3MLUL

Crystal structure of anti-hiv-1 v3 fab 2557 in complex with a zam18 v3 peptide
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
218
Chain Sequence
YLLTQPPSVSVSPGQTASISCSGDKLDDKYVSWYYQRPGQSPVLLMYQDFKRPSGIPERLSGSKSGKTATLTISGTQSLDEGDYYCQAWDASTGVSGGGTKLTVLFGEGTRLTVLAQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light
publication title Conserved structural elements in the V3 crown of HIV-1 gp120.
pubmed doi rcsb
total genus 41
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2010-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mluL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mluL01
3MO1A 1WAAE 2QKIB 2F15A 3IU4H 3WDHA 4ZDHA 2MQ0A 3SE4A 5D2LB 3NFSH 3OL2A 1QLEL 3DIFB 2ZKHH 4HIXL 4HIEA 1TCRB 3RX5A 1S7TB 3BSZL 2DMCA 1IZJA 3SJVE 3MV11 3ZDYF 2EKJA 1T22B 2NYYD 1S7XA 3K4DA 1U8JA 4NN6B 2VQTA 1INQA 3OKLB 3QJFA 4PJ7A 4QLRA 5F7DB 1JMXA 4IBLT 4JM2B 4KK5D 3SCMD 1Y6KR 4X98B 2YPVL 2RHEA 3ARGB 4PJ9B 5DJCA 3CZFB 2NZ9C 1FC2D 1DBKH 3K8KA 3Q2CA 5FGBC 4Z0XB 4HLZH 5FA4A 3ARXA 4ZQKB 2DWEA 1BFOA 4K8RL 3LPGA 1BHGA 5FDWB 1FG2B 4I1NB 4GQPH 3EDJA 3SGKC 3QYCA 4TUOB 4HKJB 1OF2A 5HYSB 1A21A 3N85L 5CUSL 3W5NA 1G9NC 3RZCB 4PLNC 3QCTL 4R4NC 4U1GB 4XGZB 1FQ9C 3U0PB 5JHDE 5D1QD 3WNOA 1DDHA 5D7SH 1KIQA 3CD4A 4DN3L 5H37H 5HXMA 3AU1A 3SKJH 3B9KB 5AYUL 2F5AL 4Y5YA 4W6YB 1KEGH 3V6OA 4NSKA 4X6DF 3D5OF 3S34L 1U36A 4RISL 4OZHF 1N6QL 4R26H 4OQTL 4TTDD 4X6FB 5DGRA 4BQCA 1KFAH 2AEIT 3QDMB 4U1SA 5GSRB 1BEYL 4MA3A 2HFFB 4J3VA 1JGEB 1KCVH 1NDGB 4X7EC 4S1QL 1OP5H 2HT3C 4WNQA 2PTTA 3FQRB 2CXKA 1IBGH 1FZMB 4CVXB 5IB2A 4XT1C 4EN3A 1U58B 5IEHA 4JCLA 5IMOA 4G7VL 3KYMA 2ZJSL 3TO4A 3QA3B 5GPRA 1U8HB 4LPCA 3R0NA 3Q3GA 1UXWB 1GOFA 1SHMA 5TPWL 1DZBA 4OGXL 4TRPL 5FM4A 5GGVL 3FQNA 1V7NL 1QD0A 2WAHA 3MLRH 5JDSA 2ICEB 5EO0A 4UQ3A 5ITBH 3O9WC 1R5VA 1DBBL 1WFTA 3VWJD 1TZIA 1LQSR 1M71A 3FB5A 3ZMRA 4XNXH 3QUKB 5KS9F 3CVHB 3EJYD 5I19L 4O5LH 4HK0B 1PZ5A 3P11L 2BFVL 1QOKA 3MREA 2MCG1 2R2CA 1KC5L 5BS0B 2P5WB 4UT6H 1ZHBB 3BP6B 1H5BC 5FECB 1AC0A 3D69A 3NAAH 4X4YA 4RMRA 4OUUB 2ITCB 3TBYB 4B41A 2B4CC 1OD7A 1MEXL 3V4PL 2XXMB 1CN4A 1HINH 5ESAB 4XVJL 3U0TB 1D9KB 2CJUH 2XFXB 1JL8A 4YDIL 3QZWG 3V0WL 1Q8MA 3V8OA 4XBPB 2P42B 3DVFA 3T0DA 5HHMD 3W39A 4C83B 4U1IA 3GSNA 3DJ9A 3WFDL 5I1EH 1AHWA 4S10A 2VDPL 1VGEH 3T2NH 1PSKL 3MNWB 2X41A 4KKCD 5BW7C 4ODUB 2VXQL 4M7KH 5CCKL 1N59B 2YKLL 3I50L 1Q0YH 1CVSC 1INEL 3TN0D 4UDUB 4M7LT 2P8MB 4IJ3B 4KJQD 4WW2A 4TQEH 5F7WC 3FCTA 3CH1A 3CMOL 2Q6WA 3A6CL 3HUJF 3IDYB 4LEOB 1YNLH 5FUZH 3ZHKA 1JNNH 3C87A 1D5ZB 2APXA 4XP1L 3BZEB 4NQED 4XI5D 1UXSA 4Q74A 3L5XH 3BZDA 4U6XA 4K94H 1F4WH 4L3EE 2LFGA 4K7PH 2YPLB 4N0CD 2JKXA 2NY6C 3TA3B 3CFEB 4AG4H 4Q97A 4JQIL 4R4BB 5GGTL 1JGUH 5LAXA 2E3VA 4S1RL 1AJ7L 3L5JA 3S37X 2IADA 4NNYA 3DSFH 2VISB 3QIWA 3REWA 3TT3L 4BZ1L 4Z76A 1FL3B 3L5WA 1C12A 5ILTL 1KCSL 2XKUA 4NHCH 3VXRB 1C08A 4G8EA 1J12A 1CICD 2B2XL 4Z9KB 1OGAA 3MBXH 3CSPA 3AC0A 4U6VH 1B0GB 5KVDL 2VLRE 1WUNT 4FFZH 4TSCL 1BQHA 1RK0B 3TBSA 1NC4A 2R2EA 1W0YT 4JE4B 1IGTA 3VXSD 3DV4B 2YBRA 3IDXH 1KTLA 2A6DB 5IMMB 1AO7E 3G5ZA 2CUHA 1NBQA 4M03A 4OLZL 1ZANH 1O0VA 2JB6A 1KIRB 4UB0H 4LCCA 1FH5H 4JG0L 4WUUE 2EIDA 3IAQA 3QCUL 5TE4H 3QNYA 1A9EA 1FNEB 3MX0A 4HMCA 4MXQD 3RQ3A 3L3HA 3Q1SH 4OBRA 3ZE1E 1MELA 1MLBA 1IGCH 5KTEH 4K8RD 1RJYB 1NMBH 3TPUA 2EDYA 4J7RA 3OKMB 5CEXA 5IMKB 5J8OA 2ZUQB 4LPWA 4QTIH 1CE6A 5E2TH 4YXHL 2Y9RT 4BQ9A 5HPMA 3THMH 4RRPG 4LRNH 1HH6B 5JQHC 1HXYB 4DK6A 1A7NL 2EDQA 3MOBL 4MD5B 4UV4L 5K9KB 3NPZB 4LBEA 5E6ID 1I9JH 2PW2B 1T3FB 4FFYH 4HUXA 2QJDA 4PREB 5A2LH 3S5LA 5FB8B 1HHJB 5SV3A 5D9SB 1CDUA 2MPAL 3GJFB 1U8QB 4PUBL 4ELMA 3JZ7A 4Y0GA 3IVKB 3RPIB 3HUJB 4PRIA 3N0PB 4F2MA 4UMGA 1NUGA 1TPXB 1L9MA 3RJDA 4LLWA 2BVOA 4KZEH 3BW9B 5EBGA 3FQWA 2F54B 3HA0A 3ZYJA 3WJJA 4EI5D 3VWKA 5D1ZA 4JFPA 2IQAB 4FQHB 4N8PA 1A7BA 1A9BA 4L4JA 4EUPA 1KUMA 5T5NF 1KXQE 1YJDL 4HMDA 4NQUA 2AK4A 2R2BB 2HKHH 2IH3A 2YEZB 3P9MA 5DI8A 4EDWH 5T3ZL 3QPQD 4JJ5B 3ARDB 1NFDE 4WU7A 5E8NA 5J9PA 1K5NA 3STLA 1XEDA 1XIWC 5J4MA 3GK8L 3O8XA 1E6OH 3EYOA 3WE6B 1ETZA 3DYPA 3MV9E 4YFLI 4RFEB 5AAWA 1OHQA 4QYOB 3QPXH 2ATKB 1AQKH 1AFVH 1NDMB 3JTTB 4F37K 5LCVH 4OQ1A 4U7KA 3LSOA 1N6UA 4HWEH 4QRTB 4LSDA 1QNZH 4GRLD 3OZ9H 4LCYA 5D8JH 2GSGA 5EPMA 3S35X 4IMLA 1F4HA 3FO2A 2FATL 3JUYA 4FP8H 4PJFE 3VXUE 2X4RB 1FBIL 3DXAA 1KNOA 4HC1H 2NY0C 4Z7UE 1J0HA 5HYQA 5ICZA 3W11D 1R3KA 4PJCA 2OZ4A 4DGIH 1QFHA 3BISA 1HQ4A 1KULA 4NQDD 5DJ2A 2FO1A 3UTQA 4FTVB 1MHCA 4E41B 3U48A 4LHUB 1ZT4A 4NZRL 5T1MB 4XVTH 1AGCB 5BZDA 5EORL 2QEJA 4EVNB 3GMMA 4H8WC 1N8ZA 3DTXB 3MJ9L 2GITB 3SDXF 1EBAA 2G5BA 3F12A 5EBMB 2P5EA 3TNNB 1QVOB 3DGGA 4XNMA 3CPLB 3IDGB 4TUKL 2BY1A 3QQ9C 1S9VB 2PYFA 1XR9B 4UV7H 1HDMA 3V5HB 3EO0B 1DUZB 2VLKE 2F19H 1XGRA 4AIXA 2O5XH 2C3VA 1TNMA 5C09D 2Z8RA 1YY9C 3WD5L 1GIGL 1OTSD 3B8SA 2X4PB 3OKYA 1X6LA 1GHFL 3QH3A 1C5CL 2WQ8A 5EIQA 3DARA 4L8DA 1LWRA 5IWLC 2VTFA 2OTUB 1MWAH 4KTDH 4WV1C 4EIZC 4GXUM 3DMMC 1KB9K 4MX7B 5I1IL 1CL7I 3VFPA 1BLNA 1I85C 3O9WB 4FHBD 5DD5H 3MRFB 1S78D 4JY4B 1WWAX 1LNUB 1EGJA 3BRFA 5DVMA 3TVMB 3LN4A 2GI7A 2X4NB 4MNQD 3IFLL 4Z7WB 5CSZB 3VFWA 3GGWB 3PHSA 4AH2B 5D93B 2ZCLH 1IEBA 1CK0L 5LWYL 1A1MA 1BJ1J 2OSLA 2HAZA 1TIUA 4QTHB 4JHAH 5SV4A 3P30L 1ES0B 3QXVA 3PWPB 4UINH 5C6TH 3ZLQC 5C86A 4DZ8A 4ONGH 4BYHA 4ZS7H 5F1KC 1MFCH 2A83B 1R3IL 2D0GA 4KK8D 4GAYA 3OGCB 2A74B 4MA1C 4P23B 4QRQA 1B0RB 4H1LH 4EQ2A 1ZA6A 4GKNB 2VL5A 1YEDA 3MUGB 3CUPA 3MLPA 2XN9E 3BGFC 1NFDF 1X5IA 4PR5B 1MHHB 4U1LB 4XP4L 2C26A 1UA6H 3TBTB 2M26A 2RFXB 3U46A 3G6JA 5HDLA 1PVHA 1RD6A 5TJWK 5EIIA 2DM2A 3O4LA 1U92A 4U1KA 5JHLH 5IW6A 5L88L 4JY6B 1X9QA 1HILB 3LRSA 2ZPKH 4K3EL 3QUZD 3CDYA 3SN6N 1P7KA 3MLZH 3V4UL 3WNKA 4PJFF 1Z3GL 4JQXC 4KUCD 3WS6C 2ZOLA 4LNVA 2R1YA 1G9EA 3EHBD 1HKFA 4F7EA 2NY4C 3WIHL 3JWDH 4LVHB 1IAMA 3R4DA 4WWID 5T5FL 2ZSVB 4PG2A 1W0VB 3WSQH 5IROA 1NAMA 4ZTOL 3UTPE 5DMJB 4QF1A 1GSMA 3W5MA 4UUJA 2CXGA 3GZKA 3V6FB 1KB5H 3OBAA 4WCYL 1D6VH 3VFGH 2DIBA 1PEWA 3LY6A 4K71C 5D2NE 4ZFGL 2BZDA 1YQVL 3PGDB 1G0XA 3DVGB 2ICCA 2Z35B 1IVLA 2HN7B 3QRGH 3G08B 3MRNA 3NCJL 5J57B 1RJLB 1M7DA 2X4QA 4F37F 4IIQB 5FYKL 5I8OL 4Y5VB 5E9DB 15C8L 5CGYD 4R8WH 4WTZA 2GKIA 4ZFOA 2YOCA 2RJMA 4YBQD 2VDOL 2IJ0C 2B5IB 2D7TL 2VNCA 3D39D 2ORBL 3VG9C 1I7TA 3T8XA 1U91A 3LHPL 3PNWA 1G9MC 3VH8B 5FYLL 3JUZA 3OXSB 1JPTH 2LAAA 4XP5L 3O2DH 4L3AA 2DWDA 3ARFC 4WFED 3QCVH 2VR5A 3BWAA 4FQPA 4NKOB 3T3PE 3HMXL 1OSPH 5FKPA 3O3BB 2GFBA 4PP2B 1Q9WB 3MV7A 3BZFA 3KWWB 4TTGA 3GJFH 4POZD 4Y16C 1J0ZA 1RVFH 2WWKO 4LEXL 3IJHB 2Z93A 3X3FH 1DJSA 4ZPVB 1A7OL 3IDIB 2PR4L 4HQQH 4HJ0D 1K4CB 3MRMB 3CDFA 3DETD 2Q8AL 1VEMA 3PQYB 4P4KB 1JPSH 3QHZH 4PS4L 5M7QA 3OKEA 1A7PH 5I30L 2NY7H 3RL1A 4YHKL 1R5IB 2G9HA 3CDGA 3I9GL 5L8JB 2A38A 4PGZA 4FOMA 2ESVE 2GAZB 4UTBH 2A73B 1FZKB 4WI8A 2EH8L 3MJ8A 5DXWA 1CE1L 4N0YH 5ALCH 1HEZA 4JFZL 4WHYH 1CFNB 1CR9H 2CK0L 2YPKB 1DQMH 2BHZA 3L3OA 5GISH 4LARH 2KUTA 4QXTB 3U4AA 1YNTB 3CXDL 4D9LH 5CBAB 3GMLA 1FORL 4BH7A 1CXEA 1MF2L 1K9TA 5A3IC 2VABB 35C8L 2F53D 2XWTB 3LKSA 3X14A 5EA0L 1CVRA 4OM1L 4KHXL 3D6GA 4YE4H 3FRPG 1VFBA 3FT3A 3SPVB 1KB9J 2E27H 3OV6A 4MXWH 5AEAA 3UMTA 3K4AA 4KK6D 3M8OH 1Z5LA 1YMHB 3HZKB 4ETYA 2WUCH 3SQBA 2FWOB 4YDLC 5CSBA 1XIWB 2HA1A 4L4VE 1OCWH 4OGYL 3MTRA 2MTPA 5IB5B 3LEYL 1IGJA 2P8LB 4TOYL 5HHPB 4NM8L 1FYTB 5L2KD 3DX8A 1H3PL 1JWUB 2HVKA 1TZGH 3HG1A 5IIEB 5E8EA 1BFSA 1KJVA 1N0XL 5DD0H 3CX5K 3SQOH 1TVHB 1BQSA 1QZ1A 3MNZA 5IKCA 1YEJL 1YEKL 3LQAL 3VFRB 1DBAH 3C6LD 2H32A 3W82A 1JWMB 1W8NA 4OT1L 5I1AB 5EU6B 3U30B 1OL0A 3ARQA 5F9JB 1PKQE 3RUGE 4DEPC 3ULUL 2PO6D 2OMNA 1BWMA 4WEMB 3HI1B 1PD6A 4PGJA 4X6DA 2OS7A 4NBYB 2BC4A 3VW3L 2BY2A 4OZHA 4U2YA 1EVUA 2AV1A 2IG2L 1MHEA 1V3KA 2VDKL 3UPRB 4NZTH 2NY3D 1YZZA 3RWCB 5C0FB 4P59H 2IBZX 4UTAL 1CLZL 2C7UA 1JV5B 5BO1L 2UUDK 3O3DB 3EYFA 1VFUA 4WW1A 6FABH 3E6FA 5F3HB 3T3PF 1AR2A 2DM4A 1R3HA 5TE6L 3HB3C 3L6FB 4ETQA 5TF0A 4OCRL 5B38B 2DBLH 5EG6C 5ID0A 4IRSB 1HQRB 1KLUA 5E08H 1Q94B 2EYTA 3QG6A 5ERWA 1IC5L 2DM3A 3DMMB 1BGXH 1RIUH 1XZ0B 4J8RB 4L4TA 5KN5B 3VFSA 4YFEA 2AJSL 1T1YB 5C0BA 5TGBB 4HHAB 5GIRB 3RWGA 1DSFL 1FNAA 1FL5A 5BOZG 5KS9A 4KV5E 4Z0BH 3RI5K 4WTXA 1CG9A 3C2SA 2A6IA 4PBWD 1P9MA 3SDYH 2BCKB 4PD4K 3ZKND 3WFBH 3F6LA 2V2TB 2DICA 1BZ7B 1XF1A 3LN5A 4IS6B 4QWWC 1WAAA 5F89A 5D6DA 1DUYB 2IH1B 1Z2KA 2NY1C 2HT4D 4AENA 3VFOA 2X7LA 3WN5A 3QUXD 4J4PA 5KSAB 5EOTB 3RL2B 5FGSA 1BQLL 1VSCA 3OAUH 4IOIA 4NJAH 2BVPB 2I25N 3DUUA 4XWOD 3SJVA 5IT2H 3GDBA 1AGBB 2A6JA 3MRRA 5JOPD 3BP7B 3BT2H 2R4RL 2JCCE 3PWJB 2ZCHH 4F7CB 3Q6GL 3HNVH 1MRCH 5ANME 5E5RB 3WO3B 1IGYA 1V3LA 4NHUB 1IGMH 5K9QI 5C07A 4NUGL 1FVCA 4KTEH 2EIZB 5K9JH 3N1FC 4G8GA 4U33A 4EEEA 3RNQA 1X7QA 2UVEA 3L1OH 3ARBD 1KN4L 2VIRB 3G6AB 3RRQA 3O0RH 5LGHL 2UZXB 5EFIB 1U8KB 5EWIH 4NKMB 1PBYA 4FQ2H 1G7QA 3CC5B 4KKAC 1NEUA 5KSUA 1VCAA 1FDLH 5CEYA 3RUGF 3UJIH 5FO8A 3MACH 4ZYKA 1VACA 3TIEB 3DRQB 1BJ1H 5HGAB 4CW1A 3VDCA 2DLIA 5CFHA 1EAPB 2AJYH 3HE6A 2IQ9H 3SGJC 5MEPB 3U82B 2A77H 2R69L 4GJTB 4M43L 1RIVH 5BVJA 4GW4B 4H88H 2FHFA 2XT1B 4Z7VB 4JDTH 3T2PA 2Y7QB 3OJDA 3GMPB 5FGBA 1Q9OB 1YN6B 3HNSL 3O11A 1WWCA 4OZFH 4QHKJ 4S0SD 2DTML 3T04D 3N9GL 1A3LL 3RWFA 5C1MB 5CJQL 1TQBC 1U3JA 1RUAL 4QNPF 1T0MB 3KYNB 4X4ME 4XB7A 4TULH 3D25B 5IVOA 3HS0B 3T0EB 3H9HB 2HH0H 5ETUB 3C5ZD 5F70A 1OGTB 4XAWL 3S4SG 1XCQA 4LLVB 4B7IA 4KWUA 3CU7A 3H3BC 1RFDL 2X70B 4MJIB 1TITA 1YN7A 4OCWH 1LE5B 1X5KA 4H5SA 4ODVH 1J8HB 3WMSA 3CK0L 4WO4C 4XRCA 1RZGA 1F8TL 1IL1B 1ED3A 1JZ6A 5F7LB 1ZWIA 4LCIH 2DLGA 1WCBB 4IDJL 4JFFE 5MP6H 3Q6FA 5F7HA 4MCYB 4QOKB 4URTB 1LO2L 3MMEA 1O7SA 3QULB 3GSVA 2ITDA 3BKML 2BNRE 1H3VA 4PRBB 2AJZA 3GI8H 3HC0B 1T0PB 3N1MC 2XZAL 4X9FA 4WHTB 3F7PC 4JFEB 3RVVD 1NMAH 1JWSB 3F7YA 4GAJH 5GSVA 1LE9A 1QRNB 1GPOH 3MGAA 5L9DH 4EDXB 4XBEL 3ULUD 1PG7L 3ROOA 3MXWL 2YD4A 3LS4H 2A2QT 1JGDB 5B4MC 4Q9QL 1ZT1A 4JN1H 5D96C 3T77A 1U8PB 3P4OA 1IAOB 3VFVA 4XMKH 1X5JA 5F8QC 4ZO8A 2XZQL 5ITFB 1EUTA 3MJ7B 2VDLL 1RULH 1NUFA 3GBMH 4U3HA 1MLCA 2H6PA 4L9DA 2BY0A 3NTCL 4J1UB 5I66A 4I0PD 1N4XH 4U6TA 1KJ2H 4UILH 4FFWD 1L6ZA 2AEPH 4GRMA 3GSOB 3R06A 1W0WA 1R3LA 1O5DT 3NH7L 2BJMH 3DI3B 1AGEA 5BZWA 1N64H 3RA7H 1A7QL 2QSCL 3AS0A 4HS8L 1P7QA 2CO6B 3O3EB 4Y1AD 2DAVA 5CP7B 5F7YC 4N90D 3RI5F 5CZXC 4PTUB 3WIFA 2V7HA 3FQUB 1JPFA 1H5BA 3NACH 5ENWA 2A9NH 3IDMB 2P43B 4JO4H 1CFBA 1QHOA 4F7MA 3QI9D 4DKAA 4ZUVA 2J8UE 2XI9A 4S1DD 4XP6H 4L3EA 3GNML 3JWDC 3I02B 2JTDA 5DVNA 3WFHB 1G7PA 4N8VA 2NX5D 1GVIA 1D6EB 2H3NA 1I1AB 2QADC 2ADJA 2XV6B 3U7YL 1NUNB 2GJZB 4KZDL 2BX5A 4QRUA 1FNLA 4JFOA 3WCYA 4DAGL 4OCYH 3EKCA 5GS1C 4NNPH 5D1XB 2M1KA 3G5VA 5C0DA 1Q9LB 5F7EL 4N5ED 2VLRA 4UT7L 4PRPE 4DKDC 2EDLA 4OCSL 4KY1H 2PYED 1HYRC 3SDAD 5GS0H 1AO7A 1YMME 3KXFD 4R0LC 5FYKU 3SKMB 1T6VN 3GHEL 2WW8A 4XPAL 3SDXA 2Y4SA 4BELD 2DQUH 1DVFB 1ORQB 4WUUA 2R0KH 3QEGL 3IT8D 1T5XA 4ZUTA 5C0NC 4N8CH 1NBVH 4HX1A 5FUOL 3DHJA 2CKBL 1IGIH 2VDQH 5KANI 1QG3A 5D7JA 4P9ML 3UZEA 2Q1EA 3JWOC 3QIUC 4M61B 4GW1B 5KZCD 3GSNL 1P1ZB 3G6DL 4HUWB 2VH5H 3ECBB 4P2RB 5D7LB 1PKOA 2CRZA 5E8DL 1RUML 3QO0B 3ZTNH 4NQSB 1UZ6E 3QQ3B 2C3XA 3IJYB 5I73B 4N1CA 2VWEE 4JPVL 2R56H 4KHTL 3RDTD 3ILQC 1T2QL 4HAGA 4PJ5B 4KRPD 4IRJD 1URLA 3GSWB 1D5BB 4NT6A 4FN0A 4P46C 4TVPE 5E1AA 2F8OA 3KPOB 6CGTA 3WKNA 1RZ8B 1SJXA 2PETA 3H3PH 2UYLA 1JI1A 2DM7A 1J8KA 2ADGA 4HEPG 4M93C 5T1KA 4NRZB 2VITA 2QTEA 1CLCA 4U1MB 2NY1B 2VLJB 2J88H 1A14H 5AZEH 1I3GL 4BZ2L 4DVRL 3VCLA 4G5ZH 5LQBL 1KT2A 3L3IB 3OJ2C 3CVIL 5DA4A 3U7WL 1CF8H 2OL3H 5DK3A 3UYPA 1NFDA 4OTXH 1OARL 4YPJA 4EOWH 4GSDL 4JN2A 1ZHKB 3O3AA 2ICWJ 3K1DA 4BH8A 3MV9A 3DUSB 2J8UF 4NQXB 1L9NA 3MLYH 5C0GA 5FOBA 2BNQD 1XF2A 4FQXC 4BSVA 4QRRA 3NCYP 3L95A 4MXVE 2F54E 4P3DA 1TJGL 5DUPL 5KAQG 4G6KH 2DQGH 4PJFA 3VXUA 1IE5A 4LPYA 3WXVL 5TQ0H 4Z95H 1ZLSL 4LCWB 5D1QB 1F2XK 1M05B 2GTWB 2IALB 3KPQA 5HYFA 2HJFB 1DQLH 3K2MC 1NCNA 3CFBB 3P73A 4AL8H 2VLMD 3VGAC 3MGOA 5F96H 4CU8A 2I5YH 4ZODA 1FCCA 1XH3A 3MRGA 1HOCA 4ALAL 1M7XA 4RAVB 1U8MB 3F7VA 4ZXBC 3LEVL 1YUHB 4OFKA 2VQUA 1NCBL 3OKOA 2FGWL 4IOSD 1VFAA 4R2GD 1X5ZA 3GIZH 4PTTA 4GUPA 1A4JB 4P57B 3PP4L 4L9LC 4QY8A 1MRFL 1HK6A 5T3XH 4PJAE 5EBLB 4KKNA 1ZS8A 1NCAL 3IDNA 4X7SL 1GC1H 4RAHA 5J6GA 2VZ3A 5D7KD 2FJHB 5E2VH 2P24A 4QHMA 5C0AB 1T1XA 5IB3B 5FHAH 1ZHNB 4XZUB 1G6RH 1ZEAH 4RDQF 4HGWA 1BBJA 1UZ6F 1EH9A 4WO4B 3FO0L 2ZSWB 4HF5H 4EN3D 3HAEG 2GJ6E 1TETH 4D94A 4N68A 3RKDC 3U83A 2QSVA 3CDCA 1MRDH 5L6YL 3V5DA 3KLAB 3FO1B 1BAFH 2WBJC 5E7FA 1SEBA 3TP4A 3VXMD 1HSBB 5DO2D 2H9GA 3FFDA 3LCYA 4U1NB 2VC2L 4ZO6A 3QUMA 1T7YA 3V52H 2UY6A 4K2UH 1ACZA 4XP9L 2OTWB 1GOHA 3GSRB 4UI2A 1TZHB 4XXDA 4YUEL 4OV5A 2WP3O 4YAQA 3C9NA 2NXYB 4IOFC 1IAKB 5ADOH 2V17L 5F1NA 1OAXL 3QHTC 1VADA 5IWLA 2XWBB 1LEGB 3MA9H 1DBJH 4WV1A 5IVXF 4Z7WE 4FRWA 1XF3A 3LOWA 5TDNA 2OZ4L 4PGEB 3ARYA 3BH9A 3GRWA 4GRWB 1A6TA 1ONQB 5DHVA 1S7QB 2MCPH 4YR6B 3T0XA 4F7TB 5IK3A 1B4RA 4MA8L 2DQIL 3TN0B 3LRGA 4DVBB 5JZ7C 2FNBA 2VDML 4FFVC 2X6MA 4WFGE 2ED7A 5IV2B 2NR6C 4LIQL 4AEIL 3H8NA 2EDRA 2DQJH 1KEML 4L8CB 1I7RB 3RTQC 5BXFB 4R97C 4RWHA 1KSRA 2CMRL 1E28B 4MD0A 3RVXC 3RP1A 1NJ9A 4ZUUB 1KCKA 3MRKA 2Q7NA 5GGSB 1T7ZA 1H3WM 4CN1A 3H3KA 4I48A 4PLOB 4UIKH 1BFVH 4Y5XB 3H0TA 3MA7A 4WWKB 3OAZH 2YD6A 4I18B 5I16B 2QLVB 2PXYA 1BD2D 2UWEE 1E4WL 1NFIA 1MCOH 3MCLH 4C57C 1DN0A 3GUTA 4MQ7A 5L2JA 3BN9C 1EGJL 3FB8B 4O58H 3JV4B 4KFZC 3F7RA 4Z18A 3AB0B 3T1FA 3E2HC 2H45A 2EYRA 4O02L 4M6OL 2FX7L 3MLTB 4PJAF 2H2PD 4HFWB 3O81A 4YIQB 2ZNXA 5C0CB 4YHLH 4MAYC 2E9BA 2GW5A 5TE7L 1K8IB 4JQXA 3RKPA 3ES6B 4B0MM 3CXHK 2X4OA 1MH5A 1YEEL 3WS6A 2A0LD 2GT9B 3QWQB 4RMVA 3SE8L 1P4IH 4ORZC 3HC4H 1CFVH 3TCXA 2Y1VA 1AKJA 3HZVA 2MJWA 1GYAA 1FNGB 4X7CC 1NC4D 4L29A 1U8IB 1DN2A 4JZJC 4RQQB 5DTFA 4ZS6D 2AERT 5JXAH 5LJYH 1CGVA 5I1LB 2BMKB 4JPKH 1YYLL 5IOPA 5E99L 5DJXA 5B22A 4OAWA 5IVXB 1PG7X 4G6AD 1UKTA 1BIHA 5E9DE 3UJJH 4X4XA 4AMKH 1VB9A 2A1WL 4YBLB 4YNYA 5C92A 1HNGA 1BBDH 5JLZA 2XY2A 1U3ZA 3S37H 1UM5H 1KCRH 1T7VA 4Z7OE 4X0KA 1I3VA 2NY5H 1T89C 5EOQH 3FTGB 3SDCC 1MCKA 2ESVA 4K3JL 3U36B 2BVQA 5DVOA 3RIAK 1FE8L 5B39A 3MRQB 3BUYB 5KVMC 4OGAD 3RGVC 4NCC2 4LKCB 4F58L 1PQZA 3BP5A 4ISVA 3RGHA 5E94A 5FK9B 1ZLVH 5CAYB 3L3KB 1A1NB 1NCTA 2VDNH 3QZWB 3OKDA 2LU4A 3C8KB 4LASH 3ARFA 1A6ZA 3T65A 2NY2D 5DYOA 4GT7A 4O4YL 1RMFL 4ODHH 1DFBL 1HH9B 1CDIA 4TSBL 4XCEA 1QBML 4PRHE 3BPCB 1BF2A 4Y16A 1J87A 4PRID 3EOBB 3LKRA 3ZSTA 4Q9RH 3SO3B 5EU7C 4Z7NE 4ZTPH 3A67L 4L4VA 3VGDA 4UOJA 1CXIA 2X1PA 5D1ZD 3GMOA 2D4FA 2I07A 3EJZC 3L3JA 1OAQL 3MV8B 5IR1A 1L7TL 2AK4D 1A3RH 1BVKB 2B39A 4ZSOE 1I9RL 4ZFOL 4JM4H 2NNAB 1I9EA 3PDGA 1P4BL 4NN5B 3UROR 4NM4L 4YPGA 1B4JL 4DCQA 1C7SA 3VGBA 4D9RD 4JQVA 5JNYB 1EEQA 4HKZA 2JELH 4KI5D 1F6AB 1PKQA 3RUGA 3U4EB 4NQDB 5EUKA 2WK2A 3LEXA 2CDGA 1ADQH 4LSSH 1HYSD 2DIAA 4OIIL 4OLWH 4LVNB 4DTGH 2E8YA 4I3RH 4ZXBB 3T4YB 1CLOH 2X4SA 1TJHL 2D7NA 4K9EL 5CLWA 1AQDB 5EU7E 3EFFB 4Z5RA 3LS5L 5SX5K 3BPLC 1S7VB 4XNYL 3NCCB 5GS0C 4KJPC 1L0XA 3TBWA 5FXCH 2W92A 3RY6A 4ZFFA 4HUUB 4L9LB 3EYUH 4QXGH 1IT9L 5K9OA 1DQQA 5C09B 2P45B 1MFEL 1X3DA 3P4MA 2XQBH 5DZNA 2BSRB 3WUWB 4JRYB 2R0ZL 2AEQH 4G9DA 4ELKB 4HXBL 4NKDA 4WEBH 1QA9B 4M48L 3E1F1 2AQ3A 2V5TA 3QRFM 3BUTA 5DJDB 2DMBA 1NEZB 1UT9A 2P5ED 4C4KT 1NFKA 5JW3L 5HYSG 3QB7C 5DQJA 3S35H 2C3HA 1YECH 4Z7OF 4HUVB 5F8RC 4MNQB 1NGWA 4QHLB 1IFHH 4M00A 3CVHL 5EUOE 3T0AA 3KJ6H 2EDNA 1GZPB 4ODXB 3UAJC 4F57H 1J1XL 1GRWA 3DV6B 2DI7A 4G8FA 2R2HA 3BIKA 2VL4A 3F62A 3TF7C 2ICES 3MRLA 1P53A 3RU8H 5DSCB 2CLRA 5DHYB 2EH7L 2AEWA 2Y06H 2FECI 5EU4A 5FUCC 5J7CC 4UBDC 4J3WA 1NCWL 1QUNA 3U9UB 3O45B 2EO9A 2H2SC 4LLMA 5I71B 1F4AA 1FVDA 1A4KB 1AC6A 5CJXC 1UWEL 4NUJA 1BVZA 3MROB 2OYPA 2JCCA 4W70A 5JPMA 3BHBB 4CL7A 4P3WA 3LQZA 3VJ6A 4O2CB 3E0GA 4PBXA 3OPZL 4JPWL 5A2FA 5ANMA 5FM8A 2JJSC 3TT1L 4Y4FC 1UEMA 5DEFA 4XAKE 1BIIA 3KPLB 4GW5B 5I1CH 3UJTL 3RIAF 1I4FA 4KTYA 2DQCH 3CH8A 1H8SA 3AAZB 3BXNB 5CGTA 1LP9B 4RGNC 5DUBB 5IBLD 5JPNA 3DYOA 4ZFZB 4NIKB 5I2IB 1LK3L 3FMGH 4LNRB 5F6IB 1T22A 4JANB 4KROD 1P4LB 4FQCH 5BRZB 3KR3H 2FZ3A 4C56E 4JB9H 1KLGB 4Y2DC 3S3PA 1EEZA 3I2CL 4F80A 5DQ9A 3VG0L 1WWWX 4LDOB 3FOLA 3QFDB 3CMGA 3EO1B 3QJHB 1IILE 4F15C 1T7XA 2HFGH 2IPKB 3BSZH 5FF6B 3EJJX 4NC0B 4NFBA 2F58L 1AR1C 3QWRA 3BEWB 1VPOL 1IQWH 4JPIA 2YPVH 1P6FA 1Q0XL 2WWMC 4HKBB 1KG0A 1WISA 4G3YH 1JNHB 1GOGA 3IFNL 4D2NA 3WHXA 4OBSA 4MAYB 1U41A 4K8RH 3RX7A 4YHIB 4JY5L 3PJSA 4FG6C 3H7BA 1GC1C 1U93B 2B1AL 5CUSH 1U9KA 2CIKA 1AE6L 4GQ9H 4JM2D 3TJHC 3QCTH 3QDGE 3CCHB 3ARGD 3K46A 4M6AA 1R5WB 2P7TB 3RWDA 5JORA 1TTGA 3CLFL 4HPOL 1KIPB 4PRNA 4HC1A 2HG5A 4BK4A 5C0EA 3QQ4B 1W2KT 4LSTL 1BZ9B 1EZVX 3V0VA 4JFFA 4MD4A 2WUBL 3AXLA 1PY9A 2F5AH 3MLVL 1RAMA 4Z7VE 3O6FC 4PRDA 2XKNB 3ULVC 1QEWA 4RISH 2BNRA 4BFIB 1N6QH 1FFPA 2Z8WC 3BKCL 4OQTH 3UYRL 3OB0H 3U2SB 3MLSL 5TFSL 4CNIA 1G7JA 2EKSA 4WU5B 3B9KD 5A16A 1TVBA 1H15A 4G7VH 3MV7D 2E9IA 4MJIE 2W38A 4P5MA 4DOHB 3EBAA 3RGVB 5F1IB 1FFOA 3QDMD 5T3XE 2XPGB 1FNSL 1VGKA 4UIMB 5EBWB 2Z92B 1UKSA 1RQ5A 5JW4Q 1VERA 1WZKA 1N3NB 4YGAB 4OGXH 2WIIB 4TRPH 1MWAA 5GGVH 2COQA 1YEIL 3Q5OA 1V7NH 3ARWA 4Q2ZB 4I5BB 1AXSB 1RHFA 3RVWC 1MQ8A 4W81A 4JFEE 2HRPL 3WYRA 1DBBH 2C9AA 3RVTC 4R3SB 3O2WL 3C8DA 1QRNE 2BSTA 3MBEA 5M95B 2I60L 1T80A 1CIUA 2EDDA 3P11H 1TXKA 1J86A 2OK0L 2DD8H 3M45A 3FB6A 4A6YA 3LKQB 3OR7A 1KTDB 1EPFA 4KDTC 4RMSA 2J8UA 5FO9A 3S36L 2PCPA 2AAVA 1MEXH 1SYVB 3V4PH 2HT2C 3BEVA 4GMTL 1OAUH 1S3KL 5J06A 4OZGE 4RFOL 1I8MB 1UM4L 3MRIA 1G9NL 4F33A 4K7PX 5BS0D 3WS3A 4H1LA 5IVNA 4NP4H 3C6LB 3ZDXF 4KJWC 4XMLL 2R1WB 3WLWC 2KQMA 2BOCB 2VN7A 3NCBB 4U05A 5MHSE 4CVZB 3RNKB 2AJUH 4K7FB 1D9KD 3HG1D 5T1LA 5CCKH 4PRPA 3D85B 1WBYA 2UVFA 1INEH 2ADFL 4S0TD 5HI5D 3MLXL 3K80A 1YMMA 3E6HA 1AIFB 2P44B 3NIDE 2FB4L 3TESA 4FXKB 2Q76A 4HKXB 4D0CB 5I1KL 4PGDB 3UTTE 1WBXB 3MNVA 4AEFA 1XF4B 2ERJB 4RSVA 4XP1H 5F9WC 3QAZC 5KOVC 2FX9H 2O5ZL 4PJDF 4PV9A 1BJ8A 1ZVSA 3DBXB 2UZYB 3KDMB 3QDAA 5JMRA 4GXVH 4TNWK 3P9LB 3VRIB 1NCCL 3H9SA 1MQKH 4JQIH 3VXTB 5GGTH 1J7VR 1B0GA 5DK0A 1U3HC 4S1RH 3WL9A 1WFNA 1AJ7H 4QEGA 3JV0A 1KPUA 3TT3H 3EYSL 4BZ1H 4HW6A 3V8CA 5JW4N 5IB1A 3DVNB 5DJ8A 5GS1A 3D3VB 1KB5A 1YPZB 4BJLA 1J5OL 4P2QE 4MDJB 1KCSH 1UWGH 4Y4HA 3MFFA 1YEHL 2FX8L 4X6EA 1MCCA 2NLJA 2OX5A 4NNXA 2CDFB 2YPLD 3TA3D 3GO1L 3U7AA 1Z9SA 2I27N 1MAKA 2RR3A 2X44D 1MIMH 4KPHL 5E24E 4R0LA 1C7TA 5J12C 5HI4D 4KJYA 2HVJB 4LHUG 3SOBL 4L4TD 2BVUA 4OLZH 3VXRD 3X13B 4CN4A 1NC2A 2B4CL 4NGHH 5C0BD 3AMLA 1UZ8A 1KOAA 2VXTH 3CFKB 4JG0H 5CD3A 1MCPL 4P5TB 4E0RA 4PJ8C 3SCMC 3QCUH 1S7UA 3QUXB 3O2DA 5EZJA 5CZKA 3QIUA 1QPXA 3ULVF 4FQIH 1MFBL 4MA7L 1UJ3B 2VXSH 3ZT5A 1G1CA 4Y19E 2EEDA 3WDJA 1MCIA 5T33L 4YXHH 4MJ2A 1JHLL 3TEUA 4U0RC 2R8SL 4PJGB 2CLVB 4LQFH 5HGBA 3MOBH 3FOMA 4J6RL 5JIPA 3HCVA 4HWNA 4UV4H 5I1HL 5F6HJ 3CSGA 5MERA 3SE4C 1O7VA 3WKMH 2X4UB 3DI2B 1F3JB 3NIGE 4P46A 2VAAB 4OZGF 3SJVD 1JIBA 4OV6F 2VZTA 4PUBH 4ZUWB 5T5NG 5FGRA 4Q0XL 4X9HA 3JTSB 5IFJB 3E3QE 4RGNB 1SBBA 4HDIB 1ACYH 1PW3A 5MENA 4OLEA 4TTDC 2X1WL 2IMMA 4PJDB 1J0KA 5EU5B 1QYGL 1IKNC 2OI9B 4Y2DB 2AABL 1LK2A 4JKLA 5C07D 3F58L 5IBTL 4G8GD 2E6PA 1YJDH 3CFJB 3HE7C 4RX4A 2F74B 2BSED 1QO3A 1VDGA 3I84A 1UYWH 4DN4H 2X9XA 5ECJE 4G43A 3GK8H 3SE9L 2Z4QB 2ED8A 4WJ5A 3TV3L 1T0NA 4OLVH 3W2DH 5D4QA 4FQXA 3FB7A 1YC8A 5IQ9A 5I1JL 5E5MB 3V6OC 4PJAA 3C5SA 3MRBB 9CGTA 1OVZA 2D31B 1NL0L 2OQJB 4NKIL 3I75A 2EYSA 2V6HA 4GBXC 3C5ZB 3ZKXB 1SBSH 3TBVB 3IGAA 2FATH 1U8LA 1RHHA 4XCNA 1WC7B 1FBIH 1MHPL 3EDKA 3GMQA 3FO9B 2L7JA 2NZ9D 3GMRA 4WI2A 3PHQA 43CAA 5J56B 5IG7B 5H8DA 2GJ6A 1KGCD 4N9GA 1J1OL 5GGRB 4MJ5B 2FO4B 4OLUL 3X11A 2CKNA 3BX7C 2GQHA 1G7HB 4BQ6A 4QCIA 3HZYB 2F9BT 4BFGA 4HIJA 3K7UA 1JJUA 4PJEE 3MJ9H 3PWUA 1RZFH 1TENA 4OSUL 1MAJA 2QR0A 3BZ4A 4HULB 4GG6B 4FTVD 3SKNA 4E41D 1N26A 3BGAA 4MX7A 2GTZA 5ACZB 2DYPA 4LVOB 1GIGH 4YHZL 1GHFH 2C4XA 4XCYA 4I0PB 5H2BB 1DQJA 2WNGA 1UFUA 4YXLH 5I1IH 3BKJL 5MEQB 2YC1B 4X9IA 5DJ6A 1KELH 2QSTA 1BVLA 1ES0A 3P0YH 3NIGF 4Y1AB 1HCVA 2C1PB 1SVZA 3IFLH 2WBJA 3SO5A 5MEOB 2V5RA 4N0FB 5ALBH 2FEDC 5LWYH 4BSWB 3EOAA 1LEKA 4AT6B 5HHME 4RIRA 3BVNB 3O9WD 3P4NB 2CUIA 3EOTL 2VXVH 5FM5M 1I1FA 1INDL 4X5WA 5GRVK 2HMIC 1QR1A 1CICC 2NX5B 1G7LB 3FQTA 3WNLA 4WW2C 5HJ3A 3NFNA 5I17B 4HV8B 2GUOA 4EXKA 3AREC 4XPHH 2UWEA 1NBZB 1U95B 1KBGL 2JIXA 5FGCB 3V2AR 1G84A 4CGTA 3QO1A 4HH9B 2ARJB 5IP4A 4LAQL 1BM3L 1UM6H 4M5YH 3MRJB 4X6CB 3LKOA 1U8NB 1M7IA 4NQEE 3WFCL 2DQEL 4JLRB 4DZBA 2MQ3A 2EEBA 2PYEB 1JFQL 3SDAB 5L88H 4OI8A 3L3DA 3KXFB 4H8WL 3VDBA 1FLRL 12E8L 1ZGLP 3RTQA 3QQNA 1EX0A 5CBEA 3I6GB 3X12A 4NQVB 4JGMA 4OD3H 5TDOB 4PJ7F 1V7ML 4S11A 4O51A 3V4UH 5J0BA 2X5PA 1AGFB 1Z3GH 1VKXA 3QUML 3SDDB 2J8HA 4LPTA 5ID1A 4GKZB 3WIHH 4UQ2A 3D48R 1OB1B 2KL6A 4KQ4L 5E00B 3TO2A 1D5IH 3PHOB 3S4SB 2CLZB 1T1ZB 3UBXA 4XH2B 4KAQH 4ZTOH 5KZCB 2C3GA 4MWFA 1I8IA 2XA8L 3TH3T 1XGQB 1QBAA 1WEJL 3HI5H 2RB8A 3TJEL 3VXSE 4QRPB 3DX7B 4UNTA 4WCYH 3GRWL 3KNBB 4ZD3L 4KGJA 1R3JA 3OG4B 4N0UE 1BFTA 2NY6D 3RDTB 1NH6A 2AKRB 4ZFGH 4ZUSB 1MUJB 4KRPB 5HHNB 5EZLB 4WI4A 3LRHA 4EI5C 1I1YA 1LO5B 2ZNWA 4OZFA 4YDVB 5I8OH 4OI7A 15C8H 5ICYA 4OZIF 1LILA 1H0DA 2DQTL 4E5XB 2VDOH 2D7TH 1G6VK 4OI9A 2ORBH 3LHPH 4R7DB 1N2RA 4RBPK 4FXLA 4AEHH 2A6KA 1EXUB 1UCBH 3QEHA 5K9KA 4PJ8B 2HFTA 3V6ZA 1SQ2N 5D6CB 4JZJA 1NAKL 4PRHA 1C5DB 1DQDH 3EZ8A 3NFSL 1F13A 5I8KL 3HMXH 1E27B 1IM3A 5DRZA 2D2OA 3MZGB 2UZIH 25C8H 1KJMA 4Y4KA 4JDVB 4P2CG 5I1DB 5DRWA 3MO1B 1A7OH 1GGCL 4G9FD 5B38G 2PR4H 4WTWA 3S88L 4ZDHB 2Q8AH 4JDZA 4DUVA 4PS4H 2XZCL 2AJ3A 3SDCA 5I30H 4HIEB 4OB5H 5HHQA 4ZSOA 4YHKH 3I9GH 2VABA 2AV7A 5HD8C 1S7XB 4HLJA 4PJ7B 1INQB 1T20A 1FG9C 2EH8H 3QJFB 5DD3H 1MAML 5LGJA 1CE1H 5J6HA 2I9TB 3LN9A 5DJCB 2E7HA 3E8UL 4JFZH 2CK0H 3PQYD 1RJZA 1IM9A 2V9TA 3MV9D 4P4KD 3VA2C 2LVEA 4DUXA 4HJGA 1PZUB 1KJ2A 3VFNA 4ZOBA 3CXDH 5FA4B 2VQ1A 1FORH 1SEQH 4QRRD 3GI9L 2DWEB 1BFOB 3SKJL 2EICA 5EA0H 3KYKL 4OM1H 4CMHB 1OF2B 2P49B 2HJKA 5B8CC 4WFFE 3VXUD 3GFUA 4F7PA 2YD8A 2AXJA 5IF0A 1DDHB 1KFAL 2Y36L 4KKBC 1JRHL 4I3SL 4H0HB 1KIQB 3AVEA 3OAYH 1OP3H 4MQXC 4OGYH 3AU1B 1KCVL 3KPRE 3LEYH 4Y5YB 4TOYH 1I3RA 1NKRA 4NSKB 5EZOL 4NM8H 4CMMA 1H3PH 1OLZA 1MCRA 1ZK9A 1GCFA 4WW2F 1XF5A 4U1SB 4UOW1 1N0XH 1G9ML 4MA3B 3ARPA 1V5JA 2ADIA 1XIWD 2C1OA 1JYWA 4TPRL 4M62L 4HFUL 5E03A 3KJ4C 3KHOA 2PTTB 1YEKH 1YEJH 4WNQB 3HLAA 3LQAH 5C0JA 5KVEH 4U4BA 2KZ1B 5IB2B 3ULSA 4EN3B 5IEHB 5IMOB 4YDJA 1FYTD 5C9JA 1X5AA 3H9ZA 3KYMB 4U7SA 4HT1H 3TO4B 2F5BL 3MYZA 5ITBL 1A02N 4CADA 5DR5L 2EIEA 1QSFE 1S8DA 5EUOA 2D03L 3ROLA 1E4XH 1N7MH 3Q3GB 4XNXL 3VW3H 3WO4C 2DQFA 4AIZA 1NKOA 3MRPA 4KK8C 2NY0D 3CSYA 3FQNB 4UT6L 5EU6D 2BSSB 5JDSB 1CCZA 5EO0B 4UQ3B 4UTAH 1CLZH 4OLYH 3ZTJG 1R5VB 1TZIB 3UPCA 5BO1H 4P9HC 1IZKA 4XNUH 2XNAA 1M71B 3DYMA 3FB5B 1HINL 1MJ7H 1S7WA 1EEYA 3N06B 3B3IA 3AY4C 4POYA 1TJIL 3ALPA 2H1PL 1PZ5B 5J13C 1FZOA 4OD1L 3MREB 1FO0H 2AS5M 2QQLL 1XMWA 3I3BA 4PBVC 3B8YA 3D69B 5DJYA 4X4YB 4W68A 4WI3A 1IC5H 3GB7A 3QUZC 4HZAA 2CR3A 1VGEL 2Z31C 2YWZA 3T2NL 2AJSH 3PABA 3TC9A 1MPAL 1YY9D 4IEFB 3EHBC 1Q0YL 1QLFA 1JZ4A 5K59E 3W39B 2IAMC 4IHOA 4U1IB 3GSNB 1AHWB 3ZE0E 3DMMD 4G7YH 1UQSA 4UT9H 5E2WL 5GXBB 3EYQD 4DKEL 1UG9A 1XR8A 1DLFH 1OQXA 5BOPA 3DWTA 3TZVC 4I77H 4C56A 5F88A 2X09A 4WW2B 3FCTB 3CH1B 3PWLA 4YHNA 1BQLH 4S1SH 4HUNB 3IF1A 5CJXA 5KOMC 1F11A 3BO8A 1UXSB 4G6JL 4ODTH 2OL3A 4X7FC 5A40E 5CGYC 1CLYL 4U6XB 3SKOA 4NHCL 3AS1A 1A7RL 3RWEA 2R4RH 4FABH 2VYRE 3U9PL 3TGXA 4Y4FA 4PG2C 3O6LH 5ESQA 3Q6GH 1LP9E 5KSAD 5LAXB 4FFZL 32C2A 2IADB 4NNYB 1QSEA 3QIWB 3REWB 5IJVA 4Z76B 1DLHA 3L5WB 1C12B 4Z77A 5AUMA 5H94A 1F6LL 3HPLA 1C08B 4G8EB 1ZANL 3QDGA 4YGVA 4UB0L 1OGAB 5LGHH 4UAOB 1FH5L 1BQHB 3TBSB 1NC4B 2R2EB 1IGTB 5TE4L 2B8OT 2YBRB 2Z91A 1KTLB 5KVGL 1IGCL 1E4KC 2DDQL 3G5ZB 5C0IA 3T0WA 3V79C 2JB6B 4YWGL 4LCCB 2NY4D 1NSNH 3MSPA 5EZIH 3THML 1KF9B 2R69H 4M8VA 2B7DT 2WINA 4M43H 4PJCF 1AKJD 3D39E 3QNYB 1A9EB 1I9JL 2D3VA 3L3HB 4JG1L 1MLBB 4J3XA 3HNSH 4U6HA 3TPUB 5CEXB 2ATPA 3PIQA 1TMCB 1A3LH 1WQVT 1CE6B 5CJQH 5KJRH 1RUAH 5HPMB 4QHKI 5C7XH 3MR9A 4G6FB 4MCYA 4LBEB 5E2UL 3IKCA 3DHMA 2WMPA 3LAFA 3QULA 4HUXB 4CDHA 2G75A 4YEEA 2NY2B 3S5LB 4MMZC 3KPPA 3IYLW 3R0MA 5HVHC 1G6RA 5GRYA 1VENA 2YXFA 2ESVD 4ELMB 1F8TH 4M7ZC 3O6FA 1AD0A 1QRNA 5H35A 5K59F 4MSWA 4PRIB 3HN3A 5KSVA 4F2MB 2FECL 2HKHL 4YFLF 1KCUL 1A1OB 2GCYA 4RA0C 4LLWB 1HI6A 2BVOB 3VFUA 1CDBA 1Z9MA 3ZE0F 3FQWB 3VWKB 5CJ8A 5D1ZB 4JFPB 2P8PA 3ARFD 4X5LA 5SWSE 5L0QC 4OFYA 1J8HD 5CIPH 1E6OL 1A9BB 4EUPB 1GAFH 1GGIH 4XBEH 1PG7H 1I3UA 1Q1JL 2AK4B 2PUQT 3QPXL 2IH3B 1AQKL 1AFVL 3MXWH 3P9MB 4QOKD 4Q9QH 1MNUH 1QFWL 4Y16D 4OZGA 1FFNA 3BQUC 5DI8B 2MKWA 3L9RA 2F53E 1QNZL 3C60A 4WU7B 3LKPA 3W9DA 5E8NB 5J9PB 1K5NB 3STLB 1F45A 1F00I 1QBBA 2V7NB 2G60H 2CGRH 4HUMB 3O8XB 4FP8L 4PG9A 4P5KA 3EYOB 3NTCH 4P4RA 5CP7A 1FVEA 3CU1A 3PL6C 1D5XA 1SJHB 4KVCL 2R1XA 1OW0C 3LSOB 5E95B 3NH7H 1G7MA 2ID5A 3VGEA 4LCYB 3HHRB 1S9XA 2GSGB 5EPMB 4LSUH 4IMLB 1A7QH 3FO2B 5L2KE 4XVTL 5BV7H 5CINH 3DXAB 1KNOB 3G5YA 3UTTA 1JYXA 3UEZA 5HYQB 5ICZB 2G2RA 1WWBX 1R3KB 4PJCB 5CKGA 3L5HA 4KDTA 1HQ4B 1L0YA 4LQ1A 3NCEB 5A3ID 3GJEA 2BXZA 5DJ2B 1TNNA 3UTQB 4M02A 1MHCB 1QFPA 4JO1H 1JZ3A 1ZT4B 1P7HL 2EE3A 4LF3A 4MS8C 5D7IE 5BZDB 4WY7H 4PP1C 3GMMB 5MI0B 1N8ZB 3KLDA 3VFTA 3OXRA 3F12B 2P5EB 3DGGB 4XNMB 2EDFA 4DAGH 2PYFB 4P2QA 4QRSA 1HDMB 3CFCH 4QXUL 2W07A 1XGRB 2VZOA 1TFHA 4TUJA 5C2BL 2C3VB 1SM3L 2W60A 1N5AA 3C09C 5F7EH 5FIEA 5HGGS 5T1DL 2CR6A 4MGXA 2V5SA 3GM8A 3QH3B 1T4KA 4JFXA 3C5JB 4UT7H 2EIBA 4PGCA 1UACL 2EDHA 4L8DB 4OCSH 3V4VL 4OJFL 1RIHL 5L8LB 1F42A 4QXWA 4A6YL 4ODBD 3VFPB 1BLNB 4XPAH 4XNZB 3F7QA 2J1KA 4HGMA 4C54A 3VA6A 3LQMA 1DBMH 3LN4B 5C6TL 3QEGH 3HPJA 1ZLWK 4D0DA 4ONGL 5FUOH 2HLAA 4HBQA 3VFWB 1MFCL 3L3GA 2CKBH 4JRXE 3AS2A 4L5FH 5JXED 1IEBB 1UGNA 1U3HA 1A1MB 4Y19A 2OSLB 3VE0A 5B21A 5DMGD 1HZHH 2ZUSA 4APQC 1EERB 4G80A 3ARBC 5E8DH 1HIMH 1ERNA 1RUMH 4DZ8B 3WFZA 2V5YA 1TQCB 1HE7A 1NMCB 4GAYB 1SJEA 2NXZC 3ARTA 4KHTH 3P77A 3WN5C 4JGJA 1KENH 3OG6B 1T2QH 2R29L 3TCLA 4QRQB 4KU1A 1ZA6B 4P48A 2VL5B 1YEDB 3CUPB 4JFQA 4XPTH 2YXMA 1DE4A 2APTA 2HWZL 1I7ZA 5JW4M 5DD1L 3MLZL 3IJSA 4NWUL 3U46B 3G6JB 3BMVA 4KROB 5EIIB 3O4LB 1CDYA 1U92B 3JWDL 4U1KB 1IAIH 3SCMA 5JOPE 5IW6B 1EUUA 5SWZE 4JEGB 1UWXH 3LRSB 5D5MF 5TF1L 3WSQL 4BZ2H 3DX9A 3OKKA 3SEPA 1P7KB 5LXGH 1MCNA 4PJIB 4EBQL 3U7WH 2ZOLB 2ZP0T 4OKVA 3KPSE 3FT4A 3TNMA 2R1YB 4RFNC 4QWWD 3AUVA 3ZT7A 5E8OA 1WCQA 2NY1D 2VLJD 4GSDH 1MI5A 5B3JE 3IETA 3QNZA 3SY0A 2BRQA 5JA9A 4TVPL 1FSKC 2ICWI 4QF1B 2E7LC 2OR8A 3PGFL 4UUJB 3HE6C 4NCDA 4UU9A 5JA8B 1W72H 4R8WL 4NBZB 3OHXA 1EO8L 3FZUC 3HAEH 3BKYH 3LZFH 3QWRD 1WFUA 3NGBB 3MRNB 1WJ3A 4EXPX 5FYJH 1IKNA 5JOEA 4P49A 3GBNH 1M7DB 2X4QB 3CNKA 4ZAKC 2P47B 1IGFH 3JWOL 2YUVA 4ZFOB 3HE7A 5GRXG 2AK1L 5IB4A 1OSPL 2YZ1A 3B6SA 5DRXA 1ADQA 1I7TB 3T8XB 1U91B 3DVIA 1TCMA 1NGXA 3PNWB 1OTUC 3LEVH 4LCWD 1T1WA 4PJEA 4XTRD 1NCBH 4HQQL 2QQKH 4KKAD 2DWDB 5TDPA 1HHHA 2FGWH 4DFIA 3BWAB 3GMNA 5IHZB 3RBSA 3BDYL 3QHZL 3T4AA 5F97E 5FKPB 4RDQG 2GFBB 3LPFA 5F7MC 3MV7B 3BZFB 4FFWC 1JP5A 3PP4H 4NN7C 1LO4L 3JWNC 1FAIL 4OZIA 3VWJA 1NCAH 4GBXA 4X7SH 2Z93B 4UTBL 2AI0H 1OD9A 1T21A 1QKZH 5SWQA 5JUEH 5ALCL 4G8IA 5HGDB 2ICWA 3OKEB 5GISL 4HK3N 5BJTA 4LARL 5HYJE 4XPBL 3RL1B 4D9LL 2GY5A 2G9HB 4ENED 1LDSA 3CDGB 5HDBF 3FO0H 3VMOA 2VN4A 1C1EL 4NRXA 4LLYA 4ONHA 1K6QL 2IPUK 4YE4L 5DT1L 4R7NA 3MJ8B 3QR2A 1OM3L 4JZOA 5L6YH 2FBJL 1HEZB 4MXWL 5C0AD 2IPTL 8CGTA 2KH2B 3L3OB 3QEUA 4O2FA 1GH7A 5L8KB 1YEGL 3LV3A 3GMLB 4BH7B 4YHPA 3DO3A 1OCWL 3NN8A 5J11B 4WO4D 1X5YA 2VC2H 3LKSB 3X14B 4M1CC 5DMKA 4DUWA 4IM8A 1TTFA 3FT3B 1RZJH 1VFBB 4XP9H 4FMKA 1ND0A 3W0WA 1CGXA 1TZGL 2O5YH 2C4FU 3NBNA 1Z5LB 1T66D 4KVNL 1DTUA 2Q86A 4NPYA 2V17H 4YH6A 4NYLA 5DD0L 1OAXH 4KH2A 5FA3A 5LGKA 1IQDA 2HJLA 4GAGH 1IGJB 4I4WA 4Y1AE 3K8LA 1WAAF 1DBAL 4HIIA 2NCMA 5JR1L 2AQ2A 3DX8B 2HVKB 2OZ4H 5B4MD 4V2BA 3HG1B 5B3JF 2Y5EA 5E8EB 3OKNA 2NXYD 1KJVB 4NQEA 5E4EC 4PJHE 2DLEA 3QIBC 1CDCA 4MA8H 3DUHA 1UC6A 5GGSA 4Y8DC 5FOJA 1JPGA 1Z0NA 3MNZB 2MMXA 4FQQA 5GS3A 5FFLA 4FXGA 4LIQH 3FFCE 4AEIH 1JUFA 5EU3A 1KEMH 4MB5A 1OAZL 4DWHA 4HS3A 5DDHA 4P59L 5LKNA 3KPNA 3VU2A 3EGSA 4D3CL 3MCG1 5T1LD 4X6DB 2BC4B 1I8KA 3O41A 2GIYA 4OZHB 2P46B 4BKLA 3PE9A 1CICA 6FABL 2AV1B 5CZXD 5C08A 1MHEB 3UXFA 3PWVA 4X6CE 3AREA 2DBLL 3VXSA 1JK8A 2Y07H 4IRJC 2W91A 2LV4A 2C7UB 3GHBH 5E08L 3U79A 2PYEE 1E4WH 1MCQA 3KXFE 1RIUL 4LP5A 3EYFB 4JZNA 4N0UA 4WW1B 3E6FB 1S9WA 3STBA 1R3HB 4ETQB 2YUXA 4WWKD 1EDQA 5D7JC 3H9SD 4O02H 5F93C 5HDQL 3WFEL 3DECA 5FCUH 1KLUB 4Z0BL 2EYTB 3QG6B 5ERWB 4BA8A 4QHNA 2QHRL 1PLGL 5FCSH 5CZVL 4L4TB 4ODSL 3VFSB 4FQJL 1RZIA 3K8MA 3G04A 4S2SA 1YEEH 3WFBL 5IFAL 5C0BB 5DWUL 2W0FA 4U31A 3RWGB 1QLRA 3K3QA 4RWYL 4OF3A 4ZNEA 4PB9H 1DL7H 5DGQA 1FL5B 5KS9B 5E6IA 1XGYH 3ZL4H 1C5BL 3HC3H 4TVPD 1CG9B 1YYML 4HWBA 4LDLB 2GJJA 3NVQA 2A6IB 3HR5A 5C0CD 1CGYA 1S9YA 3JVGC 1H9VA 4G6MH 3OAUL 4NJAL 4LSPL 5E99H 4I0KA 3WUWG 3LN5B 3IRPX 1RUQH 5C0ND 4JREB 5F89B 3BT2L 1OQOA 3MOQA 4NO0A 4AENB 3VFOB 2ZCHL 2X7LB 3WN5B 1NEZG 1MRCL 4EI5A 3QIUD 1OAKH 4PJXE 4IOIB 4MNHA 4PGBA 1ZGLA 3MOAH 3DUUB 3SJVB 2OXHA 4JHWH 5DHXB 2DMKA 2A6JB 3MRRB 3MRHA 3ZYZA 5IMLA 1M6OA 3NZHL 3QDHA 5D71H 3O0RL 3FHQA 5J1TC 5FO7A 3ILQD 2CIIA 3B83A 4N9OB 1IGYB 2J8OA 4GS7B 2WM0A 4ZOCA 1FDLL 1FVCB 5EO1A 4RGMC 5C07B 3UJIL 4X9GA 4P46D 4G8GB 3MACL 4R2GC 2J7LA 1X7QB 1DFBH 5DS8A 3RNQB 1L4IA 1QBMH 3BPNC 2BNQE 1IEAA 2YD2A 1T2XA 2W65A 5C0RH 2VZVA 3FN3A 1ZGLM 4C4KO 2WV3A 4GRLA 4LPXA 5MEND 5BV7C 1OAYH 1WITA 3A67H 4PLKC 2A77L 4EZMA 4MVBC 1G7QB 1NLDH 5KSUB 5CEYB 1KLFA 1RIVL 3CIQA 3KPRA 5FO8B 4P2OC 4ZYKB 3ZSSA 3BP4A 2QQQA 5DJZA 1VACB 1OAQH 4CW1B 3IFOA 3IDJA 3BGMA 1AXTL 4RX4D 2YRPA 3P3YA 3D9AL 3NFPA 1I9RH 2DQDL 3ZDZE 4TULL 4LOUC 2Q7YA 1P4BH 2Z0BA 3L7EA 5BVJB 4NM4H 2HH0L 2O61A 3OJDB 1PY4A 4X80L 4KRLB 1MVUA 4UDTA 1AQDA 3O11B 3QXAA 1EA9C 3MV8D 1G7IA 5JIIA 3MXVH 3RWFB 1JNJA 1P84K 1QSFA 4XNQA 5B8CA 4OIIH 1LD9A 3F8UB 2FJFA 1TJHH 1XCQB 2PW1A 4K9EH 3UBXG 4AM0A 1YDPA 3ZKSD 3GI8L 5CEZH 1YN7B 5D7KE 3ZO0A 4H5SB 2NPLX 1NMAL 4HPYH 2J5LC 4XRCB 1RZGB 4GAJL 1ED3B 5CWSA 1ZWIB 1WK0A 1G0DA 4HCRH 4M8QA 1ZTXH 2DS4A 3Q6FB 4QO1A 2X42A 4PY7A 3MMEB 3GSVB 2DQHL 4ZXBD 2OBGA 3P0GB 2ITDB 5BQ7A 2AJZB 2R0ZH 3HRZA 4RRPA 4HXBH 3WV0A 3GBML 2ZOKA 3F7YB 5DK2A 5GSVB 4M48H 1REIA 3G5XA 1KJ2L 3B2VL 1WBZA 4P0DA 4UILL 5JW3H 3ROOB 2BHUA 2AEPL 3VXME 3BMWA 1ZT1B 3T77B 1N5YH 3P4OB 3ZE1F 2FH6A 1AI1L 2ZUVA 3VFVB 2GK2A 1FZJA 2BJML 2DYPD 2OXGA 5ISZE 4JRYD 3RA7L 4PV8A 3CVHH 3KYOA 1K4DA 1MLCB 2H6PB 2X1XR 4GMSL 1J1XH 5I66B 5HSFA 3BFOA 2VERN 4KUZH 3S97C 3VXOA 1B6DA 3MGTA 4GRMB 1FIGH 3DX6A 3R06B 1W0WB 4WENB 3NACL 1WV7T 1R3LB 3EUUA 4CRPA 4UOW0 2A9NL 2K3TA 4EI6A 4JO4L 1MCHA 5BZWB 1R24A 5GZNC 4XP6L 3AY4A 2IANA 1P7QB 1NCWH 3RPKA 5SX4H 2WBJD 3KPMA 3LD8C 3LH2L 3WIFB 2V7HB 4XCFL 1JPFB 1H5BB 3M17A 4X4ZA 5ENWB 2YSSA 2W1NA 4F7MB 3QUZA 3FAXA 3P4LA 2VKWA 4OCYL 4ZUVB 2Z31A 4I8DA 4H26A 4L3EB 1NCDL 3BPOC 4X99A 1XGUA 3QWOA 1ZVYA 1V3MA 2XA3A 4IOFD 1OTTC 3L7FA 5DUML 1D5MA 4X7DC 1FAKT 3TT1H 1G7PB 4N8VB 1RK1A 4YC2C 2IAMA 2H3NB 3T3ME 4Z6AT 4ORGA 2ADJB 3ILPA 2QHLA 4KY1L 2JJTC 4QRUB 3UJTH 4JFOB 2PXYC 3U0WL 1MJ8H 5GS0L 3SBWA 1MFAH 2X89D 2YMXH 4C58B 3ARVA 3G5VB 5D2NC 5C0DB 1L0QA 5K33A 4XMPH 2EC8A 1BD2E 2VLRB 3HNTH 5DQDL 1KXTB 3TZVA 1LK3H 2G5RA 5JZ7D 4FFVD 4YEFA 1NBVL 2JJUA 4HS6A 4NC2B 2NR6D 2VO5A 3TYGL 1IGIL 5DFWH 1AO7B 5FDYA 3KAAA 2HKFH 4HKBA 5JIHA 1ZLUH 3NCFB 2YZ8A 3SDXB 3K0WA 3QEQA 4HXAL 4WUUB 2VH5L 3F6IA 4Z7UF 4Z78A 1T5XB 4ZUTB 5ADPH 3D39A 4HX1B 2NY6B 1SY6A 1FL6A 1U8OB 5BRZD 5KSBE 4MQSB 1Q0XH 5D7JB 5CILH 4XHJD 5TH2A 1MCDA 2Z8SA 1Q9KA 4D0BA 3H3PL 4PJBE 4MCZA 4Q7DA 2B1AH 1ZSDA 1AE6H 3BN9D 5E1HB 2C4FT 3NIFE 1CQYA 3MV01 1OP5K 2W0PA 3CLFH 2J88L 1A14L 4NT6B 5AZEL 3LDBC 3S9DB 5ACMA 5E1AB 5FYJE 1E4KA 3OB8A 5ELIA 5CMAA 2WUBH 4MAYD 5T3ZD 3EFDL 2UYLB 1P5VA 4U49A 5J3HC 3VXPA 5INCA 2ADGB 2OL3L 5ICXA 5T1KB 4F9LC 3BKCH 1P84J 2VITB 4PYGA 4G9FB 2OJEA 5F3BB 5SWSA 3HMWH 3MLSH 5TFSH 1HSAA 2EE2A 2FD6H 3VCLB 1KT2B 1ZT7A 4PRHD 2WLYA 1B2WH 4YJZL 5ESVA 4OF0A 1FN4A 4KI5C 5C71A 1RZJC 1NFDB 2F53A 1R0AL 1F90L 2Y6SC 1ZHLA 1JNLH 4G6KL 4JN2B 1FNSH 3ALXA 3O3AB 4BH8B 4Z95L 3MV9B 4PRIE 3MYJA 3BD4A 2XKSA 3QFJE 5FOBB 2EXWC 1XF2B 2JB5L 4QRRB 4BSVB 3L95B 2GHWB 1DQLL 3SDCD 4MHHG 4U1HA 3FQXA 4P3DB 4AL8L 5D5MA 3VXQA 1SYSA 5DD6A 3QUYC 3BPNB 1J05A 3RGVD 5L2KA 3O2WH 2J4WL 4PJFB 3VXUB 1NQBA 5A43C 4NOBA 1BWWA 4GFTB 1D3CA 4JQVC 2I60H 4WIQA 2EDTA 3KPQB 1I8LC 1IM9D 1T7WA 3VFMA 2OK0H 3P73B 5HHOE 4OCXH 4PRAA 3TM6A 3TYFA 3IXAA 3PGCA 3MGOB 3GIZL 1XH3B 4GXUN 5EN2A 1XAUA 3MRGB 1HOCB 5D7IA 3BQUA 4KI5E 2VLLA 3PWNA 1A6VL 3F7VB 5IGXL 2PO6A 3UTSE 1XCTA 2XOTA 1GC1L 3QDJE 4X7TA 1G9NH 4GG8A 4CN6A 3RWIA 1RZKH 3OKOB 1K3IA 4NQCE 1GZQA 1VFAB 2MOVA 1YNKH 3EJZD 1BOGA 1IARB 4GUPB 4PTTB 3PL6A 3REVA 4JKPH 5GZOC 3RY6C 1G6RL 1ZEAL 4XB8A 1OW0A 1MY7A 4QY8B 1A6AA 1ZS8B 3ULVL 4K94C 5J6GB 2BDNH 2FIRT 3C6SA 2P24B 1NPUA 4QHMB 4L8SA 4YHOL 1T1XB 3MLXH 4H25A 2NY0B 3PV7A 4PJBF 4HGWB 2FB4H 2J6EH 2MNUA 1BBJB 1CU4L 5I6XC 4LIQE 5I1KH 5HBBA 3NABL 4ONFH 1EHLL 1NGPH 4K2UL 3V52L 2XTJC 5HGHA 1K85A 3D85D 3WIHA 3NPSC 3V5DB 4JRXA 4XCCH 3CLEH 1SEBB 3FT2A 1NCCH 2H9GB 4ZMAT 5GS0D 4KJPD 2DLFH 3IS0X 3QUMB 1RPQA 2XRAH 4NWTL 4XXDB 4D8PB 1QBLH 4I9WE 4OV5B 4YAQB 4CBPA 3C9NB 5C9KA 1YEHH 2FIKA 3UC0H 4JO2H 3CFDA 2MCPL 1F6FB 3GO1H 5F1NB 5GJSH 3HKFA 3QG7H 1J1PH 1A2YA 1VADB 3QXDA 4J3TA 4WV1B 3FONA 1FV1A 4Y88A 5KG9A 1XF3B 3BJ91 5TDNB 3D3VD 1P2CA 1KPVA 3BH9B 1LMKA 1A6TB 1GGTA 4H20L 5DHVB 4MAUL 1I1RA 3SHSA 3WEXA 3AS3A 5IK3B 2XTJE 4XAKD 1AGDA 5SWZA 3FRPA 4V1DA 3UAJD 1B0WA 1LO3L 4UIKL 1BFVL 4WDIA 3BN3B 1IC1A 4JFDA 1MFBH 5F9OL 3HMXA 4R96A 4APQA 3KPSA 5F7UA 4MD0B 1NJ9B 1FHGA 3MRKB 5DMIL 5T33H 3ARBA 1PYWA 5I8EA 1MCOL 4UBDD 4I48B 4NN6C 4P5TD 4C56D 4MA1B 5IHLB 4JM2C 4KC3B 2H2SD 5I1HH 1FYHB 3DLQR 3H0TB 3MA7B 4O58L 4X5XA 5FYKD 2DN7A 2FR4B 4YC2B 4PJ9C 3MLWL 4LAJH 2HTKC 5J1AA 3BGFB 5IFHL 2KPNA 2PXYB 1FLTX 1A6WL 1NFIB 4YHLL 4LLAA 4Q0XH 5M94B 5FYLD 5F7FA 1DN0B 5FHBL 3AMKA 3V5KA 4A2LA 3GUTB 4MQ7B 4XPGL 5L2JB 1P69B 2HP4A 5JW5A 3RZCC 3MUHL 1UENA 4Y4FD 4PJIE 4Q6YA 3T1FB 1I75A 1E4XI 2EYRB 1S9KC 2GK0A 3QHFL 2R9HC 3D0VA 1T5WB 2AABH 1QSED 3F58H 4U1JA 4OD2A 5D2LE 2X4OB 1MH5B 5JHDA 1MFDL 4RGND 2NY4B 3ALWA 4MJ6A 3QDGD 3LVEA 1AKJB 3UJJL 3HZVB 2DL9A 1BBDL 3SE9H 4L29B 4Y2DD 3TV3H 5EO9A 1UM5L 5DTFB 2SEBA 2E7LA 2W0LA 5I1JH 1ZA3A 1ZE3C 5ACLA 3MLUH 5IOPB 5DJXB 3MPCA 2RQ8A 1ZXQA 3BRDA 2CPCA 4X4XB 4IMKA 4K71B 3BI9X 1AR1D 4YNYB 3KS0J 4FA8A 5JLZB 4MJ4A 1IKFL 2WWMD 4L3CA 2D7PA 5HYJA 4X0KB 1MHPH 1M4KA 4ZAKA 2ESVB 2BVQB 2EZ0C 3ARUA 4KMTH 5IBUG 1J1OH 2VXUL 4ODHL 1QSZA 3VG9B 5CHNA 4UNVA 1J10A 1EK3A 1PQZB 3BP5B 4ISVB 5E94B 1CZ8L 3TJHD 4M7JH 3MV7E 5IQ7L 3WXWH 4Q9RL 3OKDB 3D2UA 4NDMB 4U7MA 1K8DA 4ZTPL 3V7AG 3ARFB 1A6ZB 3PXHA 3CX5J 3QDME 1S7SA 5DYOB 4BQ8A 3ZKMC 4YQXL 5CEZE 2VUYA 2NW2A 4XCEB 4K3DL 4RA3A 1UB5A 1YY8A 3QP3A 4XVSH 2HFEA 4KV5F 3BWUC 3ULVD 4Y16B 1V8HA 2RIKA 3LKRB 1A3RL 3MBEC 3TPKA 3WLBA 2JK5A 1RSFA 3W9EA 4GKSA 4L4VB 2GEEA 4M7LH 4YHZH 4PYHA 5IVZA 1EJOH 3U4BH 1FO0A 4POUB 4Y1AA 4WFHD 3U1SL 3GMOB 2Y72A 2I07B 4OFYD 4M4RA 3L3JB 5DJAA 5HY9A 5CKAA 5IR1B 3BKJH 1S7RA 4PJHA 3QI9A 1ADQL 4EIGB 2APWA 2P48B 2PNDA 4OLWL 4DCQB 3QSKB 4YPGB 4DTGL 5DRNA 5IJKC 3FFCA 1CLOL 2K9UA 1EVTC 5I18L 4IJ3C 1CFQA 2OM5A 4HKZB 2JCCF 4JVWA 2V2XA 1JPST 3ZDYE 1PKQB 3RUGB 1CT8A 4AZ8A 4CUCA 5MHSD 4CKVX 3RVWD 1K2DA 5EUKB 5BS0E 2P5WE 3LEXB 2NTFA 2VE6A 2CDGB 4ERSH 2PKDA 1U95A 3RVTD 2MHAA 3EOTH 3F5WA 4LRIA 4DK3A 1HHIA 2CK2A 2X4SB 4I0CC 1INDH 3HI6L 1UADC 3EO9H 1BZQK 4YDLB 4Z5RB 5D2LF 1ROWA 3HG1E 3TA3C 1JN6A 4OFIA 5HI3D 3WBDA 3TBWB 1QR4A 4LSQH 1KBGH 4ZFFB 4PD4J 5K9OB 2GSIA 1DQQB 2ENYA 1AD9A 5DF0A 1T04A 1YECL 4M6ML 2ZUUA 3P4MB 3TIDA 3QIBA 4G9DB 3IFPA 2DQEH 2D7OA 4NKDB 3O2VH 1MCJA 2X9YA 1JFQH 4H8WH 12E8H 2AXGA 2YK1L 4KJWD 3NMEA 3RIFK 1WIUA 4L8BA 2APVA 3WLWD 2BOBA 2OJZL 4HH8A 1KN2L 4DEPB 5DQJB 2LAGB 4ESKA 4Y4HC 4JFYA 3QUMH 2VWEC 1NGWB 1NANI 1MCBA 2OR9H 1CBVL 4HWUA 4NO3A 3IRZA 4QT5A 2W0KA 4KQ4H 1Q38A 4G8FB 5JMOC 1S5HA 2R2HB 2Q20A 3BIKB 2YPLE 3UX9B 3KLSA 3MRLB 1HHKA 2NW3A 5I76A 4IRJA 2XA8H 3RVUC 1WEJH 2Z8VC 4LLUA 5DZOA 1RZ7H 3SDDD 3TJEH 2CLRB 3I6KB 4OFVA 2ZUQC 2VJXA 5EU4B 3OF6A 4XX1G 3GRWH 1UH2A 4RCAA 2YWYA 3JXAA 3VXRE 3STZA 4H0IA 3EOYG 1HKLL 4LLMB 5GHWL 4CJ1A 4DGVL 4U3CA 2FLBT 3R8BB 1FVDB 5C0BE 3BE1L 3S96A 4NRYA 4PJXA 2E7CA 4R90H 1U3HD 4Y19D 3GJFK 4NUJB 2D4DA 2DQCL 4P3CH 4QRPD 1CWVA 2V2WA 1J18A 2JCCB 5JPMB 1V05A 3LQZB 3VJ6B 4MYWB 3CAFA 5C3LD 1KJ3H 4NO2A 3UTZA 5ANMB 5EC1A 1I7UA 5DEFB 2B0SH 3FMGL 1BIIB 4RZCA 4ZPTA 5GRVL 4FQCL 3KR3L 4JB9L 5IHBA 1I4FB 1NAKH 5L7XL 2WSKA 3JVGA 2BNQA 1X5FA 5I8KH 3MC0A 5IW1A 5JPNB 4LLDA 4XBGA 2HFGL 3MODL 1MFNA 5AZ2H 1B88A 3LKNA 1T83A 1L7IL 4FZ8L 1GL4B 1KIUA 3ARDC 1GGCH 4PJ8D 2FZ3B 3S88H 1IQWL 3OJVC 4GOSA 4YX2L 2I9TA 1BF8A 1AY1L 1EEZB 3VD9A 5CIPA 2XZCH 2VR4A 5DQ9B 4G3YL 3FOLB 4MDIA 2YHGA 5HHVL 2BRRL 4PLJC 5C07E 4I2XB 3ARRA 3WDIA 4LLQA 4G8GE 1ODAA 5IESL 1UVQA 1MAMH 4G42A 4JPIB 4RAUA 4GQ9L 1JF5A 3HUJE 3U6RA 1MI5D 1RZKC 3E8UH 1KG0B 4PY8J 1P5UA 5FV1L 1OSZA 3PXJA 4HWBL 5CLTA 3WHXB 3DO7A 3GI9H 4F3FA 3HFML 2NQCA 4F9PC 1VHPA 3PJSB 1JGLH 3H7BB 3KYKH 1LO0L 2CIKB 1FRGH 3ZTJH 5E8PA 4CDGC 4Z7UA 5JORB 3RWDB 4PRNB 2Y36H 1JRHH 1CFSA 2HG5B 4I3SH 5C0EB 4M9OA 4P2OA 2MWCA 4NO5B 3V0VB 4JFFB 4MD4B 2R15A 3AXLB 4PRDB 3HE7D 4CVWA 5EZOH 1CGTA 4H0GA 1QEWB 5AD0A 2BNRB 1FFPB 1KGCE 3MRDA 3O3UN 4XXCC 3RWHA 4LCUA 3CZJA 1G9MH 4CVUA 4NZUL 4TPRH 4CNIB 1G7JB 4M62H 4HFUH 2EKSB 2VLKA 5A16B 3BOVA 3VXMA 3B9EA 1XGPA 4RNRA 1JHTA 1HXMA 2AXHA 1TVBB 1H15B 3RAJH 43C9A 1TQBB 3SKUD 2BSSA 4P5MB 5ISZA 5I75C 2F5BH 1VFOA 1N6VA 5DR5H 4JAMA 1FFOB 4U6YA 4GBXD 1BQHG 4NFCA 2D03H 4NJ9L 4FTVE 1VGKB 4K3HA 3TVMC 4E41E 3KYAA 4X8JA 1QQDA 4OIAA 4YHML 3QT2A 1IAII 3RIFF 1MWAB 3FN0L 3CX2A 2DD8L 3LPWA 5D93C 2H26A 3OSKA 1IC4H 2LVCA 3TO4D 5JQ6L 4O2EA 1XGTA 4ZO9A 3H2WA 3BH8A 5TQ2L 2BSTB 1QFUH 3BAEH 3MBEB 3P0VL 1TJIH 1OAUL 3OX8A 4C59B 2H1PH 2YN5A 4JFHD 2CKBA 3VD3A 4XC3L 4OD1H 1ORSA 3HZMA 2QQLH 3FB6B 1RUKH 4A6YB 3OR7B 4P23C 2B1HH 3OGOE 3EIFA 2DJ4A 2J8UB 5FO9B 4NP4L 1EO5A 2LABA 5BVPH 2PCPB 5AWNH 2AJXH 4LKXA 5D96B 3TWCL 3BEVB 3W0WD 3CFIC 1CIDA 1EFQA 2AJUL 1MPAH 3J7HA 3MRIB 4BFBD 5BMFL 2CDEA 1Z0MA 3S5LG 4F33B 4GAFB 5DVKA 1AP2A 1A6UL 3KS0H 2BNUA 2MSPA 2XN9A 3X3GL 4OM0H 3A6BL 3WS3B 4H1LB 4CU7A 3SGEH 3HRPA 3PP3K 5E2WH 3UYOD 1BD2A 4DKEH 4D9QD 1A0QL 4JGUA 5T1LB 1CDHA 2FX9L 4PRPB 1WBYB 4MXVF 1H3GA 3PWPE 4LVHC 3FRUA 3UPAA 1KPRA 1YMMB 3E6HB 2FEDD 4EUPG 4GXVL 4KQ3L 2Q76B 1HCFX 1MQKL 5DEGA 1E6JL 1P6AB 1JTOA 2FJGA 3MNVB 2E6QA 1NGZA 1RU9L 5C8JA 4G6JH 5FKAA 5JIKA 1CLYH 4PV9B 1RJCA 3W81A 5INDB 1EO7A 1ZVSB 2L0DA 1EIBA 5KSBA 1UWGL 1A7RH 2HMID 5HHXL 2PF6A 3MUY1 3U9PH 5D72H 2BK8A 3RY5A 1B3JA 3H9SB 3BIAX 4IRZL 2QADB 4QHUA 4OLXH 4YXKL 5C08D 5DK0B 1HHGA 2JJTA 3WL9B 3ARED 2FSEA 1IAIM 1MIML 1KPUB 1EMTL 3M1BA 4DGYL 5JO5A 4PJBA 4BM7A 5IB1B 4IIQC 5DJ8B 5GS1B 4Y5VC 1KB5B 1NCUA 1W72A 3DROA 4XVUC 2EXYC 5D2NA 4Y4HB 3MFFB 4P9HL 4X6EB 2NLJB 2B5IC 3HAEA 4NNXB 2V9RA 3OR6A 4NGHL 3SDXE 1BREA 4NZDA 2UUDH 4J12A 3ESVF 2VXTL 1WVZA 4R0LB 3QIWD 1NLBL 5KVGH 4KJYB 1MJJA 2DDQH 4FQIL 4O9HH 3JV6A 2VXSL 3D0LA 3IU3A 4E42A 3MCKA 5IHUH 4X6BA 1NC2B 1A5FL 2Y5TA 3VXNA 4YWGH 1OGAD 1DP0A 1UZ8B 5CD3B 4MMXC 4E0RB 1NGQL 3IXTA 2XQYG 4AEEA 4LQFL 1S7UB 2Q3AA 3GSQA 3UP1A 5EZJB 1RUPH 1X5HA 1DQTA 4JG1H 3AROA 3QIUB 1NGYA 4P4KC 3WKML 2R0WL 1F4YH 2C3WA 2XYCA 4Y7MA 2AGJH 3K4ZA 4Y4KC 1CD1A 5DFVC 2CRMA 1WTGT 5DC9B 5HGBB 4R4FL 4WUKL 2APFA 3FOMB 1ACYL 3HCVB 5JTWA 1FIEA 5E2UH 3QFJA 1A1OA 4NO0D 4RGOL 4KMQA 5I15H 2I9LA 5KW9H 2X4TA 5MERB 1BX2A 3NA4A 4Q6IA 4G9FE 2Q8BH 5HVFB 4P46B 1CL7L 2AXFA 3PDOA 1EZVY 4HIHA 2DRUA 2FRGP 4C55A 4JO3L 3FKUS 2E7BA 4M93B 4F9LA 2D0FA 4G6FD 1KCUH 4Z7WF 4ZO7A 3D18A 5MENB 3GSUA 4MLSA 1UYWL 4KK9C 4DN4L 5HHOA 2EC9U 1CD8A 1FGVH 1SY6L 1FJ1A 1NAML 2V7NA 3GIVA 4BFEA 1LK2B 1EHNA 3W2DL 4OLVL 3PQYE 2YRLA 1NBYA 1Q1JH 4WFFD 1SJHA 1B6UA 1MCEA 7CGTA 1QO3B 3UTSA 3F65A 4QRRE 1QFWH 3QDJA 2IFFH 2FEEI 1F58L 2D7MA 5IEKA 2X9WA 5IM7A 1DEEA 4NQCA 3VWKD 1MY5A 1SBSL 2RCSH 4G43B 4WJ5B 3KPRD 2N7BA 1T0NB 4FQXB 3FB7B 5IQ9B 4OZ4A 2W9EH 2EECA 4PJAB 4KVCH 3C5SB 2LQRA 3QUYA 5I8CA 3U30C 1Y18A 2ZCKL 5HD8D 4YFDB 3I75B 2EYSB 2IGFL 3IGAB 1U8LB 1RHHB 2ZG3A 4XCNB 2UWEF 3PV6A 3VRLE 3O8XD 4Z8FH 5DJ0A 4HWZA 1I8LA 3GMQB 3EYVA 3C8HA 1PAMA 3GMRB 43CAB 3PHQB 3VGAB 1Z9LA 2GJ6B 4HZLA 4N9GB 1RZFL 2WANA 3KLHC 2HLFC 3X11B 3RWJA 2VKXA 1WZLA 1QSFD 4WHDA 5JOFA 1FYTE 4ODWA 2VZSA 2J2ZA 4QCIB 3DXAD 1MJUL 4KKBD 1M1SA 4HIJB 4K7PY 4MQXD 5F9DC 3C5JA 3PWUB 2QR0B 3BZ4B 4IRSC 1EFXA 5DC4B 3SKNB 4QXUH 8FABA 1GGBH 2FLRT 3GSXA 4YXLL 2GTZB 5I75B 5EU6E 2DYPB 5C2BH 1SM3H 3EYQC 5T1DH 2R23A 4HD9A 4BZYA 5GGQL 1KELL 3P0YL 1CD0A 2E9JA 4XCYB 5GQBA 5CSGA 1UACH 4CAGA 3V4VH 1DQJB 4OJFH 4WTZG 5ALBL 5F1SA 1RIHH 1WZ1H 2AJVH 5GJTH 4A6YH 5JDJA 5C70A 1U6AH 2HYMA 3NA9L 3ISWA 5DJ6B 1WZMA 3C08L 2FYYA 2VXVL 1BVLB 3Q0HA 2XWJA 4JHZA 1AH1A 3ZHDA 4JR9H 4YO0A 3NZ8A 2WBJB 1NUDA 5EC2A 1UB6A 4JRWA 1FPTL 1RURH 3MRCA 5KSAC 1LEKB 3EOAB 1LEIA 4DQOH 4RIRB 4XPHL 5E5UB 4JKMA 5KVFL 3WJLC 3CXHJ 4GRWH 2H8PA 1I1FB 4X5WB 4M1GH 4FZEL 2IAND 5E70A 1QR1B 1UM6L 1X44A 5GRUL 4M5YL 3FQTB 3EDFA 1SMOA