5I66B

X-ray structure of the fab fragment of 8b6, a murine monoclonal antibody specific for the human serotonin transporter
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
213
Chain Sequence
DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSIPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures and mechanism of the human serotonin transporter.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords 8B6 antibody, heavy chain
total genus 52
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i66B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i66B01
3MBEA 1DVFB 2ERJB 4HUWB 3O6LL 1LNUB 3V4UH 4LMQE 5IHLB 1MREH 5ESQA 4XPHH 1D6VL 1NMCB 4HV8A 3I02A 1U8JA 3GKWH 3X13A 5HVGB 3MRGB 4FABL 2CLVB 2GEEA 3U2SB 2F58L 4H0HB 4CN6A 2AK1L 3N1PC 1KC5L 2H1PH 4L5FH 1I1FB 4BFBD 4XPBL 5J1AB 3P77A 5ACZB 1BM3L 2N56A 3ETBF 3ZTNH 3DETD 4OCXL 5DJZA 2CO7B 3DYMA 2VZUA 1JF1B 3CXHJ 2GJ6A 1SEBA 2X9YA 2JIXA 5F3HA 1KTRL 4EBQL 3CC5A 1ZHLA 4NQDB 4OD1H 2VR4A 1ZEAL 2G75B 4H20L 1EHXA 4NC2B 2Q8BH 2FATL 4G8GA 1UJ3A 1DFBL 1BVLB 3UAJD 1S7QA 4NWTH 4I8DA 4PJCB 4ZUWA 3QULB 2H9GB 4G6AC 1VHPA 5CWSB 3RWDB 1CFTA 3H2WA 4XRCB 1EFXA 1X5FA 5ERWB 3FO1A 1B0RA 3V8CA 2OMNA 4DQOL 4ZO9A 4ZPTB 1BJ8A 3I3BA 4M4PA 1RD6A 4ZOBA 5DUPH 5F44A 4O58H 2GITB 3KJ6H 3VG0L 3BZFA 2AJSL 2B0SH 3MZGB 2EXYC 3L3DA 4CRPA 4ZNEA 4FFYH 2BVOB 4FQJH 3UTQA 1JI2A 4H8WH 1G7PA 5GS1C 5BZWA 4M61A 2AXJA 4YDVB 2ORBH 4LDEB 4ZSOA 3GJFH 1XGTB 4ZG1A 4BZ1L 3QDMB 3NH7H 2CMRL 3QHZH 4YHLL 1YEKL 5MP6H 2DQJH 3V6ZB 4U1HA 4MD4A 4HKZA 5MEPA 3IU3B 4RFOH 3HMXL 1KNOA 1INQB 5ADOL 2EIEA 1RJYA 4KKCD 1R6VA 5IB3A 4I0PC 4OQ1A 1UZ6F 5KVFL 4MX7B 4Q9RL 5ISZB 1FP5A 4LASH 2FX7H 1A1MB 4PJGE 1FORH 3VFGH 4M6NL 3HS0A 1P4IH 3MLXH 1TVHB 4LU5H 5C2BH 2XZCH 2GCYA 4Z78A 4RMWA 3RWFA 5MP6L 1LK3L 4HMCA 4G5ZH 3CPLB 4HMEA 2AKRB 3QEQA 1QRNA 1HHIB 2ZUUA 3LN5B 3D69B 2ESVB 3R1GL 2BERA 4JRYA 4LSRH 2B0SL 4F9LC 3NCJH 2O93L 3TV3L 5KTEH 3SDYH 4QRQB 1J18A 1F4WL 3P30H 4JKPL 1AD0A 1TETH 1MCOH 4LIQE 3HFMH 2CIKA 4NOFA 4P4KC 3U9PL 1XIWB 1JPSH 5F88A 1F3JB 4ZO6A 3WFDL 3LN4A 1QACA 1E6OL 2X70B 4FFZL 4TRPL 1JGLH 3H0TA 4OFVA 4PJCF 5C0BA 3ZYIA 5BS0B 2XXMB 3P9WB 2AXGA 1A14L 4HIJB 1TZIB 3MRKA 1OAKL 5I1IL 2NTSP 4NC1E 3D85B 4M5YH 1JCKA 3QO0B 4ODVH 4X7FC 4JM2D 5ISZE 4EZMA 3HMXH 5TJWK 5GSVA 4PJ9B 2YD4A 4HUWA 5IOPA 1K8IB 3AREA 4GH7B 3T4AB 3HZVA 5I19H 2CD0A 2JK5B 2AV7A 1JNJA 4ONFH 3S36X 2R0ZL 1FN4B 3UBXI 4J3OC 1GOFA 1AY1L 1MEXH 4ELMB 1NQBA 3QFJA 4JZOA 4Y4HC 4MJIA 3RGVB 4PRNB 1TLKA 3EHBC 5IVZB 1FFPA 1XCQA 4AEIL 2VTFA 1V7MH 3O3BB 2DM3A 1A9BB 2VB5A 1I8IB 4YHOH 1XGRA 1U3YA 5DQ9B 1WT5A 5TQ0H 5DQ9A 3BRGC 1NBVL 3MUY1 1CE1H 5GRJL 3QFDB 2GJ6B 5IW1B 5J6GB 1LEGB 2OTUB 2DTML 1DQTA 3EYVB 5L2KB 4RFEA 3O3DA 3DO7B 2WWMC 5T1LD 5CEXA 3QIWA 3QDJE 4LRIA 3GSQB 1JYWA 3SGKC 5C0AE 3BYTA 1G9MC 4OCSH 1J12A 3BKMH 2J12B 4EN3A 4F3FA 4PD4J 3MLWL 2X4TB 1MRCL 2H3NA 2DMKA 2H3NB 4K7PH 3FN0H 1I1RA 3U7WH 4OGAD 3KNBA 1EGJL 1CFTB 5BXFA 3UJTL 3HHRB 4JANB 1CTOA 4ISVB 3S9DB 5TF0A 3IDJA 1U36A 5AG9A 3RZCA 1E28B 3VWKA 3MOQA 1YNLH 3QA3A 5KG9B 1YY9C 5IG7A 1IAIH 1P1ZB 1Z3GL 4AEFA 3DVNA 4I18C 1UA6L 4XC3H 3ES6B 3HMWL 4NM4L 4O9HH 5L8JB 5ESAB 1S9KC 2JJSA 5F7EL 1YMME 3T2NL 5C0IA 5CEZE 5H37H 3I75A 1WLHA 4ZS7H 3G6JB 3W0WA 5GGTH 1MH5B 1YC8A 2APTA 1IARB 2VE6A 4JFZL 4D3CH 5BJTA 4OF5A 1V7NH 2YRZA 3BRFA 2X42A 2RR3A 1FSKC 4QNPF 3MRPA 1P6FA 4ELMA 1JN6B 3TWCL 3LVEA 1Q1JL 3OSKA 5JNYB 2XTJB 1IT9H 5HHPA 2YN5A 1I1AA 1Q72H 4J3WA 3CCHA 2PTTB 3I2CL 1HYRC 3VMPA 2BRRH 5DJ6A 2OXGA 1M7IA 1BZ7A 5C0DB 3BH8B 3U4EA 3D3VD 4JG0L 4WUUA 1A7PL 2JB5H 1KGCD 4Z77B 2IWGA 4L4TA 4GFTB 4MB3A 4P9HH 43CAB 4GRWE 4G80A 4ODSL 4BUHA 5IMLA 5I8KL 3HE7D 5CINH 5T1KB 3K8MA 3FTGA 3FTGB 3WIIL 4QHLB 2H2SD 3ZKQD 1Q1JH 3KGRA 3TP4A 1KCKA 1N8ZA 2CKBB 4R26H 3RU8H 4S1QL 4RIRB 4Q6IB 4DCQA 5JO5A 1N5YL 3W82A 2XZAH 2JJUA 3OB0K 4YGVB 3EOBB 3MBXH 5GXBB 4HKJA 1I8IA 1GH7A 4PJXB 1MVUB 3ULSA 5GPRA 5B38A 3V4PH 4S0TD 1M71B 2A1WH 4KXZH 3NCFB 1KB5H 1IAIL 3PHQB 4P2QD 2AERT 4Y2DC 1HH9A 4XC1H 5KS9A 5IWLA 3RZCC 3QIUA 5HHVH 2W1NA 3TPUA 1ZA3A 3BRDA 1JN6A 5FDYA 5J9PB 3QDJB 5DC0A 3RGVD 4RQQA 5D1ZA 1QSFE 2HVJB 4P9HL 5BVJB 5K9QI 4AL8L 1Y6NR 1E6JH 1FCCA 4R0LB 2OJZL 4OUUB 2Q6WB 1WWWX 4HIJA 4Y1AD 1LK2A 1E4XH 5CZKA 1ORQB 2V17H 2DQTL 1P84J 3WE6B 1D6EA 3UTSA 3DVNB 5FYKD 5K59F 1IGFH 2V7NA 4M00A 4IMKA 3T77A 4H88L 4JG1L 1OAZH 3WIFA 1J1XL 5TGBB 2ADFH 4WV1B 3VGBA 4YHOL 4NN6C 3VXUD 4UQ3A 4WFEE 4XBEH 1QFUH 4Z95L 4EBQH 2VLJD 4JLRA 1KN2H 2DQDL 2IALB 2HFEB 4JVPA 3WIHL 2OR7A 2OL3B 4FFWD 4CVZA 1SHMA 4MNGA 4PGCA 5DUBA 3S34H 1E4JA 5IHUH 3MREB 4FQIH 1SM3L 3IDGB 4PJXA 3GSWB 4L29B 4L29A 5B38B 4BYHA 3L95A 1KJMA 4PJIE 1LEGA 3TCLA 5IW1A 5J6GA 3NFPB 4XNMB 1A6AB 3JV5A 1S9VB 2HKHH 2R2HA 4UIKH 1A1OA 3GHBL 3GIZH 4YGAB 4OLYH 1JHKH 1HSBB 4FQCL 4MDIB 3GK8H 4X5WB 5I75C 3MV7E 2X7LA 3EJZC 4EDXA 3G5ZA 5A2LH 5I1HL 5DHXB 1KG0B 2DQHH 3ARDD 4ODTH 2OK0L 3KPSE 2H9GA 5GGRY 32C2A 1JZ5A 4IRZL 2WLYA 1U91B 4JFQA 2VKXA 4NO0D 2VDNL 5LXGH 3QNXA 3S34L 2PYEB 1RU9H 3QBTB 4H5SA 4NQSA 1LK2B 4D9RD 1OLZA 2HVKB 3T0BA 4XP1H 4P5KA 3WIHH 1ORQA 4Y4FC 3VRIB 4X0KB 1MHPH 1WC7A 2AABL 5ISZD 5EC2B 3UPAA 3VWKC 4PJIA 1QRKA 2ZSWA 3QCTL 3ZHKA 1TCMA 4NDMB 3WN5B 9CGTA 5DJDA 1S7UB 3CLEL 4J8RB 4L4VD 4MXWH 4O2CA 4PJXE 4M6AA 5C9KA 2GUOA 3F6LA 3TGXA 4URTB 5FOJA 4C83B 5KW9L 5HDBE 3QQ3A 4DUXA 4YDVA 2X4UA 3VFVB 2DMBA 3N1MC 4BFIB 5DMJB 4PBVC 2OL3A 3PG2A 4Y4FB 4LPVA 1OGAE 3V5KB 3MRLA 3AU1A 3PDOA 4UUJA 5CEYA 4UDUA 5C2BL 2W0KA 1YN7B 1T21A 2HA1A 1OP5H 4F8TA 5I1LA 1REIA 5ILTH 1SY6A 4Y4KD 3QJFA 4XP5L 2X1PA 2YPLB 5AEAA 3IETB 3T0ED 4Y5XC 2R69L 2R15A 1RZKC 1DVFC 1NCBL 1S9WA 1GXEA 3MRJB 3AM8C 3MACH 4YBQD 3IF1B 1B2WL 3B2UC 2V9QA 2X1XR 3AS1A 4F3FB 5BV7B 2I60H 3V52H 1KTDA 4Y16C 3RWFB 1AI1H 3HE7B 2KL6A 5TFSH 2D4DA 3T0EB 3BGFB 1KPUB 2A0LC 4EQ2A 3PE9A 5F9DC 1F4WH 5L2KD 5F9JB 2DLFH 2BSRA 2HYMA 4ZAKD 1KIPB 2F74A 3GSVB 1PLGL 3JUYA 5E94A 2C5DC 1XGRB 2VQ1A 3V6OC 5IHZB 3UZQA 3NA4A 1F3RB 4CVXB 1U8NA 3C60A 2VDKH 3FHAA 4WWKB 1CXIA 4PJDA 2VDPL 2F9BT 4KMLB 3PP3H 1WFNA 5C6TH 3CIQA 5DD0L 5HPOA 2HFFA 3SE9L 4NJ9H 1ZS8A 4Y4FA 5FYKU 1ZHBB 3GB7B 4TPRH 1OGTB 2XN9B 1HHHB 2YUVA 3H9SA 4ZXBB 4CGTA 1FGVH 3VMOA 2EDEA 2AXHA 4FMFA 4HUMB 1KTLB 3EFFB 4YHKL 4UNVA 3L3IB 1H15A 3A6OA 2HTKD 3D85A 5IFHL 2WWKO 1NUFA 2IADB 1LE9B 3DX9B 4RZCB 4POYA 2B7DT 4MWFA 1AR2A 3WCYA 2DQJL 4NSKA 1KCSH 4XXDA 3MJ8B 3RFZC 1EO8L 4ODWA 5E6IC 1CIDA 1V05A 4YBLC 5D7KE 2F8OA 2FR4B 2YBRB 5DYOA 1LP9B 3HNSH 3HI6L 1WUNT 2FB4L 5CJOH 1OQXA 4M7ZB 3NPZB 2BVYA 2J2ZA 3WXVH 2DQDH 5TDPA 5LGJA 4GAJL 1XGUA 4NKOB 1II4E 4X4XB 2B20A 1OGAB 1GL4B 3FRUB 4YGVA 1UZ6E 4JO3H 3OGOE 1WIPA 3DO3A 2ZPKH 1T21B 5I1EH 4AEIH 3VGAC 2HMIC 4N0CC 4Y2DD 3SEPA 4PRBA 2UWEE 1TNNA 3I3DA 5CGMA 3P73B 3WO4B 3Q6GH 2VLKB 2V5RA 2Y7QB 4P2QE 5T3ZE 1YNKH 3E6FB 4M1DH 4OLXH 4Y5YA 4J2XA 4ZMAT 3PV7A 1JGDA 3MLSH 4DKAA 1LDSA 5BMFL 3IXAB 4YUEL 2VLKE 3IXAA 4RGOL 2ENYA 4ZS6C 4WNQA 4OCNC 3RNQB 4ERSH 4HT1L 2DICA 4NP4L 5C0AA 3WNLA 5JW3H 1IMHC 2Z8WC 1X7QB 3DMMA 1ED3A 4KZEH 2BVUA 1C12B 3O4LB 1U3ZA 3X3GL 3FN9A 4WEUD 4BZYA 5C9JA 3TYFA 5KAQG 3MLUL 2XTLA 3MRHA 2OJEB 5FHAL 3MRNA 3GM0A 4LSVL 4M6OH 5MI0C 4I18B 5I1CL 3EOTH 4G8IB 2IPTL 2ITCA 7FABH 1RVFL 2RIKA 1LP9E 2DQFB 1XGTA 3FKUS 3EJZD 1T03H 1F00I 3QDGD 5KTEL 3ZKNC 4AH2B 3ARRA 3V4UL 1X5GA 2BSSA 5DVMA 1FSKB 2FEDD 1F58L 3RGHA 1X9QA 3HCVB 3QIBC 1FE8H 3FRUA 3LD8C 4WV1C 4DJMA 2ZOLB 5CD3B 3UAJC 4ENED 1PKOA 4NQCD 3DHJA 4YR6A 5A40E 2P24B 3ARDA 5DRZA 1ZWIB 3GO1L 3K1DA 1U8QB 4HLZH 3H9SE 2J5LC 5DTFA 4JG0H 4LCCC 1NUGA 1UG9A 3IFLL 4KK9C 3RY5A 3NZ8B 3B6SB 2H2SC 3GNMH 1A3QA 1KB5A 3F7YA 2KH2B 3HS0B 1YEHL 4WV1A 3OR6A 5J1TC 3V0WH 4P59L 4DFIA 3ULUL 3O6MH 4KV5E 4HF5H 3DGGB 4JN1H 5DDHA 5EUOE 3KPRE 4XP5H 1MJUH 4X6FA 5FYLE 1KXQE 3PL6A 4I2XA 5DRXB 3K0WA 3CFJA 3D2UB 4G9FE 1UXSA 5DFVD 3QQ4B 3UBXA 4JRYB 1WBYB 3GSWA 2P5EB 4Z7UE 3TBYA 1CGTA 5EORH 1RULH 4Q58C 5E8NA 2X89A 2Y36H 5DC4B 4PJ5B 5DT1H 1AQKL 3V6OE 3WMSA 5A2JH 4D2NA 3SBWA 5L9DL 5KVFH 1C7SA 1G6RL 3V0WL 3RDTD 1UCBH 4PGBA 1GRWA 3CSYA 1RZJC 3PDGA 5IIEA 4DVBB 4NM8H 4QRTB 5IF0B 1VFBA 4LSDA 4H25B 3WNKA 4NRYB 5I17A 2BX5A 4ZS6D 1QR1B 3L3IA 1D5ZB 3GMMB 4JR9H 1AP2A 2HLAA 5ICXA 1YEKH 1CWVA 4I48A 2ZCHH 4HFUL 4M9PA 3PP4L 2EDXA 4GRWB 5IVNA 2C4FU 5HHMB 3O6FB 1YMMD 3UROR 3F5WA 2EEBA 5E03A 1KJ3H 1CFNB 3SCMA 5GGVH 4ELME 4PLKC 2WIIB 2XIDA 3S36H 1NUDA 3MUGB 4HPYH 4KUZL 1A0QL 1JWSA 5TE7L 3GJEA 2D3VA 3MRQA 1U8HB 3JWOC 2C9AA 4HK0A 3TH2T 4L4TE 4M4RA 3LN5A 1ND0B 1T22B 3VXMD 1BFTA 4IRZH 4KFZC 4FMKA 5FV2A 1KC5H 2VLJB 1OW0C 1L7IL 3DSNA 3IDNA 3CU1A 4ENEC 4XB7A 1H3TA 1VDGA 3ZHDA 3ZKXB 2BY0A 4E9LA 4KQ4L 4QRSA 3IS0X 1G1CA 3VRLF 4HJ0C 2IBGA 3I84A 4WTZA 4Q6YA 5IM7B 2XRAL 5TDOB 2VLLB 2GSGA 3ZE1F 1UM5L 2NY7H 3AB0C 5DEFA 1EBPA 4Y1AB 1W72A 5D4QA 1NCTA 3N0PB 3HA0A 5IW3A 1I1YB 5FO8A 4YXHL 2VLRA 3DRTA 2IAMC 3DGCR 4L3CB 1I8KA 5C07E 4JM2B 1NKOA 3QHTC 1YY8A 4JM2A 3G5YA 3GMMA 4BM7A 2R1XB 1NFDB 1CT8A 1KFAH 2VXTH 2JCCF 1EXUB 3CH1B 1F13A 4OJFH 3VXNB 3ARBD 1E28A 2V9TA 3CK0H 1A0QH 3I6KB 3WHE0 5EN2B 1ZTXL 1FC2D 2VLJE 2DIAA 3QWOB 2V9RA 3AAZB 1Q0XH 5E9DD 2DKMA 1JZ7A 1UVQB 4MLIA 3HZMB 2JJWA 5HHVL 5T3XE 3B2VL 4HIEA 2VSCA 2X4UB 3VFVA 3D39B 2JJTC 4OM0L 3HMXA 3M1BB 4GSDH 3QIUB 5C70A 3MPCA 3O2WL 1OLLA 3V95A 1RJCA 1JIBA 2VISA 1F6AB 3CD4A 5I30H 3RL2A 2GKIA 4GKZB 3VXRE 1CDGA 2A6KB 4UU9B 2V5SA 3FFCA 4XVSL 5CSZA 1GC1C 5C0NC 4GMTH 2QQLL 4EUPA 1S7XA 5DRWA 1GZQB 2CPCA 3KPSD 4M7ZC 5JHDE 4JN1L 4CJ1A 3M45A 2NZIA 1S3KH 1A8JH 4NHUA 4XC1L 3ZDZE 2X41A 1HSAB 1IM9B 4RDQG 5ICYB 3T77B 2NX5D 3MOBL 4J6RL 4NSKB 2OP4H 3C8DA 3CXDL 5T1KA 5J89A 3RZCD 2K9UA 2HFGL 4KK5C 4WFED 1OM3L 2Z93A 3MJ7A 4WHYG 5C6TL 4LARH 4U1JB 1TQCC 2H8PA 5JPMB 4KWUA 1R5IA 4YO0A 3PHOB 1F4XH 4MJID 4PJBE 1GJIA 1T4KA 3DTXB 2J8UF 5T3XL 1T1ZA 4YK4B 4JO1L 4DN4L 3P0YH 2NY2D 1N64H 4XWGH 4OLEA 4RWHA 1DBAH 3D2UD 4ZUUA 4FTVA 1RZJH 3KJ6L 1QVOA 2GUOB 1DCLA 1ACYH 5E1HB 3HG1A 2AQ2A 3GMNB 5I1CH 1S9XB 1JBJA 4OLUH 4X7TB 4X4YA 3T2NH 5IR1B 5F1OB 4M02A 5EUOA 1UYWL 2CRIA 4LLMA 4P3DA 4DEPC 3OXSB 5EWIL 2B2XL 1QFWL 4LVNC 2FX7L 1RUMH 4UTAH 4NRYA 3QUZB 4R0LA 4RRPG 4TQEL 5D71L 3TYGL 4Q9RH 1U8OA 2GHWB 1GAFH 25C8H 3TWCH 3BP5B 4K8RL 3RKDC 4WIQA 1M7IB 5C0JA 1YPZB 4YHYB 3VWKB 3O6FC 2VRAA 3WN5C 4PJ7E 3FZUC 3H9SD 5FDWB 1MRCH 2HG5A 1BJ1J 4L3AA 4PRDA 4L3EB 1BIHA 4DEPB 1I9JH 4OV5B 3DRQA 4WW1A 1N6QL 4XCYB 1PAMA 3PWPE 1JHTB 4R0LC 1DBJH 2YOCA 4UOJA 3EYSH 4QLRA 1RUQL 1F6FB 5F7DA 3IDMB 3MRQB 4XP6L 1LVEA 1MCFA 3HUJB 1C1EL 4X7CC 3VI4E 4OIIH 1A9BA 5D1XD 2VUOA 3IU3A 4FP8H 2X89D 4P2RA 5IVOA 4HPOL 5ANMA 1JF1A 3H3PL 4HQQH 1MAKA 3BYYA 3FT2B 5C09D 3D3VA 1FL6B 5MEOB 3QG6B 1KENL 4JFHD 3ZL4L 3KYMA 5JLZA 1TENA 1FZJB 4QHUB 5F7MC 2DTMH 3RX7A 1T0PB 4P5MA 5FIEA 4Z5RB 3U7YH 2FSEA 3MFGB 3TPKA 5IJKA 2F8XC 2F8VA 1K8DB 2Y4SA 1TVHA 3A67L 3O4LE 2XRAH 4P2CG 3DURB 5HVHC 1D5ZA 5I8OL 1HKLH 4DVRH 1EEZB 1U8OB 4GLRH 4FQLH 3SKOA 4D9LH 3I50L 4TSAH 1B4JH 4CDGC 1KBGL 1J0ZA 2K7QA 2QBWA 3B5HA 4MZ3A 2QR0A 1KJ2A 3TBWA 4DUWA 2VAAB 4LOUC 4HHAB 4NHCH 5M7QA 3OR7B 3OV6A 4I4WB 2ZUXA 4W6WB 1S7RB 4LVOB 5FYJU 3WS3A 3PWLA 5IHUL 2EC8A 1M71A 3NACH 4PJDB 1ZHKB 4NCC2 5F9WB 5BJTB 2E8ZA 3OAZH 2C3HA 5DD3L 4QOKE 4OI8A 5GS1A 8FABA 3KAAA 2R8SH 4EVNB 4R4NC 5HD8D 3ULUH 1IAII 5E4IA 1PLGH 4N8PA 2Q7NA 5INDB 4TUJA 4JFEA 2ERJC 2IC2A 5DD5H 1OTTD 1ZT4B 4M48H 4LMQI 2HMID 4PB0H 2VABB 2C1PB 5T1MA 4NO3A 3PUCA 4U7KA 1HOCB 1K2DA 4PREB 4O51B 5DF0A 1RJZB 1RJZA 2BRRL 3CFCH 1P84K 1YJDL 3B6SA 2GQHA 4R2GC 4JKPH 4K9EH 3OKOB 4AEHH 2YA2A 1SEQL 4NC1C 1BZQK 5LBSL 5SWQA 4F57L 3VXPA 5A16A 3F12B 1YJDC 4W4OA 3BHBB 1I3RA 3PGDB 4DN3H 3PF2A 4UV4L 5D5ME 2EIZB 1A1NB 5HDLA 4OCWH 1N0XH 3EOAB 1RZIA 1RK1A 2X4PA 4IRSB 3FAWA 5EORL 3ZO0A 4NZRL 5B4MD 2CUMA 1RZ7L 1NCDH 1IKFH 1HWGB 5C3TA 3KPOA 1CDJA 3RWIB 1XH3A 4PJCE 4RA3A 5D1ZD 1PX3A 2WP3T 4FTVB 4MJ2A 4PIRF 3QXWA 4QTHA 3C60B 2CIKB 3MROB 4H1LH 2XKUA 2Y6SD 4ZNCD 1HH9B 3B2VH 2X9XA 2J88L 2WK2A 4KQ3H 3NFNB 1J10A 2V2TA 4IMLB 1EUTA 3S6CA 4F57H 5IBTL 4R2GD 1GZPB 1F3DJ 1PVHA 3MV11 1PG7W 1TJIL 4UT9L 5HPMA 3QQ9D 5I17B 2CKBL 4G9DB 1TTGA 3HPJB 2V5TA 3TO4A 1H15B 2CR3A 1K85A 1CT8B 1TZIA 3FO1B 2AXGB 2MHAB 3QHZL 4PRAA 1U9KA 4NO3B 4OFYA 5LXGL 4H8WC 4RAUB 3Q6GL 3AS2A 4ZUTA 2MOVA 3OKEA 3L3KA 1AXTH 2VDOL 3CUPA 2J4WH 2CXKA 1FE8L 1X6LA 3FN3A 3MNWB 1OSZB 3Q2CA 4EI6B 3FB5B 3KJ4B 4IJ3C 1CG9B 2BHUA 3MCKB 4BQCA 3O8XC 1MNUL 4GBXA 4M61B 4Q9QL 3VFRB 4HS3A 3LKPB 2I07B 1GSMA 3STZA 4E42B 2JIXD 3NVQA 2VISB 4MJIB 3JXAA 3GZKA 3QFJB 4JZOB 3AU1B 3PDOB 4X4XA 4XMLL 2APXA 5LGJB 2IAND 4F80A 3OKLA 5L7XH 3IDGA 3G9AB 3UC0L 5AWNH 3KJ4C 4IJ3B 2FCBA 4KK8C 2AEQL 5FYJH 1UM4H 1A6UL 3B83A 4LPUA 5IB5B 1FFNA 3QUYA 4PREA 2DLEA 4RBPH 5HGAA 4DVRL 4KJQC 1QFUL 1CXLA 5ITFB 3T3PF 1IC7H 5B39G 1CICB 1M6OB 4HUXB 3QUXD 3QNYB 4LCWB 2Z31C 3SDCD 3DIFB 4NKIH 1H3GA 4XVJH 4GMSH 1T0NB 2Y72A 1G0DA 2R9HC 1F8TL 2VN7A 4LNRA 2C1OB 1I9RH 4LNRB 2P5EE 2VLRB 3HI1A 3QP3A 1BVKA 4JFQB 4WW2C 1OARL 4LPXA 3G5YB 3KPRD 4NJ9L 3EAKA 4Z7OE 3CMGA 3WO4C 2Q6WA 4PJHA 5E2TH 3PDDA 1XIWC 3HNTL 3VD7A 1AO7A 1WSST 3TT1H 1JPTL 2J8UB 1JNHA 5CEZH 3LD8B 2ZUVA 1MREL 1N5AB 2FYYB 2RHEA 3ARGD 3IFNL 4KJWC 1DL7L 1FNFA 5I76A 5MERB 4WUKH 3FFDA 2GTZA 2Q3ZA 1A5FH 1G7PB 4Y5XA 1GGIL 5E6IB 2UY7A 3L5XH 1FZOB 3STZB 4E42A 2FHCA 3BPLC 3BE1L 4C56E 2CDEA 1P4BH 3SJVB 5GRUL 1NC2D 4WI9A 1OM3H 4S1SH 4KKAD 5FHBL 3GMPB 4XPTL 4KMQA 4OZ4B 3PWPA 1NDGA 2AP2A 1UWXH 1F2QA 3QUMH 4UT6L 5I71C 4RDQF 3WFHA 4GRMB 3CLFL 5E6ZA 5K9JH 3K4AA 1HEZB 1BJMA 5F1SA 1GOGA 3RHWF 3SDXF 2YR3A 5BQ7B 3S88H 1HSAA 5GZNC 2BNUA 3WKML 2NY0B 5A3IC 2D31B 1HQRA 3P40A 3QIWC 1K8IA 3IU4L 1Q0YL 1VFAA 3SGKA 3DYPA 1KJVA 2OZ4A 5L0QB 4P5TA 5MEQA 3LS4L 1QLRA 4E0RB 4ZFFB 4GW4B 1J1PL 4K3DL 1OAUL 3K1KC 4NKQB 1XMWA 5DJAA 4XP4H 5IROC 4F33B 4HK0B 4YZFF 2A73B 5KW9H 3PWNB 4JB9L 1FO0H 4IRSD 1Y6MR 3C6LB 1DANU 3TVMB 3JV4A 3WLBA 4YK4C 3JV4B 1DL7H 1T1XA 1IFHL 2CUHA 2GY7B 4WU7A 4QGYA 4A6YA 4KVCL 3VU2A 3OGCB 4KJYA 3CX5J 2BVQA 4MXVF 5JIHA 2ICEB 2PW2A 3EJYD 2DMCA 3MNZA 3FT3B 4U05A 1NAKL 4PJFA 5E8PA 3UJIH 3LHPL 5C0BD 4LCWE 4W70A 3AUVA 1L7TH 4IOSD 3ULVF 3OXSA 3HNVL 4Z7NF 1KUMA 1MFDL 1QR4A 4LLMB 4P3DB 2P47B 4Y5VB 3EFFA 1B0WA 3RWDA 1DBBH 3MNVA 3R8BB 4PRHB 4WFGE 5BXFB 3RL1A 2Q76B 4NQEB 1I4FA 2HTKC 5DQDL 3L5HA 3T1WA 3F7VA 2ATKB 4NP4H 1GZQA 2VLKD 4PGDB 4HWZB 4PRIA 3HI5L 4XPTH 4RFOL 5D6CA 3C5ZD 3LKRB 1DE4B 3BPOB 2IG2L 4KI1A 4MJ6B 2D03H 4RNRA 2NY0C 3LKOB 3HMWH 2OBGA 4JDZB 3W39A 1KENH 1ES0B 1Q94B 2QSQA 2BNQE 4Y5XB 3OJDB 2IH3B 5H35A 1SVCP 5JW5B 2WM0A 3GJEB 4JQIH 3FMGH 4O5LH 1FFPB 4C56B 4FNLH 2QADC 4HKZB 3M17B 5BV7C 1JGUL 1UWGH 3WNMA 3DETC 3ARBC 4GAJH 2DKUA 3PQYB 5ID0B 1HH6B 2IAMB 4UQ2B 4ZYKA 3JTSA 2EDYA 2E7LA 2RAMA 3O3AA 3KXFD 2HJLA 1J8HB 4E5XB 3BGFC 4UDTB 4NKMB 3DMMC 5LGHH 2YC1B 1J86A 2VC2H 5B38G 4P3CL 3ULUC 3V7AE 43CAA 2PYEE 2KZWA 4GKNB 1KCSL 4R7NB 1G7MA 12E8L 1RUAH 3C5SB 4NQED 5AYUL 5FUCE 1YEIL 3RNQA 3EZ8A 3KNBB 5GS2D 2VL5B 4JY4B 5T1LB 4JPVL 1AFVH 4XXCA 4WU5B 2OTPA 2CGRL 3BZEB 1IAOA 1UM4L 3NPSB 1U58B 3QDGB 1CFVH 2QLVB 4Z7VA 1CFSA 1CVRA 3IFPA 5KAQF 3HC0A 4H26B 1CR9H 3SGDH 1HXYB 4YHNA 3RWIA 1JE6A 1WFUA 1EHLH 2FL5B 1IGCL 3QCUL 1NKRA 3U9PH 3CX2A 5F89A 5K9QG 4Z7OF 1FZKB 3C6LD 2D7QA 4FZ8L 1UKQA 1FZKA 3ABZA 5JOFA 1A7QL 1A4KA 4BFEA 4BSWA 4PRNA 5IVZA 3QISA 4S1RL 3QUZC 5BVPH 4TQEH 3O11A 2HKFH 4X6EB 3ZDXF 3CX5K 4DN4H 2B2XH 3DVIA 1NGPL 1ZKAA 1FVCA 4EEEA 4Y7MA 3O0RH 4I9WE 1UH3A 3OJMB 3T1FA 1U95B 4HCRA 4GRMA 4K9EL 5JXEC 4RMTA 1S7VB 1WCBB 2WBWB 4ONGH 2DLIA 4OCRH 5DLML 1UFUA 4NQEE 4DZBA 3GSNA 2A0LD 5J4MA 2YRLA 4RAUA 4Z77A 1FYTB 3E2HB 1DQLL 3DX9A 1CD8A 1T3FA 3P11H 1PGRB 4F58L 5C08E 2MKLC 5EIIA 4LCIL 2H32A 1ZLWK 3OF6D 4F9PC 2M1KA 4JAMB 5B39A 5ETUB 2VXSL 3BGMB 5EBMA 3VH8B 3MA9H 4XVTL 3VFRA 3QXUA 4BQ9A 5FO7B 3SJVD 4HBQA 4PRPA 3WLWD 5HGDB 5TDPB 3WD5L 3LKNA 4PV8B 3RWJB 5F7NC 4CNIB 3BD3A 4Z7VE 1BGXL 2Z4QA 4KKBC 5DA4A 4DGYH 2QADD 1CD0A 1WBYA 3L5JA 5I30L 1OVZA 1DQDL 3JWOL 1N6UA 4WU7B 4G6ML 2X40A 3TEUA 4OSUH 1AD0B 3CVIH 3G6JA 5C09E 3DARA 3UTQB 5EU3A 2XICA 4TNWF 1BAFH 2Z92B 4AENA 4DGVL 2IGFL 5T3ZH 1HCFX 2WUCH 4X80H 3C60C 4J23A 1VEMA 4K7FB 1OT1A 3SDDB 1PY9A 2GIYA 3CLEH 1NGWB 1HK6A 3QUML 3WFEL 1JJUA 2XFXB 1VFBB 1HZHH 4ZUVA 2IBZY 4QRTA 4TSBH 2VXQH 4IEFB 3AMKA 5C0BB 1PJ9A 2YMXH 5J0BA 1IC4H 4JDTL 3S5LA 1JMZA 3C8KA 4P2OB 5E6YA 1B0RB 6CGTA 4R90H 4P48A 2VDNH 1K2DB 2MWCA 1S9WB 1TZGL 4JZNA 1Q72L 5DMYA 1CXHA 3MLYL 2YXMA 3DX6B 5FYLL 1WBXA 1EEQA 1SJVA 1X4XA 1BREA 1KYOK 3H42H 5BW7C 2DDQH 4MJ4A 1CG9A 2XZQH 1MI5D 4W4NA 4HXBH 4KKLC 1AKJA 2DBLL 5JW5A 3ARUA 4XP1L 2G9HA 1FAIH 2XI9A 1A7OH 2QADB 4PLNC 3QFJD 1F6AA 1VGEL 1FPTL 1T7VA 3W11D 1I1FA 2B1HL 5F7EH 3RGVA 2DM7A 4PJAA 5LQBH 2G60H 3VXUB 2QKIA 2NY1C 2PO6B 3D48R 1AGCB 1YPZE 2EDLA 3NFSL 3SDAD 1JPST 2IMNA 3F58L 4ZTPL 5FA3B 3KXFA 1IE5A 3RUGB 3VGAB 4GXUN 4D94A 3KPQA 3VFUA 5DJXB 3BUYA 3LQZA 2IANA 4X4MA 3MRJA 1AHWA 4NRZA 4NGHL 4JO2H 5BZDA 2PR4H 1DBBL 3TVMC 4MGXA 3TBTA 4R7NA 3A0OA 2D7PA 4QYOA 4NC0B 3JV0A 1RZGA 1XEDA 3T09A 3GEWB 4L3CA 2PYFB 2YK1L 3G04A 1LO3L 3UTTD 2X2YA 4HUNB 1Z9MA 2BRQA 3MFFB 2BC4A 5GS0H 1NGXA 3D9AH 5EOQH 5IUSA 4PJFF 2XQYK 4ZODA 4UTBH 4NKDA 1Z0NA 2VXQL 3S36L 5DSCB 1MRDH 1YQVL 2HJFB 1RHHA 1I3GL 2AK4D 3E8UL 2PO6D 1R3LB 3TVMA 3MRNB 5GRZA 1FVEA 1Y6KR 2OJEA 3TIEB 4HWUA 5EPMB 1EVUA 4GW1A 5ALCH 4PUBL 3OWEA 2CH8A 4A6YH 2YA1A 2R0ZH 2YUXA 5FKAB 5JMRA 4POUB 4QXGH 5DUBB 2YHGA 1PQZB 4JREB 4NNYA 35C8L 1FO0A 1RURH 4PTUB 4X6DE 5KSVB 1JI1A 5D2LF 5DJ8B 1I7UB 4XNQA 3T2PA 1IKFL 3K80A 3IJYA 4U6XB 4U1KA 4AIOA 2D7OA 2OM5A 3AC0A 2ZCLL 5FXCH 3ARDB 5DRZB 2C1PA 3NIFF 1HEZA 3K2UL 1DR9A 1A7BA 1D6EB 1TVBA 3N9GL 3V7AG 4Y89A 1I7ZA 2WSKA 3EYFB 2A6IA 2IH1B 4JVUA 1TCRB 4FG6C 3DUUB 2ZKHH 4WJ5B 5E00B 2BCKB 3NCCB 2XTJD 5D9SA 5FGCE 2IBZX 2NXZD 1B6UA 4OIBA 1AGEA 1IQDA 5LWYH 1KIRA 4XAWL 1NPUA 3ZKND 4PJEE 3CFEB 2V2WB 3MA9L 2J8UE 1KJ2B 3PWNA 2A6DA 4YEEA 1CFSB 1QSFB 3VXUA 1AO7E 1QSFA 2FEEI 5IHZA 1UJ3C 5E99H 5CINL 3RWGB 2XKNA 1JYVA 1OGAD 3BSZL 3MUJA 4ODUA 4AEHL 3TA3D 3VH8G 4NNPH 5DMIH 3C6SB 3CFCL 4CL7A 5E5RB 3U36A 1AD9A 3MGOB 4AY0A 4IRJB 2QSVA 4N0UE 4CN4A 3ILQD 1WZ1H 5EFIB 5J06A 1H5BA 4QF1A 4HK3J 1NCUA 2NLJB 1VSCA 3EDFA 1IGML 1QEWB 2ZUQB 1I9RL 1I1YA 1NCNA 4PJXF 2ZNXA 3QB7C 2WBJC 1OQOA 3GMRB 2OZ4L 5CBAB 4ISVA 3C8KB 4JM2F 5CBAA 4OTXH 1WV7T 3MV8E 3RIAF 2Z35B 1A47A 4I48B 3OKDB 2IPUK 4QTIH 4XTRD 5JR1H 4YHIA 1W2KT 5KZCD 1JF6A 4HMDA 1LMKA 1J0IA 2YPVH 2DM4A 4WUUE 3S5LG 1JWMB 2Z31D 2YBRA 3SDCC 3U4AA 1JWSB 4KI5D 3BPCB 4MNQB 3D18B 1U8HA 3AMLA 3WIHA 5HVWA 3RJDA 3GKWL 3GSRA 3QZWA 3BIKA 3FONA 4EKXA 1DJSA 3SJVE 2Z31B 4YWGL 5F7HA 1DSFH 2AJSH 2DQGH 4FQQA 4ZFGL 3O3BA 3RI5K 5D1QA 5D6DA 1YEIH 1KCUL 4IRSC 4XZUA 5FCUH 3VXOB 3MLTA 2ADFL 2R0KL 1E4KA 4Z7WF 2Z9TA 1FNGA 2PNDA 3KPPA 4I3GA 1ERNA 1D5IL 1FNEB 4HJ0D 4OBRA 1RV6X 3VRJB 5IT2L 3ULVD 2AW2A 3CFKA 1DBJL 3CFKB 2X4RB 4NRZB 3U1SH 1AHWB 2YD9A 3DIFA 1WF5A 1FGNL 5DEFB 3MV8D 5BZDB 4OZFG 3LSOB 4LLYB 5ACLA 5KANI 4NGHH 3IDIB 3G6JF 1WZLA 1MWAB 4OQTA 3QUZD 3BJ91 3NABL 5SWZB 5KVGH 4M7LT 1WEJL 2SEBB 4JHZA 4P4KA 3N85L 3TNNA 5IHBA 2GT9B 4F33A 2N1KA 1GVIA 5CUSL 5I73C 3GSVA 3LEYH 1U8IB 1NLDH 1JZ3A 4WRLA 3QXDA 2O26U 4FQHB 2GTZB 1L4IA 1FL3A 1S5IH 4ZOCA 5CD5C 1VFMA 3RBGA 2W65A 1N7MH 1GIGL 1T04B 4OF0A 4NRXB 1XCQB 1MVFA 4XNYL 2EDRA 2AGJH 2YPKB 3H9ZA 2LTQB 3MO1A 1FBIL 3IKKA 1RY7B 3SE8L 4DKDC 2X4QA 1C5BL 4QRRD 1F6LL 4GLRI 3NN8B 4LBEB 2QL1A 4GG8A 1FIGL 1U8QA 3GI8H 1QSZA 5T1MB 1A6AA 3BDBA 3BH8A 1OCWL 3D1MC 2XN9D 4K7PY 5GGSB 1IEBB 1IM9D 2RFXB 3QNYA 4HUXA 4PJ9A 3IDXH 4FFVD 4XCFL 2MPAH 5CGYD 1XGPB 4IOIB 4P46B 5BCAA 1MCKA 5JA9A 1DN0B 4R4BB 4L8CB 4U1MA 2KDGA 2WUCL 4W6XB 4IIQA 2KPNA 3MRRA 5D7IE 5DJ0A 1UB6B 3FL7A 4CVZB 1IQDB 3QPXL 3CFEA 4NBYB 3QDAA 3ISWA 4HG4K 1YEJH 3NACL 5JORB 3BMVA 4E41E 4GG6F 2FBJL 2P5EA 1TITA 1BGXH 2LQRA 4MCZA 4PS4H 1EMTH 3BD4A 5SX4I 3D5OF 5IBUG 1FH5H 1LO2L 2QQQA 1NCBH 3VD4A 5DA0B 5H8DA 3WHE1 1T5XA 2FHBA 1MWAL 3LS5H 1CLCA 1ZT1B 5HHNB 3LRSA 1AC0A 1Z0MA 5D96C 3O3EA 1JRHH 1UKTA 2ZCLH 5DZOA 2X4TA 1KJ2H 5AYUH 4JRXB 2CLRB 2Q7YA 3QEQE 4PJ8C 1J0YA 3TO4B 5CKGA 3MCG1 4YFLF 3S5LB 5DVKA 1S7VA 4NQDD 1YPZA 4HBCL 2E5EA 4OV6F 1LD9A 5IMOB 5DTFB 5DEGB 4HEME 5IWLC 1IZKA 4X5XA 1VACA 3K8LA 5C86A 4NHUB 1JGEB 1K5NB 1ZHNB 3SE8H 5GGUA 1GOHA 4P57A 3FO9B 5GGTA 4QXTA 3TIEA 1NCCL 1I1AC 3FQTA 2GK2A 4GBXB 4KRMB 3FQWB 1RFDH 3MUGA 5BOPA 3VWJA 2NY1D 3QUYC 2NYYD 5GGTL 5D2NE 4MQ7A 4OGYL 4PG2A 4O00A 3ECBB 1RU9L 2ADJA 2VOTA 5HGDA 3V5KA 4J3SA 3QEQB 5GGQL 5F3BA 1JWUA 3R4DA 2Z4QB 1TVDA 5D2NA 2BVPA 1K3IA 1QBMH 2GAZB 5DJ2B 5DHYB 3THML 1PD6A 1X5JA 3GUTB 3T0XA 4L8DA 3QI9D 5IJVB 2WWMD 1RZ8A 2CRYA 3EO0B 3QEUA 1DBKL 1NANH 3EYUH 3LQZB 4LSPH 1MNUH 1KLUB 3UTSD 3W9EB 3OG4B 1A1MA 3LPWA 2GK0B 1AIFB 1A6UH 4K7FA 4NQDE 3SY0B 3GRWH 4LPWA 2EYTA 3FT4B 4GKNA 1KELL 1HHHA 4ZXBA 2FSEB 4EN3B 32C2B 4U0QB 3DRTB 1M7DB 4ZFOB 1S7SB 2QQNL 1OT2A 1KEML 3LB6D 2RQ8A 4CMHC 5FUCC 1NAKH 4U0RC 1ZAGA 5SWSD 3IDUA 1CLOH 1T66C 1MQKH 5GJSH 3RWJA 5IKCA 1BOGB 5DFTA 3K46A 6FABH 3QQ4A 4NQTA 5B8CC 2D4FA 1J8HE 4PJ5D 1DBMH 4N1EA 2P5WD 3O6LH 2BDNL 1N64L 4L4TD 1XF5A 3MJ9A 1I8MB 3WSQH 1JHTA 1Q94A 5E2UL 3GSXA 3DOSA 4IOFC 1Z5LB 4OI9A 1VB9A 5FM8A 3NIDE 4R90L 5L6YH 3CVHB 4XX1E 4JFDA 4PG9A 2YD7A 4A2MA 3RPIB 1BIIB 4WFFE 5DD6B 2YMXL 3G08B 1VADA 2VDQH 3MBXL 4P0DA 2Q7YB 2X4QB 4MQSB 4P23D 4GAGL 3X12B 2OI9C 2ZG3A 4X7SL 1MLCB 5CCKL 4MX7A 4PGJA 3MXVH 4QOKA 1EO5A 2DQCH 4JFYA 4JY5L 5ISZA 1EEYA 2ZJSH 5K9JL 2F19L 2V5YA 1K4CB 3PNWA 2O5ZH 4Z7WA 3P0GB 3ILQC 4G6JH 4UNUA 3DI2B 3BEWB 2G5BB 5EC1B 4C59B 3MLVH 3CZFB 1NCDL 5I1KL 3OPZH 5IB4A 3KYNA 4PJ5E 3WL9B 5KANG 5MEND 2VDRH 3TBVB 1MFNA 2VDPH 2BC4B 4EUPH 1Q9OB 1RSFA 1CICC 2A73A 1H8SA 3TF7C 1G7JB 3W9DB 5E24E 3WSQL 4C56A 1T1ZB 4DN3L 3BVNA 5E94B 1N3NB 2WANA 2LU7A 5DK0B 5A2FA 4JO1H 4S1RH 5J11B 1DBML 3TH3T 3BP6A 4I1NB 3REVB 5C6WH 5IP4A 2ZSVA 3MJ9H 3VXQA 5GJTH 3DBXA 3D9AL 5EOQL 3MXWH 4P23B 2HT2D 2VR5A 4IRJC 3KXFE 4PRID 1MFAH 3SOBL 4P2OD 2XN9A 3H9SB 1W72B 1SBSL 5DVLA 4PJ9D 4TUKL 4O2FB 3T1FB 5H2BB 2IEPA 2Q76A 5DRWB 4HSQA 1IC5H 4FOMA 3WUWA 4OLYL 1UC6A 3S3SA 4WI4A 5I66A 3KS0H 4WUUB 1BQLL 1V7NL 3GJFA 1W72H 4NCC1 3DECA 4L4TB 5CLTA 3B9KB 2AEQH 5FYJL 3SCMC 5HHXH 1U8IA 3GRWA 2VR9A 3FZUD 4OF3A 4WI2A 5F9WC 4WW1B 4OV5A 2LU4A 1FAKT 4GSDL 1CBVH 5DYOB 3M1BA 1D5MB 4UAOC 4ZSOB 1D5MA 2VZSA 3U2SA 3TBVA 4DTGL 3BKJH 1KIRB 2EKSB 3I50H 2MNUA 1LO4L 2V2WA 3OKNA 3RP1A 3B9KC 3RQ3A 5KN5A 3ZE1E 1YECH 2EYSA 3UBXB 3A6CL 2AABH 3X11A 1C1EH 3JWDL 1Y18A 4GAYA 3FB8A 2QV2A 1MHHB 3KPMA 5DEZA 1FFRA 3ARWA 3CXHK 4MCYA 4KK6D 4WO4A 1P7HL 4Y16A 1AXSB 3NMEA 5EO1B 5D2LE 2XPGA 4YPGA 1PX4A 1MLCA 4WFHD 1X5KA 2FNBA 2YC1A 3T04D 1N6QH 3O9WC 4JFYB 4X4ZA 1CICA 4LCWA 3S35H 5DGQA 1NBVH 1OGTA 5GRJH 2OCFD 4HULB 5I1HH 1OF2A 4H20H 5BVJA 5EOCL 1BQLH 1OTSD 2MMXA 1BFVH 3SGJC 3QEQD 4G6FD 4M5YL 2R23B 2UVEA 1Q9WA 2KQNA 1UB6A 1IC5L 3D25B 4LLDA 4LQ1A 4PJBB 4PJEB 4JGJA 3VFNB 5IQ7H 5B8CB 1L7IH 1AE6L 4N8CH 3B9KD 3ZTNL 1EBAA 1RJLA 4I2XE 4J7RA 2R0LH 5DK0A 4B5EA 2JKXA 4PFEA 4C4KT 1JV5B 4MNQD 1TZHA 4WW2F 5ITBH 4XPGH 3G5XA 2WIMA 2F58H 5LVEA 1S7WA 1KB9K 1W72L 2IALA 4HPYL 4G7VL 1F4AA 1QG3A 3X13B 5FOBB 3PQYE 1HHJA 4K2UH 4JHWL 2Q3AA 4K8RH 4NQCA 4OD3L 1S8DA 5IQ9A 3LQAC 1OD9A 2BFVH 1ZSDB 2W0FA 3TO2B 1K4DA 5JW4N 4X6DA 3UPRA 2VDOH 3NZHH 4U1KB 2L4OA 3FFCE 4EUPB 4TNWK 1WGOA 5D7JD 1AP2B 4X9IA 3VCLA 1GGCL 2VH5H 1I85A 2HJKA 1BZ7B 4OCLC 3VA6A 3DNKA 3BEVB 3LCYA 5GZOD 2IADA 1YQ2A 4AL8H 4YLQT 1OWRM 3MLXL 4ELKB 4L3EE 2IJ0C 4Z5RA 1INEL 4G43B 3IU4H 3QIBA 3O9WB 2ICWJ 3GMQB 3TN0B 2UZXB 3CSPA 5MENB 3EDEA 3WS6A 4QWWD 1FO0L 4QRPA 4LCUB 4WVRA 4RWYL 4LCUA 4LCYB 5TDNB 3VGGA 4BELD 3L5IA 3L5WA 3PHOA 1INDH 3WKNA 3CFJB 1U8LB 4AMKH 1EHLL 4R97B 1T2XA 3U30B 3AXLA 3EO1A 1NMBL 1A21A 3U0PA 4N0UB 3WYRA 4CVUA 4CMHB 4BZ1H 1A6VH 1MLBB 1IGJA 1XR8B 4NZUL 4FXGB 2R4RH 1AE6H 2GTWA 4R26L 5T3XD 4AM0A 1G7LA 1DEEB 3NPSC 4IDLA 5FK9B 3F8UB 1DLHB 1JZ4A 3NA9L 4LKCA 5D70H 3U7AA 3PL6C 5TDOA 2YEZB 1BIIA 1PKQE 1N0LA 3ARED 1D3CA 4QYOB 3OB8A 2EXWC 5KSAC 4U49A 4XVSH 4TVPH 4R3SA 5KSBE 4ZFZA 3HPJA 3LRHA 3PWPB 4G9DA 1W0VA 5AD0A 2VABA 1LO3H 4OQTH 1NAMH 3QO0A 3TJEL 1YYMH 1CF8H 3S4SG 1MFEL 4YNYB 5BV7H 5HDQH 1N4XH 3RPKA 3CDYA 1QYGL 2GJJA 2QHRL 4ZDHA 4YHIB 1KTKE 1CQYA 1A7NH 4LP4A 3HZMA 3MCKA 1FNAA 4UQ3B 1KT2B 1EAPB 4HV8B 4LSPL 2PXYD 3LPFA 4UTBL 4BJLA 5GSRA 4FN0A 3MRPB 1IAKA 5MHSE 3QDMA 3L5WB 1YPZF 1ADQL 1L0YA 4XBGA 3VG9B 1QLEL 1CBVL 4LSUL 3UO1L 1CGWA 5CJXC 4X99B 2BVTA 1RHFA 1I9JL 1BD2A 2IFGA 2NTFB 3MV8B 5I1AB 2AJVL 3DUSA 3VGFA 4P2RD 3VRJA 2P42B 1EHNA 3X12A 3QI9B 4NUJB 4JPKH 4KZEL 3ARBB 4L8DB 5IJVA 1NEZB 4GRLA 5DI8B 3T2OA 3QXAA 4PY8I 1K3ZA 3K4DA 4JPVH 5DUML 5C09A 5HGAB 1FYTA 1IEBA 1JNNL 4QRSB 1A64A 3NFNA 1FZJA 3C87A 5J9PA 4AG4L 3GBML 2NY3C 4P5MB 5SWZE 1ZGLM 4XCCH 3DX7A 3KYAA 5HYFA 3MLSL 2NY5H 2BOBB 1LE5A 2HT4D 2UYLA 4PRPE 3W0WD 1CD1B 4PJDE 5CWSA 2P8LB 2FECL 4XNXL 3DROB 4D8PB 1AGDA 3V6FB 1IRAY 1PYWB 1NC4D 3SGJA 4PRPB 1G7HA 5C92A 2HT3C 2AJUH 2VQ1B 4MNHB 2VZTA 4CMMA 1JNLL 1KEGH 2LAAA 4DTGH 2Y23A 1HXMB 2FR4A 3I3EA 3IKCA 3M8OL 1NGQH 4BFIA 5J3HC 1OAUH 1C08A 3WXWH 4KKAC 3WEXA 1IBGL 4YDIL 3RVXC 1EUUA 5I73B 2IG2H 2VO5A 4LAQH 4XNQB 3AREC 1XCTB 1WFOA 5HPMB 1NJ9B 4KAQH 4N9GA 4P9ML 1FORL 1MJUL 5I8EB 2HJKB 2BY3A 3ARBA 2MSPA 1HYSC 4HF5L 3BPOC 3WE6A 4N0RA 1UT9A 3BP4A 1BBJA 2D7NA 3LQAL 2A83B 3HNVH 4LCIH 4Y0GA 4BA8A 2ITDA 3ARGA 1QTYT 5JHDA 2W0LA 1S7QB 2WP3O 1R3JA 1DQLH 3C09C 4U1MB 1N5YH 2J6EH 3D18A 1T80A 3GSRB 3QZWB 2F53B 1G7HB 1TJGH 2DWDB 5CILH 4H1LG 4WUUD 3B9AA 4X9HA 2LAGB 3ROLA 2GITA 4UV7L 4C58B 5F1KC 4L9LB 4NDMA 4OGXH 4MXWL 5T3XH 4YHNB 3L3DB 4GW5A 2AJZA 2OL3H 1I3GH 5F1IA 3OB0H 5H94B 3TM6A 1EJOH 3FB7B 3ROOA 1YJDH 4P3WA 1QPPA 1XF2A 1A4JB 4NT6B 3MGTA 5TFSL 1T7XA 2FX8L 3PGFL 4RMQA 5C0EA 5CZXC 4M8QB 1R3KA 2NXYD 4OCYH 1MJ7H 2NX5A 2AI0H 2FD6H 3O3EB 4NRXA 2YEZA 1BVLA 1NGWA 1C5BH 1CR9L 1KIUA 4WW2A 5EO9B 2OLDA 1PG7L 4NFDA 3X3GH 3C5ZA 2W9DL 1FVCB 2CJUL 4GMSL 2EDDA 1DFBH 3QUZA 1J87A 2HT4C 4PRHA 1YEFL 3QWRD 2FATH 3WFHB 5I9QC 1KCVH 5E08H 4OZFB 3P4MA 2HLAB 1N7ML 5ICXB 1IC7L 1VERA 5KVGL 4RGMC 3QRGL 2FWOA 4Z8FH 4FQ1H 2R4SH 4P2QB 4YHMH 1G6RB 4Y4HA 1RVFH 1R3HB 4JREC 4KAQL 1BOGA 3L9RA 3B8SA 4B0MM 2W60A 3DX6A 1HXYA 1WWCA 2CRMA 4HIXL 3QNZA 4RNRB 1UM6H 4MAUH 1HIMH 4FQXA 3NH7L 4C83A 1T7WA 3L5XL 1PBYA 3CFDB 5SX5H 4B53A 3GI9L 4F2MA 2BDNH 4XGZA 2P43B 1S5HA 2FECI 3VXRD 1NGYA 5I8OH 3S96A 1T1WB 5CJ5A 4Y8AA 5EIQA 1B0GA 2OI9B 4ZTOH 1CLYH 3EDKA 5CJXA 4H88H 4YBLB 4F37K 4OCSL 1MCLA 3KHOA 3MX0A 2JB6B 5FA3A 1D7FA 2P8MA 4L4JA 1VFOA 1FNLA 2VIRA 4UDTA 3DX8A 2EE2A 5DMKB 1U42A 1U41A 1L0QA 3E6FA 4QHUA 1IM9A 2HH0H 3C9NB 2V5MA 2NX5E 2ILLA 4OLWH 5IM7A 1F3JA 2DI8A 4EDXB 1M6OA 3ZE2F 2OK0H 2X7LB 2VLLA 3H3PH 1UJ3B 2DBJA 2JJSC 1QEWA 4AIZB 4PJCA 4AT6B 1URLA 3QH3B 2F53D 1MIML 3RTQC 2IPKA 3DYOA 3U6RB 4XAKE 3VA2C 5IGXL 3C5JB 4F7EB 4JPKL 3FQUB 4UIMB 2EIBA 2YSSB 3HNSL 5KZCB 2Y36L 1AO7D 1HHIA 4YNYA 2W9DH 1KIPA 2F74B 4YFLI 1N3NA 4H26A 3HC0B 1CGYA 3LKRA 1MVUA 3ULSB 2VJXA 4MD5B 4CU7A 4HS6A 4ODWB 5EPMA 2NY2B 3B3IA 1B6DA 3FFDB 2ITCB 4HIEB 3MJ9L 4G8IA 1U3JA 5E8EB 3I02B 2Q8AL 4QRRA 2ESVD 3BW9A 2CR6A 3HE6A 2D9CA 3FQXA 4X8JB 3ZYOA 4WGWB 4UV4H 5DQDH 4G9FA 4JFDE 1QFPA 3BWAA 3L3HA 4AQ1B 3I6LE 1GC1H 4KKNA 4V1DB 4EXKA 1UH2A 3O11B 2IQAB 5INDA 3E6HB 1LO5A 2C4XA 1WIUA 5KSBF 5JIKA 2PYED 3WJLA 4MQXC 4OZHF 3H9YA 1G9ML 2XWTB 1J8HA 1A7PH 1L9NA 3VFUB 5GGRA 5ITFA 4CBPA 4OCRL 4OZIE 1U3HB 5IESL 2GJ6D 3KWWA 3EO9H 1HZHL 2H45A 3BZ4A 4ONOA 1RZJL 1DQMH 3B5GA 4JZJC 5J11C 3REWA 4ZD3L 5E99L 4XHJD 3GSNH 4H0IA 1IAMA 4PRPD 5D9SB 3W0WE 3WL9A 5CP3H 5IB4B 3KS0J 1XZ0B 4GW4A 1AGEB 2G9HB 2CLZA 4YC2B 2MQCA 1AR1D 4HCRH 4ODHL 4UIMA 4I2XB 1UXSB 1T0MB 4N1CA 2BJMH 3MGAA 4JKWA 3RNKB 1CXEA 1R3LA 4U1NB 4WWKC 3OKMA 2APWA 1U92B 1B2WH 4Z7UB 2DM2A 1I1CA 4PP2B 2CDGB 4IBLT 2Q86B 4RFNB 4RGND 1X5ZA 3MLPA 4KV5F 4KHXL 1T04A 1OAQH 2MPAL 1PQZA 4G8GB 1IZJA 2VWEC 3LDBB 5ADOH 4ZUVB 4PYGA 2XFXA 2C1OA 1KGCE 4MA1C 4FXKA 1W0WB 4GQ9L 1FNSL 1UKSA 1ZA6A 2JLLA 3U7YL 1OCWH 5K59E 1Q8MA 3S35L 1NUNB 1UXWB 5D7JC 3UTZA 2X10A 3MRKB 5I1DB 4HG4J 4Z18A 2XQBL 3WJJC 4HX1A 5DWUH 2E9WA 5DJCB 4DZ8A 4EIZC 4MNQE 1AGBB 1DE4A 2FYYA 2IMMA 5D2NC 1FVEB 5TF1H 1CZ8H 3QNZB 1IILE 3E8UH 2OS7A 1ZHKA 1EAPA 4FQXB 5JZ7D 2VE6B 4JE4B 2BCKA 4ODBD 3FQWA 2ZOKB 1ITCA 1JGVL 4KJQD 2I07A 3LKPA 2R1WA 5GS0L 3IYLW 4MVBD 4Z7VF 3D2UA 2VNCA 2IF7A 1Z9OA 3RVVD 5HYSG 3D69A 4NCDA 1JUFA 2H1PL 4N9GB 4Y4KC 3VRLE 1YMMB 3U0TA 3KPPB 1PG7X 1MHEA 1TPXB 3AS3A 4TUOA 1RZ8B 3QEUB 1BQSA 4KUZH 5IB5A 1X44A 1IM3A 3DMMD 4U2ZA 4QT5A 1DVFD 1D6VH 1Z2KA 2GSIB 4Q7DA 5KS9E 1CIUA 4PY8J 1V3LA 5I1JH 1KB5B 2DQIH 3KDMB 1QHOA 2YZ1A 2P5WB 1MFDH 3QULA 3F6IA 2VERN 5LQBL 2FH8A 5CIPB 5CKAA 1P6AB 1VGKA 3U6RA 3JVGC 4PJBA 3ORJA 1W0YT 2VYRE 3FQUA 5EOTA 3T4YB 2DJ4A 1RIHH 5IKCB 4D9QE 3EOBA 4TSBL 2XY1A 4I3SH 4P57B 3D39D 4JPIB 1ZGLB 4G7YH 1P7QB 1CZ8L 1OAZL 1I7TB 1QNZH 1HINL 4I18A 1T6VN 2P49B 2JK5A 3QQ3B 1WWAX 1TZGH 2RBLA 5CAYB 1QSEE 1FN4A 5E4EB 2BNQD 1I9IL 1SYSB 3SDCA 4QF1B 3PGCB 5EU4B 4R8WH 4PJ8D 2AJXH 3VFMB 2NLJA 1AI1L 4LLVA 3DXAB 5C0CD 4ZFOL 5IW6A 3J7HA 1DDHB 3BQUD 5JR1L 5D93B 1RZ7H 4Y88A 2EC9T 1ACZA 3LH2H 1QR1A 1TJIH 3HC3L 3MACL 5GGVY 4FA8A 4J3XA 3VCLB 2XV6B 3C2AL 4QXUL 4I5BA 3LZFL 2ARJB 3WKMH 2K1MA 2OZ4H 3HRZA 3OXRA 2R2EB 4EI5D 3IDYB 3EZJB 1YEDB 4MYWB 1JGDB 4R97C 3HAEG 4TOYL 2L0DA 4D9RE 4XP9H 2NXYC 2AS5M 1BQHA 1YZZA 5MEQB 1RURL 3RZWA 1KT2A 4FS0A 3BXNA 3QRFM 4ZNEE 5EBMB 3TC9A 3VWJB 3NIGE 3MRRB 3E1F1 4IIQB 4ONGL 5DLMH 3EIFA 1OOAA 2PTUA 5JW4R 3CH1A 2BY2A 5DK2A 1RZIB 4WI6A 5DRXA 1QZ1A 5KG9A 2BSRB 3PL6B 3WV0A 3O4LA 3TO4D 1T4KB 3DTXA 1OGAA 4KKBD 4ZOAA 4YXKL 1NFDE 1IL1A 2BMKB 3PWLB 4YHPA 4LLWA 1DQML 3SHSA 5IB2A 2AV1A 3S97C 5IVXB 4IS6A 5HDBF 4DK6A 4G5ZL 3BDXA 3O6KH 2YN3A 3HNTH 4Y8DC 4M7KH 5DURB 5JLZB 1R3KB 1DLHA 2GK0A 4PTTA 2I5YH 3P2TA 5E2WL 5HHNA 2ZUSA 3QIUC 4MAYD 3VFWA 5IV2A 5I6XB 3UYRH 4YE4L 4TUJB 5JUEL 1KPVB 2D2OA 1UCTA 1FZMB 1UZ8A 2E7HA 3DHMA 2R8SL 4L1HA 5IB3B 4TSAL 3MRBB 1YEEH 1RUPL 3HR5A 3IAQA 4NZTH 4KTEL 4MD0B 2D7TH 5DUMH 1SMAA 3UDWA 1NFIB 4KHTH 5J57B 1DUYA 2HJFA 4YHZH 5IBLD 4XH2A 3B9VA 4M9OA 4R96A 4J4PC 3CUPB 1BBDL 3UTTA 5I6XC 3DRQB 5JHDB 3LEYL 2G5RA 3RUGF 3QUXA 4QRPB 3QT2A 4KDTA 4U6TA 2AK1H 1NGQL 15C8H 4U6YA 1O7SA 2CLVA 4LRNL 3QPQD 5H35B 4XI5D 4YO0B 2COQA 3KLDA 3UDWC 3PABA 2RB8A 1MHCB 3VI4F 4QCIA 1ZK9A 1T1WA 3P4OB 3GIVA 1MPAL 1UEYA 2NTFA 5F7WC 4JQIL 1QYGH 3HAEH 3KXFB 4GG8B 1CGSH 3WHXB 4DZBB 1IM3B 2ZUWA 1YNKL 5LGKA 5CEXB 2X1OA 4Y5YB 5ICYA 4MDIA 3O8XD 1G9EA 3UYPA 3G5ZB 3HUJF 3D0LB 1R24B 3GGWA 5FA4A 4F7CA 2XT1B 1CQKA 3EDDA 1TXKA 3R06A 1V3MA 4MSWA 2FJFB 1ZLSL 3RVXD 1VGKB 3UEZA 4Z7QE 2EIZA 2O61B 1V8HA 4NBZB 4DW2H 1JGEA 1K5NA 2AJVH 4HGWB 5IMMA 5D6CB 4I4WA 3C6LA 1N5AA 3ZKMC 3UTTB 1BBDH 1FRGL 5MERA 2QJDA 2M8XA 3RJQB 5D7JB 5ABDE 3VXUE 3SO3B 5D7IA 2FX8H 2Y06L 3BKCL 4F7PA 4I13B 4ZUSA 2CIIB 4XT1C 4KRLB 1CDHA 1ZT7A 3LRSB 1JHLH 2LE9A 4P5TD 1T89C 4HAGA 2UWEB 3R1GH 1YEFH 5EA0L 3RVWC 3IAGC 1P5UA 5DURD 1MCPL 2Q20A 4XMKH 1KNOB 3TFKC 1OB1A 5EU5A 4YBHA 5I8EA 5K9KA 3LMJH 1YA5A 2EXYD 4RISL 3TLRA 2EDOA 2B8OT 3SKJH 1HSBA 3FB6B 1XR9B 1MCOL 5IMKA 4RSVA 4NM8L 1G0XA 4NN7C 3PL6D 3MC0A 5CZVH 3REWB 4K3JL 2YXFA 5HHOB 1O5DT 2JE8A 3S37H 1XGYL 3BHBA 1ES0A 2Y5TA 4UMGA 3IRPX 1XZ0A 1F11A 3C2AH 4QXUH 3T0EA 3VW3H 4LSSH 5I8CA 1R5IB 1IJ9A 2VLRE 4ZPTA 4LVEA 4NO0A 5I15L 5J12B 3MREA 4PGEB 5CHNA 1RHHB 2N7BA 2BJML 3MUHL 4EI5B 3I9GH 3U82B 4NJAH 2VQUA 2AK4E 1HDMA 1U8PA 4XCEB 1NLBH 3MLUH 5MHSD 1M05A 1KB9J 4TUOB 4S1QH 1AC6A 5B22A 4JDVA 5DMKA 2Y07H 4H8WL 1J0JA 1KXTB 1SBBA 3HE6B 4LGSB 4XXCC 5C0CA 3C9NA 4NQDA 4M93B 2NX5B 3UTOA 3SDDD 4QY8B 5AAWA 3SY0A 2GY5A 4PJAF 2DOCA 5EUOB 2UWEA 3HC3H 1FO0B 4PTUA 5KSVA 1T0NA 3LEXB 2DLTA 2DF3A 2F54D 4X6CF 5E8OB 5FGBA 4ETQA 5I1LB 4LEOA 5GRUH 1H0DB 4OUUA 3MLZL 3JV6A 3L3GB 5IVXF 1IBGH 1JYXA 1AGDB 3V6FA 1DUZB 1NC4A 2VC2L 4F7EA 1X5LA 2PXYA 4Q74A 3K2MC 1NBZA 2VAAA 5F9AC 4R96B 5HYIA 4LSQL 4XXDB 1P7QA 3SCMB 3A6CH 1A6WH 1G9NH 3EFDH 3VG0H 2YZ8A 3W0WB 2O5YL 4LVHB 4PJAE 5ESVA 5FB8A 5CP7B 4HS3B 3CK0L 1A1NA 4DKFH 1AR1C 1ZLUH 3C09B 4M7LL 3KPTA 2X4PB 4IRSA 1G84A 4NBXB 2A74B 4L8BB 4MJIE 3UPRB 4MS8D 4X99A 2O5XH 2C26A 3E6HA 3FFCD 2ZCKH 43C9A 4DOHE 4S1DD 1XGQA 5BRZD 1HH6A 2IAMA 3BDYL 3G6JE 4UQ2A 5D1XC 1FNEA 1A7OL 2DQIL 3V6OA 3K74B 1B4JL 3I85A 3KPQB 4L9LC 1A7RL 3DX8B 1HOCA 2R2HB 1FFNB 5IBLC 2GSIA 1EX0A 3INUL 1CDUA 3P4NB 2AJYL 3QQNA 3GSQA 5T33L 1A6WL 1G9NL 5HI4D 1U8KA 3IFOB 4HKXA 1J1XH 4N90E 4YHKH 5HHQB 4X83A 4ODXA 2WQ8A 4M3JA 3MRFB 4BKLA 1YN6A 1MI5A 3VXSD 4HIIA 4G8FB 2AI0L 1ADQH 1A6TA 4JQXC 4HQQL 2PETA 5DK2B 3VFNA 4F8QA 1ZGLP 1MF2L 1G7JA 3W9DA 3OKDA 2Q1EA 4NKDB 1QP1A 1MFCH 2OR9H 4K94H 4XH2B 3UTPE 1IFHH 1S7RA 4M1CC 5JQHC 1WZMA 2EH7L 3I75B 5AUMA 3ZE0E 2Z8RA 3HZVB 4LVNB 1BPVA 1AQDA 4BSVA 5BZWB 1MH5A 3ARFA 1G7LB 3TJHD 2NW3A 3KYOB 1TQBB 4S10A 4WHCA 5FM4A 3KPRB 2APVA 5IEKA 3FT3A 4YDJB 4K71C 1AGFA 5JIPA 3Q5TA 1NGYB 4LL9A 4YFEA 5IW6B 3MRCB 4G6AD 5HHXL 3MRCA 1W0WA 5KVMC 3OAUH 1Y18B 4GAYB 2GAZA 4RGNC 5BS0A 5BW7A 4NN6B 2XYCA 1UCBL 2VDLL 1N0XL 3V0VA 4V2CB 1WCBA 1CDYA 5TE4H 1S3KL 3D3VB 4PD4K 2DQUL 4TNVF 1X6NA 2IGFH 2Y5EA 1FG9C 3N06B 5GISH 3KLAA 1PG7H 5ADPL 4KK6C 1SBSH 3VFPA 4HIHB 2E9JA 4G6MH 1ONQA 3PJSB 4G43A 4F58H 2EIDA 3MUZ1 1WBZA 3ARPA 4HJGB 1QRND 4KRPC 2BHYA 4JFED 1AKJB 4PRHE 3VH8A 5I15H 5DDHB 3EOAA 3WXWL 5I18H 2FEDC 4JRYD 2FO1A 5EZJA 1XGUB 4NKOA 1XFPA 1CTNA 3O2DH 4Q0XL 1S78C 4O4YH 3RIFF 5B4MC 4R7DB 2Y9RT 3V5HA 3ZTJG 2E27H 1ZVHA 1M05B 1Q0XL 1C7TA 1IKNA 1QO3A 3KLHC 1ZMYA 3EO9L 3FB7A 4MA3A 4MAYC 4K3DH 5KVDH 4GAFB 4LKXA 3S4SA 1S9VA 3MGOA 1KLUA 1YC7A 3W9EA 3MV7D 4ZXBC 3SDDA 4LKCB 4Z0XB 5F6IB 4M6OL 3T8XB 1GZPA 4Y4HD 1K8DA 4U31A 4KVNH 4Y5VA 4N0YL 1FBIH 1KTLA 1LO5B 1VPOL 4GG6B 3GSOB 2AVGA 4GBXD 3K2UH 4OAWA 5I16A 3AROA 1CDIA 1V3JA 3BIBX 5I1JL 3S88L 5KSAA 4JHWH 5CSGA 4HS8H 1MCWW 2DS4A 2ARWA 1A7QH 5CMAB 2EC9U 4D9QD 1TTFA 4LPYA 1Q9LB 3SGDI 3L9RB 5GHWL 1MCHA 1FGNH 3FQTB 1WAAA 2HFTA 2BXYA 3T4AA 4JAMA 1JWMA 1RIVL 1WAAF 2WBJA 3ZL4H 4G3YH 4JZJB 2ADIB 2XA8L 2DYPA 3W11C 1MY7A 3NGBB 1NAMB 1R0AL 2EDNA 5IB1B 4LLQB 1R5VA 4UINL 2KQMA 3K4ZA 1DDHA 3TT3L 1VADB 4PBWD 1J1OL 2H6PA 1J5OL 2OQJA 2CSPA 1OSPL 1D9KB 5DJ2A 4GQPH 4W4OC 4LSQH 3NN8A 4LBEA 4JFDD 4NKMA 3BQUC 5EZOH 1QOKA 5MEOA 1B9ZA 4XNXH 4JRXE 1Z6JT 3D85D 2UZYB 3WFCL 5DZNA 1HNGA 1LEKB 5DC9B 4X5WA 5IT2H 2FX9H 5JHLH 5C0FB 3OKYA 1EHAA 4HUUB 3ZYJA 2UUDH 4OT1L 4N68A 2R29L 2PW1B 4XCNA 2EECA 1ZEAH 1NBQA 4OZGA 2OR8A 2WINA 5C07B 1P7QD 3NA9H 3GBLA 4X80L 1UGNA 5DEGA 1QRNB 1KB5L 4CJ0A 2A6DB 1VPOH 2UWEF 1JPGB 1CU4L 1MY5A 3OG6B 4ZDHB 1UVQA 2FGWL 5I76B 2CK0L 3MJ8A 3AGVA 4OM1L 5F7FA 3E3QE 4QRPE 5D7LD 4XBPB 5D5MB 3RWCA 1JGVH 1JPSL 1ZANL 3J8F7 1NFDF 1YEGH 4D0CB 4NNPL 1BQUA 3KPRA 2JTDA 3BT2H 4CADA 3MZTA 3OZ9H 2IAMD 3WIIH 4WCYH 3LAFA 4P59H 2A38A 5D8JH 1PW3A 4XCFH 1U95A 2DQEH 4NN5C 1KV3A 2FH6A 3A6BL 3VXTA 5LWYL 4U3XA 2NPLX 2WUBH 1TQCB 4QGTA 3VXSA 3HZKB 4L4VA 2VDMH 4UBDC 3WDJA 1D5XB 1FIGH 1ZHLB 5DJCA 3RVTD 2ICWI 4ORGB 3VFOA 4DZ8B 2XNAB 1EJOL 3T0VA 5L0QC 1CE6B 4JPWL 5C0FA 3VFSB 4NYLA 3MV9B 5D1QD 4CU8A 5HI4C 5B39B 2P8LA 2IH3A 2YD1A 3OJDA 5FYKL 1OTSC 2O61A 2HWZH 3HC4L 2H8PB 1KXVC 3RZCB 2VDLH 3CPLA 4MNGB 3C5JA 4JM2C 4FZ8H 4YXLH 4CW1A 3QDGA 1LK3H 5DHVH 2OX5A 3T65B 2FO4B 1JZ2A 5J1AA 5E8DH 2BP3A 4PR5B 3OX8A 4U1GB 3DV6A 5JPNB 2XWBB 5TE6H 5E5UB 3O9WD 2CDFA 4O2CB 2FGWH 3X17A 2AJZB 4MAYB 3RWEB 3EYQC 2X9WA 3K7UA 1WFTA 3FQNA 2PKDA 5DS8A 3RAJL 5JTWA 2E6PA 1CFBA 2M26A 2VXUL 4BUGA 3VXME 4LGRB 2X4RA 2NW2A 1WJ3A 1T5XB 5EFIA 1RZFH 4EXPX 4J3VA 4PUBH 3VFTA 3KPNA 3LEVH 3MCLH 3U79A 1NL0H 5ALBL 2EYTB 1YEHH 5IR1A 4OKVB 4Y1AA 4UDUB 4WFFD 5JQ6H 5DO2D 3TCXA 4AEEA 4MA8L 3P9LA 5IESH 3AY4A 1FJ1B 4FTVD 4MB4A 2C7UB 4XAKD 2WV3A 3EJJX 5GRXG 4WDIB 5J13C 4NQVB 3AS0A 3RWHB 2D0HA 1OP9A 4PJBF 1C5CH 4JHAL 2MCPL 4HGWA 3KWWB 4YDLB 1JPGA 3SCMD 1AGBA 3WO3B 3KLSA 3WN5A 3SQOH 2W60B 5EA0H 5CFHA 1ZOXA 1J0HA 2HRLA 3Q6FB 1TCRA 3GBNH 4TVPE 3GHBH 2B1AH 3GIZL 4X6CA 2J1KA 3MJ7B 1QLRB 1H8NA 4DGIL 4MS8C 4E0RA 2BNQA 1R0AH 3MOAH 1FYHB 3GI9H 4Q2ZA 1MEXL 4YDJA 4L4VE 2EO1A 5E7BA 3UZEA 4ONFL 3MRIA 1QBML 3RDTA 1ZSDA 1MJJB 2B4CH 3QJHB 5KSUA 2EEAA 5FHAH 1RIUH 1FLRL 5L7XL 5F7LB 5IK3A 3V6BR 2WQRA 3X11B 1AH1A 1XGQB 3KPLB 3FO2A 1HDMB 3FO2B 1KOAA 5GHWH 4ZYKB 1V5JA 1FAIL 3W2DL 3N85H 1B4RA 2RJMA 1MLBA 2EE6A 2VIRB 5BS0E 2OYPA 4CKVX 5K33A 1I9EA 2XN9E 2AEPH 3VXQB 4O51A 1XIWA 3INUH 4LPCA 4FTVE 4NO2A 3AB0B 1A7RH 3RX5A 3MNZB 5F97E 5HY9B 2WZPD 4LIQH 4X98A 1PZ5B 4H0GA 4H1LB 2P45B 2NY1B 4PY7B 2XOTA 4DVBA 4YBQC 2ZNWA 3P9MA 1RAMA 5I2IA 2GJZB 2Y5TB 2V7HA 4LCYA 1NAML 1H3PH 1KCLA 2SEBA 4Y19D 2DN7A 1IAOB 3D25A 5JO5B 3K3QA 3TNNB 2R0WH 4P23C 1AO7B 5DSCA 3LV3B 2I9LB 4PJIF 4TVPL 1DUYB 4KMTH 4BQ6A 5HHMD 5FDWA 1JNHB 1TJHL 3O6FA 2ZSWB 3MRHB 4PLOB 3WS3B 5D72L 1WCQA 2ICWB 3IJSA 2J88H 1IGFL 4M93C 3SBWC 4OLVH 4JHAH 3ILPA 3PWPD 3CMOL 3MA7A 5TPWL 3GFUA 3MA7B 2X4SB 4YAQA 3QHFH 1RIVH 3VFTB 4Z0XA 4PJFB 4G9FB 5E8PB 1P7KA 3JTTA 1J9CT 3F62A 1S8DB 1OP5K 4N9OB 2I60L 4K71B 3V52L 5CEYB 1YEJL 2EYSB 1NJ9A 4QTIL 3IXTA 3GDBA 3CDGB 3KR3H 1E4WL 2VMFA 4FQ1L 4JFOA 4EOWL 5IBTH 2WWKT 2DI9A 2A9MH 3NFPA 3VDCA 4YX2H 3RWHA 4LF3A 2P5ED 3QG6A 3U4EB 3GSNL 1IGYA 4BZ2L 4N8VB 3QDJD 4HFWB 1HYSD 3ARZA 3RDTC 4NQXB 4RX4A 4KKLD 3N1QC 3PWJA 4UOW0 3IDXL 2QSCL 4HC1H 5F6HJ 3P11L 5TE6L 3BESR 1UH4A 4TULH 1KTDB 3MV9D 3ZE2E 2ZWLT 3DROA 4YXLL 3RI5F 1SJHA 1SY6H 3HZYA 4ODHH 4DCQB 4PB0L 1F97A 2UZIL 1NGPH 3U83A 1D5BB 1QNZL 3TYFB 2CDFB 1NBYA 3DWTA 3ZT7A 3MSPA 4OD3H 3EGSA 4JPWH 4FQ2L 4PJDF 4I3SL 4G8GE 1TNMA 1AXSA 5I0ZA 4LVOC 3MGTB 3QXAB 5LJYH 1A4JA 4QT5B 3EOTL 4U0RB 1Q9KB 1SQ2N 3KG5A 2EH8H 4W6YB 5GIRB 1ZT1A 2UVFA 3RRQA 3C60D 2XQYG 4PGBB 3VFMA 1ZLUK 2E7BA 4J4PA 2DQEL 5D1ZB 5IIEB 5FUOH 1UQSA 4NPYB 2YD5A 3HKFA 3MR9B 4WCYL 4LVHC 4HKBB 2YD8A 1JHLL 3MV7A 2H2PD 4QRUA 3ARTA 2A9ML 4NQVA 2DWEA 2AK4A 1EJ6A 4M43L 4UT6H 3LV3A 3TH4T 2IPTH 1NCWH 4XPFH 1RUAL 4XWOD 4RA0C 3THMH 2VUYA 3NFSH 5C08D 4QXTB 1HCVA 5C0IB 5HYJA 4UAOB 2DB8A 1EVTC 3FB5A 4KK5D 3H9HA 5T5NG 5K9OB 5ETUA 4JDZA 3W39B 3VMNA 4O2EA 5FGSA 1RK0A 3CSBA 5IGXH 4NIKB 2VZOA 4C55A 2DBLH 3E2HC 4B50A 5ICZB 2CK2A 4BK4A 1X5YA 4ERSL 1J1OH 3PXJA 2H6PB 3IJYB 4U6XA 3B9EA 3MLWH 5KOMC 3ALWA 3ESUF 4U3CA 5HI3C 4DAGH 5F8QC 2P24A 5IB2B 1CLOL 1MHEB 4LHJB 4EDWH 1XF2B 3ZYZA 4TTGA 1KFAL 1CF8L 4LP5A 5FK9A 4MMZC 4HJJH 4AZ8A 2YPVL 2NY4B 4HWEL 3QIWD 4NYLB 1NCWL 1RPQA 2R0KH 1QRNE 3H0TB 4JO2L 4LIQL 3G6AA 4HJGA 3BXNB 2CKNA 5CIPA 5FECA 2HN7B 4Z76A 2IPUG 2HN7A 4D8PA 2CLZB 2J8OA 3BO8B 4PJHB 1FLTX 2AKRA 1T83C 4YQXL 1LO2H 4QKXB 3EYSL 3HG1E 1WITA 2CRZA 4MAUL 4KY1H 4KPHL 4UBDD 3BWUC 4XX1G 5EUKA 5EU7C 4NFCA 5C7XL 3QO1A 2BVOA 4NWUH 5F9OH 3MJ6A 3P0VH 5ESQB 3HN3A 5D5MA 3KYOA 1Q9KA 3MQIA 1TETL 2B1AL 4TYUA 1EFXD 2P1YA 3RU8L 3QUKA 2EKSA 4MQTB 4LLVB 3WEXB 3KLHD 1X5AA 5EO0B 4F15B 1F2XK 2W0FB 2IQAA 2CJUH 5D2NB 2YPKA 1LILA 4JO4H 3DXAD 1E0OB 2WW8A 1MFAL 3SOBH 5C0AD 1ZT4A 5EBWA 2HRPH 4P2RB 1W8OA 3LHPH 3ZKSD 4YC2C 3MLZH 2VDML 4WI7A 1KPRB 2G2RB 3CC5B 5HYQA 3ARGC 4PJGB 1FDLH 2MQ3A 4GJTB 5GZOC 5KVEH 4PJGA 2HFGH 3SPVA 2PN5A 2QSCH 2OP4L 3QUYD 4NQXA 1F90L 3D0LA 3VJ6A 2KBGA 4HW6A 5DMGD 5I2IB 5D70L 4QHLA 5A16B 1CD1A 2EO9A 1GIGH 1H9VA 3HE7A 1MQ8A 1WVZA 2W9EH 5CJ8A 3HPLB 2R4RL 3NAAL 5DJ0B 1RZKL 3UTTE 3CLFH 3CVIL 4LDLB 1AHWC 2VDRL 1OP3K 2NY3B 5LAXB 3FOLB 2P8PB 5C0GB 4F9LA 3VE0A 1D5BA 1KLGA 3V5HB 3KPLA 3QDGE 1YMMA 4U1IA 3BP6B 1CXKA 3I6LD 3QO1B 1FCGA 4JGMA 4M1CD 1NCAL 2F54A 1NEZA 4GRLB 5DI8A 2GTWB 2XPGB 4YPGB 1T6WA 2ADGA 3M8OH 2ADGB 1PY4A 1PEWA 3JWDC 2R69H 2PW2B 5GS1B 3TZVC 2GSGB 2B5IC 4K3JH 3PWVA 4JQVC 3QSKB 2R56L 3KR3L 3M07A 4GKZA 1KG0A 4MLSA 4H25A 4ZUWB 1DQJB 3RVUC 5MEPB 1ZXQA 3UXFA 4TTDD 2YD6A 5HJ3A 2P7TA 4F7MB 2ED9A 5KSAB 4QRUB 1QSVA 2AQ3A 4CAGA 3CDCA 5HHOE 1YUHA 5EOTB 3T4YA 3T0EE 1NSNL 3WNPA 3TBWB 5D96B 4P99A 5IMMB 3FRPA 2LTQC 3BZFB 2HKFL 4JQVA 5DJDB 3MV9A 1MPAH 1BP3B 4HK3N 4YJZL 2Z93B 2W91A 3L3JB 3ZDYE 4C4KO 5E1AB 4FZEL 2EDWA 5D7IF 1MF2H 1N26A 5DQJB 4U3HA 4JFZH 3PGCA 2FB4H 4OGAC 1EZVY 4JFDB 3OBAA 4KDTC 1IEHA 4V1DE 1WISA 3BP7B 1JK8B 3QEHA 2IBBA 3MO1B 3QEHB 4S1DC 4OD2B 4OZ4A 4M1GL 2PR4L 3AFLA 3SGEI 1HKFA 1YYLL 4Z7UA 1KCRL 4FXGA 3VD5A 4JQXA 2DKSA 3U36B 2GYSA 2Z91B 2D9QB 1QBAA 2YPLD 1MAMH 2FLRT 2X1QA 1XF4A 3ZZ1A 3CSYB 3EKCA 5BMFH 4K7PX 3V8OA 1M7DA 2JF1A 1AJ7L 4PB9L 4QHMA 4QHMB 4L5FL 4N1HB 5IVXE 3QPQC 1Q9WB 3BO8A 1NC4B 1Q9OA 4RBPK 4YDKL 4EDWL 2KKQA 5EZLA 3CH8A 4KKCC 1NFIA 1TMCB 4PLJD 1FV1A 5JMOC 3WFEH 4X9FA 5GGVL 5HI5C 3NCJL 4K23L 4GKSA 5ESAA 3C2SA 4UINH 1L6ZA 1BZ9B 4KHXH 4KC3B 5FYLH 4XWGL 3ZE0F 1WK0A 4I0KA 3STBA 3SKNB 2F54B 2HT2C 1DANT 1AQDB 1BHGA 2VXUH 4AENB 2DQTH 3KHQA 2NW2B 2Q86A 5F1NA 4X4YB 1XF1A 3T8XA 3CJJA 3BWAB 4R6UA 3TO2A 5KSUB 4U1HB 4ZSOE 4POZC 3MBEC 1FNSH 3TBSA 4JRXA 1WICA 1HI6A 2HTLD 1NMAH 4MMXC 3ZDYF 5AAMA 5IFJB 4ACPA 1ZWIA 4ZAKC 4OFDA 1SEBB 4D0BB 4XNMA 5C0DA 1FQ9C 2Y7QA 1T20A 3S37L 3U4BH 3QIWB 5FYKE 4N8VA 5DD1L 5T5FL 5HY9A 4N0YH 4HKXB 5CZVL 3VJ6B 3SE3A 1QBLL 1H3UA 3B4NA 4S1SL 1UWXK 2GCYB 4AMKL 1H8OA 1BEYH 1F3DH 2JELL 4F9PA 5T1KD 4GRLD 4GO6B 5A2KH 2ORBL 4LRIC 2NY6C 5E2VH 1QLFA 5F8RC 4GT7A 2XWJA 3ZHLA 3BP7A 1OPGL 4M03A 1GGTA 1XGYH 4J1UA 1KEGL 1BF8A 3OX8B 3NCYP 5EU6B 3CFIC 1A2YA 1UB5A 5E2JA 2ZSVB