3IWUA

Crystal structure of y116t/i16a double mutant of 5-hydroxyisourate hydrolase
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
b'LSPLSTHVLNAAQGVPGANMTIVLHRLDPVSSAWNILTTGITNDDGRCPGLITKENFIAGVYKMRFETGKYWDALGETCFYPYVEIVFTITNTSQHYHVPLLLSRFSYSTTRGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5-hydroxyisourate hydrolase
publication title Probing the Evolution of Hydroxyisourate Hydrolase into Transthyretin through Active-Site Redesign
doi rcsb
source organism Danio rerio
molecule tags Hydrolase
total genus 26
structure length 114
sequence length 114
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 3.5.2.17: Hydroxyisourate hydrolase.
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3iwuA00
4MRBA 1TLMA 1ZD6A 4ABUA 5A6IA 1BZDA 4DEUA 5CR1A 4HJUA 1TTRA 2G5UA 3CFTA 1Z7JA 4TL4A 3NG5A 3P3UA 4QRFA 3CN0A 3CXFA 3IMRA 4DESA 3FCBA 2G4EA 5AKVA 4HJTA 4QYAA 1F86A 4WNJA 5FW6A 3DJTA 2F7IA 5JIDA 3DK2A 4HIQA 3BSZA 4N87A 1GKOA 3CFMA 1FH2A 4WNSA 1IJNA 3GS7A 3OZLA 2H0EA 1RLBA 1ZCRA 4QXVA 4PWFA 3GRBA 3A4FA 5E23A 3B56A 3HJ0A 1TYRA 4IKLA 4FI6A 4PVNA 2TRHA 3ESOA 3ESPA 4TNEA 2QPFA 3QVAA 3NEXA 4Y9CA 3GRGA 5EN3A 2G2NA 5CN3A 2H6UA 5AKTA 2GABA 4TKWA 5HJGA 1TZ8A 2G2PA 4YDMA 4PVMA 1E4HA 1DVXA 1SN5A 5FW8A 3CN1A 4IIZA 1DVTA 1E3FA 2QGCA 4IK7A 4PWEA 5AKSA 4TQIA 3GLZA 3NESA 4L1TA 4Y9GA 1ICTA 3P3RA 3GS4A 5AYTA 2QGDA 4TQ8A 1QABA 1DVUA 2H4EA 1SOQA 1BZEA 1IE4A 2G3XA 3IPEA 4IK6A 4IKKA 4PMFA 3U2JA 1BM7A 5AL8A 1KGIA 4ABQA 1BZ8A 5BOJA 5JIQA 4PM1A 1SOKA 2FLMA 1TSHA 2PABA 3BT0A 4TNGA 5TTRA 1IIIA 1THCA 3IMVA 1G1OA 5E4OA 4PWJA 3TFBA 5JIMA 2B9AA 3GPSA 4TLTA 2ROYA 4PWHA 3DJSA 5CLYA 3U2IA 2IGLA 5DEJA 4TL5A 1F41A 1THAA 2QGBA 4DEWA 3DO4A 2H0JA 1Y1DA 3CFQA 2G3ZA 1U21A 2H1XA 3NEOA 4FI8A 5K1NA 1TT6A 3DJRA 3KGSA 5L4IA 5L4JA 1QWHA 5CLXA 1TTAA 1DVYA 4TNFA 4ABWA 3D2TA 1FHNA 1TTCA 3DGDA 5FW7A 1SN0A 1X7TA 3IMTA 4ACTA 4PWIA 1DVQA 5AL0A 3D7PA 4D7BA 3DK0A 4AC2A 4N86A 2NOYA 1E5AA 5CLZA 5L4FA 4FI7A 3I9PA 5CNHA 4ABVA 4TQHA 3CN2A 5DWPA 3W3BA 4TLSA 4DERA 1ETA1 1TTBA 3DJZA 5L4MA 3ESNA 4ANKA 3P3SA 1DVZA 2B14A 2G9KA 3A4DA 4L1SA 4TQPA 4DETA 1TFPA 4Y9FA 4TM9A 3P3TA 1DVSA 5FO2A 2H0FA 3GS0A 3IMUA 4I87A 3M1OA 5K1JA 5CM1A 4HISA 3OZKA 1IIKA 1BMZA 2F8IA 2ROXA 3I9IA 4IKIA 4TLKA 3SSGA 4AC4A 2QELA 4YDNA 3DIDA 3IMSA 3IWVA 4KY2A 4MASA 4N85A 4PWGA 1GKEA 4HJSA 1SN2A 3CFNA 2B16A 1OO2A 2WQAA 3I9AA 2B15A 5E4AA 3IMWA 1X7SA 3IWUA 4I89A 3KGUA 4MRCA 4Y9EA 4Y9BA 4TLUA 4IKJA 2GPZA 2QGEA 4PMEA 2B77A 3FC8A 4PVLA 3Q1EA 1KGJA 4PWKA 3TCTA 3CBRA 1ETB1 5IHHA 3CN3A 3KGTA 4Q14A 3IPBA 3NEEA 5EZPA 2TRYA 4I85A 4WO0A 2G4GA 3CN4A 2FBRA 3A4EA
chains in the Genus database with same CATH superfamily
4JG0H 2ZSVA 4K5NA 4NXKA 1LE9A 2Z31D 5HYSB 1OT1A 1E5CA 1D7FA 4H44C 1HWHB 3DECA 1PY0A 3LIUA 3VXSD 4AM0B 4RGOL 3H3PL 4Z8FH 2IMNA 1XH0A 1EAPA 1AXTL 3J2PA 2OQJB 1N6VA 3HFFA 3QPQC 2XUWA 4WGVB 4A6YH 1NJ9B 4X80L 2L4OA 5M94B 3ASWA 4HV8B 3LH2H 5I66A 2IWEA 3VD1A 2WQRA 4U2YA 4WCYL 3HRZA 2GCYB 5CO1A 4FF9A 1TTFA 5GRXG 1KXVC 5CGMA 3TF7C 2NY0C 2EXWD 4Z7WE 2NYYC 2VN3A 3NUKA 4M61B 1ID5I 4JANB 4WK4B 1KYDA 2FQGA 5JOFA 4YLCA 3BPLB 4OCNC 4QY8A 4HKBB 1OP4A 1PFCA 2JKWA 2XX1A 4RETB 3QQXA 4WV1C 5CJOL 5TK4A 4RQQB 4GIAA 1VACA 2FWLB 3B37A 3GI8L 4GW1A 1SY6H 4H20H 2C3GA 3ZDYB 4LAQL 1CFNB 4G42A 2AMGA 4JM2F 4DPBX 2ZUTA 5E99H 2H1XA 3KJ6L 4WUKH 2DZEA 3LHAA 4FFZA 4HIEB 4WW2A 5C0RL 2NY6B 1FHGA 4HBCH 4FNLL 4YN3A 1S3KL 3FSWA 2IXQA 3CC1A 2CALA 1QUNB 3BH9A 3SDCC 5DR5H 4LLWA 3JUYA 2ZUQB 1A0QH 4P0DA 3OKLA 4KI5D 4S1RH 1PNCA 5EU6A 3KGRA 5BZWB 3REWA 4YHPA 5FKAA 4RWHA 1R5WB 2J4WH 5H37G 2KL6A 1JHLL 3MNVB 2YK1L 1JZ5A 4HEMA 4EEEA 2DIJA 3HBPA 4GG8B 2WW8A 2CNYA 4TSBL 4R26L 3IMSA 3QRGL 1E4XL 1JFHA 2Y23A 4LP5A 2WZPD 5IOKA 1JNNH 1XF1A 2UWEE 2WBJC 3WIHH 2UV3A 3AWFA 4I0PA 4F8NA 3UJIH 2BNRA 3ARBA 1F3RB 1EZLA 1Q9LA 2GPZA 4MMYA 3MRMA 4HC1L 4AQAA 3IPBA 3LXBA 5D2LE 2WZAA 15C8L 2EIKB 1KCVL 5ADOH 2P5EA 3H42H 2YMTA 3KS0J 2ICEA 4JUSA 3WNKA 4HS6A 1N19A 1AOHA 5AW9B 3T0WA 3F85A 5T3ZH 4WW1A 1RIVH 4XOBA 2I5YH 2JJSA 3ALPA 1OSZB 3VB8A 1UENA 5F0PB 5DZOA 3VFNB 2XY1A 5FUZL 1EERB 1X5YA 4CW1A 3ULUF 3V4PL 1I8AA 1ACCA 5E1AA 1VFMA 5EMYA 1OK8A 3B9KC 4IRJD 3A6CH 3TC9A 3MLUL 4MS6A 2DN7A 5DRXB 3NK4A 5JTWA 4PJAB 1NL0L 2AKRB 3IGAB 2BWQA 4KO7A 1K5NA 3ZPDA 1BOGB 4F7CB 1LK3H 2OP4H 4TKWA 3EGXA 5JA8B 4M8VA 1FNAA 3C9NA 4O2EA 4ZAKD 4GMSH 3FU7B 1U2CA 4OF0A 2ZWLT 5ABAA 1W9XA 1HILB 4H8WL 3I2CL 2DQDH 2BNUA 4XMPL 4DO5A 4WFEE 2F0CA 3PU7A 5EBWA 3T6VA 5E7FA 4Z7QF 3UPRA 1I9JH 3FYIB 3QQDA 1CURA 4N8VA 4EI5D 4NQDD 4GH7B 5DQ9B 5FX3A 5I15H 2FNBA 4JPIB 3QK0A 4F20A 2R8SH 3MBEC 5TDOA 5A16B 1NLBH 2OMYA 3CUPA 4AE0A 2A38A 1JPST 1TZAA 3T4AC 2P26A 1A2YB 5MEQB 1OP9A 4J6RH 4PW4A 2JXMB 3SQBA 4D7BA 2ICWB 1HJCA 1YMME 1JXGA 5F96H 3FB8B 4ABVA 4FULA 3UO1H 2AAVA 1U3ZA 1VZHA 2K9UA 5DYFA 5TE4H 4E9RA 5K59E 1IZJA 3NACH 1HE7A 5E95B 4BSVB 1X5GA 1TU2B 3WN5B 5TF1L 1HZLA 2O26U 4M7ZC 1AD9B 3BLKA 1U8OA 5IJVA 3SSGA 2AJVL 4OZIE 3TZVB 4HJSA 4HMEA 3WEOA 3KBEA 3SCMD 1TOXA 2B15A 4KAQL 4O02B 5GS1C 1Y6NR 3AUWB 5ICZA 4Y9EA 4N20A 2O72A 4TF4A 3FT2A 3TNMB 2BCKB 1VERA 3VD7A 1RSYA 4R97B 3RFRA 3RFZA 1RFDL 4IBQA 2AK1L 3I02B 4LB8A 2QKIA 3HE6D 4HWZA 4UU9A 4HIHB 4N2GA 3RL1A 3BUYA 1Z9PA 4Y1AA 1XXFC 3O2WL 1L0PA 4M6NL 5SX5K 3NABH 3PNWB 4PIBA 3TWCH 4CJ0A 1KDJA 4IJ3B 2Q8AL 1EO7A 1CICD 3D85B 3F5WA 3WUWA 1CFVH 1XF5A 3RDTD 1GC1H 1ZA6A 2PTTB 3F65A 3MR9A 5A40E 5HHOD 2BRRH 4W9JC 3QRLA 3C60C 2XZAH 1CYWA 5I9QC 3D0AA 2W59A 3HZVA 1RJCA 3BESR 3VM5A 3ECBA 1KBBA 2N1TE 2X7LA 1RURL 3AG1B 4I1NB 3QARA 5DMIL 3VFUB 3VNZA 5I16B 5BMFL 4OKVA 3ARFC 5D1QB 4MD5B 3GMMB 2YA0A 3DV6A 1QLFB 5AVUB 5HYIA 3L1GA 2EDKA 2JJTA 4J3OF 2Z0UA 4U1KB 5DD5H 3MRJA 5D5ME 4H40A 3ARRA 5C0JB 2X4TA 4WWKA 2VUKA 2Z93B 5IEKB 5KSVB 3HUJF 5LGHL 4IMKC 1U58B 2O6PA 3SPGA 4MJIB 4JO5A 3NQIA 3VXMD 4LHUG 1MFMA 2BH0A 4BK5C 2XG4A 4WJG3 2XZCL 5AVYB 2Q3ZA 4LRIA 2Q7YB 2Z8RA 3RIFK 3NJMA 4W6YB 5DO2C 4ELME 5MHSD 3TJPA 3KYNB 4MZIA 2ZJSL 3O3DB 1S3RA 1DVFA 4JPKL 5DURB 5C07B 5JIIA 4YSRA 2A1WL 4MVBC 3F3HA 1XIWB 2NYKA 4PRHA 2X53A 1MRFH 4DEWA 1L5GA 1ZIBA 3CFEB 1F1DA 5FPIA 3TH3T 4AQ8A 3QS2A 4GT7A 3DUUA 4KBPA 3FSAA 4WI9A 4C56B 1F56A 4FP8L 1UB5B 1UUNA 3DIVA 4MDRA 5PAZA 3ZL2A 5A2KH 4DP4X 1P4IL 1RY7B 4N2FA 5EORH 1HQRB 3PQYE 4TQPA 4Y9FA 3QUKB 4LVHC 4OCXH 2DBLL 4PPTA 2FL5A 5HHVL 3S37L 3T6ZA 3V0DA 3TYGH 4BFJA 3UZEC 1HI6A 4U1GB 1A8ZA 2PPDA 3EJZC 4OCRL 4PJDE 1XB6A 3QI9B 4DEPB 4YDJA 3QORB 3K6IA 3VXRA 3X11A 2KDYA 3LH8A 4JFDB 2R23A 4LSPL 2ZUXA 3SO5A 3MKGA 4BQCA 5E8OA 2PR9A 3EXLA 4DPAX 3DPBA 5JHLL 4JBSA 4YHOH 2QZQA 1ZLUK 3GXNA 1TVBA 4NRZA 1RERA 3PJSA 3C2SA 1YAIA 3T3MF 3KPRA 4DKDC 4KHTH 2EC8A 1XBRA 4Q0XH 3CK0L 1V7ML 2APFA 5ALBH 3DBXB 5AOZA 3FRUB 1YN7B 3PL6D 3MQIA 4KTEL 1A7NL 2X4OB 2BDNL 4I48A 4DZ8B 1NFKA 4XXWA 4KJQC 4UILL 2LLNA 2SEBB 1SYVA 3GMLB 3K6OA 4JL2A 4NNPL 4NSKA 4RIRA 5HDQL 3PP4L 3PWPE 1MPAL 2WB7A 4XMUA 4AQOA 1KB9K 2QPEB 4DK6A 3U0WH 3TBWB 4Z3HA 3DX2A 2BY2A 1BZ7A 2NY2C 3BLBA 4FQQA 4FTVA 2OMBA 1G7QB 4BHUA 1YNTF 2DS4A 3LAFA 3N6YA 1AZNA 4FQXA 3S98A 2IANB 4DKFL 5C1MB 5EA0H 1WFOA 3FUHA 5C6PB 1NANH 3NIFE 1NDMA 2C9SA 1L9NA 3WKML 1RZJC 4C4KO 4PGBA 3VDAA 1QNZH 1ZWIB 3MV8D 1FZOB 4H8UA 3ZDYE 5L9DH 1HK6A 2WTRA 3GBLA 1TMQA 1XZ0A 4S0HA 4QRTB 2B0SL 3LEXB 1YEKL 1MCPL 4KZEL 3MOAL 5DLMH 5FYJU 5H2BA 3RY6A 1N67A 3SKUD 4PRDA 4TULL 5I1HH 2EVHA 3L7FA 4HVBA 2VW4A 1HTYA 1QBLL 2NXYD 2W8CA 4U4BA 5ABZA 2R1YA 3WL9A 3FU8A 5AVVB 5FGBC 1KPVB 1SLWA 1U21A 1BVOA 1WT5C 4UIKH 3LQZA 1JVLA 2GC4C 1OQOA 3E3QE 4TNFA 2O5XL 4IOIB 5FA3A 4WRLA 2Y7QA 1FE8L 3HI6L 4JFQB 4ZFFB 2O61B 1JPTH 4HX1B 3UYPB 3VFMB 5T8IA 2D73A 3EZ8A 2VMDA 1T0NB 5EOCH 1CB4A 4QWWC 5BRQA 2WLKA 4CL7A 3O6KL 3WGVB 3MRDB 4M1DH 1WUZA 1E8WA 2PCYA 1QKZL 1IT9H 3N91A 4HIXH 4HP5A 5CLWA 4HW6A 1S8DB 4L8DA 4Z3JA 2F8VA 2VH5L 1KV7A 5E6YA 3DKHA 2UZYB 4AC4A 1GJUA 1F4YH 3KLAB 4P5TD 4XMZA 1ZLVK 2AXFA 1AP2A 1U8JA 3APDA 3QE5A 2R59A 5DZPA 1NUDA 1ITBB 5IHWA 2VLJA 3CLEH 3FUEA 4PAZA 5I6XC 1RL1A 2FDBP 4HOZA 2LTQB 5LAXB 3KLHC 3UYRL 4N0UE 1CTOA 3V95A 3HNTH 4NC2B 4AG4H 4I5BB 5EZJA 3WIIH 3CDZA 3SKNB 3FO1A 3HHSA 3HNSL 3NP3A 5CEXB 1MFEL 1MCEA 2G2RB 2V5YA 2XWTB 5EZLA 2WXJA 1MIML 1DL7H 4GEIA 1T2QH 4Z7VA 4D0BA 2OSLA 5DJ6A 3U0TB 3TVMA 5BUGA 4K3EL 2P42B 2XN0A 3H4HA 2X4NA 3N06B 2ODIA 1AQDB 3QHTC 3BO8A 1JRHH 2DD8H 3ET9F 2MQGA 3MA9H 3ZOAA 2DYPD 5EC1B 3NIDB 1NAMA 1PZUB 3FU0A 4HUNB 6PCYA 2HG0A 4P3CL 1WC7B 4S1QH 2AEWA 4Q2ZB 1OGTB 4PV9B 3CHPA 1IGYA 3KR3H 5KG9B 3K8KA 3EFFB 2V37A 3CDFA 5F72S 3PGFL 2HT3D 3BVDB 4LSVL 3SZ6A 5KVMC 1R3IH 4Y2OB 1Y18B 4DN3H 1F11A 1SN5A 4Z7WF 5TQ0H 2WAHA 4N2IA 4QOKB 2Y72A 2R39A 4XB7A 4KH2A 5HJ3B 2DQGL 5IWLA 4AITA 2CDEB 4WUUE 2CO6A 1HINL 1NINA 4M3JA 2I07B 1KGIA 2IPUK 3BEVA 3GKWL 4F15C 4BH7A 1XSOA 2BIQA 3P73A 4F33A 1KGCE 4LEBA 3C5JA 4B9IA 4DVBB 1OF2A 2B9AA 4PJ5B 2ZUVA 1JUFB 4PG2A 2R0KH 5KYWA 5E00A 1R5VA 4FQIH 1L9TA 2GY7B 1F2QA 4H25A 4V2CB 3CFUA 3MGAA 2VXSH 3R0NA 3O45B 3QO1A 4NM4L 1IGCH 3DIFB 4OCWL 1FHNA 2EC9U 4JO2H 3QHFL 2IPKA 1M7DA 3OF6A 1EIBA 4LKCB 3IFPB 5ID0B 4X42A 2GY5A 5AOIA 3PAYA 4XNQB 2XA8H 4BE6A 1QHOA 5FGRA 3I9GH 3JTTA 2XQYG 4TLSA 3BMWA 2Q10A 4HPHA 1SUJA 5JUEH 5FS5A 2WCPA 1KXTB 3BPCB 4MB3A 4D9QD 3OVUB 5CAYB 5TH2A 4B3EA 3KVDD 4F1ZA 1NGZB 3WS3A 1E42A 4MNQD 5H35B 1R24A 2JF1A 4NM8L 4KY2A 1J9RA 3BIAX 2UWEF 3QCTL 4EUPA 3GZOA 3LNHA 4OLUL 1QI3A 2CGRH 2JSFA 4AVJA 5HXMA 3FULA 3QWNA 2K45A 4RRPG 5DQDL 4K7FA 1QFWM 3K5RA 1IC4L 1HKLL 5EBMB 3TCTA 2Y1YA 3B43A 5D2LF 3PPEA 4KV5E 1GZQA 2XWZA 4MNHA 4EXKA 5IM7A 4G43B 5T1LB 1JZIA 2XC8A 5DZNA 4HCRA 3SPHA 1GGTA 2A5UA 1GZHC 1MFDL 3A67H 2JJUA 1AJ7L 3QPQD 3FSVA 3WO4C 2CBTA 3QFJE 3LPOA 4IIQB 1KPRA 3KBHE 4XPHL 2BX5A 1J86A 1F4XL 1GY1A 4IBUA 2WMPA 3EYFB 1XGQB 1ASPA 1HHHB 4Y4HB 1UA6H 4N0YH 1W2KT 1CS6A 3G6DL 3EBIA 3ARGB 1YECH 1KY7A 3BUQA 2MKWA 1AI1H 1AIFA 2NY0D 4WU7A 4PLJC 1D9KA 4ZD3L 3CIAA 4BM7A 1IE5A 5CIPH 4M5SA 3NEXA 2IG2H 2OCJA 2H9GA 3CVIL 4ZYKA 4D0CA 4M5ZH 1FFPB 5EEZA 3MCKA 4PVMA 1BVKA 4FHBD 3LEVL 1PD1A 2NQCA 3RWHA 1DVTA 3VSQA 1KCSH 1UGNA 3QIWC 4HSQA 3JWNC 1IFGA 3UCQA 3TEUA 2CD0A 4XT1C 2BZCA 4NAMA 3WXWL 3S35H 3LKRA 3QQ4A 3CZSA 3RHWK 3S5YA 1WBXB 1Q0XH 2YUWA 2Y5TB 3MV9A 5E9DB 1KIPB 5DHXB 4DN4H 4M43H 4ENEC 4J3OG 3GGWB 3OHXB 5GJTL 4CC0A 3ZO0A 2A9DA 2R2BB 4UV7H 4CUCA 5DEJA 4JZJC 1ES0A 5FUCC 1BQLH 3H6AA 4U1MA 3VXQA 1D9KC 1HX0A 2IALA 2ZOOA 3CZFB 2A9MH 3CSTA 1RUQL 1KJ3L 3L3JB 3EBAA 2RQEA 2DL2A 3QXAB 1ZTXH 4K3HA 4LL1A 5I1AA 4GPVA 1KENL 1QW9A 4KWUA 1IGJB 3V4PB 1KJ2A 2UYLB 5AW5B 4CU6A 4ZZFA 3I75A 5SWSB 3P9MA 5MENE 2LVEA 4P2QA 4F80A 1AGEA 3BKYH 4OFYA 2EH8L 2CDFA 2YJLA 5K59F 1TTBA 3S0PA 3RG1C 3V6ZB 4BJLA 2DWDA 2FWUA 4UANA 1HL9A 4PRPA 1HZHH 2BW4A 1GC1C 4MQ7A 4KO5A 5C0CB 2E27H 4R84A 5CZVL 4ODHH 2NUPB 4OZIF 2BSRB 3L1OH 2GJ6B 4NLHA 3DIDA 1E67A 4M02A 1H5BA 3LXCA 1FPTL 1G1YA 1G7HA 3DVGB 2WQAA 4AQEB 4Z76B 5CZRA 5J6HA 3A6OA 3L2MA 3JV0A 4XMVA 2W81C 4UNIA 5IBTH 3MRNA 2PXYC 1JS4A 2OJEB 2WXMA 4QAMB 1U91A 5ANMB 4XH2B 5D7KD 1S5HB 2PLTA 2FK9A 3VD3A 2VXQL 1USQA 5FK9B 1G9NL 4I9XA 4MDJA 2EJ1A 2Z92B 2GC7C 2VISB 1DO5A 1E90A 2MQCA 1MG3C 5AW0B 1DZ0A 1X4ZA 2JH2A 2HKFH 1E8ZA 2C26A 3F8UB 4HJ0C 4I0PD 4M4PA 1CU4L 1DQQA 4JDZA 4K3DH 1HT6A 3ARBD 4FDWA 5KBKA 1JTOA 5CBEB 2WUBH 3FO9B 5AEAA 1EQWA 3B9KD 4L5FE 4EAEA 4YUEH 4L3CA 3RI5K 1TSRA 4JJ5A 3J27A 2F7IA 2XRAH 4X99B 3QAZC 2HLAA 5IMLA 2WD0A 3CHOA 2CLVB 1TUPA 1YJDH 2Y2TA 1RLBA 1M42A 2V7HA 2P5ED 3D39B 4OQTL 5IB4B 2CK0H 1CT8B 3MLWH 4P23A 1CGWA 1VENA 4FNQA 1WICA 5E6SB 4Y4FC 5B39G 4XMLL 2H2PD 2W9EL 4PRAB 1AH1A 5D5MF 4L37A 1BEYH 4M48H 3R4DA 4GBXA 1I3UA 3EG9B 3WMPA 5DEZA 1BIIA 4ZFOA 2XYCA 1DSFH 1E9PB 3GMRB 5F1SA 5ESAA 2NSXA 4NN5C 2DB8A 2XWJB 3FRPG 3GC3A 3R06A 3SBQA 1C5BL 1KIRB 1Q9OB 5EUOB 3TO4B 2Z1KA 4GSQA 4MA1B 4ELMF 2DMGA 2FIRT 4JREB 4P2YA 4G3YH 2VDRB 4JRLA 4LSQH 2CRIA 5E03A 5JIQA 4OCYH 5CJXA 2WZ6A 1RHFA 2H3NB 2PPAA 2WWNA 2XTSA 4JCWA 4M9OA 5CMAB 5GGRY 4C8XA 5IQMA 3WE6A 2XIDA 1MHEA 1NMCB 1BX2B 2Y7NA 5HPMB 4BELD 3BN9C 4C4KT 2FAUA 5LBSL 4ZO8A 5E4IA 4C47A 2B59A 3MO1A 3BGFC 3WTXA 3EYOB 1UM4L 1BXVA 2H2SC 1SEBB 3DSFH 4PWIA 1N8ZA 2XTJD 4MMXB 1J0ZA 1WRFA 4TQHA 3DROB 1IBZA 1MJJB 2DI9A 1T22A 1FQ9C 2NW3A 2BC4B 4NCC1 5MERA 1TITA 1TFPA 1INEH 1OPGL 5D1XE 4TRPL 3VWKB 3J07A 5HGAB 2K70A 1CK0H 1IV8A 3D34A 3WJLA 1XO8A 1K9TA 4PJDF 3OKYA 5FUOH 1CD1A 3HFML 2EEBA 1RKRA 1BPLB 3LXAA 4YL9A 4HLEA 5INCA 1ZV5A 2KT6A 5A2FA 1RU9H 5D7HA 1AFVL 1A7QL 2YXFA 5DRWB 2AV1A 5GGUA 3VU1A 4ODBD 2LQRA 4LCUA 4UTAH 3K6SA 1H19A 4FFVC 3MREB 3DURB 4J2XA 1IKNA 1ZA3B 1OP5H 4GP4B 1I7TB 3TYFB 1RSFA 3QDGB 2JNZA 5TDNA 2D31B 5AVQB 3ZZ1A 5L2KD 3OKEA 3QXDA 4R7DA 4P3DA 3QIUB 4G80B 3VM7A 3ZIMA 1UM5H 2M83A 5MP6L 2VR8A 2HJFB 1CLYH 1LEKB 2OMZB 4W70A 5C09B 2HRPH 3VDCA 3KPPA 3FH8A 3IDYB 3QJSB 4JB9L 4LVOB 2YPLD 2K6WA 3L3IB 3DXAE 1LP9B 4Y1AD 1ZVYA 2A6JB 1RZGA 1ZS8A 3C8KB 1EBAA 4ZPTB 4G59C 3SGJC 5HYQA 2QPFA 2BVPA 2JQMA 1IBHA 2Q7NA 4KQ0A 1JOIA 1Z3RA 4W4OC 2Y9RT 3QUMA 4CBPA 3D0LA 4GKNB 2K3HA 3UMTA 1UT9A 4G8GA 5KAQF 1JK8A 2HJLA 3B6SB 2GJJA 4U3HA 2YUZA 4NZUH 3AM8A 3L3HB 1ORQA 3IF1A 2VDNH 4AQ1C 4YL4A 3H2QA 2CHWA 4X8XA 3IFOA 1F00I 4D8PB 4Z7OE 4M5TA 1UWEH 4ZRGA 1JZ3A 3K71A 1UKQA 4WWKD 4G9FB 5D9SA 2GB2A 4HKBA 4OCLC 4GRMB 1NCIA 4X7SH 4XN1A 2B2XH 2DDQH 4WFFE 2AJ3B 4MSWB 4OW6A 1WG3A 1DE4B 3FQNB 3VD4A 3NCCB 4ZXBA 3MJWA 4GRLC 1SXNA 1N70A 4IHBA 3BI9X 3SBWA 3X12A 5DJ8B 5E6UB 3ZE2F 1UOLA 3VG0L 1JD9A 5KYXA 1SFDA 5CEYB 4ZNEE 3RWIB 4HD9A 1A9BB 1XF4A 2R0LL 4AW4A 5CF3A 4UT7L 1XGRB 2OR8A 4X7CC 1T7ZA 5DK0A 2B14A 4PRHD 4IEFA 2CCWA 4H1LG 1M1XA 1OAQH 3B7RL 4JPSA 4RDBA 1WK0A 1LK2B 3LZFL 1QBMH 4PVBA 3BAKA 3B2XA 2F54B 2CDGB 2FSDA 3JTSA 4MXWH 5L7XL 1NC2A 1NEUA 4AKPA 1E6JH 4V2BA 3RJOA 1GCYA 5EOQH 3OPUA 3W81A 4APXA 2HFGL 4FQJL 2CHNA 4GJTB 3APNA 1KGJA 4HQQL 4NHCH 1A4BA 1NSNL 2HRHA 1A5FL 1QHQA 4OM1L 2P48B 2ZOLA 4LSTL 1I4FB 1CQKA 4S2SB 4X8GA 5CKGA 4MB4A 1UVQA 5C0AB 1Z9SB 3BFWA 3CSYA 4QHNB 2ZCHL 5DMGC 1XV8A 2DQEL 4U1IA 3II3A 1T3FB 3HC0A 4E5XG 3WD5H 1V3LA 3WDJA 1LO4L 4K55A 1ZSHA 5IB3A 3WFCH 1JPGB 4L3EE 4OD2A 3QIBB 4JQVA 2CCVA 4Y5VC 3WY2A 3EJUA 2NX5B 3KPRD 5DJ0A 4H1LB 4B6ZA 2ZZUT 3L4ZA 1HHKB 3NFPB 3AACA 2J8OA 3V0HA 5IMKA 5H37A 2P8MB 4KUCF 3WFBH 2HUEA 2X44D 4EJ1C 2GAZB 3PG2A 1X5FA 2XG5B 2WINB 3ULSB 2C9RA 5AYUL 2QDVA 1QSVA 3QNYA 4IRZA 4DQAA 4KMQA 1AO7A 3ECUA 1EGJH 1L9MA 5E5RB 1FN4B 4PJFE 4YDVA 4Y2DA 1PL3A 2VYRE 1ADQL 4LSSH 4TUOA 4P9HH 1YYLH 1JL8A 1IIIA 4MJ6A 3RUGE 2GQHA 4BZ1H 4YMPA 1ZGLB 3QCVH 1DQML 5G4OA 1T04A 1UKSA 2ZCKL 5E5MB 1UH4A 3EGDA 1FJ1B 4U6YB 1Y1DA 3TBTB 1H3XA 3FQTB 4P5SA 3GI9H 3FUMA 4WJ5B 1KPUB 3EGSA 3L4TA 1EMTL 2R69L 3VUAA 3O3AA 3EH3B 2C3WA 1WS7A 4HK0B 4YHZL 3ZE0E 4C58B 7FABH 1DVQA 1QRNE 4MCZB 5DMYA 4IU3A 1F4WL 1SY6L 4M7LT 5B21A 4BKSC 1A2YA 4PD4J 2VB5A 3US9A 3A23A 4B7LA 4ZFGH 4UT9L 2JXMA 4N8CL 3KYKL 2ICWA 3RIAK 4WY7H 1P7KA 4OI8A 3DGCR 2QSQA 2NW2B 4PLKC 3V6OA 4GW5A 1IM9B 4Y0GA 4FERA 4AVHA 4ZJ9A 3FQXB 4MJ2A 1A0QL 1SJEB 3GKZA 1U8HB 4MASA 2NQDA 1OSYA 3GSUA 3MCG1 4YGAB 2GSGB 3MJGX 1MLBA 4UT6A 1TPXB 4PBWD 4PJHA 4RDQF 1CTMA 4G6FD 4NFBA 4AENA 5LNGA 4U7SA 3DUSB 4KV5F 2KUTA 3UTSE 1H0DA 1WAAA 4CDHA 1BYPA 1JNNL 4BCXA 2ENJA 2FBRA 3H9SB 4Y7OC 3STLB 1NCJA 2F53E 1OY3B 3UJIL 3ZZLA 5IJBC 4JFFE 1LMIA 1MH5A 4U31A 2VLJD 2DYSB 5IF0B 4JVUA 12E8H 2F7OA 5KZCD 3NIGB 2QR0A 4JO3H 4Z77B 4U6HA 3TIEA 2UZXB 5JORB 3HZYA 3HMXH 1P69B 1PKQE 3MV7A 3IAPA 3OGCA 4G6KH 4BFIB 1AKJA 2IDUA 4EI6B 3X1BA 1K4DA 3L3OA 3MGOA 5FYJH 4A2FA 1JCKA 1B2WH 5SV4A 3RB7A 3OJ2C 2XKNA 5EU7E 1CVSC 1IAKB 3M17B 3ZHFA 5D1QA 3TBYB 3NZHH 4N0FB 1MCLA 4G7VH 3FXIC 4JGJA 3TESA 1FH5L 4F7TB 4N25A 2B1HL 5FWQA 2O5YL 3DMMB 1R34A 2YPKB 4BK4A 1ZKAA 1Y0LA 4IJTA 2D0GA 4CVUA 1RZKC 2C9VA 2QV4A 3CSFA 1U8KB 4ZOAA 3BDYH 4Q6IC 3ME0A 1RQ5A 1KLUA 1U36A 1ICTA 1S7QA 3IT8D 2C7UB 4ICWA 2XN9D 2PCPB 1XSIA 2A7BA 2PABA 4GMSL 4JN2B 1WA0X 1XFPA 1JK9B 1EHNA 3WUZA 4M93C 4RRPM 2IWFA 3FUKA 3X3FL 3O3DA 1WD8A 5IGXH 2E86A 3UTPD 3RA7H 1XEUA 4NHUA 1R46A 3O11A 1I9JL 4W9DC 3QJFB 5I6MA 4MCNA 1NCDL 5ENWA 4H26A 4WI5A 4N2BA 4BXVA 4P9MH 5IR1B 4N90E 1F1AA 2H41A 1TVHA 2CU9A 4QHMB 3LZPA 1V05A 5DWPA 1NLBL 4B9JA 3SPCA 4FG4A 3S3PA 3RNKA 3OQRA 2AGJL 3AXIA 4PJBB 3W0WD 2OL3L 1P2CB 2VZUA 4JG9A 1BJ8A 4XN9A 1J8HB 1F4HA 2A83A 4P4KB 3E0GA 5DD6A 3PDOA 5C86A 4ZBJA 4Y2NA 5L8LB 1QSEA 3KL5A 1HQRA 4J6RL 2R7EB 2MTAA 1F3JB 5F96L 3OF6D 1EBPA 3AU1A 3UO1L 1J0IA 4NQXA 3GIVA 4LOEA 4HKXB 4PREA 2WXLA 2P45B 2F15A 5FWRA 1O9ZA 1CFSA 2PR4H 4TTGA 4HIJB 2BSTA 1YJDC 4LHUA 2PWFA 2PYED 3QFDA 2C1OA 3QI9A 2HZHA 4GI6A 2YMXH 1OAUH 1IGML 1KN4H 2F1EA 1IZKA 2FJHA 3U6XA 3QSKB 4NB7A 3BQUA 5EZPA 4JFDA 1KBGL 4K7PX 3SO3C 4FG6C 2F6AA 3U7YL 4P5RA 3N41F 4QHPA 5D72L 5CFHA 4NOFA 3T77A 4O2FA 4I2XB 4JZNA 5IY5B 1CMOA 3LRSB 3CX2A 4DW2L 2YC1B 2O5ZH 3B2PA 1MWOA 4MNGE 4OSUL 4L8CA 4N26A 4Z23A 5E2VH 5DZAA 2AK4E 3ISRA 2CRYA 4UIMB 3MRRB 2YPVL 3ZX1A 4ETQA 1AS6A 1IM3B 1T5XA 3TWCL 2VABA 1KYFA 5CWSA 4APQB 1I85A 2DKUA 4HG4K 4XN7A 4F9LC 2X4OA 3N9GH 2EYTB 4X6EB 1N64L 3FK3A 4HMCA 1CZ8H 2KHAA 3L3DA 1XL4A 1JF1B 3QWOB 2HH0L 1KBWA 1QACA 2WQSA 1S2EA 5I18H 4KQ4L 4XOEA 1E50A 2X3AA 3SE3C 1P4BL 1A1MB 3QEQE 4QTHB 4X5QA 3QUZB 5E8PB 4ENED 2A4CA 3FO0H 3K0YA 1K8DB 1JZJA 3NAAL 6TAAA 1BZ9A 1JNLL 5HI4C 1BQKA 5C0IB 1OB0A 3AQDA 3MA7A 4AXWB 3T04D 1KYOK 4X7TA 2ITCB 5J12B 1BZEA 1D9KD 4V1DA 1IBYA 1ZLDA 3GXUB 2EIZB 3K2UH 1U8PA 1F6LL 3IKCB 5D7LE 5IVXE 4HXBL 2ESVA 4N22A 4OIAA 4QRTA 2Y7OA 2OYPA 1AZBA 3WXVH 1QD0A 4M1GL 3ARYA 4ZMZA 2YQ2A 5DZJA 1ZRUA 1FFTB 2VLRD 2QGBA 1E9QA 2FD6H 2CXGA 3J8F7 5KAQG 1LEIA 1E9OB 3NA4A 4ONFL 4XRCB 1ACZA 3Q13A 4K07A 1NCOA 4OD1L 4NJ9H 3C6SA 1JGVH 4BGLA 4BE5A 1TEYA 3FFDB 5C0BE 2O61A 5KVFL 3VFMA 3MRLB 1OAZH 4JCMA 1C08A 2KERA 3EUDA 1JPFA 3DRQB 2KH2B 5EZOH 2Q5BA 9CGTA 1AANA 1OGSA 1JGLH 1PDKA 1R47A 4Y4KA 3BPOB 4ZUTA 4MAUL 1NLDH 2WSPA 1U8CA 2HG5B 3B3BA 2FCBA 3OB0K 3ZUCA 2QSCH 3DRTB 4OFYD 4YNYB 5JW5A 2OXGB 4LBAA 1PSKH 1KTKE 1SVCP 3LQAH 4YC2C 5FOBB 2CA4A 1O0VA 4TLUA 3IN2A 1MAJA 2B77A 5TE7L 4HJ0D 1XCQB 4LCIH 5IB2A 1KTCA 1E4WH 4JS7A 5JHDE 1BM3L 3NRQA 2CMRL 2FQDA 3KPSA 3C5XA 3QUXA 2WZ0A 4FLSA 2AJUL 2DJSA 2XFXA 5C0FB 3HI5H 3VFRA 2YWZA 3NGBC 2ZKXA 1U95A 2WWKO 1M57B 3MLVH 1XEDA 4NZRH 1YO4A 2W95A 4KUZL 3E2HB 1QI5A 1KACB 4GP5B 2FGWH 4MAYB 1UQSB 5GS2H 2HKAA 4D7PA 4KHTL 1NIFA 4BRVA 1OAXL 3DTDA 4Q0XL 1HH9B 3LN5B 5ALBL 2P7TB 1IQDA 3TA4D 4JLRA 1TTGA 1CE1L 3BWUC 3U4KA 4H7VA 1Z3GL 4R90L 1T5WA 2G2NA 5FYKU 4JM2A 5EU4A 1KIQB 2IFGA 2OULB 3NFNA 4OLYH 3ZE2B 3MBWA 5KVEH 2OTWB 4HH9B 4S1DC 1BYNA 1P84K 4ODSL 4PN6A 4NZJA 2F58H 3PFQA 3EFFA 4OZGB 1DEDA 4Y2OA 2YD8A 4FQLL 3QC6X 3TCLB 3ARDB 4P23D 1Z9MA 5I71C 4L8SB 2VRKA 2APTA 2FUTA 1G5AA 4J4PA 4FNTA 4GBXD 4W9FC 2JTYA 2CDEA 4MDIA 4YGVA 5J7CC 1R1CA 4R0LC 4LRNH 1BYOA 5KTEH 2X1XR 1F90L 3M1BB 4IOSA 3BGMA 5JPNC 5A7BA 3O2DH 4LAJH 5BO1H 5FO8B 4ZG1A 3TX4A 1CQYA 1P6WA 2ED8A 1NCAL 1P1ZB 5DLML 1BFVL 1R5IA 2XNAA 3D2TA 3VRJB 5AENA 5I1HL 3D69A 5JHBA 2IH1A 4CVXB 4PCKA 4B27A 3QZPA 2VDMH 3WTWA 5F7EH 4PJ8B 3O45A 4B0MB 2ZXCA 2O1AA 4GT0A 2XCMC 1JDAA 5C2UB 3IFPA 1YEDA 1RHHB 1I3GL 3QO0B 2VM4A 4NGHL 1YEWA 4LOFA 3B2DC 5DRNA 3L95A 1E8YA 5HSFA 1G9HA 1FZMB 1KXTA 3OBAA 3BPCA 5CINH 4FXKB 4AV5A 4PRIA 5FLUA 5LGJB 5EOCL 4AGNA 3Q3GA 3HB3B 2VXVH 2YMOA 5AB2A 4FFVD 3QYNA 4NN7C 4JG1L 4JRXA 2B16A 1X6NA 3DSNB 3BCFA 2BVOB 1T20B 3UBFA 3KGUA 2WKLA 3HNVH 4G11A 1GZPA 2XYBA 1T66D 1FYTB 3N44B 4AYDC 2E6QA 3V79C 1TZIA 3JBG7 5EBMA 1N8OE 3LKPB 1I1AC 2ITFA 4G1MA 5FECA 4M6ML 4DTGH 4HWBH 4AG4L 5LCVA 3B7TA 1KJMA 5HGGS 3O4LB 1VEPA 2ZXQA 4FQ1H 3WIIL 3K72A 3ZGIA 4HCRH 1DJGA 4RDQG 3OAUL 4LHQB 4YK4C 4JO1H 3CDGA 4BV1A 5HGDB 4JDVB 3W9DA 1DL7L 3GJFH 1T2QL 2XICA 3US0A 2VR3A 4TSAH 5E1IA 3ATEA 3FQ2A 2XQYA 2D7MA 1TYRA 4LCYB 4HUMB 2TRHA 1Q1PA 4KVCL 3W11C 3MBXH 3DO7B 4MQXD 4YSCA 1JRHL 4YX2H 1LEGA 1VB9A 1AGFB 4PJGB 3LZQA 4ESKA 1B0WA 2QFPA 2J21A 1DBBH 1AR1B 4GP8B 4JFEE 3VJ6B 4AEIH 4NO3A 4OKDA 4Z7UE 3K46A 4OGXH 1QPXA 3GSVB 3IPEA 3AAZB 4RRPA 2YD9A 5F21B 4ZSOE 4OIFA 2L8AA 4OF5A 5ICYB 2R2HB 4DN3L 3RUGF 2AXGA 1CF8H 2VLME 4GMTH 1DYZA 4GRLD 3CNKA 4KVNH 3IDMA 5E4OA 3S5LG 4JO4H 1Z5LA 2OI9B 1MCSA 3ZN6A 1GYAA 3MUGB 4G8GD 1DLFL 1YSOA 3GGWA 3OAZH 3OHXA 4GW4A 1ZLWK 2K0RA 3P2DA 5DJAB 4I3RL 4P4RA 3TBVA 1J1XL 1J8HE 2H5UA 2R29L 3LMJL 4UMSA 1GPOH 1YY8A 3BXNA 3ZE0F 3H4FA 4KO6A 4LE8A 4CRPA 1G84A 1QA9B 4ACTA 2PO6C 3QXAA 4GSUA 1CR9H 4TNVF 2V9UA 1VIWA 4IHOA 4Z9KB 4NEHB 5TE6H 5KSBB 4Q9QL 3DDGA 2C8NA 3QDME 5H4YA 2DLFH 5SWZE 2NCEA 5CBAA 3MUZ1 1VESA 5D70L 4NKDB 1J0HA 1MHHB 3F7LA 4KJPD 3V6ZA 4C57C 4ZXBD 3L9YA 3EYQC 4KKAC 1RMFH 3I9GL 4RMUA 3MTRA 4DWHA 2YRPA 4CADB 1S7VB 2BSRA 4HS8H 1QFUH 2GJ6A 4P5MB 3DTXB 4PCSA 4XVJH 5CJBA 5D7JC 3SJVB 2DWEB 3ALWA 4U3CA 4O51B 4X4MA 3Q8FA 4AQEA 3DVGA 4YXLH 5DMGD 3TASA 3LNGA 3Q2LA 3VE0B 2XWRA 1UZ6F 3GSNL 4R2GC 4LMQE 4B60A 1RK0B 2WZ5A 3Q8BA 2OJEA 4YSAA 4QRPB 4Y5YB 1S9VA 3P30L 5HVFB 4ZMQA 2VQ1A 1FF5A 3DX7B 3BZ4A 3WU1A 1NC2D 2G5UA 1IAMA 2QMJA 3GBEA 3GLEA 4TV3A 3HUJA 2CHDA 5G5DB 5ACLA 3P54A 5I17A 1U8MA 3BEWB 3ZHDA 5I19L 4UZUA 3HC4L 1P7QA 2HX8A 3HG1E 3UXFA 2P9RA 3VA6A 2AJZA 3BVVA 3K2IA 4ODTH 1VHPA 1EJ8A 3QNXB 5HHXL 1A3RL 3CPLB 3GB7B 1NGXA 2IBZX 1SDDB 3L1FA 1MJ8L 1RUKH 3EH4B 2EEAA 4NZ8A 5IHZB 5EF1A 4Y16C 1UA6L 1AGDB 3MXWL 4N0YL 2VKXA 3OB8A 1YEFH 2AEQL 1OB1A 1AI1L 3GRWL 3NCEB 4Q4IA 1OK0A 3X14B 4PWEA 4YE0A 4HIIB 3T0EA 4XVUC 4OZFG 2IG2L 3L54A 1DJHA 5IG7A 4KX9A 4HJJL 2DQIL 1A1NA 4URTB 2JKJA 4OLEA 5I8KH 1YNLH 3GPSA 3MLTB 4FJ6A 4C83B 5KN5B 3A6BH 4NO0B 3MODL 1AO7D 4DGIH 2IAAC 2F7PA 3B2VH 4RBPH 1HAUA 1K3IA 4M43L 2ARJA 3QNFA 4Y2DD 2G3NA 1AG0A 2CIKA 3EO9L 2DEYX 2W07B 4UYQA 2X9YA 1FVEB 4UV7L 3P1VA 2GT9A 1OQXA 2EEXA 3QWQB 4QD2E 4WEBH 3OXSB 2A9ML 2DEWX 4M00A 5EH1A 4TUJB 4UQ2A 3ROOA 3VXUA 3SDAA 4GEJA 1LQBC 4OJFH 1FCCA 4NWUH 1MJJA 3OAYH 1TCRB 3OWRA 2JFCA 5IV2A 2KPWA 1K4CB 2A6DA 2BC4A 1AQKH 5B39A 5K9QI 2XWCA 3L5WB 4R9HA 5FCUL 2J6EH 5JOEA 1KELH 2UVFA 1UHVA 3IRCA 4YPGB 4GKSA 2J55A 3KYOB 1DBAH 4UM8B 4PJ7B 5ABDE 3SGKA 4ODWB 3L13A 1JNHA 3FRPA 4J8RA 4MX7B 4W9GC 3D51A 5TDPA 3ARZA 1C5DA 1JV2A 4NENA 4Y19A 4PJ9B 5FYLD 3C5ZA 5T1MB 2MCMA 4ODHL 4DCQB 2ZOKA 3HVDA 2H6PA 4B9PA 4QGYA 1AD0B 1YEGH 3GLDA 1CXIA 2EE2A 5GIRA 2Q86B 2WNWA 5EG6C 1FFNB 1T6VN 2Y06H 3FFCD 4XHJD 1YNTA 1Z32X 2J25A 3DURA 4FZ8H 1I82A 2EKJA 3CZUB 4LLMA 4N4YB 5IBTL 4BCZA 5J9PA 3VD2A 1ZA3A 4QI3A 3Q05A 3OZ9L 3QH3A 1QFHA 2C4FT 4KO9A 1BVLB 4I77H 1FV1B 1HHGB 1DANT 4HJEA 5E94A 2ZXWB 2OL3B 4QRQB 3ZKSD 1Z9LA 4LO9A 2VJXA 4X9IA 3BPNC 1FG2A 2XPYA 3FU5A 3RIFF 4LCCC 3SGKC 3MYZA 2XETA 3GSXB 1MKFA 4L4TD 1JYVA 3SKMA 3UGXA 4A68A 1JWUB 2X4UA 2LFEA 3QVAA 1TKWB 2F2HA 3QGVA 4UTBL 2XRAL 1W72A 2WWKT 2YA1A 1CFTB 2G60L 1TFHA 3INOA 4KROC 4WHYH 3PGDA 5DVNA 1JZ6A 2EEDA 5A2IH 3GNML 3QG6A 1NAKL 4PJIE 4QHKJ 3MLWL 2COVD 3LNFA 1E40A 1KEGH 2VERN 2YD7A 3O3EB 2VE6B 1UG9A 4NBXB 1KLFB 2FEJA 3MX0A 3VO0A 4BXSV 2CZNA 1BEYL 1MFBH 1XH3B 4R4FH 1H3PL 3VGFA 5BOJA 2J8UB 5IVXF 4QRUA 1U8LB 2VZOA 3IGFA 5MEPB 1V7NL 3MRCB 2XBZA 1RUMH 2MQ0A 3SB3A 4KPHH 5ETUA 5F1KC 1NFIA 4LBEA 1MCRA 5GJSL 4D8PA 4OY9A 2Z31B 1MJ7H 3U48A 1UXWA 4R4BB 3O81A 1KTLA 1MCHA 1QATA 3O6FC 2ZKMX 3P4NA 3G5VB 3LQAC 3AG4B 3VXSB 4F2FA 5IMMB 4BDVA 3FOLA 2AJ3A 1CLZH 5EIIG 4XCFL 1DDHB 4FXGC 5H94A 5ECJE 2R4SL 1J9SA 3BDXA 3PWJA 1UWYA 2Q0ZX 2OS7A 4XC1H 1DVZA 2G9KA 5J11B 1JI2A 2H45A 1A9BA 3MNZA 5IFHH 4FA6A 4XPGH 3DSFL 2QTVA 3LN4B 2XN1A 4NPKA 4NS0A 1U4EA 3Q5YA 3FS9A 3CU7A 5BV7L 4G7SB 4QYOB 3IWVA 4HWNA 2X9XA 5C6WH 3KBFA 3JWOC 4ODUA 2YIHA 5DGQA 2WWOA 1INEL 2D8KA 2ZXDA 1SVZA 3MFGB 4FG6D 5TPWH 4XNUH 4CC4C 2ZPKH 1MZYA 5T5FA 3X3GL 3V5HA 1CLCA 3Q1EA 3VG9C 4B7IA 1QSED 3CBRA 1NGPL 1UZ8B 4ZMTA 3OQ3B 4R3SA 2NR6C 3IB4A 3CE1A 5AAPA 1BMGA 3OPZH 4J1UA 3LN9A 1SXCA 1RULL 4JHWL 3K4AA 4NI3A 3T1FA 4Z7WA 3KWVA 5HDBE 2EVJA 2VDOB 1Z9SA 2IOOA 4HJTA 4HUUB 2Z4QB 3L8QA 4I18C 1CE6A 5EIIB 2A2QT 1C7SA 1OGAE 2FIKB 3KXFE 3AS1A 1H6UA 4AJYV 1T3FA 3KM1A 3QZBA 3T8XA 2EZ0C 25C8L 1ZOXA 5EEVA 3EOAA 1X5AA 4JY5L 3ZE1B 3P0VL 2OZ4A 4GQRA 3T71A 1TQBC 4BZ2A 1AMXA 3CFKB 4NO5B 4AZUA 1PZBA 3W2DH 1D6VL 3WY4A 5HI4D 1P5VA 4H1LA 5DZ9A 2ZWNA 4P07A 1ZXQA 1M4KA 3QUHA 2C1PA 2P8MA 5C0GA 3C2AH 3OJVC 2VN4A 4NP4H 2FECL 4NN6B 1B0RA 2XG5A 3WSQH 2WINA 5I1JL 2HFEB 3I50L 3ULSA 2R4RH 4LL9A 2DKSA 1S7RA 4ZDHA 5KSAB 3QEGH 1KZYA 4LSRH 3KLKA 3Q1SL 3WNOA 4KITB 5CUSH 4FMKA 4NDMA 5BNXD 1C8QA 3EJYD 1HDMB 2HVJB 3UC2A 5D7EA 4L2LA 4PS8A 2G9HB 2EYRB 5T3XD 3DJRA 4LPUA 1J48A 3AREC 2UWEA 4LU5H 1FJ1A 6FABL 1DVYA 2DJUA 4YSEA 5F9DC 3COOA 2AJXL 4HZLA 4I7ZC 4E5XA 4WJ5A 2ESVD 3OKKB 1CFQB 2E7CA 4X7SL 5FHBL 3V0JA 5C7ZA 4ONHB 1ZLEA 3OC8A 4KXDA 2FR4A 1WTLA 3TH4T 5EV7A 1Q9WA 5D2LA 4JHAL 4IRJB 5DI8B 2XIIA 1TZOA 2WY3B 3ARTA 4RGNB 4IRSB 1NTDA 1U8IB 5F1IB 4L9LB 4ZAKB 5C92A 1LM8V 1DTUA 4JUTA 5GS0D 3Q2WA 3EDKA 3K6DA 3PGCB 5EO1B 3SKJH 3S9DB 5F9AC 5F3BB 1SN2A 4RZCB 4FFZL 2X2YA 2K3TA 5G2NA 2UZPA 2MPAH 5IQ7H 4L4VE 5HGHA 1OTTC 1D3CA 1A7PL 4LOUC 5EBLB 3AZUA 4P3WA 4CVZB 4MJ5A 1RD6A 5HHNB 2GSGA 3D12B 1QBML 4NQDB 4EI5B 1OD7A 1FAKT 5IP4A 3T6QC 3MJ8B 4Z18A 4Y4KD 1DUYA 2QVFB 4WJKB 2V3DA 3UBGA 4KK5D 3KL3A 4FA8A 1E7VA 4RLDA 4NQCE 4X6CB 3ZDXE 2IJ0C 5C9KA 5BW7C 4O02H 3KPQB 4DOHB 2FBJL 4YXHH 3Q06A 3QUYC 4XAKD 2EDJA 2LU3A 4CGTA 3TTYA 4D8OA 4JRYE 3V7AE 2YD6A 2DI8A 3OX8B 2F19H 4LASH 1SLXA 4MWFA 4RMBA 1I8IA 4OAWA 4YSPA 5F71A 2UZXA 1BHGA 3KPSD 3GS7A 3QUXD 5DRZA 2XOTA 3WFDL 3V0IA 3LKOA 3CV5A 1BFTA 3D3VA 3SKOA 5AWNH 4HKJA 5B1JC 1DBKH 3WD5L 2JKTM 1LO3H 3BYYA 2X0WA 1KG0A 4AGOA 1QZ1A 1IMHC 1MCWW 4F3FA 3L6FB 3FT1A 3U36A 4O2CA 4PJCE 1KEML 3BE1H 2C3XA 3BIKB 1MQ8A 4ZUVB 2MSPA 3CCHB 2V5RA 1FNEB 2AQNA 4WEUD 5B4MD 3SCMB 1L9PA 4Z7UF 2B4CL 3B5HA 4KXAA 5LUMA 5DHVH 1B4JL 2GK0B 3QZWB 1RZIB 1RUAL 1GY2A 1U8KA 1V3MA 2W0FA 3ZR5A 1AZZC 4R7NB 1VAHA 1WZLA 3RRQA 1HIMH 5T3ZE 1IEAB 1ERNA 1TEFA 2C7UA 5E2WL 1BECA 3ZGHA 4OT1L 1XMEB 1W0VA 5I8CA 4N6RB 2IOMA 3D0VA 4OZIA 1UEYA 2N4IA 1KJVA 3RDTB 4ZFZA 4XO8A 5HHOB 4P9HL 1J18A 4FE9A 4PJXB 4R8WH 3V0WH 4Q97A 2WBKA 3VRIB 2WIIB 4F58H 4BQBA 5CJQH 1A22B 3O9WA 2WNGA 3GBNH 1MIEL 4G8EB 1MHCA 3GT6A 1S5IL 2ZONA 4IOSD 3AADB 2O6FA 4K15A 3TM6A 3INUH 4BUHA 4L3AA 3BZEB 4L8BB 1BVZA 2X0UA 5KYNA 1HEJC 1D5RA 2ATKA 5KS9B 1BMZA 1SQ2N 4P4KA 2RB8A 5CILH 2YLKA 1S7SB 1JWSB 2OMUA 3DVNA 4BHUI 5JPMC 4WY7L 2I7SA 3ORJA 1FVDA 3F58L 1MI5A 4K2UH 1FGVH 3F7KA 3BP7B 1ORSB 4LSUH 5C2BH 1CTNA 1MAKA 3ETBJ 3MZTA 1OGPA 1J5HA 1EO8H 1NBVH 1VADA 1QX1A 1TVDA 4LLAA 5D2NB 4EIUA 2J5LC 4QTFA 4AUYA 5F9JB 3BAJA 3VI3B 5DSCB 2B8OT 4HH8A 1HYRC 2KZWA 2J5WA 1FP5A 4MRBA 5D5MA 1NKGA 2D3VA 5FYKH 3KPLB 5I8OL 4AL8L 3Q01A 1F97A 2C9XA 4MS8D 1KOAA 4P2OA 1OSPH 5LXVA 4QXUH 1A6VH 3LRSA 3P4LA 2EDEA 2F18A 3ULUD 2RH0A 1KFGA 2O6DA 3BHBB 3G04A 4OV5A 1NCTA 1NGYA 4ELMA 2EAEA 5DUMH 4RNRB 1BG9A 2AQPA 3TBSB 3F64A 3W38A 5ACZA 1OVZA 1Y1UA 3NJXA 3U7AA 5KYUB 5FUCE 4E41E 1ACYH 2NY1C 1CWVA 2QLYA 2BY1A 3FTGA 5ITBH 3MRFA 1NPNA 4NAQA 3UTTE 1DUZB 2LLGA 5BVPH 2J8UE 2GFBB 2ITDB 5CGYC 4P2RD 2F7RA 2GUYA 4NQVA 5D7SH 3TA3C 3Q6FB 1MCIA 1W91A 3BDBA 3L4VA 3LZRA 3GSNB 3MXVH 1JE6A 3CFDB 1JTTA 3GMPB 2HN7B 1WCBB 2H4EA 1IE4A 1SHSA 4G7VL 1K8DA 2W38A 2FE0A 1X5XA 1E28A 3F7PC 1BZ8A 3LKQB 3PQYA 4LCVA 4YDKH 4U1NA 4YJZL 2IGFH 5JIPA 2ITCA 1B4LA 3ZKND 5FO9B 1R3JB 4AK2A 2EKSB 2RTTA 4ZMNA 4OUUB 2HT2C 1UYWH 4HMDA 3OV6A 1HCZA 5BQ7A 2YKLH 4ODXA 4PJDA 3D87B 4MA7L 4DQOH 4KK8C 3WJJC 2IAMA 4XPBH 1XF2B 1OE2A 2OV0A 3PL6B 4QRAA 4OZHB 1EVTC 2WXGA 2DH3A 5HVGB 3BQVA 4TVPD 3UC0L 4WGKA 3NDYE 2W0PA 3G6JE 3G6AB 1E5AA 4RZKA 2W92A 1WIPA 3RTQA 4XP5H 1BVNP 3RA7L 2XVGA 5ID1B 3V5KA 4KKCD 4Z3TA 2VTFA 4F24A 5GZNC 1N4XH 4MD4A 3N1PC 4DZBA 5JLZA 2WYTA 1CBVH 2P8PA 5HVHB 5FO2A 4F37K 4P9ML 2YQGA 4U33A 2NPLX 1J9QA 4DO4A 5C0NC 3BUIA 1TETH 2B9BA 1BD2A 1WH0A 4GNKB 5C0DA 1BF8A 2IDSA 2Y24A 3OMIB 3H3BC 5AAWC 1UJ3C 3N1QC 3V9CA 3MV8B 5AZUA 1S7WA 3DRTA 2WQWA 3THML 3KJ4B 2K9FB 3PWPA 3QDAA 1FBIH 3HS0B 1XR8B 3LVTA 4PRBA 4OH2A 3TT1H 1RJYA 5EU5B 5JDSA 3OR7B 2BOCB 2Y36L 4L29B 1PLGH 2UY6B 3M86A 4H5SA 1P5UB 1ZLSH 3QEHB 3TO2A 3MLSH 4KNTA 4NT6B 1KB9J 3DX8A 4K7PH 1YMHB 3ZE1E 3KYMB 1KF9B 5E08L 3O6ML 1EA9C 2AABH 3LNDA 3S6CA 2PYFB 3SDYL 2I9TB 2AVFA 3KNBA 4JY4A 4XCNB 3DYPA 3AG3B 4E9QA 3R1GH 4J3OD 4MAYA 3FPYA 2YJQA 3ZMRA 3EUUA 1XGUA 4B5EA 2JI2A 1X5ZA 3AFLA 4ADIA 1U92B 3ECQA 1I7UA 1FYHB 5IBUG 1L0YA 4CDGC 3LN5A 4F7KA 1BOYA 1FL6B 2DM7A 4GXUN 4LDCA 3QULA 3BPLC 3APMA 4K9JA 4PJIF 4P5TB 1WAEA 1VGEH 1W0YT 3MUHL 4NZTH 4DP8X 1VKXB 3GMQA 1CZ8L 3IJYA 1GXEA 1CL7I 3ZHKA 2ZUUA 4MMZA 1RVFH 4QF1A 4HWEL 2D03H 5GGRB 2IVFC 2OJZH 3FT0A 1HOCB 1W6LA 4FNPA 4LGPB 3I6LD 2YD4A 3FONB 5IW3A 3MOBL 3MV01 4PJEB 3SY0B 2A74A 3WJMA 1T0PB 3LS4H 4L8SA 1JN6B 2JLPA 2NY6C 2ADGB 1W0WA 4QXGH 3P69A 4ZQKB 1NEZG 3FJTA 3T0ED 3IXAB 4XC3L 5CHNA 3T09A 1HEZB 1V3JA 1D2OA 3K2UL 4M7KL 5DUBB 1FZJB 4DT2A 3NCYS 3NA9H 2G5RA 5F7WC 5FO8A 4EO5A 3E3QC 4N0UA 1SDAB 2WXOA 2MHAB 2Y5EA 3FT4A 3DA0A 1TEGA 5DS2A 3B9DA 4CVXA 3IJ7A 3H0TB 2DYPB 3R0MA 3N42F 4RGOH 3H3PH 3QCUL 1AXTH 2IC2A 4UWQB 3RVWC 2GJZA 1TQSA 5IIEB 1IFRA 4CSTA 2DM4A 2IH3B 1RJLB 5FHAL 2VC2L 5ISZD 4X80H 2VM9A 3UG3A 4JN1L 4P2CG 1U3HA 1I8UA 2ED9A 2HFFA 4LEEA 2WQVA 4HHAB 2FEEL 5A3IC 5AW7B 4EIZC 2WN2A 1H15A 4WCYH 3T0AA 3ZTEA 3VXUD 3SDAD 4POZD 2PCFA 4ZMPA 5B38G 3DSNA 3U9UB 2BVOA 2MOGA 3HG0A 2EDQA 5JW3L 1AHWA 5GGSB 1PZAA 1K72A 1CXLA 3VWJA 4BWUA 1I8LC 5ALCH 3HPLA 3AXHA 5HDBF 1AY1L 5L0QB 1PQZA 1Q90A 2Q6WA 5CJOH 4F92B 3V6FA 2VSCA 1NBYA 4Y19D 3C5ZD 1NCHA 3OSVA 4RAVB 5GXBB 4X5XB 4BA8A 4LAQH 4WUUA 4RGMC 3BJLA 3MRQB 1MLCB 1NCBL 1JFQH 1RPQA 2V6HA 3KJ6H 3ZYJA 3ES6A 5E8EB 4FC3E 5C0RH 3EYSH 4XNZB 3SE4C 3C6LB 1J5OL 2VDLL 1S3KH 4ZT1A 5BV7B 1D5MB 1AGBB 4NZRL 2BOLA 4NIYE 5A2BA 4GG6E 3S3SA 4MNQB 1HXMA 2WLYA 3RWJA 3CN1A 4DUXA 3WNPA 1MJUL 3UP1A 4PTTB 4I8DA 1JHLH 4QJ5B 3FCSB 1BAGA 3BW9B 4TQ8A 1TQWA 2IBGA 4R26H 1Q9KA 3QRGH 1E4XH 4Z7NE 1SF5A 2EICA 5E0QA 1NAML 3L7EB 3T0DA 4MTMA 5F9OL 2BPBA 3AAZA 2XBDA 3H85A 4QRRD 5JIMA 3FQWA 4N2MA 4AM0Q 5GZOC 5DFVD 1E4KC 1H8SA 1AYRA 1D5XB 4HALA 4BSWA 5D55A 1S7XA 1ZAGA 3D18A 5DVKA 4F2ME 1CGYA 1PFOA 4ZK8A 1CD8A 3KGSA 1MOEA 1CUOA 4U1HB 3F2LA 3KCPB 3SOBL 15C8H 2CLZA 1KCVH 2E47A 1OTSD 5ES4B 4XXCA 3WN5C 2C9UA 2E0PA 3HW7A 4H88L 5ESVA 2JQZA 2DOCA 3LDBB 5BO1L 2ZSVB 1LE9B 1N6QL 3HMWL 1MAML 3N43B 5GS2D 2UZIH 2VITA 2WHVA 3SBRA 3TZVC 3B8SA 3OJMB 2GTWA 1I1FA 3WS6A 5FUZH 4EQ3A 3ASNB 1MFVA 2LU5A 1FORH 3MMEA 3QPKA 4NKDA 3V4PH 4BFGA 3HBQA 3QFJA 1EAPB 4ONGH 5C0EA 3FUIA 4ZPVA 3MLUH 5BRZD 3VH8G 1OOWA 4R97C 4WV1B 3T3PE 1NL0H 2C4XA 3EO1A 3MVSA 3RURA 3MI6A 1XCTA 1ULVA 2FEDC 1Z1WA 3ETSA 3LKNA 4GXUM 1HH6A 5I66B 4PGEA 4CADA 4BFKA 4WK0B 4IJ3C 5DHMC 5DHEA 1B2YA 1YPZE 1ETB1 1F1GA 2QQKL 1PX8A 3HRZB 4MBOA 2WXNA 5C08E 1MNUH 3SJVA 4HFWA 4H8WH 4O51A 3I2CH 5JHAA 4XMPH 3OWEA 2HX9A 1O7DC 3QZNA 3ZDXF 2EVFA 3ZTJG 3S5LA 1PY9A 5AZ2L 2VXTL 2EZ0D 1INQA 1QR1A 1CL7L 1MVUA 3RVUD 3IDGA 2BS9A 1QG3A 5JOFB 5BO0D 3IMRA 4QO1A 2K6ZA 2MOQA 4YZFE 4QY8B 1Q0YL 1NBQA 2BP8A 2ZP8A 2V3FA 2AQ2A 3BEWA 3OAZK 3VQMA 1VACB 4UMGA 5F7BA 2YHGA 4DTGL 1ZV9A 2FX8L 1GS8A 3BD5A 3G5YA 4ZFQA 5IESL 2RAMA 4G42B 1E5UI 3FMGH 2XFGB 2EIMB 2X2UA 2BHFA 1JMZA 3IBEA 5I6PA 4GLRH 4HCRL 2WCGA 3CPLA 4WW2B 1J1PL 4PJCF 2ATPA 2IXQB 1MEXL 1NANI 4HPYH 1ZSDA 2X89A 3BH9B 4LLWB 5TF1H 3KW7A 5AW1B 3OKLB 4OFDA 1EXUA 4OFQA 5MENA 5EU6B 2E3VA 3REWB 1JP5A 5JOPE 4YHPB 5FKAB 5JDJA 1XIWC 1MCBA 1PNDA 3MBXL 3QA3B 4IKKA 2AJVH 4JPWL 4HIIA 5G4MA 1R0AL 1Y07A 3FHAA 5H8DA 2LGNA 4U7KA 5HHME 3C75A 3KL0A 1LGVA 4XWOD 4RSYA 1QFPA 4N68A 5D6DC 2O30A 3KDMA 1KCUL 4AEIL 2OX5A 4L05A 3ELQA 1EZVX 3DYOA 5B8CA 4I0PB 3MLTA 1TJMA 3ARBB 1RFDH 1S7TA 2AK1H 1JF5A 2CR3A 1QWHA 1Q9LB 3FUJA 1O9WA 3B9KB 2NDFA 4MMYB 3MRMB 4M6NH 4P99A 4LEXH 4JO4L 2VDRH 2PWDA 2D7NA 4AQAB 2Q8AH 3RDJA 4W9LC 3H9HB 4KZDH 1E5ZA 4Z3IA 1TZHB 2C9PA 3FTWA 2FLRT 3VYOA 1F45A 5BS0E 5JXEA 4U1GC 5CD5D 2P5EB 1SLUA 2ICEB 3OTTA 4HS6B 4DEPC 3QORC 1RURH 3CHQA 3CLFH 3GXDA 5DMIH 1PG7W 2YSTA 1PF3A 5F0JB 1A7BA 1OP3K 1IB5A 1K4CA 5TE6L 4XAWL 1DQIA 4BFEA 4CW1B 2J1KA 3F7RA 3QEUA 1KJ2L 5E1AB 3BAXA 3EYUL 4UM8A 4OZFA 2CUAA 5CJ8A 5F3HA 4MBRA 1K5NB 4ODWA 4LCWE 5GISL 4MX7A 3RX5A 1Y6MR 3GIZL 1CBJA 3QUYD 3C9NB 4PSPA 5T1MA 4DCQA 2XZCH 3C6EA 4HS8L 4KDTC 1P9MC 2APWA 3VXTA 2OMXA 3VFOA 2Q86A 2BNUB 4FLOA 4FG0A 4BQ8A 1EHLL 2ZJSH 4JPKH 5E6IA 2A1WH 3UPRB 5SX5H 3QQDB 4WNJA 3H7LA 2KZ1B 1IVLA 4N8VB 2XTJB 3M88A 4X5RA 3MNWA 3ERXA 2HTKD 1XB3A 2QVIA 4B3VA 1G6RA 5TDOB 5KBPA 4OFVA 3HE7A 1JPSL 5I73C 2OMYB 3VYPA 3PXHA 2A6KB 2RGSA 3SDDA 5EN3A 4X98A 2DIBA 2JCCE 4I1PA 1JNJA 3T65A 1P4IH 3H2WA 2V5SA 4WFED 4PJEE 2NTFA 4M3HA 5IFJA 2DBLH 3VI4F 5D8JL 1R17A 4PV1C 1TO5A 1H8OA 5GGTA 1IJ9A 3HZKA 1QFWI 4OCRH 4KJWC 4N1HB 3S88H 1YEFL 3U1QA 4A2EA 4S10A 3VSUA 1U8OB 1TSHA 4EN3A 1XH3A 5IJVB 4LDEB 4E9TA 4BIKA 1A25A 4KX8A 3CZNA 2XU9A 3ZL4L 4LSPH 2E8YA 4XX1E 3W1ZA 3WNLA 3LSOA 4ONOA 4H8VA 4WWID 1VGKA 1FNHA 4BKTC 1YMMD 2VGLM 2Z31A 3FT2B 1MCJA 5E9NA 5IJKC 3KBPA 3G6JF 2R0ZL 3H8NA 3RFZB 4EXPX 1N18A 4JFYA 3BSGA 2QKIB 1JSYA 4HWZB 4UU9B 3VXSA 3CK0H 5IMMA 3RL1B 1SUHA 2ZT9C 1V7MH 3DUHA 2YPLB 4Y1AB 3X1FA 1TO4A 2Y6TE 3A6BL 3CTTA 1HXYA 2XDHA 4KTEH 3WUWB 3F5WB 2BDNH 3Q0HA 1XF5B 1YYCA 3QW9A 1ZA6B 1QRKA 3MR9B 4BKLA 5HDQH 5D1XC 4JR9L 1EJOL 1G4MA 2LTQC 3PP4H 3QYCA 1ILSA 3S2AA 4ISVA 4TLKA 3HZVB 1MPAH 1OW0A 4JE4B 3O9WD 3LN4A 1QR4A 3ECBB 3BH8A 2X7LB 2YR3A 5TQ2L 3DWTA 4LQ1A 4OKVB 4LPCA 2IWKA 4B53A 2AC0A 3N40P 3RJDA 3DV6B 3FUNA 3VCLA 2FNWA 3DI3B 3DXAA 3DETC 1KTRL 4FNSA 4DKFH 5CKAA 3ENEA 5I24A 1FO0A 4XR8C 1NFDE 3MRJB 2Z9TA 3WKMH 1KELL 2X4TB 3JVGA 4WWKB 4XN2A 3E38A 3STBA 1DBAL 2E6PA 4FQ2L 1YEKH 1LMKA 1W80A 2NZ9C 4JVWA 1L9QA 4L3FA 4ECNA 4Y5XA 4KZEH 1K2DA 5DT1L 3MOAH 2XG4B 4XZ4A 2AXJA 5HHPA 4TULH 1QBLH 2BZ7A 2NY1D 1YEHL 2HVBA 4U1JA 5BPPA 2GYSA 4GB9A 4R5XA 4ZOBA 3SDXE 3A5VA 1WEJL 5EIIA 3C08H 3JQOB 3OZLA 5ADPL 2VR9A 4PRHB 3TA3D 2O5XH 1L5GB 5A7EA 1FE8H 3HI6H 1SXBA 1EEZA 2YEZA 4GUQA 4NC1C 5AVZB 1EH9A 1VZGA 2JVUA 2P44B 1QKZH 1MW1A 5LN4A 4CSSA 4URKA 3QP3A 3L5JA 1YN6A 2JQAA 1WCQA 2HT2D 4YEEA 2WZPA 2XQBL 3CBJB 4H1LH 2FL5B 2FJGA 4KI1A 1PG7X 1RIUL 2HFEA 5A1AA 3EBHA 2WUCL 1N5AA 1S4IA 2B1OA 1KEGL 2NXZB 1WWWX 3OLDA 3UYRH 3TPKA 4DGVL 5B3JE 3NH7L 5CFAA 4XO9A 3VXRB 1EUUA 3X11B 1F13A 4TSCL 2IV9A 3QUML 2VDPL 1MFEH 1S9XA 2R23B 4HWUA 5FKPA 4KTGA 3CX5K 2G9HA 3PQYD 5J3HD 5E8OB 4KPHL 1XTLA 4AC2A 3DPBB 4AGQA 5HD8C 3FDWA 2WVUA 5F9WB 5C0ND 1NBZB 1MJ7L 3CN2A 3PJSB 3O6LL 1ETA1 3PNRB 4NRZB 4AUUA 2GITA 4C59B 2YLHA 3KPRB 3ZXAC 5KWYC 3P77B 2JIXA 4K3EH 4OM0L 4ZUUB 2X12A 1XGPA 4JM0A 2GUOA 3V4VA 3EO0A 1WFUA 4UQAA 3NT0A 4NNXA 5FFGA 4BWWA 4IKIA 4I48B 1KMGA 2JB5L 3B9AA 1KYUA 4RIRB 1U8IA 1OPOA 4NSKB 5J5EA 1Y6KR 3RTQD 2Y07L 3CXDL 3UFIA 4G71B 5EO1A 4L3EA 4WHTB 3PGFH 4B50A 4KXZH 1XHHA 3VVVA 4RZCA 1WWAX 1BZ7B 1I7ZA 2X70B 4DHLA 4FQQB 4FTVB 4HT1L 3BKML 3HBGA 3O8XC 4GQ9L 5IHHA 2SODB 5T5NF 1BGXL 1RZQA 3KPNA 3EOTL 4FQXB 3EAKA 3BWZA 4CVZA 4IIQC 4B9ZA 2L3BA 3N1FC 3P9LA 2DQGH 4IBYA 4NKOA 4RAHA 4ABUA 1NDMB 1HINH 2MNJB 4XI5D 4XNUL 4CBZA 4Y4HC 2VLKE 3GKWH 5ERWA 3RBSA 1FL3A 3D4CA 4PGBB 1YY9C 2EEFA 2I24N 1K85A 3ARGC 1LILA 2WTRB 1XZ0B 2OPCA 1XR9A 1QFWL 3MGTA 5F7FA 2K4AA 3PWPD 2P24A 5H2BB 3OPZL 1ZGLM 4PRDB 3L7FB 4XMWA 1P7BA 1QASA 4FL4B 5DD1L 1DEEA 2IV8A 4OCWH 3RUGA 1KFAL 1E27A 3QHFH 3C12A 3TONA 2VC2B 4GG6F 3EH1A 5EU6E 1BWMA 4OGAC 5HGBB 5E4EC 2X6CA 1FC1A 2ETWA 5CN3A 1G9EA 4IBTA 5FA3B 2VZTA 2V2XA 1NZRA 2Y7QB 3GBMH 3V7AG 3US1A 3IRPX 4DAGH 4JPVH 3BRFA 4JQIA 4BGDA 1FNSH 1I9RL 3HEIB 1N7ML 3QDJE 3P3YA 3U82B 4GAJL 4G6FB 2PW2A 3UCRA 3FBQA 4Z7NF 2BNRE 4NM8H 4L8DB 3CHSA 2XSKA 5EIVA 3WNMA 1DQLL 3AROA 4OLUH 2Z6FA 1D5ZA 2MOVA 3EHBD 4NP4L 2AXFB 1AP2B 2WIMA 3JT2A 3HN5A 3HE6A 1IC4H 1HKLH 1FFRA 2VLJB 3CZLA 1MREH 4LSRL 5KZCB 4JG5A 3IJHB 3UBXI 4WSGA 2AI0L 2AJYL 4NUJA 2H32A 2DY2A 1CICA 3U2SA 5AAMA 3FO2A 2VDLB 4IRZL 1MFDH 5EZJB 3RVWD 2HRGA 2YAFA 2Z8SA 1AJ7H 2VIRA 3CDZB 3FO1B 3HHSB 3VRIA 2WIIA 4FI7A 5CNHA 2GTZA 5DJ2B 4H8QA 4H8WC 5D7IF 3T2QA 1IAOA 1U8QA 1GGIL 2IH8A 3U83A 4XPHH 1FVCA 4UQ3A 5EZLB 4PB9L 1F4XH 4PU2A 2F53A 4Z7VB 4PS3A 4U3SA 4D0BB 1WJ3A 4JFFA 1YUKB 2OSLB 4FNUA 3FN0H 4JKKA 3G6DH 4PFEA 2EXYC 5DJ6B 3VYNA 3TVMB 3GHEL 1GOFA 4L8BA 5I26A 2X4NB 3T3PF 3BO8B 3DX0A 4MD0A 4ZD3H 3UIYA 2EIJB 3UJTH 2AITA 3CVIH 1GS7A 1NAMB 4KNUA 3TBCA 4AW7A 3BWAA 2UXGA 3VXMA 1YPZF 1DBJL 4QCIA 2IH9A 4OLZH 1ORSA 4PQXA 2W60A 3B9VA 1BG1A 3NEEA 3MRBA 3I85A 3FQ1A 2MPAL 3II1A 3NSFA 3WXWH 1X9QA 1XMWA 4TNWK 3W9EA 3E8VA 5DF0A 5J06A 4YZFF 2CO6B 3KPLA 4WO4C 5GJTH 5IB1A 3CXHJ 3BEVB 4F33B 3V8OA 1W8OA 3CVBA 5I1EL 3C5JB 4UT6L 1OF2B 1RUQH 1KJ3H 2J2ZA 2A9BA 4RAUA 1DN0A 2C3HA 3VWJD 2OSXA 5KYWB 1U30A 2K1MA 1R5VB 1KENH 5E00B 4QXVA 3W0WB 4KUCD 3ULVL 4YXHL 2Z8WC 1QTPA 3GTVA 2YD1A 3I6KA 5CEZL 3MRPA 3Q6GL 2EH8H 3FB5A 5I1DA 3JWNG 3TO4C 2IPKB 1NDTA 4MA1C 3AITA 3QISA 5FW8A 4WUUD 4A38A 4JREC 4ZMWA 1M71A 3KE0A 5DWUH 3JTTB 2DQFA 3M1CA 1KGCD 3JWDH 3M8OL 4IS6B 5DEGA 5AWNL 5B7EA 5GZOD 5CZVH 3UO8B 2W80C 2QMKA 2MIZA 2Z4TA 3RX9A 1PZ5A 1NMCC 3GSWA 1H6TA 1SOKA 2QADC 1FPTH 3WS3B 1WCBA 3AS2A 3DJ9A 2F74A 3H7BA 1R24B 5HYJE 4EUPB 5GRVK 1UM6L 4MMXC 4HS3A 2G3ZA 2V2WA 4OUUA 3QXVA 5LO7A 1G9NH 2DAVA 3FYEB 3REVA 1U8NA 3TN0A 4EDWH 5FYJE 3ARQA 4MNHB 1A6AA 1GZQB 3D7PA 1E2ZA 5IM7B 3VWKC 3IGUA 1CU4H 4JKWA 3BYTA 2YAQA 4OIBA 1YG9A 1MCKA 4L1SA 4HDIA 4H2CA 4R8WL 2ZE0A 3NJKA 2AQSA 5D1ZA 4IDJL 3UDWA 3ZJAA 1KPRB 1EEYA 1VZIA 4JGNA 4FCHA 1G7MA 2YAHA 2YZ8A 3LD8C 4OQTH 4MNGA 4JKPL 2WMPB 4P57B 5I5JA 1CPUA 2AK4A 2W9EH 3AMLA 4GRWB 4MKMA 4XMLH 1AIFB 1YQVL 3TURA 4WU7B 1AXSA 1D9KB 3FC8A 2VZ1A 3L9RA 2H9GB 1TENA 4UDTA 3QIUC 1BVKB 1MFUA 1SMAA 3QFJD 1FGVL 4QIRA 4HG4J 2VLRB 3RWHB 1JYWA 1QSFE 4P49A 5EU5A 5GRVL 4N3UA 3QEQA 1RPKA 2CJUL 3LPFA 5F2FA 1NBVL 4LVOC 1CFMA 4M9PA 3IK2A 1GGBL 3QQ4B 4QYAA 3B7YA 3PREA 4WENB 4M62L 3MV9B 4Y8AA 3U9WA 4AYSA 2EIDA 5FYKL 1IAIL 1PZDA 5ICXA 4NQSB 5KJ4A 1C5CH 3NPSB 2WLNA 5LBSH 5D7LA 1JHTA 5IVXA 2PYFA 2I9TA 3VXQB 1ES0B 1HZKA 1UM4H 5BXFA 3ABZA 2V2TA 4QXUL 4FI6A 1KYOJ 2XXGA 2GTQA 5I1AB 2JCCF 5I1LA 2P47B 1ED3A 5HJGA 1XIWD 5DJDA 3ZTCC 1KJ2B 4PV8A 3I75B 3P9MB 1OPGH 2XXCB 1AGEB 3JZ7A 4TRPH 2CDFB 1KGXA 1UFGA 3NZ8B 4L1TA 5ITBL 3LNEA 4X6BA 4M8QA 3VXRE 1C7TA 2DWDB 4GXVL 4Z95L 5C0BA 5DZVA 5BVPL 1YYML 2BRQA 4ETYA 4JZOA 4MQ7B 4P8QA 1SM3L 3OLIA 4K94L 3AY4C 1JIBA 1NDGA 1NCUA 1AFVH 1A7QH 4MJJA 2BSSA 2X89D 5K9KA 1H5BB 3U46A 4YIQA 5J6HB 1CIDA 1G7HB 1GTNA 1JN6A 3H54A 4MXQD 1R6VA 2X2JA 3MRNB 4KC3B 4OZ4A 1U91B 5PCYA 2R9HD 4PJ6A 1AE6L 4YHYB 3BRDA 1UYWL 1FZJA 4NCDA 3PUCA 5JHDA 2E8ZA 1KLGA 1SHWA 2YEQA 2CKBB 3A4DA 3EYVA 5TK2A 3HHRB 5MP6H 2A77L 4XMKL 2W65A 2J6WA 1DQQB 1HL8A 2DYPA 1U33A 5K1JA 1MF2L 4JB9H 1IIKA 4FTVE 1UD8A 2WLLA 4JJ5B 2V9TA 4XP5L 4YDNA 1BXXA 2HLAB 1EXHA 3GTTA 5JXED 1YEIL 1OL0A 2YSSA 3ISWA 2PWHA 1FUNA 1DDTA 5GS0L 2AV7A 4P23B 3VACA 1CI3M 1UD3A 4PVLA 4LLYA 1NFDF 4N24A 3UAJA 2JCWA 2QL1A 4K8RL 4L37B 1E4JA 4LXFA 1B0GA 1F8TL 1T1ZA 4GBXB 1BIIB 3OZKA 4ZFOB 4M4RB 3MRKA 4J27A 5ESAB 3RNQA 3R06B 4PRNA 3NG5A 4AT6A 2BW5A 3QIBC 1NEZA 1A3QA 2G4EA 3MC0A 4X4YA 4KNQA 1X4YA 3L3KA 3KWWB 2WYIA 4XPAH 3GLAA 5EOCJ 1PLGL 3BSZA 3RWGA 3PFUA 5T5NG 3WE6B 4X5XA 3KHQA 1NWPA 5GRUL 3HG3A 4ZMXA 1I8KA 3VG0H 3VD0A 2H26A 3KPMA 2B59B 2P80D 2BFVL 2D7PA 1YLBB 5E6ID 1MWAA 1M6OA 4QRRE 4NKIL 2VR5A 1N8ZB 4B0MM 1X44A 1G7IA 5E6RB 2ISDA 5F6HJ 3QPXL 5C97A 1UURA 1T22B 3ZHNA 5FFLA 2NW3B 4HSCX 5MERB 3HE7D 2BVTA 4NQEE 1QABA 3WLWD 3E1ZA 4R4NC 4Z1PA 3LZFH 3UEZA 2KYIA 1ANUA 3SDDD 4G72B 3RPKA 5B38A 5L7XH 1VGEL 2BCMA 2M26A 4PW9A 3CDCA 4EIBA 5B3JF 4JFZL 1CD1B 2VN5A 2HFGH 5TGBA 1NSNH 1U0QA 5INCB 1A5FH 4X6DF 4OM1H 4CKQA 1MCQA 3OSKA 5B1KA 1LJMA 4LSTH 4MZRA 3F01A 4UOW1 2AV1B 2KQNA 43C9A 3DGDA 1TTCA 2NTSP 3T08A 4DP1X 4EN3D 5D1XD 2DQEH 4MJ4A 1NKOA 5L6YL 5INDA 3QBTB 2LE9A 3VDBA 1PMYA 5TDNB 1LO4H 5KVEE 3AB0B 3BAEL 1KXVA 4LLUA 3NA9L 3OKEB 3IS0X 3QXDB 4R7DB 4JKMA 2MTPA 2J57A 4P3DB 3DX6B 2FO8A 4XTRD 4UOQA 1AQHA 1TPXC 4AEHL 1SPDA 1LD9A 4LT7A 5HDLA 3KPPB 1VJSA 2VDQL 5DS8A 3MJ6A 1T80A 3FSOA 4E9VA 4MQTB 3D8MA 1RZGB 1ZS8B 4N0CC 3FQRA 4WV1A 1HSBA 4Y9BA 1WBZA 3BWUF 5LNEA 2NZ9D 2IWGA 5HYQB 5HI5C 2KKQA 2BVPB 4FFWC 5AYUH 4XVOA 4F27A 5K1VA 2XQYK 1RUPL 3DTUB 4GRLB 4AYGA 3QNZA 4ELKA 3QUMB 3D0LB 2A0LC 2VDPB 5KYYA 4G8GB 5IROC 1ADQH 1JK8B 2HJLB 1BF2A 4LL4A 1AYOA 4LPYA 1ORQB 3IF1B 3TEYA 1C12A 3SGEH 5GGQL 3SDCA 4JFEA 3DXAD 1DQMH 4P59L 1JZEA 4Z7UA 2ZCKH 5C8JA 3IFOB 3C8HA 2KZKA 3K71B 5ALCL 2V8MA 2ZWSA 5D9SB 4ZSOA 3UJJL 5DD3L 4F9PC 5D4JA 2GSIA 1BDYA 4AMKH 1D5IL 3ULUL 2YS4A 1EMTH 2R69H 3DMMC 5EF2A 4YHZH 4IKLA 4PHZA 3FKUS 1F4WH 4ZXBB 5SX4I 2BZDA 1CGXA 4WI0A 1TMCB 2X2IA 4GS7B 2WBJA 3X12B 1JFQL 4UT9H 4N8CH 3KYKH 1I9IL 2J56A 5KYXB 3DOSA 3EYSL 4W9HC 3ABGA 5E2JA 3K1KC 1XF4B 3FH7A 2APBA 4BFNA 1SXZA 1U2HA 3HCVA 3GLZA 2DTML 3VH8A 5DK0B 3MLRH 3ATDA 4IEFB 4IBVA 2ALWA 5MEOA 1ZDSA 3QQ3A 4MLIA 1M1XB 5I0VA 3BOVA 3QDMA 3ZZSA 5SWZA 3RYMA 4TUUA 4DUWA 2XV0A 4WFFD 2ID5A 3QA3A 4YZWA 5K5YA 1K5WA 2DQHL 3JTSB 1NC2B 1AS7A 4U05A 5HD8D 5K33A 1VLXA 4Y5VB 1KCKA 4HUXA 4F8PA 4APXB 1AMYA 5IQLA 3CZJA 1NIBA 1WWBX 3NYKA 2ZOLB 4GXFA 4U0RB 1JZGA 3B9KA 4JY6A 1YNKL 2CM6A 1T21B 1UOWA 4BWTA 4TVPL 1UVQB 4GRWE 1I75A 3CSYB 3H9HA 1TZHA 1KT2B 1J11A 4U1IB 2H0FA 2WOYA 3BN3B 3MJ9A 4X0KA 3HC0B 4YFLI 3NPZB 5IB3B 1ID2A 3D5OF 1RPUA 5CU9A 3O8XD 4FFYA 2X1PA 4OD2B 1PZSA 3CBKB 3HG1A 2LAGB 1AVAA 3NRFA 3PPSA 1NPJA 2UZIL 5J89A 1TJXA 2EQDA 4A7QA 1UA3A 1ONQA 2R0WH 3HPJB 3LB6D 5DJ0B 5I6KA 3UOAB 2VSDA 1FH5H 1FZKB 2JIXD 1GW0A 1ET7A 2B1HH