3MLUL

Crystal structure of anti-hiv-1 v3 fab 2557 in complex with a zam18 v3 peptide
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
218
structure length
218
Chain Sequence
YLLTQPPSVSVSPGQTASISCSGDKLDDKYVSWYYQRPGQSPVLLMYQDFKRPSGIPERLSGSKSGKTATLTISGTQSLDEGDYYCQAWDASTGVSGGGTKLTVLFGEGTRLTVLAQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conserved structural elements in the V3 crown of HIV-1 gp120.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Human monoclonal anti-HIV-1 gp120 V3 antibody 2557 Fab light
total genus 41
structure length 218
sequence length 218
ec nomenclature
pdb deposition date 2010-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mluL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mluL01
3L5JA 3DXAE 4GBXA 5EBLA 1CU4L 3RX8A 1I8IA 2W0LA 4X4MA 4IRSB 1JZ4A 1VGKB 2W59A 4R26L 3H9YA 5C0BB 3O3BA 4TTGA 4O51A 4TSBH 4L3AA 3OJ2C 3U9PL 5HDBE 2DB8A 3FOLB 1N5YH 4JANA 1CXKA 1NGXA 2KL6A 3WKMH 3RKDD 1AKJD 2CQVA 4NZRH 3C5ZB 1C5BL 5GGUA 4S1SH 3W11D 3N9GH 1RUAL 3CFKB 4FFZH 5D7LD 4OI8A 4U3HA 5IROA 3IAGC 2XWTA 2J4WL 1F6AB 3SE9L 2HTKC 2AXGB 4XPBL 3G6JA 3VG9B 2DD8H 1QUNA 5DEZA 3S37X 1GGBH 4NZUH 3JUZA 4LNRB 5ETUB 3QCVH 4TNVK 3R0NA 4QTHB 1KENH 3ARPA 4ISVB 5F71A 1U9KA 1FGNL 5AEAA 2X4NB 4PRIE 4MAYA 1KJVB 4BUHA 1KUMA 4YK4B 1QLRA 1IM9A 5ISZD 3GSNH 4ZFFB 2CKBA 2XTJC 3OAUH 1BAFH 2AJUH 4UV7L 3ZKXB 4AG4L 5D93C 4GO6B 2G2RB 4NDMA 3L5HA 3E6HB 3WHE0 4ZS6C 2APBA 3TJEL 3BRFA 2EZ0C 1Y0LB 1I1YB 3I02A 3N1QC 4OLWH 4Y8AA 4ZNCD 1A2YA 4LCIL 5FDWA 3CSPA 1XGPA 5EPMA 4HKXA 1T22B 4DGIL 3ZDZF 3MOAH 2W0KA 5SX4I 2J3SA 3CMOH 1WISA 1SYVB 5D7KD 1F2XK 5HVFB 1R3HB 3SGKA 3BKYL 4J1UA 5FO9A 4ZQKB 1ZGLM 3QIBA 5EORL 5C6TH 3MV7E 3C2AL 1P6FA 4L8SC 1KEML 4YHYB 3TEUA 2Z93A 5SWQB 3HI1B 2XZAL 3OHXA 4ZQKA 5F1KC 4YXLL 2CGRH 2VLJE 1FIEA 2YWYA 5DMGC 3OXSB 4JFFD 3RBSA 1QD0A 3ZTJG 3FT3B 4HIHA 1FO0B 1T4KB 5HHOA 1RQ5A 3CPLA 1DQLL 2PW1B 3E8UL 3L5XH 1KLGA 1BIIB 5D2NC 5A3ID 2MMXA 5HI4C 3TNMA 1XGYH 2BVTA 1TZHB 1ZHNB 2G2RA 3KPNB 2H1PL 3MRBA 4NWTH 3LPGA 3IKKA 5HHOD 5K9KA 3MACH 1DE4B 4GS7C 3UCRA 4GAJL 2YD9A 3OL2A 5FKAB 1K8DA 1SJHA 1XGQB 1PGRB 5TDPA 1F11A 1Z5LB 2VC2H 4BH8B 4J4PD 2KZ1B 3ZDXE 3KPPA 1GZQA 2BRQA 4G6JL 1T89A 4AIZB 4S1RL 2IPTL 1N8ZB 1SYSA 5CJ8A 4G8GA 4JB9L 4JG1H 5CJOH 1DBMH 2FATH 3MA9H 4G6AD 4M43L 1Z0NA 4N8VB 5LQBL 2JIXD 1II4E 3OQ3B 3EO0B 3CK0H 2LVCA 4HJJL 2ZNXA 4NJAL 3SDDD 4XP5H 3AAZA 2ESVA 1W0WB 2WWKO 4X0KA 1JPGA 2DM4A 2ERJC 3SE3A 3D2UD 3WUWB 5JLZA 2JJSC 3MV11 2H3NA 3ELAT 4YFLI 1FLTX 4Z7UA 4NKDB 4QCIA 4TQEL 4QRUB 1RPQA 2J88H 5B38G 5HI5C 1K5NB 1RZIB 1VENA 1V3JA 3UPCA 2ZJSL 3SGEI 4I4WA 1FG9C 3QJHB 3LMJL 5J4MA 4KI5C 5IVZB 3RIFK 4YGVB 6FABL 5BQ7A 2IQAB 2AK4E 4AQ1B 1UA6H 3V7AG 4XB7A 4QTHA 5IT2L 1ZKAA 3MOQA 3E2HB 4DVRL 4NO5B 1BQLL 3LEXA 1OW0A 2OQJB 3TCLB 3EJZD 2VDQH 1HH6B 1VFMA 3QUXD 1R5VA 5E2UL 1SMAA 5K93A 1HZHL 2XTLA 4JJHA 4F2MA 1JF5A 2NW3A 1N8ZA 2ICWI 3OHXB 4XPFL 1L4IA 2VUOA 2A73B 4PB0H 3VFOA 4LSQL 4LPCA 4H1LH 4OLXH 1U3JA 4TUOA 1EO5A 1WC7A 4G8GD 3TO4C 3ULSA 4JFDE 4HLJA 3KPLB 2W9EH 5BVJB 1PG7H 4RZCB 1AO7E 4PJHF 2ZUQC 1XZ0A 2GEEA 4Y2OA 4Z7WB 3BESR 3UTOA 3RWHA 2I25N 4XPTH 1EVUA 3ALXA 3RWCB 5C71A 1INDL 1WV7T 4QXGL 1BVKA 3ABZA 1ZVSA 4KY1L 4Z7VA 3I85A 5EOQH 5IHLB 2ZG1A 2E6QA 1JPFB 2AQ3A 1IJ9A 4G6KL 3HFMH 3HE7D 3C08H 4ALAL 4C4KT 3QEUA 3S3JA 4PJDB 2FX9H 2XZCH 5KVGH 1D9KA 1E4WL 4LCIH 1NCCL 2GTZB 3ARTA 1WZKA 1AY1H 3LEYL 3EDKA 1FLRH 2OQJA 3QUZA 2B20A 1KGCE 1TITA 1YEJL 2X41A 1JRHI 4N8VG 5ISZA 1DSFL 4J12A 3STBA 3KYKL 3RTQA 5F1OB 1ERNA 1I9RL 3KPQB 4OZ4B 2DQTL 1CS6A 2A6KA 5HYJD 3C8HA 4LLWB 3VFUB 1J05B 5EC2A 5TE7H 1WBYB 1R5WB 5ICZA 1F8TL 1UYWL 3UAJC 1L6XA 1TNNA 2C3VB 2Q6WB 1YZZA 2GQHA 4JJ5B 4KKCD 3FOMA 1N6UA 5FYKE 4JHBA 4JVPA 2ZOKB 2V7HB 1CL7L 3K7UA 2A6DB 1E6JH 2OK0H 1OPGL 2ZG2A 3O2DH 1WGOA 2V9RA 4JFXA 3MRCA 4HG4J 3GIVB 1R24B 3PL6A 4JANB 2XNAA 4PUBL 2EICA 1N6VA 3MV7B 4Q6IC 1RD6A 4PG9A 4TULL 4U1JB 5CZXC 2OLDA 2EE6A 1A0QL 4LARL 2I60H 4FFZL 3AU1A 4AL8H 3SDAC 3O2WL 3SJVD 2J8OA 2Z91A 4MNQD 4NZRL 1AGEA 1H3GA 4YXHL 4WI4A 5GGSA 1RUMH 43C9B 1XF2B 1PSKH 1M1SA 2VLJB 2AKRA 4P2OC 5IEKB 3K4ZA 3LVEA 5E6IB 4G3YH 2FEEL 3P9LA 2VXSH 3TT3H 2I9LB 2RR3A 1FL6B 5JDJA 2HVJA 3DV4A 3KYOA 5IEKA 4HGMA 2EEAA 4MJIB 2CMRH 3CH1B 1I3RB 3G5XA 1YEDB 3LRSB 1NANI 2VXTL 3RJQB 3QO0A 4ZOCA 3BHBB 3QCTH 3KPNA 1XGUA 2R4SH 1R0AL 3H42H 4JFQB 35C8L 3BO8A 2EDWA 1NLDL 4WEBL 1HI6A 2NXYC 4N0YL 5HHXH 2P46B 1KPVB 3TFKC 1G9ML 3TGXA 1BLNB 3RU8L 3Q2CA 3G5VA 1ADQH 2JELH 4JFOA 5GS2D 3MLTA 5HYSB 4EI5C 3WLBA 2PXYD 4U1HA 2XPGA 2DLTA 4NKIH 3BQUB 3EYVA 2EDRA 4XMPH 1CFSA 1WQVT 4JFXB 5FF6B 2YOCA 5K9OA 1WCBB 5ITBH 4K8RH 3FAWA 1L9NA 4NP4L 2HJFA 2NY5H 3TH3T 1FNAA 2F15A 2J8UF 1HE7A 1Y18B 3EYUL 3BD4A 4N0CC 3HMWH 3V8OA 1YNTA 4D0BA 3VD4A 2H2SD 5H35B 3T2PA 2AP2A 4OT1L 3HC3L 1DLHA 5CIPB 5C2UB 3SDXE 2HFGH 1Q9OA 4HIEA 4P59L 4NO3A 4YO0A 4OLYH 5D6DA 4WFHE 3QAZC 4HULB 1H15A 2FL5A 1H3PL 2FB4H 4K9EC 5IJVA 3EYQD 1ONQA 5DO2D 4K3HA 3BHBA 5E1AA 1AD9B 2KH2B 25C8L 1IC7H 25C8H 1GRWA 5DJXB 1ZHKA 5E03A 3AB0C 4QF1A 4QHMB 3LKQA 5IEHB 5EULV 3QFJE 4OCXH 3BIAX 3PWNA 3SDCB 3ARFB 2L7JA 1OF2A 1DVFD 1U8HB 2VQTA 3RDTC 3D0VB 4OLVL 3L3HA 2QQNL 1TFHA 4DK3A 2VTFA 1ZT1A 1TZGL 4GKSB 1CTOA 5EA0L 1A8JH 5FYLD 12E8H 2VABB 1W2KT 3CJJA 1LP9F 1NAKH 1QTYT 1HK6A 4U1HB 2P5WA 3WNKA 5DK2B 5CZXD 4YGAB 1UWEH 3MRKA 3VMOA 3TO4B 4TUJA 4MB3A 4OAWA 1HOCA 3KS0H 5DJYA 3RUGA 3SEPA 2EIZA 4NNXB 1CBVH 5TE7L 3ULVL 4IJ3C 1YEFL 3JWNC 5EOTA 3RAJL 4HFUH 4JJ5A 4XVSH 2WANA 3RA7H 1EA9C 4NKIL 3NOIA 4KKBD 1Z3GL 2OCFD 3VFGH 4L9LC 5GJSL 2BOCB 3HLAA 4YPJA 1S7QB 5IW1A 2V7HA 4XCEB 1GAFH 5KSBF 3FQWA 3V5HA 4FTVA 5I15L 5ESAB 3TIEA 4FQ2H 5DK0B 3TPUB 1NGPH 5FK9B 4JZJA 3NPSC 3NN8B 5HYSG 4HS6B 1FVCA 3C6LA 4LIQH 4G6MH 1P4BH 4EN3A 4WEMB 2ZP0T 4KK8D 4KDTA 3TESA 2FEEI 3DRQB 1N64L 5F3HA 1BEYL 3VMNA 3TNNB 1D7FA 2YS4A 4GKNA 3QNZA 1D9KB 3JTTA 2Z8WC 1X6NA 3H3PL 4MVBD 4QRRE 2YC1B 2ERJB 4NQXA 4EN3D 3O4LE 3ZE1F 1YY9D 4OCLC 5GIRA 5IW6B 5GSVA 3RUGE 3GIZL 2JJVA 1SJEA 4PJ7A 4LFHD 4NO0D 3UTTB 4F8QA 4GMSH 3MRLA 4TSCL 2P8LB 4FQCL 5KZCD 5GGQL 3JVGA 1RJYB 3BFOA 2X09A 3H7LA 4LLYA 1PJ9A 1MF2H 4LEXH 1CLZL 2ZG3A 3ESUF 5C0CB 3S35L 2H2PC 1XZ0B 4JFFE 2B1HL 4HGWB 5DJAA 2O5ZL 4G8FA 3GBMH 3ULSB 2IADA 3RZWA 4JFFA 4JM2B 5IT2H 1G7PB 1FG2A 3DGGB 3GFUA 5J1AB 5I0DA 2BSSB 3PGDB 2E6PA 4GJTB 1PX4A 2HT3C 2E7HA 5CKAA 5C0RH 3OXRB 4GS7B 3BPCB 4DZBA 1NCDH 2YR3A 3MNVB 4FQXB 3MRQA 3QJHA 5E6IC 4JPVL 5TF1H 2FX7H 4JPKL 3HZYA 4DN3L 1ZSDB 4NNYA 4Z7VB 5D2NB 3UROR 5MHSD 5FUZH 3HCVA 5KVGL 4RFNC 3I9GL 2B0SH 4B7LA 1KG0A 2YN5A 1I3RA 3G5XB 1BBJA 2YUVA 3SGJC 4QRPB 5LQBH 3OXSA 3QQ9C 4G3YL 1T7YA 3D2UB 5CLWA 1OB1A 4OV5B 1WTGT 4TRPL 5IBUG 2YZ1A 1RFDH 1VFAA 3LV3A 2R0LL 3BGAA 2JK5A 4PJEF 2IH3A 3ZHLA 3FQXA 3EDJA 1O5DT 2I60L 2EC9T 4PTUB 1HINH 4JQXA 1MCWM 2J12B 1A5FH 3DHMA 4G6AC 5I8CB 5DJ6A 1JV5A 2Q7YB 1WT5A 1JWUA 4NQSB 5IVXB 3HTLX 3MRKB 2RBLA 1SVZA 1JRHH 4YHKL 2H8PA 5DJZA 3UPRA 1ES0A 1OPGH 4JN1L 2VR5A 2HG5A 3E8UH 4DQOH 1PZ5A 3SBWA 3I75B 1BF2A 5I75C 3UJIH 5I1CL 3S5LA 5C0JB 3KXFE 2QJDA 3L9RB 1JK8B 1A1NA 1HH9B 1G7MA 4NP4H 3RVXD 3SCMA 2VDPH 3FT3A 4HCRL 5H94B 3MGOB 4F7PB 2Z31B 5LXGL 3MROA 2HLFC 3BSZH 1CK0H 1EVTC 2A6JB 5GRXG 3MO1B 3BEVA 3D69A 1J10A 3ULVF 4OZGA 1GCFA 1MREL 4KMTL 4UOJA 4XH2A 1X4XA 5EO0A 3VWKB 2J8UE 1SEQL 1UCTA 2D0FA 4BQ8A 1MFAH 5E6ID 1QBML 1FO0A 3OV6A 4EIGB 3HPJA 4AY0A 3VXSE 3MUHL 3HPLA 2CK2A 4S11A 4YNYB 3HA0A 3N1MC 4MNHA 3T0DA 4FMFA 4DKEH 1SEBA 4XP5L 4D94A 1MUJB 2P5WD 4GKOA 4OZFA 5E95B 2FSEB 5E8DL 3B9VA 3BZ4B 3QHZL 4H88H 4KV5F 2NTFB 5I1JH 1MNUH 5GRWA 2AV7A 4RWHA 4ZUWA 1K8DB 1SJHB 1BFVH 3BP6A 1E4XI 3T1WA 2W9EL 3C6SA 1QNZH 1ZTXL 1U8LB 4OKVA 1F3DH 3E2HC 3HE6A 2V9TA 3EJZC 3GSOA 1G9EA 1FDLL 2AEPH 4H20H 5FYJU 1WJ3A 3L9RA 5C0IB 1UVQB 4NCC2 3VCLB 5AAWA 4XNMB 1CD9B 2H32B 4CBPA 1LP9E 3R0MA 1QYGL 3L6FB 2IANB 4FFVC 3PP3K 4NQDD 1QBAA 1OT2A 2OMNA 5CBEB 3NN8A 2NY6C 4CJ1A 4OCYL 5GS0L 1X9QA 1WITA 1IKFL 4DZBB 2A9NH 4PJBA 5DK0A 3TPUA 3TIEB 1DVFC 1R5IB 2F54E 4DUVA 5JOPE 4LAJH 3SN6N 5MENA 3I6GA 1Q94B 4FZEL 4U6HA 1MFBH 1P2CA 3C9NB 4PRPE 2D9CA 3RX7A 4L8CA 2ADIA 3QG6B 5ACLA 5HGDB 3L7EA 4Z7VE 3WV0A 1UT9A 2XZAH 5SWZD 3SY0A 1T7XA 4HX1B 4BZ2L 4YUEH 4MXVE 5B3JF 1EHAA 1T1XB 3L3KB 3ULUL 5DXWA 4HBQA 5D7LB 4RIRA 3VFNA 2VDNH 2V17L 3VXMD 2B1AL 4JREB 3FB5B 5CILH 1NMAL 5I30H 2V5TA 4J23A 5JXEA 2CDGA 2HA1A 4P5TC 2AK1H 3FRUB 4QHKJ 4XWOD 2OR9L 1WAAA 3PHQB 5I30L 2VDKL 3LD8C 4ALAH 1EMTH 4ZO6A 4WIQA 2XZZA 4OLWL 1RSFA 3OKOA 3WL9A 5EFIB 5IF0B 3U7WH 4A6YH 1KOAA 1VGKA 2YD6A 1U8PA 3EYOB 1AO7A 4JB9H 1IM9B 2P4AB 3GMMB 4KVCL 1KCVL 3BP5B 1TCMA 1I8KA 2UV3A 3VXTA 3RY6A 1DL7H 4XPTL 1ZGLA 4KFZC 5D1QA 3DWTA 3H9SB 4MA1B 4HQQL 1NSNL 5CAYB 5A3IC 3GSUB 1WIUA 2GKIA 2Q86A 5C0AD 1M7XA 1WAAF 1NCAH 2IAMB 2IBZX 3CU7A 4LVOC 4OD1L 2V9QA 4WHTB 4X7EC 5C07B 3X14B 3U6RB 4I77L 5JTWA 4UIKH 4J3XA 4L1DA 3MJ9H 4G6FD 4AK1A 5HPOA 3PJSB 3K2UL 3QUMH 3G5ZB 1A21A 3EFFB 1S7XB 3UBXI 3QEUB 4YHYC 4L8SB 4ZAKA 2X89D 2UWEB 5C0AA 2HFEB 2CDFA 5GGUB 2IG2L 3Q5TA 4OB5L 4QNPF 4ETQA 5FO8B 1Y18A 1MCRA 3HG1B 4D0CB 4M6NH 3DMMD 1OAYH 5HJ3B 4LPXA 3ROOA 5T1MB 4UTAL 2NW2A 2OI9C 4OAWB 3UTTA 2X4PB 3MCG1 4PP1D 4ZDHA 2M2DA 5D7JB 2F54D 5IIEA 5GS1A 2ADFH 1CLYH 5GSVB 2NX5B 4MJ5A 3D6GA 3FO9A 4LAQL 4GBXC 5F93C 4XMKL 4HWEL 1N5YL 4P4KA 1SY6H 2I07A 3W0WA 2D0GA 4YQXL 5F7NC 4FQHB 5LBSL 4Q6YA 1VA9A 4HLZH 2HAZA 3ZDXF 1BLNA 5D5ME 2P8PA 1G9MC 1RULH 3ZKXC 3VXSB 4NRYB 3VRLE 2Y36L 2A73A 2YPLA 3SDDA 1XGUB 1A3RL 4N0FB 3CMOL 3GJFA 3FMGL 3MJ7B 3LOWA 4YHNB 3WSQL 4JFPA 4X5XA 5FV1L 2QKIA 4PJFA 1MRCH 2X4UB 4PJIE 4DUXA 2Y7QA 4F9LA 2GSIA 1DANT 2NZ9C 4CMMA 3RVTC 3TYGH 4ELMB 3HC0B 1SJXA 3MRGA 1NFDA 3ULUH 1G6RL 1CK0L 2NXZD 4GG6F 2VR9A 3MA9L 2XYCA 1OM3H 1J1XH 1BX2A 1GH7A 1KJ3H 1QACA 3PWUB 4F33B 1CR9H 5AYUH 1VEPA 1F02I 2FIKA 4R0LB 1EX0A 4K2UH 3DETC 4UDTA 4ZD3L 4YHMH 5DWUH 3ZHKA 2VLLB 3S98A 4G42B 3LHPH 3M1BA 3BMWA 5ALCL 4NN7C 3SE3C 2E5EA 4JY4A 1F6LL 2WNGA 4AQOA 1J0IA 2X6MA 2BFVH 2JIXA 3QEHA 2IMMA 3HR5B 4DEPB 1YEGL 3AROA 2HRLA 2AJ3B 4JPIA 2EYSA 1MVFA 3MJ8A 3MV01 3WIIL 3SDCA 3FOMB 2A9MH 3DTXA 1TQBC 3L95A 4FNLL 3DVFA 2CLRA 4FHBD 5EU4A 4PJGE 4BFEA 3CZFA 2CUMA 2B2XH 2VLKB 1NBZB 4W70A 4RDQF 1JL8A 4P57B 1IL1B 4K55A 5C09D 3KPPB 4I18C 2WBJC 5KVDL 3KS0J 4P9HH 1XGQA 4JN2B 3MBEC 3O6LL 2Q8BL 4LSPH 2WBJB 2XA3A 4QTIL 1IGJA 4MLIA 1U42A 3E6FA 4U6XA 3LQAC 4FQQB 3CFJB 4OGAC 4G7YH 5IHUH 5L2KE 3MNZB 3SDXA 1KCSL 5SWZE 3MX0A 4YAQA 3VFVB 4XBPB 3KPTA 4P4RA 3K3QA 5MERA 4XGZA 5I0ZA 4XNUH 1XGTA 3CSYB 1KGCD 5CINH 5HHNB 1UVQA 1XR9B 1G7QB 2DAVA 4W6WB 5I71B 3RDTA 4UILL 3WKNA 4JPVH 4EEEA 3T77B 1MCIA 3HUJF 5KSAB 1RUKH 5KSBB 3VMPA 4PY8I 2EH8H 3EYSH 1ACZA 1PKQA 3S96A 1KB5A 4WV1B 3AY4A 1X5GA 1KIQA 2AV1B 3MV8D 2BJMH 3RA7L 2JCCE 1GJIA 3CFEB 4NZTH 4NC2B 1F5WA 3VE0A 4QHLB 4NQDE 4KRPC 5IB2B 4Z0XB 1ZLWK 4PRHB 1FZOA 3R06B 1SBSH 2YSSA 3K2MC 3GJFK 4HPOH 3HG1A 1NPUA 4D0CA 4OQTA 1UJ3B 5DTFA 2AJSH 2HFEA 1AR1D 4MNHB 1YY8A 4P2YA 1WFOA 4RA3A 1WUNT 3JTSB 2D7OA 1P7QB 1ZLWH 1XF5A 5GPRA 3TCLA 3OGCA 4WHYG 4M7ZC 4Z77A 3A67L 1KELH 2ZPKL 2F8OA 4EQ2A 2UYLA 5BV7B 3VI4E 5CJQL 1DBKH 3OKEB 5ID0B 1ACYH 4LSSH 1M7DA 1NGYA 2XG4A 1J0HA 3S34H 3T65B 4Z18A 2VZOA 4A6YA 2CLZB 2VOTA 3O6FA 5JQHC 5A2IH 1P4BL 3MLXL 5IQ7L 2DWEB 3MGAA 4H1LB 4PRBA 3HZKB 5E4EB 4CDHA 5EN2A 2DQEL 1E0OB 4ZG1A 1ITCA 4HS6A 5ITFB 2CJUL 5D7JC 4PR5A 1CFTB 4XNXL 4J6RL 3FB6A 4AEIL 5DMIL 5KG9A 4HDIA 4NKMB 3OPZH 5DMYA 4R6UA 2O5YH 1ADQA 2IALB 2AEIT 2WV3A 3E3QE 3FQRA 2HFTA 3QDJD 4LVHC 3QQNA 4XWOC 4QHUB 3GMOA 5SX5K 4LHUD 3TO2B 3ZMRA 3RBGA 2Z92B 4OGXH 4K7FA 4CVZB 2A6KB 4PRID 5B4MC 3F5WA 1J8HB 3GBNH 4JFHD 4FXLA 4JM2F 4HUUB 2VDML 3C6LC 4OFVA 3VWJD 1AR2A 2VRAA 1RUPL 1RIVL 5HYJB 4QRPA 3KNBA 1H3VA 1VPOL 4PJAB 1EFXD 4BSJA 3HZVA 4UQ2A 4UQ3B 3CGTA 4JDTL 2A1WL 4X80L 2NYYC 3GSNB 2VZSA 2VNCA 4N0CD 5CJXA 2B7DT 4MD5B 3BKML 4WUUE 3BUYA 1OQXA 1EEZA 5E08L 2H3NB 4EVNB 2NY5C 5GGQH 3WDJA 2ENYA 5DJ8A 3FKUS 4DKFH 1UH4A 4Y5VB 2RGSA 1TJGL 2B2XL 2H9GA 1UB6A 2NY0B 1V3MA 4NYLB 4J8RB 4OUOA 1DN0B 2HKHH 1G7IA 3NIFF 1KN2L 3JVGC 2VSDA 4F9PA 4HMCA 2R2EB 3Q3GA 4TOYH 1PKQE 4XRCA 4R8WH 1D6EB 5BZWB 1S9YA 5H2BA 3BKMH 1HQRB 3RWJA 5I8KL 2YD8A 2DQDL 1D5BB 3MLVL 2XV6B 4X4XA 3TWCH 5JORA 3RWJB 3PWPA 5HVWA 4ZPVB 3N85H 3GMPA 2APWA 1VERA 4R9HA 4XZUA 4PRNA 4LQ1A 4ZFGH 2MPAH 3X12B 4ZD3H 4HKJB 3GMRA 2UWEE 3LPWA 3C5JB 4WI7A 3OAZH 3BEVB 1A4JA 5FA4A 4V1DD 1G0YR 1T0NB 4OJFH 3MBEA 3GM0A 3PXJA 4IOFC 5F7YC 2CR3A 1I4FA 2OX5A 1FZJA 3BH8A 3TBWB 5FGBC 3HN3A 2BVOA 3VFGL 4CJ0A 1YEKL 3BGMA 3RGVA 3KYKH 3PDOB 4UUJA 4Y16C 1L7TH 1DJSA 4FQPA 1HI6B 4RGNC 4HG4K 1U8JB 3O8XB 3BN9D 2NXZC 4X6EA 2HG5B 3DRTB 3G5YB 5DJZB 4Y4HD 1QR1A 4KXZI 2H8PB 3LB6C 1NUFA 2C1PA 4M61A 5LKNA 1U8QB 2WBJA 1S7RA 1OQOA 4CNIA 3P9LB 4U31A 4EKXA 5D71H 4G5ZH 3MQIA 3IU4H 2GYSA 2VLJA 4OZHA 2FZ3B 2LQRA 4JZNB 5EU7C 1G7LA 1KPRB 4ZYKA 5F3BA 4D9QE 2NY1C 4V1DB 4XVTL 3VGGA 4BKLB 1IC7L 5B8CB 3MODL 5CP3H 3S3PA 4DN4H 1PG7W 1VACA 5DT1H 4NBXB 5CUSL 2EYSB 1U3HB 4NJ9L 1BD2A 4JHAH 4JQVA 3FHAA 4M8QA 3WIFA 2AXFB 3W11C 3UZEA 3HR5A 4GW5A 3VWJB 3U9UB 2FLRT 2MNUA 1RK1A 5LCVH 2JJSA 4JO2H 2XY2A 2ZUVA 1JNNH 5IFAH 4G8EB 4GKSA 2Z31C 1QPPA 4XI5D 3K74B 2CDEB 2R0KH 3GSXB 4XNYH 1CGSL 3CDYA 4NKQB 4LKCB 2DBLH 1W72B 1OARH 3W5MA 4Y89A 5D1ZC 15C8H 1UENA 1MHPL 4Z0BL 1OD9A 5BZDA 4YZFF 3MRPA 2RAMA 3HRPA 2BNQE 2D7NA 2K7QA 1YN7B 4LF3A 4I9WD 5ITBL 3BYYA 1B3JA 3VFMA 2F19L 4M93B 2DQTH 4FG6D 2WAHA 2DM7A 4EOWH 5IJKC 4NCC1 1UC6A 2VL5B 4OBRA 4PY7B 3DVNA 5I1EH 2QHRH 3ARDD 3B43A 2GT9A 4RFEA 3K81A 4P5KB 3FZUD 3P30H 1MCHA 2OTUA 1OAXL 2E27L 3CVHL 1P9MC 1J0KA 2EDDA 2ZUTA 3OX8A 3GB7B 3DX6B 2J1KA 4DTGH 4LKXB 4RFEB 4LASL 1AP2B 3C8DA 4C83A 4KJYB 5DA4A 5EO9B 4NIKB 5I2IB 1WWAX 5ELIA 1E28B 3RTQD 1ED3B 2DYPA 1ZS8A 3HMXH 1UM6L 3D39B 3RNQB 3BDYH 4Z78B 4HIJB 2P5EE 3ULUF 4GSDH 4I9WE 1H3XA 1KIQB 2AV1A 5GRJH 3B83A 1FCGA 2D4DA 4GUPB 1A3LL 5HHVL 4LKCA 2YHGA 4G6JH 1YPZF 4P2CG 4RFNB 5GISL 2P44B 4XWGL 4X6BB 3O2WH 4IS6B 43CAA 4IOSD 1U8OA 4RRPG 2AW2A 3MXWL 2NW3B 2X7LA 2G75A 4RBPH 3RVVD 4L5FL 3IDJB 5DLMH 5JDSA 1S3KL 1JGDA 1HH6A 4NNPL 1FNLA 1AO7D 1FPTH 5JW3H 1DQML 4DVRH 1YPZB 3CXDL 4JGJA 1DCLA 3UJTH 4L4VA 1DBJL 2WLYA 4JM2C 2R15A 2PUQT 3SKOA 1UQSB 4ORGB 5FUCE 5L8JB 1F8TH 2FYYA 3UBXA 4JDTH 3U2SB 4IMLA 4OZHE 2CR6A 3K46A 4Z7UB 1MH5A 1ZANL 3OR7A 3O3BB 2AJZA 4QGYA 4MA3B 4HKBB 5JXEC 2BSTA 3OKKA 5HYQB 4HT1L 4XBEH 1AKJB 3WNMA 2EZ0D 2JF1A 1Q9LB 3TM6A 5HHPB 5HTSA 1NC2D 3CXHK 2PN5A 3C08L 3UTQB 4PFEA 1MIEL 5ANME 5D7LA 1Y6MR 4BH7A 4KY1H 1KNOA 3U7AA 5T5FL 2LTQB 1D5MB 2ATPB 2VXQL 4OZIA 4B53A 4V1DE 3IAPA 1MHEB 4I48B 2W65B 1NKRA 4JFDB 1F4WH 4JRYA 4GAYA 5DQ9A 2FDBP 1YEHH 3RRQA 3MCLH 4X8JA 1U95B 3ZT6A 1YMME 1D5ZB 4NSKA 4X7SH 4GG6B 3QUMB 4XAWL 5F1NA 5C1MB 3UO1H 1G7IB 3MODH 4LSSL 5E2UH 3RIAK 3LIZL 1GGCH 1BVKB 2E8YA 1DQLH 5DD0L 4P3CL 3FAXA 3LEVH 5GRYA 3MLSH 3L3IA 4ZTPL 4R96B 2X5PA 1BVZA 4P5TA 5IHZA 3F7QA 1FFPB 2R0LH 4C56B 3T4AB 5DEFB 4ZOBA 3RZCB 4TRPH 4Y2DA 4WW1B 1I3GH 3HI1A 1MLBA 4GFTB 4JEGB 3C2AH 4ENEC 2F8XC 3VH8A 4HMDA 3SDCC 4K9EH 4Y88A 5C08B 1RJLB 5I19H 1F58L 4GBXD 1P7KA 2KQMA 3PWVA 4FQIL 3VXSD 3V6FB 2PTTB 2DQIL 4EI5D 5HPMB 3BXNB 4KRLB 3AREC 2ARJB 3W2DH 3KWWB 4OF3A 4LVEA 4QRRA 1FVEB 2ADGB 2ORBL 1N0XL 1VKXA 1NFDF 3QA3A 4HZLA 1DQDL 5ENWA 1I3VA 3QBTB 1T7WA 4L8DA 5KVFH 1HHJB 1NQBA 4AYFA 4S0SD 1OP9A 5IVZA 3NMEA 4M1GL 4U33A 5IB5A 3WN5C 4GAFB 4NC1C 1RV6X 3AFLA 3CDFA 1X44A 5D9SB 3C8KB 5FYJH 4MSWB 3GSVA 3VFTB 1EO7A 3P4OB 3P4OA 3HUJB 4I3RL 1OAUH 3QFDA 2FBJL 4PJ5B 5A2LH 4AM0B 1FPTL 2A9NL 1OAZL 3PHQA 5IFHL 3T1FA 2DQDH 4P48A 5FECB 3N1PC 4EI5B 3I2CL 1MCQA 3KJ4C 4WO4D 1CLZH 3ARUA 4UBDC 4E41E 3MXWH 3IJSB 1WEJH 3LN9A 4FFYL 4MCYA 4M3KB 1EGJH 5GS0D 3EOYG 4FFYH 4FXKA 3KXFD 1A6UL 3QRGL 3RL2B 4LCUA 3RZCD 4U7KA 3D0LB 3EOAB 2QLVB 3JWOH 2MQCA 5DMKB 1A7PL 1WWCA 1MY7A 3QPQC 5D7JD 2OBGA 4YWGL 1BFVL 4OTXH 3ETBF 3EYFB 3RVWC 4EDWL 4Q9QL 4WI2A 3BZDA 2ZSWA 3EGSB 5MENE 1YY8B 2Y6SD 1V7MH 4UTBH 5TJWK 2VMFA 1VPOH 4MNQA 2NQCA 1QFWI 2DMCA 4ODXA 3T4YB 4HUWA 4LIQL 1JHKH 3V4VH 3ET9F 1GHFL 3PNWA 1KLUA 4PLKC 3MBXH 3GSRB 4QXTA 1PZUB 2BOBB 1P1ZB 5D5MF 5DVMA 3IFOA 5J7CC 3VRLF 1T0PB 3MOAL 4ACPA 5H8DA 3WO4B 3QXDB 5KS9F 1RI8A 4RFOH 3VCLA 2EKSA 4HWBA 4IDJH 1T83A 4HKZA 4PJ8B 4HK3J 1J1OH 1L9MA 1A1OB 1U91B 3KYMB 4R7DA 4LL9A 5E00A 4NGHL 3OPZL 1JPTH 3N0PB 2DYPD 1J18A 4F7TA 2F19H 4MGXA 3RAJH 4I0PB 4YDVA 2YXFA 3WO3B 3ZDYE 2YPVL 1CFNA 1BFOB 2XWBA 3CUPA 2F54A 1G7PA 1MFDL 5F89B 3Q5YA 5T1KD 1M7IB 1HHGB 3V5DA 1F4YH 4ZSOA 4K3DH 4PJEB 4QXWA 3CX5J 2VDOH 5DJCA 5L2KB 1KENL 4EQ3A 5KTEH 4Z8FL 1T22A 4P57A 1P69B 1JP5A 5EO1A 1RHHA 3CFBB 1I1YA 2ITCA 1S9VA 3AVEA 3LQMA 4U1MA 1QRNA 1DBKL 4YJZL 3ZL4L 1I7TA 1HN1A 3D39D 2F53A 3B3IA 3PDGA 3TH4T 1J0YA 2KKQA 5JO5A 1T6VN 4PJ9A 2IG2H 3EOTL 5I8OH 3FT4B 4KDTC 4G9FE 5AZ2L 5CHNA 5GGSY 3FQTB 4OGAD 1YMMB 1ZWIA 3QUKB 4PJGF 3VXNA 3IFPA 3MRDA 1MCCA 7FABH 1UEMA 3SHSA 2XTJD 3ZYZA 3QQ3B 3HMWL 4HUVA 1CGXA 2PYEA 4W68A 3O3EA 2DL2A 2UVEA 3CSBA 4HF5L 2E7CA 2DLIA 3BVNB 1SBSL 5ABDE 4NGHH 4YHOL 5GGVH 4N5UA 2NNAB 4TPRH 3WXWL 2Z8VC 2CRMA 1BOGA 3OKMA 4OGZA 2GTWB 4I18A 5TF1L 3BISA 4O2CA 3OKDA 2DQUH 5KANG 3MV8A 3HAEA 1CFVH 2GJZA 4M00A 3PP4L 5T3ZH 3OJDB 5C0RL 4GKZB 3MRFB 5FO7A 1NLDH 4POZD 4NCDA 4QRTA 1I9IL 4ONHA 4WEBH 4RGMB 4WU7B 3WIHH 3UC0L 5F6HI 5EWIL 2OJZL 3PXHA 1U3HD 1B2WH 2JCCF 3RWIA 1V7ML 1OTSD 4UTBL 2BVYA 4P2RA 4JRYD 5BMFH 1OGTB 3SE8L 4XP1H 3V6BR 2I07B 3W0WB 4Y2DB 1Q9WA 3S37H 3QFJD 1W0VA 3VDBA 4LEXL 4OLUL 1JE6A 1WFNA 3QIWC 3MV8E 3QRGH 4X98A 4AT6A 2XACC 3RVTD 3UZQA 4HWZB 5CIPH 1RUML 2MWCA 2X10A 4HWUA 2GW5A 2XQYG 4WDIB 4WFHD 3VFWA 4U7MA 1TJGH 2PR4L 4BA8A 3UTTE 2EEBA 2PYFB 4UDUA 1A6VH 3VI4F 4KQ4H 1S7TB 1WWWX 4KVNL 4KK8C 1FE8L 5DF0A 3QDGB 2MKLC 4YDJA 4APQB 4U6YB 2E9JA 5JIIA 4WFGD 1RK0B 1NFIA 1CXEA 3CVHA 4DFIA 4G6ML 5IBLC 2J2ZA 3DVNB 1LE5B 4OI7A 4NC1E 4XX1G 1MJ7H 5EUOE 2VQ1B 1CL7H 4X9GA 3PABA 1OM3L 1KLFA 2H26A 1T5WB 2NY2C 1MPAH 5FCSH 1WT5C 4KPHL 4L4TA 4IRJB 4LLQB 3SKMA 5MEOA 3OR6B 3MRHA 2P24A 1LE9A 1PYWA 4CW1A 3BIBX 1T66D 3FN3A 4Z6AT 5KN5B 2ZKHL 4X6CE 2VN7A 3MLZH 1RZKH 5ESQA 3WFBL 4ZNEA 2WINB 3OB0H 5HHMB 2FIRT 2XXCB 5F9AC 1XH3A 4YHPB 4OM1H 3FMGH 4IMKC 4X9IA 5C0CD 4ZMAT 3VWJA 2K7PA 2PXYC 3MRRB 4M62L 5J13B 4QO1A 4K9EL 5JIHA 3WIHA 5DJ0B 1QP1A 3KAAA 4Y7MA 3ARED 2EXYD 5DGRA 4NO0B 4FFWD 4ZUVA 4OZIE 4KJPD 1F4HA 1I3GL 5IBTH 1RJZB 2JJUA 5FYKD 3ZTNL 4HWEH 3IDYB 3QG6A 1JNHA 3MRJA 2VDPL 3FONA 5F70A 2FX8H 1SMOA 2XN9B 4FTVE 4NO2A 3LRGA 4KTDL 1X7QB 4MJ4A 2VZVA 3M07A 4XBGA 1JPSL 2V6HA 4FQXD 3FO2B 3DVIA 1J0ZA 3O4OB 1KC5H 4Z7UF 2WLZA 4B41A 5EOTB 4XB8A 4OIBA 1JRHL 3QJFB 5CBAB 2QSTA 1B0GB 4J4PC 4OLYL 1V3KA 2DI9A 2LE9A 2H32A 3ARGD 1MQ8A 4WWKC 1HYRC 3GKWH 4ZNEE 3EJYD 1IEBB 2CSPA 3F62A 5CJBA 1FCCA 4MQTB 1T6WA 3QUYB 2NPLX 4ERSH 2BK8A 4KK6D 4MD4A 3VXRE 5EU3A 4F37F 5DD6A 5EUKB 1CT8A 1RFDL 1NCAL 3ARZA 4LMQI 3CDCA 1ZGLP 3BWAA 1KPUB 4OFIA 4WFFD 3IFLL 3RY5A 4HC1A 5T5FH 4PRAB 4WI6A 4EJ1C 3B9KD 2IH1A 1A9EA 2P8MA 4UB0L 2UY7A 3GI8L 3LH2H 3C5SB 1SM3L 4OZFB 3IDGA 4PRPB 3WNOA 1QOKA 5DJCB 4PLJD 1P53A 2VLRB 2A38A 5FYKH 1CDYA 1PW3A 1ND0A 3C60D 3QI9D 1ODAA 3B9DA 3VG9C 5I66A 2AK1L 3IGAB 1EEYA 5FDYA 1P84K 1U8KB 2DRUA 4ZOEA 4F3FB 1BJMA 4L8BB 2A6IB 4L29A 2UZYB 4UT9H 5EOCH 5IB1A 2VDNL 2X9WA 1OWRM 4Y16D 1DUZB 3QCTL 4BZ2H 3GI9L 4Q0XL 1T1ZA 5CJ5A 3VFRB 3IF1A 5DSCA 2L4OA 3IKCA 2YD3A 2A83A 4DVBB 5SV4A 5DVOA 1T7ZA 4XPGL 2IWGA 4MD5A 5BVJA 3NFPB 4QGTA 5D1XD 3AS3A 2B4CL 1PDKA 2I5YL 2YBRA 3MRIA 2BERA 3V5KB 1HILB 3K1DA 3RNKA 4LARH 3MZGB 4ZPTB 4JPWH 4KTEH 2LAAA 1NC2A 1ZA6A 3LSOA 2D4FA 2P42B 5I9QC 5I8CA 4PRHD 2BFVL 2UUDK 1IGFH 1I1AD 4K3EH 1HYSC 3BN3B 2HKHL 4MD0B 3FCTB 1D3CA 1KJ2L 5E7FA 1HHHB 4F7EB 1SVCP 3LS4H 4XP6L 1UFUA 4YDKH 4NUGH 2Z92A 4PJHA 2VSCA 2AK4D 4XBGB 3LHPL 2H45A 4P2OA 2FZ3A 2GFBA 3CU1A 3OKLA 5DWUL 3CVIH 2Z4QB 1OB1B 5K59F 4CN6A 4BSVB 5L6YH 2DWDB 4XCCH 4Z7NF 5MI0C 2PW2A 1NAMB 2BSRB 3B9EA 3BW9B 5IVNA 5EIIB 3TPKA 3U0WL 4UAOC 3VGEA 4MJID 5C6TL 5BV7L 1T03H 1MWAL 3CFDA 4UOW0 2C4XA 2QSQA 4UT9L 4YFLF 4J3WA 4M62H 3QZWB 3PL6B 1GAFL 1AGCB 4WJ5A 3R1GH 4LBEA 2GJ6D 2XZCL 3HNSL 2G9HA 3LKRB 4MJ6A 2AK4B 5MHSE 1BOYA 2DI8A 1U92A 3JZ7A 3K80A 4N9GA 3T0EE 4MQSB 4F57L 1DTUA 2CKNA 3P9MA 4PJDE 2YD5A 1DN2A 3WFCL 1AXTL 4UOW1 3PABB 3ULVC 3SDDC 5T3XL 4C4KO 1RU9L 2VL4A 4F7EA 1K4CA 3VRIA 1T5XB 1L0XA 1IAKB 2ADFL 1WTLA 4JAMA 1TZGH 4MB4A 1TIUA 5J12B 3GSNL 2EDOA 3GMQA 1RMFH 3NZ8A 5TDOA 3GO1L 1UWXH 2BNUB 2BVUA 4LCWE 4EN3C 2LTQC 3S8WA 4JRXE 2BY1A 1A1MA 4CADB 1A6VL 3VI3F 3MLRH 4M7LH 1OAQH 1FNHA 1TZHA 1ZHNA 4IEFB 3MLYH 4EI6A 1CGUA 4LK4A 4LBEB 3FFCD 4D8PB 1KC5L 1VGEH 3QDGE 1ZVSB 3GSWA 3O11A 5JHDA 5L9DH 3CCHB 1YJDL 2W0FB 4FQJH 4ODSL 2HLAB 1L0QA 4AENB 3TFKD 5IMKB 1ZLUK 4P59H 3BUYB 4BFBD 2OTPA 3DMMA 5EZJA 5J9PB 3QP3A 5F7FA 1NDMB 2ZUUA 5AWNH 4UU9B 1MI5A 5BJTB 4P3DA 5D5MA 3A6BH 2PYEE 4Z7QE 2E6JA 1T2QH 2A6IA 4L29B 1S7WB 2CLVA 1BD2E 5FYJD 1P5VA 3S35X 3GMQB 1F90H 1Q9KB 2K1MA 3RWGB 1LNUA 4ENED 3H7BA 5IM7A 4PB9H 4JPKH 3GHEH 2R69L 3VD3A 4N8CH 2D0HA 4RGOL 1UKQA 1FFOA 3H6JA 1FYTB 4JFHE 4ZODA 1T04B 4WHYH 1GSMA 4HUMB 4G9FD 3SQOL 1HNFA 2AI0H 4EUPG 2YA0A 1CT8B 4C56E 4WTZG 2B5IC 4ODWB 3BZFB 1EJOH 4S1RH 1T3FA 4GRLA 3WJJC 4ZS7H 4MQXD 5MEPA 3HZKA 1CL7I 2HRPL 4JVUA 5HYQA 4KROC 3QT2A 3EYQC 5KVDH 3P3YA 3OR7B 2IAMD 1IT9L 3QEQA 4E5XB 4NKOB 2AAVA 3DX9B 5GXBB 3DO7B 4TSCH 1IC4L 5K9JL 1MF2L 5E24E 2H1PH 1T0MB 4NWTL 3UEZA 1ZA3B 1I3UA 2ZUYA 3LRHA 5D7LE 2FR4A 1I8MB 2F53B 4WTWA 4XXDB 1BD2D 1A7NL 5FYJE 5ISZE 4LDEB 2I27N 2X1WL 1FBIH 2Q8AH 3ZE2F 1Y6NR 3PQYD 4XPAH 1J87A 2BC4A 1TDQA 1QNZL 3DXAB 5F7LB 3GRWH 1ZHLB 1MHCB 2XKSA 5ACZA 1MVUA 3O6FC 4DK6A 3QO1B 5JPMB 5E5MB 1I7RA 3Q6GH 1X4ZA 5F89A 3HG1D 4PYHA 2AJYH 4ZPTA 4K23L 1UZ6E 1CFNB 4XCYA 3U4AA 4M02A 3VG0H 5SWZB 5EC1A 5IB2A 2ICWB 2JB5L 32C2B 3HNTH 3H3KA 3QUXB 1T83C 1F45A 4QRQA 3ROLB 1CFSB 1CICA 1NL0L 2AI0L 2XKNB 3X11B 1JGEA 4OLZH 4RGNE 3IDXH 2OYPA 3IS0X 1JF1A 3MRQB 5E2WL 3EW3B 3BEWB 1UH3A 4WEUD 5ERWB 3BDXA 5CZKA 1YN6B 2DQIH 2E7MA 1IM9D 2QL1A 4NQDB 3LY6A 3ILPA 3QXAB 4FQIH 4H0HB 4YLQT 4XNQB 1RY7B 4L8BA 2WIIA 2HVJB 1KTRL 4YBLC 1N4XL 4GAYB 3TN0C 1ZHLA 3CLFH 3QNYB 1XAUA 5HI4D 4NHCH 3W0WD 1FNSH 4TVPH 5E94A 4FRWA 3BZEA 2FHCA 1G6VK 2X4SB 3BP4A 5DD0H 3STLB 8CGTA 5K59E 4X6CA 2NY2D 4WUUB 5FV2A 5I1DA 4PJCB 1N5AB 2JE8A 1H3PH 2FB4L 2MHAA 1LK3L 1S9WA 3K2UH 2HH0L 3E1F1 5I17B 1DEDA 4MDJB 4NKOA 2R4RL 4LCWB 3QFDB 3MCLL 5IG7B 5F9DC 3SDYL 1T20B 4E0RB 1G9NL 5MP6L 1AFVH 2SEBB 3NIGE 4G9FA 3U30B 5EZLA 1OTUD 1YUHA 5T3XH 1K3IA 3MA7A 1ZT4B 1IGML 3PWUA 1HKFA 1U8IB 3IJYA 4F33A 5F3BB 5ESAA 1CYGA 1JWSB 4ZYKB 4HLZG 1QFHA 4URTB 4LLWA 2DM2A 1REIA 3VFUA 1BMGA 5D1QD 2OL3A 4Y4FB 3NFNA 3WS3B 1PEZA 2ED9A 4WO4A 2DQCL 1MIEH 1CD8A 3LKNB 5E8OA 3V0VA 5F6IC 1RJZA 5SX4H 2D7PA 1NCDL 2AS5M 1ADQL 3T3PE 1K85A 3U82B 3LKPB 3JV6B 3QDJA 4TVPD 4F80A 1GHFH 1OSPL 5C0BE 2DTSA 2NZIA 4LU5H 1F90L 5FYLE 3S6CA 1U8JA 3NCYP 3EO1B 3O6KL 4I13B 3DYPA 1DQJB 2B5IB 2ZSVB 4QOKB 4WI3A 2VABA 4FOMA 4PY8J 5F7DB 1MFCH 4NN5B 5KSVA 4OFDA 4LSRL 4JG1L 5F9OL 2Q20A 4IBLT 1ZT1B 4PIRF 3HUJE 5DS8B 1XF4A 1JZ6A 3S35H 5AWNL 1QEWB 1KJMB 2VXSL 4K8RD 1TPXC 5IK3A 4X83A 3HE6C 1A7PH 4L9LA 4G43B 1A6UH 3MLWL 2VC2L 5C3LD 1CDHA 1EBAA 4YDKL 1HDMA 2R1XA 1DQMH 3D25A 4HMEA 1A0QH 5SWSB 5DD3H 4FXGA 1ZLVK 4EI6B 3X13B 4UI2A 3LZFL 3QDAA 4KJYA 1T21A 3RQ3A 3TZVA 4PJEA 2OP4H 4KHTH 1AHWA 2ICEA 2OL3B 1XGYL 5B39A 4YPGA 1F4AA 4YPGB 3EBAA 3UYPA 5ALCH 2J8UB 2X4QA 1AHWB 2IAMA 1LK2B 4TN9A 1FJ1B 3EKCA 2VLRA 2XA8H 5HHVH 3GKZA 4NT6A 1OSZB 5F44A 2BCKB 1VADB 5IV2B 1JGVL 3OB0K 5LAXB 1UWXK 5CLTA 5E4EC 2NY3D 2QR0A 5JPNA 4I4WB 8FABA 5M95B 2UVFA 3ZYOA 2R0WH 5GRVK 3VXPB 3NGBC 5BZDB 1I9RH 1NCBH 3SCMC 2DIJA 1XR8B 2BNRB 5JNYB 3G6JE 3IDXL 4D9QD 5E1HB 3O4LA 4PJHE 1PZ5B 1Z3GH 4NQVA 5I8EB 3LQAH 5IQ9A 3EHBC 2CD0A 2BC4B 1DSFH 1FNGB 3WFHA 3HNSH 4FTVD 1QBMH 4XVUC 3BH9B 3MBED 5E5MA 4PJ9D 5F7MC 3RVUD 1K8IA 1A6TB 4WNQA 3QJFA 5CP7A 1NBQA 4RMTA 4OLEA 4HIIA 4N90D 4E9LA 4LCYA 1GXEA 1TETL 1LP9B 2DL9A 1AC6A 4LLDA 4QXGH 3D0LA 2C7UA 1HHGA 3V5DB 4M4PA 4WO4B 3WHXA 3RTQC 2XTJE 1PG7L 1UJ3C 1JHTB 4OQTL 4FXKB 4R4BA 1MHPH 3NPZB 1Q94A 3MYJB 4FQJL 1UEYA 4K8RC 2X1XR 1A64A 4P3CH 4E41A 3WJJA 1TJHL 4XNYL 5CSBA 3FB6B 4M6NL 5TFSL 1MCFA 1VFBA 4N9OB 5FUOH 5DRNA 2WP3T 4NO0A 2OZ4L 4UAOB 3QULB 3NBNA 1JF1B 1JF6A 1GGBL 3K4AA 4NZUL 4GRWH 4KI1A 1HQ4A 1MCWW 2HTLD 2HP4A 3ZT7A 2V5SA 3HCVB 1JZ5A 2R56H 3GSVB 4P23C 5MI0B 3VFTA 4PP2A 5I71C 43CAB 5E4IA 2W0PA 1PY4A 4IRZL 3LN4A 4Q6IA 1H0DA 5D6CA 3VGAB 4HQQH 1MJUH 5E8PA 3UTPE 1MAMH 2D7TH 1V7NL 3GBLA 3OKEA 4G5ZL 5DQJA 1YEEL 2R8SL 3U0PA 2VXQH 3QXVA 3UTTD 5E6YA 5D72L 3HR6A 5FCUL 4HKJA 5FB8A 3FRPG 2WBWB 4G8GE 2HN7A 4F7MA 3MUGA 5B39G 2DKMA 4LSUL 5E0QA 5HDQH 2J88L 3DBXB 4GQ9H 2VDKH 2OTWB 2R2BB 3G08A 3O9WC 3IETA 4JRXA 1QSEA 2CIKA 1G9MH 1ZHBA 4S10A 5HHOE 2MQ3A 2EH7L 5DFVD 2NX5E 3MOBL 1XGRA 4UDUB 2FX7L 4QWWD 5CD5C 5D5MB 1OAXH 3ARFD 4JCMA 3BP7A 1VSCA 5JOEA 1ZE3C 2VIRA 4RISL 1EHLL 3D3VB 4X9HA 2Y5TB 2WUBH 5L6YL 3DMMC 3FQNB 3TT3L 1WIPA 3NA9L 2WQRA 1G7HB 3HRZA 5GS1C 4X8XA 5CMAB 2EKSB 3AY4C 3DSNA 1MAJA 1XGTB 1KXQE 3CSYA 1U6AL 1ROWA 3SDAA 1MCLA 4QRSB 2P5EB 5JW4R 4ZUUA 1OGTA 4MA7L 4MAYB 4AMKL 1LO2L 4PPTA 5I1KL 1OD7A 5I8KH 3UPAA 2GK0B 3WFDH 3CC5B 2FGWH 4LVNB 5GZNC 5JIKA 4WFEE 3GJEA 2PR4H 3P11H 2PCPA 1GC1L 1MCBA 3QQ4A 2F5BH 4LCCA 2AEPL 4H20L 1IC5L 1H8OA 3QISA 4D9RE 2FJFB 4HH9A 3O81A 1MSPA 1IEAA 1KBGL 4LSVH 4FQLL 3L5XL 3OKNA 1NC2B 1JPSH 1BOGB 3OKMB 4BJLA 1UWGH 4Y19E 4KI5E 3U4BH 3JWDC 1DQQB 4DGVL 5C0DB 4N9GB 1IZKA 2DMKA 5CCKL 2XOTA 4WWKB 4JRXD 2BVPB 3TH2T 1ZT4A 1HIML 5FECA 1LO3H 2C1OA 2ESVE 4KUCD 4PJ5A 1UZ8A 1T20A 1DBBL 2IQ9H 3O2DA 4P46A 3BKYH 4N0UA 5KSUA 1NCTA 3VXOA 5IVXF 1MFAL 2C1OB 3PP4H 3C60C 3BYTA 3QI9C 4DKDC 1SEQH 3QFJB 5BVPL 4BQBA 3H9SE 2MJWA 3TJEH 3U83A 5EOCJ 1LHZA 3V6ZA 1UG9A 2HYMA 3SJVB 3IDYC 1DZBA 3OZ9H 2AJXH 4M5ZL 3BPCA 2AJUL 1I1AB 2O5YL 3PDDA 4UV7H 2FWOA 3QIUA 2ICCA 5J6HB 3S88L 4BQ6A 2GAZB 4ZUTA 5CSGA 1VFUA 1ND0B 3PE9A 2IAMC 3BPNC 1JYNA 5FGSA 1TVHA 2MPAL 2NLJB 2PXYB 1SQ2N 3O4LD 5A16B 4JDZA 4KC3B 1WCQA 3VD5A 3JTSA 3MZTA 4M4RA 3QIWD 3CD4A 1XR8A 2V7NA 3MLXH 4YR6B 4ZFZA 5IQ7H 4GRMB 4K3JL 4Y4FD 3BAEL 2QQLL 4U6YA 4C58B 2G60L 3KPMB 4BFIB 1F3JA 5D7IF 1IMHC 1NUNB 4Y1AD 3QCVL 3KPOA 2YMXL 4PJ5E 2EDKA 2W38A 5DRZA 1CFQA 1GZPA 5JHLL 1RUAH 4MQ7B 4Q2ZA 3ZL4H 4N0UB 1KCRH 1URLA 4PV9B 2J4WH 2P7TA 3NABH 4O58L 3CFDB 1RVFH 1JVKA 3UMTA 4LCWD 1EEZB 2DDQH 2VLJD 2R1YB 1KPVA 3IETB 2ICEB 4MZ3A 1TCRB 1R3LB 1ZS8B 3U2SA 5FM4A 5SWSE 4D8PA 4O9HL 1FL5A 3LKNA 4JHWL 5D7IB 4ORGA 5DC0A 5SWZA 2XN9E 4PJAF 2FH6A 4XP1L 3DJ9A 3MYJA 5IMMA 4PJIB 2C9AA 4U1LA 2B0SL 2XN9A 3DGCR 3KPRD 4NO2B 2FEDD 5IOPB 2VQUA 3IDMB 3QQ9D 5CSZB 2HLFD 3UYOD 2V7NB 3UYRH 2OJEA 4WHTA 1I85C 1BWMA 3P77B 4PGCA 2EH7H 4HD9A 4LMQE 2HT2D 4XX1E 1CCZA 1QSVA 3B4NA 4XCFH 5A2KH 4RMUA 4KK6C 4K7FB 2X05A 1RUKL 5I9QB 4HJJH 4JFED 4IDJL 3D18A 4GOSA 3RU8H 4TSAH 4RFOL 2HJKB 3ZTJH 5DQJB 4QRRD 3EFDL 5GGTH 1RZJH 4GRLC 4K94H 3ARGB 4OZHF 1DBML 2DJ4A 2FATL 3IFLH 4F15C 4W6YB 5GGVL 3WXWH 3VXRB 1U2HA 2P5EA 2VDRH 4NQVB 2D03L 1FZMA 3C87A 2AEWA 3ZKMC 4X4YB 3ZKND 4J3UA 5E5RB 4ZFFA 1IGMH 4KK5C 4U4BA 4MXWL 3O0RH 1MJUL 4KUZH 4Y1AA 1G9NH 4KGJA 4TUKH 5E94B 1TVBA 1DANU 1VCAA 4LNVA 1HHKA 4AEHH 2KQNA 3DARA 4BZ1L 5I2IA 4FQCH 1JBJA 3F6IA 4EZMA 1LK2A 4OCRL 1J7VR 5DHVH 1OCWL 3P77A 4RMQA 3U7YL 3H9HB 4ODWA 5DHVA 3F7YA 4E41B 1C16A 3IDMA 3B3IB 4XC3L 4RAVB 4MNGA 3NCJH 2PO6A 2R39A 3KYAA 3M8OH 5F1SA 3RWDA 4DZ8B 4PJIA 1WEJL 2XWJB 3FN9A 1P84J 3SPVA 3HZMB 4GG8A 1BJ8A 3SO3C 4OD2A 3EIFA 5C0EB 1JGUL 5CIPA 3PQYB 3D25B 5E70A 3WLWC 5CGMA 2FBJH 1X5IA 1PEWA 3BXNA 2ATKB 3B5HA 1WBZB 1WLHA 3BT2H 4PGDB 2A0LC 5DD1H 4ZXBD 4D0BB 4YHIA 1KEMH 1P7KB 3O3DA 3B6SB 5JZ7C 2VAAB 3IB4A 3UC0H 5GGTA 3OF6A 2BP3A 5EBGA 1LWRA 2X9XA 4O2EA 3VH8B 2WK2A 1I9IH 4JY6B 1NGQH 1Q38A 1X5KA 3F8UB 1J9CT 4R7NB 1K2DA 5JQ6L 3QUYC 4L1HA 2BSED 3TT1L 3WUWG 5DUBA 5IMKA 5BOPA 3OAYH 2HJLA 4JFOB 5FM8A 2ZKHH 1S7TA 4M7KH 3C09C 4JM4L 3OJDA 4HJ0C 4ELKA 3NACH 4XAKE 5CINL 3SCMD 1AJ7H 2VIRB 3MREB 3S4SG 1CXHA 3IFOB 1J12A 3RGVD 3DSFH 4L3EB 4ELKB 3G5ZA 12E8L 1KIPB 1RK0A 4XHJC 1EXUB 4I0PC 3MR9A 3SQBA 1IGJB 4PBVC 1C16B 1JHKL 3V4VL 4OLVH 5CCKH 4Y4KB 5I16A 2BY0A 4K7PY 1G9NC 4X6FB 4DGVH 3DUHA 1N3NA 4FABH 3ZYJA 2PKDA 3D9AH 4ZOAA 5I8OL 43C9A 3KGRA 2A6JA 1JFQH 5KSUB 5BCAA 2Y07L 1RUQL 3W0WE 1QSEE 2DBJA 1YQVL 3IFPB 3BP5A 4CAGA 1UZ8B 1AQDA 5C08D 2ID5A 1RZJC 1Z2KA 3SE9H 4XT1C 5ANMA 5DDHA 1EGJL 1EAPB 3MRNB 3L3GA 3L3GB 4DOHE 1QRND 3WKML 4G8EA 4GQPH 3WFDL 2BRRL 3P4LA 4BZ1H 5JW4Q 1CDCA 4A2LA 2X4SA 3PWPE 4S1QL 3HS0B 5J6HA 5LWYH 1JWUB 4NQSA 5IVXA 3SO3B 3BPOB 2A74A 3GSQA 1B2WL 4DFHA 1X5JA 4DUWA 4BFGA 5FYJL 2NY7H 1QKZH 4K2UL 1QFWM 3FO2A 4XMPL 2NY3B 3FL7A 5ADOH 1S9YB 4S1DD 1OGAE 4PJ7E 5GGTL 5HHQA 3GK8H 2LV4A 3SJVE 1TZIB 4LCWA 5HHXL 3MOBH 3QPXL 3GK8L 4JFYA 1UADC 4M7JL 2Q3AA 4DWHA 35C8H 1C5DA 1TCRA 2R69H 5E00B 4HIIB 4P23A 5LGHL 4NRZB 4XPHH 3RL1B 1C08B 4XCNB 4C55A 1A3RH 1ZXQA 1YMHB 2XKNA 3O9WD 1P5UA 3RNKB 1XH3B 4P9HL 1PLGH 1S9VB 5E2TL 5KS9E 3SDYH 32C2A 1RULL 3REVB 5E5UB 3REVA 3T3MF 5I1AB 1T2XA 3QIWA 1OT1A 4DAGH 5D2LE 1MWAB 4ZUSA 4GUPA 5C92A 5C0FB 1MFBL 3QUZC 5CD3B 1HKLH 2HT4C 2OJEB 2YWZA 5DFTA 5F72S 1FH5H 4YFDB 4MAUH 3KHOA 1R3IL 4R4FH 1IQWL 4FQ1H 4HUUA 2QSCH 5JW3L 2DQGH 5C7XL 4A2MA 2VQ1A 4UU9A 4CU6A 5DHXB 4HGKC 5CEYA 1TJIH 3FO1B 5LGKA 4TVPL 4WI5A 1KIUA 3DVGA 1JFQL 4UV4L 2XT1B 2MOVA 1F3DJ 5HHQB 3GB7A 3BUTA 1PFCA 3KYMA 4R7DB 3JXAA 5IB1B 1U91A 4F7CA 4BSWB 5C0CA 4IJ3B 3ARVA 3JV4B 2UZIL 3TF7C 1QSFE 2W07A 4Q2ZB 4YZFE 5GSRB 3GUTB 3PWLA 4X9BA 5FOBA 5JA8B 1A3LH 3WS6A 4F7TB 3UZVB 5D1QB 2YPVH 1ZGLB 3W9DB 3GUTA 1PKQB 4WW2A 4PRAA 5IR1A 5C07E 3GNML 3M17B 4J4PA 1W8OA 2Q76A 2VKWA 4OZFG 3BWAB 3HMXL 1OTTC 5LVEA 4QRUA 2CIKB 3IJHB 5I17A 1RZ7H 3OZ9L 2KUTA 5C86A 4S2SB 2APFA 4X5WB 5IVOA 5EC1B 1FYHB 4LASH 2FO1A 4PJCA 2PXYA 1U58B 2Q3ZA 3HZMA 4ZO7A 4M5YL 3W81A 5LJYH 1BZ7A 3NFSL 4NWUL 5TQ2H 1QRNB 1TTUA 4GH7B 2B1AH 2Y36H 1F6FB 2BNQB 1HHHA 2VB5A 3Q6GL 4KRPD 2EYTA 1LNUB 1H0DB 1V3LA 2RFXB 3BN9C 2VLME 3BT2L 4RMWA 2GIYA 5IMOA 3U4EA 1JTTA 3SKOB 2N56A 2RQ8A 4NOBA 5T1LB 3CC5A 5I1LB 4LLMB 4L4VB 4RAHA 1MHHA 3CVIL 4PJ5D 5C9KA 2YBRB 3C60B 3QI9B 2BNRE 4TTDC 2C4FU 1NAML 5BW7C 1UXSB 1WZ1L 3MUY1 3TBSB 5C2BL 3VA6A 3U1SH 3QXUA 1NMBH 1FQ9C 4GRWB 5DLML 4LEOA 2X1QA 3FN0L 2DQFB 4WW2B 1WICA 1JHTA 3FFCA 1CDUA 1OAZH 1Z6JT 2NXYB 1HINL 4PG2A 4QRQB 1ZVYA 3WE6A 2FBOJ 3RVWD 3N9GL 1WF5A 4OCNC 2GSGB 3FCTA 4GW1A 3NVQA 4MXWH 3RWGA 3T0ED 5D71L 4OIIH 4DAGL 3MRHB 3O2VL 1ZT7A 4F58L 4M1GH 5J11C 5J06A 3I6KB 1MRDH 3EFDH 1IAKA 3BDYL 4JQVC 1A7RH 1EO8H 2B8OT 3SQOH 3L5WA 5KVMC 1JZ7A 4LPYA 3QH3B 3RVXC 3I6KA 3QZWG 4ETYA 5B3JE 5SV3A 4HC1L 2BMKB 3DTXB 3L95B 4U0RB 5EDXA 4HT1H 4XBEL 2OR8A 2CXKA 4JPIB 2F8VA 5IMMB 3ARDC 3KLDA 3W9DA 3DECA 3QEHB 4WW2C 4WRLA 5KSVB 4PJXE 1MREH 1D5XB 3DMMB 5EZJB 4E5XA 1TNMA 3D85A 3C6LD 2F53D 3ZSSA 4WI8A 4PD4J 2DQFA 4JE4B 3DO3A 3BE1L 4BFIA 4P49A 4M1CC 3QSKB 4PD4K 3C8KA 5B4MD 1QSEB 2VISB 4FP8L 4WUKL 3UTSB 1YEEH 2DDQL 1GGIH 2RB8A 4MDIB 2DF3A 1P9MA 1BX2B 1FGVL 4MXQD 1QHPA 1T5XA 3ARGA 4M6OH 5HDBF 3KJ6H 4RQQA 4PGBB 3ECBA 2GFBB 2R1XB 3MYZA 4U6XB 2WQ8A 4JQXC 4EXKA 5IJKA 4YHKH 3QDJE 4PYGA 1FORH 1N59A 4G8IB 5M94B 4LLDB 1JWSA 4LRIC 2ADJB 4OCMC 1OW0C 3V6ZB 4XCEA 3FT2B 2Q86B 2ZWLT 5CP7B 2N1KA 2VDLH 3H3PH 1LEIA 3DX8B 2JK5B 1JMZA 1BM3H 3CFCH 1PAMA 3QDGD 3WDIA 1AC0A 4R2GB 3VD9A 1P4IH 2MFNA 5IW3A 3LQZB 1MI5B 1AXTH 2V2TB 4HFWB 4CUCA 4EDXA 5CGTA 5GRUL 2V2WB 3BJ91 3DUUB 4GW4A 3VWJC 3ARBB 4PGEA 3DYMA 5HVHC 4P2QE 3HAEH 1BWWA 4ZDHB 1KTDA 3T2QA 2QR0B 1KIPA 5BO1H 2MCG1 1ORSB 4NFCA 5EBMA 1T1ZB 5CGYD 5CHNB 5DGQA 2GITA 1J8HE 3DI2B 3NH7H 1OAKH 4HS3A 5EBWA 3B5GA 5IMLA 4LOUC 1M7DB 3MLZL 3JV4A 4K07A 1K8IB 4WNQB 2BNUA 5LG1A 1YNLH 4G8IA 3NCCB 3CLEL 3OAUL 4N68A 3V79C 1A4KB 4ODTL 4U7SA 2FL5B 2ICES 2R0WL 1NLBH 1CI5A 2Z8SA 4CVXB 4N1CA 1T80A 1H5BA 3NCMA 5I1CH 4U3XA 5J6GB 3KPRA 3N85L 1CGSH 2IADB 3IXAA 3TN0A 3ZKMD 5KVEL 3GJFB 5TPWL 4KJQC 3SJVA 2Q76B 2J5LC 1EPFA 4BELD 3MLUH 3DLQR 2DD8L 1FZKA 5LAXA 4GMTH 3R06A 2I26N 4PJCF 3IYLW 3RPIA 3A6CL 2OP4L 4YEFA 3D3VA 4BYHA 1ZLVH 3AXLB 2VN4A 2YA2A 3O3DB 3FB5A 1FGVH 2Y9RT 1YMMD 3ZE0F 5C09E 2HFGL 4XNQA 3SKNB 2IBGA 2DQJH 2BMKA 2ZCKH 3OSKA 1Q72H 5C0EA 5B8CA 2D31B 4D3CH 4HS3B 4L4VE 4JKWA 4LHJB 1CGYA 3VXUB 3IDNA 2F5AH 3VFWB 1PG7X 4ELMF 1CU4H 2AJSL 2HN7B 2NY3C 4F7MB 5HDLA 4LKXA 4GG6A 4Q9RH 5IGXH 4RISH 2BVQA 4J3SA 4ZS6D 2JTDA 4Y1AB 5EU5A 4PREA 2YXMA 5EH1A 5DUBB 4JFZL 3GMNA 4I2XA 4LU5L 3H9HA 3L3JA 1ORQB 2IFFL 2C5DC 3DBXA 3VXQB 3X11A 3HKFA 4LCCB 4UNVA 4NZTL 2X4TB 3DURA 3PWJB 3WDHA 3RPIB 1LEKA 4OF5A 4XCYB 3LSOB 5GJSH 4ZFOB 3TV3L 3T0EA 1BZ7B 1IAOA 5T1KA 5T1KB 3DETD 4N1EA 3BKCH 4PJEE 5B21A 4KUCF 1A1NB 3RI5K 4HBCH 1LEKB 3RUGB 4TPRL 2K3TA 5I76A 1YA5A 5BRZE 2R4SL 4I0PD 2R8SH 4KH2A 3EJJX 5D6CB 5JO5B 4Q9BA 2Y06H 2VXTH 4V1DA 1FV1A 3GRWA 4G7YL 5IHUL 2CMRL 4GG8B 3ZKSD 4OD3H 1EHXA 2DLEA 1M05B 5EA0H 5KSAD 2M26A 3T8XA 5I1LA 5C0GA 4PV8A 1JNNL 4PRNB 5IFAL 4FZ8L 3B8SA 1U36A 5HYEA 1MY5A 5JOPD 4JO2L 1N7MH 5FHBL 3IDNB 1WK0A 1KCLA 1A7OH 4JHAL 3QDME 5HD8C 1KCRL 3RWFB 2J8UA 5CEZD 2ADIB 4P46D 5J1SC 4PREB 1B0RB 1M71B 5FEBA 1TVDA 1KCKA 4U1LB 3MLYL 3LS5H 1IARB 4EBQH 3KG5A 3WNLA 1D5XA 4FABL 1FNSL 5T33L 4HK3N 4C54A 3GDBA 3INUL 5EZIH 1F4XL 1E6OL 4M93C 1QR1B 4TVPE 1KTKE 3F7PC 4PJ8A 5CFHA 1BQUA 4HCRA 1G7MB 1Q1JL 3Q5OA 3WFEH 1LE9B 2VLRD 2OL3L 1AQKH 2LU4A 1IAOB 2JB6B 5D1ZB 4HPOL 1KFAH 3AXLA 3L1OL 4POUB 5EU7E 1CXLA 1U93B 3CLEH 3GSOB 4JM4H 2I24N 2Y23A 3HC4L 4CVXA 3FZUC 3RWIB 3ZDZE 1UJTA 4JM2D 3PWLB 4X6FA 3S96B 1D5BA 1IE5A 1ZT7B 1IRAY 2CRZA 4P2OD 3GHBL 3K8KA 3TN0B 1E4WH 5I18H 1T21B 5D7IA 3QYCA 3V0VB 5D2NE 2NY1B 2OR7A 4B7IA 3MPCA 4WDIA 5FA3A 1FJ1A 5J9PA 1KCUL 1R3LA 3D3VD 3EDEA 4L8SA 4NYLA 2GAZA 3GMLB 3DIFA 1NFIB 4FFVD 1CN4A 5ACMA 1NBYB 4K23H 4CDGC 4KDWA 1QBLL 2ZCLH 1CTNA 1JGUH 3LAFA 3WYRA 1WVZA 4IRSC 2AK4A 2F74B 3MRLB 2VL5A 1QLFB 4GW4B 4OCXL 2QTEA 3F65A 3SGDI 1EJ6A 3DX9A 2A74B 2XN9D 5FHAH 1YYLL 3DRTA 5F7DA 3JWOL 4YXHH 4ODVH 3PV7A 1HXMA 1JK8A 1HHIB 5DD3L 1IGYB 3U4EB 5IMOB 3A67H 4XPFH 5FM5O 1CWVA 5D4QA 5IQ9B 1I9JH 1R3IH 2BVPA 2P49B 1S7VA 1X5AA 5IBUB 1C5DB 5C70A 1H5BB 2JLLA 3MBEB 1IC4H 3QHFL 4ESKA 4I18B 4OD3L 3VA2C 3V4PL 3X3FH 5ADPH 4QYOB 1EZVY 1C5CH 2AXFA 5CEXA 1GGUA 1E4KA 1E27A 1O7VA 4RWYL 4HZAA 2WW8A 1N0LA 2XWTB 3ILQD 4K94L 4X6CF 1HWGB 1FRGL 2ICWJ 3TO2A 1S9XA 3QEQB 1CFVL 4DEPC 2EH8L 3FQRB 4G80A 3QPXH 3FFDA 1HQ4B 2APXA 1WWBX 5DC9B 5HVGB 5BOZG 3ISWA 5T1LD 2EO1A 4CKVX 1MRCL 1FV1B 4FFWC 4BUGA 4NN7B 2D31A 1AY1L 3LEYH 3DNKA 1BBJB 4F8TA 4WWKA 4HKZB 1MCEA 4LLUA 5C0NC 3TA3D 3CK0L 1C1EH 3SO5A 1QSFA 2NY7L 3MRDB 3MXVH 2DN7A 4KKNA 4PJCE 4V2CB 4WHCA 5T1DL 3DVGB 5I19L 5MERB 4Z9KB 1KLGB 1FYTA 3EUUA 4TNWF 2CLZA 4D3CL 1G84A 2DI7A 3NCYS 1JNJA 5HGHB 1JIBA 2ESVD 1I7ZB 4P4KB 1JGLH 1UM5L 1SY6L 1OP3H 3RJDA 1MAML 2D7TL 3OF6D 5FA4B 4I2XB 5KS9A 1P6AB 4XVJH 2BHZA 2BNRD 2R2BA 2FH8A 1ACYL 1IGCH 4U1MB 4XTRD 4KI5D 2QHLA 3AM8C 2GSGA 4HH8A 5TE6L 4TULH 3BD5A 4L9DA 3VFPA 4I3GA 1YEGH 4KK9C 1MFEH 2IFGA 1ZAGA 1OAQL 2XWJA 3OG4B 3P9MB 1YDPA 1IAIH 2PO6B 3MJGX 5H2BB 2OK0L 3E3QC 4BH7B 5T3XD 2HJFB 4NQUA 1G7QA 4NZJA 1RMFL 4I77H 4U6TA 4NQDA 2EECA 5B22A 4KZEL 3D39E 5DURD 1MEXL 3MJ6A 1CR9L 2SEBA 3MO1A 4PP2B 2Y6SC 1K4DA 4CADA 1CDJA 2QADB 5DO2C 5KSBA 3N06B 4X98B 3V2AR 3BPLC 1GVIA 1KCVH 1GOFA 5B39B 1U8PB 5F21B 3BO8B 1B88A 3VXUD 3EYFA 3BRGC 1IGIH 2ITDB 5EUOB 1CE1H 1JUFA 1IZJA 2HWZL 1KYOK 5DJ2B 3GSQB 2EXWC 5JUEL 4KDVA 1Q0YH 2OR9H 1G6RA 2HWZH 4CMMB 5F88A 5BV7C 3OKNB 5EOQL 1LO5A 4Z5RB 2RJMA 4M1DH 4D0DA 4ONHB 5T3XE 4L3EE 1H8SA 3Q0HA 4AH2A 1XF5B 2YPKA 4X5WA 4B0MM 2XQBH 1XF4B 5E2JA 5F6HJ 5HD8D 2L7UA 1UWGL 3U4BL 4MAYC 5AD0B 1CLYL 4AIZA 3CFCL 3VXOB 2IPTH 4OZHB 3HHRB 2K9UA 2AQ1A 3RL1A 1AE6H 3JV5A 1H3UA 1LVEA 1CFBA 4EUPH 2F58L 4JREC 1IAIL 4YH6A 3M8OL 1IKFH 4GAJH 2X9YA 1NBVH 1FZMB 1TQCC 1BECA 2X4QB 1GPOL 2WUCH 4H1LA 1MHHB 4UZGA 1YQ2A 4UIKL 4MA7H 1IT9H 1ED3A 2DYPB 5FA3B 3ROLA 3ARFA 3PF2A 3PWNB 1WSST 3QA3B 4HZLB 5I1HH 5F96H 3MLWH 3KLSA 4PJ8D 3AUVA 5K9QG 4NSKB 3GGWA 4R97C 1ZTXH 2X7LB 4D0DB 1CF8H 4M6AA 1FN4A 2ZJSH 5C6WH 5CD3A 5F88B 3TJHD 3I3EA 4BQCA 3U7WL 3WFHB 5A2FA 2VAJA 3V6OC 4WENB 1UXWA 1EFQA 4OFKA 4R97B 1EMTL 2WSKA 1OSPH 4MHHI 1S7VB 2FCBA 1JCKA 3RGVC 3RZCA 1ZMYA 5I73B 5FGBA 4CVWA 5IHZB 4R2GD 5FGCB 4XXDA 4QHKI 3WSQH 5CMAA 3SKUD 1TQBB 1AQDB 3FTGB 4PGDA 4MCYB 4IRJA 2EDYA 4KKBC 3W2DL 1MJ8H 1S7UB 2NYYD 2V17H 5DD6B 1MQKL 2WWMD 4LFHG 4P23B 1K4DB 2VH5H 4JO3L 1TTGA 1R24A 4B50A 4MCZA 4JFYB 1WFTA 3UAJD 3A6BL 4Z7WA 4WI9A 1TQCB 1TXKA 3GM8A 3L3OA 1KXVC 1A1MB 4OIIL 2FO4B 4HF5H 4OBSA 3DPBA 5DI8A 3PJSA 3CX2A 3KPSE 1V7NH 4HHAA 3DYOA 2XICA 1S9XB 1B0RA 1M71A 2W0FA 1ZHBB 4JQIH 4YHLH 4XP9H 2EDHA 3DIFB 5JHDB 5F96L 1BGXL 4GT7A 2E7LA 5HGDA 4PJFF 5C07D 4F9PC 4N0RA 2KBGA 1CLOH 5JHDD 3GSRA 4QXTB 3FFDB 5EBMB 4ISVA 4CMHC 3HS0A 4KQ3H 1QYGH 4HUWB 3WNPA 1YN7A 1KTDB 2YMXH 4XAWH 2AVGA 4KQ3L 3SDAD 3MCKA 3DROB 3MV9B 1KACB 3OKOB 3WL9B 2MKWA 4NJ9H 3KHQA 4HK0B 4HWNA 5DHYB 1A5FL 5DS8A 4K3JH 2D9QB 3AM8A 2E9BA 5E99H 1J0JA 4S1SL 2N7AA 2EDLA 5IFJA 3RVVC 2HT4D 4LLAA 5IFJB 1QSFB 4Y19A 5DVLA 4OM0H 3QG7L 1J1PH 1TETH 4K3DL 4O02H 1QFWH 4B5EA 2OXGA 4XHQA 3IJSA 3BPLB 1U92B 4POZC 5JLZB 3QNYA 4L4TE 3BKJH 4GBXB 5EBLB 3HAEB 3QCUH 3T2NH 5CSZA 4HIJA 4M5YH 4PTTB 1JWMA 4JZOA 1JYXA 1KSRA 1P2CB 3C9NA 4G80B 2ZZUT 1AJ7L 5JUEH 3CFBA 4MQXC 1A22B 3RWDB 4DZ8A 1VADA 4MNGB 3ULVE 2LU3A 2AXHA 1I85A 1JNHB 3MRJB 3HZYB 5DHVB 4HX1A 1LGVA 2O61A 1YEIH 5DUML 1MWAH 5DFVC 2NXYD 3GZKA 1IQDA 1MJJA 2R23A 4Y4HA 1EEUA 1A6ZB 5ESVA 5DUPL 3K4DA 4F7CB 4XRCB 3VXRD 2DLGA 3IGAA 5IG7A 3QRFM 4XCCL 2MTPA 3ILPB 5FKPA 1M05A 2MCPH 4LVOB 4YO0B 2GK0A 4KZEH 1YN6A 3RIFF 1NAKL 2Y25A 3L7FB 2FD6L 4MA1C 4X4YA 3IDJA 2UZIH 5J1TC 4H5SA 1S7UA 1TPXB 1CD0A 2D3VA 2ED7A 4NNPH 1T0NA 3V6FA 1F4XH 1Y6KR 3GRWL 3W39A 2YKLH 3R4DA 4XVUD 4QCIB 3QO1A 1F13A 4NBZB 3O45B 4FQXC 3QHFH 1TJIL 4M3JA 1GPOH 3KPRB 5C7XH 3MRIB 1VEMA 3VFPB 5D1ZD 1I9JL 4WU5A 3NFPA 1NEUA 2UWEF 2QBWA 4P5TB 4ZSOB 4HKBA 4CGTA 1FN4B 4WU7A 1XGRB 3VW3H 3I50H 1JV5B 4LRNH 1HQRA 5F6IB 3QDGA 4YDJB 5FO7B 4GKZA 5GZOD 4Q9CA 3I84A 4GW1B 4Z7WE 1BEYH 4Y4FC 4RRPA 3V95A 4APQC 4OD2B 1KPRA 1R3HA 1UM6H 1MAKA 4LPTA 3ARSA 2CKBL 4P46B 4MNQE 1AI1H 4XPHL 4LLUB 2Z31D 1FFNA 3WIHL 1FAKT 4FQ2L 1KB9K 3CCHA 4HWBH 1LP9A 5EO0B 4BQ9A 4MXVF 4AIXA 5ILTH 4JFDA 4Y0GA 2NY6B 3D69B 5KAQF 3QIWB 4R7NA 3SKJL 4UNTA 5F7HA 5EN2B 3ULVD 1MCPH 1W0YT 2BDNL 3O45A 5CEZH 2PO6D 1SM3H 3EO1A 4Q74A 2CLRB 4GW5B 2AXJA 2MHAB 2FJFA 1RZKC 4POYA 3BGMB 4JDZB 1U8LA 2ILLA 3VXQA 1T2QL 3MV8B 4DW2L 3DROA 4HPYL 2EDNA 4O5LH 4ZUWB 3UJIL 2UYLB 4ONGL 4LLQA 3SKMB 4MYWB 1S7WA 1RIHH 3D18B 4Y1AE 2GJ6B 4Z77B 2NY6D 1BBDH 2V5MA 5F9JB 2R2HB 3O3AA 1UACH 2OM5A 3TBVB 1T89C 1EGJA 4P4KD 4PRDB 1WAAE 5T33H 2P43B 2JJTA 3LEVL 4MHHG 2DIAA 4YX2H 1Q9KA 4RMVA 2GITB 4Z7OE 5JHLH 1AD9A 5BW7A 1VGEL 2Z35B 5JMOC 2PTVA 4WCYL 1ZV5A 2F9BT 2OTUB 3M17A 3CUPB 1XT5A 2Q87A 3FRPA 2YUWA 4PLJC 3ARDA 4KRNA 4QNPE 4NO3B 3IRZA 1R5IA 3HI6H 5C09B 3UTZB 1YECL 2WINA 2G60H 1LO4H 4AEFA 1UACL 1NH6A 5EIQA 2V2WA 2BVOB 3DUUA 2VR4A 2HLAA 3ARFC 2HJLB 3B2UD 4X6CB 5EZOL 3AB0B 4JCLA 3DSFL 2HT3D 5JPNB 3JUYA 4IMKA 4ELME 2CDEA 3GSXA 4IDLA 4JDVA 2BCKA 1UXWB 4O2FA 2X4NA 3WD5H 3FHQA 3CXHJ 1FZKB 4RSVA 4ODUB 4HK0A 5JZ7D 4OCWH 4DN3H 3KPMA 3BKCL 2BVEA 3EO9L 3JWOC 4YR6A 4ZFZB 4L4TB 2WIIB 5K33A 5T1MA 1MHCA 2ZCHL 3P0YH 4JAMB 2V2XA 3PHSA 3ECBB 1J86A 3VFOB 1U93A 4PBXA 4OFPA 5ILTL 2BOCA 1E28A 4JFEE 4I0PA 5D7SH 1G7LB 2FNBA 4G8FB 1AQKL 3U0WH 2YD4A 5TH2B 3QZWA 4XC1L 3FOLA 3VDAA 5B38B 3T09A 2E7BA 4XCNA 1JWMB 4JZOB 2O5ZH 4O51B 1YJDC 3F7YB 4LSPL 1P4IL 2IANE 3DRQA 5SX5H 2ED8A 2YA1A 5AYQA 2Q8AL 5GHWL 4TVSa 5HHPA 4KQ4L 2DQJL 2VERN 1HHKB 2ZCKL 2OXHA 5TE4L 3BWUC 3LQZA 4MJ2A 3LS5L 3BP7B 1FVCB 4WGVB 3ARBD 4K3EL 1EEYB 1DDHB 3P11L 1WBZA 3PGCA 4XNZB 2EYTB 2GJJA 2CO6B 5DHYA 4MD0A 5A16A 1J8HA 4L4JA 2HTKD 5KN5A 3A0OA 4PUBH 3MV9A 3MCKB 3RGHA 2EDJA 2VWEE 3ZHDA 2HJKA 1QHOA 3T8XB 4H8WL 4P2OB 5IFHH 3SE8H 1BQLH 2AABL 1D5MA 4JFEA 4Z7VF 3THML 4NQTA 5GRJL 1U3HA 3P40A 3T0XA 3V6OA 1N26A 4GLRI 3SDAB 5IMLB 4Q7DA 4LGRB 3O3EB 4JGUA 5CP3A 3AGVA 3FQXB 3GJEB 3HB3D 3QQ3A 3Q6FA 4JG0H 2BDNH 4PLNC 3CNKA 4X5LA 4M48H 4Z95H 4XMLH 2JJTC 2XWBB 3V0WL 4RGOH 2FO4A 3KJ4B 4ZFOA 3P0VH 4K7PH 3HE7A 3SKJH 3D85B 1JZ2A 5KVFL 1JI2A 1S7RB 1CFTA 4NT6B 3UTSD 1W8NA 4HWBL 1FNFA 1IFHL 4MDIA 4OZGF 3B2VL 9CGTA 3S3SA 2E8ZA 4YHOH 1XF1A 2VISA 1Q0XH 3U0TA 2X40A 5DMIH 5BO1L 5MEND 1FVDB 1INEH 5EU6D 1G7HA 4GKNB 1D9KC 1YDPB 4LSUH 4P2RE 2Y5TA 1ZVHA 4PS4H 3X13A 4ETQB 4P23D 5FO8A 4N8PA 4MJIE 4Y5XA 4FXGB 1NGYB 3QO0B 5HHMD 3SKNA 4MJIA 1FC1A 1LO0H 3KYOB 3U79A 4EBQL 3SDDB 2C4FT 4AL8L 4QOKE 2ZSWB 5DQ9B 1CG9B 5E8PB 5JXAH 4OFYA 2W65A 1I7ZA 4IRJD 2VZUA 1OVZA 3OB8A 3RI5F 4O4YH 5I6XB 4LSQH 2QEJA 2NLJA 5E9DD 4Z0XA 1A7OL 1JUFB 1NBZA 4Z7UE 3H0TA 4O2CB 4CVUA 1S7SA 5CS7A 1HZHH 2YKLL 5D70H 3T0EC 4M9OA 1I1AA 2FEDC 2DQHL 3PIQA 3ARYA 3MJ9L 3G5VB 3JV6A 5KOVC 1JGEB 2FECI 3KDMA 1LDSA 1JPST 4QWWC 3HMXA 4DW2H 1I8LC 1SJEB 2IBBA 2C3HA 1DN0A 2CDFB 1UYWH 3SPVB 4S0TD 4KMLB 5HVHB 3ARBC 3MROB 4NPYB 3SDXB 3ZTNH 3OX8B 5DUPH 4NM4H 4RA0C 5C6PB 4BSWA 3RDTB 4UT6L 1HWHB 1VACB 3MNWB 1MIML 5BVPH 4R2GC 3T65A 1FLRL 4PRDA 5I6XC 2CRYA 5EZLB 4OM1L 1MHEA 1UQSA 4Y4HC 5KANI 2H2SC 3ALWA 3DV4B 4ZFOL 4U1KA 5F7UA 4MNQB 4UBDD 4U2ZA 5EO1B 1AI1L 2YUXA 1JTPA 4Y8DC 1NC4A