5I66B

X-ray structure of the fab fragment of 8b6, a murine monoclonal antibody specific for the human serotonin transporter
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
213
structure length
213
Chain Sequence
b'DIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQKPGQSPKLLIYSASYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYSIPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 8B6 antibody, heavy chain
publication title X-ray structures and mechanism of the human serotonin transporter.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2016-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i66B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5i66B01
4NHCL 2C3WA 5I30H 3GMMA 2XTLA 5D2LA 3TO2A 5T33L 4I3RL 4FNLL 1CK0L 2AJVL 4L3AA 4U1GB 1IT9L 5I1GH 4L3CA 1ONQA 2CK2A 1YEKH 1AGFA 3O4OB 5IR1B 4HUXA 4F15B 1WWAX 3D3VD 2P5WA 1JGLL 3FCTB 3T0EB 2VLRD 5C2UB 1LGVA 1ZT4A 1I7RB 2VLJA 4HPYL 3QXUA 1CT8B 5L6YL 4XPHL 2CKNA 2BCKB 3RRQA 4CNIA 5ADPL 3OAZH 5T1KB 1UJ3C 2O5XL 5C8JA 5JR1H 5DS8A 4NFBA 3RQ3A 2VB5A 1CTOA 5GISH 3ULVH 1U36A 3HB3C 5ILTH 4TSBL 3QYCA 1TQBB 5IMLB 4V1DB 4QTHA 1ORSA 3SE3C 4N90E 5C3LD 3I6KB 2DQTL 4PRPD 1ZLUH 2HLFC 3ULSB 4HJ0C 4KAQH 5IVXF 4DN3L 2HKHH 2EKSA 4Q2ZA 4ODVH 1NLDH 4O5LH 5HGHA 2V2WB 4CN6A 3PHSA 2E6JA 5L2KB 4M6AA 5CBEA 1FO0H 1T7ZA 4Y16C 1TVBA 1E4XI 1TMCB 2HTLC 2IFGA 3D39D 1VPOL 3NMEA 4XAWL 2ICWA 3UBXA 2ZCHL 1CFSA 1YN7A 2YUZA 2GSGB 3WUWA 4U6VL 2F19L 1TETH 3ARBB 2R56H 2WBJC 3H9HB 4WEMB 1YMMB 4FFWD 1I4FB 1F4AA 1U95B 1UT9A 3S35X 5C0RL 3O45B 1QR1A 4LCUA 5DQDL 2ORBH 1I7TA 3IFNL 1FNFA 4NQXA 5DC4B 4N0UB 4UT6L 4JGMA 1B4JH 2Z9TA 1QSFE 3MV8D 4XTRC 2Z31A 4MWFA 5D2LE 5DC9B 1INQA 1CFQA 1FZJA 1IMHC 2HT2D 5ECJE 1R5WA 5DFVD 4OIIH 5EA0L 4H25B 5DD0L 4U6TA 3FN0H 4K71C 3WBDA 4ZUSA 4YDIL 1RFDH 2VWEC 5F21B 5DJXB 1EHAA 4JFHD 3NABH 4JANB 4JY4B 4HCRA 4IIQB 2QEJA 4EUPH 3J7HA 2JB5L 2P5WE 3QAZC 4U2YA 5C09D 2D7PA 3ELAT 1T3FB 2NY4D 4PB0L 4YFLI 3WEXA 2AV7A 5I16A 2EYRB 2E9JA 2DQFA 2APTA 2OQJB 3EYQD 4W6YB 4Y2DB 3TH3T 2YD1A 3FQRB 1D5BB 1NBVH 3E0GA 3HG1E 3QXAA 3SDAB 1A21A 3QWOB 4P46B 3BZEA 1QFUH 4D0CA 3WSQH 5IMMA 3DX8A 1VGEH 4DN4L 4MNGE 4PV9B 5D1ZA 2UVFA 1N5YH 3HC0A 3DURB 1T2QH 2R2CA 3IFPB 1S9YB 1N0LA 3C5SB 2DB8A 5I19L 3B5GA 1JWMA 1WITA 1HQ4A 4K94C 3BH8A 5FEBA 2E5EA 2DL2A 3EKCA 4TSAH 5I1KL 4YK4B 2Z8WC 4XVUC 1PW3A 1NCTA 4KUCD 4HK0B 4TUOB 2R1WA 5FUZL 3RTQD 1RPQA 1UM6L 2BOCA 3KLSA 4NBXB 3AUVA 4WJ5B 1F45A 3HC4L 4I48B 2X4PB 4WNQB 4YDKH 2CD0A 4NPYA 1JGDA 2BSSA 2QSQA 1XF3A 4N1CA 4U1NA 4GG6E 2NXYC 1WTGT 1S3KL 4ZUVA 5ID1A 3CFDB 3SCMD 3UTTA 4P3DA 4PTTA 4PJGB 4HWBH 4LSPL 3WIIL 4CVUA 4HWZB 1S7RA 4LIQH 4LPYA 1L0QA 2J6EH 1K9TA 1JHLL 2KH2B 2VRAA 4LLUB 1J1PH 3F7VA 1S9WB 2E8ZA 3I3BA 2BSRB 1NKOA 2WANA 3ROLA 1MLBB 1M6OB 1RZIB 4NJ9H 1BIIA 2Q7NA 3LIZL 1IBGL 1A9BB 1GPOL 2CGRH 2GJ6A 4F7EA 4HIEB 1YUHA 1J12A 4K94L 4R7NB 1M7XA 2VDOL 4HGWB 1FL5A 1PX4A 2CDFA 4K7FA 3FO2B 4PBWD 3LV3A 4HSQA 3TJHC 5DUBA 3LB6D 3QFDB 5JW5A 2XA8L 4NN6B 3WKMH 1VADB 4PJ5E 4EJ1C 1HH9A 3I84A 1DDHB 2JE8A 1WVZA 3LRGA 1AQDA 2CLVB 1YEJL 4GKSB 3RPIA 4FFVC 4M7ZB 4PJ7E 1AE6L 1WC7B 4NFCA 4EZMA 2HVKA 1Q0XL 1AKJA 4KMTL 1LK2B 4LPVA 3INUL 1U8OA 5D93C 4RFNB 4OZIF 2H2PC 1F90H 5CEYA 3STLA 4JDZB 2AJ3A 1MRCH 2C5DC 1AD0B 2VLKE 1B0WA 4JHWH 4APQB 1FZOA 3RWGB 2QADD 3CNKA 4AL8L 2VE6A 3GGWB 4KKAC 1IEBA 2EYSB 3WDJA 1UXSA 3PWVB 4OQ1A 1L9MA 1DQMH 1QBBA 3CJJA 1ZSDA 4QHKJ 1QSFD 5EU4A 4TOYL 1Z2KA 3VRIB 1C5CH 3ESUF 4XBEL 3GKWL 1NSNH 1NJ9A 4YHOH 3MJ9H 4OFYA 1KLGA 4LCIL 4WI5A 4M4RA 3ULUE 4N8CH 4KTDL 1I1FB 2L7JA 4FRWA 4BK5A 4QNPF 4G8FA 4Y4FA 4CJ0A 2OK0H 4EI5D 1EGJH 1FNSH 4S1QL 4N68A 3BGFC 2R0WH 3FB7B 3MV9D 1M4KA 3ARDB 4MAYA 3ZL4L 4X6CA 2WM0A 3AGVA 2EXWD 3KHQA 3BIKB 4PJFB 5I76B 4AENB 32C2A 2MSPA 1QBLL 2DWEB 3ZKQD 4NO2B 2FJHA 2D03L 5FM5O 4MVBD 3A0OA 5LVEA 3RHWK 5JPMA 1HYRC 4OGZA 1DUYA 3MBEA 4R4ND 1YY8B 2RHEA 4URTB 1MREL 2YOCA 5E8PA 1I9IH 5T3XH 5JDSB 1OTSD 3AU1A 5ESQB 1MLCA 2AAVA 3MTRA 5BS0A 4L8SA 5IJVA 5HY9B 1FGNH 1SJXA 4OJFL 3U36A 1I1YB 2BNRB 2H32H 4ELMA 2PNDA 3MJ8B 4WO4C 1CDHA 4I13B 3DVNA 2UZIL 4IHOA 2KDGA 3VI3F 4UT9H 3BP4B 1S9XB 3WMSA 5HBBA 4TTGA 4CL7A 3CH1A 3FB5B 4JO3H 5AYUH 1I1RA 5B38B 5C6TH 3BW9A 4XVSH 5D2NE 4M9PA 5D4QA 3BZ4B 1DVFA 1MFDL 4DGVL 4ZFOL 4NO0B 5EOCJ 4NP4H 2EIEA 3G6AB 5CSGA 3VFNA 1KIRB 4HJJH 4YHIB 1P84J 4ONFL 3IB4A 4RX4D 1N5AB 2AERT 1NMCC 1RIVH 4JVUA 3V2AR 2VR4A 2WAHA 1RUML 1AQKL 1YEDB 2NTSP 5F7WC 2AKRA 2XFXB 4U1KA 4DAGH 3DNKA 5BV7L 3QIBB 1HH6A 4NKMA 3PHOA 1R24B 2NXZC 4OTXL 4LCYA 2L7UA 1OP9A 4P23C 4PJ5D 5HVWA 2Q8AH 4JKLA 5GGRB 2HH0H 3KDMB 4EQ2A 3PIQA 2PXYD 2R2HA 1JGUH 3HA0A 2LTQB 4X83A 4Y7MA 4K23H 4X4MA 2ZUTA 4Z8FL 3FKUS 4OF0A 3UZVB 2HRPL 5IVXA 2FWOA 5DMYA 4XP1H 2VISA 2GK2A 3W82A 4P48A 2VYRE 4YFLF 3DROB 4ETQB 3WJJC 1IJ9A 1IGIL 5FOBA 5BMFL 3MNVA 3MCG1 5IHZA 5C7XH 4H26B 4PGZA 3VG0L 3T1WA 1J0ZA 4OKVA 1PZUB 4P2RD 1JNNH 1JBJA 2VZTA 3AM8C 4HJGB 5FM8A 4PRAB 3CUPA 4PBVC 3FB8A 4MLSA 1TZHB 2CXGA 5IEKA 3LKSA 1DL7L 2A38A 4YNYB 3RWEA 3S8WA 3W9EA 3QCTL 1CD8A 2MHAA 4DVRL 1F5WA 2ADIA 3QWRA 4WCYL 2CLRA 5FYJE 4QRRA 2R8SH 2DQGH 4MQ7B 4HC1L 4IMKC 3T0EE 1IGYA 3BH9B 5GQBA 3ZE0E 3OF6D 4PD4K 2ARJB 1A3RH 4RFOL 3ULUD 2V9RA 4JM2C 3VGFA 1HHHA 1FSKC 3TA3C 2AXGA 1F3RB 2MCG1 5HI5C 4EUPG 1NC4B 3BIAX 1WCBA 5J1AA 5CGMA 5DQ9A 8FABA 4MCZB 4S10A 4N0RA 1H3GA 1HDMA 4YPJA 3DX6B 4M7JL 4PRHB 3TT1H 1UQSB 4CMMB 3KPOA 1HNFA 2HTKD 2A83B 2BMKB 5JIPA 1XMWA 4X4YA 4DCQB 1SY6L 3G5XA 3EOBB 3BP6B 3L7EB 4KK6C 2IFFL 3OKNA 2X4RA 1OY3B 3QUMH 2MOVA 3TBTB 4JM2F 1GOGA 4WV1C 2JIXB 1T4KB 4LSTH 5I15L 1AR1C 5L2KE 4P2QA 3CIQA 1VHPA 2H2SC 2HWZH 3CLEH 5ENWA 3SDCC 5GSVA 2FCBA 1KEGH 3VCLB 3JV4B 5H94B 5KJRL 5IROC 1SM3L 3DJ9A 3NFSL 3QZWA 1RUAH 2O5YL 4HIJA 4LCCC 3VRLF 4Y5XC 5FO9B 4GXUM 5IQ9B 3T8XA 4S1DD 3ZYZA 1T21B 4N9GA 1RVFH 1KJ2A 1N64L 1YMME 1CFTB 5F3BA 1QNZH 3SO5A 1NFIB 3LKPB 5IVXE 2Y07H 1JK8A 5I8KL 1QA9A 1NAMB 4WGVB 3IU3B 2GIYA 1U41A 5ID0A 3GRWL 3V5HB 1RZJH 4KROC 1INDL 4CVXB 4BQ6A 5FGSA 4IDJL 2P47B 2P8LA 3JV0A 4Y4KC 4XNXL 1RHFA 2LAAA 5F72S 2Q87A 1J8HA 5F8QC 2GITB 4FABL 5DHVB 1X3DA 3H2WA 1PZ5B 5CMAA 3P4MA 4EXKA 3LN9A 4A2LA 1BQUA 1ZANH 3E3QE 3VXMB 4F8TA 3PL6D 1BOGA 5BVJA 2FX9H 4DUVA 1D9KD 1EO5A 1I8MA 1YEIL 1P7QB 2CLZA 1A0QH 1K6QH 4YZFE 4G3YH 3QG7L 4IOIB 3PXJA 3RIFK 3DPBA 2WUCH 1T66D 1U3JA 5IW6B 4QYOB 1Q0YL 5C0ND 4AT6B 3QSKB 1PY4A 2B4CH 2FX7H 3OB0K 5FB8A 2F8VA 4LVNB 3V5DB 4JG1L 3BKJL 4PLKD 4HKZA 4JO4L 3T08A 5HPOA 4DFHA 3ETBF 2VQTA 1HHKA 2FH8A 1F11A 5DMIH 1RD6A 3QCVH 2ADFH 3FQXA 1CLYL 3MACL 4UAOB 1X6NA 4IMLA 3W5NA 2QKIA 2Y5TB 5J12C 1YEGL 4RBPH 1EEYB 1EDQA 2ATKB 4ZPTB 2B1HL 1ZS8B 3VFWA 5F9AC 1IZKA 4X7SH 4P2QE 2VABB 1F4YH 3UTSA 1IKFH 1XGTB 3KWWA 4AH2B 1RSFA 5M95B 5E2UL 1AGEB 1BQLL 4PJGE 4QOKB 5C0GB 3T0ED 5LXGL 4Z77A 1J1XH 2P7TA 3O3DA 3MA7B 4L5FL 4XCNA 2F8OA 5I8OH 2CK0L 3UP1A 1MEXL 3KPPA 4DGIL 4M93C 5F9DC 5T1KD 2HYMA 3AMLA 2FATH 3IS0X 3HR6A 2FHBA 4H8WC 2EDBA 1FG9C 1N7MH 4OLVH 5I74C 4V1DD 1RI8A 3MRJB 3B6SB 2AEPH 3H3BC 4RAUA 1S9VA 1B2WH 1FL3B 4Y19D 4L4VA 3WXWH 3B5TA 4P4KB 2Y7QB 3X3GH 4WHTB 4GRMA 3HAEH 3GMRB 5KVMC 5H8DA 1NMAL 5L9DH 3U82B 1CDIA 3MOQA 3QXDA 1A7NH 3T2OA 5J1TC 1A6AB 2V7NA 1BM3H 2GYSA 4ALAH 1BX2A 2OJZL 4EVNB 1SJHA 2OYPA 5L2KD 1ORQA 2AJYL 4YFDB 3IXAB 1BVZA 5ERWB 4F57H 1P6FA 1CICC 1EO8L 2V9QA 4OLWH 4Z95L 3DXAA 3FO9A 1HIMH 4ZXBC 5IJKA 1A7PH 1UWGL 5FHBL 5J1SC 2XWJB 3WDIA 3RUGF 3LPFA 5IUSA 1UADC 3ARBD 1N4XH 4RMWA 1FIGH 2HVJB 1RJYA 1X9QA 2I60L 1KENH 4WW2B 5E8OA 4H8WL 1BVLA 3RVWD 1A7BA 1N59B 1U91B 5D1QC 3TVMC 2YRZA 3BESR 3TIDA 4JFYA 7FABL 5ANMA 4JZOB 1G7IA 1H8OA 2Y23A 1BQHA 4DQOH 2X89D 3Q1SL 1MVUB 4RIRA 4ZFOA 1MNUH 3BEVB 4ZFFA 2LAGB 1NBZB 2HMIC 3QDJA 1H5BC 4PB9H 4WW1A 2APWA 1S9KC 5H2BA 3FQTB 4W81A 3V6OE 1NDMA 1WIUA 5CBAA 3CVIL 1XGRA 1S5HB 1G7QB 4PP1C 3HZVB 2OSLA 2QV2A 5D7LA 5ACZA 1D6EA 3MGOB 4OAWB 4Y2DD 1S7WB 2PCPA 1J0JA 5B4MC 4RNRB 5F1NA 4ETQA 2EKJA 4PJFE 2JJSC 3KPSB 2FJFA 3SDAD 5F96H 3EO9H 1QLFA 4P46D 1PJ9A 4PJAB 2FEEI 4LRNH 4BQ8A 3U6RA 1A7RL 4POYA 2R0KL 4FQXA 2AABH 1AC6A 3A6CL 3KS0J 3HZMA 3WFHA 2XT1B 4JO1H 1FVDB 5LBSH 4L9LB 5AZEL 5GRJH 4OFKA 1QFWL 5J11B 4Q6YA 1KPRB 3HNTL 1GC1C 5A43C 3GNML 4CMHB 4XHJD 3QR2A 4MQXD 4OB5L 4FQCL 1PG7X 5DHYB 1UCBH 4U0RC 3U4EB 1RMFL 2AJSL 4OCYL 3TYGH 4U1JA 1S7TA 1AXSB 5I1DB 4WI6A 2MQCA 2NY6B 2DQHH 1L6ZA 1NMBL 2ITDA 4PJXF 1FVCA 3DXAE 1VKXB 4XNUL 1D5IH 2XTJC 3HCVA 4HC1A 1IE5A 5IB3B 4TPRL 3EYUH 2MCPL 5ITFA 1B0RA 5DEFA 1PYWB 3VXRD 1W0VA 1TJGH 1BZ7B 4MD0A 1FIEA 3H3KA 3N1PC 4FXLA 3UO1L 2PF6A 5CINH 3OPZH 5BQ7A 5D8JL 2YKLH 3FRUB 4LNRB 2A73A 5JO5B 1ND0B 3D69B 1A4KA 1AGBB 1QRNA 2NY0B 5SWQA 4L3EB 1WICA 4NM8L 4YHKH 4ERSH 4JN1H 1GRWA 2BVOA 4JPKH 4YEEA 2CDEB 1SY6A 2UYLB 4P57B 3CCHB 1JIBA 4GSDH 2NY1B 4NC2B 4PV8B 5EN2A 3T3PE 3VXOB 3I6GB 4P3CL 4NQDA 4D3CH 3BDYL 5FGRA 3VD4A 1AHWB 2EDQA 4JDVA 3UTQB 3PGCA 5LQBH 5DRXB 1KN4L 1ED3A 5D7LE 3BPOC 3E6HA 2IPKB 4NQCA 4I18C 1E4WL 4BJLA 3EJJX 3EYOA 3LD8C 5LG1A 4JM2A 1K3IA 1R5VB 4LLDA 4X7TA 3TO4B 3TA3A 3ES6A 4KGJA 1M05A 4APQD 5I71C 2XOTA 2V17L 4J4PA 4X7DC 5C0DB 5F6IC 4EN3C 3OL2A 3RL2B 4HKBB 4HWEL 1RIHH 3OKOA 4NN7C 1Z0MA 1A14H 4J6RL 3GRWA 4H88L 5HHVL 4XZUA 3H0TA 3TLRA 4RAVA 4X5XA 5F3HB 1WBYB 3VXPA 3OKDB 3QEGH 3VFPA 4ZFGH 4CN1A 2H9GA 4G43A 1FNGB 43CAA 3NACL 4BZYA 4WV1A 5L0QB 4MNHB 5ETUA 2OI9C 3HI1A 1T22A 3ARDD 4MD5A 3DX9B 2CJUL 5GS1C 3P77B 5F7HA 1CBVL 3V95A 1TCRB 4S1SL 4NM4L 1LE5A 4G6ML 2B20A 4N5EC 4KJYB 5I18L 2BSTA 4Y5XA 4QGTA 5IM7B 3P73A 5CJBA 2E8YA 4PJ8C 1OP3H 5GZNC 1FP5A 5DVNA 3GSNH 1ADQH 1IM9B 1HN1A 3BQUB 2DMBA 2DQUH 5J7CC 2DLFH 3W39A 1GGCH 2PW1B 5F9JA 3KPNB 3RWHB 3SDDC 1LMKA 1GAFL 3OKMB 4Q97A 1AP2A 2X41A 3ZTJG 4MYWB 1JGVH 5EBGA 4M5YH 1QSEA 5AZ2L 4YPGA 5KS9F 4FP8L 2VDQH 5HHPA 1SJEA 2A1WH 3DSFH 4Y4KA 3C5ZB 1Q9WB 2VZOA 4P3WA 1HHGB 4NDMA 5FF6B 4YLQT 4NQDE 4I9WE 4LDLB 2BNRD 5F1IA 1A6VH 1L0YA 1YMHB 1GOFA 3KLAB 4OM1H 4XPBH 1IQWH 3PABA 4FG6D 2DQIH 5I1EL 2NMSA 3K4DA 3RNQA 1IEAB 4NQCE 4LASL 2D3VA 5HGAA 1FPTL 3VG9B 1B0GA 1L7TL 2OR9L 4EBQL 1S7XA 1ZHKA 5D6DC 4NO0D 4UUJA 5DZNA 1YNLH 1DQDL 2EZ0C 2O93L 3N50A 3WFEL 3R1GL 2FYYA 2CUMA 1U2HA 4L1DA 3OJDB 2NY3D 3RVVC 2J4WL 3BKML 3W0WB 2CRIA 3WV0A 1EMTH 3DV4A 3VXME 5FKPB 3VRLE 5B22A 5TH2B 4Z6AT 3FFCD 4KZEL 2IALA 3FO0L 3QIBD 1Y6NR 4JJHA 4EIZC 3ZT7A 2ERJC 2JCCB 3HAEG 4PTUB 4KK8D 3B9VA 1KEMH 3VE0B 4UT7H 4JY5H 4XNQA 3GSUA 4HX1A 4P5KA 2JF1A 2YWZA 1KIUA 5EPMB 5K59E 1K5NA 3U46B 5I8CB 1NCAL 3PWJB 1C5BH 4CADA 4OV6F 2GTWA 3B2VH 1XGQA 4ELKB 1KCRL 1MQKL 4DKEH 3MRQA 3U4BL 4D0DA 1OTUD 3DI3B 5C86A 1FYTA 3RWDA 3RWIB 4HZLA 5TJWK 1N6UA 4BH7A 1X4ZA 2VDKL 5FDWB 3SE4A 5I1LB 5BZDA 2G60H 3ARPA 3ULUH 1HCVA 1RK0B 3L3OB 2YN5A 1CZ8H 4HIIA 2EDWA 5HVGB 3RUGA 1AXIB 1QSEE 3UYRH 1NGQH 3X11A 5GS0C 4FFZL 3N1QC 3KNBB 4QOKE 2YD7A 3GI9H 4GT7A 4PRNB 3WS6C 5IB5A 2V9TA 4Y0GA 1GZQB 4UTBL 5MENB 4O51A 4MJ6B 5D7SL 2IAMC 4QWWC 1OOAA 3PUCA 2IADB 1SVZA 4JREC 5E2WL 3U1SH 4LLWA 1A8JH 3I85A 1JNLH 1XF1A 3S5LA 2F15A 2HN7A 5EC1A 5E5MA 4JAMB 2Q76B 3L3HB 2D7NA 1CICA 4PRHD 2YPVH 3WLBA 1H3UA 1FNHA 1ZTXL 4AM0A 3NAAH 5KAQG 2AJUH 4LLVA 4U1LB 5GJTH 1MFAH 3FZUD 4NCDA 4ODXA 1SMAA 1QO3B 4KJQC 4JO2H 3IDIB 3BSZH 3HE7B 1QLEL 1BJ1J 3EOYG 1U8MA 3PGDB 5IB1A 3Q0HA 3TVMA 1XH3B 2JIXD 1PD6A 3QIUC 5F70A 5GS0L 3RJQB 3OJVC 3CXDH 1JPFA 1NGPH 5ESAB 3DRTA 1QHOA 1X5AA 4YDJB 3K7UA 3ARXA 3L3GA 1EO7A 1H5BA 4L9DA 4I9WD 2XKUA 3QISA 1BFTA 3MFFB 3BKYH 4MDIA 4KVCH 5SWZB 5TE6L 2EH8L 4LLMA 1RUQL 5BJTA 2W60A 3QI9C 4Q9CA 4R8WH 3B3IA 3QEQA 5FYKL 1U3HB 5EZIL 2R9HC 4LLQB 3QA3A 2XIDA 1LEIB 2JJTA 1IAIH 2CIKB 4WENB 4MJ4A 1X4XA 5TQ0H 4LBEA 1NC2A 3PP4L 3QQ4A 2CRYA 4PJXA 1JRHI 2YD5A 5A1AA 4O02H 1AGDA 3DYOA 3RUGE 3QJHA 1WTLA 3VXMD 3MRGB 3BVNA 4KQ4H 4QXTB 5D7IF 3MRMB 1P7QD 1X5IA 1MCSA 35C8H 2MPAL 1KCVL 5I73C 4PG9B 1BZ9A 2F54A 3D9AL 1YC8A 1UJ3B 3KPSE 4M4PA 4XCFL 3S34L 4F7MA 4WTZA 5SV3A 1OT1A 2DJ4A 1CU4L 1EJOL 4PJAE 1U6AL 5F88B 1WBZB 3O3BB 3O6KL 5E4IA 3CK0L 1FDLL 3TJEH 25C8L 2YPLA 5IFAH 2DIJA 4KMQA 1LEGB 3AC0A 5F7DA 4NNPL 4HUVB 4PJDF 5FYJH 2GY7B 4KQ3L 1EFXA 4GLRH 1JWSB 4LRIC 4G7YH 4QGYA 4Z7QE 5JXAL 2IH1A 5ALCL 2VOTA 5H35B 5IK3A 4FNLH 5DGRA 1PLGL 4NGHL 5DURB 2EDFA 2Y72A 5F7FA 4Z5RA 4Z7UF 1NCBL 1JPGA 3S35H 3RZCC 3V7MA 4OUUA 1N3NA 5EOQH 3B43A 3CVHA 3GBNL 4Y16B 5IT2H 1K8DA 1RULH 4UBDD 3MLPA 3QPXH 3K4ZA 4YWGH 4HZAA 1MAKA 4G7VH 5JUEL 2DYPA 4F9PC 3MRIA 1LE9B 2RCSH 4QOKD 4XRCB 4NQEA 2GAZA 1OTTD 4HKXA 1T7VA 5D1XC 1C5DB 3O6FC 3U0TA 4P0DA 5TDPB 2WBJB 3KLHD 3TEUA 3WFCH 1W72A 4NZTL 3Q3GB 2FH6A 5I1HH 3MJ7B 3O4LB 3D2UB 1OW0C 2AS5M 1HHIA 3U0PA 4LSQL 1KCSL 1F4XL 2R1XA 2CSPA 4XNYL 2IPUG 3G5VA 5CD5D 5KW9L 3HMWH 3HI5H 4ZG1A 4Y1AA 3I2CH 4I0PA 2NYYD 3MRPA 1OAKL 3DV6B 4I18A 4G5ZH 4ZFZA 1OAUL 3EJZD 4GG8A 4L3EE 4RWHA 3LMJH 5DA4A 5JLZB 4P4KD 4J3TA 3NA9L 1MHHA 4PJXE 5TE7H 4NO3B 1I8KA 3BDBA 3PGFL 4PLJC 4MHHG 5DK2A 4OGAC 1UZ8A 4N8PA 4NUGL 1F2QA 5CD3A 2GUOA 3NBNA 4F2MA 2DTMH 3QAZB 4JPVL 5DSCB 1EFQA 4X6BA 4DEPC 4F7TB 1CXLA 4EN3A 5LWYL 4YDLC 1XEDA 1UWXH 1NQBA 4ETYA 1H3TA 3WO4C 4O4YH 3UBXG 3MGTA 1IRAY 4XAWH 3P3YA 4GMSL 3QDMB 5I1IL 2W9EL 4PPTA 5LKNA 4BH8B 3AB0B 4YIQA 4OD3H 1CL7I 1MHPL 3AS0A 4NQVB 4ZUWA 4JN2A 3H7BA 1OCWL 4ODTL 1DQJB 5GRVK 3VFRB 1FRGH 5IESH 4YGVB 1FN4B 5KS9A 4S0SD 1C12A 5L88L 2DD8L 1FLTX 3FFDB 2OR8A 4OCSL 5GS1A 4KDTC 3LQAC 1L9NA 3GMQB 5CEXB 2ATPB 1J11A 4NUJB 1FFPA 4PLOB 3BT2L 5BVPL 3DUSB 2BRRL 2BX5A 1M7IA 3MYJB 5BZWB 4KKBC 3LKRA 3ORJA 1AO7A 1UACH 4M1DL 1ZT1A 2EDHA 1PQZA 5KVDL 5E9DB 3ZE1F 2NXYB 3VH8G 1HOCB 5GHWH 3CAFA 4WHDA 4XPTH 1OAYH 1G7MA 4OFIA 1QZ1A 4JZNA 2BFVL 1NGZA 1MWAA 4J3OC 5HVFB 5IVOA 1G0YR 1XGYH 1Q1JL 4YXHL 4YGAB 2L4OA 4U1MA 4R9HA 4UINH 3WD5H 2R0LL 3KPSD 3O9WB 3OGCB 2G75B 5GS3A 5F1SA 4J3VA 4NC1E 3PP3K 4MS8C 4QF1B 3V0VB 4GAYA 2VAAB 3HE6A 3G5YA 3PWUA 1TZGL 4KWUA 4ZPVB 4OZIB 2P8MA 4OQTL 4GMTL 1K85A 3LQAL 5DD3L 4QXUH 1YJDC 2J5LC 3ARFC 1KLFA 1V3KA 3L5XH 4XI5C 2W92A 3KAAA 2XN9B 1UYWL 3B9EA 3ET9F 1IARB 3MOBL 1VGKA 4G80B 5T3ZL 3IAGC 2NY7L 5C70A 2AK4B 1IC5L 5LGJA 1KJ2H 4RA3A 4P9ML 1ZXQA 2ZCLH 3E2HC 3TGXA 5LGKA 3WHE1 3ARGC 4P9HC 1OP5H 4AG4L 2FLBT 3AAZB 2NY6D 2E7MA 4HK3J 1LO4L 1E6OL 4BKLA 1BGXL 3A6BL 2DM7A 4B7LA 2DQDL 3MRNA 4X6FB 2YEZB 4G8GA 5D93B 3ZYIA 2E9IA 1INEL 4JAMA 2VZUA 3BKCH 3VRJB 4NOFA 1FZMB 2GTZA 5IFHL 1O7SA 3BGMB 1EAJA 2IPTH 1H8SA 1FH5H 4LHUA 5KANG 1G1YA 4LAQL 5ADOH 1LK3L 5DWUH 4ZS7L 4O58H 4OCRH 4HUUA 5DVOA 1GGYA 3EJYC 4U6HB 1JWUA 2DI8A 2ZUUA 3W0WE 1CE6B 4E5XB 3T3MF 1WT5C 4K8RD 2COQA 4MNQA 2GKIA 5EUOF 2NY0D 4L3ED 3P9MB 1N0XH 5E8DL 5I17A 1MFBH 1PFCA 5F7KC 1A5FL 2JCCE 2YMXL 4KK5D 1LWRA 1YEEL 3MRKB 2NY1D 4HS6B 3UCRA 4JHZA 4C55A 4O2CB 4P9HL 2ZUQB 1YEFL 3GMLB 3LKNB 4MA3A 3BGFB 3VGHA 1ACYL 4QY8A 1YECH 2B7DT 3K3QA 1N6QL 3CX5K 1QYGL 3GIVA 4EDXB 3U7YL 5KTEL 5ICYA 1GIGH 1IAOB 5EZOL 4WUUB 1JRHL 1P4LB 4J8RB 3U79A 5HVHB 4U31A 4PJEF 3QO0A 3BWAA 1J0KA 1IZJA 2IAMA 1CFNA 3T77B 3TO4D 2IH3A 4PGEA 3X3FH 2QTEA 5CJQH 1P1ZA 4A6YL 1I9EA 1WFUA 4HF5L 4M8QB 5CJ8A 4N0CC 3ZTNH 3SDYH 3ULVC 3NZHH 2R1YA 1Q8MA 3X13B 4FXKB 5JW3H 4X9BA 4X7EC 4WO4B 1FFOB 3M07A 4BFGA 3Q6GH 5MENE 3QH3B 5I30L 2BNQB 1HEZB 3ILQD 4MZ2A 1KG0A 1HI6A 3GHBH 4R90H 2PW2A 4OCWH 3QIUA 4X8JB 1UB6A 3O3BA 3CDGB 5I1GL 5IF0A 1YEKL 1QBML 2EYTA 1DBKH 5CIPB 2OP4H 4DVBA 3MLUH 3MRFA 4JZJC 4R0LA 3PV6A 4BFIA 4NNYB 5D7IA 3K81A 1J86A 1IM9D 3BQUD 1H3VA 3QI9A 4ZTOH 5MI0C 1I7UB 1FC2D 2PYFA 1E4JA 5A3ID 1C16A 5JR1L 2MMXA 5TDOB 5GISL 4HAGA 3ULVL 5GGVH 5ILTL 4F9LC 1KPVB 1J88A 3I6LD 5T1DH 3CFJA 4P23B 1NAKH 4JY6A 4HEPG 3C5ZD 1YQ2A 4MCYA 2OL3B 1F8TH 1T2XA 4FTVA 3EFFB 4KAQL 4AIZB 5SWZE 1G7PB 4IJ3C 4FQJH 1UENA 4PJDA 4RMUA 1QLRA 2HKHL 4M8VA 1RK1B 4PGCB 4KKNA 5EBMA 2R15A 2VITB 4ODVL 4E9LA 1NLDL 5F97E 3PDOB 4O5LL 3HUJF 4QHLA 1ZEAH 2OTUA 4L8DB 3CU1A 3V8CA 1FO0L 4Z7UA 3HR5A 4F37F 2Q6WB 4JHAH 2LABA 2IQAA 1R3HB 5IG7A 1BECA 5JLZA 5EFIB 3SPVA 4LLYB 2DLTA 2LVCA 3NFPA 1TETL 3WLWC 3OX8B 2DS4A 1X7QB 2EEDA 2R2EB 1E4XH 2R56L 3W0WD 4JFDB 2X1OA 2ICES 2QR0B 4Q9RH 4QEGA 1KTDA 5D9SB 1DSFH 1QACA 1VFMA 2BY0A 4WFEE 1TQCC 2ORBL 2I25N 5J06A 3MLYH 4H5SB 3EZ8A 4LRIA 3WHXA 3DVGB 1B4JL 2FZ3A 1LILA 2FECL 1YN6B 1FFNB 2G9HA 3ZE2E 1IGJB 1U8IA 3NFNA 3FN9A 4KKLC 4OIIL 2GK0A 4PBXA 1BD2A 2MWCA 3FN0L 2SEBB 3LEYH 4YHLH 5DI8B 1Z5LB 1RFDL 1CFBA 2R29H 3NABL 4NO5A 3PWNB 1QHPA 4OLYH 2CPCA 3EFDH 5EU5A 1GGBH 5HHOA 2FR4A 4FQHA 1JN6B 2B5IC 1Z9MA 4WWKC 5D7IE 1DBMH 2DDQH 1OW0A 3X12B 2NTFB 3S98A 1MH5B 3WHE0 1NBVL 1AD9A 4HWNA 1MCIA 1QFUL 3F7PC 4WFFE 3WSQL 3CLFH 5C2BH 1VGEL 3PWLB 2HFFA 1BFVH 1NCNA 3SDCB 1N5YL 2W65B 5DLMH 1T2QL 4WU7A 1F3DH 3KPRB 4OI8A 2XXCB 5SX4I 4LCCB 2DQCH 2ID5A 4F33B 4RFOH 4TSAL 4AJ0A 4HUWA 5MEND 3O4LE 2QQQA 1CD9B 3ZDXE 3BP5A 3J8F7 3MPCA 4K3DH 4XWOD 1ZLSH 3GSWA 3IKCA 5ICXB 5KVFH 2ADJA 2AEWA 4YDKL 4EXPX 5FHAH 5E99H 3BO8A 3VA6A 4KROB 1VACA 4Z7UE 5E24E 4QHNA 1PEWA 2ZG2A 1CDCA 3MRLA 5JPNB 4HWBL 2VNCA 3I3EA 2YA0A 4JPIB 4LIQL 2J6EL 1A6PA 4LQ1A 2P42B 4PJBF 1J1PL 2AXFA 3ARTA 1OF2B 3HE7D 3SY0A 1DLHB 4NJ9L 2VDRH 1TITA 4U1HA 3GJFK 4PJCF 2UUDK 3L5IA 2UZYB 4OQTA 2XG4A 1ES0B 1JF6A 1Q9LA 1XGPA 2CGRL 1LD9B 5DD6A 5SWSB 3MV7A 4PJ9A 1XCQB 2PYEB 5GSRA 1A6ZA 3QZWG 1NAMH 3NN8A 3RPKA 3QDME 1SYSA 4R2GB 3TBVA 4GRLC 4U3CA 4KU1A 5MEPB 4MA8H 2AV1B 1OD7A 2JJUA 3JWDH 3F58H 3F5WB 1RJZA 15C8H 1PY9A 1VEMA 4JFQA 4PJHF 3WKML 3O8XB 1GZPA 1NEZB 3IVKB 2G5BB 2ZNXA 1U3HD 4WY7L 3WIHH 1OGTB 1U8LA 3C87A 3LN4A 4GKOA 4JFFA 4LHQB 4CJ1A 3JVGC 3BD5A 2Q8BL 3C2SA 4KTEH 4CAGA 1VFUA 2WIMA 1F90L 5E9DE 2EDDA 3AREA 1MRCL 3UDWC 4HKJA 3U9PH 3PWPA 3L5HA 1DEEA 4JHWL 5B8CC 1QEWA 4WFED 2BVQA 2BDNH 2Z4QB 1ZHNB 2ADGB 1HWGB 1BBDH 1IKNC 1DQML 5E8EA 2X1XR 1PKQA 2APXA 2EIDA 1BFSA 1JYWA 5IVZA 4BSVB 2NZIA 5JW4N 3L95A 4OIBA 1C5CL 3BISA 1NSNL 3HB3D 4YHOL 3MJ9L 3WFDH 3ARGA 5EUOA 3WIFB 5IEHA 3HZYA 2QBWA 1A4JA 4N8CL 1G7LA 1NGWB 1SBBA 1IAMA 2HLFD 3EDKA 4LCWA 4OM0H 4HJ0D 2GW5A 4XPGH 3HNSH 1ZT7B 4W4OA 2OK0L 3ZE1E 1RHHA 1EGJL 1AFVH 1FNSL 3L3IB 5ISZB 3KJ4C 2DM2A 3O2WH 2R0WL 1TCMA 1TJHL 3D85B 2BXYA 1QVOB 1KBGH 3EZJB 3M17B 2XN9E 5E95B 4K3JH 5DURD 2AK4E 5HYSB 5C0AB 1FYHB 4E42B 3SOBH 3RFZC 2A6IB 2ENYA 3CSYA 1VEOA 3MXVH 5DJAA 4A6YA 4MXVF 4Y16D 4Z7WB 2YWYA 3I75B 2HTLD 3B9KA 4X6DF 5A16B 3TN0A 4ZXBB 4PJEA 1LP9B 1WJ3A 3C9NB 1Y0LA 4NHUB 5C0JB 5T3ZE 1G0DA 3SKMB 1T0NB 2WBJD 1I9IL 3OKEB 3L5WB 1I3GH 1M71A 2H6PB 3H9SB 5T3XL 2LQRA 4ZO9A 1K4CB 3QJFA 3O4LD 3D2UD 1MCOH 1OQXA 5D1QB 4FS0A 3DTXB 1FGNL 5EBWA 5FO7B 1ZGLA 1RQ5A 3FONB 1ZGLP 3TP4A 3C09B 1S7QB 4XTRD 2VXSH 4UT9L 4XBGB 1YPZF 3GM0A 3VXQB 4OD2A 4JO3L 5AYUL 5HYIA 2O61B 4HIHA 5C6TL 4XVSL 4QRTA 3OKLB 3R4DA 1ETZB 1U8PA 3IU4H 4NP4L 1HINH 1V3JA 5DD5H 3SE9H 2EDOA 3PQYB 4HJJL 2HJKA 3QNZB 3KR3H 1RIVL 1T1YB 4NWUH 2OTPA 1A1OB 1JPST 4F7PB 3QDMD 4GKNB 1PG7H 4DAGL 4ONGH 1J8HD 2ZSWA 3T3ME 3MLTB 5HDLA 5F7YC 3NPSC 1BQSA 5EUOE 1WWWX 3RWCA 4CUCA 3PG2A 4QRSA 2EO1A 3IGAB 2Q8AL 3D0VB 4LCWE 3AXLA 2HH0L 5EOCH 2HT4D 1KSRA 1JGUL 5CILH 2YR3A 2A6KB 1BQHG 4K23L 2X09A 3C6SA 2HLAB 1FO0A 4QLRA 3TPUB 4XP1L 5EU7C 4NKIH 5DJCA 4JZJA 5FA3B 4QHUB 1FCCA 3DX7B 5JXEC 5HI4D 5C7XL 2A74B 3IFLH 1JNNL 2JELH 4UU9A 2NXYD 3HUJA 2BNQE 4JRWA 5AD0B 5F6HJ 1A1MB 3DIFA 1OM3H 2YC1A 1RZKH 2UWEB 3VW3H 3FRPG 5J4MA 4FQQA 1U8JB 4ZYKA 4F9LA 3SQBA 5J56B 2I9TA 1XF2B 5F89A 3WS3A 4NWTH 5C07A 5DJYB 3RIAK 4AYFA 4LVHC 4ZOAA 4LKCB 1EBAA 1TZIA 4JQXA 2DQGL 2R8SL 3NCFB 4R4BB 5IV2B 2AEQH 1PDKA 3BPCB 1JCKA 2J12B 1P4IH 3TCLB 1P84K 1A3RL 1NUDA 3SJVA 1MFEH 4RGMC 2HKFH 3GSOB 2DQJH 3QUZA 2VZ1A 4ODWA 5GZOC 1WZ1H 4PRIA 1Q9OB 4EUPA 3VFTA 2Z91B 4UDUB 3LOWA 3LN5B 3TJHD 1FVEB 4OB5H 4WI3A 4OLZH 2XN9D 2DL9A 1E28A 2HG5A 4XGZB 3CZFB 3IDGB 1HYSD 3TT1L 4JJ5A 2AK4D 4I4WB 4GQPH 5AEAA 3EYFA 4FFVD 3VFMA 4F3FB 1I8LC 3U2SA 2CIIB 3VD9A 3NH7H 3FHAA 2YBRA 3BPOB 1XZ0B 4XH2A 1U8KB 3QEHA 3QUML 3QHZH 3OXRA 4U7MA 5T1MA 3QDGB 1TVHB 4LSTL 2H2PD 4WI2A 3MXWH 3FT3A 2HWZL 3CLEL 3MLXH 4I3GA 3RIFF 2X7LA 4G9DA 5E6IB 1KEGL 3V6ZB 3OR6A 4RISH 5HHNA 5I71B 3SBWC 4AIOA 4KKAD 4MXQD 1RUAL 5F6IB 4MX7A 3ZHKA 3RY6C 2A77H 2A6DA 3GSQB 4JFDE 4CBPA 1RVFL 2B4CC 4RMVA 1QNZL 4XPFH 4CRPA 1PG7W 4HDIA 5LAXB 3CXHJ 5GGQH 1KACB 1AH1A 4XP6H 2Y07L 1RURH 3EO1B 3HRPA 4WWKA 1KCLA 3QNXB 3O3AB 3BYYA 1RZJL 3HUJE 5INDA 1JMZA 4Y4HB 4NRZB 1XR9B 4Z7OE 4IRZH 2FIKB 2OI9B 3RGVC 4NKQB 4JRXA 2OJEA 3X14A 4BZ1H 5GIRB 1CXHA 1OWWA 4GW4A 4IS6B 3L3JA 5C07E 2A9NH 5I75C 3C6LC 5K93A 1ZANL 1MRDH 4P2OA 1NDGB 4ZO6A 2Z92B 4PJBA 1F3JA 3FJTA 4WUUD 3TC9A 2WIIB 3MRBA 4NYLA 4NKOA 2RFXA 2ED8A 5GGTH 2FX9L 5EU6B 1KLUA 4PJ8B 1A0QL 1K6QL 4MA1B 4PJCA 4G3YL 2GFBB 4OLUH 1R5IB 3SJVE 4D0BA 3GSRB 2FO4A 2ZOKB 2WUCL 3SDDB 5IB4A 3CVHH 1XF4A 3B8YA 1EXUA 2FX7L 4PRIE 4JM4L 1ZOXA 5SX5H 1EIBA 1UKTA 2NY5H 3C60B 4WI9A 3WYRA 2XI9A 4MB4A 5I6XC 2YD2A 3KPRE 1K8IA 1J9CT 2PR4H 5DMIL 3QCVL 4PJHA 2ADFL 3PDDA 1W72H 1K3ZA 3C08H 4WO4D 1MJJB 3G9AB 2FHCA 2M26A 2D31B 2VL5B 2BNQD 4I5BA 3WL9A 4X4XA 4E41A 4JFOB 3NACH 3VU2A 5CWSB 2YN3A 1OSZB 2EDKA 4LSUH 4DZ8A 4X5WA 1UB5B 3VI4E 4X7SL 3EYVA 3NIFF 4HXBH 5C08B 4BQBA 1F4YL 3UYPA 1IKFL 3CFKB 4NZUH 4MHHI 3R06A 2H1PH 3CPLA 3STZB 2JK5B 3PHQA 5BRZA 3GSVB 2X40A 1MHEA 1J1XL 3ESVF 4OFVA 4XC1H 2ITCA 1W2KT 3MJ9A 1C1EH 5I8OL 1CGTA 3IAPA 2HT2C 4F7CB 2FATL 4B53A 1MI5B 2BERA 3T1FA 1CVSC 2ERJB 2NXZD 1I7ZA 1EGJA 1N7ML 4OLVL 1LO2H 5SWSE 2PYEE 2AEPL 4P23D 4U49A 5E6ZA 3JVGA 3SGKC 3TYFB 2ESVB 4JLRA 1B2WL 3WXWL 3X3GL 4YBLC 4JRXE 2CKBB 5C9KA 1NGYB 1Q9KA 1KTLB 3T65A 5ESVB 5L9DL 4H1LB 3GJEA 5FECB 1A7NL 5DHXB 4FZ8H 1UC6A 5MERB 1BM3L 4ODHH 5BW7A 4ALAL 3LEXA 1I1AA 1YDPA 1IKNA 3IDYB 2D0HA 4PJCE 2KPNA 3RL1A 4PRBB 4F57L 3QUXA 4OLWL 5JORB 5FYLE 1IM3A 1HIML 1XIWA 1YYMH 5IP4A 4YAQB 1A7PL 2IJ0C 4X6DA 1X5JA 1NFDF 3RVUC 2A0LD 1WBXB 1N4XL 4HD9A 1FIGL 5MEQB 4JFDD 1KENL 5IOPB 1D5MB 1MWAH 1P7KA 3T04D 5T1LA 4ZS6D 3RTQC 3G04B 2BP3A 3HRZA 4KI5E 4PJHE 1Y18A 1CGSH 3GMOA 3HS0B 4OFDA 3DETD 3EDJA 1L4IA 4TNVK 2FNBA 1TPXB 3F7YB 4POZD 4UV7H 5F44A 5HHQA 4DQOL 5HI5D 1B9ZA 3N9GH 1NGXB 4JREB 2VXUH 1MNUL 2BNUB 2BY1A 3OR7A 5BXFB 1X5GA 5LGHH 1YPZA 4KKCC 3QFJA 4PB9L 4OF5A 5DJZB 1GL4B 3IJSB 3MROA 2E7HA 5CP7B 3O81A 5I2IA 2X4UB 3QULB 4JKPH 2D7OA 4U7KA 4XXDB 2GSIA 2FBOJ 3UJJH 3MRCA 4KUCF 5BRZE 1KIQB 3G08B 3MRDB 4RWYH 1UA6H 5JOPE 3WKNA 4IRJA 5HYQA 3MLSH 2G2RA 4TUKH 5KSAA 1EUUA 4ZTPH 2IANB 5C0AE 3S4SB 2Q86B 5F96L 3EO9L 1FGVH 2VQUA 1BBJA 4LVOC 3L3DB 1PAMA 4M7KH 4Z7VB 4Z7WE 4LRNL 2CQVA 3SDCD 1ERNA 3D6GA 3E6FA 3NZ8A 2AABL 3FO1B 1A7QH 5DJ6A 2B39A 3KPRD 1HQRB 2FJGB 4O2EA 4JO1L 3REVA 5LBSL 3QDAA 5GRJL 3T2PA 2RJMA 4P5TB 1H9VA 1JNHA 5D6CA 4JQIH 3BI9X 3JWOH 2GJZA 4L8BB 5F7LB 1HCFX 1JHTB 4DUXA 3S5LG 1UCBL 3IJHB 2Y25A 1WIPA 3CFCH 4XP4H 3TYGL 2BZDA 4NRXB 1CIDA 4YDVB 4KROD 3ZHDA 2D0FA 2DQHL 2ZNWA 1BP3B 1RZ8A 5DTFB 2BC4B 3EYSH 1SEBA 1D5IL 1HXYA 1DQLH 2FB4H 4N0YH 3V6FA 2Z93A 3EYUL 4XCYB 2YA2A 2KKQA 1TJGL 4X99A 1XCTA 3SGJA 2YHGA 3BPLC 3P4NB 3HC3H 1A6WH 3N1GC 4L8CB 5CINL 5JDJA 3MO1B 3OPZL 4N8VB 3PQYE 2XQBH 2EDJA 4U05A 5I73B 2HRLA 1JE6A 2FL5A 1JGEB 2YKLL 3A67H 5SWSD 1DQQA 1H15B 2PYED 5EO9B 4LSDA 4LSVH 4EI5C 4JG0H 5JXEA 5IVNA 1NLBH 4YHKL 4NNXA 1I3VA 4JN1L 4ERSL 3ZT6A 3QFJE 4JPKL 3QEUA 1KB5B 5DJ2B 3CH8A 2X2YA 2EXWC 4GSDL 3O8XD 2X4TB 1MCPH 1G7HA 4ORGA 5F1KC 4D3CL 3LKOB 1S7SB 3V8OA 5GRWA 1KT2B 2W0FA 5LQBL 3NTCH 3IDMA 1UWEH 3KXFB 3FB6A 1MHCA 5JHDA 1OQOA 4NN5C 1VFAB 3VGAC 4ODBD 5FYLD 1EPFA 3RZCB 3PP4H 4X0KA 4ZNEE 4S1RH 2A6JA 2NR6C 3O3AA 5I1AB 2VDMH 5E56A 5C0BA 1EBPA 1T89C 2UWEE 3ARWA 5L2JA 3KPMA 5D1XB 2VR9A 3GZKA 3NCEB 3O6FB 3FQUB 1IGTB 4KI5D 5LJYH 2ZG1A 1K2DB 4XNMA 4X98A 5KSVB 4W6WB 4Q58C 1RIHL 1Z3GH 4R7DA 1S7UA 4Q6IB 3SO3C 4WTZG 3ZMRA 5KN5B 4WI8A 5JMOC 1A14L 4GBXB 5JNYB 3P0YH 1CI5A 1P2CB 4CKVX 1DUZB 3NCJH 2X4QA 5IBTH 3I02B 5E7BA 1QR4A 1D6VH 1JI2A 2RB8A 5FV2A 2E7CA 3IFOB 2C1PA 4GLRI 1G6RL 3MFGB 1ZWIB 1KULA 1E27A 4JRYB 3QEGL 4ZFGL 5I1CH 3NOIA 4HUNB 4JDTH 4H0GA 3BP7A 1I9JH 5ISZD 3QNYB 2EC9T 2G5RA 3D85D 1SYVB 3LQZA 1R3LB 5DRWA 4XBPB 2KQMA 3RNKA 5CAYB 1HKFA 3SBWA 4B0MM 4M6NH 4DEPB 4GG6F 3TNNB 4XP9H 5CS7A 4YDLB 1U8HB 5IBLC 5F7UA 5DJDA 3RY6A 4POUB 3WO4B 4NT6A 3GSNL 1ADQL 3RKDC 5CZVH 4LF3A 2DQUL 2DLFL 4ZXBD 1GGCL 5FUCE 3Q6FB 3LRSB 1GJIA 5I0DA 3QDGE 3CDYA 1PGRB 3K8MA 1HSBB 3KPLB 3QXVA 2V5YA 3TH4T 1JGVL 4AMKH 3H9SD 2P8PB 4M5YL 3QUYB 3D3VA 1VEPA 2VQ1B 5AG8A 1MCKA 4ORZC 2VDQL 3ZSSA 5J6GB 3C5JA 2A1WL 3DSFL 4LEOB 2N7AA 2VLRA 3VFGH 5HYEA 5D1QD 3THMH 4RGNE 4QHMB 4PYHA 2X9WA 4M7LH 4DUWA 3MRHB 2MQ3A 2PTTA 1A6VL 1EEZA 5D1ZC 5HGBB 4OM1L 2VSCA 3C6LA 4Z7NF 5IKCB 5FM5M 1IQWL 5MEOA 2DQIL 5JHDE 4YHPA 4QRUB 4WHYH 1QUNA 5CHNB 1BWMA 4HW6A 2HMID 3VFSB 2A2QT 3TBYA 3FQNB 3GMPB 2H26B 3DI2B 4K3EH 4PGDA 3SKNA 2P4AB 4PRPA 5D96B 4R3SB 4K07A 4PJ7F 3VXUB 1YNLL 2JKXA 1IQDA 4PP1D 4B50A 2C4FT 3DRQB 4N1EA 3PQYD 3WE6A 2XWTB 2YD4A 3RX8A 3ULUC 4JFXB 5B4MD 1RIUH 3TNMB 4LL9A 1EMTL 2XZZA 2XKSA 5IHUH 1CGVA 4DZBA 4GXUN 5EWIH 5E1AA 2C7UA 1JV5A 1T1ZA 3HZKB 5EU6E 4F8QA 3V4PH 1JUFA 3D39A 4OKDA 2VLLB 2VLME 3HAEA 1KEML 1G1CA 1DN0B 4JY5L 4UT7L 2HJFA 1BVKB 5FKAA 1T20A 3TIEB 1BLNB 5IB2A 3C8KA 3H9YA 4U7SA 3QDHA 2J5LB 3ARFB 3O3EB 5E70A 3TZVB 3GUTA 1JYXA 3ZHLA 2HJLA 5EIIB 4FMFA 4U1IA 3P4OA 5CSZA 3UTZB 1C5BL 1C7SA 1Y6KR 4P99A 5D7JB 3ULUF 5IQ7H 4OZFA 3B2VL 5F1OB 3E2HB 5K9KB 1KJVB 5EZLA 5EBLA 1TDQA 3G6JB 4G42B 4DKEL 3MV8A 4DTGH 4LP5A 5IHBA 5J3HD 4XB8A 4WDIA 5TDNB 1JF1A 1REIA 2G60L 5L8JB 3ULUL 2FGWH 2XTJD 3GB7B 4HH9B 1M7DA 4S1DC 1CZ8L 5C08E 5D5MB 4M61A 1RJLA 2I07A 5EH1A 3SKOB 1F13A 3SGKA 1NFDA 3UYRL 1NGQL 2AQ3A 5C09A 3MUGA 4ZQKB 1DQTA 3JSSA 3GI9L 3TF7C 5D2NC 2JB6B 1XR8A 4YE4H 1UCTA 4HT1H 2WNGA 1UXWA 5GGUA 3FOLB 3BOVA 4GKZB 2XYCA 3U1SL 3S3PA 1RZGB 3T4YB 1JNLL 4TTDD 2J8UB 4FOMA 5J6HA 3GO1H 2QQNH 4WFGE 2YPVL 1DE4B 4MMXC 5T3ZH 2ESVE 3PL6C 5GRUH 2W0PA 3U30C 4J3XA 4TNWK 3S6CA 1QD0A 3NAAL 2EDYA 1D9KC 2VN4A 3LKQA 1YNTB 2AJUL 3EW3B 4NZRH 4M3JA 4LVEA 2XPGA 5GJTL 5J9PB 1KPUB 1MFAL 1R3JA 3TBWA 4JO2L 1G9NH 3BSZL 2GT9A 3RTQA 1T66C 4Y4FC 1F6AA 1DANT 3IJYA 1TTUA 3QDGD 5I8EA 2IEPA 3VWKB 2WWKO 3VXTA 4LHUG 3CXDL 4MAYC 1KJMB 1AR2A 1WSST 1NGPL 4RFEA 3D39E 3SCMA 3BJLA 5HTSA 3G5ZA 3DMMB 4LOUC 4OV5A 3CSBA 1X5XA 1EAPA 1KV3A 5EIVA 1F4WH 1A3QA 1OAXH 3PF2A 4PY7A 5KG9A 3BKYL 5EUKA 1OGAB 4KVCL 3ARQA 1AIFB 3CFBB 2D7MA 2J88H 4OZ4A 1U8NB 4AIXA 3DBXA 4K2UH 3BD4A 4R8WL 2D0GA 3MBEC 2OMBA 2ICCA 2H8PB 1IL1B 3O4OC 5EU3A 5C0IA 5IMKA 1IAIL 4Y4HD 4YO0A 5TQ0L 3T0EC 1KGCD 4X7FC 4KJPD 3OXSA 2BY2A 5EB9A 3IAQA 4JFHE 2H3NB 4M1GH 4O02L 1CLOH 4JFEB 3RWFB 3ROOA 2P46B 2VTFA 4N0FB 2P24B 1EERB 4HHAB 5AWNH 3DO7B 4KQ4L 1IGMH 2VDLH 4G6AC 2XACC 1U2CA 5EU6D 1TQBC 4PJ8D 1M1SA 3OB8A 4M62H 35C8L 4FMKA 2DBJA 2X44D 4DW2H 1DVFC 2CDGB 1K4DA 2VLMD 4D94A 4DWHA 3SDDD 1JL8A 5B3JF 5I0ZA 4HS3B 2XNAA 1U58B 1ZA3B 1FZKB 3HI6H 1LQSR 3CFIC 4L29B 1NCDH 3C60D 3MMEB 4NQUA 2R39A 3MRRA 3BD3A 4HQQH 5HDQH 2V2XA 3DUUA 1HILA 4GS7B 5TPWH 3RWJA 3TJEL 2V5RA 3MA9H 5E94A 5IFAL 4WGWB 1CF8H 2XZCH 5CIPH 3REWB 4Y5VA 1JMXA 5FYJL 2I9LA 4LEXH 5F9WB 4BUGA 3BPNB 1GGTA 2OTWB 4G7YL 1QSFA 4FXGA 3UZEA 4QRQA 5KSBB 1ZA6B 1SBSH 4C56B 3S35L 4MJIB 4HFWA 3ARBC 4GAFB 4R96A 2VZ3A 3P40A 5EOQL 4ZUTB 2X4NA 3BUYB 1QBMH 5C08D 4ODUA 1T0MA 5DDHB 5IT2L 1HNGA 1RULL 1UKQA 3FOMA 3QPXL 4YWGL 2EZ0D 4EI5A 4G7VL 4RQQB 5DEGB 5DJ0B 4ZOCA 3QG6A 2RCSL 2ICEA 4KRNA 3MV9A 1MELA 1J0HA 3FMGH 1WZLA 2KL6A 4I1NB 2C9AA 3P9LB 2OL3H 3RVVD 2XKNB 3WFCL 1QG3A 5I1HL 5IW1A 4O9HH 3HG1A 1G6RA 1MI5D 1LDPH 4G8EA 5FYKU 1TQCB 3JV5A 1BFOB 3K8LA 4I2XB 4MNGA 3CFEA 5E8NA 4LFHD 4NQSA 4TVPE 3HMWL 4MQTB 3HI5L 4WFGD 4UZGA 3WJLA 4HV8A 3E3QC 3I2CL 4UMGA 4J3UA 4G5ZL 2ESVD 4Y19B 1FE8H 5DYOA 3LMJL 3PNWA 1OWRM 4J1UB 5DQJA 4CU8A 3OQ3B 2ZSVA 4LP4A 5TE7L 5M94B 4CVZB 5C6PB 1T89A 4PP2B 4MNQD 3GSNA 4DOHE 1ADQA 2X70B 2ZOLA 3SDAC 5EOTA 3D0LA 2DTML 5IMOA 1T0PB 4TULH 2R23A 2R2BB 3KYNA 1VFBA 4OF3A 2B5IB 4IBLT 5DR5H 4GG6A 1FJ1B 2XWBB 2WINA 1FBIH 4XMKH 4XVJH 4O4YL 1NBYA 4NQTA 3JTSB 4LHJB 3VDBA 2PKDA 3BZFA 1FNEB 3V79C 4OD3L 4KPHH 4FQ2H 2V2TB 4YK4C 3ECBA 1TENA 4XHJC 2F74A 3T2QA 1FRGL 5IESL 5GS0D 5SV4A 1AGCA 2EEAA 2Z35A 3MNWA 3BHBB 4P5MB 4YZFF 1CL7H 1NKRA 4RX4A 4QXGH 3L3KB 4WHYG 5K9QI 1S8DA 3WNKA 1MRFH 5JIHA 3IKKA 4LPCA 1EH9A 4QWWD 1EEUA 1GVIA 4P4RB 4YC2B 1D5XA 2ED7A 3IF1B 1UACL 1UVQB 3T4AA 5EC2B 5FYKD 2WUBH 1XGUA 4PJ5A 3FTGA 5GHWL 1CXEA 3LZFH 5FOJA 1AC0A 4XPTL 1J10A 5IWLC 3VH8A 1OAYL 2PXYA 2R4SH 5EIQA 1EJ6A 1A6TB 5I66B 4PJ7A 3MV9E 3MODH 2FX8H 3HPJA 1CGXA 1G9MH 3AS1A 2PO6B 1XGYL 3WFZA 5ICZA 4I0CC 4UINL 1QFOA 3WD5L 3RKPA 2IAND 1S7VB 3LAFA 4G8IB 1YC7A 1FNLA 4PRDB 4XPAH 3QIUD 4P2RA 5H37H 5K9JH 2DKSA 4PJGF 3MR9A 5L8LB 3VFUA 2VLKA 2W0KA 3FT2A 3DOSA 4NN6C 1H0DA 4X6EA 3KYOB 5FK9A 2C3VA 3L9RB 4GRLB 1T1WB 2VIRB 4M7ZC 2ZKHH 4QXUL 4P5TD 1VSCA 5F9OH 1MUJA 3L7FA 1A9EB 1CG9A 3L5XL 4LQFH 5K33A 1QFHA 2Q7YB 3I50H 3OF6A 1QRKA 5HJ3A 2W59A 3OV6A 4RZCA 1KJ2L 4RFNC 3U48A 1I8IA 1ZHBA 1XF5A 2ZCLL 5C0CB 5DXWA 2EIZB 2DAVA 2F53B 4CW1B 4EIGB 1JZ2A 4UDTA 4LMQI 3HTLX 2NW2B 1A1NA 5B39A 3QRGH 5E0QA 4ODSH 2HFEB 4U1SA 3P30H 3BKCL 4QCIB 5TGBB 3VXRB 5DVMA 1I3RA 4WHCA 1OB1A 1GXEA 2IPTL 5IIEA 1KJ3H 1FH5L 3LSOA 3VXUE 3HLAA 3WUZA 4UQ2B 5ADOL 5B8CB 3UPRA 2WZPD 5DWUL 3OAYK 1FV1B 3QB7C 2K1MA 4O58L 4OCRL 4BQCA 4RCAA 1J05B 3JTTB 2YA1A 5FDYA 3BXNA 4LKXB 1VCAA 4TVPD 5EZJB 3LCYA 4AZ8A 4D8PA 12E8H 2QQLH 5EO0A 3QUKB 2AJZB 1MCWM 4Z7NE 1CD1B 4AEIH 4J2XA 4MJ5A 1T1XA 1N0XL 5FYLH 1MFBL 1JHKH 3QQ3B 3OHXA 2H32B 3C8HA 4O2FB 3W9DA 5C9JB 4ZDHA 2DMCA 4NJAH 4U0QB 4L4TB 1QQDA 1FL6A 1UEMA 1N2RA 4WY7H 4Z0XB 3UAJC 3KJ4B 3D18A 3VFVB 3EO0A 1YECL 3IDXH 1U92A 1R3KA 2YPKB 3KXFD 3P9WB 4ZUUB 3TBSA 4PY8J 2Q8BH 2P48B 4ISVB 5K9OB 1GIGL 4JKKA 3RZCD 7CGTA 5D2NA 2HFGH 4P2RE 2NX5B 3G6JE 3JV6A 4PR5B 4YXLH 2GCYA 1J87A 1U93A 4ONHB 1WK0A 3X3FL 4PJIB 5D1XD 5F7EH 4PGBA 1E0OB 3O6FD 4XCCH 5CJQL 4PREB 4EI6A 4PJFF 5HD8D 2ZJSH 5CGYC 5D5ME 4Q9QH 2DICA 1MVFA 2VZVA 3ZTNL 3MCKB 3SDYL 3PL6A 3NZHL 3SGEH 5IJKC 4GBXD 1D9KA 5C71A 2W9DH 5JW3L 3MNZB 3KPQB 3LHPL 2NW3B 1QOKA 3Q6GL 1LEKB 1W0YT 3MUZ1 5JOFA 5HDBE 4JRYD 3GHBL 4QT5A 3GSXA 4R90L 2DMKA 3P4LA 3MREB 4OCWL 5FO8A 2K3TA 1HSAB 3EGSB 5DMKA 5DRZB 1TJHH 4GW1A 3RDTB 1NCCH 2J8UE 3Q2CA 2N7BA 4DKAA 4PLJD 4BK4A 4HIXH 4XAKD 1DBKL 1C08A 2OP4L 3D25B 3BEWB 1LO5A 4X9IA 1G7JA 2E7BA 3MLUL 4JB9H 3F12B 3F7RA 2YSSB 5KOVC 3N1FC 4KK8C 3UPCA 4ZTOL 5HGDB 1P9MA 2LTQC 4Z76B 3NPSB 5GGVL 3GI8H 1J7VR 1HXMB 5IR1A 5BV7C 4YJZL 2EICA 3QUYD 4WU5B 5T1DL 5BOPA 1W0WB 3FCTA 5F8RC 1NAKL 3U9UB 3T0EA 5ACMA 4S2SB 1I7RA 2YS4A 3OAUH 3VA2C 1F8TL 5GS2D 1CT8A 1DLFH 2BCKA 1OGAE 2AW2A 2C3HA 4FQJL 5T1KA 4OZHB 2OMNA 4FQXC 5AUMB 1BJMA 4CGTA 3MUJA 4KKBD 3T3PF 5IMLA 1ZEAL 4V1DA 4Q0XH 3I6KA 8CGTA 4JHAL 3ULSA 3VXUD 5ELIA 4MD4B 3TWCH 3QUMB 2NY3B 4OGYH 3GM8A 3B9AA 1E4XL 3VJ6B 4LVHB 1HHJB 3QO1B 2X4OB 3NIDF 4J23A 4Y5YB 4YHMH 3FFCB 4Q9RL 3TT3H 1DSFL 2V2WA 3OKKB 5L2KA 4OI7A 1YEHH 2ENSA 2YD3A 3MLYL 4KHTH 3BRGC 4Y8AA 2Y1VA 2DLGA 2Z0BA 2GSGA 1D7FA 3FT4B 3EIFA 3SDXB 3UJIH 2FSEB 2BOBB 3ARBA 1MFCH 4M1CC 3H9HA 3ARFD 3LEYL 5INCB 4YHLL 1YMMA 4XVTH 3TZVD 1MJ7H 1I4FA 1U95A 2R29L 3O45A 4ZNCD 5D7JD 43C9B 4TUJB 3HPLB 4OLYL 3L3KA 3EFDL 2DM3A 4ZO7A 1GGBL 3VWJB 4N0UA 4JFZH 1KB9J 1DBML 2DDQL 2X89A 3IETB 5KSBE 3DECA 4H25A 4C56E 1EUTA 1GGIH 1ACZA 1A47A 3M1BB 4K9EH 5DJXA 3V4UH 3CLFL 2NY2C 3K2UH 5B3JE 5C2BL 4JANA 1BFVL 4JY4A 4IOFC 3VXSB 3VXNB 4IIQA 4LDOB 1MFNA 5FCUH 5DLML 2EDEA 1QPXA 1T3FA 1U8QB 3B2UC 2EYRA 3IDNB 1OLZA 3EJYD 2DQCL 2OQJA 5C0EB 4Y2DA 1OL0A 1CXFA 2HP4A 3FQRA 4R6UA 1D5BA 1D5ZB 5SX4H 3SDAA 3QWOA 4P46A 2ICWJ 5DK0B 4K3DL 3Q5TA 5GGSB 1ZLSL 4J4PC 4PV9A 5GRZA 2ZG3A 4V1DE 2B2XH 3DURA 3KYMB 3IFPA 5KVFL 5FHAL 5E99L 5HPMB 3GJFB 4MSWB 1S9YA 5AAMA 3C5SA 4JKMA 3DGGB 2VXTH 3O11B 4Y19E 5DUPH 1QP1A 3GMNB 3RGVB 2W0LA 1FC1A 1CQKA 3VGEA 4B7IA 4Z78B 5FA4B 1E6JH 5I75B 3FQWB 4HK0A 4TUOA 5IFJB 2NNAB 2VDNH 3O0RH 2VDRL 5CEZE 4CDHA 1KCUH 4WJ5A 4WNQA 4XCEB 4I48A 2X4PA 4BSWB 4LVNC 4OF8A 1IAKB 5CZKA 3VWKD 4KK9D 2FDBP 2F5BH 3CFDA 2VXVH 4PJGA 2NZ9C 3S96B 3DMMD 2V7HB 4HWZA 1NAML 4ZOEA 1OSPH 3K8KA 2WLZA 3ILPB 4MA8L 4LLUA 1S9WA 4RDQG 2BSRA 3JWDL 3F58L 1OGAD 4N0CD 2X4SB 3IDJB 1MLBA 3ULVD 15C8L 1M6OA 1RZIA 5IWLA 5EO1B 4IRSB 4FA8A 2W07A 4HXAH 3SKJH 3WIHL 3VGDA 1A9BA 3OB0H 4N0UE 2Q3AA 4HIEA 3CC5B 5K59F 4R7NA 5MP6H 4HGWA 3PE9A 3FO2A 1OHQA 4DK3A 1CFVH 3F62A 4KTEL 1FLRH 2EE9A 3KLHC 3QFDA 1LNUB 5C1MB 1T04B 1VADA 2EO9A 2VKWA 4JFED 5L7XH 1DDHA 4GRWB 5HYJB 3U9PL 2D2OA 2CLVA 4GKSA 1LO3H 2DBLH 4GW5B 1WC7A 2J2ZA 1URLA 2BDNL 4QRPB 1S78C 1BBDL 1LK2A 2NYYC 4TRPH 3EOAB 3VFOB 4FQ1H 4P4KC 4JM4H 4JDZA 3O41B 4OZGB 5BO1H 3WFDL 3RY4A 1AD0A 1CYGA 1TVDA 5E00B 4GUPB 3TPKA 4APQA 1NUNB 1EK3A 3ARVA 3RWGA 4OM0L 4XPGL 1Q94B 3HNSL 3GGWA 4NSKB 4FQPA 2EYSA 3F6LA 1AFVL 2MKLC 2WLYA 3PWVA 4YBLB 3O2WL 1OT2A 2XQYK 4MDJB 5C0FB 4BZ2H 1DBAH 1KBGL 4EDWH 3WNPA 4NKDB 3VRIA 4K3JL 4YR6B 5DJ8B 2Y5EA 3WN5B 1FG2B 4C56D 1CWVA 3QPQC 4MJID 3SOBL 3UTPE 1CDBA 3MXVL 3PJSB 5KSUB 1I1FA 1OARH 3V6OA 1IGCH 4U6XB 4W6XB 2AK1H 4HMCA 3FB7A 3KPTA 3ARDA 3CZJA 1YY9D 3WLWD 1UM4H 3VXRE 1I3GL 3TH2T 5HYSG 3BIKA 4PJFA 3L6FB 5I76A 1MCOL 2CKBH 3SE4C 4AENA 4S11A 2CO7B 3WNOA 1JVKA 4EKXA 2E9BA 2DWEA 4NO2A 4HPOL 5E2JA 3TCXA 4XMLH 4C83B 3LEVH 3O6MH 1J5OH 2DWDB 2VXSL 3IXTB 1YY8A 2NLJB 4WW2F 4E0RB 2D9CA 2V6HA 4KKLD 4YHNB 1T5WB 1VB9A 3QIWB 2X9XA 5JDSA 4WTWA 5ESQA 4LU5H 3NIGE 4NRYB 3V5KB 4X4ZA 5HY9A 3B8SA 3IU4L 1TTFA 1HINL 1I1YA 2BNRA 5CEZD 4JFPB 3MJ8A 5DD5L 3SE9L 5F93C 1KIPB 1MCRA 1RZKC 4OT1H 4UIMB 3Q5OA 3KR3L 3BP4A 1RZFH 1S9XA 4OZFH 3RIAF 3FB5A 1TLKA 4NWUL 5B38A 1KNOB 1PG7L 1BAFH 4A2MA 2C1OB 4ONGL 3JUZA 3BZ4A 2E6QA 5J11C 3H6JA 3ZDZE 2RQ8A 5AYQA 4NO0A 1JZ3A 1ZHLB 4ZSOB 3G6AA 4KRPB 4PJIE 1KIRA 4YHIA 5EOCL 1N5AA 5DRNB 5CILL 1ZVSB 3CSPA 4U6YB 1YEDA 4W4NA 2WWKT 4PJAF 4QO1A 2XFXA 4RRPA 4M00A 5IHLB 2DLIA 5D70H 3QIBA 4NKIL 1R24A 4ZAKB 1T5XB 2P5EB 1VESA 3IFLL 3UXFA 1NEUA 4JGUA 1A2YB 2JELL 3QT2A 5GGRA 4Z9KB 3KDMA 4G9FB 2YD6A 2BSED 1OM3L 4Z7QF 1J8KA 1RZKL 2R0ZH 3VW3L 3S3JA 1Z0NA 4BFEA 3FRPA 2WV3A 5A2FA 2PO6D 3GMMB 3H7LA 3CDCA 4NWTL 2ILLA 5D2LB 1T7XA 3BPLB 1DCLA 3TO2B 2JJTC 3DROA 5CKGA 1WAAE 4H26A 3OTTA 2AEQL 4L3CB 1ONQB 4KK5C 1P4IL 4HJGA 1AGFB 2Z8RA 5CZXC 4PRAA 1UH2A 3IS1X 1MFEL 4HUXB 4JPWH 1IVLA 2HKFL 1TZHA 2P5WB 1TJIH 4GRLD 2DQJL 3E1F1 4YNYA 1EZVX 1WZ1L 1ZT4B 4FQLL 2VLJB 3GK8H 2O5ZH 1ULVA 1NCWH 3MV11 3BAEH 4MQ7A 4CNIB 4HGMA 4OLZL 1EVUA 3BH9A 5C8JB 1KELH 2BK8A 5DS8B 2ARJA 2XG5A 4PFEA 2BNRE 3DARA 2DQEH 3UTPD 2E27H 5C0CD 4W70A 3GDBA 3NH7L 4QTHB 2F53D 1ORSB 4OZHE 1T83A 5DD1H 5LCVH 3TO4C 1MY7A 1NC4A 3N85H 3VGAB 3QHZL 4TVPH 1C7TA 4MCZA 3MXWL 3V0WH 2D4FA 3DX6A 3EAKA 4PRHA 1A22B 2WP3O 3MLXL 2EKSB 2CUIA 4Q2ZB 1UQSA 4CMMA 3TFKC 2A83A 2BMKA 1NL0H 3MZTA 4RISL 3HFMH 4DCQA 1KB5H 5HGHB 1SVCP 2VXQH 4HBCH 4XNZB 3BZDA 3EOBA 3BP6A 2FEDC 3L7EA 4L4JA 5CBEB 2AJXH 2A77L 4UTAH 2IBBA 3VMPA 3SO3B 1TVBB 1JZ4A 4XPFL 3FFCE 2ICWB 3UBXB 3TBTA 1CFSB 1YN7B 2JIXA 1T4KA 2NY5C 3WUWB 5GGQL 4XP6L 3P0GB 1RURL 2ZUVA 3VCLA 3JV4A 5H94A 2DF3A 3MQIA 5HXMA 1QR1B 4L4TD 3GIZH 4LCUB 4K7PX 2MTPA 2XY1A 5FO9A 1I7TB 4IRZL 5IQ9A 3DSNA 4XXCC 1T21A 4NQXB 1CFTA 1D3CA 3WNLA 4BZ1L 1TXKA 1NFIA 3LKPA 3BQUC 2J8OA 1Q72H 2A9NL 4I0PC 2Z31B 4MWFB 1ZLVK 1CFQB 1FZJB 1INQB 1MRDL 1R5WB 2X1QA 3KGRA 1NAMA 1X5ZA 3IU3A 3NIDE 4ZUSB 5GGTL 2NX5D 4OUOA 1TNNA 3V5HA 4CVXA 4OLUL 1IAIM 3C5ZC 4MA7H 5A2JH 4Z0BH 2GITA 5DHVA 3CVHL 1PZ5A 2W9LA 3WEXB 2AV7B 5I16B 2DQFB 2RAMA 5FGBA 3WIHA 4HUMB 2NY5L 3UTOA 3VXMA 4UQ3B 3QXAB 1I85C 5ITBH 2PR4L 1P7QA 4KXZI 3BZEB 1FFQA 2R69H 3VG9C 4D0CB 1W72L 5IMMB 3DX8B 3MGAA 4IOIA 4PG2C 3C08L 5D1ZB 2WQ8A 1G6RH 3D1MC 1FHGA 3HC0B 5IW6A 4QYOA 1JTPA 4AT6A 1F4HA 3EDFA 2EC8A 1N6VA 4LSUL 3RVTD 1E4KC 1JWMB 1HQ4B 3CXHK 3BH8B 3V5DA 3RDTD 4HXBL 1QFPA 4PRHE 4U3HA 4NZUL 1C8PA 2H1PL 3UJTH 2BOCB 5TQ2H 2Y5TA 5D7KE 1DFBH 4NPYB 1JGDB 2BSSB 1EEYA 4XC1L 1XF3B 4U1NB 5GS2H 2ATKA 1C1EL 4ZPTA 4ZUVB 5ID1B 1LHZA 3UTTB 4P3DB 5FCSH 5DT1H 3NGBB 3RI5F 4PTTB 5IGXH 5GGVY 1ZS8A 1S7RB 5TF1H 2X05A 2VABA 3T2NH 1XGTA 3F7VB 4AH2A 4TNVF 1LO2L 2KZ1B 1AGEA 3ROLB 2CRZA 4QOKA 5C0GA 3V4VH 2AXHA 4MZ3A 3K0WA 3IDUA 1BIIB 3MLWH 3MA7A 4LMQE 3S36X 2GJ6B 1NUFA 4F7EB 1YUHB 3HE6C 2VZSA 2JCCF 3EUUA 4FZ8L 3O2VH 1FL5B 2CDFB 4K7FB 4ODHL 3LV3B 3MRJA 3B6SA 5DUBB 5JW5B 5HDOA 1FL3A 1HH9B 4UOW1 4P4KA 2Y7QA 1YYML 4WHTA 5GGRY 1AQDB 3RPIB 3GMRA 1V3MA 4D9QD 2QQKH 3L1OH 2HVKB 1AKJB 2DI7A 1YJDH 4GRWE 1MWAL 5HYJE 1A6AA 2E7LA 1VERA 4LGSB 3SQOH 4EVNA 1U8OB 4LLAA 1ZLWK 3IXAA 1CGSL 4QRPE 5CEYB 3STLB 5ERWA 2AJ3B 4LPTA 5CSBA 4BQ9A 4R4FH 1JP5A 4OCLC 4UV7L 2XWJA 3N9GL 1FZOB 2VXUL 4MAUH 3JWOC 5EG6C 2VE6B 4YEFA 1PEZA 5LGHL 1B4RA 1IEBB 4OZGE 2HVJA 1UXSB 4WW2A 4PIRF 2QHLA 3BJ91 1N59A 1U91A 4OZFG 5EU4B 4OLXH 4JKPL 1NJ9B 3UJJL 3VWJD 4JZOA 1KLGB 4RWYL 1UA6L 3RP1A 5EORH 3MLSL 3V9FA 4TUKL 4WVRA 1MVUA 6FABH 4G8FB 4ZTPL 3BEVA 4Y4FB 4KZDH 3P2TA 1NBZA 4TSCH 1NH6A 1FGVL 3FQTA 1A3LH 4M7KL 4MAYB 4XMPH 3VXSD 4X6CB 2CUHA 1S5HA 1GHFH 4GQ9H 1G7QA 1A7QL 3HZVA 1U3HC 1P69B 2FEEL 3LH2H 2YK1H 1RUPL 32C2B 3LVEA 3MGOA 4M48H 4OAWA 1S7WA 2FJHB 4RNRA 2BVTA 4JQIL 3S4SG 3UC0H 1CVRA 3JWOL 3KPSA 5JPMB 1DUYB 3MBEB 4PJAA 2E9WA 5E8PB 3CFCL 3SGDH 4XP4L 2VJXA 2OS7A 3AU1B 4KH2A 1MLCB 3H3PH 3P11H 1FVDA 3RAJH 2YRPA 5BS0B 4L8SB 4L9LA 5C92A 5DZOA 5IJVB 3EYSL 3RGVD 1KPRA 3U36B 4ELMB 1G9EA 1UM5H 1DQLL 2FB4L 5D7KD 1BIHA 4N0YL 3DVNB 4IHOB 3C6LD 5DHYA 1KN2H 3CH1B 3U4EA 3V7AE 3VD5A 3HC3L 1RV6X 1A6WL 4C4KO 1MCCA 3BW9B 1YNKH 1AXSA 5I1DA 2XQBL 1IC4H 1DVFB 2BVYA 3A67L 4LSVL 4P59H 1VKXA 4JG0L 5IB3A 3S7GA 3VFNB 4YXKH 5GXBB 1NLBL 4UILH 3DGCR 2OM5A 4R0LC 1PYWA 1MAMH 4OCNC 1BZ7A 2XRAH 2AKRB 4N8VG 4ZSOE 4IRSD 4J12A 4U1KB 1MCPL 1H3PH 4HFUH 1HH6B 4NKMB 3PHOB 5JA9A 3ZE2F 3FRUA 3EOTH 4LCYB 3NTCL 3OAZK 4LNRA 1UWEL 5JO5A 4BYHA 1ND0A 3D69A 1AGBA 4L3EA 2A9MH 3HMXA 2N1KA 4YBHA 3PIQB 3SKUD 2R2HB 1CIUA 2P5EE 2CDEA 4S1RL 2UYLA 4GOSA 4P57A 3CCHA 1ZLUK 5E08L 4DKFH 4PV8A 3VXOA 3BE1H 2VDML 5IVXB 3I6GA 2FWOB 2VISB 4G9FE 1KXVC 5HYJD 4HGKC 2AGJH 1Y6MR 2EXYC 3K1KC 2RGSA 5FOBB 1AHWA 3UTQA 3MNVB 5IHZB 4TN9A 5DRXA 1HKLH 1N8ZB 2EE3A 4OKVB 4D2NA 4QRPD 2IPKA 1Z3GL 2OCFD 3MJ6A 4JEGB 3CUPB 3FB8B 5IEKB 3P0YL 5DZLA 3LKSB 3NCJL 5IBTL 4G6FB 3RWEB 1R5VA 1F3DJ 1D6VL 3W9EB 3ZKSD 2MHAB 2ADIB 5CKAA 1LDSA 3ALPA 3TO4A 2FGZA 2PUQT 2CLRB 4QRRB 2RIKA 4NIKB 3ZSTA 2FHFA 5I1CL 3C8DA 1IGYB 4JDTL 5C0DA 3S3SA 5GRYA 1I9JL 4WFHE 2VLJE 3RL2A 4HKBA 3ZDXF 4F37K 5GGTA 4UQ3A 1HHHB 3WDHA 2AXGB 3AB0C 5CJOH 4M6NL 1WCBB 5J1AB 4XP9L 1HZHH 2ARWA 3NCBB 5DQ9B 8FABB 1WWCA 5F3HA 1WBYA 3LDBC 4MJ2A 3OKDA 1HDMB 1ROWA 1FNGA 3C2AL 5CZVL 3D87B 4MNHA 3KPOB 2HT4C 5E2TH 4X4YB 3DX9A 3RVUD 3G5XB 4NBYB 1S5IH 3ALXA 3P77A 3T09A 4UOW0 1QSVA 4AMKL 1TCRA 1OPGH 3OJ2C 3WXVH 3OKNB 2X4RB 4KJYA 3VFGL 3THML 4J7RA 4XXCA 5D72H 5HI4C 4RMRA 5IM7A 4WEBH 4QTIH 4P2QB 4M7LL 1IM9A 3CMOH 2RR3A 2I24N 3BQUA 5ENWB 5CEZH 5GSVB 2PW1A 3KPNA 3RWHA 3DYPA 3OKMA 3GHEH 2F5AH 4Q9BA 3QZWB 4K71B 4HIJB 3QIWD 4KKCD 3T8XB 4K3EL 4N9GB 3G9VA 1KJ2B 5F3BB 1DBBH 3C5ZA 1Q9WA 5HHXH 1HHGA 5F7NC 3O9WC 2JJWA 4KV5E 5FF6A 2OZ4L 4EQ3A 1EZVY 1JK8B 1YMHA 3KLAA 1QA9B 4ZO8A 4YUEL 3O2DH 5ID0B 4GAGH 4N90D 3K2MC 2V5TA 6CGTA 1IEAA 1MIEH 1RIUL 4GXVH 2P8LB 1I85A 5IHUL 1MCNA 5I1JH 2APVA 1J8HB 5EWIL 1ZMYA 4PG2A 3A6OA 5CMAB 1OD9A 3P4MB 4LSSH 3P0VH 3V4PL 5I9QC 5E5RB 1HYSC 2D7QA 4KRPD 1BOGB 5E5UB 5BVJB 1E4KA 4X80H 3OJDA 1I8MB 1KUMA 2CLZB 4M43H 3W0WA 3PP3H 4EOWH 5JIKA 5FKPA 5TH2A 1JPTH 4PJ9C 1AJ7H 3TV3H 3KYKH 5IBUB 4H0IA 4TNWF 5IQ7L 2J3SA 5ACLA 4ZAKD 5FB8B 2P5ED 2JCCA 4PTUA 3BUTA 4CU7A 2CR3A 4NOBA 4DTGL 4HKZB 3VE0A 4G9FD 1HHKB 1F11B 4MXQC 2APBA 2FGWL 3FQXB 5EPMA 1UH3A 1G9NC 3U46A 5I8CA 1RZ7H 3PWJA 4IMLB 2QKIB 4HMDA 3F7QA 4DGYH 4ELKA 4K7PY 2ZCKH 1IC1A 3VFWB 3BDXA 1XAUA 1A6UH 3RWIA 1FNAA 3UTSB 4YE4L 3AREC 4YHYC 5FDWA 5I1LA 3KWWB 2I5YH 3W11C 3UTTE 4XB7A 2VC2H 4HT1L 1RK0A 3L3OA 2P5WD 5JTWA 2ZUQC 4AY0A 5DA0B 2BJMH 4U4BA 4WFHD 2VLJD 4Z77B 1UZ6E 2P7TB 3O3DB 5CUSH 2XZQH 3I6LE 4XCNB 3MBXH 5JOEA 3GO1L 2QQNL 3KPPB 2Y36H 3KNBA 3HG1D 5GRUL 4PRNA 4HUKB 2LU4A 1GZQA 2C3GA 5HVHC 4NZRL 5MENA 2YXFA 2GJ6E 4MJ6A 4KDVA 4RAUB 4F80A 1S9VB 2IADA 2WBWB 1G9NL 4WUKH 5B39G 4W4OC 4L4VB 4RMTA 2EDNA 4GRMB 2Q76A 3L3HA 2NR6D 3MOAH 4ZD3H 4XHQA 3QXDB 4P49A 2V7NB 4U1LA 1BX2B 1F4WL 1SJHB 1OAXL 3ZKMC 1ORQB 1QO3A 4JQVA 1FFRA 1CLZH 4C58B 3IDIA 5KVGH 4FQIH 3HE7A 4YX2H 3PGDA 4KY1H 3B9KC 2J88L 3W81A 3TN0C 1XH3A 3DXAB 3FO9B 4K2UL 1QKZH 1WIOA 3ZKNC 5ESAA 1RJYB 3MLZH 5E8OB 4YDJA 1BVLB 1R3IH 1JZ7A 1I9RH 4YBQC 1ZK9A 2DM4A 3MFFA 3V52H 5SWZA 3TIDB 4JFYB 5ANMB 5TFSH 3RVXC 1G7IB 1BQHB 4M1GL 1CLOL 4ONOA 2Z31D 4XX1E 4RIRB 1U3HA 4ZFOB 3U0WH 1TFHA 4ZFFB 5AWNL 1IGML 3QDJB 4LLQA 2VDLL 5IBLD 4WW1B 3QHFH 5H2BB 1LEIA 4M62L 4DW2L 5E4EC 1QPPA 2CIKA 3RKDD 1NDMB 5CBAB 1XGRB 1PSKH 3LQMA 3SGEI 1BF2A 3HI6L 3OSKA 2OX5A 5BV7B 3S37H 2OSLB 5D7LB 5ACZB 1D6EB 4X6CE 1NCDL 2PCPB 2QSTA 3MRGA 4HQQL 5F1NB 5TPWL 5HDQL 4QXTA 3MRMA 3MA9L 2FJFB 1QLFB 1CF8L 1N8ZA 2CMRH 2XZCL 3LHPH 4LDEB 4PG9A 4LEXL 5D1ZD 1A7OH 2IGFH 3U6RB 1WZKA 2VLKD 1UJ3A 4FQXB 4YQXL 5A2KH 1JZ5A 2Y06L 2D7TH 1GCFA 4P2CG 3HZMB 3WFHB 1SBSL 5F88A 1WBZA 2A0LC 5JQHC 1FAKT 3SE3A 5FUOL 4LAJH 5HI3C 1LEGA 4FZEH 5BS0E 4ZS6C 1MCLA 4HUVA 1JWSA 1NMCB 4ELME 1QFWI 3FMGL 3DETC 4U1JB 1S7TB 2OL3L 1YQVH 2VERN 5H35A 1DN2A 4POZC 1CDGA 2FD6H 3UTTD 4O9HL 4K3HA 1V7NH 2ITDB 2I27N 1FVCB 1LDPL 3HCVB 3JWNC 2NXZB 1Q38A 4Y16A 2IQ9H 5GJSH 5ITFB 1B0RB 5DEFB 1W0VB 5MHSE 4MD0B