3MLUL

Crystal structure of anti-hiv-1 v3 fab 2557 in complex with a zam18 v3 peptide
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
218
Chain Sequence
YLLTQPPSVSVSPGQTASISCSGDKLDDKYVSWYYQRPGQSPVLLMYQDFKRPSGIPERLSGSKSGKTATLTISGTQSLDEGDYYCQAWDASTGVSGGGTKLTVLFGEGTRLTVLAQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved structural elements in the V3 crown of HIV-1 gp120.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light
total genus 41
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2010-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mluL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mluL01
3PQYD 4IDLA 4XRCA 5C71A 3RX5A 4FG6D 1I7ZA 3ILPB 1PDKA 3MV8B 3FQUA 4MAYB 4X7SL 4ODBD 1MPAL 1IZJA 1QBBA 2Y36H 1WC7B 1RZ8B 5BMFL 3QFDB 2VSCA 3BI9X 3T65B 3WIHA 2YWZA 1WK0A 5J1TC 1YN7A 3IAPA 3ARFD 4GAGH 3QXAB 1UXWA 3KYMB 3L3IB 4LARH 1Y6MR 3HMWH 1T3FA 5BJTB 3ULVE 2BSSB 4O9HL 2EDKA 3MXVL 5FDWA 1JK8A 1MCPH 1F5WA 3ARDC 4ZO9A 3ECBA 1BGXL 1MUJA 1G6RB 1NGPH 1RV6X 3MA7A 2VXSH 5B3JF 1AI1H 1PZ5A 1LEIA 4R9HA 1PKOA 2ADFH 5JPNA 1F2XK 1K5NA 3VH8G 5IHZA 1CLZH 1KGCE 3TBSB 4GMSL 2A38A 3Q3GA 1D5MA 3CCHB 1Q9KB 4O58H 1RZIA 5GJTL 1K8IA 3R0NA 4IRJD 2NY4D 5HHMB 2IFFH 1OAKH 4G8EA 4X6BA 1GSMA 3RU8L 3D3VD 2BP3A 3AU1B 1Y18A 5C09A 4R90H 2ERJC 3ARBC 4OUUA 4OTXL 4P2CG 4X98A 1FNEB 5BS0D 1MFCH 3EJYD 4NKQB 5IEKB 1HSBB 1M71A 1AC0A 4C56D 3AB0B 1NGQH 1NBYA 3GB7B 3QZWA 1A47A 4FFVC 5C0BE 1EHLH 5I1KH 5CUSL 3RWFA 3EOBB 3P77B 1KBGL 4WO4A 5B3JE 5TF1H 4HIIA 5F7EH 5JR1H 5ISZE 4F57H 2AJSL 5CWSB 4K7PH 5I8KL 3U9UA 3WHXB 5F6IB 3VGAB 2RFXA 2A6KA 3VFRB 3NZ8A 2MNUA 1H3TA 2X44D 4U1GB 3SE8L 4PB0L 1K6QH 2GITA 3X3GL 5F3HB 2VLJA 1NUGA 1KNOB 4BQBA 2AK1L 5IOPB 3DARA 3OXRB 4HH8A 1LNUB 2NYYD 5DJ8B 4YHZL 4PJHA 3T2QA 1NLBH 2I5YH 1JHKH 3L5WA 4LOUC 3DUUB 4H8WC 4GSDH 3RVUD 1U36A 4JY5H 3W0WE 4G8GB 2YEZB 5DVNA 3HZVA 4KHXH 4XX1E 1CXEA 3QPXL 3STBA 4F3FA 2QBWA 4DFIA 2F15A 4JZJA 1KCUL 5C92A 1TENA 3EZ8A 3QRGH 2WIIA 3TIDA 4OQTA 4G42A 2VR5A 1K6QL 3OGCA 2J7LA 1YY8A 4MLIA 4NNYB 3DV4B 1BEYH 4ZFFA 3WLBA 3AMLA 1FFOA 4QTIH 1CFQB 3BWAA 4HT1L 2EDYA 4J23A 4MVBC 3D69A 1N8ZA 1WITA 3GKZA 1ACYH 3FOMB 5EULV 1MCJA 4GAYB 1ZEAL 4G42B 5IMLA 1NMBH 3RJQB 4M8QB 1YJDL 1JL8A 3QCUH 4PRPB 4XP9H 5LKNA 4JZJB 5C0DB 5E2UL 3MUGA 2E9WA 3LS5H 5CJOH 3WFHA 4Q97A 3QEUB 4KXZH 5BOPA 2G5BA 5L9DH 1LDSA 5FA3B 1BF2A 1DQDL 3IF1A 3C09B 2GT9A 1LNUA 1SJHA 3IYLW 3ULVH 3PWNA 3S88L 4I8DA 5C9KA 4KV5E 2AJUL 1JIBA 2X4TB 5FUCC 3L3GA 5F9WC 4MJ6A 1RUKL 5IMOB 5J3HC 2WMPA 3EYVB 1LO5A 3T0ED 1X4XA 4YDLC 2RIKA 4ELMB 1N3NB 1QHOA 2IAMA 4PLJC 2Z91A 5T1LD 4PS4L 2BMKA 3MJGX 1UH4A 2VXSL 4XVJL 1O5DT 1NAKH 1L4IA 2EIDA 4WEMB 3VXNA 3ZKQD 4CDHA 5GS0D 2Q8AH 3JV4B 4NO3A 3MLZH 3MRMA 4P2QA 3VD4A 3ROLA 4FA8A 5I73B 4X5XB 4FTVE 5JR1L 5ID1B 1NEZA 2D7TL 5DMJB 4OZ4A 5C0AA 3MUGB 4HPOL 4JQVC 4PGCA 2GHWB 5FO7A 5I9QC 2DQGL 1PEZA 4JM2B 3ECBB 1A02N 1XGQA 2VIRA 1TFHA 4Q0XL 1CWVA 4HFUL 4UTAL 2BNQE 2IH1A 4LSTL 4XVUD 1QFWI 1TITA 2CD0A 3NCMA 1JZ5A 4K23H 2DM2A 1UM6H 1WCQA 3HR6A 4DUVA 5HI3D 3MV11 1BWWA 3I6GB 5GZOC 1ES0A 4OZFG 4YO0B 5GRJH 2NYYC 3KJ6H 2CK2A 3HR5A 1OWWA 2ITCA 3D85A 2PTTA 1UT9A 5TJWK 1CE6A 5CZKA 4OZIA 1UKQA 1CDIA 1J8HD 4LHJB 1EZVX 1MNUL 3QIUC 2YS4A 4KK6D 3GKWH 5EN2A 1T3FB 1ONQB 1ZK9A 3OKKA 4AM0A 2HN7A 3WIFB 4UDTA 4LEOA 1NMCC 3VD7A 2AEPL 4M5YL 1FYTB 2CIIB 2XICA 4ONHB 3QQ3A 1NBQA 4XBEH 3MNWB 4UILL 3QXVA 4JO4L 2BNRE 3CDFA 5BQ7A 4HFWA 5CSGA 5C07B 1IC7H 4O4YH 1MCWW 5I9QB 1OAYL 3QIBD 2DMKA 1T7YA 4JFEE 1A6UL 2DQCL 2A6KB 1DQTA 4XTRC 5F3BA 4R4BB 4L3EA 1H0DB 1QEWB 5FOBA 5EPMB 4JRYE 3OTTA 3I02B 5IVZB 2F54D 5CBAA 3D2UA 4K8RC 4PJIB 4JANA 2EZ0C 5HYIA 1S7VA 5DYOA 5F7UA 3UO1L 1OARH 2VE6A 2P49B 2NY0C 2GJ6B 1EAPA 5KANG 3I50L 4OQTL 1NBYB 3GB7A 4RRPG 2VN4A 4FQ1L 4FQQA 2HLAB 3MFFB 1NAML 3JV6A 1UACH 3TFKC 3V4PL 1FNEA 4PRNA 3CFJB 1HKFA 2PW1A 3BEVA 4JEGB 3IDJA 4LCCC 4GRLA 4XI5D 2N7AA 3EZJB 3HC3L 3IDYC 3C5JB 3SCMA 1RIUL 4U6YB 5IWLA 3UTPD 4BJLA 5ANMB 3WSQL 5MEQB 2D9CA 1RJZA 1D5MB 2YSSB 3C6LB 3EYUH 2DKUA 1ZAGA 1IRAY 4LEXL 4MA7H 4X7SH 5EDXA 4PRPA 3RZCA 3GRWL 2XV6B 4Y4KD 4LHUA 3WFBH 3H6JA 5D7JA 2GSIB 3MRBB 3MRQA 3Q6GL 4GAYA 4WI8A 5IK3B 1FV1B 1IGJA 4OSUH 4FFWC 1RULH 2XZZA 4NBYB 3ZHLA 4D9RD 2W1NA 1Q94A 3RVTD 3RGHA 3MYJB 1I9EA 1QVOB 1INEL 1B2WL 1MCPL 1C08B 5BZDB 3K74B 1J1OH 1V05A 4RDQG 5IV2B 1XEDA 3MSPA 1JRHL 1MIMH 2ED8A 3L9RA 4NYLA 5C8JA 3OAZH 1AP2B 2YD9A 4U1MB 4R4ND 3MV8A 4EOWH 3PJSA 4OFIA 3EYSH 4D0BA 1MHEB 2Y7QB 5IGXL 2R2HA 4M1DL 1BIIA 1NC2D 1UVQB 4EBQH 1QQDB 2COQA 1S3KL 4I18B 4PRBA 3TJHC 5DC9B 4G8FB 3C5JA 4LDOB 4PV8A 3DX9A 5GRUL 2ZNXA 3GJEB 2VLRA 1AO7B 2I26N 4AEIH 1FJ1A 1TJIL 4NQCD 2XZCH 4UT7H 5E8EB 1JGLH 3UJJH 4PUBL 3TBVA 4LHUD 1CTNA 5F6HJ 3RVXD 2IPKA 3SGEH 2LQRA 2OSLA 4OD1L 4X4MA 1T03L 4DOHB 2MHAB 3GJEA 5DUML 4GKOA 3RWFB 5DS8B 1A3RL 2QQNH 5IEHA 5E7BA 2F53A 2WINA 3ARGB 3C5ZD 4GW4B 4JFFE 3S37L 1F11A 3GGWA 2FSEB 3HMXH 4MCZB 4GS7B 4D9RE 3CFEB 4K3DL 1EFXA 3E8UL 4GT7A 3GBNL 2GEEA 3BE1H 1JNNL 3UAJC 3GSXB 3W2DH 3C5SB 1I8IA 3H9SD 5CINL 3BN9D 2P5EA 1P1ZA 2NY7L 3BDYL 4P57B 4BZYA 4AY0A 1XF3A 3MLUH 2Z35A 4AM0B 4YAQB 3VFWB 4P3CH 4HCRH 1YYMH 2ZCHH 5CCKL 1WIPA 2F5AH 4NKIH 4ZOBA 2D0HA 1UVQA 3QWOA 3GMQB 3DRTB 5D7IB 1I9JL 4NZUH 5FYJU 3EYUL 4D9LH 3RI5K 5D7JB 4GRWE 4UNVA 5HDQH 1FL5B 2VRAA 2BHZA 4EKXA 1C5DA 4OGXH 3B6SB 1PGRB 4AK1A 1MQKL 5HTSA 4U3CA 1I8MA 2VDPL 3KPMA 3FMGL 5D5ME 1G1CA 1NAMH 2BJML 1DN2A 4RMVA 4OF8A 3OKNB 5EUOE 3TJEL 1GC1L 3TCXA 1FAIL 4OGYH 3O6FA 1EJOL 5C0NC 4WNQB 4G7VL 4LP4A 1IGJB 3CFJA 1KENL 4NKDB 4G6AC 3LDBB 3FN0L 4ETQA 2R0KH 4JFDD 2GKIA 3HI6H 4Y0GA 4YDKL 5DJXB 1IAIM 4ZYKA 1EEQA 3G5ZB 5T3XD 3OF6D 1NCCL 5F7MC 4IOFD 3WXVH 5JW4N 2IPTL 1GL4B 5HHXH 4OD3H 4QY8A 5C0EA 3RA7L 2QKIA 2FJFA 5DWUH 2PXYD 4P9ML 2YK1H 43CAA 1QRNB 3SE8H 3FJTA 4KY1L 2D2OA 4EN3D 3ULUH 4DKEH 4GLRI 2B4CC 1HHIA 4Z5RB 1UM6L 2AXGB 1RZGA 3RUGF 1SJHB 1MJJB 4UIMA 5I15L 1EEZB 3CSYB 3TLRA 3MBXL 4LSSH 2RAMA 3VFSA 5E00A 5ABDE 4JGUA 4M4PA 2QQNL 2UWEE 3EGSB 5C0FA 3I75B 1YECH 3G04A 1AGBA 3QDMA 4TVSa 3IDMA 3WNMA 1LQSR 5GIRA 5TE4L 2R2BB 3D6GA 3NZHL 4K2UH 4YGVA 1A8JH 2GTZA 2L7UA 1XF2B 3T4YA 3X14B 5C2UB 5LWYL 2R8SH 2VH5L 5AAWA 1X44A 3I6KA 4UNTA 5ALCL 5SV4A 5TE4H 3DX8A 3T0XA 3MOBL 1FORL 1Q9OA 1T2XA 3CFIC 4D0CA 1EPFA 4HXBH 1JF1B 5IROC 3B83A 5C0JB 5B4MD 1Q0YL 4BQ8A 4WV1C 4YHOL 1OGTA 1G7QA 2R0WH 4Z7WB 2UUDK 3E1F1 5ICYB 4V1DD 1P4IL 4RZCB 3VFMB 1I4FA 3QULB 4QHNA 5L8LB 2BVYA 4F9LA 4AEEA 3V79C 1OAZH 5EUOB 4U05A 2AXGA 1RHHB 1DFBL 5B39A 3MRJB 5D71H 2FB4H 5J1AA 5ICXB 2A2QT 1QRNA 5FO8B 3W9EA 1UG9A 4N5UA 3GSNA 4KKBC 3SJVB 4WV1A 4G8IA 3WDHA 1JF6A 2BC4B 3VXNB 2KQNA 1A4JB 2D4FA 4N8CH 1XGPB 3OKDA 3E6FB 3CMOH 1WBXB 5JXEA 4KRLB 2AQ3A 3SCMD 4EIZC 1R3JB 3EFDL 1U92A 1YY9C 1JPFA 4P5TC 5D2NB 3S88H 4K3EH 4HWNA 3DROB 4RQQA 1IE5A 5LGJA 1JTTA 3MRQB 3S35X 3KPSB 5L88H 4U1KA 3D0LA 2Z4QB 2DWDB 4TTDC 3GMRB 2P48B 4U33A 1KIPA 3UYOD 1X5IA 4O02H 4K07A 1FNFA 3RBGA 3MUJA 3LMJL 1MY5A 4FXGB 3EOBA 4M7ZC 3LN5A 3LKNA 1NFKA 4JO3H 1UM5H 5CILH 2VKXA 4P9HH 1U6AH 1D5ZA 5F7KC 4S1QL 3DO7B 4I3SH 5C07E 4UAOC 4CU8A 3HI1A 3K8KA 4KAQL 4YH6A 5JHLH 5F89B 4H1LA 1JHTA 4PRNB 3HZKB 1OGAB 4GUPA 5KOMC 1IAMA 2M8XA 2BSTB 1M6OA 2FRGP 1J05A 4UI2A 4KFZC 2GJJA 2Z4QA 5C0BB 5L8JB 3WUWB 4A6YA 4W6YB 1M05B 3PWPA 5E8PA 4LVHB 1AIFB 1YEHL 2P8MA 4NNXA 5I1DB 1L9MA 4MNQD 1HHKB 5BOZG 1P7QD 3O3EA 3ARYA 5EUKB 2ILLA 3VG9B 3D5OF 4NCC2 4HLJA 4HKBA 4XCFL 3P9MA 5KSVA 1KCVL 3QR2A 4G8IB 3AREC 2YA0A 5TE6H 1AFVH 4QXTA 4GQ9H 2NY4C 1BJ1H 5D6DC 2O5XL 5I17B 4JKPL 4NM4H 3RUGA 4IS6A 2EDOA 3W82A 5KSBE 4YIQA 3I85A 3BZFB 5CSBA 1UYWH 1V3MA 5DD1H 1E6OH 1YPZA 4XMLH 4HG4J 2NY1B 3HUJA 1SBSL 5E56A 2Y06H 4WU7A 4FQLH 4NZJA 5KSUB 3HE6D 2ENYA 3P4NB 1SYVA 1AR1D 1A5FH 4K8RL 1V7ML 4C83B 3BFOA 3FN9A 1W72B 1XF2A 3LHPH 4M6ML 3IETA 3UZEA 1OD7A 1S78C 3UYRH 5B3NA 4TPRH 1MVUA 4JREB 3NCBB 3ZDXE 3TO4D 2IQ9L 3K46A 1HDMB 4NRZB 4ZOCA 1HXMB 5DMIL 5BVPL 5FUOH 4PD4K 3QWRD 3QZWB 1T0MB 4TPRL 3PL6B 1I1YA 4Y5YB 1C8PA 6FABH 2XTJE 3MGOB 5EZIH 3PGDA 3F12B 4HK3N 4MXVF 4F7TA 2EIBA 3PGFL 1SY6L 2AJVH 4PJBA 2QKIB 4Y19D 4P23D 4JFHE 1ZHNB 1U92B 2EE9A 4LLMA 2VZVA 4W68A 5ELIA 4EN3C 3QIUA 1WFNA 4HIIB 3D3VA 5EWIL 5ESVA 4DN4L 1Q9KA 1V3LA 4YBHA 4KJWC 2XA8L 4OJFL 1IKFL 2V2XB 4RGOL 4I2XA 1E4WH 5GGSA 1INDH 2BXYA 4R96A 4JZOA 4RFEA 2H2SC 3HC0A 2D9QB 4BFBD 4BH8B 4M7LH 3VGBA 1CFSA 5HVGB 2EKSB 4QEGA 5CP7B 1DQJA 1Q8MA 2HTLC 4R7DA 3OB0K 4X98B 3TJEH 1VGEH 1B6DA 1BQHB 3O4OB 4OV6F 3VCLB 2EDWA 2J8UB 1JK8B 3HA0A 1KPRB 1OQXA 2DQTH 1MQKH 2ZPKH 3QUYD 4TTDD 3SDAC 2P5WA 4WU5B 3VFGL 2WW8A 3CCHA 3NFSL 4MA1B 4X99B 1GZQA 1PG7X 1CFTB 5KS9E 3BIBX 4Y1AA 2KKQA 4XI5C 4GOSA 5SWZA 4OAWB 5IW6B 43C9B 2B5IB 1S7QB 1RSFA 2OL3B 3KPOA 3ULUD 3FRPG 5IB2B 4F7EA 2DL9A 1TNMA 3MBXH 3CZFB 5E8NB 4S0TD 5EH1A 2VXTL 4P5TB 4ZFFB 2FECI 3NN8A 2V2XA 3HUJB 5E1AA 5FDWB 3KNBA 3VFWA 2PR4H 5GSVA 4PV9B 3S98A 3WUWG 5TE6L 4OLXH 4NNPH 1GHFH 2CJUL 3ZKXC 4TSCH 4IRJB 1RZ7H 3PABA 2BCKB 3ZTNL 3TCLA 4GMTL 1IGTA 1VDGA 4NO0A 5K93A 3ZT7A 1KJVB 1F3RB 2IQAB 1DE4A 1CG9B 1A22B 2DAVA 4B53A 5I1EL 4QY8B 1NGQL 5HBBA 4CMHC 3T0EE 4A6YH 4MNGE 1QLRA 4OLVL 4OT1H 4BM7A 2P8MB 1MCOL 3WJJA 1NDGA 4UBDD 4PUBH 1JGDA 1P69B 3GBLA 4J12A 4QRPA 1NCDH 3EHBD 4C56E 3UTTE 3T3ME 3N9GL 1VKXA 4U4BA 2YUZA 2KPNA 4MQ7A 4HUVB 3SDXE 1CE1H 1KT2B 5DA0B 3NFNA 1KB9K 2UVFA 4X5LA 1Z3GH 4P49A 5IVXB 1A7QL 2XTJD 3HN3A 3QO0A 3CLEH 3SDDA 2OZ4A 3SKOB 1R24B 4PRID 3ROOA 3T0DA 1I9JH 4NZUL 1BZQK 3LHPL 4M6MH 3MBEC 2SEBA 2V5MA 4HV8B 4G6KL 2E6PA 5EOCJ 5K9QI 4U1KB 2OR9H 1BF8A 4DGIL 5D7IA 4LCWB 5AYQA 3SDAA 4JPKH 4QXTB 2Q3ZA 3LQZA 4PJCF 4Q9QL 1DBKH 2OI9C 5ID0A 1ZSDA 4NUJB 1A7PL 1I7TB 1F3JB 4MA8H 3WHE1 5CIPH 1A7QH 4YFEA 2LVEA 2WNGA 3BEWB 1U8MB 3T0WA 4PTTA 1OAXL 4LCWA 5CJXA 4MCYA 4U1JB 5FYKH 3MRJA 2W38A 2XN9A 4MA8L 1BMGA 5TGBB 4PIRF 2IMNA 2DM7A 1UJTA 2F58L 5DDHB 4F7MA 2J88H 1CIDA 5MEOB 1UENA 2CMRH 4X4XB 3TO4C 3W2DL 4X6FA 2BRQA 4RZCA 4XCFH 2OQJB 1DL7H 4PJ5D 2ESVB 3BP7B 2JJWA 2B0SH 1VFBB 5HHXL 3NMEA 3EO9H 3REVA 5E2TL 2EDQA 1N5YL 2OJZH 4QLRA 2YUVA 4HEME 1F4YL 2EC9U 2W0LA 3HI5L 4ZUUA 3BPLC 4H88L 5L6YL 1HYSD 3ALXA 3PHOB 1Y0LB 5KVFH 1VCAA 1UYWL 2EXWC 1Q1JH 2M1KA 1K8DB 5T3ZL 3TNNB 4FQQB 3TIEB 2Q76B 3CDGB 3QHZH 2CLVB 3VG0H 2VLRB 3BISA 3QDJB 4IHOA 4RQQB 2ADGB 2R29L 5JZ7D 3P77A 1PYWA 1CD8A 1DN0B 4JANB 1OTSC 2X4PA 1BBDH 3S36L 1T7VA 1UCBL 2X1OA 1K85A 1K3ZA 1YPZB 3L7EB 1JRHH 2BY1A 5C6WH 1P5VA 3BXNB 2Y5EA 3GSNL 3OGCB 2DQDL 4S10A 4Q6IB 2PETA 3MQIA 4U7MA 4YEFA 3KPRD 5DJCA 4Z7QF 5E9DD 3V8CA 5MEOA 3NCFB 5ENWB 1RPQA 1MY7A 3OG4B 4OFYA 4PJ9B 5DEFB 5HI4C 1MELA 4FTVD 2DQUL 4EUPH 1DBML 3RGVA 2V7NB 4PRDB 3DUUA 2VTFA 1T03H 3TBYB 5HYQA 5CD5C 2AI0H 4L29B 1B0WA 4P2OC 1Q94B 2CR6A 3BP4B 1A6WH 1KYOK 4FHBD 5E8PB 4K9EC 4JPVL 4KKAC 1A6VH 3TJHD 1OSPL 1XCQA 1G6RA 3EOAB 4MLSA 4Z7WF 4YHIA 4N0UA 2VO5A 3TA3A 4PY7B 2O93L 1S7WB 3RBSA 3UYRL 3PWPD 5FK9A 4UUJB 3K7UA 5E2VH 4PGBA 4M93B 5IVXA 3VXQB 4KH2A 4Y4KA 4JREC 1U8LA 5F6HI 1J0HA 3V6BR 1H5BA 1U3JA 4H26A 1RZFL 1I7ZB 4MAYA 4R0LC 3Q2CA 5ETUA 1BOGA 3B9AA 4XVUC 2DQTL 1UZ6E 4O2FB 4IMLB 3CPLA 5KSAB 4QRPB 5F72S 1DQQB 5GS2H 4JLRB 3GJFA 3U4AA 3LKOA 2RHEA 3P4LA 2P24B 2ZWLT 5FGBA 4NKIL 1ZLWK 3FHAA 3RWJB 2JB6A 3HE7D 1NUNB 4KUCD 5T3ZD 5EPMA 4BFIB 2DYPD 3HFMH 3IAGC 1S5IH 3CSPA 4GRLD 2AQ1A 4AEHH 2MQCA 1RAMA 1MREL 3JXAA 3VRIB 4Q9QH 4EQ3A 1T7WA 4PLJD 4EUPB 2LTQB 5I16A 1K3IA 3RAJH 5E08H 3PWNB 4RMUA 1MHPL 1QNZL 5H2BB 4X6DF 5TH2A 1LVEA 3DTXB 4PRHE 1BZ7A 1T22B 4LARL 2R23A 2ZUVA 2ZOLA 3MRLA 4KUZL 4NQCB 4P5MA 1W0WB 3HG1E 1IGCH 5CHNB 2YD4A 5DVMA 1RURL 5JOFA 1VACA 1BECA 1MFBH 3A67L 4CJ0A 3H7BB 1QSED 3HTLX 4R90L 3VFVB 4M43L 1A64A 4WUKH 4JFDE 5DT1L 2CDGA 4I48B 1K4CA 1N8ZB 3RL2B 1KJ2L 4QRSA 3EDJA 1F4XH 1G7PB 1FO0H 4LCUA 4OIIH 3O3AB 5IGXH 1IAOA 1NJ9B 2PN5A 2VWEE 3H9SB 4M9OA 3IFOB 2GSGA 4UINL 1YNKL 1IGCL 3HLAA 4CVZA 3H7LA 2ERJB 4JM2C 3QIUD 1RZKC 5F1NA 4EVNA 1INQB 2EIEA 4YE4L 5EORL 3DUHA 3IFLL 3VRIA 2EDJA 1F4WH 3MLSL 5D8JL 1E4XH 1CU4H 3PP4H 2W9DL 1NCTA 5A2IH 3ZHDA 4F7PA 3BDXA 5I75C 4GXVH 3JVGC 1BVLA 5E8OB 2VLKB 4JGMA 5IOPA 3G5ZA 1DN0A 3WE6B 5FYJE 3LRHA 1TTUA 1S7TA 3DMMC 3SDDD 5JOPE 3VE0A 5AZ2H 5MHSE 4GXVL 3VXOA 4HBCL 3NCJL 4Y2DD 1RUMH 4PJCE 4F7EB 3U0PB 4L9LC 2PCPA 4NIKB 4S1RL 2A83B 2A77L 3PDOB 4ODVH 4U6VL 1ADQA 4CL7A 1FSKB 1MAMH 1E28A 3P0YH 3P30H 3QG7L 4PJEF 1QFOA 2BFVL 1CT8A 4U6VH 3V6OC 3PL6C 3I50H 4XVSL 1MFNA 1Q9LA 4QRQA 4NFCA 3TO4B 2NY5H 3MRDB 4JFFD 3BEVB 4IRZH 4X6DB 4PRIA 3TN0C 2IWGA 3EOAA 3DV6A 3KLHD 3RKPA 1RJYA 3V9FA 1U8KB 4MX7B 2P8LB 3ARDB 1CVSC 5I1CL 2D31A 6FABL 3PQYA 2I07B 1BVKB 4M8VA 2X4RB 5FKAA 3BRFA 1PKQB 4LGPB 4UB0H 2DBLL 4ODVL 4QOKA 3RY4A 3SDDB 5L8KB 4L4TB 5E8OA 3GSVB 3O3BA 1EO8H 5J3HD 5FF6A 1EBPA 2R56H 5CAYB 2VDRL 1E4KC 2J4WH 3TBSA 1XF3B 3SKJH 1FZJA 2VLMD 5MEND 1QFWH 4KKLD 3MRKB 4KQ4L 2IGFL 4R4FH 5TQ0H 2OLDA 1AKJA 5E99L 1TPXC 4OLEA 3DGGA 2WWKT 3L1OL 2ZUUA 5D5MB 1N4XH 3HZVB 4YR6B 2AJVL 3JWDH 3BD4A 3O9WB 1G7QB 3FL7A 4Z7WA 2C1PB 1MREH 2XG5A 4KKCD 4GRWB 5J57B 3JUYA 4R8WH 2VXQL 1UB5B 5EU3B 3W0WB 4M1GL 2E9IA 4ISVB 1T1XA 4F7CA 3V6ZA 3O45A 2JCCE 4Z7VB 5JHDA 3RJDA 5DC0A 1VACB 4YUEL 2CSPA 5HHOD 1MAKA 1XF4B 1OWRM 4F80A 2Y6SD 1FG2B 2A74B 3MRCB 4FTVA 4NQTA 5F1IB 1A6TA 3T0AA 3TZVB 3VXSA 2VQ1B 5ACZB 3DURA 2DB8A 3HE7A 1BVLB 1X5AA 3BZDA 4R4NC 2H45A 5IWLC 2VDNH 3NIDE 5HGBB 5LBSL 3W11C 1K4DA 5L2KA 1OF2B 2YWYA 1HSBA 2P44B 1TZGL 4OZHA 4LP5A 1X5LA 4M7ZB 1C1EH 1XCTB 2FHBA 1S7QA 4JDVA 4UTBH 3GMOB 4OCRH 4D3CH 4NKOA 4H0GA 5BXFB 3QXDA 3BEWA 5A2JH 4HC1L 5HD8D 5IVNA 4WW2B 2Y5TB 1N3NA 4PGDB 1T21A 1NC2B 1ND0B 2J8HA 4M5ZL 2G9HB 1MIEH 2X4UB 3CPLB 2R1XB 3WN5A 1WISA 2FL5B 3MROA 1QA9B 3PUCA 4LLUA 1F8TL 1YMMD 3LZFL 1CXLA 2YA1A 4R96B 5IMMA 3LKSB 4YPGB 3NIDF 2XIDA 3CC5B 4PJEB 4FZEL 5IBLC 3C6LA 3VI3F 1YEFL 3T2OA 5IJVA 4OD1H 5BRZE 2ZOLB 4TUJB 2XQYG 1FBIH 1X7QA 4KROB 1JZ4A 3SDCD 1NSNL 4K94H 3KPPA 4F58L 3LKSA 1C5DB 3MGTA 5C86A 4AG4H 5I1CH 5E4EB 4IMKC 1RJLA 1XAUA 4PRIB 1XGUA 3V2AR 5D1XB 4YXLL 2IF7A 2HJFA 4ALAL 1UJ3A 3BPCB 1P7KB 1AGCB 3DRTA 4NWTH 1NMBL 3V52L 3SE9H 3QUZB 3ZE2F 4NO0D 1FFRA 3H9HA 4OFDA 3DROA 2HFGL 4PBWD 4XMKH 1G9EA 4HX1A 1HINL 1QRKA 3ARFA 3FFCD 4BZ1H 4P2RD 3D48R 4YXHH 1CGYA 1MJJA 1TCRB 5BO1H 1MLBA 2ZCHL 2MPAH 1RUAL 1H3XA 5AZEH 1N4XL 1N6VA 2V5SA 1TTGA 4PJDB 3N06B 4Z7QE 1D9KC 3PWLA 4XVJH 3VWJB 5I1GH 3ZYIA 1J87A 1RMFL 4I9WD 4PRPE 4X4YB 4YLQT 4Z9KB 1I8LC 1T20B 4FOMA 4C4KO 1G7JB 3BOVA 5CBEB 5JORB 2YPLD 5DD3H 4I4WA 4KTEH 4HGKC 5CEZD 2BK8A 3QUKA 1Q9OB 4KRPB 4C55A 2IAND 4QXGL 1CGSL 2NXYD 1MWAB 2VOTA 3QIWB 3P4OB 1QSFE 4JHZA 4AENB 1FZMB 1B88A 3SPVB 4Q6YA 2ZOKB 3HMXA 3AXLB 3FT3B 1EO5A 1LO4H 4HPOH 2BY3A 4HK0A 4U6HA 3LKQA 2RCSH 3KXFE 4QO1A 2F74A 6CGTA 3OR7A 3UBXI 5D4QA 1WV7T 2JJSC 5DJ0B 1NGXB 1U42A 2FYYB 1YEKL 1CK0H 3QUMA 3RX7A 5JXAH 2EEAA 3P0GB 4X9FA 3R06A 1XGQB 4ZUTA 4Y5XA 4OSUL 1WBYB 3DRQA 1RJYB 3UTOA 2F5BH 4GLRH 5HYJD 1IGIL 4HGMA 4XPBH 1YUHA 2W0PA 4LRNH 4JJ5A 1BD2D 2NPLX 4R2GB 1KIUA 3F58L 3HC0B 4UQ2A 1ND0A 1OAUH 3EYFB 3VXRE 4AL8H 1C7TA 4TVPE 1AY1L 4QRUA 4RGND 2IAMB 4JG0L 4LCIL 3UTQB 4HWUA 1YMME 3NOIA 3NABL 4XWOC 4WI5A 2E7HA 2VDKH 2RQ8A 4DFHA 3FB8B 3W5MA 3IFLH 1MH5A 3R8BB 3RWIB 2XZAL 4LAQH 5GRWA 3R8QA 3FO1A 2DQUH 4OI7A 2VLLA 2V7HA 4ZUWA 3K4DA 4NZRH 1D9KB 3FFDB 3M07A 4QT5A 1AGFA 4G6ML 4P4RA 5C3LD 3QIBC 1FSKC 3GJFB 3A0OA 4RFOL 5DFWH 4JO3L 3HNVL 4Z7UA 2BY2A 4DZBB 2P5EE 1FRGH 2XKNA 3O6LH 2YMXL 3S4SB 4MD5A 1VFUA 1UADC 1U8OB 1QLFA 4J3SA 3F7YB 2PTVA 4PG2A 3VXUA 1OAYH 4S2SA 4Y5XB 3FTGB 2X70A 2R2EA 3IU3A 1UQSA 3S34L 5T3XL 2EYRA 4G8GD 4LCUB 4OZGA 4N9GA 3BYTA 1FFOB 2ARJA 2HFEA 4XAKD 3WS6C 5JOPD 1LWRA 5MHSD 4JRXA 5T3XH 3MODL 3QNXA 4WHCA 4D2NA 4UDUA 3QUMH 4J3UA 1U3ZA 5GZNC 1ZHKB 2FIKA 5DJYB 3CH1A 2ID5A 3AS1A 2AXHA 3REWB 4PJAB 1VADB 2NXZD 3SKNB 1PEWA 3D85D 3EGSA 3W5NA 4HWEL 5CJ5A 4FQJH 4Y16B 1OTUD 5EC2B 5F71A 5FYKL 4K7PL 5D1ZC 3U30B 4L1DA 2WZPD 4G6JL 2EDEA 4OZIF 3Q5OA 3TN0D 5E1AB 3MYJA 2DD8L 3C60B 2X09A 3HNTH 7FABH 1YYLH 1EDQA 5IMMB 4HWEH 3MGAA 5I1DA 3SKNA 5K9OB 5KVFL 1GGYA 3E2HB 2EDDA 3OJVC 5F3HA 2VN7A 2DJ4A 1BWMA 2DS4A 1PJ9A 2EH7H 4RFNC 5I71C 4HUVA 3F7PC 2MTPA 4KUCF 5JHLL 5CS7A 4EN3B 1T2QL 2DJSA 1N5YH 3ILQD 3BKYH 2CK0L 1T66D 4D0DB 4DVRL 4JFQA 4JFEB 5D2LE 3MV7A 1MCCA 1NCBL 4LKCA 4V1DB 5FB8A 5F9AC 4HBQA 2JK5B 3STLB 1QG3A 5D96C 2QQLH 5JXED 2R2CA 4LL9A 2KBGA 2F8OA 5EO9A 4TULH 4JZJC 5T1LB 1KPUB 3Q48A 2UWEA 4AH2B 1VPOH 5BZWB 2QL1A 1IGTB 4OB5L 3U7AA 1CK0L 1ZVSB 1LMKA 1J5OL 1GGIH 3AY4C 4NN7C 4Y4HD 2AK4E 5FB8B 4HJGB 4PG2C 4P46C 1ZLWH 2HKFL 1IEHA 1FL6A 2ADIB 1CU4L 1IM3A 3QJFB 4JHWH 4BYHA 1MCRA 2VXUH 5GGRA 3LS5L 3G5XA 4JY5L 4ZO7A 5D1QA 1LE9B 1P4BL 4E41D 2NW3B 1IGYB 3IB4A 1HINH 3DIFA 1D5IH 5CCKH 4NQVA 4EI5C 4WO4C 5IW6A 3MRFA 3K3QA 1EO8L 1HOCA 2XWBA 2J1KA 5KSBB 4LEOB 1LEKA 2OYPA 3DJ9A 5D2NC 3CJJA 4HDIA 5I73C 2FECL 5T5NG 4UQ2B 2H26B 4Z7NE 3VH8A 1SEQH 3NVQA 3G08B 4JKMA 1NANH 5KVGL 3VCLA 1CICC 1X5HA 3CH1B 3E8UH 3JZ7A 2LE9A 4ZFOB 1A9EA 1KLUB 4XVSH 4HJ0C 4PJ9C 4YO0A 5D7IF 3BMWA 1ZLVH 4S1DD 1WFOA 1OAQL 3ARWA 4CNIA 3QO0B 4PR5A 4KJYB 3HE6B 3P4MA 2H32A 4OGAD 2HFGH 4N9GB 4XMKL 5IF0B 3C08L 3C5ZA 1ZEAH 4HCRL 4F37F 3MJ8B 4QGYA 2I07A 2VNCA 2E3VA 2R4SH 2E6QA 4YIQB 2WBJB 1RZ7L 4H0HB 1I8KB 2YRLA 1ACZA 1VFOA 2W91A 1UA6H 1ZHKA 2FIKB 4N90E 3UCRA 3UXFA 1UB5A 1QBLL 1M7DA 2V2WA 1NGZA 4JQVA 5DO2C 5JNYB 2HJKA 5DSCB 4ZUUB 4WHYH 4RWYH 4H0IA 4R8WL 1P6AB 4HKBB 5KSVB 4GBXB 5CIPA 1NKRA 2XWBB 4WENB 4ZTOL 4RMTA 4NNXB 2AJUH 3VWKB 2HJLB 1M7DB 1G6RH 2V2WB 3DI2B 4ODUA 4YR6A 4FN0A 1F6FB 5KSAA 3UMTA 4X7TA 2IH3A 5C9JB 2DQDH 3KYAA 2HT3D 5F8RC 4IRJA 3SE4A 1ZA6A 1CDBA 5HI3C 2XKNB 1R3LA 3HI1B 1GHFL 2CJUH 4KGJA 3FT4A 1T4KA 1WBZA 3QUXA 4WRLA 5DMGC 1OM3H 3VA2C 4F7PB 5C09D 1IC4L 4WU7B 3GMLA 4YC2B 3RUGE 4PGBB 4IJ3B 2BNRB 1TETL 3TC9A 5CFHA 2JKXA 3MJ6A 4CNIB 3QP3A 1AXTL 1YQ2A 1M71B 4OFKA 5GHWL 5JMOC 4Y4FC 5DI8B 2UWEF 4MQTB 2HFTA 2JIXB 4U49A 1KTLB 1J1XL 1FL5A 2QQKL 4HFUH 5MENA 4QHMB 4P2RA 1CFTA 3MRDA 4G9FB 2J12B 3V4VL 2A77H 1OARL 3C8HA 2GK0A 4TQEL 2HKFH 3DV4A 3K4ZA 4BFGA 1QVOA 3X12A 1NCAL 1P9MA 1T80A 3IDGB 4NJ9H 5DJZB 5D2LF 3SJVA 2FB4L 1OQOA 1YECL 1YC8A 1JF5A 1WT5C 3TH4T 2C1OA 2Z31A 4QWWC 5BV7H 3PHQA 2AXJA 2I27N 4Q7DA 3GMNB 4MJ6B 5JOEA 4EDWH 1W0WA 4PJXE 4PP2A 3MACH 1ZS8B 3KJ4B 2WLZA 1YNLH 4ZXBB 3RTQC 3V5DB 4XC1L 1ZT7A 3O9WC 4PJHB 5CSZA 5J8OA 1SQ2N 1QBMH 5DS8A 3S3SA 3MPCA 3UTSE 3ZE1E 5MERA 1PYWB 3C60D 1P4IH 3CX2A 5IKCA 5AZEL 4XNUL 1INQA 3WFCH 1ZVHA 4R4FL 4FXKB 3FOLA 4I2XE 2RFXB 3V4PH 3ULVC 4M1CC 3PL6A 1JGVL 3ZLQC 1ZANL 4MQSB 1BD2A 5KSAC 4ZPTA 2HFFB 3GBML 1UC6A 5DJDB 4OKVA 3EIFA 3I9GH 2W9LA 3OKEA 3HPLA 1PVHA 4FQJL 3BPCA 3TN0A 2VMFA 3O2DH 3F7YA 3RNQA 3QRFM 4OM1H 4Z7VA 5JHDB 5FO8A 5I1GL 3DVFA 3GUTB 1NCBH 5FM4A 1AP2A 2CDEA 1S3KH 1OY3B 5SWZB 4LVNB 3BPNC 4Y1AE 5D1ZB 3U30C 3RVUC 3ARBB 3WXVL 3UPCA 1S7XA 2YXMA 1FYTA 2CIIA 4F9PC 4N0FB 4HXAL 4QT5B 1C08A 5BZDA 3LPFA 3AS0A 3KDMB 3JWOH 1AI1L 1ZS8A 1B0RA 1AE6H 4YHIB 1VESA 2EE2A 3K1KC 3EDDA 2BDNL 2EDLA 1JZ3A 4W4OA 5EU6A 1C5BL 3STZB 3AB0C 3REWA 3UROR 3FQTB 1FH5H 3GHBH 5SWSD 2H8PB 5IB3B 1RUKH 3OJ2C 1IEAA 4WTWA 4YDIL 5DK3A 3VXUD 2G60H 2VZSA 4M62L 2BOCB 4XCYA 3C2AH 3PIQB 2ARJB 3VG0L 2DKSA 4OUOA 3U7WH 3MX0A 3RGVB 4ERSH 5HI5D 4D8PB 2OR8A 3QFDA 2NY3B 2FATH 5E2JA 3UJIL 3T04D 1OHQA 3DV6B 1IARB 2GCYB 3T0EA 3OAZK 4ZSOE 2VXUL 3GI9H 3ZDZF 3O8XA 4JN1L 3AAZB 1S5HA 4PJAE 4I3GA 1KN2L 3EKCA 3NZHH 4L4VB 5DJ6A 2CRYA 1WZKA 2ZUTA 1HH9A 1A6VL 1MHHB 4XC1H 3QWQB 4X9IA 5JZ7C 4JKWA 4Y5VC 1MPAH 2A83A 2DQCH 1NBZB 3D39B 2VDOL 1RZJC 1J8HA 1KCSL 4YDVA 2X4OA 3VXMA 1FIGH 1MCQA 5JPNB 1NGYB 3F12A 5DMGD 5HGDA 1PKQE 3PP3K 1IKFH 2GTWA 2OI9B 3IXAA 1VA9A 3RHWF 4NP4L 3ZKNC 3BPNB 2XZAH 4NM8H 2XA3A 4XB7A 2DQIH 1I9RL 3BH9B 3TBWA 1BGXH 4GQPH 3BESR 1WFUA 1YEDA 3PWLB 3L1OH 3INUL 1HKLL 2C7UB 5M94B 4FTVB 3MRCA 1CFNA 3EJZD 4LF3B 5EIVA 2KUTA 3BVNB 1OP3K 5C6TH 5GGUB 1EHXA 1JYNA 4BSWA 1IMHC 4OCYL 3FO0L 1NJ9A 2R4SL 4PJGA 4YXKL 43C9A 3RNKA 3MLTB 5I30H 2WUBH 3CVHL 2XQBH 4CW1A 1QO3A 3AROA 1SYSA 2HFEB 4IIQC 4Z7OE 4I3SL 1JE6A 4ZD3H 1QBLH 3VFOA 1WZLA 2HFFA 2C1PA 3V5HA 1BIIB 2AJXH 3SY0B 4WFGE 4DKEL 2VUYA 5FCSH 3DX8B 2IH1B 4G3YL 3IU3B 1AJ7H 5E95B 1A3LH 1JPGB 4U1HA 4M43H 3SGDH 1N0LA 2FLBT 3GSRB 3GSXA 3PV6A 3OHXA 4MHHG 4HV8A 4OF0A 4XPTL 5CUSH 4P4KD 5HPOA 3SQOL 2BNUB 3TH3T 1E6JL 1UACL 3TNMB 4FQ2L 5I18H 4MCZA 1F6AB 4W6WB 1A1NB 1CDGA 1JPSH 1E6OL 4MJIA 4MXWH 3REVB 5IB1A 4Q6IC 1G9NC 4MGXA 1I7UA 4MJ5B 3SEPA 1FV1A 1IGYA 3FO1B 5CZXD 5EZLA 2GITB 4KVNL 3H9YA 4MA7L 1MHCB 3TBVB 4RAVB 2FHFA 4HEPG 3NZ8B 2FBJL 5IM7B 3HZKA 2Y1VA 3L3JA 1JPFB 1WWWX 2WK2A 4JGJA 3GZKA 4EIGB 1WIUA 2IFGA 4P5KB 2VXTH 4XNZC 1HH9B 1C12B 3OKOA 1KTDB 5BXFA 1JYVA 5CJQH 2JJTA 1RK1A 1HE7A 4Y19E 5CEYA 1ZVSA 3ULVD 3ARSA 2VYRE 2AEPH 1J8KA 3Q0HA 4NFBA 5ICXA 3TF7C 4Q0XH 1Q9WA 1IAKB 1S9WB 5EIIA 1LK2B 1NMCB 2AGJL 3L95B 3L5IA 5LGHH 3IGAA 4DW2H 1Z3GL 1OF2A 5L7XH 1VGKB 3T0VA 3HPJB 3DYMA 3PGFH 4YFLI 4HT1H 4PV9A 3O6FD 4JO2L 3ARGD 3C5ZB 5D2NA 2NXZC 3T77B 2HT2D 4LKCB 4V1DA 2XNAA 4P5TA 3E6FA 1YJDH 3LKQB 4M6NH 4OLYH 5EU6D 5IIEA 4N0UE 4O02L 3KPSD 3JSSA 3UO1H 4L9DA 4TVPL 5F8QC 1HEZB 2AW2A 1FZOA 2B7DT 3CNKA 5J1AB 3QO1A 3V0AC 3TZVC 4XC3H 3DECA 3AUVA 3LCYA 1RIVL 1NEZG 5AZ2L 4FQCH 3H0TA 1A7NH 3UPRB 2E9BA 3BP4A 5EWIH 4PTUB 1WWBX 3LV3A 3Q5TA 3C9NB 1ORSA 5M7QA 3RWDB 3RIAK 5EO0A 4QHKI 1BAFH 4CGTA 2VR4A 1CGTA 3T1FB 2GFBB 1KNOA 3CVIL 3QH3A 3IVKB 1EIBA 2FD6H 3D1MC 4I48A 4NP4H 1DQLH 1U3HC 1UWGL 1FGNL 43CAB 5DD5L 5IB4B 4Y8DC 2VLRD 1ZA3A 5F7DA 3PF2A 1GJIA 2IAMC 4WJ5B 2O5YL 2QADB 2NZIA 2XRAH 3E3QC 4XPGL 3CSGA 4U6XA 2RB8A 3U36A 5GS1B 5I18L 1T0NB 2VLJE 4KI5D 2X9WA 4ZAKD 4HLZH 3VXSB 4NBXB 4IHOB 4JN2B 5DFVC 5DQJA 4M7KL 2AJZA 3X13B 3PXJA 3ZMRA 4J8RA 5BZWA 1ORQA 3BAEL 3JWDL 3CFDA 5F9DC 4LPWA 1PAMA 3QG6B 5J06A 4X9GA 3LDBC 3GSOB 5TDPA 2NY6D 5GRYA 5T1KB 1A9EB 3TYGH 3O2VH 2ORBL 5GRZA 4QHLA 2FO1A 3F7QA 5IUSA 1N5AB 4PRBB 1CZ8H 2LAAA 5IBTL 1I75A 1K8IB 1T04B 3HNTL 2R0ZL 2HN7B 4QRTA 4KAQH 2BOCA 4XCYB 1AXTH 4Z0XB 1F42A 2DQFA 3WFBL 1ORSB 3KLDA 4U1NB 2VLLB 1QRND 5E08L 2ICWB 5IM7A 5GISL 1KCRH 4YQXH 4F7MB 5D72L 1GGCL 4YNYA 4LKXA 5FGSA 1RIHL 4IIQB 4RMSA 1KCRL 4YQXL 2CQVA 1TVHB 4X5WB 2AI0L 5H37H 3IDXL 1FZJB 2PKDA 2WQRA 4JG1H 4WI2A 3U7YL 2FWOB 2R15A 4PGDA 4LCIH 3HS0A 2VITA 3CFCH 4JFDB 4HJGA 3V0VB 5EZIL 3DMMB 4H5SB 3QDJD 1WAAA 4RA3A 4NWUH 5F97E 4S1DC 3M17B 3QHTC 1QFHA 1BOYA 2NZ9D 1F90L 2IADA 5INDA 4OCMC 2VDNL 5LBSH 1ZGLA 1V5JA 3D39D 4KTYA 4IDJH 3TYFB 4TQEH 3X11A 4OV5B 1XGTB 3LH2H 2IEPA 1NGWA 1P6FA 4N68A 2ICEB 2W59A 4YXLH 1GGIL 2JF1A 2I25N 2E27H 3WLWC 5DJ0A 5FO9B 3BPLB 3O3EB 4HUKB 1QHPA 2UUDH 3HE7B 4OKDA 1CL7L 1E4JA 3RL2A 3UTTD 4GKSA 2EE6A 1D6EA 5H8DA 2X1PA 3FCTA 1TQCC 4MQ7B 4X80H 4YXKH 4EN3A 5LCVL 4YX2L 5IT2H 4IOFC 4EEEA 2EICA 3I3EA 1EVUA 1T83C 4ISVA 3CGTA 4LK4A 5IKCB 1UWXH 1A9BA 3D0VB 5J0BA 4Z7UB 5D93B 4CDGC 3FQWB 2APVA 2APWA 3NA4A 3ARXA 3G6JA 4GXUM 4KPHH 5FO9A 4HBCH 4Z18A 4G80B 1FVCA 1OT1A 2BNQA 3FHQA 3L5XH 1L0QA 1P9MC 5IR1B 3UTZB 5ACMA 2AQ2A 4OM1L 1A9BB 4YWGL 2J3SA 4UZGA 3DX7A 2CIKA 2VDMH 4R6UA 4P99A 4U1MA 3BT2L 3WJJC 3MCKA 4PLKD 3RVTC 1KENH 1UWEH 1JPGA 1P53A 1DANU 4U1HB 4JCLA 9CGTA 2H2PD 4ODTH 3WN5C 3WIIL 4J1UB 1AO7A 1XIWC 4LPUA 3B9DA 1OCWH 4TSCL 5A16B 1HCFX 5EUKA 2P7TB 1J11A 4KRPC 25C8L 1DEDA 4HPYL 4GW5A 4OZGB 5C08E 2CKBL 3F6IA 2HMIC 1XMWA 5L9DL 1YMMB 5JW5B 4MNGB 3ZL4L 4QHMA 4KKCC 5GGTL 4S1QH 4AMKH 1E0OB 3QHFH 1Z5LA 4NQDB 2G75B 1KJ2H 3QEHB 4HHAA 2F19H 4X6DA 3ZSSA 3VXMD 3IXTA 1W0VA 1BBJA 3W39A 3QUMB 2OTPA 4HWBA 5ANMA 4P23A 4PJ5E 3NFSH 5KN5B 1SVZA 2D7NA 1UJ3C 4HIXH 4N5EC 4PJEA 1C12A 3OKOB 4P9HL 5IVXF 5GS0L 1DDHB 1A2YA 1GXEA 4KUZH 5IHZB 5D1XD 1EH9A 1I3GH 4YDIH 1KIPB 5HGDB 5IB3A 1DLFH 4HKXB 5CP7A 1LE9A 1MJUL 1LHZA 5GGTH 3OMZA 2VDKL 4WDIA 5EG6C 5FYKU 3BGAA 1SMOA 4AT6B 2AJZB 3X13A 3FB8A 5EBGA 5BS0A 5SWQB 5D6CA 1QFPA 3C87A 5CMAB 4XNQB 2YRZA 1FVEB 4HKZB 3QDJE 1MCEA 1MJUH 2EDBA 2Y6SC 5KJRL 2L4OA 1U3HD 4YE4H 5E5MB 5DURD 4X4YA 5JIKA 1QSFB 5I0DA 2OMNA 1G0DA 1OGAE 4QRPD 4NO5A 1MRCH 1XR9A 1V7NL 3N85L 2DYPA 5DHVA 4FNLH 2OCFD 3U7YH 2J8UF 4LU5H 2PO6A 3S35H 2QSTA 5D1ZD 4LPYA 1NANI 3RNQB 5I74C 3QDGE 4AIZA 4LBEB 3O4LD 1HYSC 5FEBA 3THML 2NW2A 4O2EA 32C2B 4IRZL 1B3JA 4X6CE 4N8VB 2MKLC 2CXGA 3TFKD 1QTYT 5IFAL 1KJ2A 5T1DH 1A6TB 5IP4A 3OX8B 4OCRL 3BSZH 4O5LH 1D6VH 4ZFZB 4P4KA 4Y5XC 1ZA3B 1LO2H 2FATL 3UJIH 5BRZA 4CMMB 3ZYJA 4YBLC 1NLBL 2IJ0C 5HHNA 1U95A 5CHNA 4ZDHA 3ULUE 3GHEH 3VH8B 1G7LB 4R7NB 2XNAB 4CJ1A 3MLXL 1UWGH 2C9AA 3BDYH 1JFQH 3VWKD 1UH2A 5HSFA 2Z31C 32C2A 5KZCB 3BO8B 3CLFH 3KYKH 2MKWA 3HKFA 3RGVC 1DFBH 2XTJB 3V5KA 2DF3A 1CBVH 4XZUB 2NX5E 4XPGH 1JFQL 2WWMC 1F00I 7FABL 3L3HB 5JA9A 2KZWA 3RPIA 5CKGA 3HCVA 3PL6D 2WUBL 3CVHH 5D70H 5DTFB 5BRZB 4G8GA 5J12C 2X4UA 1ES0B 2IGFH 1MLBB 5J6HA 5LAXB 3CX5K 3EFDH 3QUZC 5I0ZA 3P73B 4XP1L 3F65A 3VFNB 3GNMH 2ORBH 1BAFL 2WBKA 4WHTB 3S34H 1TVDA 1LD9A 5DJ6B 1FO0L 1QZ1A 4G9FA 4ALAH 2ZPKL 1FFPA 2VQTA 4F7TB 1VGKA 4EI5B 2CMRL 4HUNB 4ZXBC 3ZT5A 3WNLA 2FX8H 4MJ5A 1TJHL 1VGEL 1OW0C 3OQ3B 4NGHH 3TA3D 5K9KB 5INCA 2B20A 5C0CD 4GRWH 4FQXB 5I1JH 4MJIB 4JE4B 5I30L 2EKJA 1QSFA 1TJHH 4M61B 5FGCE 3D39E 2VQ1A 4M62H 4R97B 2NY2C 4ODSL 4XCEB 4H8WL 4LSQL 5HHVH 1NFDF 3TH2T 1Z0NA 5I1HL 3WL9A 3RPKA 5AG9A 1S9YB 2BVQB 2EEBA 5GSRB 4G8EB 5JW5A 1CXFA 1OP9A 5H35A 1J7VR 4U1SA 5DFVD 3AC0A 4X9BA 4PB9H 1CGSH 1OAZL 3G6DL 3WIFA 4ENED 1VFAA 2JELL 5BVPH 1HHGB 2V7NA 1KLGA 3H3KA 3J8F7 1T1ZA 3RKDD 2P8PB 1L0YA 3O41B 3EDKA 1HWGB 4WHDA 3FQRB 2LTQC 1S9VA 3BHBB 5K9JH 4HC1A 1ZLVK 2IANE 1OP3H 4XNMB 1FNGA 4NNPL 1X6NA 1YJDC 1P4LB 2VL5B 4Y2DA 3ESVF 4QRRE 5GGRY 4F2MA 1EFXB 1U2CA 1IQWH 2W92A 1YMMA 3TN0B 2HT4C 1BM3L 5GSVB 3OL2A 3ISWA 1PLGH 5FUOL 4K3DH 5GRVL 2YKLH 2B1AL 2YPLA 2Z8VC 4APQA 5C0CE 1FNSL 3RNKB 2FCBA 4RIRB 4UQ3A 1KT2A 4FQCL 1IGFL 4HUMB 1S9YA 1IJ9A 3I6KB 3TIEA 5FV1L 4PJFB 1T89A 1J05B 5KBNC 4HKJB 2K3TA 3BP6A 3L95A 3SKMB 1F8TH 1P7QA 1Y0LA 4P3CL 4O51A 4Y1AB 5FA4B 1MCLA 4M48H 3S4SA 4ODUB 2VDML 5F7YC 4G6FD 4X5XA 5F88A 3OKLA 1QLRB 2P1YA 2RBLA 1DEEB 1T20A 4PLKC 4JVUA 4ZXBD 5KANI 3PDGA 2R2HB 4HQQL 1BFOB 1JNLH 5JDSA 4XBPA 2NY4B 4ZXBA 1NDMB 4OGXL 1IC7L 1SVCP 3MBEB 2W0KA 3DO3A 1YEHH 3ET9F 1CFSB 5GGSY 3LSOB 4YXHL 3QDME 3NCCB 5IB5B 4OZGF 4JRXE 4XPAH 4D8PA 2H2SD 3KHOA 3PABB 3QJFA 3ARVA 4NUGH 3RRQA 4DQOL 3U9PL 4JPKL 3RZWA 1URLA 3WMSA 3DXAB 4NUJA 3SOBH 3EO1B 4L3EB 2Q6WB 2W0FA 4FFWD 2NY7H 1U6AL 1JNHA 3GSNB 5JIPA 4OLXL 5A2LH 2VWEC 2DL2A 1KELH 3MZGB 1NGWB 2ARJQ 3OB8A 4KVNH 3GJFK 2OL3A 3KPOB 4NN5B 4XHQA 3WS3B 1OAXH 3UP1A 2JIXA 4E41A 3A67H 2ICWA 3FB6B 3QQ4A 3DYPA 5FGBC 5C7XL 2VABB 2C3GA 2QR0A 1TETH 1HDMA 4NRZA 1J0JA 4HF5H 4UU9A 1QRNE 5EO1A 4NWUL 4PY7A 3UYPA 4FZ8L 4CW1B 3P73A 1S78D 4EXPX 5DR5L 4PGJA 4XPTH 1KEGH 4PJ9D 3PDOA 3DIFB 4UIKL 4OQ1A 2ADJA 1RY7B 2PNDA 3LN4A 4ZNCD 4JZOB 4JAMA 4K7PY 2CXKA 1KJ2B 4YHPB 5D9SA 3EO1A 1FC1A 4PJ7E 3VFMA 1FCCA 4I4WB 2WANA 3KPRA 3MACL 3U46B 2C3HA 4OCLC 2F54E 2W9DH 3KR3L 4ZS7H 5B39G 3OXSB 4L9LA 1YEJH 1KIQA 1KXTB 3BMVA 1IQDA 4KI5E 1QYGH 4EI5D 3VGFA 1QOKA 4D0CB 2NY6B 3QA3A 1A14L 4XPFH 4YDLB 1FORH 3MV9B 2DQHH 5D7LE 2AK4A 3KWWB 5ENWA 3K8LA 4HFWB 5C07A 4L4VE 3RWCB 1SMAA 1IQDB 5LWYH 2CLZB 4GKZB 3TP4A 4ONHA 3FN3A 5CJ8A 1X5KA 3SBWA 2HG5A 2HLFD 1CFBA 4ZSOB 4RMQA 1G7PA 5L2JB 1QFWM 1BD2B 2XQYK 1MCKA 3T0BA 3VI4F 4LLWA 4PP2B 5HDOA 3MV7B 3N1FC 2OSLB 4LSSL 2ZG1A 4XXDB 4O5LL 4ETQB 3GO1H 4M03A 3A6BL 3HR5B 3IFPA 5E24E 5IB2A 4PRAA 3MLVL 1LEGB 3QJHB 2ENSA 2R1WA 1MFAL 5HPMA 1BEYL 5C09B 2K9UA 4NRXB 1ULVA 2QHLA 3U0TB 3RVVC 5TE7H 4H20L 1AD9B 1GZQB 1XT5A 3JVGA 2E27L 1N26A 1FYHB 4OZFA 3FRPA 3BH8A 1YNTA 4NBZB 3RFZC 2NY5L 2VDQL 3CVHA 2HH0H 2AKRB 1MCSA 2MPAL 4EZMA 3GNML 2BDNH 2J88L 3OB0H 5KVDH 3S36X 1VERA 1L6XA 5HD8C 1X5GA 1NEZB 2HYMA 2M2DA 1DUYB 1FZOB 2WWMD 3MRKA 4PYHA 2A9NH 4PJIF 5E2TH 1CR9L 5TPWH 1VSCA 3T4AB 1OP5H 3O4LA 1DQML 4RWYL 3RAJL 1YDPA 2Q86A 5IQ9B 2H32H 2WP3T 2PO6D 3SE3A 3KLAA 3WIHL 3S97C 1AIFA 3O2WH 1BP3B 3SHSA 2O5ZH 1FDLH 1HHJA 2LV4A 2ZP0T 5GSRA 4OZIE 2H6PA 3C5SA 4JHAH 5F6IC 5MENB 1CFVH 4YNYB 5C0AD 2ITDA 3DX7B 4IRSC 4MSWA 2YEZA 5DRXA 1MWAH 2F5BL 2HJLA 5CKAA 5IJKC 2QTEA 5L88L 4HIEA 3BH8B 4Y2OA 3BZEB 2OP4H 4MAUH 2G5BB 2P7TA 3KYOA 1I1AB 2BNUA 4WGVB 2FO4A 1GGUA 1TDQA 1P1ZB 1RZKL 2CKBH 1CN4A 2E5EA 4X6EA 5T1MA 1IQWL 4L3EE 3JV6B 3FZUC 3WD5H 2YXFA 1X5JA 5IMLB 4K3HA 3CLEL 4U6TA 5EZLB 1XIWB 4FFYH 3LH2L 3DX9B 5GS1A 1MFBL 2ZG3A 1DVFD 5IB1B 2YD6A 1V7NH 3N85H 1L7IH 5CLTA 4W4OC 4RWHA 1G9MH 3BZEA 3JV5A 4ZQKA 3H9SE 4MB3A 1P4BH 5KS9B 1U8QA 2APBA 2ESVD 1T83A 4HJJH 5AUMA 1KEMH 3GMNA 12E8L 1QSEA 3MJ9A 2EXYC 2XXCB 3HLAB 3KAAA 1WJ3A 1IAII 2C1OB 1YEGL 2Z31B 4R3SA 4HQQH 4TNWK 2X4QA 4WI9A 5FHAL 3IKKA 3DGCR 1HCVA 4JJHA 1MFDL 1J1PL 2HTLD 2R0LL 3EFFB 1JCKA 4PJ8B 4ZDHB 3WXWH 3IXAB 1NFIA 4LPCA 3HG1B 5J89A 3I3BA 3C8DA 2QJDA 4HS6B 5EOCL 2ADGA 3BN9C 4IIQA 1ACYL 2EYTB 4GG6A 4UB0L 1JNLL 3SBWC 3LRGA 1U8HA 2K7PA 3LKRA 5FGRA 2PYFA 1PX3A 4KKNA 2IADB 4UOJA 5C0ND 1ETZB 4U1NA 3ZYOA 3D9AH 2PW2B 5DQDL 5E94B 3VFPB 1EVTC 3HNVH 1Q9LB 4QNPF 1R6VA 4XCEA 3DBXB 5C0FB 4ZD3L 2UZIH 2QHRL 4NQEB 4KJPC 2NY6C 3CK0L 3LEVL 4PJ8D 2IANB 3MODH 3ZKXB 3B9KB 2O61B 1SBBA 2Q3AA 1D9KA 3HC4L 3LEYH 1I9RH 4I5BA 4LLAA 5IK3A 1ZT4A 2NX5D 1YNLL 3GK8H 1VKXB 1QBAA 3MREB 2VC2H 3ZSTA 4M7LL 4X6BB 1ZLUK 1JZ8A 5GGSB 4E9LA 1UM5L 3QDHA 4N5ED 4BQ9A 5IG7A 4K9EH 2YD8A 4WHTA 3RU8H 1ERNA 4EUPG 5EBWB 1WF5A 3B9KD 2Y23A 1MCDA 4XNQA 5A40E 2FNBA 1IEBB 4ZO6A 4LRNL 4W6XB 3LSOA 3WJLC 1AD0A 3HAEH 1CR9H 5FGCB 5CD5D 2G2RA 3F7VB 1GPOH 1INDL 5DR5H 4NUGL 4JM2F 3GK8L 1KIRB 4L8DB 4KMQA 4JFFA 5F9JA 1ORQB 4PJXB 1U91B 4L3ED 3IDIA 2P4AB 2GT9B 1I4FB 2R0KL 2YRPA 2EDRA 3ARZA 3QULA 5EU6E 3CDCA 3NFPA 1KSRA 2ZKHH 3VMOA 1NGXA 1CICD 4QRSB 2R8SL 1MEXL 2AJYL 2DDQL 3PGCA 3P0VL 4J4PD 3BP5A 3SKMA 1A1MA 2HKHH 4DUXA 5DRNB 4XCCL 5CD3A 1MI5B 4PRAB 3V6ZB 3M8OH 3T4YB 4JM4L 5H94B 4KJQD 4ONFH 4FFZL 3TGXA 3QWOB 2E6JA 3SDCC 1HQRA 1MCOH 3G08A 3QDMB 4TSAL 4QYOA 2DIJA 3KS0J 1T1WB 3FZUD 1NAMB 4NKMB 2Z35B 4ZSOA 5T1KD 3ZDXF 4YJZL 4ZS6C 2AP2A 4IMKA 5EU5B 3CFKA 3VFTB 5M95B 5FYLH 3J7HA 1JHLH 4XNMA 4I3RH 3NABH 4Z5RA 3EW3B 1AHWA 3OV6A 3KXFB 4EUPA 1J1OL 2CUMA 5I1HH 4NQEE 3QNZA 4K3JH 4K94C 3H3PL 4RFEB 2CKBA 5JQ6L 3BXNA 2X1XR 1J8HE 4MAYC 4R0LA 1JYWA 3I2CL 4AYFA 3MCG1 2R9HD 1MFAH 3GDBA 1H9VA 3VXME 4G5ZL 4LPXA 4NSKA 3CXDH 4ZFGH 2GTWB 2HWZH 3WLWD 4ZUWB 2X7LA 3GMMB 2X4SA 3L3JB 4M1DH 2UV3A 3IS0X 4XP4L 4Y19B 3V6FB 1ZHLA 2V5RA 1TZIB 4PJIE 1C5CL 3L5XL 1B6UA 5I19L 4YX2H 3BKJH 1KOAA 4OZ4B 1OD9A 5C0AB 1DVFB 4UBDC 4F37K 1AKJD 5JW3H 5EU3A 3W0WA 5F96H 1I1YB 5I8EA 3VFUB 3IDGA 1NCWH 1JGLL 4LSVL 4ZODA 4LMQI 4Y4KB 3C08H 5KVGH 1WICA 4XP5H 3RWHB 5GS3A 5IJVB 1JGVH 5I2IA 5INCB 1AQKH 1WEJL 4PJGE 5DUBA 1DVFA 1F6LL 2AJXL 2XKUA 4M3JA 3VG9C 1OAQH 1PSKH 3N50A 3MLVH 3LKRB 1HZHL 2HLAA 4ZUTB 3ZHKA 5HYSG 2XG4A 1AKJB 3FFCA 2VZUA 3OJDB 2Y72A 2BVUA 5C0RL 4LCCB 1NH6A 4JHAL 5DYOB 1E4WL 2Q8AL 2MCG1 2XA8H 1AFVL 4HUUA 3OR7B 1NL0H 4B7IA 3P2TA 5FM5M 4NRYB 5C6TL 2EXYD 2FDBP 3QEQB 5EA0L 4UIKH 1X5FA 3IS1X 5D7KE 5IVXE 4N1CA 2NMSA 2ZCKH 3FT2A 4PJ5B 3CSBA 3NAAL 3UJTH 1DVFC 1BQHG 1J1XH 2QQKH 4ZTOH 3VMNA 1B0RB 1LP9A 2WLYA 5L2KB 4HIJA 4LCWD 4UV7H 4M93C 4Q58C 3G6JF 2IALB 4TSBL 3VMPA 1F4XL 2H41A 3O6KL 2C3VA 3KYNA 5HHVL 3NH7H 3D0VA 4S1SL 3NFNB 3MOAH 1BBDL 3S36H 1EUUA 2GY7B 2DIBA 3LQAH 3QEQE 4LSRL 4DN3H 3I6GA 3QIWA 4AENA 5C2BL 3JTSB 3SGDI 3V0WL 5AAMA 4WEBL 4BUGA 5EU7E 4ELME 4UILH 4UTAH 3KYOB 3LN9A 3CAFA 3D2UB 4P4RB 4NHUB 1JTPA 4P23C 2CLZA 4GKZA 5ALCH 2CUHA 2F53D 4DKDC 3QQ9D 3U7WL 4UV4H 2HRLA 2JLLA 4YHKH 5DSCA 3UJJL 4KGLA 1U8PA 5SWSE 2X4NB 4RMWA 5CLWA 3BGFC 4V1DE 3BZ4B 3DGGB 3QFJA 1R5VB 1AHWB 4YHYB 1OAKL 3QUYC 5HDBF 1O7VA 5BQ7B 2Y9RT 1C5CH 2I9LB 2YK1L 3CLFL 1A14H 4RAHA 4LSPH 3NPSC 1X7QB 4RFOH 4WTXA 2J4WL 2OXHA 1IT9H 3A6CH 3MJ8A 2ICWJ 5EBWA 3IU4L 2BMKB 2FX9L 4PP1C 1F3JA 4JY6B 4FQHA 3ARGC 4R2GD 4NQSA 4CUCA 1A7RL 3MRFB 5F21B 3T1WA 3FO2B 3P9LB 5CP3H 1R3HA 3WFEH 2FEEL 1P7KA 3SO3C 1AQKL 4LPTA 5IFJA 3FQTA 4K7FB 2CRMA 1KGCD 3HCVB 4HMEA 4OFYD 1A6ZB 5I8KH 1LP9F 1DDHA 2OM5A 5IIEB 3V5KB 2R4RH 1DL7L 4LOUD 1YNTB 5DLML 1UXWB 4CAGA 4ONGH 3FMGH 1RVFL 4QWWD 1BZ7B 1T22A 4HK0B 4HHAB 5E8DL 4ODTL 4G6MH 4KI1A 5T1KA 1XCTA 1KV3A 3ARTA 4DKFH 2L7JA 1PW3A 2YPKA 1A4KB 4EI5A 4KKAD 4ZO8A 2ADFL 3EJZC 4LMQE 1MUJB 1P84J 3WIHH 4NZDA 3H9ZA 3O8XD 1GPOL 4PJCA 1DSFL 1KTDA 1N59B 1ED3B 1JV5A 2F5AL 3STLA 3ZL4H 1JRHI 4U6XB 5D1QD 4P2YA 3KPQB 5D7KD 5TPWL 3O0RH 2C5DC 2OS7A 1C5BH 3FONA 1YEEH 4OFPA 3MR9A 1DSFH 2DI7A 2D7QA 5IESH 5DEFA 5D72H 5HVHB 4WI4A 4GRLC 2BNQB 2JELH 2NNAB 2FEDC 3IDXH 5IHBA 4GW4A 3QDMD 3OXRA 2HVKB 3NGBC 5DJAA 4XGZA 3WD5L 2MHAA 3V7AG 2CLVA 4LPVA 2ICES 3IETB 3RIAF 4GG8B 3OPZL 2RCSL 5AWNH 1XGUB 5IBLD 3VW3H 4I1NB 4UTBL 4HS3A 5CWSA 4X0KA 1G7IB 4YGVB 1EGJL 2FO4B 3PWUB 3O6ML 4LHUG 4XP4H 4CVXA 3BSZL 3T77A 3X3FL 4IJ3C 3VRJA 4N0CD 3L3OA 5GHWH 4DVRH 4Y16A 4PJGB 4O2EB 5F9WB 5CEZH 4FQIH 5IEKA 2D31B 3GI8H 3V7AE 1PFCA 4U31A 4M5ZH 2DQEH 5LVEA 1U8OA 5JDJA 5CGYC 1NAKL 1Z9MA 2YMXH 4BZ2H 5I17A 3F7VA 2OXGA 4BH7A 5FHAH 5F44A 4HUXB 4OGAC 2PYEE 1FP5A 5GRUH 3WUZA 1JNJA 4GAJH 4J6RL 2P8PA 3O41A 3KJ4C 4ZOAA 2DQEL 2VLRE 4UDUB 2YHGA 3I9GL 5KS9A 1A3QA 3BQUC 4UV4L 2R0WL 2Y5TA 4NRYA 2Z9TA 1D5IL 2BOBB 1U9KA 4RISL 5J9PA 4PJFE 5FYLL 4X8JA 4NN6B 5B8CB 4RGMC 5HGHB 4Z78B 1NUFA 4X4ME 2FLRT 5J12B 1UQSB 3B9EA 1HHHA 3SCMC 4K8RD 1KTLA 1FZKB 2IBZX 3UEZA 5DRWA 1IC1A 2UZYB 1A6PA 3LEVH 4X6EB 5T1MB 5KG9B 4WGWB 3WO3B 4J6RH 2YSSA 4PJDE 1YQVL 4PLNC 1I3RA 3QDGB 3B5GA 3O2DA 4WFFE 1HXMA 3SGKC 5EZJB 5IVOA 5D7JC 1OTTC 1FVDA 2XRAL 4FABH 1H3PL 2IQ9H 1CLZL 3NPSB 1P7QB 2BFVH 4GW1B 3IDUA 2IH3B 3DVIA 3IJYA 3CFDB 4DTGL 4NJAH 3D0LB 4XXDA 4MNGA 1LK3H 1JGDB 5JIIA 1BZ9A 3O6KH 5ICZA 3KYNB 1OPGL 2JK5A 3VFOB 3MUZ1 1OGAD 2W65B 2B0SL 2UZIL 3UTTA 5HJ3A 1CVRA 3U4BH 3SDXA 4LNVA 3QNZB 3VD5A 2H8PA 4U0QB 3F58H 3EOTL 2R56L 1DQMH 5H37G 3QH3B 3QEGL 4PJEE 5EUOA 3SDCA 3DRQB 1GOGA 3ME0A 1WZ1L 5EU6B 2BSRA 3KR3H 4DZ8A 2VISB 5A1AA 4NQCA 4P5MB 4J3OC 4WUUA 3TESA 4L8BA 3DUSA 4RAUB 2DLIA 3RWEA 3ZO0A 5JORA 1FDLL 1DZBA 3NIFF 2QQLL 5DMYA 4YK4B 1UM4L 3ULSB 3HS0B 1QPXA 3DTXA 1TJGH 3BGFB 4KHTL 4U0RB 4UINH 2EECA 3S8WA 1PQZA 1GGBH 3H0TB 4DCQA 3U0TA 1G7IA 4ORZC 5E70A 5I16B 4XWGH 1BVKA 1KEGL 5EBLA 4ODXA 4H8WH 4LSQH 3D18B 5K59F 1TZGH 4L1HA 4BFIA 1JHKL 3S9DB 1V3JA 1T1YB 1K9TA 5J56B 3QUKB 2J5LC 1SM3L 1MFCL 4G8FA 4KDTA 4QTHA 2NY1C 2Z0BA 3S5LG 5FYJL 5HXMA 2Y7QA 3LQAL 1ZKAA 1FCGA 3R4DA 1EMTL 3U48A 2D3VA 4JFYB 2YBRB 4X6CA 3BQUD 3GMRA 2ATPA 4MD5B 5FYJH 3AM8A 2V17L 4HIHA 5A3ID 1AD0B 2GIYA 4IDJL 2X6MA 3NGBB 3T3MF 3UBXB 3O4OC 4APQD 4TUJA 4DQOH 2OBGA 1SJEB 2JCCB 4P5KA 3PIQA 1YDPB 2WUCH 4NM8L 4N0UB 3TA3B 1ZHNA 3VI3E 5F3BB 4KK9C 1M7IA 2OTWB 3AM8C 4YHMH 1YEGH 3NIGF 2CRZA 4MVBD 1RUML 3GJFH 1IBGL 1N7MH 2E8YA 2YBRA 1EXUB 4X6CB 5DMKA 5BV7L 1OTUC 3O8XC 4FRWA 3STZA 1XGRB 5D71L 4GBXD 2J8UE 4TUOA 3LS4H 4BSVB 4RBPH 2P5WD 2BX5A 3C60A 4KQ3L 3X12B 3O81A 5C07D 1G1YA 4HUWB 3TNMA 4P46A 3KPMB 1FG9C 3LOWA 4G8GE 1XH3A 1T1WA 4I0KA 1BBJB 2C4FT 1A6AA 2IAMD 4NZTH 2XT1B 3I6LE 5AD0B 2CLRB 4KROC 1CGVA 2XACC 4FZ8H 2WSKA 4OD2A 3D85B 5D96B 1A6ZA 4XB8A 2R1WB 4NT6A 1QR1B 3NAAH 1XCQB 1MRFL 1BFTA 5L0QC 2CRIA 1DQJB 4OLUH 4YZFF 4CN6A 4J3TA 3WDJA 2AVGA 4IOSD 3MXVH 3AS2A 3G5YA 2FYYA 3JV0A 4GW5B 2A6DA 3VFGH 3VD3A 1NDGB 1HSAA 2VZOA 4ZPTB 4FQHB 2JJSA 5EFIA 2NLJA 4G3YH 3TBYA 4MAYD 4L8CA 4NJAL 5ISZB 1CLCA 2X70B 2D03L 2DLFH 2X10A 2GY5A 2P45B 4DZ8B 1RFDL 1T5WB 2BVTA 3FRUB 1RK0A 5FYJD 3ULVF 4P3WA 3SOBL 2XFXA 3TEUA 5GGUA 1KB5A 4WWKA 3L7FB 1HZHH 1TVBB 3AREA 1XR9B 4G7YL 4XCNA 3B3IB 5DUPL 3TCLB 4CVWA 2QSVA 4NO2B 1FNLA 4P9MH 3DSFL 4Y5VA 1YEEL 3KNBB 4WO4D 4ZYKB 3PWPE 4OLVH 4OT1L 5D9SB 1KN4L 5L2KD 1AGEA 1HNFA 2X42A 2VLKE 1I9IL 4OI8A 1LO5B 4L3AA 2XFXB 2WP3O 2DM3A 4RNRA 3U83A 3VFRA 1RUPL 4NKDA 4MCYB 1HI6B 4ZNEE 4QHUA 2QADC 3RDTD 3UTQA 4WFFD 5BW7A 2Q7YA 4J4PC 4ODWA 3HE6C 4F57L 3QIBA 3NCEB 4KC3B 3ARQA 5C2BH 3WDIA 2IANA 2GK0B 2A6DB 3TBTB 2X9XA 1AXSB 5CJBA 3ALPA 3N9GH 1FNSH 3FFCB 4P2OD 4S1SH 3OHXB 3C2SA 2XTJC 5ALBL 2A1WL 3WYRA 4WFED 1I9IH 4PJHE 1AGDB 3HUJE 4K23L 4K8RH 3RA7H 4KRPD 3PWJB 4LU5L 4U1IB 5J13B 3PNWB 1I1AD 5ID1A 2EDFA 1L9NA 1YEFH 3VXSD 2JCCF 3ARED 3CUPA 5JXEC 4U1GC 1KLGB 3HG1A 1QFUH 4CVXB 2DTSA 4AQ1B 1N6QL 1DANT 1BQSA 3QCVL 3U6RB 1F13A 1XGPA 3OKDB 2B4CH 2QV2A 3O4LB 4TUKL 5ESVB 8CGTA 4RISH 5ITFA 1K2DA 3UTSD 1MNUH 4P57A 3AFLA 2W9EH 4Y4FA 1DUYA 3BT2H 5T3ZE 5IB5A 1CI5A 2X2YA 3DNKA 5DZNA 4KZDL 1FRGL 1H3UA 2E7BA 5DJCB 3HZYB 1VEOA 1IM3B 4GRWF 2HVKA 2NY1D 2EO9A 3L7EA 1T0MA 4TVPD 4W4NA 3ARGA 1LDPH 2DLTA 4TRPH 1PSKL 4PREB 5FIEA 4HXBL 2CDEB 5IESL 1AQDA 4H88H 2VB5A 3QCUL 3LEYL 4XP9L 1KC5H 1KJVA 4TRPL 4JFPA 4P4KB 1GOFA 5EU5A 1CYGA 5JMRA 4LAJH 1A0QH 3VE0B 2JJTC 3MV9D 1CFQA 3BWAB 3IDYB 1G9NL 1LGVA 2ARWA 3BW9B 2HKHL 1ZHBA 2HG5B 4E41E 3SE4C 4QXGH 2NNAA 4YFLF 5E9DA 5CGMA 2X89D 2CKBB 3KPLA 3D18A 1FH5L 3VWJA 4ERSL 3BKYL 4XCNB 5D1XA 5E7FA 5T3ZH 5I75B 2VXQH 5D6DA 4LLQB 2HTKD 3B8YA 3NCYS 5DHXB 2DQJL 3G5VA 5INDB 4NHCH 3ULUL 3MV7D 3RPIB 2FJFB 4P2QE 4TYUA 4BQCA 4KK5C 2W07A 2OZ4L 3SQOH 5ICYA 2OJZL 3HAEB 1GC1C 3V5DA 1ONQA 1B9ZA 2D7TH 3OKKB 5HYSB 4PRIE 1B0GB 5EC2A 2CK0H 3U2SB 4RX4A 2ICWI 5ESQA 1CIUA 4YHPA 4K71B 2FWOA 1HHKA 3FB5B 3QYCA 1K5NB 3QUZA 4X9HA 5D7SH 1MCIA 5E0QA 4PJ7A 4QXUH 2HAZA 4PRHD 5DD1L 4PP1D 3C6SB 4OZFH 1UKSA 1YYLL 2IBGA 8FABA 3PE9A 3U6RA 3IFNL 4WI6A 3FO9A 4HLZG 5D7LA 1T04A 4P46B 3RWHA 5KVEL 3ULUF 4L4VA 1YN7B 4LVOC 1JVKA 1I8MB 4BZ2L 4WCYH 5HHQB 1OW0A 3QBTB 4LASL 3IXTB 3TV3L 1ZLSH 4DGIH 1TCMA 2KDGA 1CICA 4U1LA 5MEPA 2GI7A 2YPVL 4N8VG 1TQBC 1HQ4B 3MGOA 3A6BH 4PY8I 3JWOC 4E42A 1H3VA 3SKUD 2DYPB 5DK0B 1IEBA 2MCPL 4Z8FL 1EGJH 1GZPA 4KDWA 3OGOE 4WW2A 5A16A 3D3VB 5CBAB 4FABL 1FIGL 1E4KA 2VL4A 3H8NA 3MJ7A 3UX9B 1PY9A 3CXDL 4QTIL 5DD5H 3MRPB 4ETYA 4CMHB 4JRYA 5HHPA 2EC8A 5GJSH 5SX5H 3TPKA 4XMPH 3IDNB 4KZEH 4JDVB 2IQAA 4DN4H 3WEXB 1U8JA 2DTMH 2PUQT 4KK6C 3QA3B 4AJ0A 5K9OA 4I5BB 5HVHC 1X9QA 4LSUH 5F7LB 1U8LB 5EA0H 1TZHB 4YHOH 2VSDA 5B38B 3CX5J 4Y2DC 4PGEA 4JPWH 3UPAA 4B5EA 5ACZA 1BJMA 4P48A 3OR6B 3P0YL 3P30L 4JJ5B 3RVVD 3VXRD 3ZZ1A 2P5ED 2AAVA 2ADJB 1NEUA 4O00A 3DWTA 1BREA 5CD3B 5DK2B 5HYJE 2FR4B 4LCWE 5HGGS 4HS6A 3D69B 3VRJB 2IFFL 2C3WA 2PYEB 1U8NA 3MOAL 4ODSH 3GSVA 3C8KA 1M05A 2O5YH 1KPRA 5C1MB 3RWEB 2X4RA 5FKAB 4IBLT 1NLDH 2A9NL 3LKPB 3VXUB 3SDCB 1UEMA 2J6EL 4IS6B 4RGOH 4HH9A 4TN9A 3L9RB 4QXUL 2DI8A 1AQDB 4OLWL 5J7CC 4DOHE 2VLJD 3MRLB 3VW3L 4L3CB 2XWJA 3L5JA 1AHWC 4C58B 2B1HH 4Z0BL 3B5HA 4ZQKB 1CFVL 3HZMB 1I3RB 3ORJA 5AG8A 2EH8L 3BP7A 3FAXA 4NQVB 1JWSB 4G6FB 2FGWH 3PQYB 5GISH 1VPOL 4WUKL 5DT1H 1IAIH 3G9VA 3DVGA 5IMOA 4YHZH 4M3KB 3KPSA 1HHJB 3O6FC 3PGDB 4GW1A 1KUMA 4NQED 4AZ8A 1DJSA 1OSZA 3TWCL 5FOJA 5ITFB 4QCIB 5BV7C 2PTUA 1DLHA 1CT8B 4K55A 1TLKA 3P11H 2XWTB 2OX5A 3LN5B 3ZDYF 1DQQA 2NX5B 3IRZA 1MVUB 4NC0B 4JVWA 5K9KA 2HJFB 3WBDA 3RY6A 4M7LT 4GH7B 4H26B 1CXHA 1QSZA 3THMH 4JFOB 5F1SA 4OB5H 4OCWH 3AU1A 3MLYL 3F7RA 5KVEH 1MAML 5SX5K 3P40A 5LCVH 3I3DA 3P4NA 5EFIB 1LD9B 3SY0A 4PTTB 4CADB 2J6EA 5T1DL 4TVPH 3WS6A 3MOQA 2Q86B 4JKKA 3IU4H 1QO3B 4M7JH 4XHJD 4MJ4A 1H0DA 2LU3A 5FOBB 3VDCA 1EX0A 3W9DB 5E6IA 4ONGL 3LS4L 4JB9L 1JGUH 1QA9A 4LLUB 3KXFA 2R2BA 2UVEA 4L5FH 3FO2A 3P9LA 1PBYA 2CLRA 1CFNB 4LF3A 1RZFH 1T21B 4K3GA 3NACH 3QPXH 2BERA 4NN5C 4Q2ZB 4QRTB 3QXAA 1FPTL 5D1ZA 2DWEA 5K33A 3AMKA 4M7JL 3GSWB 4PJAA 4ODHH 3F62A 1EGJA 2YD5A 5FM8A 2NW3A 3DVNB 4MS8C 4IM8A 3O9WD 35C8L 1X5ZA 3LD8B 4Q74A 3QG6A 5SV3A 5DEGA 2JIXD 3HRZB 1T0PB 2V2TA 2GJ6A 3HC4H 5GS0H 3BRGC 4UT9H 1IM9B 2BVOA 1RZKH 3NBNA 2X05A 3EJYC 4CN1A 4HX1B 3S7GA 4XPHH 4CRPA 1NBVH 5EORH 4LVEA 4MAUL 5I1AB 3OKMA 3QXWA 2F54B 4YUEH 5FO7B 5KSAD 2PO6B 3TYFA 3X11B 4OV5A 1CG9A 1QR1A 4JQXA 2Q87A 2Z92B 3RVWD 1EZVY 1FQ9C 4PREA 3TO2B 3OPZH 5FV2A 4YBQD 3GSNH 5GGQH 2F8XC 5KS9F 2R69L 3KPQA 4KHTH 1VFBA 2GJZA 2JE8A 4K71C 4RDQF 5AYUH 5EOTB 1G84A 4JFDA 4HC1H 4WY7L 3B6SA 4L4JA 2R69H 2CGRL 4JRXD 5IMKA 2X1QA 1A21A 5I15H 4G9FD 5F7WC 3IJSA 2ITCB 5B39B 2VLKD 1JHLL 5D1QB 4BH8A 2PF6A 2CGRH 4Y1AD 4M5YH 4MNQE 4PB9L 4GG6F 5GS2D 3O6FB 4XNXL 3TVMD 3VXPA 1N6QH 4NQDD 2EDTA 4JFZH 3IKCA 1I1RA 5I1LA 5FF6B 1A1NA 5FAAA 3DHJA 2QSQA 4WEBH 5HHOE 1JF1A 3BX7C 2D7OA 5CGTA 1SY6H 4ONFL 5GQBA 4P2RB 5EBMA 3TVMB 1ZLUH 4WUUD 2UWEB 4AH2A 1WBYA 4GAFB 4WWKD 4YHYC 2VJXA 1NFDE 4YK4C 1D6VL 5F7NC 1NFIB 5EUOF 3MC0A 2MJWA 3SE9L 1Q0YH 3G04B 2FGZA 4ZFGL 1OT2A 2XN9D 5DJDA 4HMCA 2I9TA 4PJIA 3K80A 3ZE2E 4D9QD 4FP8L 4OIBA 1JGEA 2IPKB 2WIIB 3SPVA 5C0GB 4BSWB 1I8IB 3TT3L 2CIKB 3UZQA 5E2WH 2QEJA 4WW1A 3QIWD 1GYAA 1ADQH 2G5RA 4HWBH 3ES6B 3QUYA 5DZLA 2X7LB 4FZEH 4JRWA 5C0AE 1P2CA 4M6AA 4MD0B 4QF1A 2JB5H 1A7BA 1WUNT 1FLRH 4KZDH 3HZMA 2Y36L 4ZAKB 3UC0H 4KWUA 1MHEA 4Q2ZA 4NZTL 3QZWG 2OQJA 3BZFA 1FVEA 4HKZA 5DD3L 5DHYB 4JFXB 4JHBA 2VL5A 3PV7A 4Y2DB 1FZKA 3UC0L 3EO0B 3PV6B 1MJ7L 1JUFB 1ZGLM 2KQMA 5J13C 3U4BL 4Y5YC 1G9NH 1KG0A 2PR4L 5E6IB 1L6ZA 1UB6A 1J12A 3O0RL 3L5HA 3HE7C 3CMGA 3CU7A 4POZC 5FYLE 4APQB 4M4RA 5ID0B 4PJXF 3EBAA 5KN5A 4WFHD 3O6MH 1B4JH 4W70A 1KB9J 1EHAA 4M00A 3O8XB 4NCC1 2FJGB 3DI3B 4XP1H 2F19L 4LHQB 4Z7WE 2NR6C 4MSWB 5DRXB 2DJUA 1I1CA 1A1MB 1QSFD 2WM0A 3CXHJ 1QLEL 1JI2A 5LG1A 5DEZA 1FFNB 3L3OB 1UZ8B 3ROLB 4GQ9L 1W8OA 5HDLA 2FBJH 5JHDE 5I74B 3NH7L 1DUZA 1ZOXA 3LMJH 5C70A 2FEDD 1UFUA 4J1UA 2ZOKA 4P59L 2VLJB