5DMKB

Crystal structure of iag7 in complex with rlgl-we14
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
212
structure length
190
Chain Sequence
SRLGLWSRMDQLERHFVHQFKGECYFTNGTQRIRLVTRYIYNREEYLRFDSDVGEYRAVTELGRHSAEYYNKQYLERTRAELDTACRHNYEETEVPTSLRRLEQPNVAISLSHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPHQGEVYTCHVEHPSLKSPITVEWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class II histocompatibility antigen, A-D alpha chain
publication title N-terminal additions to the WE14 peptide of chromogranin A create strong autoantigen agonists in type 1 diabetes.
pubmed doi rcsb
source organism Mus musculus
total genus 41
structure length 190
sequence length 212
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2015-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dmkB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5dmkB01
4NGHL 3RY6C 1AY1L 4MNQD 4RCAA 1YA5A 2VZ1A 1VFOA 3Q5YA 2KUTA 1VADB 2ORBH 1RIHL 2X89D 4GAJL 4NN7B 3TYGH 5I16A 5FFLA 4EDXA 1FE8L 4JPIA 1ACYL 4Y1AA 2BVOA 5HYJE 5MEPA 1X5ZA 1MREH 3C9NB 4NPYA 1FNGB 1MEXL 5FYLL 5ADPH 4MA3B 2HFGH 3IFNL 5B38B 4K23L 5IB4A 1QFHA 3FHAA 4XBGB 5C0DB 3UTOA 1I9JL 1RUPL 1N64H 2Z8VC 5I76B 2X4QA 3VWKC 3OB8A 4X4ZA 2I60H 2XA3A 3H7BB 4RX4D 5DK0B 4U1KB 2Z31C 3OKOB 4MA7L 4PGJA 2XACC 4OLXH 1PX3A 4AM0A 4G7YH 2VXUH 3JWNC 2P7TB 8FABA 5ADOH 4KI5E 1SJXA 4RISL 4JGUA 1Q9WB 2AXHA 2DS4A 3HFML 4Q74A 2GCYB 5JW3H 5LQBH 1FGNH 1KJMA 5DD3H 5L8JB 4YHMH 3DETD 2L7UA 4WWID 1BVLA 1T7ZA 1QNZL 3VD3A 3WKMH 1I8LC 1HILA 3PJSA 1HWGB 2DMKA 1BOGB 1WFUA 5IQ9A 1P9MA 4ONHB 5FYJL 4U49A 2DKUA 3ARFD 5E99L 2DLEA 5DRZB 3NFPB 1NGZA 4PJDF 5EC2A 3L5HA 1IKFH 5HYQA 2GEEA 2IPKB 4YEEA 5FYLE 2NX5B 3H9SE 4P48A 1DL7H 4R4BB 3N0PB 4PRHE 3W2DH 3HMXL 5E6IA 3MLUL 2JK5A 4XC1H 1QD0A 2DBLH 3TZVC 4G6JL 3ARGA 4L4VD 4J4PD 5C2BL 3EYFB 5IWLC 3MODL 4PJ5B 3T08A 3E6HB 3BPLB 5CSBA 5F7DA 1JMXA 2Z35B 4XPBH 2VLRB 3DUUB 3LEVL 3EGSA 2AABH 5F7FA 1MH5B 4IDJL 3GMOB 2FH6A 2QR0A 5INDB 1YJDL 4MAYB 4ODVH 4QGTA 2QTEA 5AAMA 1IGCH 1VENA 4FFWD 1ZVSB 4Y4KB 3CFJA 1A9EB 4KK6D 1Q94A 2B8OT 4JFQA 2AJVH 5DFTA 1U0QA 3E6FA 1XF5A 5E9DE 2WW8A 3V6OA 2VDKH 4J3TA 3RVVC 1IAIM 1CGXA 1FLTX 2C9AA 5GS1A 2EO9A 4DKFL 4YXKL 3RWIA 4B7LA 1UM6L 3WXVH 3MLPA 3Q5TA 4UT6H 5EU6B 5F96H 5JXED 2CXGA 5J13B 3ZKQD 4NJ9H 1UA6H 4O4YL 4P4KA 5BRZE 4EEEA 1ZXQA 5DVKA 4WHDA 4C4KO 2FO4B 4P3CL 2YPKB 4P2OB 1ZT4A 5EO0A 4L4TD 1H8OA 4K3DL 2GITA 1OP5H 2NY0B 2HTKC 4HD9A 1UADC 4KKAD 1BMGA 1MY5A 1B0WA 3QB7C 2V2TB 2AEPL 1SJHA 3EO9L 4NYLB 2FR4B 4XP1H 3E0GA 2X09A 3QCTH 1QSFB 3GSVB 3MA9L 5JDSA 1A9BB 4Y19B 1UFUA 1EVUA 1NUFA 3G5YA 4TSAL 4WEBH 3FTGB 3IDGA 3HHRB 3HE6B 4NKIL 3DSNA 4RRPA 4XP4L 5AYUH 4M5YH 1YNTA 5IF0A 3GHBH 4PJGB 2IPTL 3SDYH 4AENA 1F3JA 3EOAA 2APVA 2A83A 4ZOBA 5B38G 3BYTA 3M17B 1JI2A 2F5AL 3WN5B 1HH6B 3QA3A 4XNQA 1I9EA 4MD0B 3TN0A 4PJAE 4YX2L 1HNFA 5GQBA 4OQTL 5FO8A 4U6TA 2VDLL 4RGNB 3WFCL 2X7LB 4KK5D 2Q20A 2Z91B 1J1OL 3FJTA 2NTSP 5CKGA 4MWFB 3ZYOA 2GJZB 3STZB 3FO2B 3KPRA 2VDML 3NCJH 5A2LH 2D3VA 4O58L 3KYOB 4F7EA 1E4WL 5KS9B 3UJTH 1N3NB 2EDKA 3MLRH 5HGBB 5FAAA 2W0LA 4F7TB 4GRWH 1EO8H 2XZAL 4PJFE 2FL5A 2C7UB 3CXHK 5DS8A 5C9JB 1CFSA 4UTBH 2IC2A 2NY3B 4LCWB 3ZE2F 1HIML 5ENWA 1GVIA 1CFTB 1F58H 4DGIH 2XN9B 3ALXA 1NKRA 1SEQL 1W8NA 1QEWA 3T0EB 2IMMA 3L5IA 4N0UB 5IVZB 3B9KB 1OSZB 5JW4Q 1OLLA 3VWKD 1EO7A 1JPSH 2QADB 4LVHC 2DIAA 3QIBC 1T6VN 5MI0C 1U8QB 2Z31D 5C0FB 1WTGT 1FZKA 1GZQB 3QIUC 4JFFB 1DLFL 3S35H 1YDPA 2GSGB 4OGAC 2BK8A 1P4IL 4WO4D 1JVKA 4LP4A 1GSMA 3SDDB 3ZE1E 1N0XL 2D4DA 2JKXA 2Q3AA 3JUZA 3L9RA 5GHWL 5D6DA 3H9HB 2NY5C 2V2WB 1IILE 2P8LB 2HAZA 1H15B 1HHGB 4LASH 3F12B 2E7MA 4NC1C 2I9TB 4IM8A 1ZA6B 3VXUD 4ZAKA 3W0WB 4WJ5A 5C9KA 4CRPA 5GRUL 4YGVB 2GAZB 4XPFL 3I6KB 2UVFA 3IAGC 4GKSA 2OX5A 4D3CL 4YE4H 2R23B 3RHWF 3HE7D 2GJ6D 4UT9H 5FECB 3ZYIA 5DK2A 1S8DB 2Y5TA 5I1CL 3DI2B 4EDWL 3V2AR 2EDQA 5EBLB 4YFLF 1MRCH 1JWSB 3LPWA 3PGCB 3FOLA 1Z3GH 5T1MB 5GIRB 4NQDE 1O5DT 1KJ2B 1KPUB 3FQNB 2C3XA 1UVQB 3TZVD 3OJDA 1FBIL 4JN1L 5C0AD 4XNUH 5LCVL 4GRLB 4TTGA 4GW4B 1PLGH 4I2XB 1MHEA 3TO4D 3WNNA 5TQ0L 2BDNL 3LKNB 1ZGLA 4Y1AE 5B8CB 1EHLL 1YMMB 4ZG1A 2DYPD 5CCKH 3KR3L 1ETZB 2W1NA 4OCWH 1G7HA 2NY1B 2MNUA 3D69A 4CDHA 1RULL 4NN5B 1ITBB 2B2XH 4GMSH 5FKPB 4IJ3C 4OM0L 3D85B 4H1LB 4U6VH 3ZMRA 1OQXA 1X4YA 4HKBA 1PAMA 3RVVD 3WS3B 3D0LA 4FQHA 4AIZA 1BIIB 1LK2B 1EA9C 3QJFA 4H26B 4LSVH 4IRSC 3F7YA 1LEGA 4FZEL 4L5FL 2O26U 2EICA 4QOKA 1U8MB 4M48L 2FH8A 2VJXA 3JBG7 3HNVH 4GW5A 2VH5L 3I9GL 3GSOB 4QRSA 4ZFFA 2OCFD 1JF6A 5BS0B 5F88A 4RFOL 2Y7QB 4MQ7B 1IGTB 2YS4A 2LAGB 1R3HB 4LLMB 2BJMH 3WL9A 4F33B 1MJUL 3QUMH 1W0VB 3EYOB 2F8VA 3OKMB 3H3KA 4UDUA 1BM3L 3CDGA 1CD1A 4M43L 3U46B 4JQXA 5FA4A 4C57C 1AGCA 4FQ1L 4KPHH 4NQSB 1MCOL 2ZOKB 4TOYL 1UCTA 2Y6SC 2VABB 1CICC 1MFBL 3VFMA 3P0YL 3QP3A 2A6DA 3FN0L 4ODSH 5IBTL 2IQ9H 1K8IA 4XPTH 1L9MA 3ZO0A 3SQBA 5D71H 4F9PA 1DQQA 4BQBA 5E8PB 1KB9K 1A1OA 1FC1A 1CN4A 3C8HA 3VXTB 4O2EA 1ZANH 1RZ7L 3V7AG 5GRVL 4J12A 1S7WA 1UG9A 4O00A 4U6YB 1K9TA 1PDKA 3IFLL 4XGZA 1LO4L 3C6SA 5F1NB 3A0OA 1F45A 5FUCE 3R1GL 4AT6A 4XXCC 1FDLL 3O3UN 2HFFA 2LTQB 2EYRA 1IEAA 4R4FL 4NZRL 1KNOB 3HC3L 3DTXB 1J10A 3O11A 5IGXL 1CDUA 3P4NA 3WFHB 2HVKA 2JTDA 5CBEB 3S9DB 4XNXH 4OLUL 1E27A 4S0TD 3L7EB 5GJSL 3V6OE 2VC2H 4L29A 3RZCA 3RNQA 1GCFA 2CKNA 1QLRA 1T5WA 1JYXA 2VKXA 4WUUA 3QHFL 4ZXBD 1I4FB 4JQVA 1IM3A 5D96B 4CDGC 5J0BA 2WP3O 4ONGH 3CXHJ 3GSQA 5CBAA 2WBJB 3CMGA 3TBSA 4L3AA 1I1FB 2D0FA 1HCFX 3PXHA 3CFCL 3I85A 5CS7A 4ZUWB 1TZHB 5LXGH 3QIBD 1J0IA 3WFDL 1NGPL 1OF2B 2VWEE 2X89A 4FXKB 3OKYA 2RIKA 1JJUA 2X4PA 4GH7B 1E28A 4PRNA 1T0NB 4JE4B 1E6JH 2WANA 4J23A 3MLXL 1L9NA 3MRKA 2ICWA 4MD5B 3EYSL 4P5KB 1RI8A 1RUAL 5FK9A 2WIIA 4I0PB 4P5MA 5CEZD 4YHOH 3CZJA 4X7TB 1WZ1L 4QRUA 1UKQA 5I15H 4RX4A 3VI4F 3O4OC 4H1LG 4LKXB 4OBRA 4F37K 1QRKA 2UUDH 3SKNB 5IM7B 4WFFE 1M7IA 1NMCB 1QFPA 1HOCA 2HVJB 3QEHB 5ALCL 2ADJB 3B2UD 1MNUL 4JRYD 2R1YB 1F4AA 1EUTA 3IGAB 4FTVA 1U58A 5E1AA 3MLYH 3KPNA 3BISA 3ARBB 1DVFB 5D7SL 2EYTA 4K8RC 5D2LB 1U91B 4YHNB 1CBVL 5KAQG 3I6LE 2DI9A 3KPRE 1FRGL 5DMYA 1GC1H 4TPRL 5HHMB 1FGVH 5I1HH 4LRNL 3KLAA 4HHAB 4KUZH 4QRQA 4YBLB 1T1WA 3QIWA 1JGVH 5T3ZD 5I66A 2B4CH 4PY7B 3GGWB 3QQ3A 1F5WA 5E00A 1NL0L 4NHCL 3U7YL 4D0CA 3QXTA 3QFJD 4N90D 3UPRA 1O7SA 3G6AB 3TBTB 4YBQC 4ODHH 1FZMA 1UXWA 3IDIB 4AYFA 4EI5A 4L4VA 4J4PA 4PB9H 3ULUC 1RHHA 5EIIA 1QR1A 4X7DC 4DTGL 2O61B 1KCVH 1ONQB 3SOBL 1C1EL 4JHZA 3HZYB 5A1AA 1PX4A 1KJ2H 5AWNL 5AYQA 3RIFF 3KJ6L 1FN4B 4KRPD 3KNBB 1UQSB 4WENB 2M8XA 3CZFA 4CVXA 5DRWA 5AZEL 1AXSB 3C5SA 2CLRB 1BHGA 3IJSB 1Z5LB 2BHUA 4JJ5A 2Y06L 3D2UB 3O6LH 5FM5O 5FV1L 2H6PA 2LE9A 2Y9RT 5I1AA 1U8KB 3DX7B 5GSVA 4FQCH 3CFEB 2FYYB 1MPAL 3L5WB 4R96A 5DJ8A 4F80A 5C0GB 3CVIL 5D1XA 2Y6SD 4H1LH 1CICD 4HT1H 4BFIB 1R3KB 2IG2H 3M45A 5DEGA 1WEJH 2VDOL 4YDIH 3MACH 1FYTA 3RWEB 3P77A 1QRNB 1DJSA 4KROB 2HTLC 4PRPD 1IGIH 1I3UA 1NFDA 1E4KC 4ONFL 1KTDB 4DQOL 4R97B 4JPKL 3K1KC 1KELL 3CVHA 3MLWL 4LARL 5I18L 5L0QC 1FVEA 2BMKB 4U1GB 4AK1A 3I3EA 1GHFL 4ODXB 5C0RH 2IAMC 4P57B 4W81A 1VEOA 3IDYB 4LPCA 1MF2H 4JAMA 5DTFA 1TZIA 3UBXA 3BAEH 4ZUSB 1DUYA 3AAZB 5KSBB 1CGVA 4DFIA 4JPWH 4FQIL 1JPFA 4HWBH 1CS6A 3KPPB 4OCRH 5DMJB 4ZPTA 3MYZA 2FJHA 3RAJH 2WSKA 4UIMA 1YEIH 3D25B 3WNLA 2X70A 4XZUB 1PKQA 1P1ZA 3C8KB 2DQJL 2YZ8A 4DUWA 5C6PB 1S7QB 1JCKA 2FRGP 4R2GB 1FFPB 4N9OB 5JW4M 2O93L 3JV6A 5F1OB 4J6RL 3BZFB 4N8CL 3QUXA 1QLFB 3QUYA 4Y5YB 1HI6B 4LHJB 1XCQB 4IRZL 2VXTH 3S34H 4P9HL 4QOKE 1FVCA 4Y2DC 1KBGL 3QQ4A 5JORB 3BH9A 4K94L 2ZOLB 1XGPB 1XF4A 4Y5XA 5AUMB 2NW2B 4NKQB 2AS5M 3S8WA 3I6GA 3ZTNL 2VDPH 1NDGB 1N7ML 1N59B 3L3IA 1AR1C 2X44D 3GMMA 2ZCKL 3F62A 2CK0H 5F1KC 4YDJA 2DQGL 1UWEL 3ZHKA 1A6VH 3MC0A 1T3FA 4U0QB 3T4AA 2VLJD 3MCLH 2DAVA 2XV6B 2DDQL 4Z0BL 5CGTA 2XTJC 4NRXB 2IALA 3PIQB 1T21A 3LMJH 2FWOA 4XCNA 3IETA 4I18B 3L1OH 3VWKA 5F7KC 3E2HC 3BXNA 1MELA 2IGFL 2GY7B 3N50A 5TF1H 3L3KB 2J88H 4JO3H 3F7RA 3EYVA 4JQIL 1K4DB 4OZFA 4RFNB 3O2VH 4IOIA 4MMZC 1BGXL 1OW0C 4XXDA 4JM4H 4UIKH 4Y4HC 5IQ7L 4PJFF 4ETQA 3GJFH 5CZVL 4PREA 4HUMB 2IMNA 2V5TA 4GUPB 3N85L 3UXFA 1N6QH 4X6EA 3QEUA 1A7PL 4K8RD 5GRXG 5C86A 2H2PC 3ECBA 2BNQB 1S7VA 3O3AB 4XVSH 4BZ2H 4K9EL 1HWHB 3DO7B 1IEBB 3GIVA 5DK3A 1KCSL 1QFWI 1H3PH 4WUUE 1HK6A 4KV5E 1A6ZA 5JNYA 3HC0B 2OSLA 5FCUH 1LILA 2NY6B 5E6ZA 1KACB 5TE4L 2PR4H 3QPXL 5DRXB 2MQ3A 3T2NL 1NCNA 1FHGA 3OKDA 4H88H 3ZE1F 3RDTD 1LWRA 1MFEH 4R9HA 4NOBA 2Q6WB 3RL2B 3GRWA 5C0AA 3ULUD 5E56A 3PGFH 4N8PA 5IWLA 1XGUB 3NAAH 3VFOB 3LKPA 3QJHA 2IANB 4P99A 1SY6L 3LQAL 5FYKH 4ALAL 1A64A 3P9MA 4X6CA 4QY8A 3G6JA 5IB3A 1H5BB 2DYPA 3RU8L 4OF0A 5ESAB 5GZOC 4JHBA 3VI3E 3MJ9L 5IEKA 4BM7A 1FFQA 1YY8A 4MXVE 3BUTA 1V05A 5D93B 3OMZA 1JMZA 2A1WL 5K9JL 1NCAL 4QT5A 3DSFH 4HULB 3BHBB 3FOMA 1F11A 1BF2A 3Q1SH 4KGLA 5DJYB 2R8SH 4L3EA 3FO9B 1J18A 4A6YL 4YFDB 2D7TL 4KKBC 3DV6A 4P2RD 3RX7A 1CG9A 2VL5A 4J7RA 1D5BB 2ZKHL 4QTIH 4JKWA 1NCBH 4JZOA 3PP3H 3T77B 1WK0A 5MEQB 2ARJQ 1RUMH 2O5YL 3FRUA 2IEPA 5FGBC 4FFVC 3WEXA 4G6AC 1W72A 3BMWA 4FTVE 2HTLD 1FP5A 4DZ8A 1NCCH 3TT1H 4L8BA 4XCCL 3RWHA 3ZDXE 3BP7A 1QO3A 2C3GA 4RGMB 1J8HD 2APFA 4PRAB 4CVZB 2IAMD 2XZQL 1NBZB 4NBZB 5EA0H 5I6XB 2OTUB 5FA3A 3ZL4L 1EGJH 4J3WA 3FFDA 1M05A 1JGDA 3HS0B 4MQSB 3KWWB 3GMLB 3S96B 1HZHH 5HYSA 1BVKA 5DJDB 4HUXB 4PJCB 3ZDZE 1OTSC 1S9WA 3RPIB 3QXDB 1A6UH 5E5MA 2C3WA 5HDQL 4L4VE 4XPAH 5J11C 2ZP0T 1DE4A 1INEL 1JYVA 3RWJB 2FEEL 1CZ8L 3V5DA 1KN4H 2F54D 3RTQC 4GAGH 4XNYL 2C3HA 4PTUB 4Y2DD 3VXSB 2JJWA 5D7JC 1RFDH 1ZLVK 4KAQH 1IAOB 1IJ9A 1Y6MR 3RRQA 4FNLH 2C1OA 3MJ7A 4NKOB 4HF5L 1BIHA 1OARH 4G6MH 3TT3H 1JV5A 3QRGH 4WFGE 1AR1D 1ZVYA 2VITB 1J5OH 3BKJL 2H3NB 5HYJB 3MO1B 4D9QD 1I7TA 5F6HI 3VXUB 4EI6A 1QKZL 1EZVX 4EN3C 2P5WA 2AK4E 1A0QL 4ZSOB 3NIGE 2YRZA 4UBDC 4NO5A 1UB6A 4XP9L 2XTJD 2LU7A 1MHHB 1LHZA 1FYTE 2QQNH 4S10A 4JCLA 3RGVD 3OPZL 1X5GA 3ZKNC 1UZ6E 4Q9QH 4YQXH 5I1DB 1NFDE 3QIBA 4QHUA 1G9NC 1P7KB 4JHAL 3C6LC 3MLTA 4RMQA 2VXVL 3QIUA 3C60B 2ZUXA 5HJ3A 4C83A 3HMWL 4GJTB 5C07B 4NKDB 1IGYA 1KJ3H 3O9WC 4HGKC 4Y4HD 1D5ZB 4LQFH 4QXTB 1WBZB 1IRAY 4PS4L 4I3RL 2DLGA 5EUOA 3UYPA 5MEND 5KVDH 1D5IL 1QFWH 1U8OB 1G7LB 1XGTB 3E3QE 4R3SB 5DMGC 2V7HB 1A7NL 1PKQE 2MHAA 5IHLB 1I75A 4R7NA 1EXUB 1IAMA 2DTSA 2J7LA 2P49B 4PJ8B 1LQSR 2BC4A 4HUUA 1JNNL 4I5BA 1PG7X 1UGNA 1X6NA 4X0KA 4BQ8A 4OKVA 4ZUUB 1DN0B 5IESH 3HKFA 3C2SA 1GH7A 3N1MC 2EH7H 2X4OB 1IL1A 4OSUH 2FEDC 4HK0B 2HFEA 1MHPH 4WU7A 5ILTH 1A6AA 3BP5B 2N1KA 4PP1C 4YR6A 5EDXA 1NC4A 1QBMH 4F7PB 3QUZC 4RQQA 3BKML 2EC9T 3K2MC 4RAUA 3VH8A 4HIEA 5L88H 3S5LA 4ZPVB 3STLB 3DUSB 4PJBA 4M9PA 2WAHA 2ZNXA 1V3KA 4YO0A 2V5SA 3CJJA 5F7EL 2OTWB 3IF1A 3UJJL 4ZTOL 5GJTH 3D6GA 1VA9A 4KVNL 4WGVB 4DK3A 1MY7A 4PGCA 3QEGL 1XT5A 3SE9L 5T5FH 3X3GH 2X9XA 5CJQL 2DKSA 3B43A 3GRWL 3WFBL 2A73A 3AU1A 4XP5H 3S88H 4DEPB 1PSKL 3BQUB 4P46B 1UJ3C 5L9DH 4KKBD 1T22A 1VKXB 1MHCA 4IRSA 2R15A 1SYSB 3MRJB 3TIDA 1GGCL 3D87B 5IB2A 4KRMB 4WHYH 1VDGA 3LAFA 3U0WL 3VW3L 2XFXB 4HLZG 2YD7A 5F97E 4JG0L 3B5GA 3L7FB 4P3WA 3RL1A 3UC0L 3AREC 1ERNA 5DGRA 3C2AL 3O6FB 4ZFGH 5ETUB 5E8OB 3CVHH 1D6VL 3TVMA 2P4AB 4LBEA 3T2QA 3DI3B 3DRQB 1LP9A 2IFFH 1F6AA 1DSFL 1P4BL 4UU9A 4XCFH 1YEFL 3HC4L 1CICA 2K7PA 2HT4C 1NFKA 5E5UB 3PG2A 5IMLB 4OI9A 5IVXA 3KPQA 3O2WH 1UM5L 3BW9B 3FMGL 3RVUC 1OPGH 4X80L 3I3BA 4JRXD 3GJEB 3LKQB 3U79A 4PRPA 3F7VA 3SY0A 1OTSD 4QYOB 2FIKA 12E8H 5E70A 5E8NA 2Y07L 3NGBB 5C0AE 1L7IH 4C56A 4CMMB 4F15B 1GZPA 2BNUA 3ARVA 2UWEB 3REVB 4PJAB 3FT2A 2E9IA 5GRJH 4JFYB 4HXBH 2JJTC 3OB0H 4LSUL 1U8JB 2DWDA 3BVNB 1OP3K 3UTPD 4LLWB 2IBGA 4X6CE 5D7JD 4U2ZA 3G6JE 2R1WA 2WLZA 4M7ZC 4PV8A 4HUKB 3SQOL 3EUUA 4X7FC 5I17A 3DMMC 1W0YT 3MZGB 3V4PL 4HS8L 4PGDB 5ERWA 3OZ9L 2WZPD 1OAXH 2YPLD 3PL6B 4RZCB 5IB1B 4QRRA 1A3QA 1AI1L 4UDTA 5GZNC 4ZTPH 1IC4L 2EKSB 3VFPA 1K6QH 3MOQA 3FO1A 3UCRA 2P1YA 5D9SA 4L3EE 1B4JL 5DYOA 1F3DJ 1MJJB 2P43B 2BXZA 2HH0L 3PWPB 1TCRA 5C3LD 2VLKB 3CDFA 1EUUA 1I1RA 1ORQB 4N5ED 4EUPB 4EXPX 4FQXC 4MXWL 4UBDD 2R4RH 5DMIL 3LN4A 3J8F7 3B2VL 3REWB 3LDBC 4D9LH 1EEYB 2CDFA 3LEYH 6FABL 3ZKND 4AJ0A 1DQMH 5JHLH 5DD5L 1NCTA 1X5LA 2W91A 3O3EA 5CLWA 3QCVH 4YHIB 4HPYL 5I30L 4OZFH 4NJAH 1LK3H 1LEIB 3ZHDA 3D18B 1JBJA 1NGWB 1HHKB 1Q9LA 4U6HB 3TNMA 4XB8A 2VLJA 4TUJA 1C7SA 3MXVH 4S1SL 5DUBA 1XF2B 3GSUB 4QNPE 3QO0B 4NO2A 3BO8B 1JHKL 1RK0A 3HTLX 1GAFH 2XQYK 4XBEL 3WNOA 4G43B 3CSGA 1D9KB 4TQEL 1HNGA 2NTFA 1IGMH 1R3JA 2DQFB 43C9B 4FQPA 4L9DA 4OF7A 4XVJL 3MFFB 1LEKB 2AJ3A 2A0LC 1RZIA 4LSSH 3PNWB 5EO1A 2AEQH 2J12B 4HGWA 1SYVB 1YECH 3DARA 3GSWB 4N1CA 5D7KE 2NW3A 4LGRB 4CMHB 4EOWH 4PP2A 4U05A 2CRYA 4EBQL 1WLHA 2DL2A 3LVEA 1KIPB 1NC2B 1Z2KA 1YMHA 4N0FA 2FEDD 3T0BA 4C55A 3T0DA 5CSZB 1WIUA 1IT9H 5DC9B 2VDNL 2MWCA 4ZO9A 3JZ7A 1LD9A 3LY6A 4NDMB 3QUZD 5L2KB 4BUHA 5I16B 5IIEB 4JPIB 4Y1AB 2F53D 4HZLA 5MEPB 3QXVA 1CXIA 4X5WA 5KVGL 4APQC 1FL5A 1R3LA 1R5VA 4K07A 4MA1B 4YHYC 3GMQA 1CT8A 5JUEH 2MTPA 1OTUC 4XPHL 2P5WE 1D5XA 4PFEA 2GTWA 1TVBB 5T1LB 5IB4B 3ZKMD 1P6FA 3MREB 3QDAA 2DLHA 1PZUB 2X41A 4OLWL 1ACYH 4BH7B 2X4QB 1OTTC 2Q1EA 5IMKA 3U4BH 5H2BB 4HK3J 1P7QD 3VFSA 3WD5L 2Y36L 2E8ZA 3VA2C 5HGAB 2OZ4A 1RUPH 3PUCA 4JY5L 5BMFL 4LCYA 5BQ7A 2RQ8A 8FABB 2ESVA 1P2CA 2ARWA 1XGYL 2Y4SA 3FQUA 4NC2B 4Y4FD 7CGTA 3EZ8A 4GS7B 5EN2A 1W72H 4KV5F 2A9ML 1GGIL 4LIQL 1A14L 5D72L 5EUOE 4HMCA 4BK5A 4HJGA 4NC1E 5SV4A 5CEZE 4GW1A 1F42A 1HILB 2VN4A 5I71B 1G7MA 4UV7H 1YPZA 2B1AL 3KDMA 5C0CA 4E0RB 1PGRB 3AMKA 3QDGA 5JXAL 5EZJB 4R8WL 5I75B 1MUJA 4YDLB 5JOFA 1NGZB 4JB9H 5EC2B 1BQSA 2ZPKL 2HT4D 1I1AD 5B4MC 5E8DH 1CQKA 1QNZH 2H32A 1NH6A 3ALWA 5E6IB 1UM4H 2R1XB 2JK5B 5E99H 1FNEA 1KPRB 4PR5A 3TH2T 3AM8C 3VI3F 4LSPH 5KSVA 1E4KA 4TUKL 4EUPG 1ZHLA 4MXVF 3DX6A 3ESVF 5F9AC 5CEYB 4RMWA 4PRBB 2HJKA 1Y0LB 4QHMA 4M5ZL 5K9OB 1D7FA 1N5YL 4TVPD 3EGSB 1LO2L 2QR0B 4PJBE 2HP4A 4Z76B 1G84A 3FB8A 3IDMA 4JEGB 2CIIB 3CFJB 1CE6A 3U36A 1Q94B 3MODH 4JFQB 3DMMD 2BVQA 4R90L 4JFEB 1L4IA 3MNVB 4OM1H 2H1PL 3E6FB 4OB5H 5ITBH 1DP0A 3BDYL 4LIQE 5CUSH 3EOBA 4N5UA 1U3ZA 1YJDH 4U1JA 5FIEA 5E2WL 4OV5A 4E41A 2IQAA 4OLZL 3RWIB 2PTVA 3S36H 2GI7A 3FQXB 2F54A 2LAAA 3OKNB 2P5ED 4HG4J 4JDZA 2J4WL 4Y2DA 1NLBL 4YXHL 4L8DA 4P4KB 1PBYA 1S78C 2B1HL 3BDXA 3CFKB 3B5TA 3PABA 2VXSL 3MV8B 1E4XL 3V6FB 4KVCL 4GMTH 3P4MA 3DUHA 1M7XA 1F4YL 1UM6H 2GITB 4KTEH 4G8EA 5FGSA 5GGRY 1BFSA 1O0VA 1BBDL 1VSCA 5DO2C 5FYKU 1T03H 1SJHB 4O4YH 5D5MB 4H25A 2QSVA 4NSKB 3ZDZF 1UZ8B 1LP9E 3CSPA 3VFWA 2YN3A 5J8OA 3WYRA 1KTLA 3MRQA 5BV7H 3IDGB 3TJHD 2CRMA 5DEZA 1T1ZB 5JLZA 5IVXE 2OJEA 2WINA 3O41B 2Z4QA 5DZLA 5CEZH 1I8KA 2NXZD 3GUTA 3OBAA 4PRPE 2A6KA 4HBCL 1X4XA 3EOAB 1DFBL 4UT7L 3VG0H 4FFYL 3WJJC 5A40E 5HHQA 5A2FA 1CFQB 2VMFA 1J0YA 1DEDA 4XP4H 4C56E 3GMPA 1OW0A 1OAUH 1KLGA 5CWSB 3B6SA 4Y4HA 1FPTH 2G9HA 1U93B 4NHUA 3TO2B 3MRHA 1MWAL 2YMXL 3RVXC 3VXMD 3GSXA 5DHVA 2YEZA 3H9YA 2F9BT 1I3GL 4X98A 2NY4B 3P9WB 2VR9A 3HZVA 5KOVC 2AV1B 4HUWA 1RURH 1RJLA 1JI1A 3C09B 3NIGF 3QEQD 5F7HA 1LGVA 1VHPA 4K3EL 2YHGA 3UJIH 3KXFD 4HEPG 4QRRE 3WFCH 5C7XL 4AEHL 3UTSA 2DQTL 4LSRH 2IADB 3MRPA 5EU5A 3W11C 2MSPA 2FL5B 5T3ZH 2FLRT 3QFDB 5HVFB 1UZ6F 5DS8B 3BH8B 1CFSB 1NFDF 5JHDA 4KJYA 4ZOCA 1WBXA 4U1LA 1FAKT 5I8OL 3U30C 1UCBH 5H94A 4E5XB 4M8QA 5I1IL 1FCGA 1C7TA 4HGMA 3AC0A 3Q6FB 5I1GH 1FFOB 3S3JA 5A2JH 4JZNA 3VD7A 1OTTD 1VFBA 2X1PA 3QDJD 3TEUA 1Z0MA 4LSDA 3KVQA 1AD0B 3ULSA 1FZKB 4MNHA 5LG1A 4HUVA 2I9LA 3DWTA 1YDPB 3H2WA 4Z8FL 5IROC 1SEQH 3RJDA 4WWKC 2KQMA 4CAGA 1ZGLP 2OP4L 3LH2L 4YH6A 3GB7A 4NKMA 5ICYA 5HGHA 2VLJE 3L9RB 1J86A 1PG7L 1QPPA 1U8HB 3EFDL 5A3ID 1I7RA 2IFGA 1LMKA 3D3VD 4LDEB 1H3GA 3B9AA 4DJMA 1B2WH 4KUCD 1N0XH 2FX7L 1VFUA 1MCHA 3FHQA 3IS0X 5F6IB 5DK2B 3OXRB 3EOTH 2Y5TB 4NM8L 3P30L 3SDAD 2GIYA 1U41A 5B4MD 5GRUH 4OZIB 2YSSA 5SWZB 5FGBA 1YQVL 1QBAA 4WHTA 4KTDL 1QSEB 4N0YH 1DBBH 5HGDA 3LSOA 3OJDB 1S7XB 5HY9B 1N2RB 3QRFM 1DBJH 5LGKA 4AH2B 4U1NA 1DQDL 2AI0L 4HEME 3CMOH 1LO5A 1MHEB 5CINL 1ULVA 1HKLL 1ZGLB 2BOCA 1VFAA 4HXAH 3GDBA 3FQWA 4S2SB 4M7LT 4W70A 5I8KL 1CIUA 4G9DA 1BQHA 2D9QB 5I74C 4HKBB 5A2IH 1TMCB 2HJLB 2HN7A 3OWEA 5TE6H 3KR3H 5DDHB 3D0LB 4XMLH 3ULUE 4RRPG 1CLYL 5IMOA 3ULVL 3SO5A 4JO2L 4JO1H 2Z8WC 4QOKB 1JPGA 2IH3A 3RTQA 3MRMA 1Q9KB 5IUSA 4GW5B 1GXEA 4ZFFB 4XAKE 5TJWK 1WAAA 5D7JA 4NM4L 1S78D 3WBDA 2ESVE 4Y89A 3GBNH 5DFWH 2Q76A 3AB0C 3WL9B 1GGUA 1JGLH 3FCTA 4JGJA 1S7UB 3LN5A 5K9QG 3EDKA 3O3BA 4DW2L 2FX9H 5DO2D 3X11A 1JNHA 1WV7T 1HQ4A 2OL3L 3CDGB 5FA4B 4M3KB 1AGCB 3TV3L 1YPZE 5C0CE 3QDGE 4HWEH 4EN3A 3CCHB 3VFMB 1A2YA 1BEYH 3PHSA 5FGCE 2HWZL 3NZ8A 4HV8A 5CZXC 1MJ7H 3UAJC 3T2OA 2R56H 4MX7A 1K8IB 4M43H 4ZQKB 1QFUL 4FQ1H 1XF3A 3G6JF 1DQQB 5DJ6A 1NKOA 4W68A 2Y1VA 3MROB 3OAZH 4I77H 4YGAB 2DTML 4F2MA 1S7WB 1FAIL 3C6LA 3ES6A 4X4MA 5DSCA 2ADFL 1OM3L 2CRZA 4XGZB 1TITA 4Z77B 3MCKB 1NEZB 2X5PA 4RDQF 4RAHA 4Z7OE 3RBSA 4XWGL 1I8MA 3O9WA 4JY6A 1CR9H 1OT1A 1WSST 3FB5A 3H42L 3RVXD 2HFFB 3W9DA 2GTZA 1TJHL 2D7QA 3GFUA 1BFOA 3O11B 3VFTA 3VG9B 3QXUA 3MLVH 2HJFA 2HVKB 3T3ME 1FNLA 2PW2A 3BUYB 5D1QC 1RJYA 4ESKA 1E27B 4CU7A 3ARTA 4L29B 3RZCB 4HFUH 3RNQB 3W11D 1QLRB 4M7JL 1C08B 4QTHA 4E41E 4NZRH 2LFGA 1Q8MA 7FABH 4J8RA 1WCBA 4JVWA 1BPVA 1IM3B 5ACZA 2F54E 4TULL 4L3CA 1CTNA 1W0WA 3IAPA 5F1SA 4PLNC 2F8XC 4KDVA 3LEXA 1M7DA 5GJSH 3TBSB 4YNYA 1OGAA 4UB0H 4WV1C 3OHXA 5B21A 2XWJA 4QNPF 3QHFH 3QI9C 1YEHH 3MJ8A 4M62L 1CFNA 1I8IB 2OR9L 4DN3L 3FONA 5F3BB 3RVTC 3ULUH 2NYYC 1QOKA 2VUOA 3CH1A 5E4EB 1TJGL 3QUZA 4JFZH 1PQZA 5JO5B 1E28B 2OZ4H 2ICES 4WWKD 3CXDL 2EE9A 4YK4C 1XR9B 3MXWH 1NDMA 2GK0A 4WW2C 1EBPA 4XH2A 4NQCA 2BSTA 2ICWB 3MRKB 1R5IA 4HJJL 4P5MB 1CF8L 3GHEL 3GM8A 5E7FA 3TLRA 2Q86B 1Q1JH 2PO6C 3V6ZB 3FO0H 5C0JB 1ZKAA 1A1NA 2E6PA 2W65A 4M6ML 1UJ3A 1P7QA 4JFXB 2DJSA 3RFZC 1AO7D 1INDH 1OGTA 1RUAH 2BOBA 4L1DA 2BFVL 3KGRA 1B6UA 5L7XH 3SCMC 5J1AA 3LN9A 1M7IB 1HOCB 2V5MA 4WGWB 5EZIH 2OI9C 2UZXB 3IKCA 5DVOA 4FTVB 3VFVB 1OD7A 1U58B 2DLFH 3MFGB 4Y88A 2DB8A 3KPNB 3MGTB 4Z18A 4I9WE 1FL3A 3AREA 1LO0L 1A47A 3ARDC 4HC1A 4OCXL 3O0RL 4I3GA 3MRDA 1I3RA 4IBLT 1JE6A 3MV7D 2OMBA 1RK1A 3QIWB 4LVNB 4BZ1L 1KB5A 2YPLB 3UTSE 1UJTA 5DFVC 4M7KL 4M03A 1ZT1A 5I66B 3WLWC 2O5XH 1MCJA 1EX0A 4YPGA 2H41A 5JHDE 4KY1H 4UAOC 3NFSL 5DEFA 3ARXA 5E00B 4OI7A 4X6FB 1AKJB 4Q9RL 1HXYA 2JELH 3VXRD 4D0CB 3ME0A 2YA1A 4KRNA 4J1UA 3JWOH 2ITCA 3BGAA 4ZYKA 4DGVL 1HHIA 4XMKH 4EI5B 3VRIB 3RWFA 4GRMA 3OKEB 3ARPA 4BKLA 1RHHB 4A6YB 1QR1B 4NHCH 3U7YH 1T80A 2Z92A 4GXUN 5EUOF 5GGTL 3NPSB 4AIXA 1V7MH 3MRIA 3EAKA 3R8QA 4LNRB 2JJTA 4LMQI 4LGPB 4M1DH 2UUDK 3ROOB 3MTRA 4ORGB 2YKLL 2JIXD 2J5LB 4JPVL 3IU3A 3CZFB 2GSIB 4CVXB 2DI8A 5DRWB 3DMMA 5FO7A 2SEBA 1NEZG 3O45B 4LSTH 5DT1L 4RAVA 4NNYB 4JJ5B 4DZBB 1C1EH 5D7LD 4X6BA 2J6EA 3R4DA 5GSRA 1QVOB 3UP1A 1I3VA 5DR5H 5AWNH 1CI5A 5I1AB 1MRFL 5GSVB 3WFEH 4XP6H 4NN7C 5TFSL 3WSQL 5BVJA 5ID1A 5D1XB 2AK4B 1ND0A 4D9RE 4JDTH 4B5EA 5I0DA 1FNHA 4MJIA 4ODWA 4FQXA 1PEZA 2YUWA 5CZXD 3MGOA 2H9GA 1FYTB 3WO3B 3P77B 4KZDL 4PJBF 4YXLH 2PTTA 3TCLA 1RUQL 4U1MA 3CVIH 2NZIA 3WKNA 3DX9B 4BSVB 1DBKL 1A7QH 1B9ZA 4NCC1 4LLQA 4AL8L 2OK0L 1HQRB 4WFHD 5HHPA 5DTFB 1IMHC 3BZ4B 4LU5L 2A9NL 3LS5L 3UBXB 5IOPA 1JYWA 1DUYB 1WFTA 4JPKH 1JPFB 3RPKA 5C6WH 3MLWH 1KELH 6CGTA 1KN2H 3KPSD 4XCYA 3HAEA 4UIMB 3PF2A 4X99B 2X70B 3CLEL 1KG0A 1PKQB 3VXPB 1P1ZB 4X6DA 2YWYA 3B5HA 4LMQE 5E6YA 4G80B 2N4IA 3FT3A 3MYJA 3G08A 1G9NL 1SBSH 1U8LA 1YEJH 2Z93B 3F58L 3U83A 5BJTA 5I1JL 3QUXB 3QUYB 1A3RL 2AJXL 1Z9LA 5GGUA 1MCPL 2GUOA 4OLYH 2NY2B 5KVEH 3IDXL 2W9EH 5FYJU 3QQ4B 4OV6F 2X4RA 3BH9B 3VXMA 5L6YL 4MAUL 1LP9F 3UTPE 3C8DA 4Y5XB 1MCWW 1G1CA 1IVLA 1WAAE 2NQCA 2P8MA 3NCYS 3MV9D 3P73A 3RNKA 3I6GB 1C5DA 2R29L 4P59H 3QEQA 1SM3L 4OD2A 5IVXF 3RVTD 3L3IB 2NYYD 4NNXB 3GMMB 4CVWA 4P9HH 5DURB 1GPOL 4K94H 4GG6A 3O4LD 1MVUB 4PRDB 1KYOK 3HA0A 2DQCH 4APQA 3T4AB 1AFVL 3E8UL 5I73C 2DQHH 2MPAL 2ZUWA 1JNLL 1U6AL 4MAYC 4JFOA 1RZ8A 1KLUA 1BLNA 4P5TB 3VWJB 2IALB 3WFZA 1T21B 1UH4A 1KGCD 2FWOB 3IETB 3DXAD 2PO6D 1KF9B 3CGTA 1CFVH 1EIBA 3EYVB 2GFBA 1V3LA 5I19L 1NEUA 4ZOEA 4X4ME 1MCQA 1OAZL 2XY1A 4IOIB 4J3VA 4FP8L 1LE9B 4X9IA 4XXDB 4MA8L 3VFRA 4KHXH 4ZOAA 1ORSA 3NBNA 4I4WA 5J13C 2WV3A 1WTLA 1YQ2A 4UV4H 2IGFH 5JQ6L 3LZFH 5IHUH 5E8EA 5DMKA 2HKHH 1W8OA 3MRFA 4X6EB 4QXUL 4P2OC 4LLUA 3K7UA 3SJVD 2ZUTA 2EECA 3ARDD 4HKXA 1HSAB 5CIPA 1T2XA 2YD5A 5IQ7H 2NY0C 3IXAA 5FUZH 3MQIA 2L7JA 3MLSL 5K33A 5C09A 3MUGA 1KIRB 5DFVD 4UTAH 5D1ZC 4CADB 4OUUB 1A6ZB 1WFOA 1P4LB 2OSLB 1DN2A 4UQ2B 2ZJSL 4LPVA 2HRPL 3A6CH 4RSVA 4BSJA 4CVUA 2YC1A 2CXKA 3OKDB 3LB6C 4KFZC 4R4NC 3SE8L 1C12A 4W6WB 1OGAE 1XAUA 2BRRL 2G75B 2NZ9C 3AM8A 5TGBB 5EPMB 1JUFB 3M8OH 3U7WH 3LKPB 5TE4H 3QJHB 4BSWB 1GIGL 4GG8B 5JOPD 5T1KD 4KHTL 4PJ9D 3P9MB 1EV2E 3H3PL 4MS8C 4X6CB 4OUOA 1NMBH 1RQ5A 5HXMA 4G9FD 4Y16D 2VRAA 5H35B 2OXGA 4UQ3B 3GJFK 3IAQA 4HIJA 1DDHA 1NLDH 1URLA 4F7MA 4PRID 5IEKB 1DBML 1YY8B 2AJZA 4NQCE 4ODTL 3BD5A 1SY6H 2C1PA 4QT5B 3LQAH 3UBXG 5T1DH 3FOMB 5LJYH 5J12B 3TNNB 4L3EB 3TFKC 2AJYL 5C08A 3DV6B 1PKOA 1AD9A 1C5BH 1BFVL 1NGQL 2ENSA 4XMPL 5DI8B 4JZOB 3BD3A 4ZDHA 2CKBH 3TJEH 2NY3C 1FNSH 2P8PB 3UDWC 2CGRH 3FRUB 1CD8A 3QSKB 5DQJB 5HVWA 1NFIA 4A6YH 2D7TH 2UY6A 1VGEH 2OQJB 3BP6A 3T0EC 2AGJH 4DZ8B 1S5IL 2W9DL 3B9KC 2J6EL 4L8BB 3L3JA 3RWHB 3P3YA 3BP7B 1QO3B 2QHRL 4G8GB 3AXLB 4NRZB 1BZ9B 3KYKH 3MLZH 3PHOB 1FIEA 5IW3A 1EEZB 1ADQL 3B9DA 4P4RA 3ULUF 5FA3B 3FFDB 3RWCA 4XCCH 1M05B 1T7XA 3VE0B 4KMTL 4PJEA 1UWGL 2X1QA 5TPWL 5HYSB 1BVKB 2EDWA 2OM5A 5DD1L 4OIIL 2B4CC 2VLLA 2WUBL 1KT2A 1S9WB 3ZL4H 3IFPB 3G6DL 2QQKL 1C16B 3BD4A 4CL7A 4YWGH 3VRLE 4UILL 5EUKA 1UWXH 1X5AA 3HI5H 1GYAA 3BPOB 4JJHA 5ICZB 1YPZF 2DIBA 4M61B 3ETBF 2NX5D 3JV4A 4H20H 2AKRB 4S1QH 4UINL 3MJ7B 4NC0B 5EIQA 3V7MA 1NAML 3GNML 4K3JL 4KC3B 2AXFA 1AIFA 5ALBL 4RNRA 1RSFA 2KBGA 3QUKA 4PD4K 1FFNA 4GRLC 4PJ5D 1IAII 2K3TA 3W5NA 4LLVB 3J7HA 4QHNA 3JTSA 4N9GA 2VLRD 2P5WB 2PYEA 2OLDA 4YDKL 1OQOA 5B8CC 4DUVA 3RQ3A 4MAYD 4QLRA 5DUMH 4MJIE 3BKJH 3MOBL 2NY1C 2W38A 3BZDA 4NO5B 1UB6B 4Y4KD 4Z7OF 3SBWA 2R0KH 4NN5C 3JSSA 3X12A 2GYSA 4OAWB 4BYHA 4QHUB 5DJ0A 5MI0B 2RR3A 1QP1A 2KH2B 3MLTB 5I1KL 3T3MF 3QIUB 5HJ3B 4U4BA 4KJPC 5DJZB 3K4DA 3A67H 5IHZA 4YHZL 3SGJC 4WWKA 3SPVA 2R0ZH 5DVNA 3I84A 5EU6D 2WM0A 5L8LB 1P84J 1ZVHA 5D2NB 3BKCH 1G0DA 1YUHA 1D5MA 4P2OD 5DZOA 1FNAA 5F9JA 4QGYA 4LOUC 4Q9CA 4HC1H 1CGSH 3PDOA 5KANI 4OTXL 2XQBL 5CFHA 1MAMH 1MCDA 2MHAB 4R7NB 4X6DE 2NY0D 4G6KH 1DUZB 1G6RA 2P47B 3BE1L 1K8DA 2VLMD 3G04A 1KB5H 2IBZX 4I5BB 1QSFD 5JMOC 2IF7A 4X0KB 4ZD3H 1E6OH 4OKVB 4M1CC 4Y19D 4TSBH 3DGGA 2DI7A 1KEGL 1FH5H 4HKJA 2JB6B 3HE6D 1HSBA 2AK1L 3I02B 1IQWH 3VXME 4OCSH 3LB6D 4XI5C 1IL1B 5DRNA 1T20A 2BSED 2HFEB 2NZ9D 4WU7B 1FZJA 3HI1A 4NP4H 1A6AB 2E27H 2FJGA 1NC4B 2A2QT 4E42A 2R9HC 5IJKC 3HR5A 3WIIH 2CUMA 4RQQB 3BEVB 1HINL 4RAUB 5T33H 3VH8B 4O9HH 2XKNB 4JANA 4GG6E 5DD6A 1RU9H 3IB4A 4MS8D 3DPBA 4TVPH 5FHAL 4YO0B 4X7SL 4OCYL 3O6MH 2L0DA 2I25N 3QAZC 4P9MH 4XRCA 4DN4H 3IF1B 3S35X 4FQLL 4RGND 3VXRA 5HYEA 1JHTB 2AEWA 2LTQC 3PP4L 4PGCB 3BKMH 1TXKA 3S4SB 3T8XA 2W59A 1CIDA 5INCA 2A73B 3AU1B 3NACL 1T22B 5HYSG 1MHCB 4IRSB 3GI9H 3VCLA 1NAKL 1H0DA 3QEGH 5B3JE 4XT1C 3QR2A 4JVUA 3GBML 2EE6A 3RA7H 1T2QL 4OI8A 3W39B 3OG4B 5D96C 2NY3D 5CJQH 1JPTL 1B3JA 2A6JA 3WUWA 4LCWD 1R3IL 3WFBH 4H0IA 1FIGL 3SKJL 4AZ8A 2XN9D 3T0ED 5CJOH 5J6GB 2VO5A 5F89A 3B9KD 2XZZA 4MYWB 3TVMB 1G7PA 2QADD 3G5XB 5F1IA 3TYFB 5T3XD 1LP9B 1WT5C 3VXNB 3X13A 4WTZG 2APTA 4F37F 2EE3A 2XA8H 4JFFD 4JG0H 43CAB 3ZT6A 3K8MA 4PLKC 4MJ2A 1F3DH 5LAXA 5C09E 3O8XB 4Z7WB 2XG4A 2DOCA 3SDDD 1CD0A 3TIEA 1CYGA 3HAEH 4HPOH 1VACA 5LKNA 1AGDA 1Q0YH 1RJCA 4I0PC 3F7VB 3WNPA 2C5DC 2FIKB 1NCDL 2E7CA 3PQYB 2BHYA 4PJ7F 3W0WD 5AAWA 4D2NA 1J1XL 1OL0A 4OFYA 1Z9OA 3V4UH 4X5XA 4PB0L 2Q7YB 4C56B 3MOAL 4JKKA 2FDBP 1OY3B 2MCPL 3FAXA 3FT2B 3NFNA 3HNTL 3WIFA 4DVRL 5I0ZA 2DWDB 5AZ2L 5JIKA 2J3SA 3T0XA 2R1WB 2G5RA 3PGDB 1DLHB 3QXWA 4R26L 1IAIH 2Y07H 2ZUSA 1BF8A 5SWSA 2EH8L 3TA3C 5I17B 3JVGA 3IDJA 4FABH 5ERWB 1RD6A 4Z7NE 1T4KA 3MRLB 5D1QA 5MHSE 1DVFC 4QRRB 5F9WB 4UDTB 3V5KA 2GT9B 4U3HA 2CR6A 4O2FA 3G5ZA 2VISA 3FO1B 2NY7H 5FO9A 4GRLD 5D9SB 3OJ2C 3SQOH 5C08E 5EU4A 4YBLC 4NQEE 1MLBB 5LGHL 4UUJA 4PD4J 1YMMD 2FATH 1AI1H 1NGXB 1IC4H 2NY1D 3SKOA 3LN4B 3QG6A 3A6BL 3MV9A 1RUKL 3U0PA 1JGUH 1XZ0A 3D85D 5F70A 3TF7C 5LBSL 3O6KL 3QI9A 2OR7A 2HH0H 3UMTA 2YWZA 1RVFL 1RZKL 2CLZB 4XVTH 4ZUVB 4KK8D 3O3EB 5GGRB 2Q8AH 1JF1B 2AAVA 3B9EA 5BZWB 2VB5A 3RKPA 1IE5A 3AVEA 3RX8A 2OXHA 3O4LA 1F2XK 1Q9LB 3EO1B 3JWDL 3QCUL 3P0VL 3TNMB 3UYRL 4JKPL 4TUJB 4RMVA 5AD0A 1MWAB 4M6NL 1NSNH 4WW2A 4NO2B 1ITCA 1Q9OA 5BS0D 3L95A 3ISWA 3ZE2E 3VH8G 1T66D 1LE5B 4DKEL 5I30H 4RIRA 4PJEE 4LOUD 3QQ9D 5GGQL 1U92B 2NTFB 2PO6A 1R3JB 1WAAF 3VMNA 5KW9H 4S1SH 3MRGB 1MI5A 1JPST 4JREB 2AJ3B 1RZIB 4XBEH 3S4SG 2XNAA 4M1CD 3SCMA 2NW3B 4YHLL 3THML 2CIKA 2ZCLH 5I1LA 1KUMA 1DBAH 1U3HB 4PP2B 4JLRA 4RMRA 1GRWA 2DN7A 2GW5A 5C0EB 5EOCL 5EZLA 1KFAL 1VGKB 3VU2A 4FXGA 3U6RA 2ZNWA 5BVPL 4KROC 4NQTA 3VGAB 3ARDA 4EQ2A 4HCRH 5B39A 1M6OA 5IKCA 4LAJH 1A6WH 1WF5A 1X9QA 3QDMA 4NNPL 1F90H 25C8L 4R97C 1BBJA 4TSCL 4G42A 1G6RL 1T7WA 3OKKA 2AJSL 1XR8A 1FG9C 3PWVA 1HXMB 4U1GC 1R3LB 3IDYC 3GMQB 1CT8B 2UZIH 1KENL 1K2DA 2PYEE 3LKSA 2GTWB 3NPZB 4OF6A 3IJYB 4MHHI 5F9DC 3WNKA 5CEXA 1TETL 4MNGA 1EAPB 3DBXA 3P9LB 2I5YL 1MQKL 3GSNA 1MFDL 4WCYH 1IC7L 3VDAA 3T4YB 3WE6A 5IMKB 1V8HA 4KK9D 4R2GC 1BJ1H 4XPHH 1EFQA 3VFSB 1AHWC 2QBWA 4W4OC 1YN6A 2RFXB 4M1GL 3T65A 3DJ9A 4OLWH 5H37H 4LCYB 5BQ7B 1XFPA 1JTOA 2QQLH 4G9FA 4ORZC 4HIHA 2B0SH 2ORBL 3FQUB 4G8FA 2NNAB 4U7KA 2D03H 2WBJD 5ESQB 3F5WA 3TYGL 3QYCA 4PRIA 2H26A 2X6MA 2G5BA 4F8QA 4PGEA 1MREL 1S9VA 1EBAA 4JY5H 5BMFH 4HJGB 4GW1B 5ADPL 5DVLA 4GXUM 3Q5OA 1VADA 1XGYH 4NFCA 5C0CB 3QDGB 4NRYA 3F7QA 1N64L 2XWTA 3ZSSA 2COQA 1T89C 3C9NA 1FNGA 2I60L 1CXLA 4MA3A 1AC0A 2H32B 1DQTA 3ARFC 1KJVA 4OLXL 3L3OB 5FDWA 4I0PD 3X3FH 5KSVB 2VXUL 5I76A 4I18C 5ADOL 1MCWM 3DX6B 2YXMA 5DD0H 1YNLH 2R4SL 1ACZA 3H7BA 5L0QB 3T04D 2HJKB 4FQQA 4U1KA 5JW3L 2QSQA 4QHMB 5HGGS 4RFNC 5KSUA 4YHML 3D1MC 4LLYB 2WNGA 2CSPA 3P4OB 3V9FA 3IDMB 3WKML 2P7TA 1CE6B 1CTOA 1PG7W 2VYRE 1G9MH 2BVQB 1IEHA 3VXRE 2XICA 5FYKD 4M5ZH 3ARBD 1DVFD 4LKCB 4S1RH 1JFQH 1T5XA 5KG9A 1IKFL 3OAUH 1P5VA 2OL3B 4KK6C 5C1MB 4OV5B 4E41B 2IQAB 1TVHB 3F6IA 5HHMD 1DL7L 4GKOA 4MQXC 3W2DL 4AQOA 1H8SA 1L7TH 4XC1L 5HHNA 2DBLL 3NFPA 1CQYA 4QXGL 2VDRH 5EORH 2IPKA 1DQJB 3PABB 2NX5A 2XZCL 1QBBA 3UTTA 5J3HC 4NZJA 4XPBL 4XCEB 5F7UA 5JXEC 2AABL 3BIKA 4JFDB 4ODVL 1EHXA 1G6VK 1IGCL 4ELMA 3EYFA 4UNVA 1F4XL 5EG6C 5GS0C 1R0AH 4PJ5A 4H25B 4G8IA 4LCCC 1D6EA 2EDNA 4PBXA 4Q9BA 1CE1L 1AQDA 2VLRA 1KTLB 3DUUA 3MRQB 2NR6D 3MGAA 2VDKL 3GMOA 1H5BC 4KKAC 1BBDH 3HI6H 4HIXH 1QTYT 4MAYA 3VRLF 5DWUH 2OJEB 4H8WC 4HFWA 3WHE0 4X8JA 5SWQB 2XWBA 2BNRA 5D93C 1EMTH 3HG1A 3B3IB 5IVNA 3NABH 5EWIH 3D2UD 2A6KB 4XVUC 1UA6L 3NH7L 3D48R 5ID0B 4OLEA 4NUJA 4OCMC 1GGTA 5IFJA 2APBA 4LEOA 4JO4H 1CLZL 2MKLC 3GMPB 1KLGB 3B6SB 4NHUB 2IPUG 3MRHB 4YAQA 2P45B 3GSXB 4HAFA 5DHVB 3VFGH 3R06A 4PJ9B 4X98B 3C5ZA 4G5ZH 3WHXB 1WZLA 4XP1L 3QCTL 4Q0XH 1QRND 2EIEA 4HUWB 4KROD 1RJLB 5SWSE 1XCTA 2F19L 4O51B 4WEBL 3EYUH 2R0WH 4KRLB 1MWAH 2YMXH 4ZUTA 3UTSB 5J57B 5EU5B 4RGMC 1I3GH 1II4E 5AYUL 4QF1A 3MCG1 3VI4E 3HCVA 2FR4A 5D1ZA 5JHDB 3GHBL 1QSFA 1NBVH 4Q6IB 3FB6B 5I8CB 4G7VH 1A9BA 4U1LB 1J12A 4GAFB 5H94B 1RZFL 4K3EH 4M8QB 4CJ0A 3CFBB 2WWMC 3FTGA 2BX5A 1TCMA 5L2JA 5E08L 4XAWH 3KPOA 3MV9E 1FJ1A 4KJWC 4PJGA 4B0MM 1CDJA 1I7ZB 4R2GD 3OJVC 3ULSB 2I9LB 3M17A 3SGDH 3CNKA 1HH6A 4H5SB 2AJUH 3O4LE 2EIBA 4X6DF 3NCJL 4MD0A 1EJ6A 2HT3C 3GB7B 2GQHA 5ICYB 3NTCH 1RIUH 5J9PA 2H8PB 3UJTL 3MLRL 1A7OH 5HDBE 3QNXB 4F7CB 1I7RB 1RZJH 1EO8L 2Z91A 2RBLA 5FM8A 1A3LH 4WO4C 3RVWC 4UTBL 4NN6B 5F93C 4JZJC 3BX7C 1KGCE 2VZOA 3KYOA 1AR2A 1C8PA 1BQLL 5KS9A 4DGIL 1MI5E 15C8L 4RGOH 1F8TL 3FFCB 4K3GA 2C7UA 1ZTXL 4ZO8A 1JPSL 2YSSB 5C0BB 3DVGA 3UDWA 3HE7C 4HS6A 4GG6F 1U8NB 1YEEH 3CFIC 1CFTA 5ITFB 4AEIH 3S35L 3T0EA 5HGDB 4U1HA 4NO3B 2A77H 3G5VA 3B9KA 1RHFA 1OSZA 4P2QA 1MJ8H 4GSDH 3QDME 1N26A 2EDXA 1U8QA 5C0FA 1T1XA 1KCKA 4JFFA 3EJJX 3OG6B 3VGDA 2BOCB 3FZUD 5F9OH 3FQWB 4KI5C 3VGEA 2V7NA 4YE4L 4Q97A 5B3JF 3TO4C 1A7RL 3F7PC 4LDOB 1REIA 4UT9L 3H9HA 4G9DB 4GRWE 2P8LA 1BQHB 1H15A 3GSRB 1F4HA 1HKLH 4MNGE 4NCDA 2RHEA 2HN7B 3W0WA 4AY0A 5KJRH 1XH3A 4YGVA 3I6KA 2BNQD 1MRCL 3HNSH 3LIZH 3MUHL 5F7YC 4YFEA 1QQDB 1Z3GL 2R23A 4MQXD 5IMOB 4PJ8C 3RTQB 1F6LL 5IV2A 5JOPE 1FO0H 4NO0B 4XNUL 5TDOB 4KUCF 3V6BR 3TWCL 2NY6D 3FQRA 1PLGL 4FQJL 4G9FE 4PJXB 5T1MA 5TE7H 2FO1A 5J3HD 4MQTB 3V95A 3ULVH 4PRIE 3O3BB 1JRHI 1KJ2A 3ZKSD 1KPUA 5CCKL 3WS6C 1UVQA 3X11B 4OCWL 2R2BB 5GS0D 4GKNA 2B2XL 4I2XA 3BGFC 1H8NA 2W0PA 4U6VL 2IAND 4EN3B 3FAWA 5TH2B 4PYHA 5B8CA 2MFNA 1KIQB 3SDCB 3NZ8B 1A4JB 1IFHH 1MCKA 4HV8B 5DVMA 5TQ2H 2OL3H 4LSVL 2X05A 2D0HA 1L0XA 2P46B 3D85A 2ZCHH 1Q38A 1XF3B 4H1LA 4NWUL 1CWVA 4PIRF 3HNVL 4F57H 3GKWH 4XVUD 2FB4H 3MBEB 2WQ8A 3C6LB 2UY7A 3ES6B 1KLFA 4UNTA 3KLDA 1U3JA 4Z7NF 3U4EA 1AGBA 4OZ4A 4H26A 4BQ9A 3SGJA 5FM5M 3QUML 1I8MB 1QFUH 3O9WB 2E6QA 4JY6B 5HHOB 1U8MA 1ZLSH 3ARQA 4MJ4A 3SKMA 5BXFA 3GSOA 1CK0H 2I07B 3T3PE 2DTMH 1X7QA 2AXJA 4U0RB 3D39B 2Y7QA 1BFOB 3ZTJG 1NMAH 4KPHL 2HJFB 1R3HA 2PW2B 1IGJA 1RJYB 2DQIH 2O5ZH 1OAQH 1W0VA 4XWGH 2EDOA 2Q7NA 4HWBA 1C5CL 1EHAA 4ODSL 4GBXA 2IQ9L 5I1EH 1DANT 3GK8L 1EEQA 3U46A 4J8RB 1WCBB 4WI5A 5D71L 5ACZB 4LPUA 2VABA 1YJDC 1ZANL 1W0WB 2RCSH 4L3CB 2WWMD 4Y5VB 3OAYH 1YNKH 4YNYB 1OGAB 4OJFH 1XF1A 3VFNB 5HPOA 4ZXBC 4M7JH 4PJIB 3GSNH 2NX5E 4YDVB 3MJ8B 1CFNB 3UTTE 3PV6A 4KJWD 4XBPA 3BPCA 3K81A 3OAZK 4TRPL 5IJKA 5FB8A 4L8SA 4PJEF 4ELME 3NGBC 3SDXB 4OD3H 1QA9A 5ISZB 4XNXL 2HT3D 3I2CH 4DN3H 4EVNB 1NDMB 4GQ9L 1BD2B 2VLRE 3VXSD 4NQCB 3DROB 2VC2L 2BSTB 1CU4H 5GRVK 2MMXA 1VFMA 1R5IB 2NPLX 1IQDB 3IRPX 5FF6B 5I9QB 3DTXA 3RVWD 5EOTB 4Z9KB 5EFIB 3WFHA 2IWGA 2BNRE 5BV7C 1LDPH 5CBEA 1A1NB 3HG1E 4ONGL 2ZWLT 5HYJD 4MB4A 1NQBA 2PXYB 2W0KA 1BQHG 1OGTB 2BOBB 1IBGH 1X3DA 2FSEA 1I4FA 5J1AB 1KC5H 2IBBA 5LXGL 1J1PH 5IVOA 3IKCB 1M71A 4M6MH 1DEEA 3AREB 5IR1A 2BFVH 4M6OH 2WBWB 3MBXH 2DQDH 1ES0B 3B2UC 3GJFA 1D3CA 1TZHA 3MRDB 4NZDA 4NOFA 1I3RB 4DK6A 4K7PY 1OF2A 3C60D 2VLME 4YHOL 5C07D 2F5BH 1LO0H 4OD1H 4EIZC 4KI5D 1QSFE 5CLTA 2AVGA 3BKYH 1HXYB 1GGBL 5I15L 3O0RH 5A2KH 3KYAA 35C8H 4MD5A 2UYLA 5EZOH 2ITCB 4I0PA 4ZYKB 1OAYH 5JPNA 3RWFB 1D9KC 4GRMB 4BKLB 4X7TA 5IFAL 2YZ1A 3NFSH 1P6AB 4KJQC 4PJGE 5BW7C 4GXVH 2Z92B 4JM2A 3DGCR 4GAYB 5FV2A 3MLYL 4PJ8D 2W9LA 4K7PL 1U9KA 4LKXA 1JRHH 3DNKA 3SKNA 1AE6H 2WWKO 5IM7A 3KPLA 5FYLD 1GC1L 2G2RB 4M7ZB 2EIZA 3BWAB 3NA4A 1FGVL 4JFPB 3QEHA 5I1HL 2G60H 3IU3B 1RMFH 4KUZL 3TA3A 2P42B 3RIAK 5FO7B 5GGVH 1JGVL 3U0TB 1A1MA 3HUJF 4JDVB 4RAVB 3S37H 2ERJB 2KZ1B 4X6BB 1DVFA 2B4CL 5D2LA 1U91A 4YHNA 4KRPC 4FZ8H 3ARUA 3KLHC 4CU8A 4LAQH 4PJHA 1KXQE 1CVSC 1H3VA 5HHXH 5KS9E 1FSKB 1JZ4A 3BESR 4J3OC 4Z7UB 5JIHA 4MJIB 4WUKH 3MUY1 3WIHH 5JR1H 4BJLA 4ODWB 4PB9L 4FQXB 3K80A 4LLDA 4AMKL 3GGWA 3ZT5A 4C4KT 4V1DB 2PTTB 3TCLB 3QPQD 3V7AE 2QEJA 3LDBB 4U1MB 3WSQH 3TPUA 3T0EE 4Z78B 3VGGA 1NJ9A 2P48B 1DQLL 4P2QE 4LLQB 3N1QC 3BQUD 4P46D 1KPVA 3LV3B 5D8JL 5FYJD 5HI5C 1G0XA 3WXWH 2A38A 2EDFA 4KZDH 5HHPB 3IU4L 2E9JA 1OCWH 3P0GB 4JFFE 5IOPB 3IS1X 4WI6A 3HZYA 3O6LL 3MUJA 1DBKH 3N9GH 1FN4A 4FQCL 3KNBA 2IH1B 1ZEAH 4XCYB 2VAAB 4OGZA 3U9PL 1NAMB 3I75A 4JY4B 1EEUA 5DJ2A 2MOVA 4X6DB 4HT1L 1EGJA 1Z5LA 5CHNA 1ZT7A 1WEJL 2JCCA 1IGFL 3O6FD 1U8LB 3W0WE 1HHHB 2CDGB 5BJTB 4HH9A 5I71C 1FORH 3DX7A 4HBQA 3CFEA 2FYYA 2XKSA 2ZSWB 4K71B 5I75C 1IGIL 5FKAB 1BZ7B 2X4RB 2R39A 4BFIA 1TJIH 4M7LH 4QRPA 3CH8A 4IOSD 4O2CB 3F58H 3RNKB 1CL7I 1A3RH 5C0RL 3RWEA 5E6IC 1MF2L 1C5DB 4OD2B 3BAEL 4JPWL 3MNWA 2VE6A 4OCRL 4GG6B 3ORJA 4FG6D 3RAJL 4MNQA 4JG1L 1YEIL 2BMKA 4LGSB 4APQB 4PJDB 9CGTA 4P57A 4I2XE 3OGOE 3Q2CA 4MDIB 4U7MA 4JFOB 1RZ8B 5LWYH 3AAZA 2ED9A 2EEBA 1KLUB 4ZFZB 3EJYC 1GPOH 2AXGB 4Z5RB 2EC9U 5ACLA 2VXTL 1JNJA 4XZUA 1MVFA 5DA4A 3PL6D 3C8KA 2MPAH 1AQKH 2AV7B 2GFBB 1AHWA 3DVIA 2J8HA 4W4OA 5IT2H 3BZFA 2GJJA 1QLFA 5EC1A 5HHVL 3KPMB 3TBVB 1UYWH 3PWPD 2VDPL 4WFEE 2VLKD 4LHUB 1T0PB 4QHLA 1ORSB 4W6YB 2F15A 2ZOLA 5DMKB 1XGPA 2ARJB 4DVBA 4HMEA 5AUMA 5I19H 2BY1A 1A6VL 4LLUB 4DAGH 5HPMB 1LNUB 5C8JB 3LD8C 4HKXB 2VZUA 1NDGA 5CIPB 1HYRC 1N59A 5T3XH 3MCLL 1IAKA 5CJXC 2OTPA 5CP3H 3FKUS 5C09B 3MUGB 5DJAB 1AXTH 1HH9A 5IK3B 3LMJL 4WEUD 3QZWB 1T89A 3L1OL 4KZEH 4Y8AA 4DGYH 1FLRL 5TF1L 5E24E 5KSAB 3CC5B 3ARFA 1UXSA 1I9IH 3B8SA 3O2VL 3ELAT 4NRXA 1HEZB 3PIQA 2VIRA 5HDBF 1D9KD 4JM4L 4WW2F 4I18A 3UTQA 4QXWA 4KJQD 1H3WM 3L3KA 5EU3A 1N6QL 1OHQA 3GI8H 3RDTC 4LCUB 2ZSVB 5F7NC 2BRRH 1U95B 4ZNEA 4XVSL 1ZA3A 4BZ2L 5E94B 4G3YH 2K9UA 4HIJB 4LPYA 2YD1A 1DDHB 3C08H 4F7MB 3INUL 2HMIC 5JZ7C 4X4XA 1NC2D 1HDMA 4LSQH 3NZHH 4XHJD 4FQ2H 3JUYA 5J6HA 2C1PB 2JB5H 4KH2A 4TNWK 5ESVA 1H3PL 5IFHH 3FL7A 1JWUA 5FCUL 2GKIA 5ACMA 3KLHD 4CNIA 2BNQA 3FN3A 3O3AA 5C08B 2PR4L 4NQEB 1AD9B 5L2KD 3BFOA 3V0VA 1GL4B 4H88L 2VNCA 4Y1AD 1BZQK 4LPTA 5D70H 1MFEL 4ZDHB 1HHJA 3GMNB 2V9TA 3HC0A 3K4AA 4TYUA 1TQBC 3NAAL 3EO0B 2AJYH 1NFIB 5T1LD 3BP6B 3CFDB 1F4WH 4KXZI 1J7VR 3FB7A 1UH3A 5JXEA 1EH9A 4DFHA 3OR7B 3DURA 2Q6WA 3TBWB 4GRWF 3U1SH 4DKDC 3VFOA 5HI5D 4LCCA 4L4TA 1PEWA 2IANA 3CSBA 3DSFL 4P4RB 3EFFA 3Q1SL 1CGUA 4NUGH 1H5BA 4NZUH 4QHKJ 4NWTH 1T04B 5ESAA 1ZLWK 4HQQH 4D0DB 2B5IC 2QHRH 5D6DC 3V4VH 1YYLH 2C4FT 1JGEB 4QTIL 1WQVT 4NQXA 1U2CA 1ADQH 4JFHD 1RUML 5DJYA 1CL7H 4GLRI 4EQ3A 2FGWH 5TPWH 5EUKB 5F6IC 3JWOC 5DD1H 4Y2OA 1NCCL 5CILH 3TT1L 3HZKA 1J0ZA 2WUCH 3S36X 3T77A 4TUOA 5MEQA 2HKFL 4WY7L 3JV4B 1SJVA 2R69H 4O02H 5E6ID 1S3KL 5EA0L 1HCVA 2JLLA 4LHUG 5FYKE 5I8EB 2EE2A 4RNRB 1EGJL 3PWUB 3HB3D 1HZHL 3RY6A 4YHKH 3SKUD 2CPCA 1JN6B 1MRDL 4QHNB 4PJHE 4PRAA 4CVZA 4N9GB 2PYEB 1MIMH 1NBZA 2EXYD 3GNMH 4K3JH 4PTTB 3U30B 3OR6A 1YEKL 4QWWC 2WP3T 1A6UL 4XPAL 3BI9X 3O2DH 3EJYD 3V5HA 4OT1H 3HS0A 3OXSA 3KWWA 3GMLA 1KN4L 3S96A 5E03A 3EHBD 3EOYG 4JFED 4POYA 4GAGL 3X12B 3QZWG 2E9BA 5DJDA 3T3PF 4PJCA 3KPTA 3VA6A 1WWWX 1WZMA 1RFDL 4OZGA 3LHPH 4KAQL 5EU7C 1WBYA 1UKTA 4R0LB 3D9AH 4FN0A 4FNLL 3RGVC 1OARL 1UWXK 3SPVB 4G6ML 3K1DA 3TT3L 3BJ91 3QRGL 1TIUA 4DOHE 4PTUA 5DLML 1QYGH 4ZFOA 3EW3B 2Z31A 3VXSA 4P4KD 5DQDL 1YUHB 1D5MB 1IAOA 3MV8D 3H8NA 4N1EA 5IBUB 4WO4A 2QSCL 1JIBA 4NKOA 4JZJA 2VITA 3HN3A 1G6RB 2H3NA 4UOW0 1K8DB 2ATKA 2JCCE 4LVOB 3BN3B 4JQXC 3VXUA 2QQNL 4PG2C 2JF1A 4I3SH 1BJ8A 1I8LA 4ELMF 4F58H 4Q9QL 1VB9A 4EXKA 1N5AB 3HE7A 5GXBB 4ZSOA 4HKJB 2GJ6A 1HSBB 4YFLI 3R8BB 5CD5C 1EJOH 4QRPE 1OSPH 2DLTA 4JKMA 5DRNB 1T20B 3PXJA 3K46A 1GOFA 3WJLC 1AGEA 1S7RA 1KJ3L 3HI1B 4LQFL 4E42B 2HLAA 3QG7H 2XPGB 2AK1H 4JANB 5KN5B 5KVDL 3NCFB 5DD6B 1QFWL 3TZVA 1PD6A 1FL6B 3VMOA 2K7QA 4MNQE 1Y18B 4NKDA 5C07A 4XRCB 4P9HC 3V0AC 4NZTL 2I24N 3ZDYE 4K94C 3TO4A 1X5IA 2HMID 5JZ7D 2X42A 3ILPB 4F8TA 2NY4D 5EIVA 3I6LD 3UO1H 3VG9C 3GM0A 1U8OA 5INCB 5FOJA 1TQCB 1G7LA 2DD8H 3O3DA 4R3SA 1IM9B 1V5JA 5IESL 3MR9A 2V7HA 2XYCA 4FQLH 1EXUA 1NCUA 3JTTB 2C4XA 4XNMA 5JIIA 2EH7L 4KXZH 5KBNC 1H0DB 4PJ8A 1KOAA 4OSUL 1Z9SA 1MHPL 3OTTA 4NBXB 5ILTL 1WIOA 2DQUH 1QBML 3ALPA 2A6JB 4ZUUA 2DIJA 1DR9A 2ICWJ 3NACH 1QLEL 5KZCB 4Q6YA 5L88L 4QCIA 4HK0A 4LL9A 3WS6A 1T2QH 1G7PB 1X6LA 4PLOB 5GJTL 3X13B 1OB1B 1R3IH 5E4EC 4KQ4H 3ROLA 1FIGH 5JPMB 3EDJA 3STLA 1ZHKA 4PJGF 3X3GL 4XNZB 1AGFB 5M95B 4JR9H 2VR4A 3LRSB 2Z8SA 2OTWA 1EDQA 4GLRH 1VACB 4BH8B 2X1WL 2A6IB 1AGDB 2J2ZA 2BSRB 1KEMH 4M02A 4X5XB 1NBYB 2PUQT 4G6FB 5F71A 4CW1B 2Q8BL 3NFNB 5HVHC 2X4SA 1JTPA 2PW1A 3ZYJA 4ZFGL 1MLCB 3CVHL 5KS9F 3OJMB 2XFXA 4ZNEE 5KVFL 2IFFL 5SWSB 4PB0H 5SWZD 1F6FB 3IDJB 2APWA 4XCFL 1UACH 3CAFA 1QSED 5D1QB 3IYLW 3HNTH 1SMOA 1XIWB 4O2FB 5ETUA 5E8OA 5FO9B 2FHFA 3O2WL 4R26H 3MA7A 3NIFE 5LVEA 2BNQE 3DRQA 4L9LB 1OPGL 5IBUG 3QIWC 4LVNC 3LQAC 4UUJB 5JW5B 2HG5B 12E8L 4QWWD 2ZUQB 3UX9B 1KCUH 5IMLA 3SKOB 4IRJB 3QG6B 1RJZB 4LNVA 4ZXBA 1FG2A 4HXBL 3QI9B 1QBLH 4MD4B 1CXKA 3GJEA 3LKQA 3H9ZA 3Q0HA 4N5EC 3K2UH 5LGHH 2UZYB 4QYOA 3VFUA 2DM3A 1TENA 4L8CA 2EDRA 4CMMA 2R0LH 2UWEA 5DJCB 1RUKH 3REVA 2BRQA 3LPGA 4L4TE 4QOKD 1OAXL 4JFYA 1QR4A 4ERSH 2IANE 3EBAA 5AD0B 5DUPL 4ZTPL 1B0RB 4YC2B 5K59E 4WW2B 1RZKH 1Q9OB 3L95B 4ACPA 5ANMA 4P0DA 2J5LC 3LQZA 1ZSDB 4RIRB 5TDPA 2XXCB 4IIQC 3JWDH 1G1YA 2VKWA 4JN2B 3LS4H 4RZCA 5IB1A 4N8VB 1MI5B 1MFAH 3V79C 2EKSA 4IOFC 1L0YA 4OGXL 1AP2A 4MCYB 3RY4A 2FECI 4DKEH 4D9LL 1NGYA 2XNAB 3AS1A 1MJJA 3LEYL 5IB5A 1WIPA 3SCMB 3PWPA 5D1XC 1FV1B 1DQML 1S9XA 2VLKA 5GGQH 3L3DB 3CLFL 5I1LB 1CDHA 2NXYB 1O7VA 4JLRB 1ORQA 4RWHA 4ZFOL 2X10A 5CD5D 2RJMA 4NJAL 4FXGB 4Y0GA 3U6RB 1VESA 3OV6A 3REWA 3H9SB 1EEYA 3MXVL 3RJQB 5B39B 1M6OB 5IKCB 3QDMB 2YUZA 3SGEI 4PRHB 5GS2H 4JRYA 3PWNA 1KCRH 2LABA 1S5HB 3OKKB 5BOPA 1GAFL 4M4RA 3TH4T 3PWVB 4YHIA 3VJ6A 5E2VL 1LEIA 3D18A 1NGWA 2VERN 4U6HA 4PGZA 4WDIB 3MNZA 1IGML 3CX2A 2YD4A 4U2YA 3LKSB 2ATPB 2D31B 1XF2A 2EYSB 1F97A 5F6HJ 4KGJA 1TZGH 1RIVH 2E7HA 4LSSL 4MNGB 1YECL 1M4KA 5E2TL 4G43A 1MIEH 1D9KA 3WE6B 5KAQF 2EXWD 3MRRB 1KENH 4EOWL 5AG8A 3BGMB 3QNYB 4PJCE 2E7BA 5BW7A 2DQFA 3ZKMC 3QFJA 5E9DB 3RZCD 1UC6A 4OZGE 3T65B 1LEKA 3QUYC 4JVPA 3ZE0E 4EKXA 1SYVA 4UNUA 1IT9L 1OAKH 1WFNA 1MCLA 3HRZA 5FOBB 4G8FB 5GGSA 3F5WB 2X4TA 2H26B 1J87A 3VXSE 1NC2A 2G5BB 4RBPK 4PGEB 2CJUL 1WICA 5BRZB 1S9VB 5JUEL 3GO1H 5CSZA 3BPNB 4Y4FC 5GS0H 4FFZH 3VRJA 1FVDB 4NDMA 1F3RB 4PV9A 4NRYB 5L2KA 2J8UA 3WO4B 1V3JA 4N0CD 5IIEA 2XWTB 3KJ4C 3VXUE 1B88A 2ZUUA 3U4BL 4H8WH 3IVKB 1TVBA 5T1LA 1YZZA 1KJVB 4ZSOE 3MREA 2GJ6E 3OKLB 5FDWB 4P5TC 3VWJC 1I1AC 3LCYA 4BH7A 2BCKB 4EZMA 4D0BA 2OS7A 2RGSA 1T0MB 3WDHA 3JV5A 5H2BA 4FQQB 1W72L 2XRAH 3T0AA 4UOJA 5KSUB 5HGAA 5EO9B 3VXQA 5C07E 4UV7L 2ILLA 2R4SH 4FTVD 2OJZH 1P7HL 5GISH 4IS6A 4JB9L 3NA9L 1I9RL 1T5XB 5KG9B 1P53A 4XXCA 5E8DL 2CMRL 4BELD 2X4NA 4E0RA 1UM4L 3QT2A 5JA9A 1ZHBA 3QIWD 3NCMA 5EZJA 5HHNB 4LSPL 2D9CA 1CDGA 1ZV5A 4N8VG 4PJFB 1G7QB 4HG4K 3L6FA 1AKJD 5ABDE 3EIFA 3UTTB 2VZTA 3V0WL 2R1XA 2X40A 4PG9B 5E2UH 1KPRA 4C58B 3BIKB 1INQB 4EI5D 4ELMB 2V17H 4QXGH 5A16B 1G0YR 1TTUA 4HLZH 4FXLA 4G8IB 5F3HB 5CEYA 3NMEA 1D6EB 2ICEB 4PRBA 3LQMA 2XZCH 4OM1L 3QUMB 1Y0LA 4OB5L 5ITBL 1AQDB 2DMBA 5I73B 5K9OA 1X5FA 5B39G 5DC4B 5CUSL 4Z76A 4JM2F 2CIIA 1F4XH 4HFWB 4X8JB 3BZEA 5C6TH 2XWBB 3S36L 2BNRB 4JFEA 1Q0XH 3MNVA 4WFGD 3HG1B 5GRYA 4XC3H 1CE1H 4XB7A 3AGVA 1EFXB 3TJHC 1T6WA 3LKRA 5IG7A 1SVCP 4IOFD 2CDEB 5J12C 4JHWH 4NUJB 5IFJB 3LRGA 1U42A 1U8PB 2X9YA 2FBOJ 4GMTL 4I48A 4LEOB 4HLJA 5IW6B 2NXZC 4KTEL 5D2LF 5D1XD 3FQXA 2AK4D 5FYJE 3SGEH 3OKNA 4YAQB 2X9WA 3KYMA 3Q6GL 4O5LH 1JYNA 3S97C 3NCBB 2EEAA 1R5WA 1T03L 1Z0NA 4PJHF 3R06B 3NH7H 4KKNA 5B3NA 1KTRL 4C59B 3CFKA 3C5ZB 2EZ0C 3KYNA 3IFOA 3RI5F 1FYTD 5MP6L 3V6FA 3MV8A 4U6XB 1XCTB 5BO1H 4P2YA 1CLZH 1BWMA 4JRWA 5BV7L 4NQDB 4P23B 4ZUTB 2NY5L 4PLJC 5DHYA 3KHQA 5CJXA 5D5MA 2YUVA 4QF1B 3HCVB 5CEZL 1H3TA 4NSKA 5D1ZB 1UZ8A 4ISVA 4HJ0C 2F19H 4A2LA 3GIZH 4N0RA 3VG0L 3BSZH 4EDXB 2BVOB 4TN9A 4WRLA 1T1ZA 4BFBD 5L2JB 3WUZA 3KPOB 4NGHH 1AY1H 4NPYB 1LDSA 3O41A 3PDDA 1OAUL 1FJ1B 4IMLA 1FPTL 1BECA 1S9YA 5IW1A 4YPJA 4CU6A 1RIHH 1RZFH 4POZC 4GAJH 1I85C 2ADIA 3H0TA 1CFQA 1FE8H 3QUXD 3QUYD 3RDTA 1RURL 5E08H 2AQ3A 2UWEE 2NY2D 2QSTA 1MEXH 2JCCF 3BPOC 5CZKA 5FYLH 5CWSA 5GGSY 5J9PB 3UJIL 1U93A 3IFNH 1MCRA 3TO2A 3K3QA 3TBYA 1EERB 4K23H 4LSRL 3T2PA 5T3ZL 1I9JH 2F8OA 3MPCA 5ANME 4AM0B 1VERA 5MERA 4LDLB 2AV1A 3PWJA 4KDTC 1UCBL 5A3IC 4N1HB 3EYQC 3MJGX 5DURD 5I1GL 4K2UL 4MA7H 1KJMB 2A74A 1J0JA 2IADA 3UZQA 4BQ6A 3QFDA 1BVLB 4TVSa 3BH8A 5EOQL 4MJ6A 5C2UB 3PJSB 5IQ9B 3DVGB 3PWPE 3P4LA 2VLKE 4HS6B 4RISH 4P2RA 1HE7A 4WVRA 4E5XA 3HFMH 3NCYP 1BQLH 1PYWA 1IZKA 3Q6FA 1FFOA 15C8H 1F8TH 4FMFA 4P5TD 4U1HB 3VWJD 3SDAC 3G5VB 1Y6NR 5HYQB 1KXVC 1ZAGA 3ZDYF 3RP1A 5C0NC 4MZ2A 4P2QB 1ZTXH 5KSBF 2EC8A 2ZZUT 4LFHG 4JRYE 1T83C 1AD0A 1T1XB 5FYJH 4V2CB 1BX2A 2Z0BA 3ARGB 5E95B 1B2WL 2MCG1 2V7NB 1JZ5A 1J8HA 4I8DA 1U8HA 5F7DB 2IAMA 5D2NC 3HMXH 4HSQA 3EOTL 1I1YA 3MLUH 5T3ZE 2XG5A 3V52L 4G6JH 5T5NF 3DIFA 3MX0A 5C2BH 1XH3B 5JQHC 2QKIA 4LP5A 5BZDA 1A7RH 1T2JA 1XF5B 1NUGA 4N0YL 2YA2A 3QFJE 4KWUA 1DBBL 4PUBL 3OXRA 4N90E 5IV2B 3LEVH 4IDJH 1TPXB 3S98A 1DBJL 4GQPH 3CSYA 3FQRB 4P3DA 5GS1B 4OZIA 3CMOL 1V7NL 2IPUK 5SWZA 3T1FA 1QSEA 2DWEA 32C2A 3QO1A 4HXAL 1S7XA 5HY9A 4PPTA 1N2RA 2DBJA 2F74A 4AH2A 3TWCH 1ZT4B 4GKNB 1CLOL 4HWZA 5EO0B 4FQJH 4DKFH 4YXKH 1T7YA 4YJZL 5L2KE 3QULA 2C3VA 2J8UE 3AY4C 3JXAA 4B7IA 5TE6L 5SX4I 2FX8L 1H3XA 4XMLL 2OYPA 4S2SA 4S0SD 4P3CH 5JDSB 3SO3C 4JO1L 1EZVY 1DCLA 4K3DH 3CUPA 3G5YB 5IHBA 2X4UA 1YEGL 2HJLA 3D5OF 4Q58C 1UB5A 2AEPH 5DDHA 4L3ED 4OLVL 3GBNL 3EO9H 3CD4A 3U4EB 1YNTB 1AGBB 5IF0B 4OZ4B 3H3BC 3QXAA 3MA9H 1JGLL 3RGVA 4KKLC 1GOHA 4AENB 4NWUH 3TP4A 1F3JB 2W07A 1Q9KA 1CVRA 2FX9L 2A83B 3NIFF 4TSAH 4ONOA 3SKMB 4EUPH 4NBYB 5BXFB 4U7SA 4NKIH 1X7QB 3QA3B 4NQVA 4XNQB 2EZ0D 3TN0B 3UPAA 4LEXL 5FO8B 1IGJB 4HWEL 3Q3GA 3LKOA 2IPTH 1S7UA 1BEYL 5TDNA 2D7OA 2HTKD 4PLJD 3TVMC 4G8GD 5ICXA 1G9MC 4R7DA 1MJ7L 4JFHE 2F5AH 4GBXB 2R56L 5J1SC 5MENA 3KPRB 3QWQB 4JCMA 2EDJA 4Z7VA 4HJ0D 4PG2A 4YX2H 2W60A 4F7EB 4OQTH 4I77L 5D7IA 3CCHA 2VDLH 3O8XC 3HZMA 4D8PA 4M4PA 1J1OH 1C5CH 4MJ5A 2CD0A 3ZKXB 5K59F 2VDMH 3WJLA 3GK8H 4ZQKA 3PV6B 4XBPB 4O58H 3BPCB 4OF8A 1CR9L 1E4WH 3MROA 4WIQA 3N1FC 5ENWB 4Q2ZA 5FB8B 4L8SB 3AMLA 4POZD 1Y6KR 4OKDA 4W4NA 1QEWB 2XZAH 1R24A 5IEHA 1QA9B 3QWRD 3MLVL 4K8RL 4Z77A 1GGYA 5D7KD 3MCKA 1NEZA 3QAZB 4TRPH 1HIMH 5BCAA 1L0QA