3IWUA

Crystal structure of y116t/i16a double mutant of 5-hydroxyisourate hydrolase
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
LSPLSTHVLNAAQGVPGANMTIVLHRLDPVSSAWNILTTGITNDDGRCPGLITKENFIAGVYKMRFETGKYWDALGETCFYPYVEIVFTITNTSQHYHVPLLLSRFSYSTTRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 5-hydroxyisourate hydrolase
publication title Probing the Evolution of Hydroxyisourate Hydrolase into Transthyretin through Active-Site Redesign
doi rcsb
source organism Danio rerio
total genus 26
structure length 114
sequence length 114
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.2.17: Hydroxyisourate hydrolase.
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3iwuA00
3CN4A 4TNGA 4ABQA 5AL8A 1KGJA 4TQIA 5BOJA 4IKKA 1X7SA 1X7TA 1G1OA 2G4GA 4PWIA 3CFMA 3BSZA 4WO0A 3DJZA 1E3FA 2WQAA 3IMUA 3P3RA 1F86A 3DJTA 5FW8A 1TYRA 5CN3A 2ROYA 2G4EA 3Q1EA 1E5AA 1QWHA 1Y1DA 4QRFA 4QYAA 3A4DA 3ESPA 2H6UA 4HISA 4PWEA 4TLSA 4TM9A 3IMRA 2QGDA 5AKTA 4DETA 1THAA 1TTAA 4TQPA 4Y9EA 3W3BA 4PWHA 3CBRA 3P3TA 4TL5A 1KGIA 2B77A 2G5UA 3GS0A 4ABUA 1IJNA 3GRGA 3GS7A 3IWVA 3NEOA 3DK0A 1QABA 3CFQA 4KY2A 4TKWA 4YDNA 3U2IA 1DVYA 1FHNA 2QGCA 3B56A 4PMEA 4IKLA 3DGDA 3CFTA 5CNHA 4N85A 4IK7A 3GRBA 3P3UA 2ROXA 5CR1A 4I87A 4ANKA 4TNFA 3IMWA 5CLZA 5TTRA 2PABA 4AC4A 1SOKA 4Y9GA 1BZDA 1RLBA 5K1JA 5A6IA 4TL4A 5JIMA 4IK6A 3D2TA 3DJSA 3IMSA 3DIDA 1TFPA 2GABA 4N87A 1ETA1 3OZKA 2H0JA 5CM1A 1TT6A 3I9AA 3SSGA 2G2PA 2H0EA 1TTBA 4DERA 2B9AA 3IMTA 5DWPA 1E4HA 4WNJA 1ZD6A 4PVLA 4PMFA 4YDMA 4DESA 2FLMA 4WNSA 4IKIA 5FW7A 4TLUA 2B16A 4D7BA 3ESNA 3NG5A 2G3ZA 4PWKA 3CN3A 1DVTA 3OZLA 4FI8A 4L1TA 2B15A 2GPZA 3NESA 4QXVA 1DVZA 1BM7A 1FH2A 2F8IA 5CLYA 5IHHA 4TQ8A 5AKVA 4ACTA 5AL0A 3I9PA 4PM1A 2G9KA 4Y9CA 3IPBA 2TRYA 1TLMA 4ABVA 5L4MA 4TLKA 1SN5A 4MASA 2TRHA 5E4AA 4PWGA 1DVSA 1F41A 3GS4A 3I9IA 5DEJA 2H4EA 4IIZA 1TTCA 1GKOA 4PWJA 5HJGA 1BMZA 3GLZA 3CN1A 3P3SA 5L4FA 3BT0A 3HJ0A 4Y9FA 4N86A 4FI7A 4DEWA 2H0FA 5AYTA 4TLTA 3U2JA 2G3XA 4PVNA 3M1OA 1Z7JA 2QGEA 1BZ8A 1TSHA 2NOYA 2F7IA 3IWUA 4FI6A 1GKEA 3A4EA 4MRCA 4TQHA 1BZEA 3D7PA 1DVXA 2QELA 3NEXA 4ABWA 3FCBA 1ICTA 1U21A 3DJRA 1ZCRA 1IIIA 4HIQA 5EZPA 3KGTA 3NEEA 2G2NA 2IGLA 5CLXA 5AKSA 1OO2A 2FBRA 3CXFA 4HJUA 4IKJA 5FW6A 3A4FA 1ETB1 1IE4A 3IPEA 3KGUA 3KGSA 3TFBA 5EN3A 1TZ8A 2QGBA 4HJTA 1SN0A 3CN0A 4Y9BA 5E4OA 5FO2A 5L4JA 3GPSA 4PWFA 1TTRA 4L1SA 3CFNA 4MRBA 4AC2A 5E23A 3TCTA 4HJSA 1SOQA 3ESOA 4I89A 1THCA 5JIQA 2B14A 2H1XA 5K1NA 4PVMA 2QPFA 3FC8A 4Q14A 4I85A 1DVQA 4DEUA 3IMVA 3DK2A 5JIDA 4TNEA 3QVAA 1DVUA 3CN2A 5L4IA 1SN2A 1IIKA 3DO4A
chains in the Genus database with same CATH superfamily
3KW8A 1FZJB 2YSTA 3MZTA 1UQSA 4OLWH 1XGUB 1QSFA 3OLIA 5DZAA 3A5VA 2WQAA 3WUWA 4XMTA 1UACH 4MX7A 5IQNA 4MVBD 2EICA 4IGBA 1OGTA 4HUWA 4LLUA 3JT2A 5AKTA 1OAQL 1NPJA 4YSSA 3TN0A 3TM6A 4KFZC 3FTGB 3ECWA 5IFAH 3MRPA 3EO9L 3QFJE 3AXIA 4ZAKA 2JJSC 1UFUA 2WBJD 1KCVL 3SGKC 1O9WA 2XPZA 1YYLH 1PJ9A 5B1JA 4EN3B 3TNNA 4TTDD 4A6YH 1SYVB 3E0GA 1Z3RA 5DO8A 3I3EA 3RWDA 4XP4H 1DBAH 1ILUA 4Y8DC 2PPAA 3O2DH 3UCRA 1KCUH 4C59B 2C7UA 2XSKA 3I74A 2XRAL 4LGPB 5GZNC 3QDJB 4GSQA 2FIKA 4PJIF 2LLNA 4WI0B 3WJLA 2DOCA 1HOCB 1NIEA 3MRRB 4UT9A 5DVPA 4RVBA 3CAFA 4K3HA 1F3DH 4U05A 2W9EH 1NC4D 4UINL 1R34A 4AI7A 3NIFF 3VA2C 3OZLA 2OZ4A 2B15A 1IAOB 5EU7E 4Q0XL 1SXCA 4OZGF 2BVOA 5D5MF 2PCPA 3MRQA 3G5VA 5AVUB 5JORB 4PJDF 2FBOJ 2VMDA 1MN4A 1XBRA 4HX1B 4F33A 3GYRA 1X5IA 4O4YL 1SN5A 4K94C 4MASA 3S35L 4PI2A 1A65A 1ADQH 3Q2VA 2D03H 2ZXBA 4UOW1 1L9MA 2FEDC 4N2KA 4LAJH 2X4UA 5DF0A 2XUWA 1Z5LB 4BK5C 3L4UA 2FD6L 1B0GA 1I9RL 3LCYA 5D72L 5C3LD 4PW3A 5D7EA 5FM5O 1L0YA 3MRCB 3GHBH 4LPXA 5EPMA 4MJID 1FCGA 1HXKA 1PL3A 2OLDA 1J0YA 4FFVD 4OT1H 4AKQA 5J12B 3RGVA 3GO1L 5L8LB 2HVJB 1I1AC 1S3KL 3BZFB 1KYDA 3GSQB 2DJUA 3HHSA 5EHFA 3L7EA 1CFNB 5DUJA 3HG0A 3X1EA 5IHWA 3A4AA 4EI6B 1X4XA 3FMGL 2P52A 3IPEA 3MUUA 3CX5J 1L5GB 3FT3B 4N2NA 2JQZA 4AQ1C 4LVNC 1CBVL 4AQ8A 4YSCA 5D9SB 1JAEA 1OEZW 4F1SA 2BNUB 1IAII 2E7MA 2X2JA 3TCTA 3HPJA 1KSRA 2EC9U 4FYQA 4OUUA 4TUKH 3E1F1 4XO5A 1ACXA 3U4BH 1L3WA 3HHRB 4CVZA 3DK2A 3DX6B 1FVEA 2F5BH 3RVWC 4G9FE 3CN4A 5HJ3B 2PR4L 4G2AA 2F74B 5E2JA 4Z7QB 4F2FA 1MCWM 1O7VA 2HT4D 3FHQA 1DQKA 5I76B 3VU1A 4UBDC 1JFHA 1S46A 1N0LB 2FYVA 4F7PB 2CD0A 3AROA 2JCCE 2NTSP 3BDYH 3IMRA 3MSPA 3T4AA 4QHNA 1THAA 3WTXA 1IAKA 3H9HA 5IFJA 4O00A 3ZE1E 5JHLA 5TPWH 4HXAH 2BK8A 4I48B 4FFZL 5HBBA 5DC9B 3HG2A 4BZ1A 1P6WA 2J21A 4PN6A 2GBUA 1TJHL 4PJFB 2A6JB 2DLHA 3NZHH 1QSZA 3VYNA 1W8EA 1E9QB 3VFUA 1J8KA 4ONOA 3PDOA 3IK2A 3UACA 2ZG3A 4QDGA 5C07E 3RP1A 1BA9A 3MKKA 4IDJL 3L5WA 3V4UH 3MUGA 3Q01A 3WFBH 5I1DB 1OWWA 1P69B 3KLAB 2IPTH 4H44C 1TT6A 4JRYA 1EDYA 5I1KL 1YQVH 1Q9LB 2F58H 3KXFD 5HI3C 5KVFE 1LHZA 3Q9QA 4JO4H 5ID1A 1N18A 4LASH 3VG0L 1IX2A 2YBRB 1KN4L 2GJZB 3STZA 2OP4L 2VXQH 3CX2A 1ZHBA 2X1WL 4KRPB 5DJCA 2I9LA 1U8CA 1ZT7A 1EMTH 2BZCA 4L1TA 4UQCA 2DTML 4FNLH 1FIEA 3MRFB 4OF3A 5D4JA 4JFXB 2UZXA 4LDLB 3C60B 5EO0B 3MX0A 3SPVB 4M5ZH 4PJ5D 4PG9B 3B2UC 4UQ3A 2O5XL 3SDDA 4XZUA 3VFGL 1AP2B 2WQWA 3L1OH 3C9NA 3T3PE 4DGVL 4OTXL 1OZUA 4Q9RH 1DJHA 3EJTA 2WC7A 4NSKA 3QUKA 3LMJL 1YEGL 4HZLB 5IQ9B 4K3GA 5T1KB 3D18A 1GKEA 3ELQA 3G3LA 4M5YH 1WLHA 5G4MA 3EDFA 2IDTA 4M1DL 4WGVB 4Y8AA 3T2NL 1T2JA 3VWJD 3MUJA 3GMRB 2LVEA 3BPOB 4X8JA 4L4VE 3GNML 1YMMA 2L8AA 3FQTA 4ZO7A 1EAPA 4GAJL 4G11A 2G2RA 4K2UL 4JGMA 2ZCLH 2Z1KA 5DUBB 5IBUB 4PP1C 5ACMA 3UAEA 1HHIA 3SE9L 3QR1A 1OTTD 2H32A 3X3GH 1GGIH 5I6OA 3UZEC 3DPDA 3N41F 3KPSB 4KRPD 3VRIA 1NTDA 2J12B 1BZ7B 3MDJA 2E46A 4F9PA 1QBLH 2OTUA 2EUVA 4JL2A 2WXRA 1H8NA 3SB3A 4W6YB 1KXHA 4PJ9B 1IC4L 1HL8A 3BH4A 1PY4A 3PWPA 1X5LA 3QJXA 1ED3A 3FU3A 3MRMB 3WELA 1J0HA 5GJTH 3I6GA 4ETQA 4NQEE 1TZAA 2X1OA 5J8OA 3TEYA 1OAYH 2SODB 2RHEA 3GJFB 4ZQKB 4F9LC 1QPXA 1KYUA 1QEWA 2AXFB 3MV9D 1P7BA 4BQ6A 1NCUA 2CPCA 2WQVA 3FQUA 5T1KD 1JMZA 1R5IB 2VDLL 4ODTL 3RVXC 4XH2A 1DBJH 3IJHB 4GQPH 2YC1B 3LX9A 3SKOB 2VSMB 4F91B 3RWHB 1J86A 2NDFA 4HJ1A 5GRUL 1P5UB 5DFVD 1ZTXE 1IGCH 2IXQB 5CU5A 4A66A 4KKAC 4TTGA 2KDGA 4JQIA 4M02A 2CWRA 2X4SA 3VAEA 1LWJA 4OFVA 1J1OH 5E6IA 5DDHA 2KT6A 4Y5YB 2K0RA 4ES8A 3E7JA 3KPSD 3R1GL 1JPFB 1T0PB 4NNXB 5GS1C 4K8RL 1MXGA 4P3WA 4UM9A 2B0SH 3L2LA 3DVGB 4G43A 4GSRA 4YHKH 1OGSA 2AJUH 4PGBB 3G6AB 4PJ9D 5IG7A 2PTTA 1KOAA 2G60H 4L8BB 5CR8A 1F41A 2EDDA 3ZE0B 4H40A 3AGVA 1AD9B 1XD0A 4JQVA 3WNNA 5CP3A 1MFCH 2OBGA 4C4UA 3WFDL 2CO4A 1G7QA 2ZWLT 3BRGC 3Q6GL 1T4WA 5JYLA 1ZK9A 2WB7A 1XB3A 5CUSL 3G6DH 3OAUL 4ZW5A 1HKFA 5C0BA 4O02H 3U30C 2W91A 1YC7A 1LO0H 1RZJL 4YXLL 4X8GA 4A38A 2YXWA 3VFOB 2QKIA 4HCRA 1OHZA 2H3XC 4JFQB 4U1JA 3DUHA 3QO1A 5AW4B 2VDKH 3QQ9C 5IW1B 4EXKA 1G7IA 4EAEA 1BZ9A 1DQQB 5GSRA 4JHWH 3T2OA 4GAGL 2P5EB 3OD3A 4D0BA 1I31A 1G1CA 2OQJA 3LEYH 4MQXD 3T8XB 2LHAA 1KEMH 1JERA 2ZKWA 3SPJA 2WJ7A 1IIKA 4FQJH 1D6EA 2NW3A 1FSKC 1J5DA 1NDMB 1GS8A 3AITA 3TF4A 3WKYA 1TZOA 5E5UB 2VJXA 4UU9B 5JHBA 4ZUWB 1HHKB 4I77H 3G08A 4GG6E 1SBSL 2XU9A 3DMMD 3BW9B 1BXXA 2I60H 5EU3B 2BNRE 3ARQA 4R7LA 2O6PA 2CR6A 3KS0H 4TQEH 5JOPD 3FOLB 4YHYC 1KULA 3UTSA 4O2FB 1C12A 2NUTB 3P0VH 4A7SA 5J57B 3DHUA 2R23B 1OK8A 3DRQB 4NYLB 1X5FA 4YAQB 1ASQA 3S97C 3KMDA 2YMOA 3OR7B 3GSRB 5DZVA 3BVTA 3VXTA 3LNEA 2PCXA 4FHBD 5F3HB 3TIEA 4YFDB 1GGTA 2FAUA 3RX5A 5IF0A 2IAMD 3ZL2A 3E80A 2DI7A 3IDGB 4FQCH 4OCWL 5SV3A 3G04B 4X4XB 2DQUL 3QJTB 4U7MA 4F37F 2ZUTA 3SE8H 5JQHC 5JMOC 1L0XA 3PY9A 5I8OH 1E4WL 4FQHA 4RMTA 3FUKA 1J9QA 4LVHC 3VG9B 5KS9F 4KK6C 4QPEA 3B9AA 1R46A 4MJJA 4JRXB 4RH4A 3SIKA 4RX4D 3D25B 2EUWA 1CDGA 3LKOA 4PJ6A 3PAVA 5CGYD 4CSTA 1H3XA 1RZKH 4KMLB 1GY1A 1V7ML 4U0QB 4TSCH 3U9WA 1JYNA 1DDHA 3NK4A 1S3RA 3VI3F 1YPZE 1WUZA 1CGWA 2BNRD 4IRJC 5H2BB 2VN4A 4A2FA 4ELMF 3QRGH 1JCKA 2NSQA 2X2YA 3M1CA 4XBEL 3ZHKA 5IJVB 5L7XL 3QEQD 3FFCA 4ZUVB 4XMPH 1SEBB 4RGNC 3MBEB 1ZMYA 4YGVB 4N8VB 3DOSB 2ESVE 1EHKB 4ZG1A 2Q86A 1A1NB 1JG9A 3K80A 3TTSA 4JCMA 1LEKA 5GJSH 3LZFL 5TH2A 3BO8B 1IC7H 2XN9B 5KSAB 2HPOA 4RISH 1NEZA 3O4OB 4XVJH 1NDGA 1MAMH 1T1YA 2V17L 1S7SB 3QDGE 1S9XA 4QHPA 4OV5B 3GBNH 4K9EL 3ILDA 1UGNA 5F96H 4DKFL 5I9QC 2YFNA 4LLQB 5FO2A 5JPNA 3CDZB 4Y2NA 2AS5M 3DI2B 2BSCA 4OAWB 1ZV5A 1QP1A 4AW7A 2FQEA 3WTUA 5IJCC 2WHVA 3QEUB 1RIHL 3L5JA 3LQAC 2YXMA 5IMLA 3TA3A 1AOZA 1YNKH 3KWUA 3D3VA 1F4YH 3EHBB 2XA8H 3TZVB 3JWOH 3TBYA 4P46C 4R96A 4ONGH 1QFHA 2DWXA 2ADGA 3AS2A 1QRNE 1FO0B 1W16A 1IGIH 4JDEA 2A9ML 4HHGA 3ZGIA 2X10A 4DO5A 4N0FB 4OM1H 1H5BA 3RA7L 3L9RA 2WXNA 3QB7C 3JZYA 1VF5C 5I16B 2D8KA 1NGYA 3MBED 4CU8A 1I3RA 1UA3A 4FYTA 4HK0B 3MRNA 4M00A 3F00A 1K6QL 4V1DA 1QLEH 3RVVD 3DROB 5IB2B 1VKXA 2YUWA 5HGBB 4DWHA 1CL7I 2J88H 2O5YL 3GXUB 4M6MH 3VTTA 2OMZB 2ZUXA 2E9WA 15C8H 2WVTA 4D2NA 3MV8E 3LKSB 4XO4A 1FH5H 3BAEL 4BYHA 1GCYA 5KEZA 5E6ZA 1GAFH 1NL0L 2XV2A 4Y4FC 5E2VL 2BJMH 2X4NA 1DSYA 4M6AA 5JDSB 2IDQA 1MH5A 4K71B 1B0RA 2GQHA 1YN6B 4XNQA 5DJDA 4JKPL 5IVXE 3AXLA 4NZRL 3ZN6A 1KNOB 2P8MA 1JZJA 4FEMA 4KUCF 2CU9A 2QHRL 4R5VA 1S78C 2GPZA 2JKTM 3EOAA 4X6DF 3EHBD 4PS4H 4GRWE 2AV1B 3ARXA 2X2HA 4LCWA 4AEHH 1R24A 4UT7H 5ADOL 5AW1B 3CQFA 1UZ6E 2D9CA 5FYLE 1LWHA 2Q7YB 3GTNA 2ZCKL 3QUXC 5HHMB 1DTUA 2CHZA 5AUMA 5GIRA 1NKGA 3QK0A 1J8RA 2ZXGA 4O5LL 5HVFB 5K9QI 3ARGA 3NDYE 3L6FB 3VXQA 2AXGA 4B6ZA 5I6KA 1J9RA 4Z5RB 4X0KB 4DKEH 3FPXA 3BH8B 2A83A 1A4BA 2FHCA 1ZLEA 5E9DB 2R1YA 1CU4L 3OKMB 2F18A 2PW1A 3AU0A 3SYPA 1VZGA 2VITB 4JPSA 2XJKA 5T8IA 3MNWA 5BVPL 2ZXEB 2KHAA 2Q9OA 4XR8C 3NEEA 5MP6L 1REIA 5AKRA 1RD6A 3NUKA 1XL6A 5K9JL 2WANA 1MCFA 2SEBA 2J1KA 2R27A 2R4SH 3VDCA 2DBLL 5J13C 1MWOA 3BP6B 5I23A 3IXTA 3LV3B 3PWNA 2IADB 1FFPB 1FGNL 2AMGA 3VXUB 3O45B 4BWTA 3ABKB 4H0HB 4GI9A 4W6WB 5IR1A 1G7JB 4K73A 1OSPL 2K4AA 2XWZA 4DGWC 1ZDQA 1GZPA 3P02A 3S48A 2Y25A 3UTTA 4LU5H 1OM3L 3EXJA 5C0FB 3KBPA 5BV7B 3MPCA 2KC0A 3KR3L 1IAIL 1MVFA 1I8KB 3AM8C 1SHXA 1U2CA 5AB0A 4B9FA 1A4CA 1MHPH 4KZEH 2NYZA 3OG6B 4H1LA 4AGLA 1CD9B 4GYBA 2I26N 3ZQXA 3DX9B 1KGIA 1VCBC 4P9ML 5DHVH 1HH6A 2X89A 5DUMH 5CSGA 5IKCA 3SGEH 2IWFA 5LVEA 2QMKA 3J27A 2HUHA 3OR6A 4AQEB 5DJYA 5IVZB 4BZ2A 2HX9A 1M1XA 3FYEB 3IMWA 2AABL 3GINA 1SZNA 1HQRA 1RZQA 1I8AA 2D31A 3KCWA 3RVWD 3UPAA 4U6HB 1D3CA 4OCLC 3SPIA 1A66A 4XB8A 2XI9A 4RSVA 2OMWB 3OKLB 4MLSA 1T04A 4MJ2A 5E1AB 3K5RA 2BERA 3W57A 4UBDD 5FO9B 1DO5A 3CLWA 3TYFA 3VXUD 1CGSL 5FYJU 2PYFA 2YQ2A 3ABLB 3CE1A 3W9DB 1HWGB 4XCYA 4OQTL 2ICWA 3MJ7A 4WHTA 4G1EB 2OYKA 5JHDD 4WCYH 4UT6L 4K4KA 5JIPA 3O3DA 4J4PD 1JHKL 4XVUD 1DQJA 3V55A 5LBGA 3DX8B 4N0CC 1U9KA 1BMZA 2VMJA 5KVEL 3X13A 2VUKA 4AL8L 4Z7OF 3R4DA 2J1XA 5TDNB 2BC4B 1EFXA 5T1LB 4G8IA 2QZ5A 1UEMA 3NSXA 2MMXA 1BXAA 1J0ZA 4PRAA 5HI3D 2WTOA 2XY1A 3EFOB 1A2YA 3V7AG 3EOBA 4ZTPH 2FO4A 2VRQA 3BH9B 4P3DA 1IKOP 4FQIH 1I8IA 1QBMH 4OCRH 3EOTH 4NXSA 1JNHA 3RL2A 1PEZA 4PTTA 1F00I 4OLYL 4PJAE 1TCRA 3MACL 1ZTXL 1HHGB 2MH4A 4OF5A 3CZLA 3LIZH 4ZO9A 5TK2A 1QZNA 3WL9B 1E90A 3DVFA 4JM0A 2XICA 3WIHA 1X5KA 2WXFA 4KKZA 2HRLA 3IJ8A 2JVUA 3L3IA 3LHPH 1EZLA 1QSEA 1UQSB 4X80L 2EDYA 4GKLA 1RFDL 4IM8A 1QSFB 3AQYA 1SNRA 1WZKA 3WUWB 2Y1AA 4F8OA 4MX7B 3ISRA 4F2EA 5HHQA 5IK3A 4IGBB 4UDTA 1OGTB 3O4LE 1CDHA 4HUWB 4LLUB 2CO6A 3RFZA 4ETYA 4LRNH 3TN0B 3LPPA 3QNYA 3ZUNC 1RHFA 2J4WH 3MRPB 3C09C 3N42B 4ZAKB 1XH3A 4BFIA 5T1LD 4EUPG 3UADA 1V3JA 4MNQE 2XZCL 5DO2C 3BFWA 4PP1D 3CVHH 4R8WL 3FF8A 2KYIA 3RWDB 2Z34A 4HDIA 1I3VA 5KW9L 2DPKA 1NCHA 4LP5A 5E8OA 2C7UB 1SGKA 4CVUA 1HNGA 1O7DC 3OKNA 3BAJA 5B1AB 5GSVA 2YRZA 1KEGH 2FIKB 3E6FA 5I18H 4NS0A 2AEIT 1NFDF 2X7LA 3V0AC 2D4DA 4WAFA 4KJWC 2C4FT 4Q6IC 5AB9A 1NCTA 2CRZA 2GTZA 2NY6B 1KTLA 1NOAA 1F0LA 3EJZC 4CADA 2BVOB 4H8WC 1T3FA 2PCPB 3W2DH 3MRQB 3G5VB 4JN2A 1BAFL 1WEJL 5JA8B 1QSFD 1FBIH 4F33B 1OSYA 7PAZA 5CSZA 2CGRH 5EEZA 4MHHG 1FVDA 4UWQB 4IGBD 3RVXD 1OB1A 3CK0H 3RPKA 2X4UB 3VRLF 3TN0D 3WTSA 5ABZA 4PRHA 3IDJA 4M6NL 1IBBA 5TE6H 4X9FA 1B0GB 2FATH 4F7MA 2XTJE 4KROC 4X4ME 3C2AL 4ZAKD 4DEWA 1I8UA 3IN2A 1XL4A 5EPMB 1EHLL 3RGVB 2FGZA 1LK2A 4OZ4A 3EH4B 3HHSB 1N0XL 2F7IA 3ZXAC 3L7EB 4GI6A 3V9EA 3WLWC 3VQLA 4NJAH 2HLFD 3ARGC 3QQDA 4JN1L 1OARH 2QDWA 3FRUA 5ESQA 1HL9A 3PLYA 3GI8L 1K3ZA 5I71C 5EZOL 2Y06L 1MW1A 4GT7A 2DQ6A 3IM1A 5C0JA 4JZJC 4MB5A 5IIEA 1VA9A 4PJEF 1AGCA 3HPJB 3K8KA 2ENSA 2OW6A 5L4JA 2ATKB 4OUUB 4IMKC 3GUTA 2ETWA 3DURA 2YPLA 5CILL 4BV1A 2HKFH 4CVZB 4TXVB 1FVEB 2WMPA 5CZXC 4FJ6A 3JQOB 1ZLVH 3X17A 4ZYKA 5I30H 4E9QA 5JW4M 1BMGA 4LZKA 3K5SA 5HY9A 3TONA 1BVNP 5DD6A 3OWEA 1G6RH 2P48B 3PGFL 2JMRA 1I7RA 3RHWK 3K4ZA 3B43A 3KJ4B 1TYJA 2Y7NA 3HUJE 2WNGA 3JVFC 3C08L 3F8UB 1BGXL 4JY6A 3T4AB 4QHNB 1IAKB 2ERJB 1BQLL 3H9HB 2XWEA 3BQUC 4HK3J 4LSVL 4ZW8A 5IFJB 1HYSC 3BP4A 1DJXA 1U91A 1AO7A 1P1VA 3BE1H 2XFXA 4U7SA 2IWGA 4LL4A 1OAXH 1GY2A 1ZHNA 5EC2B 3GRGA 5HHVL 3OPZL 2FHFA 1PF3A 2NNCA 3ARTA 4RA0C 3RGVD 3TBSA 1NMBH 4NRXA 3PV7A 2ORBL 4L05A 1X5JA 1FNGA 1YNTA 2ROXA 3KYAA 3VFUB 4DGYL 4L8SB 1S7RA 4XGZA 1JZHA 2ARJA 3L5WB 3MUGB 2YUVA 3ALXA 1KENH 4JRYB 4UUJA 4OZIA 4NNPL 5K33A 3ZHDA 5D7HA 1IQWL 3W1ZA 3STZB 1ASOA 1L9TA 3NQIA 4HALA 1ZHBB 5DJCB 2I9LB 1U8CB 5A2CA 1ZT7B 2GTWA 1KV7A 2CKNA 3HNSH 4HU8A 1LE9A 2MQGA 2BCMA 1A25A 2V9QA 4LSUL 5CGMA 4A2MA 4ANUA 4QXGL 4RGNE 1C9SA 4FTVE 2UZXB 4P0DA 1F5WA 4R90L 3MX0B 3IDXL 4UQIM 2UWEF 4X83A 4IIQA 4FN0A 4EBQL 2RIKA 3T0EA 4UQ3B 4K3DL 1HKLH 2XCMC 3SDDB 3ZIMA 3GFUA 2GC7C 3C9NB 4MD4A 2A6KA 1JE6A 3TEZA 1OAUL 2ZPKL 2C9RA 3QUKB 5E1GA 4NLHA 4RLDA 3D18B 2ZYHA 5KSUA 1A7RL 4FE9A 4OVUA 5CFHA 3C5ZB 4XVOA 1RAMA 3IWUA 4XTRC 4D3CL 1UKQA 1MVUA 3CMOL 3QIBA 4X8JB 3KVQA 1N9PA 1YMMB 3FQTB 3S7GA 4CBPA 1SLWA 1EAPB 4Q97A 1JRHH 3S5LA 2G2RB 2XQYG 4JRYD 1HHIB 2JI2A 2XJLA 1CWVA 3ESUF 3NT0A 4LLWA 2BHUA 4L2LA 3V4PL 2H32B 5LWYL 1W0WA 4DSYA 4Z23A 4EMZA 2CKBH 5EF0A 2WBWB 2QLVB 4IRJD 1F3RB 4K94L 3VRIB 2RQ8A 1YEJH 4Z0BL 4U49A 1A3QA 4WW2A 3FQRA 5JIDA 4NQCA 3EGDA 2OTUB 4QHKI 5I73C 1OCZB 4E41D 1BF2A 1JOIA 4NJ9H 4UAHA 5E6RB 3WFEH 2YA0A 3PWPB 4O58H 5AAWC 1FG2A 1ED3B 2Q2LA 1F86A 3I6GB 2DTSA 4ETQB 5C0NC 1H3PL 5FYLL 3SDDD 4W9JC 2C34A 2Y2TA 4M62L 2D2OA 5EIIG 4RMBA 1YY9D 2EDHA 2AITA 4XT1C 3UDWC 3WHE1 5I6XC 1A1OA 1MOEA 1QFWM 3SCMB 2R8SH 3EUUA 4TS6A 3RNQA 3LXAA 1UWYA 2RALA 5I17A 3Q2WA 2VTFA 5HHOE 1SVZA 4XH2B 4L23A 1R3IH 1FPTL 4OLXL 4UOJA 1ZS8A 2EEXA 4HFUH 2V2WA 5F6IC 5EDSA 1J5IA 4ENEC 4N8PA 4PJ8A 2ARWA 2DMKA 5IUCA 3NCYS 3P77A 4GSUA 3IE4A 1YMMD 2DL2A 2OJ1A 1N6VA 2E76C 3CVIH 2ISDA 1PLGH 4GLRI 3PUUA 1R75A 3SN6N 4R83A 1KIRA 2E59A 2F8OA 4P46D 3STBA 2X4SB 3QCUL 4FC3E 2G2PA 2GBTA 3NSCA 3P40A 5E2TL 1FC2D 5E6IB 5DDHB 1CL7L 2XHNA 1UD8A 4KBPA 5AZEH 1BJ1J 3N06B 3ZE2E 1GGCH 3MGTA 2XVKA 1RVFL 3B7YA 5DGRA 5EDXA 3PHSA 1SUJA 4UM9B 3U1QA 5I1CH 1MWAH 3J07A 1J8HA 1B4LA 4G43B 5HI5D 2FX8L 4QGYA 1INEL 3S88L 5IG7B 1DQIA 2VAAB 2WXOA 3MVSA 2PTTB 3PWPD 3ZKXC 3ZTDC 1JYXA 3O6LL 5BV7L 2VO5A 3MBXL 4DPCX 3IAQA 5GHWH 2CRYA 5HGDA 4JO8A 4PGJA 1E6JL 4EF3A 2ZE0A 2XTLA 3QO0A 1S5IH 4FFYH 4FZEH 4YK4B 1G7QB 3TJEL 3ARFC 5LGKA 4N1EA 4UCFA 4Y4FD 3MLXL 4KJQC 4AQOA 5ITBH 4S10A 2P5WE 2NSXA 5HYFA 1FNSH 2AK4B 1TSHA 3OLEA 3PJNA 1RV6X 2AEPL 2QKIB 1GPOH 2BIPA 4U1JB 4MDRA 3QO1B 5EN2A 1IMHC 4DW2H 3HW7A 5IEHA 1TCMA 4JR9L 4N20A 1XF3A 1G7IB 4XN4A 5JPMC 3PL6C 2BSRA 1BZ9B 4AYID 4Y2OA 1TZGH 4K5NA 3EO1A 5FYJH 3FTSA 1A6UH 2X9WA 1LDPH 1PW3A 2FQGA 4ES9A 5F9JA 4GAAA 4D0BB 4GS7B 1TVHA 2Y1YA 2OQJB 5F9OL 3DNKA 1B90A 3FQ1A 2UV3A 4KH2A 2NW3B 4I85A 1D6EB 4MDIA 4NKDA 3DLQR 3RWCA 2XIDA 3G08B 2AXWA 3ZR6A 3WN5A 1TFHA 1CFTB 4K3EL 2GJRA 4UV4L 1XDTT 2PWDA 1INDL 3DI3B 4JHAH 4HIJA 3CLEH 5AVRB 4E9YA 1CDJA 4PREA 1WFTA 2HLAA 2C9SA 4L1BA 5I8EA 3DXAB 3UTSB 4ANWA 5CINH 4WHYH 1C12B 3INUL 1INQA 3GI9H 1WFJA 1ZVSA 3PQYE 4PJFF 4PD4K 5C0BD 2P5WD 1URLA 4YDNA 3B2MA 3KH4A 1WFMA 2WKLA 3S36X 4NBZB 2CBQA 2FBJH 3OJMB 4KY1H 4WK0B 4ZUUA 3VXTB 4TNFA 3TIEB 4E9LA 6PCYA 3QUYA 5IF0B 4CILA 3EKCA 4ACPA 2RA1A 3QDHA 1IT9H 2XG5A 3U6XS 3SGDI 2GABA 3W0WA 4EIGB 4L2YA 1DQML 1A47A 1M53A 2EE6A 2HRGA 2VLRE 4KH9A 1FL5A 4KVPA 2J8UA 4JFZH 4FQHB 5B8CB 1R0AH 3MJGX 4QRBA 1DFBL 2QV4A 4G83A 5BQDA 3CTTA 3JWDH 4WUUE 3PREA 2EIKB 5AVTB 3GSOB 3LKOB 3P9LB 5DK3A 1N59A 3DVIA 5J5EA 1WCQA 5E00A 3ZVVA 3EYQC 4K23L 1DDHB 1M7UA 4JDTH 4AQZA 1D6VL 4GRLA 3QW9A 3DARA 1A21A 3N1PC 4UQ9A 5E4AA 2F7QA 4OCYL 3FFCB 2EKJA 1WAAA 4KPHH 1NGPL 3DA0A 3H42H 5SWZE 5IY5B 5CCKL 1FQ9C 1QNZL 1M3IA 4FI7A 4QLRA 2Q86B 1CD8A 1L0QA 3V6OC 5C08E 1LEKB 3FRPA 2UZIH 4B5ZA 4DN4L 1OM9A 4NN5B 3HC4H 2WOBA 5HDQL 3KYMB 1MI5E 1MQKL 1NDGB 1T1YB 4P4KC 2ICEB 1S9XB 4U1SA 1DBKH 1JPTH 3VUAA 3FAWA 3PP4H 4QNPE 4B3VA 5JPNB 1MRCH 1QTPA 1URZA 2N56A 4JO2L 3HZ3A 4XNXH 3EDEA 3DHPA 1UXSA 3G6JE 1EXUA 4UT9L 4WUUD 4LRIC 2ZXWB 1GZHC 3MNVA 4HSQA 4N0CD 3TA3B 3ZU8A 1MRFL 5I1AA 5I75B 5IMLB 2K1MA 3D3VB 4KO6A 4R0LA 3TBYB 2OZ4L 3PAZA 2DS4A 3O81A 4R96B 5C2BL 2ADGB 4DJMA 3O41A 4JDEB 2Y2WA 2NY1C 4M1CD 4K7PY 5E8PA 1H5BB 5JUEH 3L9RB 4XNAA 3TOPA 5I1IL 3TNMA 5IT2H 3MV7E 3FFCD 1HE8A 5E03A 2BNQA 1RIVL 3TYGH 1X3DA 1RUAH 1NGYB 4JE0A 4S2SA 1RZKC 1I3RB 1O7DE 4EE2A 3MRNB 2VDOH 4NWUL 4V1DB 1HZLA 1VKXB 1J0JA 2ZUSA 1FHNA 1A02N 2Q5BA 3S3JA 1KN2H 1MLCA 5AOLA 4LLDA 1MI5D 1GMIA 3AWEA 4OBRA 4AKPA 3T09A 1XTMA 2BSEA 2HJLA 3BVDB 3EZJB 4NT6A 2G5BA 1NBVL 4Q52A 4QRTA 1L9SA 1WD8A 2X4NB 3LIZA 3ZT5A 4PJHA 3IMSA 4X9YA 1MH5B 3T0BA 1B0RB 1Q4NX 4OZFG 1A8JH 4KTDL 5CEXA 2DYPD 5DJDB 1VIWA 2EYSA 1L9OA 1RHHA 3AXLB 1ROCA 4N22A 2P8MB 5IOPA 2L7QA 5DWPA 1E4HA 4R7XA 2WXPA 4XNMA 3D3VD 4KUZH 4BDVA 3NG5A 5D70H 2N1TE 2F9BT 3VD4A 1AE6L 4EXPX 2J3SA 3VWKA 1F1GA 3KJ6L 4LCWB 1R24B 1QA9B 3ZE0F 4Z7NE 1CK0L 1SVBA 4L8DA 4DAGL 3OMAB 3GIZH 3X3FH 4N2CA 1EX0A 3L4WA 2ZOKA 3H3PH 4KJPD 5AUMB 5GIRB 2X12A 1MCBA 1HJCA 2R0LL 4B53A 1OWRM 1MDAA 2DQIL 3ULUD 1KTDA 5AW6B 3JWOC 3HRZC 2Q7AA 4MA3A 4MGXA 3VXQB 2AXGB 3M17B 3MA9H 4WSJA 5DUPH 4JPKH 2NY5H 2OTPA 4N86A 2A83B 4V1DD 2CJTA 3CVHA 2R1YB 3HE7A 3TV8A 3UXFA 4HU2A 4X5QA 5IBTL 1C5BL 2R0WH 2PW1B 4KJWD 5BS0E 4EJ1C 3MLUH 1DSFH 3MNWB 2AXJA 3K2IA 5I6PA 4KHXL 5LNDA 4NCC1 5J7CC 1E5CA 3LXCA 3L3JA 4LK4A 3SDAA 32C2A 1VADA 3EYOA 3MU3A 4U31A 4PGEA 4N2GA 4G8FA 2SEBB 1XFPA 4GMTH 1ZHLA 3H8NA 3P11H 2WZ5A 3PE9A 3IXTB 1R3JB 3PWNB 2EH7H 5EN3A 4X9HA 2ICWI 3JSSA 4KTEL 1KCRH 4OLZL 5ISZE 4LSTL 1TTRA 3WBDA 5IR1B 3R18A 3UTQA 3QDJE 4AC2A 1Q1PA 1NAMA 5ACZA 2GIYA 1JGUL 1GZPB 3CXHK 1UWEH 3CUPA 4I7ZC 3UTTB 4GG6F 4JM2C 2O5ZL 4KROD 1LEGA 2A4ZA 2HTLC 1WBZA 1SEQH 1VEOA 1QHQA 3LY6A 2ZYRA 1CR9L 3KDMA 3VX0A 2V33A 2H1PH 4OLUL 4BZYA 4OJEH 5B38G 3ZYZA 1PBYA 3WLWD 4HG4J 4KHTH 1UWGL 4H1LB 3ARGD 4QYAA 2IGTA 3RWIA 1D7BA 5IB3A 4PPTA 1J0IA 1HH6B 1RP8A 5LBVA 3W3BA 1XB6A 9CGTA 4R7NA 5IKCB 3FZUC 1DQDH 3PPSA 1RSFA 3CGTA 3OR6B 3GS7A 5LXGH 2OM5A 5FO8A 1D2OA 1M1XB 3B56A 3B8YA 4X0NA 2VDMB 2ZT9C 1JVKA 2X87A 3ZDWA 1HQRB 2D31B 3QS3A 4ZX4A 5G5DA 3U2SA 4RFOL 1NCDH 2VH5H 4I9WE 3L81A 4ZXBA 3Q5TA 2ZF9A 1RH8A 5I5JA 4EDWH 3NIGE 1T04B 4NUJA 5BUPA 2FT7A 1FAIH 5ERWA 1I8MA 5D2LF 2H0JA 4HAKA 3MLSL 3TYFB 3HLAA 3WKML 2BVTA 3QZOA 1VGEL 4EIBA 3BQUD 2NXZB 4XO8A 1VACA 2UXTA 2ZYIA 1FYTA 4L1LA 4NQVA 1G6RA 4PJXF 4XCYB 3UTTD 5HYSG 1KF9B 4RAHA 4NWTH 5IMOA 2EDOA 2ICWB 2Y1ZA 5BZWA 3MJ7B 2ILLA 2R0ZH 4OCSL 4WHTB 5GISL 3EGXA 2OSYA 3O3DB 1OLZA 1U33A 1DQJB 3D39E 3FFDB 1IL1A 5T1JA 2WLNA 3AWFA 4Z7QE 1Y6NR 4WJG3 3VFSA 3X13B 4FNQA 4KAQH 1EFXB 4G8IB 4E9RA 4G6AC 2NMSA 4HUUA 2RGSA 3S96A 2QPUA 3EF4A 2X89D 4B0MB 4EZLA 3K91A 1DVFC 2CA3A 4KWUA 5EUOA 4PRAB 4HCFA 5J9PA 1IBDA 4PJCE 1A2YB 3TT3L 3AS0A 3EOBB 2FO4B 4P3DB 3GMNA 3ETSA 4OF8A 1I8IB 3BUQA 4XXDA 3I6SA 5DRZA 4JGNA 1JNHB 2GBVA 5FK9A 3RL2B 5B4MC 5BO1H 1GIGH 4PTTB 4Z3FA 4XX5A 1NFIA 4DKAA 4WI2A 1FJ1A 5SWSA 1TCRB 3ARBA 3PWLA 3C6SA 1IIIA 3II1A 4R4NC 4RNRB 2XBTA 3GB7B 5ICUA 3SBPA 7FABH 3LXUX 4GG8A 4HJTA 4NI6A 5E4OA 4JQIL 4IOFC 5BRZE 2NTFA 3MCKA 4NO3A 1MREL 3L3IB 1KB5A 1QSEB 2IOOA 2NXZD 5TQ0L 2OW7A 1QTSA 4OLVH 2WO4A 2X28A 4HUNB 4LL1A 3L95A 4RGMB 4CN1A 1NKRA 1HESA 5HHQB 4F15B 5IK3B 4UDTB 3UO1H 2CO6B 1OAZH 2ED7A 1G1OA 4RMSA 5C6WH 3VD3A 1W0VB 3QNYB 2AQRA 2BS8A 2MNUA 2ROYA 3JTTA 5CD5D 2AQ1A 2F08A 1WE5A 2NXYC 5C09A 2PNDA 1EFXD 4BFIB 3HC3H 5LKNA 1N6QL 1U58A 2WVUA 2WXLA 4CAGA 3VACA 1MPAH 3D34A 1IARB 2CHNA 4RIRA 4G7YH 4OJFL 1PKQE 3KBEA 4HDIB 4IKLA 1DUZA 5LCVL 5E8OB 1AJ7L 3F65A 3MBWA 4JB9H 3OKNB 3AMKA 1CLOL 4FL4B 5GSVB 2CNZA 3E6FB 4U6XA 2MRYA 4HEME 1P4BL 4NN6B 3FUEA 2X7LB 1ID2A 2YMXH 5DYFA 1QSVA 4YBHA 3VFWA 3HS0A 2H1LM 5JQIB 4W9CC 5IV2A 2EXSA 3SO3C 2CKBA 1KXTA 2GTZB 2EVGA 3ULSA 3CQQA 2BLFA 2A9BA 1YRKA 5AG9A 2YPVL 4CADB 1PZUB 1HAWA 3KPPA 1T3FB 4I3SH 4JN2B 3H9ZA 2UX6A 2BIHA 1UCTA 4ONHA 1S7XB 5D71H 4DP7X 4K5PA 2WXQA 4YEFA 5CSZB 1BXUA 1E8XA 3U36A 1FVDB 2V37A 2K45A 1M9WA 2HH0L 1OB1B 3AJ7A 3DHMA 3FQ2A 1P1ZA 3LPGA 3NACH 1N7MH 1CICC 1IKFH 4PRHB 3IDJB 4FG2A 1O6SA 4U0RB 1P4LA 3QG7L 4RDBA 4F7MB 1I7TA 3QRFM 4PCYA 3H6AA 3EYUL 4NUMA 2GT9A 3QUML 1ZPUA 4OZ4B 5E95B 4MJ4A 5T3ZH 4HS3A 4LBEA 5E0FA 3IT8D 4JDZA 2O61A 3IU4H 3H54A 3QQDB 5ESQB 3I6LE 3ZL4L 1GHFL 3FSZA 3NSFA 2NR6C 2W60A 4MXWL 4Q4EA 1SJEA 2P42B 3BI9X 4QHKJ 4AVIA 3IJYA 5C0JB 2DYRB 3F12B 5IIEB 2DYSB 1L6PA 4XNZB 2K9FB 1AGCB 4S0TD 5HYIA 3HC0A 3P1VA 4I8DA 3SDXE 3GUTB 4TOYL 4EZJA 2YPLB 1KJ2H 3WKNA 3OJVC 4E36A 1FF5A 4AM0B 1A7NH 5B3NA 2WMPB 3H0TA 4ZYKB 3P30L 5HY9B 5D1XC 1KCBA 1CPUA 1NSNH 4HJSA 1SOQA 4N8CL 4P2OC 4XWOD 1GSKA 3NCXA 1SBBA 3ZL1A 5GGTL 1I7RB 4XI5C 4GEIA 4ZODA 4EOWH 4HF5L 2XZZA 3NP3A 1UKSA 1XO8A 4JY6B 1R47A 4KNUA 5EBWA 4PAZA 4NUGL 4DUXA 5DR5H 4G5ZL 1YQ2A 3MOAL 3MRIB 5DQJA 4FFYA 3BP4B 1U91B 2JKJA 2WWOA 1AO7B 2XFXB 3ESPA 3O6FC 1VFMA 1ZANH 2DL9A 4PRNB 1ZHNB 4PEEA 4TM9A 4IRZH 4PI0A 4GPVA 3PL6D 4FXKA 4F7KA 5IUSA 1MCJA 1WUNT 3OQRA 3TBSB 4HGWA 4P2AA 4NRXB 1XGZA 3DK0A 5DMIL 1FNGB 1YNTB 3EGSA 1CFSA 5D7LE 4I18C 2W38A 1ORSA 1S7RB 2QPDB 4XGZB 3ECBA 2ARJB 2YAEA 1MIML 4JY4A 3GRBA 4RZCA 5AAMA 5IGXL 4GSDL 4ANKA 4PJIA 1RIUH 4UUJB 1QFWH 5LNGA 3UYPA 4OZIB 2IQAA 4M3KB 2A4EA 2Y23A 4MMXA 1EA9C 3AMLA 1ETA1 1CLYH 2UVFA 4ZMLA 2E6JA 4K5OA 4U6TA 1E7UA 2GTWB 4ZXBC 1HWHB 1WDAA 4PJDA 4ZQTA 1LE9B 3VD9A 1OGAA 1OF0A 3IJ9A 3FQNA 4UANA 3ESNA 2ARJQ 1LP9A 3FYIB 3SEPA 3T6QC 1LILA 4ZSOA 3VE0A 1JVOA 4BUHA 4KZDL 4TULL 1NOLA 4IIQB 3T0EB 3BWZA 3V6OE 1VPOH 4Y9CA 3WY1A 1H6TA 1DBML 4OIIH 3WXWH 1NANH 4MD4B 2XZQL 4TSAL 1BG1A 4DP5X 1AO7D 3KCPA 1NMCB 3U4KA 2YD8A 2I32A 4URTB 3M86A 3D30A 3O3AA 3HNTH 5BZZA 5KSUB 1WD9A 4R4FH 5GS2H 2VXTL 3BAYA 3QISA 5D7LD 4PJAF 1MVUB 1XSIA 3QIBB 4ZPTA 9PCYA 5IMMA 2VZ1A 2DEXX 1JS4A 1FDLH 5G55A 2M1KA 5LBSH 3S5LB 5JIHA 3U25A 3VGFA 2HZHA 2RCSL 5TQ2L 4LSRL 2JE8A 4BRVA 4JREC 4LLWB 4EZKA 2YA2A 2DQDH 1PD0A 1Y1UA 1W0WB 2VR7A 2GAZB 3B2VH 3RJOA 2Q3AA 3CD4A 2FEEL 1AXSA 5AOMA 1SMDA 3BOVA 3UYRL 1PCSA 4UTBA 4MRBA 4WW2B 3FQRB 3RUGE 1T6VN 3EGDB 1M57B 3LDBB 1DP0A 5J1SC 3RIFF 1ZHKB 2CMRL 4OLWL 2YGQA 2IBBA 1AR1C 2WCSA 3C6LA 4G8GE 1FG2B 2L04A 2ODIA 2AW2A 1UACL 3T0ED 1A7OL 3NFSH 2VDPH 4JRXE 3N42F 3PDGA 2WYIA 4YN3A 4TRPH 3HAEG 3NIDB 2E7CA 4KTYA 5AOIA 1A1OB 5ALBH 4P4KD 3TEUA 4JFDA 1T5WA 1PSKL 4MMYA 5IFAL 5I17B 3FTVA 1N2RA 1O0VA 2D7TL 4JFHE 4J8QA 1JTTA 1ZS8B 1FL6A 1YYLL 1W80A 2V2WB 1D7FA 3JWNH 4TKWA 3SDCC 4A6YL 1JYWA 3HKFA 3QIBD 4PJ8B 3TV3H 3P77B 1PD1A 4MSWA 1PG7W 4ZD3H 2C3XA 3CDFA 4XP4L 4XHJD 3HI5H 2VQ1B 1KCUL 5I0ZA 3T77A 4UOW0 3ILPA 1HINH 1KIRB 4HWBH 2F19H 2ZX5A 4TL4A 1CGYA 3N43B 1CDBA 2EDFA 4KKQA 4QF1A 3SBQA 4LHQB 3MGTB 2L7UA 2VWEC 2W9EL 2ZUQB 3IDIA 4AGQA 5MI0B 3APCA 4NQCD 3ZZSA 4B7IA 2YUXA 1J8HB 3ZBMA 3MCYA 1XSOA 4G8GD 2EUZA 1YHPA 4HXBH 4EIUA 3NZ8A 3MQIA 4U6VH 3KLLA 2ZF8A 5HGDB 3NCMA 2AFNA 1U0QA 3ILEA 3FCSA 4PCKA 3UIZA 2AKRA 3QO0B 4QJ3B 1NCGA 1SXNA 4WWPA 4B97A 3RVTC 4ZNEE 3I02B 3IDNA 5KYWA 1N5AA 3GHBL 4YHIA 4FLHA 2NY0B 5GGVY 1Q94A 3SJVB 5L2KA 2VSKB 4OT1L 4MNGE 3HFMH 3U2JA 4ZX3A 4PJ8D 3BWAA 1J5HA 1I7UA 4P05A 1CDUA 2EIBA 1GZQA 5EN2B 1JWMA 4EUPH 5IEHB 1XF3B 3QQXA 2BSRB 3OM3B 4Y2DC 3V6BR 4Y2OB 3EO1B 2J1YA 5EZPA 1U3JA 1NICA 2C7FA 3REWA 1G43A 4D0CA 5GGUA 5F9JB 5KTEH 4TUKL 1TQCB 2G0LA 5TDOA 4ZOAA 3UAAA 3U4BL 2YSSA 2B7DT 3QCVH 4ZJ9A 3H7LA 4MDIB 4NKDB 4NOBA 4B9CA 1XF2A 5D7SH 1K72A 3RWCB 3PNRB 4I1RA 4K7PH 3ZQ9A 4QOKE 3WN5B 4XXCA 4V11A 1I1FA 1NA8A 3I85A 2A3TA 1MY5A 3PYCA 2ENJA 4H25A 4HIJB 1CN4A 3QNXB 3FPYA 3KWWA 5CHNA 2BSBA 4PREB 2HLAB 3UABA 5I8EB 2K7PA 3O3EA 2AJYH 4BFGA 1QFOA 2B1HH 4HXAL 3RJDA 1INQB 1MHHA 1AZNA 2CGYA 1ZVSB 1VFUA 4H0IA 5D7JA 3VGDA 3NA9L 4TNWF 1XF4A 3ABGA 3WS6C 4QRPE 2G3NA 3CFUA 3QI9C 4H0LC 4IJ3B 3RIKA 3WAKA 4ZUUB 4PMEA 4X6BA 3ESMA 1KTJA 4UV7H 3QUYB 4WTQA 4HMDA 4ZMPA 2ITEA 5E9DE 2VN5A 4FG4A 3V4UL 2XG5B 3WFBL 4AX3A 3VH8G 3W0WB 1E6OH 2IPTL 2W81C 4CN4A 4IMLA 1KLFA 1IAMA 1FL5B 1YQVL 1FNFA 2J8UB 4XMVA 3L17A 1EFQA 3VQ2C 2B5IB 4JO4L 4M9OA 4LASL 2XWJA 1ZA3A 2E4TA 3E38A 2ZOTA 1ZY9A 1B6UA 4F7EA 1EMTL 1U4FA 5E5LA 1N59B 2HWZH 3QRBA 5E00B 4HAGA 1KJ3H 3FZUD 2YXVA 1YG9A 4XOCA 4BQBA 2MEJB 1QFUH 4GRLB 1VGKA 4TYUA 1S6NA 3U9UA 2YBGA 4M5ZL 2YAMA 3EW3B 4W4OC 5EOQL 1SVCP 2PCFA 2ZNWA 4LHJB 5MHSD 3B3IA 1BFOA 3OMIB 1F6LL 3L1OL 1DQTA 4Q9RL 4R2GC 2J5LC 4JE4B 3ZK0A 2WBKA 3F04A 3QEGL 2ICWJ 5F7UA 4M61A 4M7JH 5KBKA 3KPMA 4CJ1A 4M5YL 4D9LH 4K7FA 4KFMA 1NGZA 1OCWH 2X0VA 2TAAA 3QAZC 2OTWA 4JFYA 4NQTA 2QKSA 4U1SB 4I4WA 4EDXA 1RZFH 5AW7B 3AS3A 4HSAC 2ITCA 3W0WD 3WIAA 2JIXA 4Z7VE 1JF6A 4XN8A 4LNRA 5IHUH 2NYKA 3F2LA 2J20A 2ZCLL 2GTQA 5HYEA 5CLXA 3HE6A 3ETTA 4JPQA 5E2UL 5C0RH 5HI4C 2JELH 2XX1A 1EXUB 1HX0A 3MNVB 5F7HA 3X3GL 2P24A 1GGIL 5I1AB 1ECYA 3CZUB 4AZ8A 3WTVA 4R0LB 3LH2H 1UWFA 3IS1X 4G6AD 3O41B 1JHLH 2DLEA 1BP3B 1QBLL 1G4RA 1DVFD 1FYHB 4JKMA 4YZWA 4GRLD 3JWDC 4BEIA 4H20H 4LO9A 4PRIA 3TNMB 1PX4A 4ZTOH 5CEZE 5EU6D 2BNQB 5GJTL 4S0SD 4S2SB 1E5UI 5E1QA 3WG7B 1OAYL 1UYWL 3C6EA 2N0KA 4OJDH 2YAQA 3FN3A 5DD3L 2EQDA 5AAPA 3TCXA 1MLCB 3MMEA 1MQ8A 4TPRL 4LLDB 4OGQC 4ZX6A 5DD1H 3F58H 1XH0A 2VDNH 3QC6X 4HJJH 4IOFD 3O8XA 2HJLB 5B39A 4NT6B 4JFVA 3TX4A 2G5BB 2UZPA 2VC2B 4RMWA 4S1RH 5CLZA 4QRTB 3PP3K 4JY5H 1U8HA 1IGCL 4PJHB 3UTPD 4U1GC 5KYXA 5INDA 5CEXB 2W0FA 2NY2B 4C56A 2EYSB 1RHHB 3TL5A 3OZKA 3A47A 4NP4H 3M45A 5IOPB 4R7DA 2OFQA 3BKCH 1Y6MR 35C8H 1MRDH 3CX5K 4XNMB 3KL5A 3N6YA 4WFHE 4BDVB 2R51A 1AQKH 3U1SH 1MVYA 1FFQA 1IQDB 4NBYB 3VWKB 5HPOA 4L8DB 1UH4A 2B0SL 2Y7OA 1OW0A 3NJHA 3O3BA 4ZX5A 4ELMA 2A73A 4XBMA 2AJUL 4YHKL 2ZOKB 2G60L 3FK3A 3IPBA 4UNVA 4P57A 5MENE 1EAJA 2BNQD 4MA3B 4M93C 1UXWA 4F2MB 4L3CA 1MFCL 5DEJA 1CLZL 3D50A 4IU3A 3FDWA 3HE7B 1JPSH 3BT0A 3CC1A 2WVVA 3WFZA 1N67A 3G6DL 4PS8A 4OF0A 2OPCA 1OANA 2ENYA 1KGCE 5L6YH 1UFGA 3C75A 3FT0A 2DZEA 1LO0L 1FN4A 2H47C 2VISA 3L3JB 2BSED 3SDAB 1K85A 1VADB 2BZ7A 2VXSH 5D1XE 1J9SA 2NZ9D 3A67H 3EYOB 3QEHA 3ZJAA 1BZEA 4PGEB 4G8FB 1KXVC 4QXUH 2GG1A 2VDKL 4IJTA 1L0PA 1ZHLB 3L7FB 1FWXA 3S37X 4AJWA 3PV6A 1UOVA 1D5RA 4JHWL 2NY2D 5AOJA 3FTZA 3UTQB 1NAMB 1AR2A 5ACZB 2A74C 5KVGL 3CUPB 3LEYL 3FXIC 3F3HA 1HNYA 2RTTA 1LEGB 4LVOC 4FQJL 3L4YA 1WBZB 1X5HA 3ZX1A 4ZOBA 3CN2A 2KPNA 3KDMB 4I77L 1NCWH 5AL8A 3TTYA 4NHUB 2R56H 3RWIB 1QFPA 4F8LA 1L7TH 3ERXA 5IB3B 2H5UA 1ES0A 2IBGA 2JKLA 4OLEA 4R7NB 1UJ3A 3A4DA 4MMZA 3LKNB 4OKVA 3C2SA 4PRPE 5G4OA 4FQ1H 3HE7D 3TT1H 3WEAA 4Q9CA 5B1BB 4M1GH 5FO8B 1KGCD 3P0VL 3U7YH 5I5IA 1XGPA 4KY2A 5EFIA 4BK8A 4MYPA 4YH6A 3U2SB 1BIHA 2EIMB 3TASA 2NY5C 3NCFB 4P2OD 1F4HA 3ATFA 1ODUA 2HJKA 5H37G 2XV6B 3IJEA 1F8TH 4NUJB 4FQCL 4XI5D 5EOCJ 2VAJA 5ERWB 2GJ6D 1I8MB 5DMGD 2IOIA 3Q3GA 4Z7WE 1I9JH 5E4EB 1TFPA 3HLAB 3OX8A 3SE8L 1MNUH 2QV2A 4Q2ZA 3BJLA 1TZIA 3TJPA 4W68A 5I8OL 1J0KA 1VACB 2IEPA 1FYTB 2KQMA 1AQMA 2FECI 4XAWH 1AOHA 2W80C 3ZYJA 4E5XG 5ESAA 1XEUA 5IMOB 1O9VA 5FW7A 2GEEA 3BPLB 3OG4B 5BZWB 3EGXB 1U2HA 4OFKA 4YDLC 1KELH 2Z3FA 1RZKL 5K39A 4TSCL 1BQUA 3N1MC 1IL1B 4WO4A 4Z7UA 3C8HA 4X2UA 4NRYA 1Y6KR 5EMYA 2XYBA 4PGDA 1NPNA 3QRGL 4HUVA 3S96B 1E9PA 2YAPA 4HUUB 5EA0H 2IANA 1GA2A 4NEHB 3VFRA 2DD8L 4JQXA 1KXQE 5EUOB 1R5VA 1Q9WA 4J3OH 5FM5M 5J9PB 1LMIA 3HJ0A 5C9KA 5A2AA 3SD5A 1FGVL 4X6EB 5IJDC 1TYEB 3RDJA 1CTNA 1TOXA 4XXDB 5DRZB 5GJSL 4AIZA 2JQAA 3WDJA 2W92A 2WO2B 1NFIB 4E0RA 4ZXBD 1IC7L 1FJ1B 4BKLB 1NC2D 5SWSB 2HCZX 4RISL 3ARBB 5K9OA 3PWLB 3C6SB 4I0PA 4XVJL 1MAML 4HPYL 5FGBC 3GBNL 4WI9A 5F96L 2NQ3A 5FXCH 2Z8RA 4HUCA 4GG8B 4P2QA 2I85A 1B4TA 2OI9C 2NTFB 3MCKB 4NO3B 3VRJA 2I9TA 1DE4B 2XVGA 4HLZH 4KK9D 1KB5B 4KNSA 3VXSA 2Z4TA 4JFSA 1FYTD 4I0CC 1EUUA 3WYRA 3FB7A 4ZZFA 3BGFC 1JV2A 3L95B 5IQLA 1F4YL 2XA8L 3JWOL 4L9DA 3BD3A 4ONGL 3DPBA 1Q38A 4N1CA 1JN6A 1IGIL 3ULUF 2KI6A 4PLJC 1U3YA 5A2LH 5EBLA 3RWFA 3JTTB 4OM1L 1X7TA 1E4JA 2EO7A 3WFCH 3CLFH 5C09B 5F9DC 3ARYA 1U58B 1KCLA 1N4XH 4O9HH 3TWYA 4KKPA 3S8GB 1JXJA 4RIRB 1U3HA 1SF3A 1K2DA 2J44A 1QLEL 3KPRD 1TEGA 1DUZB 2B08A 2J88L 4BHUA 2H8PA 2PTUA 4BCZA 1DEEA 1L4IA 4BBWA 2C5DC 4RRPG 4N2IA 15C8L 1NCNA 4U6XB 1XZ0A 4U1IA 3S2CA 1FNEA 2VWEE 2Z1PA 3HBQA 4P5SA 5D2NC 1FH5L 3ARBD 3RAJL 3WIIH 1T2QH 1PZSA 3HS0B 1GAFL 4Y89A 5D6DA 5DTFA 5F70A 3Q2LA 1X5ZA 2BJML 5E8EB 3VNZA 5JIMA 1ZPLA 2CKBB 1KXTB 5H94A 3ULSB 1LMKA 4IS6A 4KXBA 2E74C 4WFFE 4B5EA 3ARDB 3I9AA 3KPPB 2CHWA 4XN2A 4CU6A 5C92A 4ONHB 1M6UA 2QQNH 2JI1A 4FFZA 2LQRA 2NY4B 3KL3A 1P7QA 3U36B 4PS4L 3DV4A 1G9EA 3US9A 4OH2A 4JL1A 5TE7H 4AEHL 1MCOH 3QNFA 4UT7L 3B7UX 5MERA 4ACTA 3SDCD 1O6SB 5E1HB 2ZX8A 1P4LB 2FJHA 4Y88A 5E5MA 2MNJB 1YECH 1I7TB 2AGJH 3CFJA 3JV6A 5C09D 5A6LA 4XOAA 1WA2X 5LN8A 3V0WH 2YAHA 1LO2H 4HS3B 4LBEB 1T5KA 4GP8B 4DKEL 1TUPA 3FONB 3LNFA 4JDZB 1KGWA 2JB6B 1O7SA 2O61B 3MRHA 1YDPA 2FB4H 5KZCD 4QT5A 4J3UA 2VB5A 2W60B 3WU1A 5IB1A 2ZX7A 1FG9C 2DMBA 3VO0A 1SJEB 3I2CL 2QL1A 2XWCA 3IJYB 3KLSA 5ANHA 3U6XA 5DHEA 4UZGA 4HWBA 4HMCA 5JW3H 4J39A 1UH2A 1U21A 1EERB 1JZ5A 3KGTA 3H0TB 2R4SL 1GC1H 3CH8A 1ETB1 3OTTA 2WM0A 4WIQA 1JGDA 1SN0A 1XCTA 5D1QC 1Q0EA 5HYJE 3JVGA 1QEXA 2CIIA 4O2EA 4WTWA 2WLIA 5FYKD 4PU2A 4WRLA 3V9FA 3MRDA 2B14A 3D48R 4OZFH 5E8DH 3T6VA 2UXFA 4PUBH 4N90D 4AXWB 3VI4E 4BGDA 2H3NB 4L1DA 1QBAA 1PG7H 3VGAB 2Y72A 5EBWB 4S0HA 1NOFA 1SUHA 5F0JB 5DQJB 2R59A 1MHPL 1ET8A 3WLBA 1TYRA 4OIFA 4L5FL 4FXKB 4Y2DD 2WNKA 4HGWB 4FP8L 1Z1WA 4GXVH 5DUML 4R4BA 3V0FA 4JMXA 3QZBA 1OD7A 5IWLC 3D08A 1ORSB 3ZUCA 1SF5A 2QQKL 4JY4B 3CFQA 3Q6FA 4RZCB 4EUPA 4Z7IA 1KCWA 4BXSV 3X2QB 5A1AA 4PJIB 5KN5A 5I5RA 3UYPB 4X7TA 1T80A 5SX4H 2IQAB 2Z4QA 1AY1H 4MMXB 4U3CA 2ZXQA 2AK4E 5FYJE 3I6KA 4OGXH 3RFZC 5T1DH 1KZYA 5F7WC 3FQXA 1KIPA 2QQQA 3NIFB 2GIMA 3BRFA 1QTYT 3IU3A 4GUPA 3K72B 4M5TA 4OZGB 1WPCA 2HYMA 4PJDB 3BYYA 4P59L 4LEXH 3JV5A 3O9WA 4Y1AE 1OGAB 4GAFB 1ERNA 3L3OC 3FQNB 2X4QA 4AGMA 4PMFA 4ZSOB 2JSFA 3VE0B 4TV3A 3ECVA 3JV4A 4Y19A 4R3SA 4L48A 1TJXA 4WCYL 3T1WA 2XYCA 2XWBA 3N85H 3QAZB 3AY4A 4LOEA 4QTIH 2GJPA 2IVFC 3GZPA 1ZGLM 3O3AB 4X9BA 4JVPA 4PWGA 4YBQC 5GGVH 4Z9KB 4Z77A 1AGDA 3FW6A 3LEVH 1KC5H 3KGRA 5JW4N 1H8SA 4D9RD 5C7ZA 4N8UA 4KQ3H 5IMMB 4KMTH 5GZOA 3QARA 2V6HA 3DXAE 3UTSE 4ZTPL 1R3HA 3I75A 4FQIL 4NZDA 4OCRL 3EOTL 5F93C 5TJWK 5FYJD 1XGQA 1S7UA 2C4FU 3D7PA 4JFEE 4X7FC 3NEXA 4WWNA 2VC2L 5T5FH 1ROWA 3LIZL 1L3NA 1TETH 3I9GH 3N1QC 2FBRA 2VR3A 2BY0A 2PYEA 3U79A 4IBYA 1MHEA 5T3XE 1I85C 4KITB 2P44B 4OGAD 1J48A 3ZSSA 1OGAD 1J9TA 3LHPL 3PIQA 3HRPA 1CF1A 4GW5A 1I9IH 4KC3B 2Q8AH 3C6LB 2RMNA 5J6GA 1ZV2A 5HDBE 1JF5A 1Q90A 2PO6C 1PLBA 3BT2L 1I3GH 1CBJA 3VXOA 3EAKA 4LRNL 4PB9H 1DCLA 5B7MA 1FUNA 3PNWA 3KPOA 4JFDB 1T5WB 5HGGS 4NM8H 4MMYB 3ZDXE 5GGSY 4JPVL 1N2RB 2BOCA 5DT1H 1I1CA 1I7ZA 4PJ7A 1BD2A 2EXTA 2C9AA 3L5HA 4FADA 1FL6B 2QHLA 4YZFE 4D94A 4ZFZA 3HG1A 5AWNH 1PFOA 5FA3A 1SY6H 2VCOA 3CVHL 4D8PA 3REVA 1L9RA 5DXWA 4MSWB 1BW8A 2JTYA 3V52H 4YXKH 2WP3O 2WUBH 3T77B 4P5MA 3ILPB 1KEGL 1TQVA 1KTCA 4OGYH 3DBXA 5I18L 1U92A 2VDQH 5DJXA 2C8NA 4QF1B 3RWEA 2QDVA 4B9PA 1G9NL 4DIXA 1HZKA 5CMAB 1RK1A 1ULVA 4IRSC 3IDIB 5C0AA 3WY4A 3S98A 2ZOWA 4XAKE 4PD4J 1RJYA 2B9AA 3GBEA 3VDBA 5E08H 3QAQA 3RI5K 1RUQH 1FBIL 3NZ8B 3C6LD 5CXPA 2CGRL 2CR0A 1AS6A 2WBJA 2AKRB 5DHXB 3CK0L 3QQ3A 4H26A 4AVKA 1M3JA 3MCG1 4GBXC 3NCJL 5TE6L 4JFDD 3WJJA 2Z7YA 4LSSH 2FATL 1F1DA 2FJUB 3GLAA 4F8PA 1I8LC 4F5CA 3IDNB 5KYWB 1N5AB 4LCIL 4YHIB 2JI3A 1VFAA 1Q94B 2FX7H 5L2KB 1M71A 3IDYB 2D7PA 3BCFA 3BWUC 2J6WA 3TVMA 1A6AA 2DWTA 4GQ9H 5FX3A 2B3RA 2C3HA 1JWMB 5F71A 1N64H 1QNIA 4DP8X 4NJAL 4ENZA 4OIAA 2EZ0C 3QR0A 4HD5A 1RURH 4FKKA 4D0CB 3C8DA 3JWNC 3REWB 1BIIA 5GGUB 2VN6A 3N41B 1UC6A 2ED6A 2GSIA 4NIKB 3V5KA 3GM8A 4P2YA 1OO2A 1ZKAA 1KTRL 4ZS6D 5TDOB 4JRLA 2WAQA 2XQYA 2HKFL 2YSSB 4HWZA 3VCLA 2N4IA 5AZUA 3L4ZA 5FA4A 5I30L 1XF2B 1TMQA 1T83A 4MCZA 4FOMA 4LQFL 4CUCA 3CMGA 2HTKC 4ANVA 1LYQA 3KWTA 2HVKA 1G6RL 2LTQC 2OMYA 1I1FB 3DSFH 3CIAA 3QFJA 4M6OH 2X42A 4UIKH 4DQOL 1OT1A 3F7YA 4NM4L 5MEOA 2R29H 3PXLA 5CHNB 3KWWB 1YJDH 3QE5A 4QKTA 4YNYA 5KBDA 1UUSA 4X7SH 5FIEA 1YVLA 4XB3A 3THMH 4HV8A 1EGJA 2MCMA 3O3EB 4WO0A 4XP6H 2VM3A 4L4TE 1TEFA 2F8VA 1MHHB 1W8NA 3FUNA 5D7JB 3VFTA 3BE1L 4UILL 1RUPH 1XF4B 1OAXL 1YNTF 2LLLA 3KPQA 2P49B 3B7RL 4YE4H 1BF8A 6CGTA 5L2KD 5EIIA 2A0LD 5T33L 4X6BB 2NSMA 4H0GA 6TAAA 3UX9B 4CMHC 3UBGA 3R8QA 1R6VA 2QVMA 4OZIF 2MKWA 3NFNA 4CC1A 3CFTA 1V54B 4W9KC 3ULVF 4IMLB 1KLFB 3KD4A 1QBBA 4F20A 4NZFA 2XWJB 4YE0A 1EHNA 4U1HA 1BVLB 3S37H 4HMEA 1KLUA 1S2EA 2YK1H 3BZDA 3TXAA 3L1GA 5DS2A 1TVDA 3B9VA 4FLSA 4X7CC 5E24E 4RWYH 3HNSL 1DFXA 4P07A 5EWIH 2DIJA 5EIQA 1H3UA 1UA7A 5C1MB 4XNYH 4MQ7A 2B16A 4YDJA 5KYUA 5JQ6H 1CE1H 1HE7A 1VGKB 3N9GH 5CZVH 4GKZA 4LCCA 3U9UB 1CD1A 4HC1H 2DWDA 4RAVA 5A2JH 2PCFB 1U8JA 2F8XC 3FB6A 3VD2A 3B3IB 1BFOB 2HA1A 2I25N 3QPQC 5FEBA 5L2JB 4YR6A 4AV4A 1T20A 4N0RA 3VU2A 1WRFA 3IPFA 3EG9A 4LARL 1TPXC 3FF7A 2R9HC 3KPMB 3FO0H 1GVIA 2W8CA 4K7FB 2FWLB 1NGZB 4Y5XC 4AJ0A 4D0DA 2OTWB 4AYDC 2F53E 3KXFA 4JFYB 4KVCH 4W93A 4X6CE 2O93L 4I4WB 4EDXB 5J11B 3RBSA 1A3ZA 2NLJA 2WCGA 2ITCB 4IHBA 2JIXB 4G9FA 3UBXG 4U3SA 2E8YA 4EPSA 4FMFA 3HE6B 2PP8A 2IF7A 3DJRA 4MTMA 5GZOC 2Y6SD 2Q0ZX 4XPBH 2YGVA 4WW2F 3WHE0 2IGLA 3MREA 4LCUA 4FQPA 2P24B 4BINA 3MUHL 3LJ3A 4AZ8B 2CKBL 2JJUA 4XX1E 3GJFK 4OUOA 5EZJA 3K6FA 2XN2A 5DSCA 1JL8A 2IAAC 3LD8B 4PJ5A 2GK0A 2IG2H 2AV7A 3D0VA 4MA1B 1EXGA 1OF2A 1I3UA 2DQGL 2WXHA 4KDTA 4O2CA 3WFEL 2A9DA 4O58L 5B3JF 1AC0A 1WFIA 3NIDF 4KK8D 4MYWB 2EEAA 1CQKA 2ZKMX 4NPYA 3VJ6A 2EXWD 3T5WA 3L4TA 3VWJA 5C07A 2MOVA 2R8SL 4Y4HC 5HDRA 2KZ1B 3MMEB 4N68A 4NHCH 2VN3A 3DX7A 4XN5A 1UUNA 3CBJB 1R3IL 1NCIA 1NIAA 3B9KB 2YD3A 4Q9QL 2WAHA 3O8XB 2YAOA 1D5XA 3U2IA 5JZ7D 4ZPVA 4AYBA 2VQTA 3HG4A 1GJWA 2F7RA 3KAAA 3MOQA 1U8HB 3N43F 4N85A 3ZT7A 2JIXD 3CVIL 1YEEH 1PLGL 5KYXB 5INDB 4HH8A 2W0FB 3QJHA 5HHXH 3IAGC 1SXSA 5EZIL 4C56B 3QIUC 1IEHA 3QH3A 3DIDA 1JDCA 4PLJD 4PV9A 5C8JA 4J3XA 2E6PA 4E2OA 1O5DT 5AZEL 1S9YA 1GGCL 4K3JL 1TR7A 5CCGE 5F89A 2VNCA 5I1CL 2IPUK 1LWRA 5JO5A 3O3BB 4ELMB 4DESA 2A73B 3VTMA 1KTKE 2FIRT 1F58H 2VR4A 5D8JH 1QSEE 3NPSC 5C6PB 2YGOA 4PRID 3KYKH 3FUMA 5B1KA 3KH3A 4BELD 3H6JA 2D3VA 4P57B 3GBLA 1P4IH 1KYAA 4YXHH 3SQOH 2KERA 5GHWL 2FLRT 2DB8A 3TBCA 1UXWB 4L3CB 1W15A 4ZMYA 1S5IL 4FFYL 4FZEL 5D1ZC 4IU3B 1UGKA 4FNPA 4L4VA 1GGBH 2WVVB 4MAZA 2KLSA 1L6ZA 2EVFA 3ENEA 2XQBH 1F13A 4G3YL 2XA3A 4WV1C 5ITBL 4MNHA 4XZ4A 4WWKC 3WY3A 1FNSL 1FN4B 3O8XD 5C71A 2Y4SA 1JD9A 3QORB 1KJVB 2KZBA 1GPOL 3QEHB 5JW4Q 4JVUA 4YDIH 4DQAA 5D1QE 2NOYA 3NGBC 3U6RA 4M8QA 4KRNA 5DD5H 3TEWA 1YYCA 2CXGA 5FUCC 1PNCA 3PV6B 4JCLA 3QJRB 1DJSA 2GCYB 1TZGL 4K15A 5F7FA 3UP1A 2CJSA 3QQ4A 5FYJL 3TVMC 1A6UL 1ZCRA 1LDPL 3JBG7 1EO8H 4XCNA 3DJ9A 4UT6A 2NCMA 3LEXA 1PLCA 4P99A 1U8QA 4HEPG 2HFEA 3WO4C 3ZW3A 4OZHE 4NQEA 2WV3A 2IALA 1W8OA 2LU7A 2YQBA 4U3XA 1IV8A 1DVQA 3JTBA 4M7LL 2CG9X 3UBHA 3ZDYF 2E3VA 4MXVF 4XMWA 1RUMH 5L4IA 1OY3B 4JHAL 3CLEL 3DUSA 1HQ4A 2FSDA 1MJJA 1ES0B 1LNUA 1HZHH 1UJ3B 3QHZH 4MMZB 4OKVB 5DQ9A 2GIXA 5L0QC 3LRSA 2G4EA 5CINL 1NLBL 1QG3A 2H6UA 4PRHE 4UDUA 2ZKXA 4N9OB 3ECUA 4GAYA 1XGPB 5EFIB 5EV7A 1MFMA 1UWXK 5SWQA 2X6CA 4KY1L 5CF3A 2Y5EA 4X98A 1SDDA 2WKOA 2HJKB 3IJEB 2NW2A 1KACB 2L7EA 2J8UF 1T22B 1T03H 4YC2B 1IAIM 2WWMC 2XNAA 4WVRA 8FABA 1IT9L 3WE6A 3Q3GB 3OX8B 4Y9GA 4I13B 1IZKA 1V8HA 4Q2ZB 3HCVA 1HCYA 1T1WA 1TZIB 2E7BA 4JFZL 3FJTA 3CDGA 1HNFA 2OCFD 3B8SA 3DMMA 4PRBA 3JWDL 4HKZA 5ESAB 5EU7C 4G6KH 4OZFA 3OB0K 4NC2B 1QRKA 2D3JA 1CZ8H 3PP3H 3FH7A 3K4DA 1DO6A 1F6FB 1BFSA 1JNNH 2Y6TE 5K39B 1XGYL 4Z7UB 4WO4B 4KQ4H 1AHWC 2NUPB 3TEXA 4JDTL 1P53A 1PZBA 4QTFA 1KV3A 4PGDB 1N8ZA 5M94B 4HUVB 1F02I 2JKXA 1E9PB 4ODHH 1KCVH 1ZOXA 2IANB 4PS3A 2XV3A 2BDNH 1W72H 4KPHL 1WV7T 3H42L 3VFRB 1JHTA 2AF2A 2I69A 4DEPB 1R5VB 1Q9WB 5T3ZD 5GXBB 3NH7H 1XWVA 2Y7LA 3GLEA 5D7KD 2IAMA 3GLZA 2PW2A 2R0KH 3HC2A 4AIZB 3BX7C 2UZIL 4XXWC 5BQ7A 4ZFOA 3FCGA 4E0RB 2M26A 4QI3A 3HR5A 5I28A 5K9OB 1NCAH 4I0PB 1TQUA 4HW6A 1DBKL 1JPTL 1X9QA 2QVKA 4MRCA 2YLKA 2DM4A 3PP4L 1SMAA 4PBWD 2FNWA 5IB4B 1OE1A 4P2QB 4UINH 1MRCL 3VRJB 3CFEA 4U7KA 3VXSB 3CHSA 3SE6A 4GG6A 1HHHA 3GDBA 1IE4A 5BXFA 4LPUA 3MNMA 3FB7B 1T7WA 3N04A 4QRRD 1JV2B 2BNRA 3A24A 25C8L 4ICXA 3S2AA 3TBVA 5FF6A 3O2VH 4UYQA 4YBQD 3HZVA 3X14A 3QEQA 4HWEH 3DPBB 4JKLA 1JN6B 2CJ3A 4P23A 1EPFA 4PBVC 2F5AH 4WO4D 5EBLB 1EAOA 3RWFB 1ZEAH 2WTPA 2E7LA 3OMZA 5JUEL 2WZ6A 4CN6A 2FTAA 5IT2L 1MAKA 1G7HA 4NN7B 4XCEA 4YPJA 3LRKA 3QUZC 3TYGL 4N2HA 4MAUH 1BYOA 4M7ZC 4WDIA 5B38A 5E2WH 1U3HB 2VDOL 4H7VA 1K2DB 5IROA 1PX8A 1SXZA 5DRNA 5JW5A 3MFGB 4DP4X 4UMGA 1NGWA 2H8PB 1KN2L 1U3ZA 1DEEB 3IVKA 1XZ0B 4U1IB 1FNEB 4PJHF 4J3OC 2HJFA 3L4XA 4XRCA 4Y16A 5HHPA 5CNHA 5KBMA 5DTFB 4LQ1A 5D2LA 4FA7B 1P7KB 5GRYA 4YSAA 1ZLUK 1Y18A 3UTOA 4IS6B 4BSWB 1KYOJ 3VXSD 3I84A 4PJXA 3CPLA 1RP9A 4B3EA 4LSDA 4C4BA 1YPZA 5H4YA 4LSQH 3SSGA 2W5PA 1U8LA 3VQMA 1CGUA 1P7QB 4LCYA 4KUZL 4NNYA 2VO8A 5D70L 3DV4B 1G0YR 5MERB 5CJXA 3X12A 1YC8A 3DTUB 4Z7OB 2ESVA 2G3ZA 1XMEB 5HYSA 3RLSA 4Y5VC 2X41A 2K3TA 2E5EA 3GIZL 2FJHB 5E5MB 3VA6A 3X3FL 1BM7A 3CFJB 1EEUA 3JV6B 2ZYSA 4PJGE 1A6TB 5EU5A 3LN5A 5F9WC 4FERA 3S4SG 2QR0A 3MA9L 5GS2D 3CHPA 4BFNA 5FUOL 3ZRCC 4JPKL 3NOIA 2ADFH 1SY6A 1DL7L 4WGWB 3IXAA 1YDPB 3JWNE 3MRHB 4PJBE 4QT5B 2R0WL 4IDJH 4NQSA 4Y9FA 5IB1B 2HX7A 4XCCH 4YHMH 5INCA 4PLOB 2B39A 4PW4A 3MLUL 1DSFL 5HPMA 5DRXB 1UCBL 1TJIH 4L29A 3FKUS 2CBMA 3PFUA 3IYLW 4HCIA 4UB0H 2VQ4A 5I6LA 5T5NG 5AW2B 3ASNB 1DLFH 4JJOA 4PG2C 3P11L 1BWWA 4CVXA 2K7QA 1EIBA 2EH7L 3OV6A 4JHZA 2ZD0A 1QRNA 4NFDA 2JJSA 4HSCX 2DTMH 1JGDB 5SX5K 1KCRL 4Y0GA 5FW6A 3SGKA 2CIIB 4ZMNA 4O2EB 2WLIB 3GSNH 3V4VA 3MRDB 4GBXD 3LNHA 4M9PA 1UWEL 3IETA 4M4PA 3SBWC 2AQNA 1P7QD 1FC1A 1HXYB 1PMYA 2EDNA 4MHHI 5T5NF 5I1EH 3QHTC 4KI5E 3B2XA 4XP5H 1WT5C 2X38A 4WFED 4LEBA 2D73A 2R7EA 1SEQL 5GZNA 3UJTL 4ODSH 4C47A 5JOFB 2FJFA 4WI8A 2L7JA 5FHAH 4OTXH 1CO1A 1J8HE 1E3XA 1SJVA 3H9SE 4X4YA 3WLBB 4KHTL 3LMJH 1XBDA 5I8CA 2FCBA 2XIBA 2OL3H 2EZ0D 1CJYA 4HOZA 2X05A 3RY6C 1DQDL 3BFQG 4XMLH 1ZLWK 3PGDA 3CH1A 3V4PA 3WD5H 4N26A 5LXGL 1CB4A 3U0WH 5AVYB 2KPWA 4EUPB 1Q72H 2F15A 5KN5B 1K4DB 1NFDB 5E6SB 1YY8A 4X7TB 2ADYA 2Z4QB 3QXVA 1AS7A 5IVXA 2VN7A 1RPUA 1EH9A 1M4KA 1NCDL 2VH5L 3SJVE 2O1AA 3I6KB 3FN0H 3WDHA 1AACA 1BBJA 3FQXB 1KIPB 4EDWL 4GUPB 3IU3B 1LE5A 3UH8A 3KYNA 1FAIL 4NCC2 2AI0H 5DS8A 3BLBA 2ZAIA 5LDSA 2IH9A 3O9WB 3ALPA 1G4MA 5DFWH 2COVD 4ZK8A 1BAGA 4CSPA 5GGRB 1I1AA 5BW7C 5D4IA 1IC4H 2X2UA 1TQBB 1WBYA 3I3DA 1IE5A 1GC1C 1TTUA 4NWTL 2YS4A 3T08A 4AV0A 4Y19B 2VJ8A 3JV4B 2VIRA 4R3SB 2NNFA 3IN0A 4K9JA 4AQ1A 3A6BH 3NJNA 3CFBB 1C7TA 2XWBB 2WP3T 4H8VA 5F7DB 1HILB 4JJ5A 2MCPL 2BP3A 1BAWA 2VMFA 5EUOF 2XBDA 3PHOA 4KAQL 2VR9A 3WEXA 4XPTL 2QVIA 2VDLH 1AGDB 1AVAA 1L9PA 4AMKH 5CD3A 3FUJA 3FTUA 3LAFA 4P4RA 4LNVA 3P0GB 1U36A 3BPNC 4ZS7H 1R3HB 4AUJA 5C9JA 3ZGHA 3DYMA 3I75B 2DDQL 3IFLL 2EAEA 4A39A 5BO1L 1GIGL 3M1OA 1GS7A 1XGQB 2APFA 1S7UB 4BSJA 3DOHA 4JFFE 3IFNL 3ZQWA 4AYSA 2PYEB 4LBAA 7FABL 4G6JH 3AACA 1VENA 4IBSA 5D7IE 3O9WD 2XVBA 5JHDA 3U0TA 5I0YA 2WD0A 5EO1A 4TUOA 3F6IA 1XIWC 3BSZH 3PIQB 3GRWH 2QPEB 3MRJA 4GW5B 2ZUWA 4P5RA 4FCAA 1J18A 1LD9A 5J6GB 3FUIA 3GD1C 4GW1A 4Y19D 4AKOA 3LB6D 2XACC 5KSVA 2WKGA 3UPRA 2GSGA 2QEJA 3VXOB 3GEFA 4TF4A 1OAZL 4AOFA 2DN7A 3LIUA 4HQQH 3PNWB 3KPOB 3Q6GH 2D7NA 1U8OB 3OAUH 2BOCB 5I24A 1I7ZB 4PJ7B 1BD2B 3ZDZB 5J4MA 1E3FA 3GBML 4MA8L 4BH8A 3HC3L 5C6TH 2GYSA 4ZFZB 3HG1B 1RZJH 2NPLX 4PH8A 1S7VA 1WAAE 4D8PB 4DETA 3REVB 4G7YL 1CGXA 5D96C 5GZOD 1U8MB 4MKMA 1OQOA 3CBRA 3P3TA 3NJVA 3LOWA 5L8KB 4JB9L 4YFEA 2JKRM 4P5MB 2X9ZA 1CIDA 4DF9A 3DBXB 3V8CA 5DJXB 2YMXL 1SLUA 3FTWA 4NB7A 4C4KO 3M7FB 4HKXB 2DJSA 3ROLA 2PYED 4BM7A 1RK1B 5C0AB 2DIBA 4KXZH 2KZKA 3K2UH 2ZX6A 1RJYB 5LAPA 2W1NA 4X5XA 1MHCB 1L9NA 3KPLA 3S9DB 2D4FA 1XXFC 2E9JA 4I3SL 2XZAH 4FDWA 1M2VB 4N24A 5DJAA 5D71L 4DERA 3R0MA 4HBCH 4A7UA 4BGLA 1OGPA 2BSTA 3F5WB 5IJKC 2WBJB 2EH8H 4AY0A 3VMPA 3QQ3B 4H26B 3NACL 4U2ZA 5ILTH 1G84A 1N7ML 3WNLA 1IKFL 2EDXA 3BAWA 3RY4A 3K6DA 1HIML 2HSIA 3L48A 3VSTA 1BD2D 3E2HC 5ECJE 4JG0H 3UZEA 5CJXC 1VFAB 4F57H 4PJAA 2HUEA 1M71B 1BM3H 3HG1D 4OBSA 4WWID 1F1AA 5T3ZL 1A6AB 4HG4K 3T3MB 3QIUD 4YSTA 1HSBA 2VMEA 5B7FA 1HH9A 2LU3A 1A4AA 3QDME 1NC4B 3HG3A 1LDSA 4S1SH 4AJVA 1B2WH 1BIIB 1Z9PA 5AVXB 2D9QB 5K59F 1WHPA 5I1LA 1R4XA 2GSIB 1E4WH 1MCKA 3V5KB 4N5EC 3FSAA 3CG8A 4F9LA 1RLWA 3H4FA 3WIFA 1KJ2L 3U82B 1ITCA 5C0AD 1A7NL 3VCLB 3BWSA 3HB3C 2WINA 3O4LA 4MCZB 1NSNL 1HVXA 4MQSB 1H6EA 3OMNB 1ZV9A 2HVKB 2OMYB 3VD0A 2HRPH 3QFJB 1AANA 7PCYA 5KSBE 3F7YB 4QHUA 5MEOB 4JJHA 1TO4A 1TJGL 2AXHA 5DJ6A 2ADIB 1VFOA 2J1ZA 4TNWK 4XBEH 5DZOA 4YNYB 2EVJA 1A0QH 2Z7WA 1OSZA 4LHUG 3DIFA 3Q48A 4MJIB 4TNEA 4HV8B 4APQC 2YD4A 2PPDA 5DR5L 4YDKH 2H2PC 2RFXA 1JMXA 2OMVB 1A14H 1R1CA 2IPKA 3VFTB 2K70A 3DIVA 3FO9A 5JR1L 1ZANL 2ZAHA 4HHAA 3KPQB 4YDZA 5AVVB 1O5PA 5EIIB 5GS1A 3HAEA 4FMVA 4KX8A