4XP6L

X-ray structure of drosophila dopamine transporter bound to psychostimulant methamphetamine
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
213
structure length
213
Chain Sequence
ENVLTQSPAIMSTSPGEKVTMTCRASSSVGSSYLHWYQQKSGASPKLWIYSTSNLASGVPARFSGSGSGTSYSLTISSVEAEDAATYYCQQFSGYPLTFGSGTKLEMKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Tranport protein/inhibitor
molecule keywords Transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 46
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp6L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp6L01
4GW1A 1NBYB 3MO1A 1U8MB 5D2NE 4ZQKB 5FGCE 4EI5C 3T0EA 1L4IA 4OF3A 3KLHC 3E1F1 5DHXB 4J4PD 1MCLA 1XF3B 35C8H 1DFBL 4HD9A 4JO1L 4Z0XB 1SJEA 3ARGC 1NKOA 4IRZH 3EDJA 4LSRL 4HQQL 2PF6A 1DBKH 3B9VA 1HZHH 4FQXD 1JUFB 2PTTB 1EHLL 3GSNH 2DM3A 2RFXB 5F6IC 3O4LE 1J8HD 2QQKH 2XWBB 1I8MB 4LU5H 5TE7H 4YDJB 4P2QE 1WBYB 2KUTA 4DN4H 2XWTA 4X4ME 2OMBA 2FX7H 4NQXA 1P9MC 3W0WD 4O00A 5DR5L 4G8GD 2FJFB 2M1KA 2OI9C 3SKJL 5FO8A 4NN7C 5GRVK 4MJ6A 5CWSB 2E9WA 5DA4A 5FYJU 3TBSB 1INDH 2O5ZL 1TVHB 1A47A 2OR9H 2UUDH 5FYKD 2XA8H 2X09A 5EUOB 3WUZA 5GIRB 1OF2B 1U3ZA 3BP7B 3TCLA 3IVKA 2MKLC 2PW1A 2XZCH 2ZUQB 3RWIA 3T1FA 2FECI 4NCC2 3RWHB 1NGYB 3R1GH 5D7IA 5AAMA 3WN5B 1N0XH 1MFEH 2AV1A 4M93C 4G80B 5DVLA 3TCXA 1G7PB 3PL6C 2WWMD 4NT6A 5INCB 4R26L 1JGLH 3KS0H 3CH8A 4I1NB 4JGMA 1NMBH 3HMWH 1ZLVK 3PWVB 1G0XA 2YD4A 2XN9A 4NO5A 3JWDH 3PJSB 4G9FD 2D7OA 1C08A 5EC1B 3PGCA 3RL1B 2AJZB 4PJFE 4Q97A 4LQ1A 1IC7L 4O2CB 3T77A 3O0RL 4NZUH 4LGRB 1J5OL 4MJIB 4NO3A 1B2WL 5IB3A 3LAFA 4LSPH 1CU4L 5BRZB 2EEBA 5HHVH 4CW1B 1ZA6A 3JUYA 1Q94B 4KZDL 2G5BB 1OARH 2BNRA 1PKQA 4QOKB 3RUGB 5T1LA 32C2B 1SY6H 2Y06H 1M7XA 3RWDB 5ADOL 3I75A 4P3DB 1R3LB 4NNYA 3CXDL 3GSUB 2VXTL 4X7DC 1ONQA 5DFWH 1LDSA 3SDDA 3T65A 3BYTA 5D8JL 3ZSTA 1S5IL 3BD3A 4OZ4A 4PB9H 1RAMA 2FJHB 2QJDA 2J5LC 1NUNB 3DSFH 4OT1L 2IBGA 4QXGH 4HHAB 5KJRH 3CVHA 2DMCA 5IW3A 4J3SA 1T4KA 3VG0L 1WBZB 3L3IB 4Q7DA 1ZVHA 3NCCB 2YA1A 1D6VH 3JWOH 4JY5H 5TQ0H 3MJ7A 3SY0B 4DEPB 5I15H 3JV0A 4RGNB 1FNLA 3QUYD 4DUXA 4H8WL 3A6BH 3UYPA 5KZCD 3TYGL 3FQTA 1G7QA 5E8PB 5FYLD 3KPSD 4NO2A 2GTWA 2CKNA 3HNSH 4BELD 5IESH 1U93B 2WP3O 3B83A 3GSQA 5I1DB 1PG7H 4WRLA 4LARH 1RVFH 1AKJA 1K9TA 3D39B 4IOFD 3RY6A 1GIGL 5LXGH 1ZWIA 2GKIA 3V95A 4P2YA 2X4RA 3B9KD 4L8CA 1F3JB 4XX1G 3FT2A 2CXGA 4KZEH 3X3FH 1ITCA 1S9YA 5KSBB 5I75B 2P24B 5FOJA 4J3OC 1ZT1B 3KGRA 4MX7B 2HVKA 5F9JA 2JK5A 2Q7NA 1M4KA 4PJXF 3MRDA 4XHQA 2ICWI 4WTZA 4JFOB 5HHPA 2YOCA 1ADQL 4NFDA 2OL3L 4MZ2A 1I1AC 3THMH 5C6TL 1J1PH 5GSVB 4G6AC 2OLDA 4S1SL 4WDIB 1JN6A 3LQAL 3S34L 4U3CA 3U9PH 5F70A 1NMCB 4XC3H 2J8UF 4NKOA 2PO6D 5ITBL 3OG4B 5L2JB 1HHJB 1CLZH 1BIIA 3BPNC 2AK4B 5D2NC 1TVBB 5SWSB 1QKZL 3VFGH 4ZUTB 4PR5A 5HI5C 3M1BB 4IBLT 5KSVB 1W8OA 4HKBB 3IFLL 3EIFA 1QLRA 1QACA 2NXZB 4Z7QF 1XF4A 1UKSA 2B1HL 2VH5H 1HXYB 1E28B 1K4CA 4PRPB 2BVYA 3AS1A 3DX8A 4HIEA 5GGRA 5TE4H 3MPCA 3VDBA 4KI5F 1KB9J 5EBMA 3TZVB 1EMTL 1ZANL 5EZLA 4UT7L 3W2DH 3DYOA 1HSAB 1V3KA 4ZO6A 4OZGB 5HHOD 1WVZA 5JQ6L 1A9EB 5HVHC 1U3HA 3P4LA 1U8IB 1FQ9C 1ZS8A 4JDZA 3ZT6A 4ETQA 5MHSE 4PS4H 1DZBA 4XVUD 2P7TA 2WZPD 4HBCH 2FCBA 1EEZB 1XR9A 3QEQD 1NAKL 4NZDA 1PAMA 2PETA 1LEKB 3HUJE 3Q5YA 4QRTA 4POZC 3BP5A 4EOWH 5JIPA 3MOAH 2DLIA 1QBLL 4X0KB 1AC0A 1MHPH 3T8XA 3BDXA 1CE6B 2D7MA 2DM4A 2VDMH 4FXGB 3F58H 4LRNH 2FDBP 4Y88A 4JAMB 3DUUA 2VO5A 2KDGA 5DYOB 5BW7C 4H1LA 2HN7B 4DUWA 1EZVY 3QWQB 4RIRA 1JI1A 4WI3A 2I07B 3QQ4A 5T3ZL 4NDMA 1F11B 3S9DB 4PJCF 1U8KB 5FA3A 3ARGB 3L5WB 3UPRB 5SWZE 2R0LL 4BFIB 3NFSH 4OBSA 2PKDA 3WFBH 1IARB 3AUVA 3KPQA 3S36H 3RWJB 4GQ9H 1MFBH 3FN9A 5DQ9B 3VXRA 3REWA 4ZMAT 2L4OA 2APWA 4N0YL 3UTPE 1FHGA 1RIUH 3MLRL 3DV4B 2GQHA 1OB1B 2CLZB 2PXYD 4PRHA 5I1CL 5J0BA 4R4BA 4P5TD 2W59A 4PRNB 1YEFL 2R1XB 5I8OL 2J88L 2VL4A 3QISA 1S7QA 3GHEH 4V1DB 4NN7B 3G9AB 3PWNA 5DQDL 1V5JA 3CUPA 1PBYA 1MHCB 2A0LD 5F7NC 2BSSB 3RVVD 5CKGA 4RMUA 1MI5A 1B6UA 5ICXA 4QCIA 2YPKB 1NGWB 2CMRH 4L9LA 2AKRA 4HT1H 1TETL 1XGTA 1I1FB 4KV5E 5F9WB 1WFTA 3KPRD 2VAAA 3UDWA 4Y19E 4K3HA 3DRTA 3DMMB 3BQUA 2V5MA 2JB5L 1JNLH 4OZHE 5HYQA 3G5XB 3TEUA 3BDYL 4JZJC 2QKIA 1ETZB 5FUZL 4OLXH 4XPHH 4X8JA 3LEXB 2ARJQ 3VRJB 1MIEH 1G7LB 3VW3H 4AIOA 2C1OA 3W5NA 3WFHA 3C2AH 5C08A 4NFCA 4CVZB 5BS0E 2MQ0A 4Q6YA 1J88A 2DDQL 4ZXBB 3O8XA 2OTUA 4BZ1L 1P4IH 5AWNL 7FABH 2YUZA 4D3CL 1NGPL 1CI5A 4PIRF 1NBQA 1LP9E 3GZKA 1VEMA 1YNKL 3BHBA 3SDXA 2P4AB 2XACC 3BUTA 4WHTB 1QNZH 2NLJA 4M7LH 4HLZH 3ZHLA 2H32H 1P84K 4KVNH 3VWKC 3D87B 3ZKMD 1GGCL 1KCSH 3TYFB 1TMCB 1JPSH 2EIZB 3IKCA 3QDGD 4XI5C 1J0KA 2AQ1A 1MCPL 4LSVH 5E00A 2DF3A 1NAMA 1YUHA 4BYHA 2PYFA 2Y9RT 3F6LA 8FABB 1G9MH 2FZ3A 4BQ9A 1EV2E 4EVNA 3RIFF 2DQUL 4PREB 1FZMA 3BE1L 3EYSH 1S9VA 2IG2L 3DARA 4FQJL 5I6XC 4LSTH 1CR9H 3ARBC 3F7VA 1QSFE 4MLIA 3U7WL 3WS3A 4LBEA 3WIFA 1U8JB 1T2JA 4PJGA 2MMXA 1M7IA 1IGIH 4WY7L 3EGSB 1FN4B 1Z5LA 3DO3A 4FP8L 4JY6A 2GTZA 5JHDB 4XZUA 2F53B 4GKZB 2ATKB 4KK5D 5I1GL 4AL8L 5ESAA 1B4JL 4LSDA 4WJ5B 4P2OD 4PJIA 1J87A 3RVXC 5F7DB 4YXHH 5A2FA 3IDMA 3V6FA 5F9AC 1QUNA 2ED9A 1OM3H 3ZMRA 2YMXL 1KPUB 1OSZA 5ALCH 1TJIL 4YHMH 1JIBA 3GSRA 3TVMB 3P30L 1BLNA 4Z7UE 3H9SE 3JTTA 4H88H 1F97A 4PJBB 1CG9B 2GFBA 3G5ZB 5FUCE 4U7SA 4D0CB 1FZJA 1R3KA 1SYVB 4HXBH 3OJMB 3S37H 1ZOXA 1MRFL 3S96B 4Y8AA 4EKXA 1G7JB 4RFNC 1CFSB 3L5IA 3TA3B 3QULA 4FS0A 3VXSB 1N7ML 3NCEB 2UY7A 5HHMD 2JJVA 3DI3B 4MS8D 3M07A 3DYPA 5CD5C 5H2BA 2J8UE 4JJ5B 3VFRA 3NZ8A 4NM8L 3F5WB 3ARDC 4CVXB 2XTJC 3V4VL 3B4NA 4XB7A 5LGJA 1W72H 4F33A 3EJJX 3PWJA 4YE4L 5ALBL 2XN9D 1TPXC 5C0JB 4GG6F 4FTVE 2CIKB 4JM2A 2VLKE 4XBGB 4GRMA 4R2GD 1HOCA 2X9WA 4NZRL 2Y6SC 2HH0H 1OWWA 4LEXH 1NCCL 4LPUA 3K2UH 3C5JB 3RGVD 2I60L 4JN1L 1TJHL 1UH2A 4MNGB 5JO5A 2N7BA 3O2DA 4RA3A 3CK0H 3C60A 4KHTL 2YPLD 4LCWB 3VD7A 3O9WC 1FGNH 3CH1B 4R90H 1KC5L 3LRSB 3Q6FA 3Q1SL 2BNRD 3VXUE 1TCRB 1BBJA 4R3SB 4HS3A 2CLRB 5T1LD 1D5ZB 3WDJA 5B3JF 2DQEH 5CCKL 5BZWA 4M7ZC 3W39B 5I9QB 3LKSA 4QEGA 2VXUH 1GPOL 4PJEE 3SDDD 3VXMD 3G5VB 4LPWA 1WAAA 3IETA 1DTUA 2NW2A 2GT9B 1W72A 3KPOB 2XI9A 2ZUSA 3HRZB 2PTUA 4RFEA 3WEXB 4NHCL 2DLFL 2X05A 5EUOE 5DGQA 3LMJH 4TVSa 5GGVL 1A1NA 3EYVB 4WO4C 1II4E 1BFVH 3AMLA 2R1WB 5C0AA 1FL3B 1XAUA 4L8DA 1MQKH 4JY4A 2D03L 5JORA 4X5LA 2XQBH 3IRZA 4N5ED 4WI6A 3DBXA 2CH8A 3MUZ1 3QNXB 2R56L 3IDUA 4QRRE 2CDFA 1QFOA 5AAWA 3V4PH 1LDPL 2X1XR 2XZQL 2HKFH 4HIXL 2IPUG 1KCUH 4H26A 4LPVA 3VFPB 4EN3A 4NPYB 1AKJD 4XNUH 2OK0H 5HYJE 1XIWD 4TQEL 3WIHA 3G6DL 4GW4B 5GS1A 3D3VB 2GJ6B 2DQDL 5TDOB 3ET9F 1CL7L 3ZDZF 4U6TA 4YGVB 2BXZA 4UQ3A 3SGDH 1A3RL 4P59H 2ARWA 1F6AA 5KN5A 1UQSA 2IAMD 2CR6A 4IRJA 3STBA 5E2UH 1FZOA 2VWEE 1NH6A 4DOHE 4Y16A 4E0RB 1RUMH 5B38B 3EOTH 2HVJA 1ZGLB 4MWFB 3ESUF 4BH8B 1QPXA 4NJAL 1R5VB 3MACL 2EDDA 2VB5A 3AY4C 4XMKH 4TSAH 1R3HB 4K94L 2CO7B 3LH2H 4LDLB 4KU1A 5MI0C 4NO0D 1XCQA 1MWAB 3OKEB 3L3KA 3TWCH 4OB5H 3NVQA 3JVGA 5CBAB 4JFQA 4UTBH 4JFYA 5EBWA 5EZOL 3CLEL 3C09C 4UQ2A 5IBTL 3QIUA 2X4QA 4Y7MA 2VSDA 4MJ5A 5C0CE 3OKMA 3K3QA 4XWOD 1ZA3B 1RZKH 4YK4C 2UUDK 3GEWB 2EH8H 3I02A 1NEZG 5IMMB 3QUMH 2QL1A 1Z6JT 4CKVX 4PLNC 4M6OL 3SOBH 3U36B 1IZJA 4HKJB 1IM9D 5C0BD 4FQLH 5ILTL 3QI9B 4R0LB 2JCCF 5F3BA 1I7UB 2VXQL 1Z3GH 3NH7L 5EU5A 1F4XL 5IB2A 2NY5L 5F3HB 1FLRH 5D7JB 4WNQA 5TF1H 1EJOH 3NCFB 4P2RA 4Z5RA 3L7EA 3DTXA 5HGHB 3ULUL 4YXKL 2O26U 3GIZL 1DQJB 4PJ5E 3LSOB 1SJHB 2F5BH 3RRQA 5KSBE 2D2OA 1T1WB 1KXVC 3F12A 4IS6B 1YC8A 2Z93A 4F9LA 4OD1L 3NCYP 3MA7B 3JTSA 3OXSA 5D1QA 3HA0A 1FV1A 5IT2L 5BMFL 4ZAKB 2WWKT 1JNNL 2DL9A 1JNHA 5JXEC 4JKWA 3T3ME 2WBJB 3WDIA 1YMHB 4I77L 2IPTL 4K3DH 1XT5A 5AZ2H 4A6YB 2ATPA 4MSWB 3KHOA 5DJCA 4ODWA 3RQ3A 2P5EE 1JZ2A 2E27H 3QDMB 2UYLB 5EIQA 1BQHB 1RZJL 5J3HC 2I27N 5ACZB 5ANMB 4UIKH 1CXEA 2C9AA 5HBBA 1RZFH 5K9OA 4FABH 1SYSA 5HPMB 1HHGB 4F37K 2AJ3A 3AAZA 4Q9BA 4X6CF 4AT6A 1FNFA 2AK4E 3WL9A 3TIEA 3D0VA 4UV7L 5EN2A 4YR6A 3GMLB 4U6HA 4NM4L 4KI5C 4BJLA 1OOAA 3VXRD 2ARJA 3ULSA 1TVDA 1NKRA 1OW0A 1LK2B 2E9IA 4OFDA 2M2DA 4PJAE 4J8RB 4PRHD 1RZIB 4QY8A 3MLXH 3VFTA 5DRXB 5B39A 1QEWB 3SGEI 1K4DA 1YEEL 3Q3GB 5SWQB 3DXAA 2MNUA 4LSRH 4HQQH 4BQCA 4J2XA 4PP2A 3O2DL 3B2VH 4GRLB 4LRIC 3O3EB 1OP9A 2NYYC 5BO1H 1NFDF 2GYSA 2HLFC 1QFPA 2FECL 5IOPA 5C71A 3ROOA 4MNQD 3SE9H 3HCVA 2NPLX 2YRLA 4AQOA 4Y4FD 2C1PB 4TVPE 5DR5H 4HCRA 4JFDD 1Y6NR 3TC9A 4GAJL 3BW9B 4IMLB 1GAFH 1FG9C 1GZQA 2BC4A 3U4EA 1S7VB 2DQFB 5DXWA 2HRPH 3UTSE 4NN6B 2FWOA 2XFXB 2V2WA 3D18A 3UTQB 1ZMYA 3IDJB 5J11C 1WWAX 5KTEH 5FK9B 1A14L 3SDAA 3O3BB 2I5YH 4WFHD 3MBEB 5IBLD 4GXVL 4LSQL 4NQCB 1A0QL 1A7PL 2ZPKL 5KOMC 4GQPH 1MH5A 3B9DA 4U1LA 4EJ1C 4JFHD 4Q6IB 2D31B 3O6LH 3OR7A 4OQTH 4R26H 3MJ8B 2E3VA 2FH8A 4G6KL 5CIPB 3QZWB 1JE6A 3V0WL 1WZKA 4JPKH 4Q9QL 1TTGA 5FXCH 1IM3A 3L3OB 3V8OA 1OLLA 1MREH 2HFGH 2YPVH 1DEDA 3O6FC 4JCLA 2VWEC 4M7ZB 5D7LB 4J1UA 1OT1A 5DMGD 1W0VB 1J5OH 3HAEA 5A3ID 1B2WH 1S7WB 4HUUA 5DJ2B 1D5IL 5F7KC 3WJLA 4BKLA 4CNIA 3BO8A 3E2HC 3RZCC 4KZDH 1LMKA 3BZEB 4UI2A 2G2RB 4OGXH 1G0YR 5JW4N 4JKKA 3EDDA 5C07A 3U0WH 3O4LA 1C1EL 1T20B 4M1CD 4JGUA 1QO3A 4WO4B 3VD5A 1V8HA 4P2QA 3RAJL 1IAIM 3IF1B 3LKOA 5F8RC 2J4WH 2B5IC 1JFQH 3VMNA 1KBGH 5GRJL 1OGAD 4P9HC 2BSRB 5GZOC 3QUKB 1OTSD 2FR4A 4LFHD 5JLZB 3LRHA 3SJVE 4UU9A 3BAEH 4G3YH 3CFEA 1TQCB 1HHHA 3MGTB 4O58L 1A7QH 1DDHA 3LS4L 4ZUVB 1IKNA 4AM0B 3CSGA 2HJLB 1GGIH 3EOAB 4Q2ZA 2APTA 4G8GB 2EDOA 2V9TA 1D5MA 3L3DB 3UROR 3EYQC 5D2LF 4P4RA 4ODBD 4ZFOL 1AO7A 3VXTB 3PQYE 4PJ8A 4L4VA 5IB4B 4JZOA 5BJTB 4GRWF 3BKJL 4KRNA 4YFEA 4BA8A 4WFED 3IU3B 4WI2A 1MLCB 1TJGH 1CE1H 4OFIA 3GKWH 4QHKJ 3BIAX 5IJVB 1JZ8A 3RVWD 4G43B 1VSCA 1F45A 3X12B 1UM6L 2ZUYA 1K8DB 1CFNA 1HXMB 1N8ZA 4JM2D 5CSGA 3MRQA 1JPTH 5ID1B 3L95A 2NY6D 2DJ4A 2XNAB 2YD8A 5JQHC 2P44B 4PJFA 1HWHB 2FLRT 2NY4D 1IC4L 4G9FB 2CLVB 5C6TH 1HSBB 4HFWA 3NGBB 5B4MD 2HT4D 3MRCA 4ZODA 2CKBL 4S1SH 5J7CC 1DLHB 4HZLB 3FOLB 3QCUH 4ZPVA 1DQML 3C2SA 4OCSH 1LD9B 5EBLA 4I18A 4S0SD 4L29B 2B0SL 5J9PB 3WDHA 3DROA 4FFWC 4HPYH 4XC1L 1QKZH 5IR1A 1KJ2B 4UZGA 5C0DA 4OCMC 3FQWB 5HI3D 3S7GA 2FX9L 1DQDL 2Z4QB 3QPXL 1X5LA 3IFLH 2EDXA 4HIIB 3C6LD 2XG5A 3PWUA 1JGEB 5HYSB 2B1HH 2EICA 4F58H 3TH3T 3VXSE 4L8SA 1RUPL 2WUBL 3FRPG 4UIMB 4BSJA 2DQIL 5DMJB 1T04A 5LAXA 5C0AD 3OZ9H 3I3BA 4N9OB 4KJWD 3C6SB 1EMTH 2AGJL 4NOBA 4U0QB 1SEBB 1XCTA 4JO3H 4PJXB 1T6VN 4RWYH 5TE6H 4N8CL 3FN0L 5JQ6H 1KG0B 1DVFD 5KVMC 3UYRL 3PHSA 3MXVH 1NBVL 4Z7OF 3MNZB 3NAAH 3DX6A 1CLOH 4G7YH 2FEDC 1HYSC 12E8H 1QLFA 4G7VL 5F1SA 3ULVF 3BH9A 4EN3D 3QDJB 1T1XA 4LLUA 2GUOB 2OTWA 4XNYH 8CGTA 5IP4A 3RHWK 3LKRA 3G6AB 4LLDA 1JYXA 1YJDL 2UWEF 2GITB 5FB8A 2JIXA 4N0CD 2E7CA 4MNGE 3STZA 1UM4L 5JMRA 4LCWE 5C8JA 3P0YL 5FUOH 1VB9A 2JJSC 1DQQB 3FJTA 2HJFA 3CFDA 5F9OL 3CX5K 5EUKB 3LN4B 5T3ZH 5D72L 3TH2T 4NQVB 4KUCD 1GGYA 3OB0H 4RISH 4FZEL 4QRPE 4RMWA 4LP5A 5I1LA 2C3WA 1XF2A 5IGXL 1W0WA 3GKZA 4UDTB 4APQC 3W9EA 5ENWB 3BOVA 1YY9C 3SKOA 4FFYL 3FZUC 3GJEA 3V7AE 1DE4B 1R24A 1G6VK 2Z92A 3QIUD 4BK4A 2IQ9L 5DJDA 4Z7WF 1OQOA 1IC5L 1J10A 2R23B 2AI0H 5KSAA 3RTQC 4KK9D 4OF6A 2X9XA 2VTFA 3VFWA 2YC1A 4MXWL 3WUWG 1H8OA 4KKBC 4ZOAA 1ORSA 4U05A 2VKXA 2DL2A 2BHZA 3SBWA 3HE6C 3BXNB 1F3DJ 2VLJD 2OZ4A 5E2TH 1RZGA 3AM8C 5MEND 4XXCC 1NDGA 5IVNA 1TETH 3TJEH 1FGVL 3GUTA 4M03A 3D5OF 5I74B 3N9GH 3O81A 1BWWA 4P2RD 1OCWL 3NIGE 2NY1D 4O9HL 5HGBB 5J57B 3K0WA 4MQ7B 4KUCF 3WD5L 4FQ2H 3JWNC 4MVBC 5J1SC 3BDYH 3HUJA 3F62A 3L6FA 5D1QD 5IK3B 1EXUA 1YEIH 1BJ1J 4GAYA 5FUZH 2YEZB 4DKAA 3KWWB 2W0KA 5C0EA 5F89B 5I2IA 1AP2A 3UZVB 3MV9A 1EA9C 4ISVA 4C4KO 5LJYH 2Y07H 1P5UA 4DVBA 3RNKB 4WI8A 3N50A 3O2VL 2DDQH 1JK8B 1IKFH 1KN2L 3DUSB 2AEWA 4LVHC 3U6RB 2P8LB 5AWNH 1V3MA 1T0MB 4ODTL 43CAB 3P9WB 2VE6A 1ZSDB 4WV1B 1YNKH 2XPGA 3RPIB 4GLRH 4N8VB 1WBXB 4G9DA 5IJKA 4DCQB 1V7NL 4G8FB 3O45A 5EIVA 2XZAL 5GSRB 5C7XH 1MCWW 1A6AB 4PUBL 5FHBL 3UJTH 1MCRA 2HKHH 3S3SA 1GGCH 4XMPL 2Q7YB 4XCYA 4YZFF 3TNNA 1VFBA 3G6JE 5JIIA 3RZCB 2BCKB 3BPCB 3BWUC 3SGKA 1MCPH 5DK3A 3S5LB 2HT2D 3SPVA 4PRIB 1F5WA 5E8EB 3Q0HA 4GBXA 2G9HA 3C5ZD 5IEKB 3RBGA 1KIPB 1J0JA 4QNPF 1I1RA 3W81A 1NEUA 3D9AH 3U7WH 2EDEA 5BXFB 1MPAH 4KAQL 5IMKA 4NRYA 3DXAD 4LASH 1V7ML 2YKLH 3MCKB 4WY7H 1KIQB 4HPOL 1EK3A 5L6YL 1C5CH 3I6LE 5GGTH 1DANU 4U6YB 4OKVB 2PXYB 4WTWA 4PJ7E 5CEZH 1A9BB 3WNKA 5D7SL 1NCAH 3ELAT 5CUSH 5DD1L 3ARZA 1FNGA 3LEYH 4HSQA 2VDPL 3ZSSA 2YMXH 5KVEL 3I2CH 3TBVA 4NJ9H 5E7BA 3M17A 4EIGB 3IJHB 1N6VA 2OM5A 4Y19A 3KLDA 4X5XA 4XPTH 1A6PA 4L3CB 3KPLB 5CGTA 5I8EA 2QQQA 2LVCA 4MJ2A 1UACH 2WW8A 3GIVB 4OZHA 5E2WL 3E6HB 4J7RA 3SDYL 3VXPA 1QFUH 3LZFH 1YPZA 4R9HA 5JW3H 1BQLH 4JFEB 2J2ZA 2ZUXA 4QHNB 1MHHA 5ESVA 1JVKA 3OAZH 2X4OA 4WUUA 3SDAD 4PV8A 5BS0A 2KZ1B 1DBJH 4NCDA 1H15B 2FO4B 4P4KD 1G9NC 1MJUH 2NCMA 3ZLQC 3BGMB 4BFEA 4J3XA 4O02H 4OTXH 2C3HA 2XA3A 1QSEE 3BWAA 3K4DA 3U9UB 4NBXB 1NC2B 2A74A 3ZKND 3MLTB 3T0VA 1IFHL 4TULL 1NCBL 1T22A 4KUZH 4I4WB 4TSCL 4OLVH 2AJXL 4NNXB 4O2EA 4PJDF 4KROC 4UOW0 4KKAD 2NXYC 1XR8A 4CMHC 4M7KL 4PG9A 4UT9H 5DT1H 5GGSB 4BQBA 1XGRA 4PJ9C 1NCCH 2VLRE 2VUOA 4XCNA 3PWPD 2Q8AL 2AXGB 4DZ8B 2F54B 1Z9SA 1TJHH 4LSUL 4KMTL 1KJVA 1WCBB 5FGBC 3RKPA 4R8WL 4Y4KC 5EA0L 4UV4H 3Q1SH 1A64A 4UUJB 5I73B 1O7SA 1N5AA 4TN9A 5C07D 1YC7A 5L2KD 3LN5B 3TBWB 3ZYOA 4MCYB 4JCMA 3FB5A 4IJ3C 4PLJD 1D5XA 1T21B 4F7MB 3V0VB 2VABA 2DQTH 3WNNA 5FFLA 2YRZA 4MA3A 4GG6B 1IEAB 3MV7D 4Z7UA 4P2OB 3ILQD 3KHQA 1VKXA 1P7QD 3OX8B 5J89A 1CFVL 5GGVH 3E8UL 4JKPL 2BOBB 4XHJC 3FQUB 3FT3B 1KNOA 5E8OB 2X4NA 3QEUA 4KPHH 5CBEB 2WINB 4P0DA 1T5XA 2D03H 4ODUA 1FYTD 2CR3A 1NBZB 3ARYA 1I8LA 3BP6B 4CMMB 4L4VD 2BRRH 5ID0B 3KYKL 3MRRB 2OZ4L 4NC2B 4PJHE 3VGGA 4F7CB 1JGUL 2XZQH 4OCXH 1OSPH 2BOCB 4P23D 1U8OA 5K59E 2Z31C 1S7SB 5AUMB 1IE5A 3KXFA 4N0UB 3BZFB 3SE4C 5HPOA 3ARXA 1MAML 1XFPA 3G6DH 2AEIT 5IMOA 5EBGA 2DQDH 5I17B 5B38G 1NBYA 4JVUA 1U8MA 3GSNB 3TO4B 3QFDB 4FTVA 4QHKI 5H37G 4ZQKA 4R4FL 3DUHA 5D7LE 1AD9B 3CVIH 4JRXD 2AXJA 2LQRA 1J9CT 4HH9B 2WWKO 1XF3A 3QPQD 1UH4A 4Z0XA 3PP4L 1KSRA 1RIHL 3KYMB 4K3JH 4YX2H 5JNYB 1JUFA 2PTTA 5DSCA 3T2NL 2RFXA 3MACH 2XWBA 1I8MA 5FGRA 3MGOA 3RGVB 2NX5D 3MRFB 3VDCA 4YDJA 2D7TL 1AH1A 1WBYA 3RTQB 1TIUA 5D6DA 1LK3L 1CFTB 2YD5A 3QUXC 1J8HE 3NPZB 2FJFA 3OB8A 3L5XL 2HG5B 5CWSA 4BQ8A 1NLBL 3WMSA 1AJ7H 1MNUH 4FMFA 3TBSA 1INQB 3GGWB 3V5DB 1TVHA 3HE7C 5DD0H 3ECBA 3QQ3B 5DJXB 3W0WE 1S9WB 4MCZB 4YUEL 3MUGB 3VXMB 1AXSB 5EUOA 5GIRA 3GJFA 1OF2A 5HHXL 1SQ2N 3BP7A 3D85B 2QADC 3RWHA 4M6OH 4ONHB 2F58L 1NGYA 2DI9A 1GXEA 1KN4L 2AEQL 5FYKE 3WN5A 1MRDH 3MLSL 4LAQL 4YHPB 1JYWA 3VFOB 4G80A 2F19L 2AJVL 3NH7H 1G7PA 1WT5C 1E6JH 4RAUB 3LPWA 1HEZA 4KVCL 1JPGB 5INCA 1EO8H 4YWGL 1DL7H 3QUZA 1AGCB 1IBGL 4UNTA 2DI8A 1MCNA 1VACB 1I9IH 4XXDB 2DYPD 1MJ8H 4YHOH 5E8NB 2OQJB 3PWVA 4KQ4H 1CBVH 5F8QC 3GIZH 4K8RH 1QOKA 1FIGH 2FNBA 3PJSA 9CGTA 4PY8J 1A6TB 1BQHG 1N59B 1YYLL 3RL1A 5ISZE 1JNNH 1CICD 2AJZA 2RR3A 2JIXD 4O2CA 3GK8L 3I50H 3ZTNH 1XIWB 5D1ZD 1OAUL 4I77H 5GRUH 4MJIA 5DO2C 1NL0L 5BRZA 1M71B 1VFOA 2ESVB 2E7HA 4CW1A 5CJOL 1Q94A 2G5BA 2CRYA 4OZIE 4QOKA 1U91B 1GRWA 1RI8A 3K8LA 3RUGA 32C2A 5CEXA 2IAMB 1I3UA 3RWDA 4OLYL 4P3DA 5DC4B 4HWBL 1R3LA 5F1KC 3U7AA 2IBZX 4JPWH 1TZGL 3GSUA 1WWWX 3FO1B 2DM7A 2R2EB 5I1AB 5CD3B 2ZG3A 3HRPA 1HYRC 4O4YL 5CSBA 4N0FB 4G42B 2EDRA 4H25B 4O2FB 4JO2H 1BGXH 4KHXL 4NQDB 2EZ0C 2FJHA 4XH2B 2CDGB 1S78C 2EDBA 2DQJL 1IAII 3D0LB 4NO0B 1J1OL 4HHAA 2IGFH 2CK2A 3OXRB 3B5TA 5ACMA 3WLWD 4OIIH 1WBZA 3IDXH 1AD0B 4LOUD 3ULVC 3UBXB 4RWHA 2ADFH 3LKNB 3SY0A 3WFDL 3ARFC 4Y8DC 1F4WH 3SDCD 5E8PA 3ZKSD 3NIDE 3P73B 1G1CA 1U93A 1X5FA 5I1DA 4GUPB 3OJDB 5ADPL 1SM3L 1H3GA 1NMAL 1Y18B 1IM9B 5FYLE 1KCVH 3KPSE 1F3JA 1EUUA 3EFFB 3AREC 4WFGD 1CQYA 2HTKC 1KB5L 2Z8RA 2HFEB 2OBGA 1T7WA 5A2KH 5KSBA 5FKPB 2P24A 3F7QA 5FDYA 1LILA 4QHMB 4U2ZA 4MX7A 4R7DB 1DSFL 2ZOLB 4MXQD 3QZWG 1UJ3C 3MV9D 3B8SA 4X80H 4JFOA 2UZIH 4Y5YC 2B7DT 2GIYA 5BZDB 2ADGA 1CGXA 1NFDB 1MFAH 5GSVA 5C09D 1TZIB 4LSQH 4WDIA 1A7PH 2V17L 3QQNA 2J3SA 4PJ9B 3MOQA 3GI9L 4UILH 3SKMB 2DIBA 1Z9LA 4M6MH 4EI6B 4OCYL 3V0WH 1OWRM 5HDBF 1HHJA 1S7TB 4XP6H 1CDBA 1EBAA 3SKNB 4IM8A 2AK4A 1TVBA 5CMAB 1P84J 4W6XB 4ZUTA 2IALB 4JHAL 3VGFA 3M1BA 1D3CA 3HI1B 5KSVA 1LQSR 4HKBA 4GBXD 1HH6B 3WSQH 1F3RB 1C16B 2H3NB 1JGVL 2W60B 1HXYA 1E28A 1CZ8H 4PRPA 3DHJA 3QWOB 1D5IH 4J4PC 4S1DC 3TZVA 4ZNEA 4DKFH 1P1ZB 3P0VL 2C3VB 4M6NH 3FOMA 3MLYL 3ZDXF 1HSAA 1GGUA 4HGMA 1WEJL 4OZGA 5IVXF 1UWEH 4X7SH 2JJTC 4ZD3H 1SEQL 3WS6C 1KULA 1U8IA 5KS9E 2QQNL 1L7IL 3K2MC 1YEKH 2RQ8A 3BSZH 5HHOE 1CLYL 1EEZA 4JREC 4HXAH 4MNQB 1LEKA 3IFOB 2VDNL 2ICES 4YQXL 4X0KA 1LO0L 5HGDA 4ZFGH 2PYEB 1T89C 4O58H 5DMIH 1P2CB 3QEQE 5HYFA 1CE6A 1PVHA 4JFDB 2YRPA 4KWUA 4FXGA 2R8SL 4TOYL 3CDGA 5DYOA 4JG1L 4FG6C 2HN7A 3H9YA 1WIUA 4K7FB 2I07A 2C26A 2AP2A 1F11A 1KCRL 5IWLC 1XGUB 3VWJD 1U8KA 3ARGA 3L5WA 3UPRA 2HMIC 3OB0K 4BFIA 5CEZD 2WWMC 1PW3A 3MODL 2LV4A 4ODSL 1NPUA 1GZPB 3VI4E 4YHYC 3RWJA 1EFXB 4LCCC 3FMGH 5DQ9A 4BSVB 1HINL 3MLWL 1U3YA 1U8QB 4NWTH 4U1IB 2IH1B 3DV4A 1OB1A 2CLZA 4E42B 4JM4L 4S11A 4TTDD 5I30H 4ODVH 1F8TL 5LGHL 1QPPA 4CRPA 4KRPC 3RZWA 1A7NH 3RNQB 1U36A 1JTPA 2R1XA 1IC4H 5BV7L 3U83A 1H3VA 2BVPB 2F15A 4V1DA 5DJ6B 1EO7A 4ZUWA 5D2LB 3GMNB 2BNQE 1A8JH 5DEFB 5EU6B 4OV5B 1CT8B 1MHCA 3VCLB 5KSUB 1R5WB 3HE7B 2BSSA 4GRWB 3HZVB 3BKYH 3BX7C 3HC4H 2YPKA 1NGWA 2B0SH 4J6RH 1I1FA 3SE8H 1MCKA 4XC1H 4IDJL 5BVJB 1Z0NA 1D9KA 3HPLB 3B43A 4NKIH 3DMMA 4GXUM 4HC1H 2FATL 2AJYL 1DQDH 2D0GA 3QIWC 3QPXH 4I0PC 2B4CC 3G5XA 4AEIL 1JGDB 2CSPA 3KPRE 2W1NA 2K3TA 3RL2B 5DUMH 3T0XA 3N1QC 1PZ5B 3LEXA 4OLUL 1A5FH 4YHKH 3VRJA 1OGAB 2X44D 1ERNA 1G7LA 3A67L 3NA9L 2H32B 5GGVY 3HG1D 5IW6B 5EOCJ 3FN0H 3GI8H 3AFLA 4ZXBA 3GSVB 3CC5B 1FDLL 3DVIA 1ZLSL 2BJML 1A6UH 3PP3K 1X4ZA 1LO3L 3P77B 1JV5B 4G7VH 4WHTA 5CGMA 5J12C 1NGQH 2NY2D 4PFEA 2EIZA 5T5NF 5HVFB 4IOFC 3GMMA 2JELH 1VENA 3QNYB 5E03A 1OY3B 2EE6A 2IPUK 8FABA 1OAYH 5DD3H 4HC1A 4PREA 3UTZB 4KY1L 4Z7NF 5DK0B 3T3PF 1UM4H 3QDGE 1ZEAL 2MJWA 3QIBC 5I16B 3P0YH 3P11H 4WI4A 4MXVF 1U8JA 3T0EE 5FECB 1S3KH 4M48L 1FN4A 4IMKC 1MSPA 3UO1L 5HVWA 1FNEB 5JHDA 2F53A 4GKZA 2ATKA 1A7RL 1FBIH 1KEML 4JQXA 3S97C 4YEFA 4WJ5A 1CF8L 1BAFL 4FZEH 2NY4B 1K3IA 1KPUA 1UWGH 4FFYH 4OM1L 3HC3L 1T0PB 4GG8B 2PO6C 3TVMA 4N5UA 2QEJA 2VZTA 4M1GL 1CG9A 3G5ZA 4WHCA 4D0CA 1SYVA 4LLQB 4DQOH 4XPBH 4FQHB 1NUGA 4MQXC 3S96A 4X6DF 5IB5B 1G7JA 1CFSA 3TA3A 3OKDB 4HKZB 4M43L 4GAFB 3C08L 4MXWH 1S9XB 4IRSC 3VXSA 4HG4K 1ZT7B 1DLFL 2CRIA 2BX5A 2YXMA 4HS8L 3OAZK 4M00A 2A1WL 4ELMB 4JJ5A 4C55A 4TNWF 4R96B 2CIIB 4KTDL 4L4JA 4U1SA 3F5WA 2VR5A 1FFOB 5HHME 5DVNA 4CVXA 4AQ1B 4WWKB 4UINH 1AI1L 5D7IE 2ZSWB 1UJ3B 2L7JA 1OCWH 4XP5L 3RX8A 3SHSA 3MLVL 4KJPC 4O9HH 1IGML 3KS0J 2MWCA 1R0AH 5DA0B 4KQ3L 5C0JA 1DVFB 1LEGB 4TVPL 2CIKA 4M9OA 5E5MB 5AZEL 4U1KA 4XBGA 2EE3A 4LAJH 3DO7B 1EUTA 4EDXB 3GRWL 3MCLL 4L9DA 2AS5M 4Z7WB 3KPPB 3C5JA 4JANB 2XN9E 3IXAB 1NCWL 4MNGA 1C7TA 4MJID 1A1MB 3PV6B 1R5IB 3BZDA 4PY8I 5BRZD 4LCWA 3WV0A 4Y2OA 3QEHB 2Q8BH 5T33H 3CH1A 5ACLA 3LRSA 4JPVH 5B8CB 4QOKD 1TCRA 4XPFL 4R3SA 2CLRA 2WNGA 1D5ZA 3K4AA 2YPLE 4MA8H 1TENA 4PB0H 3W39A 2AERT 2WLYA 4P46A 2OYPA 1Q0XL 4LKXB 4Z7VF 2HTLD 1FL6B 3G5VA 2BNRE 1PKQE 4KJQD 4NNPL 4OF0A 4PTUB 4FQ1H 4Y2DB 4LNRB 4JDTL 2GCYB 3EJYD 4X6BB 1EHXA 2GT9A 3KPOA 4TNWK 3HRZA 1MFCL 3OKLB 4K8RD 3WEXA 5KVFL 3VXME 5I18L 4MA1B 2DS4A 3DI2B 3EYVA 5J6GB 3SDXF 1DBML 3OPZH 1IQDA 1V7MH 2R1WA 4G6JL 5H37H 1FL3A 3KJ6L 4HPOH 2BY0A 2H9GB 3E0GA 3OKNB 4RGND 2E7BA 2UZXB 2ZUWA 2GJJA 3QNXA 1H0DB 3X3GL 4H8WC 3FHAA 5DD1H 5D93C 3R8BB 2NY0B 2WBWB 4XCCL 2O5XH 3NZHH 3RVVC 4QF1B 1PLGL 3O6MH 2EDFA 3VFPA 4NPYA 4PRDA 4OFKA 1P4BL 3D39D 3OWEA 2RJMA 2VLJB 1S7RB 1UGNA 4GW4A 4PJGF 4YHIB 3JUZA 3D3VA 2CK0L 2GJ6A 5TDOA 1U0QA 2CGRH 2EE9A 3HLAB 3QNZB 3MRLA 2C3XA 1TZHB 4YGVA 1JHLL 4GOSA 2ERJB 3SDYH 1TCMA 4OFPA 3AS3A 1ZVSB 4N8PA 5GGQL 4PJIF 4D9LH 5KW9H 2NY1B 5IFHL 1DUYA 1ZT4B 4L5FL 3J7HA 4AYFA 1C5BH 4YHYB 1UVQB 4HUWB 4E0RA 3IU4H 3QHZH 3ULUF 4LCCB 1CDUA 2IFFL 1KT2B 5B38A 3MGAA 1UXWB 1ZGLA 4MWFA 4BH8A 3U4BL 4KRLB 1R5VA 4K2UH 3M45A 4YNYB 2D9CA 4MGXA 5IBUB 1NJ9B 4I3RL 2FHCA 1R3HA 3MLZH 3LQAC 2Q1EA 4CL7A 4KRPB 3SKUD 3WHE1 1N6QH 2H45A 1MWAA 3L5JA 4Y4HD 3OKEA 4XPGL 2Q6WB 4F8QA 4K3EL 1FO0L 5CBAA 4GT7A 4X9HA 4M7KH 5SWSD 4DGVL 3L7FB 1FH5L 1KLGB 3GMQB 2GSGB 1UJTA 2WBKA 4R4NC 5IKCB 1NGZB 1ZA3A 5ERWB 4U1GC 3IFNL 1ZHBB 5FO7B 1KOAA 3T0EC 4PRPD 4M9PA 1P6AB 5IMMA 5LBSH 1B0RB 4R8WH 3TZVD 2CXKA 2W9DH 3QIWB 3T0BA 3U36A 1T03L 4HKJA 4KKLD 1KELH 3C5ZB 4Q0XL 1UEYA 5F7MC 3UZEA 3QI9A 4R0LA 4PLKD 4O51B 1I7UA 3G9VA 4XP1H 5TDNB 5IM7B 4PJ7A 5GJTH 3LPFA 4MD0B 5F3HA 3HPJB 5D7JA 5IROA 5C0BE 3O3AB 1QR4A 4NQEB 5DHYB 4GKOA 5HGHA 5E4EB 4UB0L 1DQJA 1NANI 1NLDL 3LSOA 1SJHA 2J6EA 3PABB 2EYSB 1T1WA 4XAKD 5C0ND 3QFJB 1W8NA 4IS6A 1FVEA 2X1WL 5D4QA 3MA7A 3NABH 4OUUB 4XT1C 4LQFL 1YZZA 2AJSH 4JKPH 4R7NB 5ETUA 4ZAKA 4OSUL 4NKDB 5J12B 2X9YA 4C54A 4F9PA 1QVOB 2OCFD 3SO5A 2VSCA 2WBJA 2X4UB 4OZFG 4ZS7H 1YMHA 5MEPB 2DLTA 5FCUH 1JRHI 4A6YA 1DBBH 3LD8C 4MSWA 1WAAF 1MOEA 2G60L 4AEEA 1TDQA 3QDMA 2UYLA 1BQHA 5HHNB 1PYWB 3KYKH 1DN2A 3A6CL 1IGCL 4HJJL 5ANMA 2A9ML 4EI5D 5ACZA 3KLHD 4PYGA 1HQ4B 1KFAH 2FB4H 3QIBB 1H3PH 5HPMA 1HHGA 3ARGD 2DD8L 3FQNB 3U2SB 4HK0B 1KENL 3MJ6A 4ODXB 1X5IA 1MFDH 5JXAL 3GMLA 1G9NL 2W9EH 1R3JB 1T7VA 1G6RL 1BZQK 2XTLA 1YMMB 2A6DA 2J1KA 4ZTPH 3UJJL 4J8RA 3ZHDA 2R9HD 2GY7B 1RZIA 1F02I 4HWZB 5DRXA 1QEWA 4TRPL 3MV8D 7CGTA 3Q3GA 3VXRE 2H1PH 1X4YA 2B1AH 2AV7B 1TQBB 4L1HA 2YD1A 4GRLA 1E4JA 2XXCB 4JPIA 1HCFX 1G1YA 5CP7B 4V1DD 3T2NH 4AIZA 3VA6A 4PRHE 1FC1A 3U30C 1RMFH 3PWPB 5I1IL 3MJGX 3FRUB 5KVDL 4NQSB 4LF3B 3HC0B 2N4IA 5SX4I 4IRSB 1C12A 4NRXB 2HA1A 2XIDA 2C1PA 4DTGL 3B9EA 5DJ8B 2YD2A 3UJIH 2VZSA 3W9DB 3MJ9A 3BW9A 1LE5B 1WWBX 2OS7A 1MI5E 3SDDC 3QRGL 4DFIA 4IMLA 2XRAL 4Y5XB 2WP3T 3DIFB 1S7VA 2DQFA 3H7LA 3V7MA 5FF6B 3SCMC 4YUEH 1F90L 3ETBF 4JFDE 1FAIL 1PY4A 5EU4B 5HHXH 2E7MA 3Q5OA 3UTQA 4WGVB 1WTGT 3IDJA 4FZ8H 1LO5B 5KANI 4HGWB 5EORH 5FK9A 1D6EB 3MV7B 3DSNA 3HNTL 3CLFL 4U6XB 1FL5A 4LAQH 3O3BA 5E24E 1JWSA 4LSSH 4ZXBD 2Q86B 2EH7L 3MBEA 4NQCA 3QDHA 4L3EB 4Q6IA 2D31A 5F7LB 4YWGH 1CYGA 3IGAB 1KUMA 5CIPA 1BD2B 5C08E 2L0DA 3QZWA 1MELA 4XGZB 4K9EL 1F2QA 3IDNB 2B20A 4WFHE 1FYTB 5DUPH 4NN5B 4X4ZA 5CHNB 3TGXA 3L3OA 1Q1JL 4GKNB 4JFHE 3U0TB 3RY6C 2ZCKH 2ZCHH 3AS2A 2R69L 2FLBT 4P23B 2AAVA 1ZE3C 4RRPG 5GQBA 2VMFA 5D7LA 1W0VA 2SEBB 2WUCH 1S7WA 3P4OB 2Y5EA 1IAOB 5DJ2A 1S7XA 3LEVL 2IMMA 5CJOH 4R97C 4HK3N 5I1JH 3BZEA 4JRXB 4P5KB 5JHDD 3CX5J 2G2RA 2YD7A 4DK6A 2FD6L 1T20A 2QSCL 5A2JH 4HWBH 4PJGE 4XP4L 1NUDA 3HNVL 4FFZL 2R2CA 3BPOC 4ZO9A 3IF1A 1MWAL 4LIQH 3N85L 2XY1A 4JFZH 1J8HA 1QRNB 4YBLC 2BSRA 4PY7B 4K23L 3UBXG 4KHXH 3WO4C 2NX5B 5JLZA 4HWEL 1VHPA 4JQVA 4CGTA 4I5BB 1NC4B 1BVKB 1J1OH 4MA7H 3MRPB 1J11A 1BOYA 1VERA 3MXWH 3MGTA 4ELKB 1RULH 1OGAE 4ZUVA 3TA3D 2APVA 4NZJA 3W0WA 2HJLA 1N2RB 2R0ZH 3EOAA 1EBPA 4G8GA 3L3DA 1U2HA 2P47B 3UPAA 1F4AA 3VXTA 3GBML 1MRCH 3C87A 5DS8B 4EZMA 5IB4A 1N4XL 5BJTA 5J6HB 3SE3A 1RD6A 3WBDA 3KAAA 3IU3A 3BZ4B 4LVOC 2DN7A 2V7HB 1MLCA 2X4TB 3NFPB 5IJVA 3GMOB 1U3HC 4DGIH 1VGKB 3T0WA 5ADPH 3WFCH 3WHXB 4G43A 2KZWA 3EO9H 3X12A 3STLB 5CGYC 1RU9H 4WFEE 1K8DA 1I1AD 1HXMA 1KB5H 4JLRB 1KJMB 2J6EL 1UM5L 5ID1A 4G6AD 1MJJB 4ERSL 2D3VA 4AEHL 4F7PB 4FNLH 2NY7H 2XNAA 4W70A 2DQGL 2DYPB 1DSFH 4RFOL 5DFTA 1OTTC 1NQBA 2AQ2A 3ZE0F 3H3PL 2ZSVA 4G9FA 5C3TA 2MPAL 2CLVA 1ED3B 1HSBA 4MD5B 4QHLB 1QFWH 1XZ0B 3CMOL 4V2BA 1JMXA 5EWIH 2V17H 4OJFL 3ZE2E 1DLHA 4HZLA 4OZIA 3FOLA 5D1ZB 1UZ8B 2VDLL 1LD9A 1JHKL 4L29A 3FONB 4OGAC 5J9PA 1VFMA 2J8HA 2FBJH 1U6AL 1KJ2A 3TNMB 3FQWA 3QEGL 1UB5B 3KDMB 2Z4QA 3DV6B 4U1NB 4HIIA 1IRAY 4WEBH 2NMSA 5CJBA 1JGEA 5HYSA 4RCAA 3QXDB 4WFFD 3U79A 5GHWH 1A6VL 3NIFF 4G6ML 1XF5B 3C6SA 4ELME 1SEBA 4PJXA 4TPRH 3BISA 3K8KA 2AQ3A 3P0VH 4H20L 4EDWH 1AGDA 4D94A 4CN6A 5GRVL 1KG0A 1SEQH 2Z9TA 5C0AE 4G6FD 5GS0L 3MNZA 3IDYC 4EBQH 4RZCB 4HEPG 3QDJA 1N64H 4YDKH 2GUOA 5DURB 3LD8B 2VZOA 4L9LC 5LGKA 1PEWA 3SDCB 5K9QG 5IF0B 4UMGA 2GJ6D 4HX1B 3VGBA 1YY8B 5ELIA 3G6AA 2ZZUT 3UDWC 3CFJB 2VJXA 4KDTC 3BQUC 1LO0H 2F5AL 2GITA 3R8QA 4OLEA 2DOCA 4QTHA 5DRZB 4I8DA 2ZNXA 2KQMA 5GZNC 4XBEH 1T66C 2G5RA 1RIVH 1DQQA 2VERN 4OI8A 3EO0B 5EUKA 3LN4A 4IIQC 5IQ7L 4M7LT 5JOFB 2DWDB 4NO5B 2AXHA 1RURL 4LDEB 2ICCA 1KCRH 1RPQA 4NQVA 5IVXB 1JPST 3MBXH 3EYUL 3O8XC 5T3XH 1CIDA 4HK3J 4LDOB 4K94C 2F9BT 4UDTA 5ENWA 4LRIA 4Z77B 1RFDL 1SBSH 3BRGC 4K7PX 5C09B 5IHUL 3I6GB 15C8H 1DE4A 5E70A 2BVOB 1F6LL 3H0TB 4HUVB 1CN4A 1OAQL 1MCOH 1CDYA 2R23A 1FZKB 5IFAH 3EFDL 1AQDB 3BGAA 1IGJB 1NSNH 4F57L 2ED7A 5SX5H 4P9ML 1CXIA 4BUHA 4IHOB 1SMAA 2VUYA 2H6PB 3M8OL 3BXNA 1I3GH 4L8BB 3QI9D 3SCMB 2EDJA 4I0CC 2ZKHL 3ARUA 1HNFA 5J13B 1E4XH 2NY5C 3H6JA 4PJFF 2VLJE 4IDJH 1X5YA 1T4KB 2EC8A 5MENE 1FVDB 3QWRD 4OCRL 5HHOA 2ZUTA 4MQ7A 2ITDB 3ULUC 4X7TB 5D1XB 1QHPA 1F58L 4AEIH 4XP9L 1XMWA 5IK3A 1OPGH 2E8ZA 4P2RE 3V52H 2YEZA 4KRMB 3KWWA 1EO5A 2RB8A 4OLUH 4P9HH 1GGBH 1YEGH 2DQHL 5F89A 3TESA 2IFGA 4XPAL 1BX2B 1BEYL 3Q6GH 2WBJD 4MAYB 2H2SD 3A67H 1PX3A 4XCEB 3VWKD 5IHZA 4JHZA 2WM0A 4Z95L 4XI5D 3KR3L 3RNKA 1JK8A 1URLA 4UNUA 3DUSA 4GMTL 3U6RA 1RHFA 3QDMD 1BM3L 1T0MA 1Z0MA 43CAA 5FOBB 1U9KA 1W0YT 4DW2L 1RZJC 3JSSA 5ESQB 1ZSDA 5FYKL 4WV1A 3RPIA 3BKCL 4N8VA 1WBXA 2Q87A 5JIHA 1J05B 3BN9D 4DCQA 3NMEA 2ORBL 3ARBD 4G8FA 5GSRA 3E3QE 3PHOB 1A6AA 4RAVB 1OAKL 3RDTB 2Q7YA 1JZ4A 2R29H 5KBNC 5EC2B 3RZCA 2BCKA 3BPCA 3QAZC 1G84A 1PQZB 1FRGL 1Y0LB 3S5LA 5ICYB 4PRIA 4YDIH 3VWJB 1Q9LB 4YPJA 5IEKA 1KIPA 2QR0B 3HR5A 3RVXD 2DRUA 4M7JH 4HAGA 5BXFA 3BPOB 2VDQL 2FL5B 4Z76B 5E1HB 1GHFL 3U1SH 5HGAA 3MCKA 4YBLB 1I7TB 1KIQA 4G5ZH 3UO1H 4U6YA 3C60C 1MEXL 4MQTB 4NGHH 4OKVA 2PXYA 1H9VA 1KEMH 1A9BA 3DXAE 1UYWH 4K7PL 3PGFL 1JNJA 4WHYG 5EIIB 1YQVL 3HI6H 2YXFA 5GS2H 1XF4B 4U1MA 4JB9L 5T1DL 1K4CB 3WXVL 4M1GH 1RUQH 5CD5D 3IJHA 4CVWA 3QA3B 1BPVA 4L3CA 3KPLA 3H2WA 5MHSD 4HLJA 1K5NB 1IGTB 3GIVA 3HKFA 5F96L 5IW1B 1NEZB 5BVPL 2XTJD 4YXLH 4OM0L 2HP4A 1U3HB 1OD9A 4PGCA 4GSDL 4UT6H 4JFEA 1T83A 4XVTL 2HJKB 5B22A 3K74B 5HDQH 4QHNA 1NCDH 1BZ7B 2EXYD 4ONFH 3TF7C 4AENB 5IVZB 1H15A 2FO4A 3CFBB 4LCIL 2JE8A 4NQCD 2Y6SD 4JFPB 2EC9U 3BP5B 3BGMA 5GRYA 2NTFB 1AI1H 3U9UA 3WNOA 1NC2A 3MLTA 4OI9A 2AEPH 3T8XB 3CU7A 4I4WA 3HG1B 4BSWB 2E6JA 1T80A 1YNLH 4NNXA 4DGYL 3O9WD 4KQ3H 5FCSH 4EN3C 4FQQB 5GGSA 5C0RH 5FYLL 5D70H 1VGEL 2P5WD 4H1LB 3GRWH 5KVGL 5GS1C 1TNNA 1MCDA 1KEGL 1CTNA 1I9RH 3VA2C 2AXGA 2V9QA 1UXSB 2F54A 4DZ8A 4X6DB 1PDKA 1S7UB 2NY2B 3UXFA 1NCWH 4TSBH 5CEYB 4RMVA 3QDGA 3FO9B 2AJUH 1DQLL 3KLAB 3VGAC 1ODAA 2ZCLH 1WCBA 4IRJC 3PWPE 4J3TA 5I1EH 4U6VL 3A6OA 4UUJA 4Y16C 5K9JH 4MNHB 1N26A 4OZFH 2D4FA 4EQ3A 2DJSA 3HUJF 4Z78B 5E95B 4WO4D 3LN5A 3TBWA 4MCYA 4NNPH 4F7MA 4Y1AD 1Q9WB 3V0VA 3MA9L 5C07E 3MFGB 3HFML 5L2KE 3JVGC 4GG6A 1IEAA 1MCJA 3FO0H 3PWNB 4P2OA 2OP4H 4M61B 4XCFH 4K71B 3WLBB 1H5BB 3OX8A 1EZVX 1LO4H 3FCTA 2BOBA 3FQUA 4I2XE 3WNPA 1QLEH 3FT3A 5E8OA 2ITCB 3QO1B 1ZHLB 2O5YL 3FL7A 5CBEA 5C9JB 4QXUL 3QG7L 4M4PA 2WINA 5D5MB 3MV7E 3Q2CA 2AKRB 1XGTB 2A9NH 2X4PA 4MYWB 3CPLB 1NBZA 4P48A 3DRTB 5F93C 3BP6A 2ID5A 4RGMC 3KVQA 5ID0A 3MRRA 3CSPA 4F7CA 5I8KH 1E4WL 4PYHA 1PLGH 1AO7E 5CZXD 1S7SA 3PXJA 1BFOB 4UTAH 4N0UA 3BZFA 4QWWC 4Z7VB 4L4VE 3VFSB 5L88L 4ODHH 5JA8B 5EOQL 4IIQB 1LEIB 2ZP0T 5I17A 3V5HB 3GSNA 3TO4A 1JHLH 2CQVA 3QFDA 1T0NB 5IBUG 1AD9A 5CJXA 5GGQH 4BZYA 1BF8A 4HH9A 1A6WH 5D1QC 5IFHH 2FX8L 3BHBB 3VGEA 1FFPB 3HMXH 2NLJB 4BUGA 5JNYA 1YYMH 3ZDYE 5I0ZA 4KV5F 3O11B 3KJ4C 4HJGB 3RFZC 1RK1B 5DD6B 3U4BH 2ZUVA 3IKCB 3LS5L 3C5SA 2PNDA 2L7UA 2XKNB 4HH8A 1WZ1H 4I3RH 4ZOEA 3E3QC 4FQCL 3TP4A 3RGVA 3MRFA 2NR6C 4OZHF 2PYFB 4OD2B 2AABH 1CFTA 3LIZL 5CZKA 5I76B 2DQCH 2JKXA 2YPLA 2IANB 2Y36L 1FO0H 3I6KA 1U42A 5E1AB 1K6QH 4DGVH 2XY2A 2HG5A 2NX5E 2JB6B 4XAWL 3BIBX 3WIFB 2IH3B 1MVUB 4FQIH 1XGQB 2DKMA 2YR3A 1HK6A 2DKSA 1INQA 3GGWA 4PTTA 3RY4A 3V5DA 4GKSB 4LCUB 3IFNH 1DCLA 3QQ3A 5DJXA 5IUSA 1S9WA 1OW0C 4MCZA 3MUGA 2IC2A 1U2CA 3VXMA 1UCTA 1AXSA 2I9LB 1LP9F 1CXKA 2PR4L 2X1QA 3BPLC 5CJQH 3CXHK 3D85A 4ONHA 4OLWH 1JRHL 4YHPA 1AXTL 3VFOA 3HMXA 1I8KA 2YA0A 3HZKB 4QHUB 3UP1A 3QP3A 4RAUA 5F7EL 1KXTB 3RY5A 3T4YB 1R3KB 5JXED 1FNHA 5DRWB 1JWMB 3GBNL 1AGCA 1VACA 4XXDA 1CGSH 3QDJD 2J7LA 2OQJA 4LVEA 3CJJA 4P3WA 5TPWL 2ZJSL 1A6TA 4S1QH 3G5YA 5FDWB 1J12A 1YJDC 1SY6A 5T1KB 1XIWA 4LVNB 3BGFB 2V2XB 1M71A 2ESVA 4KFZC 1EGJH 4XVJH 4KI5D 3I9GL 3QO0A 3A6CH 1IGCH 2F74B 3TJHD 1U91A 3KYNB 4Z7UF 3SDAC 1PX4A 4ORZC 1YECL 3SGDI 2Y1VA 2IAMA 4LGPB 5KAQF 2HWZH 1HOCB 4X6EB 2XG4A 2R2EA 5DZNA 5I1AA 5CD3A 1KENH 1WZMA 1RUKL 2QQLH 5EO0A 4P5MB 3VXUD 5TFSL 1G9NH 3ZKNC 2NYYD 2GSIB 3ARTA 2Y5TB 4N0FA 4X98B 5AYUL 2OJZH 4TNVF 5CZVL 2FO1A 4G42A 3MCG1 4H25A 4O2FA 2ADIB 5EO1B 5M95B 4XH2A 4NQDA 1G6RH 1INEL 3ZT5A 4F15B 2CDGA 1J18A 3GO1L 4OLZL 3Q6FB 5CINH 5JPNB 3UJJH 3D0LA 4LLWB 4NO0A 3V6BR 4Y4HB 1JL8A 2D4DA 1H3WM 2VDOH 4TRPH 2CUHA 3OXRA 2A6IB 3RA7H 3FT4B 1AD0A 43C9A 1GSMA 4YFLI 1AGFB 3MRKB 2NY3C 3LKNA 1B88A 4JO4H 3WJLC 1FNSL 2YN3A 1ES0B 5KVDH 3WO3B 3HI5L 1CXFA 1DEEA 3P73A 5FHAL 1E6OH 1EHAA 1X5GA 4P3CL 5TGBB 3CFCH 3OJDA 4S1RL 1DBAH 5T3XD 1Y18A 1IM9A 5C0BA 3EFFA 1U58B 1Q0YL 2XRAH 4XRCB 5E99L 2A77H 3WFEH 2HFEA 3H9ZA 5FKPA 5JMOC 1HIMH 5C0IB 5HYJD 4ZS6C 4QHMA 2CDFB 4R7DA 1TLKA 2ZOLA 4WFGE 2B8OT 5D71L 1IKNC 2MOVA 3RVUC 4DAGH 2APXA 4OCLC 4RA0C 3HNTH 3MNVB 3WIIL 5BZDA 4TNVK 4PJEF 1A7BA 1F42A 1NFDA 5DQJB 3BH8B 3I3EA 3O6FD 1I8IB 1TZIA 3IS0X 5GS1B 4PJ9A 1REIA 4WCYH 4HS6B 3MV9E 4PJ8C 4HZAA 3SKMA 4X9IA 2HLAB 2QV2A 4YHZH 5AYQA 5DUBB 4CU7A 3GM8A 4EI6A 5EUOF 1S7TA 4X4XA 5C09E 3SKNA 5CMAA 2HT3C 3RZCD 1FZOB 1M7DB 4EI5B 2IALA 1VESA 5FYJH 1DBKL 3GHBH 4PRID 1HZHL 3HI1A 3MZGB 1HH6A 2WK2A 3ZT7A 1DJSA 1C16A 4AMKL 5I71C 2H3NA 2QQKL 2W60A 2NNAB 4LU5L 1IAIH 5TE7L 2VC2H 4ZFZB 1E4KA 3QWOA 3GM0A 1Y6KR 1T6WA 3CAFA 4DN4L 5E9DB 3EOBB 5F6IB 1P1ZA 2FX7L 2C3VA 4TUKH 4UQ2B 5H35B 1QBAA 2YBRB 1JMZA 2R1YB 3H3BC 3MV8B 1T2QL 3OKMB 3CD4A 1PG7X 3BKMH 3JXAA 4ONGL 1INDL 4BZ2H 2OR9L 2OI9B 4DVRL 2XA8L 3N85H 2R4RL 3WHE0 1I75A 3EYQD 4RQQB 3I02B 3VG9C 3EDFA 4K23H 5C6WH 5FIEA 3IDGB 4MNQA 4ZFOB 4CN1A 5FYKU 2XZCL 1ORQB 3IFOA 3GSXA 3R1GL 2ICWB 5JZ7C 5GGSY 3ZKXC 2W38A 5JUEL 3FFCB 2PYEA 1N0XL 4Y4FA 1MFEL 1DN0B 1P2CA 3WUWB 1KCKA 3TPKA 4JFDA 5IB2B 5L9DL 4JFED 1BOGB 5GJSH 1JGLL 4L8SC 4HG4J 1BZ9B 3GBMH 4M93B 4Z5RB 4WU5A 4GRWH 1NMBL 4ENEC 3PL6B 2X89D 2BVTA 1BVLB 1YPZE 4K7FA 2DIJA 2VN4A 1XGUA 3CVHL 3OXSB 1FV1B 1NC2D 4ZUSB 2VDRH 4WUUE 1HKLH 5T1MB 2LFGA 1GZPA 1AY1L 4KDWA 4NZUL 3ARRA 5CLWA 1EFXA 5GS2D 4LSPL 4BSVA 2AK1L 2K9UA 4ERSH 1U8QA 5HHVL 3WJJC 4AEHH 2VITB 2CKBB 2IH1A 4U1IA 5CEZE 4Y5VC 2R0WH 4E42A 2BRQA 2F54D 3P4NB 1IAKB 4NC1E 1SY6L 2BDNH 3RNQA 1R6VA 1IGFH 3H3PH 4EXKA 3LOWA 4FFWD 4BM7A 3TV3L 5SX5K 3TN0C 4GW5B 2BVPA 5DJ6A 5D2LA 3GMNA 5JHLL 5DEFA 4OV5A 1CT8A 4NKMB 4OJFH 5E6YA 3VJ6A 3VCLA 5KSUA 1R5WA 5E56A 3HE7A 4L4TB 5KSBF 4PB9L 3HZVA 1HNGA 4ALAH 3DSFL 1JHKH 5JPMB 3MROB 4QXGL 4FMKA 1G9EA 1T5WB 3LKPB 5ITFA 1U6AH 5BVJA 3HPLA 3T3MF 2J5LB 1QYGL 2BSTB 1HDMB 4D0DB 5J4MA 2FGWL 5HVGB 4HULB 1D6VL 2FEEI 4HMDA 3GB7B 5TQ0L 5I15L 5JA9A 4JG0H 1JGDA 3A6BL 5IOPB 3RL2A 3ROOB 25C8H 1A6VH 1PZ5A 2FEDD 1HYSD 2EYRB 3L3GB 1V05A 1OGAA 3RWEB 3HNSL 5IESL 5KSAC 4OI7A 5F1NA 1CD0A 5M94B 1PG7L 4LARL 1RVFL 5FKAB 2H32A 2FGZA 3UTSD 5IW6A 1CWVA 2W0FB 4PGBB 5LXGL 1LO2H 3GSVA 5TQ2H 1LNUB 3CC5A 3TFKD 3SBWC 4NUGL 2V2TB 1A22B 3ULVH 4XB8A 4KZEL 1WC7B 3P77A 1JV5A 3X3FL 1Q72H 4I13B 4U1JA 4C4KT 3HG1E 5ICZB 4PJAF 5FV2A 1A3LH 1L9MA 2V2WB 3QSKB 3OG6B 1WIOA 4WHYH 4JFFB 1U8HB 3QNYA 3TO4D 3RIFK 4NHUB 3GMRB 3KXFE 3THML 1I4FB 3UTZA 5DK0A 1OTUD 2ADJB 2C4FT 3DGCR 4ZO8A 1X5XA 3H42H 4N1CA 4U1LB 5DTFB 3X11A 5I16A 4APQD 4YBQC 3U9PL 1JYVA 3V79C 1I1AB 1YY9D 4MXQC 2GHWB 5FECA 5J1AB 5IQ7H 1CLZL 1H8SA 3ZYIA 1IM3B 3CZFB 5D96C 5IQ9B 3BJLA 1FNEA 1TITA 2RCSH 4YO0B 3VFGL 4ZTOH 4I48B 3RTQD 1R3IH 3S88H 3BPNB 4HF5L 2OR7A 5D2NB 5F7WC 5FGCB 5D6CB 1S5HB 1RFDH 2VH5L 5IJKC 4GG8A 4WEMB 1OGTB 1WQVT 2X2YA 1FJ1B 3HE6D 5E8DL 5TE4L 3RKDC 4LLQA 3W2DL 4FQHA 3EFDH 1RJCA 4M1DH 5IB5A 4GBXC 3O4LB 1Q8MA 3OKDA 1J1XH 4HKZA 3U7YH 5D5ME 3DECA 2Y7QB 2R4SH 3UEZA 1ZT7A 2P8PB 1CLCA 4CADB 2LAGB 6FABL 3D85D 3LKOB 3C6LA 4PS4L 5HVHB 4ELMA 1MLBB 4HBCL 4A2LA 1L7TH 1JZ6A 4R96A 4MVBD 2CIIA 4Q9RL 3OR6A 2FSEA 5AEAA 2ZKHH 1J0ZA 4KTEH 1FFOA 4Z0BH 1FG2B 1CD1B 3MRMB 4UU9B 4WWKA 3MOAL 1VA9A 2ZSWA 3GNMH 4NC0B 1UJ3A 5TJWK 1MHPL 2VDML 4Q2ZB 4PV9B 2VISB 1T7YA 5C2UB 5I1KH 4LRNL 3QH3B 1DVFA 1LEGA 2C7UB 5E5MA 4G6FB 1F58H 1JHTB 2BXYA 5C2BH 3DO7A 4PG2A 4EDXA 2XV6B 3S3PA 3OKOA 1I7RB 3WXWH 1OAXH 4Z7WA 3KPPA 2PN5A 2X7LB 5T5FH 1ACYH 3BEVB 4JANA 1RUAH 5F7HA 4HEME 1MF2H 2F8OA 1A1MA 3BESR 1R5IA 3O6KL 2ESVD 3QEHA 3NFSL 4M3JA 1EERB 4GMTH 1BM3H 2E5EA 3JV5A 2BERA 3WFBL 5B8CA 1MIMH 2WLZA 3L1OL 1UCBH 4GQ9L 1MFBL 2VQUA 1BMGA 4MJIE 3BKCH 5BRZE 2ORBH 4XTRC 2VZUA 5ECJE 1RIUL 1T3FA 4RGOH 2E6PA 4LKXA 5HY9B 4PJFB 1FL6A 3SQOH 1GYAA 2KBGA 1PGRB 4QOKE 4GAGH 3RUGE 4PTUA 1AFVH 4Y2DA 4LNRA 3P2TA 4ZDHB 2GCYA 4X6BA 3QCVL 3VFMB 4NQDD 3S37X 4NC1C 2IPKA 5I8CB 3OKLA 5J6GA 4XNZC 1WFOA 3NTCL 1RY7B 3VG9B 2CMRL 3X13B 1NAML 4DN3H 2H9GA 5E2VH 3OKNA 5T5NG 2GI7A 2VQ1B 1FPTH 4MB4A 1H0DA 4JR9H 4K7PH 1EAPB 1YQVH 3PWUB 2ZWLT 4MB3A 3RI5F 5F7UA 1XH3B 4RGNE 5T1DH 4KGLA 4OLXL 4XPHL 3G04B 3ROLB 2VLJA 1S7RA 1MIEL 4YHIA 3VW3L 3TPUB 4JZJB 4Z18A 5MENA 3HLAA 3QNZA 3C2AL 1UKQA 1TZHA 4QYOA 3RWCA 5F96H 4H0HB 3D39E 3WKMH 5F1IA 1ZVSA 4GSDH 5FUCC 4DKEH 1ZT4A 2B4CH 5DEGB 4PBVC 3D69B 1QD0A 3PV7A 1UVQA 2CJUL 4HUWA 4J3VA 1QNZL 2NXYD 1T1XB 1KT2A 4XVSH 4KVNL 1UXWA 1KCSL 2LU7A 5C9KA 4LCIH 4YNYA 4Y5VB 4JKMA 4H1LG 4PJ9D 1NJ9A 4LSVL 4RX4D 5EFIB 3HS0B 1I8LC 1OD7A 1G9ML 4N90D 3VWKB 1RZ7H 2BFVH 5FGSA 5GPRA 2Q6WA 3TN0B 3EYSL 4LP4A 4HUNB 2OXHA 4Y4KD 4S2SB 3L7FA 3QUMA 4XWGH 2BVEA 2VXVH 3TT3L 2IWGA 1KLGA 3GMQA 3S35H 2GSGA 3F7PC 4QRPD 4HV8B 1CVRA 1CTOA 5IKCA 5I6XB 1L0XA 5DJYB 1NGZA 3ARBB 5ERWA 2OX5A 1HH9B 5GISH 1ZHBA 5FO7A 1AQKH 4PBWD 5SWSE 2Z91A 3RI5K 3K46A 4S0TD 4W4OA 3PHQA 5E0QA 1B0RA 5HTSA 1Q9KB 4JE4B 3PE9A 1OM3L 3SKOB 3C5ZA 2V5YA 4YEEA 1T2XA 4PRPE 4O51A 4JO1H 1DFBH 4P49A 1M6OB 5TDNA 5IM7A 3PDOB 4XHJD 3OJ2C 1PSKL 3UPCA 4F2MB 4ZNEE 2GY5A 4MD0A 1RJZB 3HPJA 3S37L 3EZ8A 3O3AA 1EHLH 5DJAB 3FB8B 2ICEB 3MA9H 4NQEA 5D6DC 4OZGE 5A40E 5DHYA 2YC1B 4NSKB 3PABA 4JN2B 2EYSA 3QFJA 2YN5A 3TBYB 4RFNB 3AC0A 3RVTC 5C0GB 4OUUA 2X6MA 4R7NA 2PYED 3PWLB 3VGHA 5FYJD 2Z31D 1QVOA 3QG7H 2X4UA 3QRFM 5DDHB 4XAKE 5DJZB 3SKJH 5MEPA 4HGKC 3GUTB 2R2BA 5BCAA 2R2HB 2O5ZH 3LB6D 1W72L 2ZUQC 5HHNA 1PYWA 2W65B 3ARDB 4TUOB 2XTJB 3VFNB 1QRKA 3MC0A 1HQ4A 3MFFB 2Z8VC 3BJ91 3U2SA 4LEXL 1DANT 4HK0A 1TPXB 3UMTA 1FCGA 3QXAB 2P49B 3QUZC 4ODXA 2BHYA 4IMKA 3IB4A 1EFXD 4LPXA 4P4KA 5C3LD 3CK0L 1UH3A 1R3JA 1GOGA 1FGNL 2BNUB 5DMKB 3LCYA 3OGCB 4R90L 1C5DB 1YMMA 4HFUL 4FN0A 4HWZA 1A1OB 2FX8H 3QUXD 3O9WB 1RJYB 1UC6A 2AV7A 3JV4B 3WIHL 2P48B 2LU4A 2X40A 5CP7A 2QLVB 2P46B 2WAHA 2P5WB 5BV7C 2VXUL 5SWZB 3RJDA 3BVNB 1JYNA 2VLLA 5EU6D 3NIGF 3PWPA 1IC7H 3IDIB 4FQCH 3R06B 2BY3A 5EZIL 3FRUA 3HE7D 3O0RH 1BFTA 4E41D 1T1YB 3C8DA 4NQSA 4LF3A 3HC0A 4P99A 1CU4H 4V1DE 2BHUA 4IRSA 4NRXA 1FC2D 5DJ8A 2QADD 2E7LA 5K33A 4LLVA 1MQ8A 4OV6F 1BFVL 3W9DA 4KH2A 3IAQA 1MQKL 4Y5XA 1D5BA 3DIFA 5ADOH 5L2KA 5EZJB 2XYCA 3CXDH 5FF6A 3LN9A 2VXTH 2XQBL 3D1MC 3EJYC 3W11D 4YHNB 4Y1AB 5E6IC 2VRAA 5D8JH 5JW4M 4OQTA 3QXWA 4I2XA 1S5IH 2HKFL 1LO5A 2RAMA 4HGWA 4JRYD 1KCUL 1D6EA 3MV7A 2DMBA 3WCYA 4OT1H 4U6XA 4XNUL 1ZGLM 1P7QA 2Q86A 2ZG2A 2D0FA 3G6JF 2A38A 1N0LA 4DEPC 4RGNC 2W0PA 4L3EA 1ZHNB 1P69B 5GRXG 3VG0H 1MCIA 3IGAA 3AU1B 1VDGA 1BD2A 5L8LB 4XGZA 4B41A 1WCQA 3IDNA 5DO2D 4P59L 1FYTA 1VCAA 4H8WH 5CHNA 4QGYA 3TYGH 4GKNA 3U0TA 4DWHA 5IFJB 2GW5A 1JZ5A 1ZGLP 2X4OB 2XKUA 3MRHB 2ZG1A 3VI3E 1MCEA 1RUML 4P23A 3MLUL 2NZ9D 3QXVA 2YZ1A 3HZMA 4QT5B 1GIGH 1U3JA 4PJ7F 5I75C 4ZFFA 4XMKL 4TSAL 2SEBA 3P4OA 1IAOA 1LP9B 5TF0A 3LH2L 2EYTB 4KMQA 3I9GH 2VLRD 5IB1B 2M26A 3TWCL 4OB5L 3MNWB 2EZ0D 2P42B 4JRXA 4UTBL 4P5KA 5GRZA 1S78D 4PG9B 3HB3C 5MI0B 4F7EB 1CFQB 1RZKL 1ADQH 4M5ZL 3C09B 2IQAB 2OL3H 1KTRL 1RUKH 2CRZA 1CK0L 1NMCC 5TFSH 5JHDE 3ULVD 2F53E 5EPMB 1AIFB 5CZVH 3B2UD 2EH8L 1J7VR 4H0IA 1QRNA 4MLSA 4PY7A 1YQ2A 3LQAH 3S34H 1QSFB 3ARFD 1ITBB 4YK4B 1INEH 2NX5A 1JWUA 1LHZA 3QUML 4QTIL 3SOBL 4I5BA 5CJ5A 1NC4A 1BVKA 1HN1A 2VN7A 3MRPA 2Z8SA 4FQLL 5ITBH 4ELKA 1ND0B 4N1EA 3NOIA 1IAMA 3T04D 3EYFB 1N2RA 1Z3GL 2NXZC 4D0BB 1WGOA 4PJBE 4HIHB 1FLRL 4H5SB 5TF1L 3ARED 4QRQB 5FM5M 2HTKD 3MRNB 3MRGB 1C7SA 3ORJA 1KACB 1AE6L 1MCCA 1KB5B 1MFNA 3NN8B 5H94B 2XKSA 1B0GB 4KKLC 2F5BL 3BZ4A 3H9SB 2V7HA 4OKDA 2X4TA 3SEPA 3NFPA 1WK0A 4YDVB 4WWKD 3GMOA 1ZANH 4X7FC 4NIKB 4S1RH 3FQRB 4LKCB 3WHXA 4UT7H 3STLA 4E5XB 5CSZB 5E99H 4JLRA 4JFXB 1KJMA 1MJJA 4QXWA 2EXWC 4F7PA 2E27L 5C0NC 4OAWB 2J8UB 3QCTL 3MTRA 2DYPA 3WNLA 4UIKL 2VZ3A 3L3HB 1NAKH 4HCRL 3WIIH 2IEPA 1WFNA 3ZL4L 1ED3A 4QHLA 1A2YB 4MD5A 1QBLH 1XZ0A 2QTEA 1CICA 3CMGA 3R0NA 3NBNA 4OF7A 5D1ZA 1N3NB 4DUVA 4FTVB 1UZ8A 2VLKB 3RX5A 4AJ0A 3MYJB 3FONA 3RU8L 3PIQB 3J8F7 1RHHA 3MLXL 4S1DD 4MMZC 2Q3AA 3TNMA 5HI4C 1UB5A 3O3DB 4Y2DD 3KDMA 3B2VL 5E08L 3O4OC 3DV6A 4U1NA 5BO1L 5DSCB 2YHGA 1J0IA 5D9SB 4AMKH 3DLQR 4JVPA 2E9JA 2R0LH 2MTPA 3ABZA 3QXDA 4M4RA 5IEHA 3V5KA 3MGOB 4PJHF 3VXUB 2EDTA 3SE9L 2R9HC 1XF5A 5K59F 1UZ6E 2EO9A 3LPGA 1EEYB 4N0YH 5M7QA 4MDIB 3MLRH 4RSVA 3O2WL 1BWMA 4PJEB 4WFFE 5I1CH 1PY9A 5F1OB 4JZNB 1T2QH 4ONGH 5DWUL 1GAFL 1KTDB 1YEFH 3DX7A 5I8OH 2J88H 2NY0D 2HRPL 3ECBB 3H7BB 4RZCA 4DVRH 2R4RH 5DQDH 1DR9A 3UTTD 3GJFB 4K7PY 2G75A 5MERB 3UAJC 3F7YB 3SDCA 4FG6D 5IF0A 5F9WC 4HX1A 1D9KC 1YY8A 4PD4K 5KTEL 3CFJA 3BUYB 3DMMC 5JUEH 3I3DA 2I5YL 4PJCB 1AGEB 5DRZA 5J11B 5L9DH 2HMID 2E6QA 4QRRB 3S98A 3D3VE 1HEZB 2GJ6E 4CU8A 3O6LL 4PPTA 4OQTL 3QUZB 3VRLE 2JB5H 2MFNA 1MAKA 3EO0A 5ISZD 4WW1B 4JPKL 4PRBB 5EU3B 5HYJB 5JOFA 2DWDA 3RWFB 4XBPA 5IMLB 1MREL 5IVXA 2HFGL 2YPVL 3CVHH 4ZXBC 4EXPX 4KRPD 3DX9B 1IT9L 1RK0B 3C8HA 4R6UA 1AY1H 4Z77A 3B6SB 3O6FB 4JDVB 4BZ1H 5BV7B 5C09A 2FHBA 3I6GA 3KPNB 3PP3H 2AK1H 4D3CH 1NGPH 1IGYB 4DOHB 2BVOA 1N5YL 1CQKA 1UA6L 3V0AC 3H0TA 4HUVA 3INUL 5J1TC 3MYZA 4YBHA 4LPCA 1FFQA 2FEEL 1FZKA 1AQDA 4OGXL 1JF1B 5CEXB 1IGJA 3U0WL 4JHBA 3E2HB 2LVEA 3TV3H 3UYOD 5B39G 1MHEB 2IMNA 5JHLH 3DRQB 4MAUL 4IHOA 3QIWD 4I0PD 2H6PA 2J4WL 1JFQL 5HDLA 2DQUH 1KBGL 3BE1H 4L8BA 4YDLC 2IG2H 1EVTC 2DWEB 4FQJH 3SCMA 2VXSL 3QDAA 3RBSA 3U48A 2JJUA 5E6IB 2B5IB 1QQDB 5C0CB 3BAEL 3IJYB 4G3YL 4J23A 4JQXC 3ZE1E 5JW5B 4FP8H 1A7QL 4NQED 4X6FB 4LPYA 1GGIL 4KGJA 1MY7A 1QYGH 1VEOA 3B9AA 3O41B 1FVDA 5I1GH 4AL8H 2FGWH 2ITDA 1CVSC 1B4JH 2VNCA 4OF5A 4X7TA 3TVMC 5D1XA 3QFJD 1P6FA 3SO3C 1X7QB 1WITA 1I85A 1A4JA 4OZIF 1TJIH 5IG7B 1BX2A 2EDNA 3P30H 4MAYA 1TJGL 3MMEB 1CE1L 4XCEA 5C1MB 3GKWL 3VD9A 3TA3C 3OAUL 4PRAA 1M1SA 5F21B 1MRFH 3AVEA 4D8PB 3NFNB 3AS0A 1DUZB 4NUGH 5FOBA 2WSKA 4LLAA 5ESQA 4PJ5B 1N7MH 2V7NB 1JPTL 1J05A 3QJHB 2CDEB 5HD8C 3HHRB 3QIBD 4WHDA 3T2PA 2K7PA 3PHOA 4RAVA 3QDME 1AR1C 3RDTA 1FIEA 5ANME 5EC2A 4NM8H 2RBLA 2EEAA 1PQZA 1Y0LA 5HYIA 4LK4A 5ICYA 4I0KA 4AK1A 2ADGB 5GGTA 4FXKB 1U95A 3SGJC 1JCKA 1Q9LA 4MB5A 4KK8C 3V4VH 3VWJA 4LMQE 5K9KB 2QR0A 2P5EB 1YMMD 4POYA 1X5JA 3PNWB 2EDQA 3NIDF 3D2UB 4F80A 4YE4H 2APBA 5ALBH 2BP3A 3OF6A 3QCUL 2X41A 4OCSL 2FL5A 4Z76A 1QZ1A 3HAEG 1I7TA 4J3WA 1BHGA 4PGEB 4NZRH 5KOVC 4HPYL 5IIEB 1ZKAA 2PCPB 2I60H 4MQXD 4JN1H 1QFWM 1KXQE 4ZYKB 4HF5H 5EIIA 4KHTH 2FJGB 2FIKB 4IRSD 4BH7B 3L3JB 2H8PB 3PF2A 4F58L 1KC5H 4PJAB 1UWXH 4H1LH 5I9QC 4P46C 4TUJB 5E8DH 4WW2A 3QA3A 3OZ9L 2YUXA 4NOFA 3IJSB 4JO3L 5CCKH 4FA8A 1K5NA 4RWYL 1IGTA 3FOMB 5TE6L 4QRSB 5IW1A 1NEZA 1GPOH 4C56D 3MXVL 2HJKA 4KJPD 3NAAL 4KXZH 4NRZB 6FABH 3P9MB 1CLOL 4G7YL 4UOW1 12E8L 1BZ7A 3CXHJ 5JDSB 2I24N 2XTJE 4RMQA 4NHCH 2DLFH 4FFVC 4TYUA 3IFPB 4AENA 5IVZA 4Q9RH 4XNYL 3CFBA 1ZHKB 1OP3H 1JF6A 3MUJA 1LVEA 4JFPA 4L3ED 2I9TB 2NTFA 1BD2D 5HGDB 1UB6B 3DOSA 3UTSB 3HG1A 4BSWA 4K9EC 5HXMA 2DMKA 3KG5A 4NQCE 4LHUB 2R56H 5FUOL 4LLMB 4FQQA 1LDPH 3CDGB 1T1ZA 1B4RA 2A6KA 4HIXH 3D48R 4OZFB 1UXSA 4X6DA 4TQEH 2BMKB 1S7UA 5CEYA 5TH2B 3FO9A 3KLAA 5KS9F 2P5WE 3O6KH 4RISL 1CL7H 2R15A 3EDEA 5SV4A 3N1MC 4Q58C 3O4OB 1A3RH 3L1OH 1LE9B 1I1YB 4MNHA 1I3RB 1P7HL 4APQB 4Z78A 4CVUA 2NW3B 1A3QA 3S6CA 2BNQD 2A83B 3EHBC 2AI0L 1Q9WA 4NJAH 3EO1B 2V6HA 1QRND 3QCVH 1J0YA 4K94H 4ZUWB 1N6UA 4UBDC 4M61A 3WLBA 3VD3A 1NC4D 4OGYL 3ZKQD 1H5BA 1WISA 1WZLA 4Y1AE 3T08A 1TFHA 3C9NB 4ZUUB 5E2TL 5MP6L 2BVQB 1H3TA 3NTCH 4MD4B 2ITCA 2NZIA 3EW3B 3QO1A 5EZOH 1ZHLA 3CLEH 3F65A 5C9JA 3HE6B 5D5MA 5IBTH 3FO2B 1KGCD 3TJEL 3VMPA 3EOYG 1NAMH 4G8EB 3N9GL 4DKDC 3CPLA 3CFKB 1D9KB 1MCHA 3GDBA 4KDTA 3VI4F 3V6OA 1HQRB 5DVOA 3ZYZA 4G8GE 1U8NB 3N0PB 3QI9C 4FQ2L 4WWID 4R0LC 3ZYJA 3OQ3B 3SJVB 1YEIL 3DYMA 1BFOA 1U41A 3X14B 4Z7VA 4M8QB 5ILTH 2COQA 3ISWA 3VFSA 1T7ZA 3LV3B 5D7JC 5IROC 1VFAB 1LEIA 4IIQA 2VXQH 5JIKA 2A6JB 4IOIB 1JPFB 3V5HA 1F4XH 2MHAB 2Y07L 2NY5H 1T0NA 3U0PB 1IKFL 3PQYB 4EUPB 3AB0C 3QG6B 3ULUH 4YXKH 4ZAKC 4HIJB 5A1AA 1FFPA 4LIQE 2CJUH 3ES6B 4LVHB 4F9PC 5C7XL 1FO0B 2WBJC 4OD1H 3O11A 2H2SC 3UJTL 2HKHL 5EC1A 4HJGA 5IT2H 5BMFH 1RK1A 5DD6A 1EFQA 4R4ND 4B5EA 2XKNA 3GMMB 4WI7A 4NFBA 3RPKA 4KJYB 2IPTH 4G9FE 5EU7E 2DLGA 4M62L