5I1CH 1C12B 1HQRA 4YHMH 4N8VG 1D5BB 4EI5C 5IVXA 3TGXA 5JMOC 4TRPL 1YY8B 3WIFB 2FECI 4OLWL 3WIHH 4PJHF 4AIOA 3OGCB 5TFSL 4M8VA 4XBGA 5HI4C 5GZNC 5DFVC 1AD0A 3HRZB 1OL0A 2VDMH 4DKAA 1RZIA 2BSED 2R9HD 4NO2A 1CTNA 4AIXA 4JFXB 1KPRB 1G1YA 1LEGA 4G6FD 1BP3B 1NAML 3FQUB 4QNPF 3TBTA 4E9LA 3NCJH 3LH2H 1EHXA 2Q6WA 4LCCB 4LAQH 2VLKB 4O2EA 3U30B 4HKBA 5E6IA 2HVKB 3SDCD 1CFSA 5DJYA 5T1DH 4IBLT 2JE8A 3ECBA 4RFNC 5C0BA 5FGCE 2WIIB 2X4NA 2DQTL 2HTKD 4G5ZH 3KNBA 5E5RB 3S3SA 1W0VA 4POZD 3ZTNL 2IGFH 3MNZA 3CCHB 1MREH 1HINH 2NZ9D 1RZFH 3WKMH 1AH1A 2BVYA 1EEZA 3RP1A 1EJOL 2EH7L 3CSBA 4J4PD 3IJHB 3QQ4A 3RWHB 5A2FA 1Y0LA 3G5VA 5ALCH 3SKJH 1YYLH 1P6AB 4RNRA 4ZS7L 5D1QB 5HPMA 3NPSB 4YDKL 4HSQA 3H3PH 5I66B 4M48L 5EU5B 1RZKH 4D0BB 5JW4Q 3QIUA 4QRUB 1D9KA 3RDTA 3BE1H 1MJJA 3VFGH 4NCDA 3HPJB 4PGCA 4QXTA 1B2WL 4JREC 4U33A 2F53A 3ULVH 1A7NH 4XNMB 5I74B 1NUFA 4PR5A 3VGFA 1A6WH 1QSFD 5D8JL 3VXMD 2NY6D 1K8IB 1JPFA 3HRPA 4L8DB 4HLZH 4OLXL 3MJ6A 3CK0L 1YMMD 1FFOA 1U8KB 1F42A 5K9JL 4CN6A 4KZEL 4MAYD 1WCBA 4QHLB 3WUZA 3ZYZA 5SWQB 1JBJA 2EE6A 2F54A 1YDPB 4JG0H 1MLCA 5J0BA 5F70A 5I19H 3JTTB 5C0EA 4PJAE 4D9RE 3MCLH 5AZEH 1TMCB 4YE4L 3HAEA 4F57H 4Q9RL 5HGGS 3MZTA 4ZUVA 1JV5B 2PTVA 1KEGL 3FAWA 3PWPD 4PJDF 4U7SA 3D39B 5DC0A 2PO6B 2NW3A 5GZOC 5D9SB 5C07E 2R2BA 1NMBL 3EGSA 2CUIA 5GHWH 1YECL 5DJCB 3H9ZA 5TQ0H 4HIEB 1CGYA 4N90D 3SY0A 1TVHA 2VQ1A 5DD0H 5IHUH 5GXBB 1UG9A 4N1HB 1AQKL 4JPWL 4F7TA 5IFJB 1ZA3B 3SBWC 3G5YA 1XGUA 2EDWA 3QUXB 3A6BH 4KK5D 2HLAB 4IMLB 2JJSA 1PFCA 4UZGA 2Q7YA 2AP2A 5KVDH 4OQTL 3PWNB 4U6YA 4APQA 1EDQA 3HI6H 4R90H 4W4NA 2A9ML 1ZE3C 3TWCL 1KN4L 1WIPA 2X4UB 5JOFA 4ZXBC 4KKBC 2NX5E 1FV1A 2MQCA 5D5MB 2YD6A 1OTUC 4JAMA 1OB1B 4NQCE 1JNJA 1S7RB 1AY1L 3WLBB 5I30H 1CDHA 4JFDB 4MAYA 5C3LD 5ERWA 1KLFA 3SDAD 1XF2A 4WHCA 1AGCB 2YRPA 3QJFB 4W70A 3QWOB 3HMXL 2R2HA 2BVOA 3FN0H 4U6HB 2O5ZH 3MRGA 3CFCH 4LQFH 5FA3A 3VMPA 5JMRA 5FCUL 2A9NH 1YN7B 3GIVB 3WJJC 1AR1D 2DKMA 2EEDA 4L29A 5E2WH 3VD9A 5LAXA 3BQUA 2QHRL 4ZYKA 1P7HL 5KZCD 3FO1B 4X8XA 1QD0A 5EO9A 5ADOL 4PP2A 5I16B 2RQ8A 2DLGA 3PWPA 2XKSA 3O3AA 2KBGA 1OF2A 1OGAB 3EDEA 5K9KB 4FFZL 2EIZA 1Q1JH 2XIDA 3ORJA 4N9GA 2EYSB 4CW1A 3QULA 3DHMA 4Y5VA 3BPNC 1N59B 3VWKC 3MRBA 5J9PB 1KCUH 5E99H 3QXVA 2G60H 2BSTA 1IGTB 1IGJA 1EEUA 4D0CB 1BJ8A 1FPTH 1KXTB 4F15B 4MQ7A 4CUCA 5F7NC 4H25B 2Z31D 5DVMA 2ENYA 1TLKA 4GUPA 3T77A 4FQXC 5B38G 5EU6A 5FHBH 1A5FH 4ZNEE 4HMDA 3LV3A 5I6XB 1YA5A 3ELAT 3L3DB 3ARDD 5E70A 2X70A 4ONGL 1I8IB 3N1PC 1X7QB 2VXSL 3S88H 1FJ1B 2HP4A 4KV5E 4OM1L 4ZFZB 3B5HA 1T1ZA 1KJVA 1NAMH 1P5VA 4QOKB 2Q3ZA 4FP8L 3NZ8A 3GSWA 4NRYB 2H2PC 3PXJA 1M6OB 2P5WD 1XF1A 5C8JA 2FYYA 2MPAH 3WD5L 1O0VA 1NGXA 5KTEL 2P42B 3MUGA 4I2XB 3U36B 3BDBA 3Q1SL 2Y9RT 1U8HB 4XP6L 4AIZA 4NQVB 1MI5D 3ZTNH 5DD1L 3BJLA 3REWA 3H7BA 3RU8L 4H5SB 2J5LC 1WAAE 3P73A 3LQAL 1I8MB 1EJOH 3L3JA 1IC4L 1J5OH 1K8DB 4M3KB 1AI1L 4JFED 2V7HA 5DF0A 1AKJD 4X5WA 5E8OB 4MZ3A 4ELMB 4YDKH 4YPJA 4K94H 5IMMB 3U0TA 3X3FH 4KUCD 3RJQB 3VI3F 4HXBH 1T21B 3MBED 3TH3T 5CGYD 2Z91B 4HIHB 3IS1X 4OD2B 2VITA 2W60B 3GGWA 2CJUL 5I2IB 3K4ZA 2V9RA 4F2MB 2HJKB 3D48R 3THMH 4NJAL 4XBPA 5HY9A 5A2KH 2YKLL 3TVMC 4K7PY 1E4JA 3D3VD 5F7LB 3DX9A 4Z18A 2JIXB 3BEWA 3QO0A 3IGAB 5ALBH 5C9JA 5SV3A 5B39B 5BRZB 3IXAB 4L3EB 1XH3A 4F58H 4M02A 1ZOXA 1JNHB 3L5WB 4K8RL 5C0AD 4KZEH 2QEJA 4EEEA 1U8MA 3B3IA 4BQBA 1VEMA 3QIBB 1OSZB 4A2LA 3OKMB 2A6IB 3P77B 3OL2A 1XT5A 4JZJB 3QCUL 4JVUA 4V2CB 5HYJA 5LXGH 2BFVL 2YA2A 5E08L 4RMVA 2E5EA 2C9AA 3ZDYF 3PDOB 5FKAB 5ESQB 4Q9RH 1XR8B 1IQDB 4UNVA 1I1AC 3VXTA 4HAFA 1KEGH 4LHUD 5T1MA 4GSDL 4BH7B 4L4TD 4ODXA 2A38A 3P0VL 2X4RB 1P1ZA 4F9PA 1RPQA 2DQUH 5KS9F 3WL9B 3FHAA 4XHJD 5HHPA 4ZAKC 2QADD 3ZDZE 5DQDL 3O2WL 1WBXB 3TJHC 1QLRB 5T33L 3CXDH 2ZP0T 3MBEA 5JIPA 4YHOH 4GG8B 2MCG1 1TVBB 4PPTA 5AAWA 4MCZA 2D7NA 5ITFA 1I9EA 4MGXA 2X9WA 5FUZH 5HGDA 4RAVB 4OV6F 2COQA 5T3ZD 1JRHL 1IM9B 5CD3B 5IOPB 3SE3A 4OSUH 4ZFOA 3CFEA 1JGDB 3P9LB 4HV8A 1S9KC 2UWEE 5FV1L 1JWUA 1AY1H 1URLA 3LKRB 3QUYD 2DMKA 1KFAH 3UPRA 4YIQA 2Y5EA 1TITA 3VXOB 4DGVH 2AW2A 1YEKH 5KN5B 2I9TB 1G7LA 5I8EA 2FIKA 3RNKA 1HZHL 5FCUH 5CD5D 4PLOB 2A1WL 1IGCL 3O2VH 1TCRB 4F3FA 1I1YB 4YH6A 2XFXA 1OAYL 4LVNC 5DI8B 4LHUA 4X80L 3ULUH 2PYEE 4OUUB 4YX2L 2R2CA 3BOVA 3UYPA 4AEHL 3KPNA 3F6IA 2IAND 5DS8A 5DZNA 3HZKA 1FE8H 3OAZK 4P2OA 5CJ5A 3QQ9C 3C2SA 3AXLA 5I17A 1VFAB 5K9QG 4CDHA 2IAMD 5DEZA 4UILH 2E6PA 3OJMB 3IDNB 4L4VD 1P4IH 2BRQA 1CQYA 3WNMA 4ODWA 3QDJD 4OGXH 4HG4J 5T1KB 1LE9B 1OP3K 4GRLB 1F4WL 4FTVD 5I76B 2GJ6A 5CP7B 1A1MA 2CLRA 4QO1A 1Q0YL 1AXTL 3O4LB 4U1JB 4ONGH 1RVFL 4HGKC 4O02L 1T22A 3VRJA 4RGND 5EBWA 5GGRA 3WE6B 4OI7A 4KJYB 3E3QE 3CDGB 3QDGE 3UCRA 3ARBA 3L3GB 5E8EA 3WDIA 3CNKA 4CL7A 2W0KA 2OR7A 1QA9A 2J88H 3RGVC 5IIEB 1SJHB 5H35A 5KTEH 1LO0H 2FHCA 2BXYA 2EC8A 4L5FH 4QY8B 3B6SB 1KIRB 3MZGB 3Q1SH 1G6RB 1OGTB 3GMPB 5L0QC 4EDXA 3B9KD 3T0EB 1BQHB 2DS4A 5JDJA 4E0RB 5AD0B 4PRAA 3LQAH 3TIEA 3HZYA 2ADFL 3VG0L 1N64L 1G6VK 3H3KA 2VLJA 5F3BB 3IETB 4OZHA 5L8KB 3AB0B 4TOYH 3B5TA 5JA8B 3NBNA 2PN5A 4PJ7A 1OLLA 2AKRA 3U7WL 3UTZA 2IAMA 1RK0A 2CJUH 2EXYD 5DMKB 5DUMH 1MF2L 5MEQA 2A77L 1EHNA 2YWZA 4NKOB 4NJAH 5T1LA 4M6OL 4ZS6C 2YKLH 4AT6B 1MJ8H 2YXMA 3G08A 3UTSD 5EC1B 3R8QA 5A3IC 5CEXB 1CF8L 2HFEA 2OL3A 3DVIA 5DO2C 2GFBB 3WSQL 1QFWL 1U8JA 2EDFA 5EO1B 1I3GL 5E24E 1B0GA 4WI5A 1KN2L 1C16A 4U49A 3V5KB 4Q2ZA 4Z95H 4K8RH 3EHBC 3SGKC 4FZEH 5J7CC 4RIRA 5FYJD 3OAUL 1QPPA 2EDKA 1SM3L 4ODTH 3CVIH 2C1PB 4KRLB 2V9QA 1LEIB 1AGBB 3C5ZB 1X5AA 2HFFB 4G3YL 3LMJL 1FGVL 1T2QL 4YR6B 3QCUH 4X6EB 4GRWB 4FQPA 2BFVH 4BFEA 4M7LL 3V5DB 4EVNA 5F9OL 4FRWA 5DK0A 4Y4KD 4X6DE 1INEL 1IGIH 4OD3L 4R2GB 3TZVD 1UB5A 4PJ9A 1OSPL 35C8L 4PRHA 1CFBA 4GSDH 2NMSA 1GJIA 4KMQA 4OLVL 5F44A 5CSZA 3P0VH 3DO7B 1P5UA 1A1NB 5JTWA 5EU3B 2EDJA 5EFIB 1YPZA 5K9OB 2XKNA 3HE7C 3ARQA 2JJTA 4C56B 3PL6C 3NN8A 3TN0B 1E4WL 2D31A 2AV1A 4TUOA 4ETQA 5C70A 1B3JA 5IEKB 5A2JH 4I48A 5IB1B 1MCCA 3MRPA 4ZD3L 3K1DA 4AG4L 4G6KL 1K5NB 4BSWA 3DVFA 1WZ1H 1LO3H 5GRYA 4GRMA 2L0DA 4XPBH 1Q9OB 25C8H 2QSCH 1JGEB 1G0DA 2C3HA 5I1KH 5HDLA 1JRHH 1BLNA 5IQ7L 4C4KO 3F7YA 4FFVC 4HXAH 3FQXA 3V6OA 3T04D 4QGTA 1F58H 1S8DB 4F33A 4DVBA 1FZOA 3UDWA 3LKOB 3L3KB 4WI9A 2VKXA 2OSLA 3D69A 4YXHL 2PUQT 3OKNB 2XNAB 3CMGA 4IOIB 3BVNB 5DWUH 1ZHKB 5T5NF 5EBLA 3U0WL 5DD3H 1F5WA 3RX7A 3D2UD 2I07B 4NT6A 1K4CB 4Z7VA 3JV4B 3DVGA 4XMPL 4WDIA 2R4RH 1UXSB 3AREC 2WBJB 3PWVA 5KSAA 3SJVA 1SJEB 1SYSA 4YXKH 5IHZA 4JQVA 1HZHH 3O3DA 5CBEB 4XCYB 4HC1H 3BISA 5KVEL 1A7PL 1IGCH 5HHOB 1CG9B 2JCCE 3WS3B 2YC1A 3EOYG 4O5LL 1GAFL 5F1NB 3VG9C 4ZDHB 1KG0B 1Z5LB 4Z76A 5JXEA 3GHBL 1DSFH 1S7UB 1DE4A 4HFWA 2VUOA 3TZVA 2O61A 4X80H 2P8MA 4W6YB 2XPGB 5I8OL 5ELIA 4IRZH 5BXFA 1U3HD 3ARFC 2GTWA 2Z4QA 3RX5A 4PJIB 4LNRB 2XTJD 5MERA 3IFLL 5F7DB 1A4KB 3VXSD 5L88L 4FNLL 4MX7B 1OCWL 1CGWA 4CMHC 1LEKB 1UA6H 3PV7A 1G9MC 5I1LA 5IWLC 4LASL 4S2SA 5ID0B 5EBMA 5DHVA 1FVCA 2OM5A 1PAMA 4OF5A 1AGEA 1F8TL 2DBLL 3BUTA 3WNPA 3Q48A 3LEXA 2NY5H 4LLWB 1DCLA 1F4WH 3RWGA 4C83B 4P9HC 2AXGB 1DBBH 2AK4B 1QBMH 4O02H 1WZKA 1UWXH 2VISA 2F5BL 1A6PA 5C0IA 4HUUA 2X4OB 1NEZA 1D6VH 3TVMB 1BGXH 5E4EB 4HGMA 3NH7H 3UTTD 5TDNA 1WBYB 3D2UA 1N6UA 4Z78B 4Y1AE 4OI8A 4WI6A 3WEXA 2R1WB 3FFDA 4IM8A 2BHYA 2VR4A 3LCYA 4RQQA 1RK1B 1MRDL 4DGIH 1KC5H 1CIUA 3RKDC 2NR6C 1Z9MA 1LO2L 4QRQA 1ZXQA 1JNLL 2AEQL 3CZJA 2C3VB 2IH3B 1FC1A 1GZPA 4RGOH 5IFAH 2GIYA 1A3QA 4PRPB 1OWWA 4G6FB 2ADFH 3VG0H 4PJCA 4OBRA 1IQWL 2ITDB 1U8QB 3SPVA 3IFPB 3C8DA 4Y19A 1L9NA 3SDCB 3VXSA 2VABA 4JKWA 3WFHA 1EHLH 1FL6B 2ZUTA 4I18B 4GKSA 2A74B 1EEYB 3LEVH 1P4LA 3U1SL 3CSYB 3UTPD 2FCBA 5M7QA 1V3MA 4KVCH 2A77H 4DKFL 4J7RA 1MCPH 2P43B 4EJ1C 2C1OA 5CGMA 5CIPH 4RFOL 4LRIA 1R24A 2P5EA 5MEOB 1S9WB 5B3NA 3OPZL 1AO7D 1I3GH 2OMNA 1DVFA 4HS6B 1PG7X 2XYCA 1ZV5A 1HSAB 1G7MA 2P46B 3NIDF 4GAGH 4H8WL 4UV7L 4U1NB 1SM3H 1KV3A 2R0ZL 3NCEB 3WIHA 3LMJH 4PRNA 4G42B 4YBQC 1N7MH 2ZOLB 1FGVH 4CVXB 1R5VB 2G5RA 3E6FB 4JY5L 1HN1A 1QSFB 1ULVA 1DBJH 1NFDE 2R39A 2NY6B 4XNQA 3VXMB 4BJLA 4I4WB 1CGVA 5EIQA 5J1SC 1HYSD 2CKBB 3EOAA 1INEH 2CO7B 4BFBD 4H1LG 5J6HA 5D2LF 5GRVK 1OSPH 5E2VH 3O45A 4KDVA 1YMMB 4OLVH 5L7XH 1FYTA 4P5KB 3BP5A 3S5LG 3BFOA 3ARUA 4Z0BH 1U8PB 4HS3B 4EDWL 4Z7WA 5TF1L 5AZ2H 2HVJA 1RZJH 3TYFA 4XCEA 4N0FA 4ZFGL 3DI3B 1LE5B 3AAZB 5C08D 3G6DL 1QEWA 4R6UA 3ROOA 4DZ8A 4M7KL 5HDBF 2FX9H 4G80A 3I02B 1RJLB 1ZLWH 1NUNB 3LIZH 3QG7L 3M17B 5EO0B 3V0WH 3QIWD 5GS1C 2O5YH 1KJ2B 4WV1C 3GSQB 5D2NC 2LAGB 2X41A 5IQ7H 4P23A 2J2ZA 3C5JB 1NBZB 4H26A 3RWDB 4MD4A 3KWWA 2X40A 3VXUE 2BJML 4OCWH 3L3HB 4HKXA 1RIVH 4YXHH 2MKWA 3QUMH 3D6GA 1YMHA 3H9HA 3SDYH 2HH0H 4L3CA 3V4UL 4MB5A 3EFFA 3U0WH 4LRNL 1K4DB 1UEMA 5EUKA 1EVUA 3O6FA 4Q0XL 2DM2A 3V5HA 5ANME 4R4BA 1RZ7L 5TE7H 5J06A 5BS0B 3S4SA 2LU7A 2YK1L 1VGKB 5IUSA 1PEZA 5GRJL 5E9DA 5C2UB 4LEOA 2R4SL 1GAFH 3HN3A 5DMIL 3GHBH 4TSCL 2KH2B 1CLYL 4JO2H 1G7JB 3CJJA 3RWCA 5FIEA 4FXKB 5FYLE 3LRGA 3NFPA 3SDAB 1J1PL 3GMMA 1GGUA 1HXMB 4LHJB 3KPPB 1NBVH 3QI9D 5D4QA 3FQNA 7FABL 5SWZB 1RJYB 1E28A 3HLAA 1S7TA 4YHKH 2VLLA 5AWNH 4MA7L 1WTGT 2ZSVB 4I3RH 4X99A 2VDQH 3P4NB 1MJUH 1KBGH 4RMTA 2AEIT 4QTIH 5JLZA 3RWIA 2AV7A 5DRNA 3IDJB 3H9SE 3QIWA 3RWJA 1E27B 1JGUL 3O3BB 4X83A 5INCA 4Y88A 5FYJU 3LDBB 1Z2KA 3LN5B 5DJ6B 2ADIB 1KNOA 1ONQA 5J8OA 3GJFB 4XH2B 1DDHA 1GGBH 1MWAB 4P2QD 4JFFE 3F58L 3ESUF 5B8CA 3SDDA 5GSVA 2ZPKH 1TZGL 3VFPA 3D25B 2PXYC 1F00I 2HJLA 5T3XH 5HHME 5F93C 1V7MH 2XI9A 1FNEB 4TNWK 2Z31B 1DLFH 4HJGB 3NFNA 4LLYA 1MRDH 2UVEA 5IK3B 2EO9A 3ME0A 1RJZB 3C9NB 5D2NE 1I9IL 3BKJH 5D96B 1BQHG 3ARDB 5F9WC 1T5WB 3QEGL 1M05B 5GRVL 3QCVL 5JHLL 1BEYH 1I7UB 2JELL 4U6XB 4H20H 4WHTB 1S5IL 3DETD 1MVFA 2P5WB 3FB8B 1I3UA 5SWSB 1OAZH 4TUJA 1QNZH 2BY3A 3MLUL 4IMKC 4RX4A 4JLRB 4GLRH 4U4BA 5DQJA 2AJSH 1T20B 4OAWA 1CL7L 1ZT4B 3M07A 5GS0C 1T5XB 3MGOB 3U1SH 4DTGL 4NO0A 4LCUB 1MI5B 1YQ2A 5C09A 4DKFH 5F89A 2IBZX 4JVWA 1UM6L 1QFOA 4LPYA 1E0OB 1YYMH 2DLTA 4P46A 5EN2A 4BKLB 4YNYB 3TBYB 2YD5A 1JGVL 5ICZB 4JFEB 3SDXE 1AKJB 2YD9A 4TPRL 1TNNA 2D7TL 4PRID 3OPZH 2BC4A 5FO8A 3C87A 4D8PB 4GAYB 4R0LA 4P2QA 1A2YA 4Y4HD 5BMFL 3RTQD 2Y5TB 4NQDD 4V1DD 2O26U 4FQ1L 5DR5H 4FQHA 5DK2B 1XGTA 4WWID 5HGAA 1S78D 3OJDA 3LB6C 4XP4L 3D3VB 1M7IB 2A73A 1EO7A 5GS3A 5GISL 4HUXA 4OCMC 2FLRT 4KJQC 3REVB 5MENE 1NAMA 4TUKL 2X4TA 1VCAA 1UACH 2QSVA 3VGGA 4PY7A 1UKSA 4JRXD 1IEHA 1J8HB 1EBAA 5GIRA 3DGGB 5HJ3B 1JYXA 3EO0A 1FP5A 3GSUB 3QNZA 1JPGA 2W91A 5C0AB 1MCLA 3RX8A 4JGJA 4NM4L 4RA3A 4U31A 2OMBA 4JANB 3EO9H 5TDPB 1BMGA 2K9UA 4ZFGH 5CGTA 4J6RH 3G6DH 5FM4A 4Z6AT 5BJTB 2QQQA 3QXAA 1PLGH 2CLVA 4OJFL 5EIVA 3RNQA 1MCRA 4YUEL 3PF2A 4QRTB 4WW1B 3DYOA 1IEBB 3OB0H 5ISZA 1L7TH 4L4TB 1AD9A 4ZFFA 2JB6A 4M1DH 8FABA 3HS0B 1GGTA 4WU7A 2IFFL 1IC5L 1XGQB 1MPAH 3G5XA 2A83A 3LKQB 1P7QD 1P9MA 2QADB 2RCSL 3FN9A 4MJ5B 5DA4A 3VGDA 1QRND 1ZEAH 1PEWA 2I26N 1TXKA 1Y6KR 3WLWC 2OTWA 3F5WA 1GC1C 1UWGL 3L7EB 3QUZA 5C0FA 1OD9A 5CJOL 5IGXL 4QXUL 3GSXB 1YNLH 1RZ7H 4PREA 2GK2A 4KXZH 2NLJB 4TSBL 4WWKD 3MRRA 3MRHB 4HBCH 4GQPH 3SO3C 3MRJB 4OKVB 2R4SH 1KIUA 2APTA 2NY2D 1EAJA 4QXWA 1MJ7L 3QXWA 1ORSB 3N1MC 4K7FB 1TJGL 4LEXL 4P5TC 3MBXL 3VGAB 4NIKB 4JQIH 4PJ5B 3QUYB 1LMKA 4X7CC 4WUUD 3KHOA 4XPTH 3BYTA 1CCZA 1J1PH 5IMKA 4NQED 3TO2B 4MS8C 3S3JA 3P0YL 3I75B 5E8DL 1NCWL 1FGNH 3RVXC 5GGUA 4R3SA 3ZO0A 2W0PA 5JQ6L 4OCSL 5J11C 1MAML 2DM3A 4NKMA 4GW5B 4P49A 4WFGD 4J3XA 2X09A 4HWBA 3TBVB 1KPUA 2OXHA 5KVFH 5GQBA 3WHXA 5IFHL 1S7SB 1XCTB 3FO0H 4YDVA 1JGUH 2HTLC 2IBBA 1I4FB 2FX8H 4TNVK 1HHIB 5I1HL 2AK1H 2IANB 5E8NB 1JRHI 4LCWA 2VERN 2QTEA 4PGBB 2ZSWA 4S1DD 2DM4A 1T6WA 1TZGH 1U8LA 3CUPB 2D2OA 4C54A 3PIQA 2YSSB 1I3RA 2B4CC 5LBSH 3LS4L 4L4VB 3ARGD 1FVEA 4XCFH 2J8OA 3QDJB 4WFED 4XCCH 3RUGE 1U95B 5CSBA 1WAAF 3KJ4C 1GXEA 4UQ3A 2Q3AA 4FTVB 2DJ4A 3G6JA 3QEGH 2PYFA 3OAYH 1ED3B 3B43A 3QCVH 4RGNB 3LRSB 4NNPL 3E2HB 1F90L 1S5IH 1JZ5A 4KRPD 3GM0A 1AXSA 1D5XB 2DQGH 4LLUA 2NY4C 3GI9H 3MLUH 1WF5A 4KHXH 1FDLH 4JG1H 3JZ7A 2XQYK 2XZQH 2EYRA 1CL7H 3HUJA 3W81A 3GM8A 4DGYH 2P24B 4N0UE 3ZYOA 4OCRH 3VDBA 5KBNC 4M43L 3QXTA 1LDPL 3B9KB 5IVZB 3BUYA 2NTSP 2FJFB 3LQZB 4XC1H 3L95B 5DHYB 1JHKL 1TJHH 4JR9L 4D9QE 3N85H 2EDLA 5FHAH 1JYNA 3EOBA 4UI2A 3K4DA 4TPRH 4UTBL 2DRUA 2G9HB 5DUPH 4E41D 4AY0A 3STLA 3SCMC 3IJYB 2ICWI 1KLGB 2QV2A 2ICWJ 1CFNA 1OQXA 1QSED 4GG6A 2YN5A 1A8JH 4DQOL 5ESAB 1TQBC 1A1OA 4WI8A 4KK8D 5KSBB 2H32B 5TPWL 3V4VH 3PP3H 1U8OA 2C26A 2R23A 1D6EA 4JFHD 3BKCL 1O7SA 2AJ3B 3UTSB 4X4XB 3IAPA 3MO1B 2EDRA 1EO8H 3DBXA 4Q74A 1IGYB 4JN1H 4TUKH 3U2SA 5I18L 3WFZA 4HH9A 3BWUC 5IB3A 3W0WA 3N9GL 4HJ0C 3FT3B 4KI5C 4KY1L 3ZDZF 1BBDL 2BOCB 5D7LA 3SQOL 3VE0B 5JHDD 2Z92A 4NWTH 4L8SC 4G8GD 1DLHB 1H5BA 4G43B 5C0ND 5GS2H 2WWKO 4M6NL 2VXVL 4JM4L 4AEFA 1OT1A 3HB3C 2XN9A 5DQ9A 4KQ4L 4YHIA 5ENWA 1QVOB 4NOBA 2GAZA 4GBXA 2WMPA 3R06A 1T7YA 1H3PL 5F1IA 3CLEL 4Y4KB 2P49B 4WJ5A 2CDEB 2FHBA 3GNMH 2F5AL 1DTUA 1IFHL 1I8KA 4NKIL 5DC9B 2ADGB 3HG1D 4JJ5B 4X6CA 1XF5A 3QWRD 2UWEF 4JM2D 1WBZA 3DRTB 3O9WD 1JZ3A 1NLBL 2VE6A 5DEGB 3UROR 3GIZH 5E6IC 2V2TA 1RUMH 4LCYB 1T0NA 3DXAE 2IC2A 3EZJB 3RL2A 4YDJA 3FFCA 1QSEA 1RUPL 5A1AA 4PLKD 5H94A 1X5ZA 5CMAB 3BDYL 4KZDH 1ZSDA 4AK1A 1REIA 2VZUA 3WHE0 1E4XL 3U4BH 5IGXH 2FO4B 1BM3L 4TSBH 5CJBA 1T66C 3QDMA 1M7DA 3IXTA 4NNYA 3NA9L 4NO3A 4PTUA 1AHWA 3P9WB 4P4KA 4Y2DA 1ZT7B 4HULB 5LGHH 15C8L 2ESVA 1MJ7H 4AL8L 3R0MA 2FL5B 4X8JA 1EIBA 1AC0A 2G2RB 3K2UH 4ZSOB 3BPOC 3QEUA 1NUDA 5JHDA 2BVPA 3QIUC 5JNYA 4QYOB 1UJ3A 1D9KC 3ARSA 1MQKL 5HI5D 3RIAF 4HCRH 1JYVA 3K2MC 5GGSY 4XWGL 1R3KA 3MNVA 5JQ6H 1UWXK 1X5XA 4TTDD 1H8OA 3T3MF 2EDOA 5FOBA 5BV7C 1QR1A 1AGFB 5BW7A 1ODAA 2XZAH 5HVGB 1R3LB 3A0OA 4OLUH 3HCVA 3IDMA 3AROA 3I3BA 4RRPG 3L1OH 2XOTA 3R1GH 1U3HB 2P7TA 3MV9A 2DDQL 3UJIL 4DAGH 1YNTA 2BNUB 1ZKAA 4KI5E 1NCDL 2H1PL 3LD8C 1FFQA 4YGVA 3UTQA 1YC7A 2GSIA 4XCNB 2C7UB 2LU4A 3HI1A 3VW3L 5DLMH 2HYMA 2ZUUA 1M71B 1OTSC 5IVXE 4JCLA 4OLZL 4J2XA 3BEVB 2HG5B 1H15A 1MHPL 1X5KA 3AVEA 3SE4A 2F19L 5I8CA 2VOTA 4O4YL 4POZC 4X7TB 3DROA 1BOYA 4ZOCA 3TA3A 4MCYA 4R7DA 4BH8B 1MHHB 1EUTA 5HYEA 4DKEL 4EUPG 3BXNB 1UVQA 1I9RH 2IJ0C 3HC0A 5F88B 4NNPH 2XY2A 4Y5YB 4ORZC 3JWDH 4LSRH 4NQCA 4YPGB 4IDJL 1DEEA 3B2UD 3D9AH 3VFRA 4HC1A 4PG9A 3UTTB 3KG5A 1JK8B 2JJSC 3CVHB 1J0YA 5C0BE 2IADA 2DQDL 4HWZA 3SE8L 5D1XA 1UZ8A 3ILQD 4J1UA 2LTQB 4APQC 5CJXA 3O6KH 2A2QT 1J7VR 4MYWB 3NAAL 4G6ML 1DL7L 1NMAL 3QUKA 1JZ7A 1ZHBA 5HI3D 3V4PL 3MLRL 3O41A 5IJVB 4RFEA 3GO1L 5JZ7D 4OZIA 4GFTB 1JF1A 4HPYL 1DBKL 3R4DA 5ESVA 2D03L 2XWBA 3MV8A 4I5BB 3EO1A 4PV9B 1S5HB 5IW1B 4N5ED 4NWUL 3E8UH 2MQ0A 2ITCA 5L2JB 5EU4A 3BP6B 2FZ3A 1DQDH 4QRPA 4LLVB 3T09A 2O93L 4PGJA 1FFRA 1E6OL 2CMRL 1J10A 1TZHB 5DJXA 1GGIH 1PQZB 4F37K 2M26A 5DMGC 2ZCHL 2F53E 2GITB 5F3HA 3MLZL 5IEHA 3BQUC 3LZFL 4NUJB 3NTCL 2ICWA 5TPWH 2ZJSH 4X6DF 1IGFH 3L5XL 4LIQE 4MJIA 1W0WA 4UMGA 1TQCC 1NGZB 3CFBA 4LHQB 1MCNA 1NGYB 1IZKA 4OM0H 4YQXL 5I18H 2JJWA 4Y5VC 3STZA 1AO7B 2CUMA 4NBXB 3N9GH 5D7IA 2NY3D 2F54E 1HSBA 4DVRL 4CVUA 5E7FA 1YY9D 4Q58C 4PJ8D 5FECB 4LU5L 2X10A 5D93C 4P4RA 4OZGB 4JM4H 4UAOB 4X7FC 3WUWA 2W9DL 1GOGA 2X4PB 3K3QA 4S1QH 4NFBA 4HIJA 3JBG7 4O9HH 4GLRI 4Z5RB 2VC2H 3CLFL 3FT4B 3P4OA 2H26A 3EJJX 2EEBA 3ZE0E 4LHUG 4ALAL 1W72L 4D0DA 1L0QA 1MCKA 2X05A 4WY7H 1VENA 2F5AH 1IFHH 1ITBB 2EH8L 1UH2A 1ZA6B 5C7XH 1IJ9A 4Q6IA 1AFVL 5DURB 1ZMYA 3P9MB 5F8QC 4FA8A 3I6LE 3PABB 3S9DB 1NBQA 5A40E 3KYNA 1AXIB 4UIMB 2NY7H 5C08B 3PQYB 5DUBA 3WO4B 1XCQB 5EA0L 4GS7B 5AYUH 4I77H 5CIPA 3KAAA 2EYTB 2XQBH 3P11H 5EUOA 4RMRA 4WI7A 4N8VA 1KPVB 2BNQD 4Z7UB 1KTRL 3WS6A 3EDKA 1BM3H 5HGHB 2AXFA 3S36X 1BD2A 4R4NC 4DK3A 5C0CB 3QEHA 5HD8C 1YMME 3K80A 1BZ7B 3C6LA 4FQCH 3HE6A 2CDGB 5HHVH 3D18A 3O3UN 3DRQB 4LLMA 3MRFA 1A6UL 1IT9L 3AS1A 5DJZB 2WINA 3RWFB 2DLFH 4DN3L 2C4XA 1GOHA 1S7WB 3O8XB 3O6ML 1KJMA 3L5JA 3QXDA 1IVLA 1MFCH 4MJ4A 4F8TA 3ALPA 5SV4A 5EWIL 1R3JA 4BZ2L 5DXWA 1FL3B 4GKNB 4KKCD 1QACA 3PWPE 1RU9L 2J4WH 3PHOB 3UJJL 2PW2A 4RMWA 1MQ8A 4M61A 4CAGA 4QCIA 4A6YL 3QNYB 3LKPA 3OR7B 1PZUB 3ILPA 3MRQA 1B4JH 3QJHB 3QZWB 2DDQH 3UJIH 3LSOB 4IRSD 1N0XH 2BNRA 2DWEB 4R97B 3V0VA 1MFEL 2IMMA 4O51A 5H2BA 5C86A 4PJEA 1GSMA 1DQQB 4G9FD 3QI9B 3QHFL 2APVA 4X5XB 1RIHL 3BN9D 1NC2A 3VW3H 3W9EB 4WW2B 4QHKI 5AEAA 1MHPH 1N4XH 5EZJA 1MHCA 2NTFA 3TNMB 4JDZB 5EU6E 4HKZB 4OD1H 3CPLB 1X5IA 4XVTH 1QFUH 2XXMB 1QHPA 4F9PC 1IAKB 3QUMA 2R0WH 4KXZI 3CFDA 5CWSB 2FSEA 3DSNA 4GW4A 1GZQA 4DKEH 1K3ZA 4LKCA 5DJDB 4M6MH 4KK6D 4MNQD 3HZVA 4JFZL 4WUKH 3M8OL 3MBEC 5T5FH 1FIGL 4MDJB 3L3IA 4YDLB 3GJEB 2BVUA 2NY0D 2W38A 2NXYC 3SE8H 1DQML 4BK4A 4JB9L 4G6MH 4AH2B 1NMAH 4NJ9L 2PTTA 5JW5B 3UC0H 2C3WA 3V4PH 3MLRH 1X5HA 1HXYB 3SE3C 1QYGH 2FJGA 4IJ3B 1DBKH 2ATPB 1TJIH 2A0LD 2D03H 3TCLB 2N7AA 4QXGL 5CJQL 1FO0L 3ARVA 5FGSA 3RKPA 4M62L 1OHQA 1S7VA 1HHKA 2B0SL 2FH6A 5DTFB 3GMNB 4LSQH 2YZ1A 1HIML 5DEFB 3RFZC 2OQJB 2QQLL 5TDOB 3RZCA 1VEOA 4K3JL 4HAGA 2A6KA 2HT2D 4G9FA 1XIWB 3DUHA 3MGTA 4P3DA 4EN3B 2N4IA 2H6PA 1MAKA 3JWOC 2ZCHH 4M3JA 2I60H 4WI2A 3QQ3B 3AMKA 3FQWA 1UCBH 3MLYH 1CDYA 3UYOD 3MCKA 4M03A 2Q6WB 1CGTA 1XF3B 3L5XH 1FSKC 2YPLD 4L9LB 5IBLD 1U91B 5GJSH 5L2KA 4JDVA 1JUFA 3KPSA 1ZHLB 3NVQA 2F8OA 2AS5M 5AUMB 1F3RB 4PRIB 2X4NB 1KYOJ 2JK5A 4P2OC 5FEBA 3VJ6B 1G6RH 4Y4HB 1OT2A 3RTQB 3OKKB 3K0WA 4NQDB 4V1DB 3N1GC 5I0DA 4CVZA 4OB5L 4K2UH 4LU5H 1S9YB 1N6QL 1LDSA 4LOUC 1RUQH 1PYWB 1PVHA 3AUVA 1PSKH 3G5VB 3VXRD 2IG2L 3D0LA 3C8KB 1I75A 4U6VH 3LEYH 2YPVL 3D0VA 3GSRA 4ONHA 3VRLE 2A6DA 3VFUA 2VIRB 4UBDC 5D70L 1CL7I 4X4YB 2NCMA 1D9KB 2WWMD 1RFDH 4ALAH 4D2NA 2DIBA 4JRXB 1MCQA 4NN7B 2GT9A 3GZKA 3LKSA 4I0PD 2HLFC 3ARBC 4YAQA 2V7NB 2X4SA 4PJBA 5J1AB 1NFIB 1JFQL 5CEZH 2V17H 5E6YA 3HNTL 3FQRB 5BV7B 3EW3B 4LMQI 2QQKH 5LG1A 4PGDA 1DUYB 5CD5C 1A4JB 3MRDB 4OV5B 4Y16D 2GEEA 3BAEH 4LKXA 4NRZB 3IRZA 3TPKA 4MJ6A 3QEQD 1EGJL 1T1YA 5GRZA 4MA1C 3IVKA 2AI0H 2FD6L 4GRWH 32C2A 3GHEL 3ZKND 2Z35A 3KPOB 3MJGX 1GRWA 1XEDA 1P7QB 1NANH 4JRYD 4NN5C 5HYQB 3OX8A 2YD7A 5I9QB 4M4PA 1HKLL 1V7NL 2RFXA 2HKHL 4I9WE 1MRCH 2X89A 1GHFL 3T0VA 4NN6C 5FKPB 1K6QL 2IAMC 4IRJA 1IEAA 4ZO6A 1MRFL 3DUUB 5BO1L 3I6GB 3KPLB 5F96L 5EWIH 2Y7QA 4ERSH 2OBGA 3HI5L 4WWKB 4M8QA 4QTHA 3OF6A 2VQ1B 3KYOA 2YMXL 4XAWH 2BY1A 1RU9H 1FZKA 2NY2B 1L9MA 4G7YH 3KJ6H 3C6SB 1JF5A 5E94A 5ACZA 3IDGA 3C60D 4NO5A 4G9DB 4NP4L 4HX1A 3VFMA 4S1SL 3KXFD 1MAJA 3S96A 4U1GB 1XZ0B 2XA8H 5TE6L 3P4MA 4LCIH 2ICEA 3H0TB 4YHPB 4WUUB 5FK9B 5IG7A 1WT5A 2EIDA 1ZVSB 2BY0A 1KACB 3DX6B 1JI2A 1U92A 3MV7B 4NQEB 1JPTH 2AGJL 3C5SA 1G7QB 4LBEB 1IL1B 1H0DA 1MCDA 1AQDA 3DMMD 3QHFH 5D71H 3PWUB 1I7RA 4G6JL 4X5LA 4KRNA 2J1KA 5EC2B 2CIKB 4XVSL 3OJ2C 4F7CB 4PLJD 5HBBA 3W39A 3OKEB 3IT8D 4PJ9C 4OFKA 3KLAA 4I3SH 3FONA 2GJ6E 4LARL 1T1WB 3RRQA 2V2XA 3UP1A 1BECA 3MRMA 5D7JA 3RPIA 4R7NB 3UXFA 5ICYA 2JJTC 4K9EL 3ZKXC 5I73C 1HWHB 4X6FA 3MRLA 2X1WL 4P3CL 4U1MB 5JOPD 4L8BA 8CGTA 1GGCL 1BOGA 4KKLC 4WIQA 2NY1D 1FIGH 1MNUH 4J3UA 3TT1L 3BHBA 3KPMB 4YXLH 5F6IB 5I1GL 5FUOH 5BVJA 3ARGB 4ESKA 4JB9H 3GMLB 2X2YA 1IC7L 4WO4D 1EXUB 2IPKA 4HPOL 1MHEB 4U3CA 2AJVL 4YGAB 3V6OC 3WFBL 3QFJA 4JFYA 2JCCA 2Q86A 5DJ2B 5C0GA 4Z7QE 1TETL 4G7VL 4O2FA 4IIQB 3QFDB 3SDXF 3UDWC 5CJQH 1T3FB 1PKQB 3JTSA 3F7VB 2B0SH 3FOMA 2VLJE 4G6AC 4PJFA 1A7BA 4NM8L 4OZHE 5EU7C 4BSVB 1PZ5A 2JJVA 3FRUB 4PJ7E 1D5MB 4GMTL 5CZXC 2D7QA 3KLHC 4K3JH 2P47B 5KSAC 3VA6A 1WC7A 4JQVC 2VDNL 5IHLB 43C9B 3ZDXE 4AENA 1FVDB 1QQDA 3I2CL 5JXEC 5JORA 4NPYB 3TLRA 1G7IA 1HWGB 2OJEB 4XTRC 1NDMB 2P45B 4DZBA 4HS8L 2DI8A 4NKQB 1WFOA 5ACMA 1N26A 3HPLA 5JDSA 1IAMA 2WUCL 2YD4A 4HKJA 4XGZA 1GPOH 1X4XA 2YRZA 4E41B 1EZVY 1FZJA 4Z8FL 4R96A 4S1RL 2N7BA 1PD6A 4LIQH 5GJTL 2W0FA 5CEYA 3CXHJ 1JPSL 3BGFB 4MNGA 5DVOA 5HXMA 4TVPL 4M5ZL 5DRZA 3D5OF 1HILB 1FL5A 3VXPA 1NUGA 4JO1L 5KAQG 4HLZG 4N0YL 3B9DA 4WO4A 4LVOB 1IAOB 4F7PA 4PRHE 3GSNL 2VTFA 3MLVL 5D70H 1B0RB 3VWJA 5F7EL 2P8PA 2Y1VA 4HUVB 2VWEC 1YPZE 3INUL 5F7UA 4UB0L 4OCXH 5E00A 4G8GB 1QRKA 1LK3L 1CT8B 3RL1B 3WHE1 3CMOH 2ZUWA 4PJGB 1WEJL 3SGEH 3PGFL 4OGYH 5HHXH 1C08A 1X5YA 1XAUA 3MA7A 4KTDL 4OFVA 3LPWA 3OG6B 1F13A 5B21A 2X42A 1I9JH 3GMQB 3WN5B 2AEPH 2GUOB 1C12A 2XZCL 4Z0XB 4WI3A 3EAKA 1D5BA 3X3GL 1CK0L 1WWCA 2XV6B 4FFYL 3CH1B 3V6OE 1ADQL 1MFNA 1YY8A 3WIFA 2M8XA 3S36L 3HG1B 3FO2B 3OGCA 2UZIL 4JM2B 3HNVL 3HRZA 4S11A 3GHEH 1U2HA 3TBWA 3O9WB 3PGCB 2XTJC 5EU7E 1D7FA 4JFXA 1KPRA 1N8ZB 2CKBH 5FYJE 3FQUA 1V7NH 4LCCA 4OGAD 4Z7VE 1GHFH 2VLKA 4U2ZA 2EC9U 3SJVE 4U1KB 1K6QH 3ZKMC 2HVKA 5JPMB 1MRFH 3GBNL 1P1ZB 1U42A 5F96H 4PJHB 3V6BR 5FO9B 5JUEL 2WIIA 2VJXA 1ZGLB 2YMXH 3CCHA 2APWA 1BBJB 4JEGB 4LRIC 4H88H 3GI8H 3U9UB 3W2DH 1INQB 4NP4H 3EYQD 4R26L 4YFDB 4G8IB 4JKPL 3IJHA 1DVFC 1DN2A 3RWHA 3QZWG 3I6KB 4M1GL 5D1QA 1IAIM 2ZUXA 5HGDB 1KJ2H 4P9MH 3VFOB 4AZ8A 2B2XH 5I66A 2DF3A 5EU5A 1L7IL 1T0PB 4D0BA 1YEHL 2OI9C 2JKXA 4QRUA 1G9ML 2BSSB 2R0KL 1M1SA 1X4ZA 4NC1C 4OFYD 4Y5XB 1RUKH 3CFEB 3HPJA 2BRRH 3VA2C 1V5JA 2B7DT 4HIXL 4XNMA 3BH9B 3RUGF 4DK6A 5EZIH 4AQOA 1CICD 5EOQH 2ARWA 2FIRT 3FMGL 5HYSB 1K8IA 1S3KL 2VLMD 3EYVB 1XF4B 4L8DA 4P9HL 2VWEE 3RNKB 1F11B 2VQTA 2DJSA 3FHQA 4LL9A 3BPCA 4HQQL 1VDGA 2NPLX 4K9EH 3MUZ1 4P3CH 4XAKD 1LQSR 4ISVB 4QHLA 5SWQA 1IM3A 2JB5H 1UZ6E 3TP4A 1KCRL 1YDPA 4XP1H 5C2BH 1MEXL 4C55A 4B5EA 2F74B 3JTTA 1Z9SA 3WXVH 1CXFA 2VLRD 2VDRL 3H7LA 4PS4L 3CZFB 2WNGA 4I13B 3LN9A 1T83A 3S37X 4HPOH 4P23C 2AJVH 3U4EB 5KW9L 1RZKC 5KSVB 1JV5A 2Y06L 2YR3A 3E6HB 1F3JB 3D39A 2FEEI 4PJCE 2PO6A 4HCRA 5D9SA 3ULVC 2XTJE 5DJCA 2APXA 5JXAL 4FG6D 3BSZL 2B20A 2FEDD 4HIEA 4Y19E 4AM0B 3MXVL 3VXSE 1RZ8B 2Z9TA 1QR4A 2MTPA 4AEIL 3O6FC 1Q9KB 3O3EB 2IBZY 5E03A 5IFJA 4OFYA 4ZODA 1ZA3A 3ZE1E 3QPXH 3GJFH 1Z9OA 1HHJB 3QUXA 1MWAH 4PJDB 2HLAA 4IMLA 3KPRB 4M93B 5EBWB 2VQUA 3I2CH 5E5MB 3PWNA 1X44A 3FB6B 4QWWD 2P5EE 3QHTC 2X4UA 3MJ9L 4R4FH 3G9AB 4U7MA 5H35B 5IMOB 5D5MA 3FN3A 3TFKC 3BW9B 1OB1A 5BZDB 4QEGA 1S7RA 1SJVA 2Q8BL 4NOFA 4S1RH 1P4BH 3WLBA 3U6RB 3C09B 4DN4L 3PP4L 4JFDA 1MY5A 4K3DH 4MAUH 1JPSH 2VRAA 4K71B 1AGCA 2CUHA 3QJFA 5TE4L 4NC1E 3QWOA 4NQSB 3IJSB 3TIEB 4U6HA 3ZKQD 4JO1H 1YN7A 5J13C 3GIVA 3QIWC 3O4OC 4U0QB 3SE9H 2B5IB 4JHAL 3FO1A 1NGWB 5I71C 1LNUB 5I16A 2ZCLH 1FYTE 2GJZB 2J6EL 4DFHA 1OGAA 5K9KA 3CX5J 2VN4A 2NY3B 5B8CC 4Z7WE 5FDWB 3SDDC 2WBKA 1R3HB 3T0WA 3M1BA 3JWNC 4CBPA 2EYSA 1HHHB 3NCYP 2VZ3A 1B88A 5I1EL 4YBLC 1WEJH 1FBIL 3CFKB 1XR9B 1N59A 4XRCB 4LVHB 5J9PA 4P59L 3LN4B 4ZO9A 1BX2B 1IGTA 1U8JB 2YA1A 4D0CA 2BERA 4H25A 1JJUA 2AJYH 1QBBA 4RIRB 2E9WA 4WW2F 4XPGH 1ADQH 3VU2A 1B90A 4AMKH 3MOAH 3W82A 2JIXD 1QFHA 3L3DA 4H0GA 3VH8G 2UZIH 1INDH 5E8PB 1I8IA 3ULVE 1LP9B 1FJ1A 1SY6A 1T7VA 4ZFZA 4M4RA 1A6AB 1NC4D 1YNKH 1CWVA 1Q9WB 2ZUQC 3O6LH 4QOKA 3OKLB 4NRYA 2Y23A 1M6OA 1G7HB 5C6TL 1KULA 2HFGL 1Q38A 1U6AL 1KUMA 6FABH 1ZGLP 5E9DE 2BNQB 5I0ZA 2EDBA 3B4NA 5JUEH 1G9NC 4I2XA 3U36A 3N1FC 5I73B 4P46C 4EQ3A 1U8HA 5ID1B 4DEPB 4NQVA 4FABL 3HMWH 1ZT1B 3U48A 4H5SA 4YDIL 1CGUA 4KI5F 1I8MA 5E1HB 4R0LC 1WFTA 5D1ZD 4JKPH 1J0HA 1K8DA 3VFSB 2J8UF 3Q0HA 3WFEH 2VXUH 5E8OA 4ELMA 2PW1B 5IMMA 3MFGB 3TO4D 5IVXF 5IMLB 1YEHH 1YEFH 4R9HA 1T21A 4KVNH 2Z91A 4HIHA 5GGSB 4OD2A 2W60A 1VACB 3FCTB 5I2IA 4F2MA 2HJKA 5CFHA 2CK0H 4WGWB 3NACL 1YEJH 2HMID 3U0PB 1IM9D 3AS3A 3QDAA 3BJ91 4WEBL 2DQJH 2JIXA 4XNUH 1NBYB 3V6FB 1KCLA 3IGAA 1FLRH 2D9CA 2NNAB 4IRSB 5T3ZH 3WV0A 4FQ2L 5BRZA 5B39A 3DURB 4DWHA 3B83A 3IXAA 2E7MA 4L3EA 2YC1B 4J3WA 4MB4A 1JNHA 3L5WA 4ENEC 4EI5D 1LWRA 1K85A 1DN0B 1NANI 5CUSL 3QIBA 1OM3H 4LSUH 1OSZA 3UAJC 4ZQKB 4HWEL 1A6ZA 3ZMRA 3OKMA 2A6IA 1FNGB 1KGCE 2WM0A 3EYSH 3P77A 5HI4D 4JZJA 5GZND 5C07D 5DFVD 2CKNA 3VDCA 1A7QL 2VSDA 4K94C 3PDOA 3QBTB 5FKAA 4RGMC 3F7PC 5ESQA 1XR8A 1IQDA 5KW9H 4QRRB 1ZHNB 4BH7A 4LDEB 3Q5YA 1B0WA 1HH9B 2X4RA 2BDNL 1MCEA 5C0RL 4R8WH 4MNQB 2XA3A 3WL9A 3LOWA 1PW3A 1JHLL 1D5IH 3TPUB 1KLUB 2JF1A 3B2VH 3IFOB 1R0AH 2DB8A 4XNYL 1KCVL 1P69B 1WBXA 3BKYH 3QUZC 2NY0B 4OBSA 4NCC1 1QLRA 1BVLB 5JQHC 4JPVL 3X12B 1AR2A 5GS0L 1A6VL 4GG8A 5C09E 2FGWH 4ODHL 1TVBA 2NX5D 1YN6B 2NXZC 5IR1B 2FGZA 1IKNA 5KS9B 4RAVA 1NEZB 5E4IA 4LLQB 1NCTA 2DQFB 5T1KD 1IM9A 5CD3A 5IOPA 3NABH 1F97A 3MJ9H 4LSVL 3WEXB 1V05A 2WK2A 4P2QE 3GKZA 1JGDA 3P9LA 3C2AL 1GIGL 3TEUA 4WU5B 4QGYA 2IF7A 3LKRA 2Q8BH 3HC3L 1JF6A 3VXOA 2Y36L 2X1XR 3QCTL 5FUCC 4Y8DC 5TE4H 5KN5A 2I9TA 2OXGA 3NMEA 1FIEA 3CU7A 1VFUA 2GTZB 5I1JL 1RUAH 3F8UB 2OZ4A 5B4MC 4OF7A 3IDUA 2YPLB 1JE6A 2E8ZA 1IGML 2IPTH 4JHAH 1TCRA 4HF5L 1I1YA 2VABB 3EDDA 5AAMA 5DI8A 3VGEA 4OUUA 1CGSL 4OF8A 4YWGL 3MACL 4UU9A 5E2UL 4XP5L 1LILA 1MFAL 2HWZL 5SX5K 5BOZG 3PWJB 5HPOA 1B6UA 5C3TA 4FQJL 1BFTA 2UZYB 2CRIA 5IF0B 4CVWA 1VFAA 1R24B 3VXRB 4P59H 2CPCA 4NUGL 1FHGA 4KI1A 5GZOD 2FX7H 2Q76B 1E4KA 2CSPA 5ISZE 2AXJA 4CADB 1FG2B 2V5RA 3IDNA 4MDIB 3QAZB 1DQJB 2HN7B 4N0UA 3ZT7A 2DKSA 3ZT6A 1LE9A 1JWSB 5FF6B 2H32H 4GRLA 5FV2A 4I0PB 5I76A 5CP7A 3WYRA 1I7TB 3MLSL 2LABA 3O4LA 4U1JA 1RURL 2OJZH 1BQSA 1QHOA 4L8CB 2RHEA 1EK3A 3S3PA 2AEWA 1EUUA 4WHYG 4KJYA 1FH5H 3WE6A 3CDGA 3QO1B 3RVTC 2QLVB 2D4DA 3L3GA 1GC1L 3MLXH 2E8YA 3ULUC 4ZUUB 2CR6A 4Y16B 5IIEA 2E7HA 4X9IA 1SJHA 1U6AH 4KKBD 1S9XB 3WNKA 3F7RA 4J3TA 1OTUD 2EICA 4QY8A 1OTTD 3AC0A 3QEQB 3B6SA 4YO0B 3A67H 1KIRA 5FFLA 1KENL 2BVTA 1G6RA 1OGTA 3GMPA 2F58H 2FWOB 3T0EA 1JI1A 1BQHA 3I50H 1I1FB 4E0RA 4MWFB 4DZ8B 4YDIH 5AD0A 4JRYB 4OZ4B 4LPWA 2RBLA 3IETA 5F3BA 2CGRH 1Y6MR 4JRWA 1V3LA 1G0YR 5FUCE 4D3CL 4W4OA 3BD3A 4UDTB 5C1MB 1UWEL 3SGEI 2VDLL 1CR9L 5DMKA 4YHNB 2OK0L 3DX7B 4NKOA 1ORQB 1C5BL 2X9YA 5GGQL 4AT6A 4ODBD 3C60B 1I8LA 1TPXB 5K93A 1WVZA 5EC1A 3MLTA 3DTXB 4MSWB 3KXFB 5CEXA 4WEBH 3WDJA 4LCWE 2YPKB 3VWKD 2GFBA 4TQEH 1KCKA 1CIDA 1G7PB 1H5BC 4MXWH 5EO1A 4KRPC 1LO5B 1QRNE 4LPCA 3DSFH 3V5KA 4L4JA 1A7OL 5I8KH 3DMMB 1EJ6A 2WSKA 2C1PA 3LPFA 4FQXD 1LEIA 1AGBA 3C5ZA 1HNFA 2HFFA 4GBXC 4BZ1H 4B50A 1AIFB 3ES6B 3WFCL 4YR6A 1KF9B 3TYGL 5HHOD 3V5DA 1K9TA 1NH6A 1X5GA 1ND0B 3S37L 3G6JE 1PY4A 1AJ7H 1F45A 2H2PD 3UPAA 1OAUH 3V8OA 4CGTA 3ZE2E 3WNOA 3LHPH 2WANA 1UM5H 4PJXB 4E42B 3DO7A 1A1NA 1WSST 1U8IB 5EU3A 5EFIA 1F4XL 5K9OA 3O2DL 2EZ0C 3WFDL 2CDFB 2NY1B 4C56A 1BJ1H 2GHWB 3L3OB 4UT9H 2ZCKL 3TN0A 1KCVH 2BX5A 3FO9B 3HUJE 1HEZB 3ULUE 5JW3H 5IEKA 5IB1A 4JPVH 4MXQC 1CE6B 1HE7A 3MJ7B 3CDCA 1K5NA 1LO4H 4PJGF 5F7WC 2R2EB 1AHWC 1Q9OA 1JGEA 4K8RC 1F2XK 4P4KC 4Y2DC 3ZSTA 1PBYA 5GGTH 1E6JH 3UEZA 3S35L 1MOEA 2DD8H 1S8DA 3VI4E 4UT7L 1ROWA 4JQXA 1QP1A 1UJ3C 1OQOA 3LKOA 3L3KA 3VXNB 4GG6E 2N56A 1MCSA 3OKNA 2BK8A 3HC3H 2XNAA 4M1CC 4IOIA 2R69H 3BVNA 1ZHKA 3TVMD 2XTLA 3PNWB 3V2AR 2I07A 3NPZB 1K4CA 1IRAY 4KTEH 3JV4A 1UXSA 4EOWL 2WBJA 2PYED 2VKWA 1SJEA 4XPHH 5BW7C 5CBEA 1A47A 4U2YA 3VRLF 5I1JH 2ADJB 4XCYA 2PR4H 2YD3A 1NL0L 4CJ1A 3IDXL 1CE1L 1N3NB 5HHOA 1CG9A 3WS3A 1EV2E 3CVHH 5F1NA 1IAIL 4ZDHA 1KG0A 1U9KA 1Z5LA 4HF5H 3BT2H 3W0WE 4U0RC 4X7SH 5D7LE 5LWYL 1DR9A 2XPGA 2OR9H 4Q9CA 3MA9L 4PRPD 3Q6GL 5E2UH 4UINH 1RZGB 4XP5H 4PJIA 3IDIB 1OAQH 3QT2A 1C1EH 1EMTL 4ZUSB 3CSGA 4P2RB 5EORH 5EZLB 2XN9E 4ZUWB 5CJ8A 4LLDB 5A16B 4MX7A 1I1AD 1LEKA 3P4LA 3SKNB 4KMTL 1C5DB 4LSTH 3TA3C 5ID0A 3T2OA 3B9VA 2UZXB 3D87B 1CZ8H 2EE9A 1NAKH 4ZAKD 2BCKB 1GH7A 3P30L 4X6CE 3QDGD 2DJUA 5ILTL 5ITBL 3TJHD 5CS7A 4LLWA 3MODH 4C83A 1OW0A 2AXGA 4YK4B 2AK4A 2PKDA 3EJYC 3QG6B 4PY8J 1BFVL 4WEMB 3FFCE 1QSEE 2VH5H 1QFPA 4NKDB 1T0MB 4HUXB 3S98A 4QT5A 5D1XC 4U3HA 1QLFB 2X4OA 1G1CA 4KJWC 5CJXC 4IDLA 4M7ZC 1F4AA 4JY4B 4NZJA 3IB4A 3NZHL 1WBYA 1AGDB 3OGOE 5BZWB 4Z78A 4ZO8A 1SEQL 3QDME 1MY7A 4JDTL 2R1WA 4J12A 1RK1A 1C5CH 3GSVB 2ESVE 1UXWB 2GY7B 1IMHC 2XWJB 5ADPL 2C3VA 5JHDE 1J1XH 1SBBA 4PRPA 1O7VA 4HWNA 1CFTA 3BKML 2CLVB 2QQNL 3CC5B 1FN4B 5DRWB 1BFOB 4MXVE 2FATL 3NA4A 4WFFE 2ITDA 1U8QA 3RWEA 3IFPA 4P2YA 3SDCA 4D3CH 2X1QA 2NY5C 1FNHA 5KSUB 1R5WB 3WIIH 1FL6A 3MROB 5CBAB 4I18A 1UWEH 5F7FA 1NCAL 3D85D 2A74A 3BWAB 1EEYA 3CSYA 3TIDB 5BV7L 3UBXB 4FXGB 1YUHB 3U9PH 1NKRA 3MV9E 4LGPB 1WITA 3TT3L 3QQ9D 4M9OA 1A02N 4J4PA 5HDQL 2X6MA 4N0CC 3ULSB 2FBJL 1GCFA 1ZLVH 5MEOA 1LGVA 1S9WA 3X11B 3IU4L 1JN6B 4MMXC 4HS6A 3SOBH 4IOFC 1BQLH 3BN3B 1MIML 1A7OH 3AGVA 4U1NA 2VZSA 4ELKB 1J18A 1K3IA 4FZ8H 1M4KA 1AE6L 4JPKH 4W68A 3AU1B 1CFVH 1CXLA 4G42A 5BS0D 2ZOLA 4CVXA 1CICB 5F97E 1R5VA 1ACYH 3E6FA 4KUZL 1QSFA 4JE4B 3VXMA 4JVPA 4ZOAA 5J12C 4DOHB 2CKBA 5GGVL 3Q3GB 1A3RL 3GJFK 4Q6IC 3PXHA 1MIEH 3IDYB 4OZHF 2JTDA 3DUSB 1YMMA 1J05B 3IKCB 3RGVD 4PJ7F 4P5KA 4Z77B 4JZNB 4ZTOH 3T2NL 4HK3N 5TGBB 2AJXL 1U8PA 4HS3A 5HGBB 3UJTH 3AFLA 3WFDH 5DMYA 2XKUA 2DQEH 4M5YL 4C4KT 2DI9A 3IYLW 3ZDXF 4BA8A 3MV11 3RAJH 1LE5A 5SWZD 3AAZA 5D2LB 3WS6C 4MVBC 2VLRB 4OZIE 2E9JA 1ZLUH 5DD5L 4K7PX 3MV8E 3I02A 2Z8VC 1RJLA 1L0YA 3M17A 4MA8H 2IFGA 5EO0A 1KJ2A 3C6LC 3GSQA 4JHWH 3HE6C 1OP5K 4DUVA 2GCYB 3S35H 1NBZA 5I1DB 5FDYA 4BFIB 3RWDA 3L6FB 3OKDB 4QRPE 5KVGH 1X5FA 4XMLL 2MMXA 3L3HA 4ODVH 1YEDB 2BVQB 4NGHH 3OBAA 4ZS6D 4ZPVB 1LP9F 2I9LB 2KL6A 1K4DA 1FQ9C 3CU1A 4ETYA 3P3YA 5DO2D 4MJIE 4Y4FB 1VGKA 1NL0H 3IDXH 4PB9L 4TRPH 3UPCA 1Q9LB 5IBUB 5DJ0B 5E1AB 4OLWH 3EHBD 5EG6C 1RZJC 5C0DB 2X4QB 5TFSH 2DIAA 4KGJA 5D7IE 3EFDL 1XGYL 4TVPD 4RA0C 5F9DC 1G7JA 4HUMB 1FNAA 2D7MA 4FXKA 5BQ7B 2R1XB 3O81A 3SDAA 1Z3GL 1EMTH 5SWSD 1MH5A 1QSZA 1QG3A 2VN7A 1HXMA 3EOTL 3KPPA 4RZCB 3BH8A 1T89C 3MNWB 2DLEA 2WIMA 1NCBL 2DQTH 2ZSVA 4GQ9L 4QHUB 2VDOL 3GBLA 5KOMC 3HE7D 1ERNA 3IDJA 3JXAA 3PL6D 1E27A 1A64A 1EHAA 3TNNB 1FCGA 2EH7H 4RRPA 5ILTH 5ITBH 2EEAA 5I1IL 2J7LA 3O3BA 2Y6SC 2O5XL 1P53A 5DDHB 2Q8AL 3LN5A 5DJ6A 2ADIA 4ZS7H 3Q6FB 4JO4L 4XNZC 3C8HA 1D6EB 4YBHA 4Y1AD 3GJFA 4XH2A 4Z7VF 1MWAA 4LSPL 3RPKA 1BFVH 4LSSL 4M48H 2I24N 3D25A 1SBSL 2RJMA 4HZLB 1QLEL 4Z7OF 2RAMA 5EUOE 2VL5B 5I15L 4FFVD 1B2WH 1WWWX 3GEWB 4B0MM 1FNEA 1BD2E 2Z31A 1T2JA 2I5YL 5C71A 4HJGA 5IJKA 5D8JH 5IK3A 3RZWA 1RJZA 2ZZUT 3C9NA 4OLXH 3ARDA 5ADPH 1KTDB 3CK0H 4JZOB 1T5WA 1J8HD 4EUPA 1M05A 4G8EB 3RZCC 5K9JH 1I7UA 3ARED 1NC4B 5FGCB 4U6XA 1NMCB 5ABDE 4WHTA 2D0GA 3QB7C 2GSGB 2P5WA 1ZS8B 3FB8A 3JV5A 2FATH 1R3IL 5SWSA 5MP6L 2B1AL 4JLRA 1T20A 4KDTA 4PRBB 1ZT4A 1T03L 1T5XA 3MGOA 3GMRB 2G5BB 4OLYL 1WUNT 3ARFD 4YE4H 5BV7H 4OZFB 4LCUA 1MI5A 4Q9QL 3IF1B 3ETBF 4BZYA 3F12B 4BKLA 4YNYA 2QKIB 1NMBH 2BNRE 5D1ZB 3TBYA 5ICZA 4JFEA 3C08L 1YECH 3H2WA 2W9EL 1AKJA 4UIKL 2IMNA 1MLBB 5JO5B 4PJEE 4XVUC 1A9BB 3E3QC 3RVUC 4D8PA 3K8LA 1UZ6F 4GAYA 2YBRB 3EYUL 4KROC 4U1LB 4X98B 3TO4B 4NFCA 1AQKH 4JPWH 3MPCA 2Y5TA 2BXZA 2VL4A 2Z93B 5DSCB 1ADQA 1T1XB 3NIGE 4Q97A 3VFWB 4NYLB 4OQTH 4UDUB 1FORL 3P40A 2ZNXA 2BSRB 3QHZL 3V52L 4KUZH 1J88A 3DV6B 3D3VA 2A9MH 1M7IA 4J8RB 3TWCH 4RAUB 1KN4H 3AS0A 1RI8A 1SYVB 4PJCF 1EEQA 2HKFL 3REVA 2HT3C 3DGGA 4PJAB 4KDWA 5HJ3A 3KVQA 5DVKA 3GSUA 3ESVF 4PJ5D 5C0AA 2ICES 4EI5B 4XP9L 2AJXH 1A6TB 5CINL 5HYIA 1OAKL 4JANA 2E7LA 3ZE1F 3G5ZB 5TDPA 3HMXH 1BAFL 3RKDD 3CDYA 2NR6D 1QBAA 3BP4B 5C07B 3T2QA 5IB4B 1MELA 5GSRB 5BJTA 1Y6NR 3VXUD 4EBQL 2QHRH 4TSAL 4FQIL 4ZFOL 4QRTA 3O11A 5ADOH 5E56A 4WW1A 1IEBA 3KYKL 3PDGA 4L4TA 4F80A 1XGPB 2FR4B 3HS0A 4MQXD 3ET9F 4FFZH 1XGQA 4RFNB 1W8OA 4XMLH 4Y7MA 3LKQA 4YZFF 4G9FE 3DGCR 4MJ5A 4IRJC 3SKMB 4FQLL 1KTLB 3V8CA 5D6DA 3WJLA 1OY3B 3JWOL 3HC4L 4G8FB 3FRPG 1HI6B 2ZG3A 2NX5B 1NLDL 3GSXA 5L2KE 3NCBB 2H8PB 2NLJA 4K55A 4OIIL 3KPSE 5FYLD 3MRHA 5MI0C 1KJ3L 3MRJA 4OKVA 1RHHB 3TH4T 5CILL 5T3XE 1I3VA 5DT1L 1UFUA 4Z7WF 3BPLC 4M7ZB 1WT5C 5T5NG 3TV3L 1ORSA 2VXSH 4K7FA 2ATKB 4OM1H 1IARB 4JREB 2ZKHL 1A14L 4YBQD 1FYHB 3QUYA 4QRSB 4FP8H 1FZMB 2KQNA 5HTSA 3TO2A 3ZHDA 1NGPL 3I75A 1QUNA 4WHDA 3WD5H 2Z8WC 3H9SD 2GYSA 1BJ1J 1ACZA 1FAKT 1NCBH 2X5PA 4TYUA 5D6CB 4XP6H 4GW5A 3GDBA 1HCVA 2GJJA 5DD1H 3TBVA 5D7JC 2L7JA 2OLDA 5E2TL 4XBEL 5F72S 1S7SA 3RU8H 3V7AG 1XCTA 3ZKNC 5B3JE 4FHBD 3ULVF 4CKVX 1I4FA 3G6AB 4XC3L 1HHIA 1Y18B 1IC4H 4LAJH 4LLAA 5HHMD 1UENA 4PJBE 1AI1H 2O5XH 2Q8AH 2R0LL 2IANA 1PX3A 5E8NA 5CHNB 1ZTXL 2ORBL 4LSPH 4OTXL 4PGBA 5FB8B 1F4YL 3CUPA 2DYPB 1UJTA 5I15H 1W72B 4P3WA 1S7QB 4UV4L 2Z8SA 3R8BB 3HZMB 43CAB 2FHFA 1ETZB 4KU1A 3MJ9A 2R1YB 4L4VA 1BF8A 1AC6A 2I5YH 2EDHA 2X44D 3QDJA 1FNLA 3O0RL 4O58L 4HW6A 3K8MA 1U95A 1SMOA 2ERJC 1Z0MA 4FTVA 1JHTB 1L6ZA 1ED3A 3LRSA 1MSPA 1DBAL 4KPHL 1RD6A 1PKOA 4DCQB 5HSFA 2X1PA 3P4OB 4PJXF 1D5XA 4LPTA 5J12B 1X6LA 2VDPL 4S10A 2OR8A 5MP6H 1U93B 4ZXBB 4BUHA 3FL7A 5E08H 3QPQC 3ZZ1A 3X14B 5CKGA 4OLYH 4MNHB 4ZUTB 5E7BA 4Q9QH 4YHYC 3B9KA 1P2CB 4HG4K 5IVZA 4LDOB 2FJFA 3LQZA 3L95A 2ED8A 5DHYA 4X9FA 4WTWA 1QOKA 1L0XA 5DA0B 2GKIA 3HA0A 1ZANL 3FB5B 2G9HA 5TQ2L 5L8JB 3IJYA 4KKAC 1KLGA 5DQDH 3EYUH 3O2WH 5BCAA 4D9LL 3MR9B 3QEHB 4XNXL 5T33H 1MFDL 4F7MB 2MQ3A 1XGRB 4GAJL 1CU4L 2BHZA 5ESAA 4A6YB 4WI4A 3LPGA 5KJRL 1UB6B 5HHNB 5KSBA 4WHYH 2H32A 2Z0BA 4MMZC 4NRXB 3VWJC 3QHZH 2AJ3A 3UTSA 3BPNB 4X4XA 2X7LB 4CNIB 2H9GB 3MO1A 4N68A 5FM8A 4OCLC 5DRXB 3VWKB 1IGYA 2PXYD 4LQ1A 3RVWD 4PP1C 3FT3A 4HJJL 2BOCA 3VE0A 2Y4SA 1F3DH 1DLHA 2D3VA 4G43A 5CINH 2YS4A 4FQXB 1J87A 2QSQA 2L4OA 3RHWF 5IB2B 1NJ9B 3WKNA 1F6FB 1UH3A 5JIHA 2A1WH 1QVOA 3QFJE 4K7PL 4TSAH 1KIQA 4Y4KA 2J3SA 1UQSB 1OAYH 2CDEA 2APBA 4PJFE 1H3WM 4WRLA 3U82B 4YX2H 2ADGA 3MYJB 4PD4J 4YFLI 4JJ5A 3KYMB 1PDKA 4AEHH 3MRIB 1BREA 3DRTA 4LCCC 5GS0D 2EIEA 5DEGA 3U30C 4LCYA 4XX1G 5LCVL 4ONFL 3QSKB 2J5LB 5CMAA 9CGTA 1FO0B 2UY7A 5FCSH 4YEEA 3KS0H 1NLDH 5DGQA 2DN7A 1WIOA 2UWEB 2FO4A 1YEEL 4AJ0A 4OF6A 1WCQA 4JKLA 5IBUG 5E0QA 1CD0A 1CQKA 4K07A 2HT4C 1ZT7A 4P5MB 1Q0YH 1AXTH 5D1QC 2FL5A 4PUBL 3NPSC 4XZUB 3TV3H 1RVFH 2FLBT 2IEPA 4MNGE 1FLTX 2G2RA 4ZSOA 1A14H 2DQIL 3LB6D 4FQQB 4QYOA 1NGQL 2YWYA 1OARL 2GK0B 1HHKB 4KJQD 5I74C 5KVMC 2PYEB 3FB7B 1QKZL 4KQ3L 4TNWF 1MCWM 4W6WB 2VXQL 1AGFA 3HNSL 1R3LA 5E2TH 4XBEH 4UT6L 1P6FA 3QH3A 5E6ZA 1U3HA 3MCKB 4ZOEA 1N64H 2BNUA 5EOCL 1CLZL 4UTAL 2B1HL 2ORBH 3QNXB 2XG4A 4OTXH 4RWYL 4OF0A 4XCNA 1I1AB 3U7WH 2C7UA 5HVFB 3KLDA 4U1HB 1FFPB 5GGTA 5LGJA 4UV4H 1M71A 4XI5C 3SO5A 1JGLL 1T83C 3BEVA 1EBPA 2HG5A 2YEZB 1MF2H 4LMQE 1HOCB 2APFA 4M6OH 4ZAKB 4X4MA 4X7TA 4ONOA 2YHGA 4GT7A 3QDGB 1H3GA 2PO6C 4JKKA 1CF8H 4BH8A 4OT1L 1MHHA 3WSQH 1QFWH 4XXDB 3QA3B 3WLWD 5B39G 3BXNA 3ARWA 4WENB 2XY1A 1QO3B 5F88A 1KN2H 2VLKE 4Y5YA 3VGHA 2WLZA 4YPGA 3OAUH 4WTZG 4YHLL 5IBTL 3QUXC 3UTTA 1LD9B 1JK8A 1MVUB 4G3YH 3CVHA 4JPIB 1N2RB 4OLEA 1ZLSL 3LS5L 1T2QH 1VHPA 3CGTA 4M7LH 5F9OH 5IJVA 1BVKB 4P5TD 4PB0L 1N5YL 4XPFL 4OD3H 3GK8L 35C8H 3GSOB 4I5BA 4MS8D 5I1CL 4PV9A 3IRPX 1S5HA 5IW1A 4PIRF 5DURD 2Z8RA 3EJZC 5L2JA 3BP6A 3V7MA 4LLVA 5B38B 1E4WH 3WIHL 4D9LH 1ZWIB 3OAZH 1TZHA 1PQZA 1KB5B 4LVNB 4XWOD 3PQYD 4BQCA 4ZD3H 4AG4H 1J1OL 1NSNL 2GITA 1TENA 2VDML 3D85B 2P44B 2HTLD 4G6KH 4GAJH 4NZDA 5KG9B 4NUJA 1NKOA 3NCJL 3JWDC 3G6JF 2EO1A 1YZZA 2WWKT 1IEAB 1NGZA 5C0CD 1NGYA 2VSCA 2EKSB 5T1DL 4NHUA 2Q1EA 1ZLUK 1OP3H 4B7IA 3DJ9A 1AO7A 1ES0B 5F9JB 4ORGB 1EH9A 2IGFL 4MD5B 2QR0B 1MREL 3KPQB 1HINL 4N5UA 3HUJF 3O8XD 3ULUF 3WKML 5FECA 4X6DB 3LKNB 5GGVY 3RHWK 4XMPH 2P8LB 4OZGA 4F15C 5K59F 3VFVB 3SKJL 1YYLL 1BIIB 2X4PA 2MCPL 5FAAA 1EFXD 1A7PH 5KVEH 5D7SL 1BIHA 4O5LH 2BMKB 3MX0A 4Z5RA 3D39E 3FT4A 5I6XC 2DM7A 1RMFL 3VFGL 4L9DA 3DXAD 3VI4F 1ZA6A 5I8OH 2NY4D 3RGVB 3ULVL 2VXTL 4GKZA 4GG6F 4HEME 3VD4A 1A6WL 3P9MA 2ED9A 1L4IA 3IFLH 3PABA 1YJDL 3VXQB 1HYRC 5L88H 5L0QB 4FNLH 1OCWH 4UIMA 4CMMB 5FXCH 1G84A 1JMZA 2B8OT 2CXGA 5IW6B 5C08A 4ONFH 3PQYA 1XCQA 4LASH 2EYTA 2AJZB 4ODSL 1KPVA 4Z7UA 1TZIB 1L6XA 5HGHA 3SCMD 1F8TH 2DBLH 2LFGA 4JG0L 3JV6B 5I19L 5D5ME 5C0CA 1R6VA 4TNVF 4OI9A 4IHOB 1BZ7A 4PUBH 3MCLL 2IQ9L 4JFDE 2CDGA 2FH8A 2F5BH 3DRQA 4F57L 1I85A 5DJZA 3TM6A 4WCYL 3RWFA 2DWDB 2F8VA 1S7WA 2WUBL 3O8XA 3BRFA 4S0SD 5I1AB 3DV4B 1BZQK 1OARH 1T4KB 3GUTB 1CD9B 5D2LE 5GHWL 4RMQA 5DJ8B 1U58B 1FL3A 4GKNA 1JTPA 4X6CF 4HJ0D 4KI5D 3MRNB 4KK9C 5DD0L 3PHOA 3RJDA 5J57B 1Z6JT 3HNSH 1LO2H 4ACPA 1T2XA 1OGAE 1JNLH 2AEQH 3OXRB 1KSRA 3QNYA 2DTSA 3A6BL 3BO8B 3OR7A 2CQVA 1HQ4B 1W8NA 3W9DB 3QJHA 5KVDL 3QZWA 3HB3D 2CIIA 3LSOA 1G7IB 1LK2A 4LF3B 1NPUA 1AP2B 3HI6L 1IQWH 5IP4A 2DWEA 3QIBC 4AEEA 4XMKL 4F8QA 1DQQA 2QL1A 1YEIL 1XIWD 3GSNB 3QI9A 4EN3D 4X5XA 4JZJC 4XGZB 5DMJB 3W9EA 4WW2A 1FZJB 1F4HA 2JLLA 1FCCA 5I30L 3TNMA 4JDZA 1VFBB 5CEYB 3T1FB 3OG4B 4HKZA 1JWMB 3CPLA 3HE7B 3PL6B 2EECA 3DIFB 4PRDB 1R5IB 2E7CA 5E6ID 3UYRL 2GY5A 3FN0L 5EIIB 1IAKA 2O5ZL 1F6AB 4M7JL 5K33A 4RFOH 3CFCL 5CWSA 3TJEL 2A9NL 4N9OB 5C0BD 2OTUB 5DJDA 4Y1AB 5E2WL 4QOKE 5JR1L 3OXSB 4V2BA 4MXVF 3WBDA 5FM5M 1TFHA 1V3KA 4H8WH 4UV7H 1T66D 4PJAF 4RWHA 4MDJA 1HKFA 5IBTH 2UVFA 2F15A 3GJEA 1S9VB 2R0ZH 4I2XE 1G9NL 1IKNC 4JY5H 4AH2A 3MJ8B 4D94A 5JW5A 2FJHB 4PB0H 1HXYA 4I0KA 2IWGA 3QIUD 1D9KD 1KCUL 2ATPA 3TCLA 2G60L 2BHUA 5DTFA 1FPTL 2F53D 3GMNA 3AREB 3T4AB 4ELME 4ZPTB 5CLTA 4Q9BA 5DEFA 1JMXA 3WCYA 4U7KA 4EDWH 2OQJA 4FFWC 5TF1H 3MRKB 5TDOA 5FHBL 1A5FL 3VG9B 3FTGB 3CH8A 4ZOBA 1XIWA 4EN3A 3BIKB 4XT1C 1J1OH 1NSNH 3FJTA 4MLSA 3QQ3A 3S88L 2IPUG 2UYLB 3TBWB 4M7KH 5JA9A 3ARFB 3T4YB 1IZJA 4KAQL 1WJ3A 4U1SB 4DFIA 1DANT 3QG7H 2F54D 1EAPB 5IVNA 1XF3A 4L9LA 1U91A 1VADB 4KJPC 4KFZC 2MPAL 2YOCA 5BRZE 5J89A 4CMHB 4L3EE 1ZHLA 4OFDA 2VB5A 5AUMA 1HH6B 1NCNA 4PRIA 2BJMH 2BOBB 1OTSD 1J8KA 4NZTL 3RVVC 5MHSD 3FQTB 3BIAX 4PBXA 3VJ6A 5ICXB 4MD0B 4Y4HA 3V6ZB 3MRCB 1NFDB 3RTQA 3OKKA 4GW1B 4NQDA 4V1DA 4JN2B 3V4UH 4HIIB 2QHLA 1S9YA 4LRNH 4OZIF 1E4KC 1PYWA 4Q0XH 1J5OL 1RIUL 3C8KA 3IAQA 2YK1H 1CFQB 2MCPH 4ZG1A 1EA9C 2EXWD 5GRJH 4K94L 5IB5B 5D7SH 3X3FL 2VIRA 4GRLC 3I6LD 4HXBL 4WEUD 5DMIH 4X4YA 3M45A 4TSCH 1RMFH 2HA1A 1X4YA 2NYYC 1CLYH 4JRXA 1FC2D 3THML 2VXTH 4APQD 3BMWA 4EZMA 1WGOA 2V7NA 1G0XA 4N8CL 1Q72L 3MV7D 5J1AA 1NFIA 1YJDH 3FQRA 1QZ1A 4HGWB 7FABH 5E95B 5ALBL 1DUYA 1A4JA 4F58L 4MA7H 3BPCB 3VXUB 4TTGA 2UY6A 3MRDA 4L1HA 1CD1B 4RMSA 4OV5A 3MLPA 4ODSH 3UTOA 5FYKL 4NRZA 5EZOL 1EFQA 3T0EC 1IM3B 1SQ2N 2ZOKB 4CRPA 3ZL4L 5D7IF 4J23A 4KV5F 3VH8A 3MFFB 5DMGD 4JHBA 5LXGL 4BYHA 3KPOA 2IQ9H 5ANMB 1P7QA 5HYQA 3BQUD 3AB0C 3F58H 1B6DA 1QRNA 4OQTA 1BZ9B 1LHZA 4W4OC 4WCYH 3VMOA 5FKPA 1DUZB 2WUBH 5GPRA 4KGLA 3DUUA 2DQUL 3I6GA 3HR6A 3KPLA 1F3DJ 4HWBL 5EOTB 1C7SA 1I8LC 4WWKA 5C92A 3F65A 2K3TA 3BP7B 3G04B 1I9IH 3CXDL 3C6SA 4YHOL 4G9DA 3X13B 2VZTA 5JHLH 3HMXA 3U7YL 1XZ0A 2JELH 5F21B 4YHPA 3H0TA 5FK9A 5FUZL 4WUUA 1OVZA 5DJAB 1C8PA 4HD9A 4U1IB 1ZVSA 3DX6A 4BM7A 5H37G 3MV7A 4NQEA 2ZUVA 1J0JA 5EU6D 3C5ZC 5EUOF 4XMKH 1G7QA 4LBEA 1IL1A 3DX8B 3H9SB 1YEIH 4OSUL 4JGUA 5GGRY 3PWUA 1D3CA 5EC2A 1OTTC 2CIKA 4DTGH 4F7CA 2NQCA 3OKEA 4WFHD 4R2GC 3U46B 1KFAL 4JFFB 1SEBB 4DGVL 5J6GB 1UM6H 3RIFK 1YEKL 3SKOB 4KHTL 3UYRH 1T1WA 3O4LE 1QPXA 3KS0J 5F7KC 1JGVH 4M7JH 5HHMB 5M94B 4R7NA 3ZKSD 3TJEH 2D7TH 5CLWA 4B53A 5INDB 5JR1H 4NQXB 3O2VL 1PG7W 3TN0C 4U1MA 3I85A 1PG7L 5BMFH 4YC2C 3LVEA 2DIJA 4FQ1H 5GS1B 4F37F 3ULUL 4WV1B 4R4ND 4B41A 5D2NB 3IU3B 3BGMB 4JFQB 3KPMA 6CGTA 5HD8D 2N1KA 3M1BB 3ARGA 4L1DA 3T8XB 1G9NH 1FE8L 3GMLA 4XP4H 4CN1A 1VB9A 4MJ2A 1EXUA 3BESR 3T0EE 1MHEA 4HK0B