5FM5O

Crystal structure of the myomesin:obscurin-like-1 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
97
structure length
97
Chain Sequence
PLGSGILMAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords MYOMESIN-1
publication title Binding of Myomesin to Obscurin-Like-1 at the Muscle M-Band Provides a Strategy for Isoform-Specific Mechanical Protection.
pubmed doi rcsb
source organism Homo sapiens
total genus 17
structure length 97
sequence length 97
chains with identical sequence P
ec nomenclature
pdb deposition date 2015-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fm5O00
1JWSA 2D0HA 5BXFA 5FGCB 3IGAA 3C2AH 3SDDB 4KTYA 4WV1A 3HNSH 4KJYB 1MNUH 5EORL 1DVFC 3BW9A 1DJSA 5HYJE 1YEFL 2VYRE 4M8VA 4Y16D 4FABL 4U6HA 4OI7A 4PJIB 3QPXL 4CJ1A 2PW1B 5ACZA 1VADB 5C9JA 3KLHC 5DXWA 2B7DT 5A40E 3SGKA 5HYJA 3NCEB 4NWUL 3UMTA 5F8QC 1CFSA 4K94C 2DIBA 4XWOD 2AGJL 4J4PA 4I0PC 1EPFA 1GAFH 5GRVL 3ZTJH 3L5IA 4XWGL 2BSRB 1AO7B 1IKFH 1FFNA 4ORZC 3W81A 1IGYB 3V0AC 2ADFL 5DDHA 3EOAB 3KPNB 1KIQA 3VGFA 4GMSH 4HXBH 5J57B 1J10A 4WEMB 4R4FL 3LRGA 5D1QC 5L9DL 4PJDF 2OK0L 4OCWH 3VE0A 3GRWL 3U30B 1FV1B 2Y5TA 1NEUA 5SX5K 2YXMA 3F58L 2CLZB 3RBGA 4WDIB 1B2WH 3EJYC 4UTBL 1RIVL 1QNZL 1BIIA 4BA8A 4M1GH 1FZMB 4XMLL 1X5FA 4IM8A 1TQBC 3FRPG 5JA8B 2ITDA 2Q87A 4FQ1L 3IXAA 2OYPA 1MIMH 5ESAB 1ND0B 4JQVA 4R26L 3SKMB 2ED8A 3KWWB 4P4KC 3MFFB 2IPKB 4ZPVB 2AEIT 2IQAB 2DLHA 3QXVA 2D3VA 5ERWA 4HLZG 4HCRA 4UOW1 4LKCB 4XP9L 1J0YA 4H5SA 3A6OA 2FR4A 4EBQL 3UTTB 2F54D 1LEGB 3ARBD 4G43A 1UXWB 2CLRA 2A83A 5BS0D 3QA3A 1HHGA 1AIFB 6CGTA 1UWGH 1VEOA 1EUUA 3DGGA 3ZSTA 4B50A 5DJ8A 4S1SH 3F7YA 4M61B 5DR5H 4JFOA 1SJEA 5DJYA 4L4VE 3AREA 2NZ9D 5FKAB 3V52H 3NFSH 2ZOLA 3IFNL 3HMWL 3ARDD 3VH8A 3N85H 1OGAD 3G5XB 4F33B 3VFVA 5B22A 5I1CL 2YRLA 4IEFB 5EZIH 2P5WE 4L4VA 1RK1B 1M1SA 4HGWA 4JZNB 4D9RE 3DO7A 4F7CB 4FXLA 1I3VA 4ZS7H 1X5XA 2DWDA 1URLA 2DJSA 3G5YA 5M7QA 3H6JA 2DKSA 3Q1SL 1EA9C 3IU4H 4XVJH 2P5WA 4JCMA 3S4SA 1IGFH 4F37F 4ZOEA 4XCCH 3VU2A 2CDEB 1JPSL 1W2KT 4LVOB 5FYJH 1B3JA 4RWYH 1RURH 2X4QA 1P2CA 2A77L 1YNTB 2R2BA 1KC5L 1V3MA 2YUZA 3C5ZD 5MENE 2YZ8A 4J1UB 3HI1A 2OQJB 4V1DB 2D2OA 3T2NH 1U92B 5T3ZH 5E00B 3R06B 5HI5D 4KJQC 4NSKA 5EBLA 2JCCF 3S36H 5J56B 1RJCA 5EU3B 1WFOA 3N0PB 3SCMA 4NM4L 1FP5A 1JPFB 4XPFL 3GMOB 3IVKB 3I02B 1J1PH 3U48A 1IAIH 3O9WD 4OCXL 4HK0B 1CXEA 2E6JA 3RWJA 2B4CC 1F3JB 4Z5RB 3MOAH 5IB1A 2VC2H 3VFPA 2OBGA 2NR6D 3D39E 4Q9CA 5C86A 3GMQB 3S88L 1ZHKB 3PG2A 1YYLL 5FYJD 3K4ZA 4OB5L 3MBEA 3E6HB 2AP2A 3JWOL 3LQZB 5C0AA 3OKEA 3LKSB 3D39A 3O0RL 4PLKD 1J5OL 3F5WB 1TVBA 4U1NB 5T3ZD 5I76B 3QZWA 1UFUA 4HV8B 3QDAA 2D31A 4M7LL 4L5FL 4F15C 4Y4KC 4AYFA 4DKEL 1FL3A 1AE6L 3BHBA 3PABA 2V2XB 4PJBB 3UYOD 3MRFB 5FB8A 1H3VA 5HGGS 4WCYL 4J3XA 1HINL 3PGDA 1OP5K 2FJGB 2OP4L 1W8NA 4NN5B 5C07E 32C2B 3I3BA 1T7VA 1C5CH 1M05B 4KZDH 3O6KL 5EBGA 1MCQA 4JKLA 4KWUA 1CDBA 5DD1L 5T1DH 5C07A 1HDMA 3M07A 3O3DB 4LSQH 3KR3L 1H8OA 2IG2L 4RBPH 3W0WD 2BVPA 1U8HA 3QCVL 3ZE0E 3A67H 4GG6B 3CLFH 5DWUH 4G42A 3HR5A 4ZFGH 5CBAA 2ATKA 2N7AA 1XGRA 1AHWA 2VN4A 4JFZL 1A6VH 1QLEH 3M1BA 4FN0A 1R3IH 4LDOB 3RWGB 3LSOB 4BH7A 1L7IH 3QUYC 4R8WH 4E42A 1WCBB 3O3BB 1U91B 3DUUB 4PJGF 5I1HL 3QHFL 1RVFH 2UUDH 3GJFH 3WCYA 3S96B 3TIEA 5D7IB 1E28B 4FZEL 5JPNB 2JB5L 1LGVA 1XZ0A 2DICA 4JGUA 5A3ID 4LMQI 4D0BA 43C9B 1WSST 1F4YL 1CFBA 2F5AL 4PJFF 5TGBB 4N0UE 3P11H 3VGHA 1D9KA 1C12B 4KUZL 3BESR 1IFHH 1T04B 1F6LL 1WWWX 3LKPB 3QXAB 4OIAA 5DJ2A 4L8SB 3ZKNC 4BSVB 2EZ0D 1FL6A 3VMPA 1H8NA 2WANA 5DC4B 3F7VA 3WEXB 5HYSB 2VDML 3VFGH 4M5ZH 4N0UA 3U0TB 3EIFA 3OB0H 1UM5L 2F19H 3MV01 5HHMD 1CIDA 1H5BA 4X9GA 4EOWH 3JTTA 4JKKA 3DROA 3BEVB 4APQB 3GMPA 3MRKB 4YDKL 3S5LG 3ZL4H 2EDRA 3TBWB 5HI3D 5F7NC 1EV2E 3VMOA 5C0CB 4GRWE 1SYVA 4N0CC 1CQYA 1ONQB 4QHMB 3SDCB 5DK3A 4N0FB 3P4OA 2R0WH 4D0CB 3CUPB 3EDDA 3GK8L 5CJQL 2NY2D 2Z4QA 4Q58C 4XVTH 3DRTA 2XQYG 1MCFA 1Z0NA 3W39A 2CR6A 3DRQB 5DLMH 3DX8A 4JFFB 5CSZB 4FNLH 1IM3B 4X7EC 1T6VN 2J6EL 4UNVA 1TETL 4X9IA 5IVXB 1BZ9A 3QRGL 5AYUH 5L88H 3QIBC 5KSUA 2E9BA 3TM6A 5C71A 1JTTA 4K7PX 4OLVH 2XFXA 2FX7L 1VACA 5J06A 1ZSDB 1Z0MA 2ICWB 4QT5A 3MLZH 3HE7D 3SO5A 3HCVB 1NANH 5T3XH 4BSJA 3H42L 3KPSB 5EBMA 3O4OC 5F1IA 4JPVL 4I2XE 5E99L 1U3HB 1P53A 4XBEL 1A3LL 4MVBC 3B8SA 4AIOA 2AEWA 1R3JB 3OJDA 2LAGB 3I9GL 4FOMA 2V5RA 4JPKL 4LLMB 2EYSB 4TSCH 5FYKL 3TVMB 4I2XA 4WFGE 3CC5B 1VPOL 3U4BL 3TP4A 2D4DA 4DN4L 4KI5D 5KVDL 3CNKA 3QUXD 4RNRA 3O2DA 4FQIL 5E4EC 4ELMB 4LSVL 4UT7L 4ONFL 1NCCH 3WKNA 2PTTB 1UVQB 3FZUD 1KPVA 1OM3H 2C1OA 3TO2A 3BUYB 2BCKB 5LQBH 3WSQH 4LASL 1OAQL 1WT5A 1SMOA 3X3FL 4HS6A 4XPAL 4RGNB 5BV7C 1QBAA 5SWSD 5LVEA 4XCFL 4F7MA 1MCHA 1YNKH 1ZK9A 5JDSB 1KJVA 1TTFA 5J9PB 1ITBB 4XBGA 4QTHA 1ZGLB 4Q6YA 1RUML 3MFGB 4UI2A 5C0GA 1S7WB 5JOFB 3WHE1 3BH9A 4W6XB 5SV3A 2PYFB 5DFVC 1P4BH 3ZZ1A 2EYTA 4XZUB 3TYFB 3P77A 2ENYA 4YJZL 4PG2C 4ELMF 4MCYA 5D2NB 1MJ7L 4JRXE 3OAYH 4KKCD 4XP1L 5EORH 4FQLL 5K9QI 4JY4A 1SY6H 1ROWA 3QUKB 5DZLA 1RK0B 2M1KA 2XZZA 4OV5B 1CLOL 4FABH 2X4TA 3QPXH 1DE4A 5FGCE 1WFNA 3L7EB 5D7KD 4NWUH 2CH8A 2X9WA 4J8RA 3MJ8A 2EC9U 5BVJB 4D0DB 2OZ4L 5FGSA 1KLUB 2IPTH 3SDDA 3Q48A 5M94B 3THML 1OWRM 4GJTB 4YQXL 4KJYA 5L2KD 5EOQL 2ADFH 1CXIA 4KDTA 2PTUA 5GGTH 5CP3H 1E4XI 5F72S 5EOCJ 1UM4L 3QQ9C 5DT1L 2DYPB 1ADQA 1JTPA 3GSNA 5L9DH 4PJIA 2OK0H 3SDAC 1VADA 3GRWH 3KYNB 3U79A 5DJZB 3F58H 2AJZB 5FYLL 1S7UB 1N7MH 2PXYD 3GKWL 2EXYC 1TQCC 2BVTA 4R4NC 1QNZH 3RVXD 2YD2A 4NO5B 5IGXL 3TBYB 3E2HB 2BOCB 4Q6IB 4P5KA 3ILQD 4XMLH 1T89A 1SHMA 4PJEB 1AO7A 3HUJB 4Y4HD 4FQ1H 3QI9B 4UNUA 1QR1B 4P23C 5CS7A 3KGRA 4JJHA 1IGYA 4WWID 3LN5A 2NY3D 2W0FB 3EOAA 4YDIL 1MFDL 3KPNA 4N90E 1R5VB 5F7EH 3I6LD 5F93C 2BP3A 1ZAGA 1FV1A 4EBQH 2CRIA 2LTQC 3OAZK 1NFKA 2CLZA 3MV7E 4WDIA 4YK4B 1V5JA 2CDFA 3MXWL 1K6QL 5C0FB 1T83C 1FZMA 5BQ7B 5I8OL 4OJFL 4XXDB 2CKNA 2MKLC 5CIPH 5JHDD 3MV7A 4YX2L 5TE7L 3IFNH 3HMWH 3UPAA 1ND0A 3BD4A 3SKMA 3UTTE 3GHEL 1Z3GL 3KWWA 3WXVH 2IPKA 4ZPVA 2R69H 2IQAA 2W9DL 5I1CH 1JI2A 3WS6C 3HMXL 4LKCA 2GK2A 3QG6B 3UTTA 4K9EH 2LU4A 1LEGA 1UXWA 3Q1SH 1YECH 3VFWB 1AIFA 2FCBA 3SE9L 2DI7A 3VFNB 1F58L 5T1MA 3VFOB 1D5BB 1JPSH 1P7KB 5FKAA 3GI8L 4P9HC 3DWTA 2A77H 4NRYB 4Z7QE 3LQAC 4PBVC 1KC5H 4L3EB 5F7WC 4MQ7B 4BQ6A 4BH8B 4EDWL 3CFKB 2VLLB 4F33A 2XKUA 1QEWB 4GQPH 3K8MA 2E7LA 1XMWA 3FQTB 1RK1A 4ZXBB 2VWEC 4HUWB 3K3QA 4F7CA 4BUHA 2DJUA 2I9LA 4NM4H 4Z76B 4AY0A 2AEPL 4XPFH 3R8QA 3BGMB 4X6CE 1M6OB 1J05A 4GRLD 2NY1B 4OCXH 4NT6B 4IRJB 5I1KH 3G9VA 1J7VR 3QFJD 1T5WB 4NO2B 1EJOH 2IAMD 3TH2T 4OGYH 1YNTA 2XZQL 3S88H 2N7BA 4QGYA 1YYLH 1M71B 4J1UA 5DJCB 1XR8B 2OQJA 4OB5H 4V1DA 1K5NB 4L9LB 5E00A 3IB4A 3O0RH 5EU3A 2ZCKH 1PKQE 3GMOA 3IVKA 2VDNH 3I02A 2YEZB 5DHVH 4M7LH 3QIUC 4EKXA 5ICYB 4L5FH 4HK0A 3A0OA 1NKRA 4QXTB 3VXPB 1F3JA 4DKEH 3O81A 4Z5RA 4FFWC 5JMOC 5EC1B 4QHUB 2XTJC 3GMQA 1HINH 2ZNXA 2F53B 4O5LH 2OP4H 2VLRB 5D8JH 3O6KH 4IMKC 1UM6L 3ULUD 4ZAKA 3VXRB 3LQZA 3LKSA 2NXYB 3VDBA 1FL5B 3HZKB 5DD1H 3F5WA 4PJBE 4U1NA 5E7BA 3V0VB 2H32H 4MJIB 2Q8AL 4HV8A 5I76A 3IJHB 3FO1B 2IG2H 1DVFD 3G6JB 3MJ7B 3C5JB 3QCVH 4JB9L 3LN9A 3K4DA 5FKPB 3FT2A 4NQSB 2V2XA 4PJBA 4WUUD 1V7MH 4HJJL 1CYGA 4LRNH 3KLHD 3P9LB 1FDLH 2FJGA 32C2A 2Y36H 1M05A 4OZHF 3BP6B 4YXLL 4MLIA 2IH3B 4I0PD 3IS1X 2JB5H 1TLKA 4WWKC 3AAZB 3R8BB 3O3DA 3PNWB 1KUMA 4N1EA 1F4YH 1IKNA 1AKJD 2F5AH 1YMMB 4OTXL 4MMXC 3NZHL 4YHPB 4GG6A 4O2FB 1U9KA 4EXPX 5KSAC 5D7IE 3G6JF 3GUTB 4NJ9H 1IQWH 3RWGA 3LSOA 4AM0B 2JTDA 1WCBA 4UT9L 3EJYD 1U91A 3DUUA 1Y18B 3S97C 1EEQA 4U31A 5IV2A 3S96A 4GH7B 1K4DB 5D7IA 5JPNA 2E27H 5JIKA 4LHUA 4MX7B 1R5IB 3U7AA 5CINL 3V7AE 4O4YL 4U2YA 4M8QA 1NPUA 4Z0XB 3OR6B 4JDTH 4P4KD 2XXCB 4G8GD 3GK8H 4MXWL 1NKOA 1T04A 3UTZA 3LKPA 3QXAA 4L8SA 1K85A 3MUY1 4LOUC 5MEOB 1UB5B 3WEXA 5HYSA 4U1HB 3V95A 3U0TA 4LFHD 2J6EH 2HKFL 1TETH 5JLZB 3MRDB 3Q5YA 3QRGH 3L5WB 2BXYA 3NABL 3NOIA 3MRKA 3TBWA 2FX7H 2YD8A 5I8KH 2K9UA 1ONQA 1HIML 2FECI 4QHMA 3SDCA 4N0FA 3MNWB 4XI5D 4W6YB 1G7HB 4P0DA 5GRVK 5D2LB 4D0CA 2AJVL 3CUPA 3H42H 5E2VH 5IVXE 3TC9A 5EBWB 5F3BB 5E99H 1VKXB 5CLTA 2BY3A 3ULVE 4XBEH 3DRQA 1A3LH 3A6BL 4HBQA 5CSZA 4KI5F 3I9GH 4GXVL 1I1AB 3V6BR 4JPKH 1LEIB 4R0LB 2UV3A 4O00A 5IVXA 5FYKH 4RQQB 4JM2D 1VPOH 1A2YB 3T8XB 3KPSE 1MAML 3QAZC 3U4BH 2VLJB 4GW4A 1ZSDA 4DN4H 2ICWA 2VDRH 4DW2L 5TQ0H 5KVDH 3HCVA 3WUWB 4FQIH 2Q3ZA 4UT7H 1B4RA 4ONFH 3KPSA 4L9DA 4D8PB 1A7NL 4QXGH 2YUVA 1UC6A 4A2LA 5D2LF 1U3HA 3N50A 5K9JH 2YPVL 2E9WA 1OAQH 4GFTB 1R3JA 4KKNA 2Z0BA 3X3FH 4YHIB 4XPAH 2RQ8A 4OGAC 4BSWB 4LLMA 2EYSA 3LKRB 5EUOB 3TVMA 3CC5A 4ZYKB 4NM8L 3MRQA 2CD0A 3C6LC 2BXZA 1HNFA 4JVPA 1U41A 4BUGA 5FYKD 4ZFFB 5CZKA 1JMZA 5J0BA 3F65A 1IC7H 5F89B 2FBJL 2PTTA 1UVQA 1G9MC 1OVZA 1P7QA 1EEUA 2W07A 3BUYA 3FHAA 3MLXL 3UJTH 3BWAB 1MJ7H 4MXQC 1G1CA 4XP1H 4FQLH 2XNAB 3OBAA 3SO3C 2ERJC 1DFBH 1CLOH 2E5EA 2E6PA 4EJ1C 1SJXA 5E2JA 2HAZA 3MLSL 4ORGA 4Y4KD 1MCIA 2H45A 4Y0GA 1ZGLA 5D2NE 5HPMA 3FAWA 4QKXB 1CIUA 2DQHH 1H3PL 3DVIA 3EDKA 2DOCA 1S7WA 5JOFA 2R9HC 2BNQB 3BZ4B 4WI8A 4YBHA 4XZUA 3TYFA 4TVPL 3THMH 4YQXH 1BVLB 3MACH 5D2NA 5BJTB 1I7TB 1JGDB 3ZTJG 1IAOB 3QUKA 5HDLA 3H9SD 1RK0A 3QIWC 4OV5A 1UM4H 4PJCB 1N8ZB 1U36A 3KXFB 2WP3O 3DSFL 4BZ1H 1RZKC 3L7EA 2ZKHL 5FYLH 3T08A 1FSKC 3GKWH 3UTSD 2FH6A 1KNOB 3CIQA 5IGXH 1ZA3B 2DI8A 3QUYD 4D0DA 1MCJA 1X3DA 3PDOB 4NQVB 5KSVB 3CVIH 1AGCB 4UAOC 4WRLA 1CDUA 4WI7A 4YDIH 4U1KB 4PLNC 1KT2B 4R7DB 1CS6A 1NCDL 2DYPA 2DM2A 3ARRA 1JI1A 1QSED 1Q9KB 3H8NA 2H2PC 2XICA 3O2WH 5CIPB 4PJEE 2YPLB 1SBBA 1G6RH 3KYNA 4FFVC 3HUJE 5DJZA 3GI9H 2AJZA 1S7UA 1TPXB 3ZKND 1K6QH 5T1KB 3BP5B 4NO5A 4LVNC 5F9OL 3TBYA 4OQTA 2BOCA 4Q6IA 5FYLD 5ACMA 5I8OH 4RX4A 4PJEA 3HUJA 3TNNB 3QI9A 1QR1A 2XWTB 5IFAL 3L3KB 3OKLB 3LHPH 5TE7H 2W0FA 4M62H 2DTML 4Y19B 3EYUL 2EKJA 2J8OA 4R97B 1K3IA 1R5VA 3QFJB 4OFDA 4JVUA 2W9DH 4N0CD 3VWJB 3MLYL 2C4FU 1VHPA 4X80L 4M00A 1YYMH 2J8UB 3WNNA 3VG0H 8CGTA 3H9ZA 3DIFB 3P2TA 2LVEA 5JA9A 2EE2A 5ISZE 1OLLA 2BDNL 4KKBC 5BQ7A 3SE9H 3NN8B 1BOGB 4HC1L 1BBJA 5FF6B 2EECA 1ZGLP 3QWRD 2FWOB 3GI8H 5EO1B 5HYQB 2E7MA 5CZVL 4F9LC 3QEHB 1C08B 4EDWH 2BERA 1QSFB 3EYOB 4XVSL 4UV4L 5GZOC 3B83A 1N59B 3BRFA 1EMTL 4L4TB 3S34L 1CU4H 4HWZB 3VA2C 3QG6A 3VW3H 3LS4L 4K3JL 2XG4A 5F21B 3SOBL 2AEPH 4RMWA 3TO4A 2APTA 4R4BB 5MHSE 1FO0L 1WAAE 4L3EE 4MVBD 1DUZB 3U1SH 1I75A 3VFWA 2FO4B 4G6FB 3VFNA 4Q9RL 4G8IB 5TE6H 2X4SA 3GGWB 1D5BA 2FEDC 3K4AA 1P7KA 2NXZC 2R0ZL 5JOPE 4KGLA 2HH0H 4NRYA 2APBA 4L3EA 4R3SB 4MQ7A 4BH8A 3VJ6B 1QEWA 4TUOB 4F2MB 5LGHL 5JW4Q 1CLYL 4B0MM 5FOBB 4AIZA 4ZXBA 4UU9B 4U1IB 4HUWA 5JQ6H 2ICWJ 3GO1H 3PL6B 3U0WL 5EU7E 4WI4A 4ZOBA 4Z18A 1M6OA 5JORA 3STBA 4KMQA 4WTWA 4YHYB 4NT6A 1NBZB 4ZNEA 5JW5B 2AEQL 1KCVL 2J2ZA 4HEPG 4IRJA 4M7KH 1CGVA 1HSAB 2O5ZL 3C60C 3WFZA 4KK5C 1T5WA 4NO2A 3RTQB 2JF1A 3GIVB 2VZVA 1WZ1L 1DANU 4QWWD 1S9XB 3TIDB 1M71A 2AK1L 5DJCA 4LAJH 5I8EB 5GS0C 2IADB 3K1KC 1UM6H 4HKBB 1UACL 1K5NA 4BJLA 3MZGB 2ZUXA 4J3OC 1MREL 1VCAA 5IWLC 4XB7A 3B4NA 1OT2A 3QXDB 4P9ML 4S1DC 2NZIA 4X6DB 1XCTB 4QXTA 5GZND 3VXPA 4JB9H 12E8L 1EVTC 2VLRE 1Q9OA 2DL9A 2X42A 2K7PA 2QR0B 1MHEB 1G7LB 4QOKE 2AKRB 3HAEB 5C7XL 2Y06L 4JFYA 5I0DA 2YWZA 3ZKMC 4KRPB 2DIAA 5EC1A 1HOCB 4QHUA 5FGBC 2VZ3A 3C8KB 5CZXC 2F53A 2VLRA 1E4XH 2F5BL 4NN6C 4UOW0 3VXRA 4LSRH 4YXLH 4BZ2H 3BH8B 1SM3H 3MV8D 3G9AB 2D4FA 3HZKA 3RAJL 3T0VA 4GT7A 3C8DA 4WFEE 4U6XB 1JWMB 3V0VA 4G7YH 4MJIA 4YBLB 4B7IA 4G6KL 1QZ1A 5KANI 3IJHA 1MFEL 4OTXH 3MJ7A 3C5JA 1PZ5B 3QO1B 5F6IB 3W9DA 1OLZA 3BQUA 3U2SA 3F7QA 3AFLA 3T3MF 4CGTA 5DJXB 3KPMB 1CL7I 3QQ9D 4HUXB 4NQSA 2IANB 4ZO9A 4Q7DA 4M02A 1KIUA 2OS7A 3P9LA 4UV7L 1A7QH 4UT9H 2PO6B 2EXYD 3P9WB 3BP6A 1AD0B 2IH3A 4K3GA 5L8LB 1JZ8A 4Z7UB 5I1GH 3SE8L 3QEQB 4KMTH 3BRDA 1PDKA 2NW2B 3KPRB 3AAZA 4P23D 3PNWA 5IB2B 4QHNA 5HDBE 1EFQA 5CINH 4LLAA 4EVNB 4LNVA 4YHPA 5EDXA 4P59H 3W2DL 4MB5A 4MXWH 4O2FA 3TA3C 5C0BD 4WFFE 3GUTA 3O3EA 4OQ1A 1WBZB 4Q9QH 4BM7A 1UZ6F 1WITA 2HKFH 3L6FB 4GS7C 3BAEL 3O8XB 1JGEB 4JHAL 3BGFC 3ES6B 1K4DA 3B43A 3NABH 2J4WL 4P9HH 3HTLX 1TMCB 3DBXB 4Z7VF 3QUZC 1HIMH 4MX7A 1R5IA 3FN9A 4YDVB 4Z0XA 3OR6A 3CX2A 4OUUB 5IQ9A 4W68A 1JNLH 4M3JA 4JM2F 3WFBL 3D3VD 1FH5L 1JUFA 4D3CL 4NNYB 4K23L 1Z5LB 5MEOA 3C9NB 2R29L 3A6BH 4HWNA 4LPYA 4U1HA 3ILPB 1OTUC 1G9NL 4KH2A 3MRDA 5TF1L 5JLZA 3L5WA 4L3CB 1JNJA 3B9KB 4JEGB 5F7DB 5DVNA 4OLWH 1XGPB 5FM5M 3TCXA 4BQ9A 4XX1E 5E4IA 3MNWA 1G7HA 2A74B 1UKSA 2VXSL 1HQRB 2ZSVA 3T0EB 3EDFA 3RPKA 2YPVH 2E8YA 1I1AA 3BWUC 1LEIA 4R0LA 4O51B 3FB7B 3BI9X 5IHBA 1D5IL 1WBXB 5DO2C 3TN0C 1P4IL 2V5TA 1A2YA 1J87A 3T8XA 4NM8H 4JRYB 5D7JC 1RIUH 3FOLA 2IBZX 3UBXI 2YRZA 1CN4A 3ARFC 3WUWA 5KOMC 5EOTB 1QLRA 3NCCB 1DLFL 4ODHL 4JQXA 4LVEA 1FAIL 2FJFB 2FBJH 4D8PA 2VLKD 1R3KB 4QNPF 4KJWC 1JWUB 3MLXH 4LLUB 5BRZE 3L3DB 4HQQL 2GSIB 4YHIA 1EZVX 4BSWA 4LF3B 3LKRA 4WHCA 5EUOA 1J0IA 3VGDA 3QIUD 3VI4E 5E8PB 4ZYKA 5DMJB 2IEPA 3MLSH 4OGXH 3GM0A 4ZFFA 2AK4B 1CDJA 4FFWD 1MCSA 1H3PH 2XTJD 2EDQA 2GQHA 1X5ZA 5F89A 3V8OA 3VI3E 4MQSB 4TVPH 2VERN 4YXHL 2OXGA 3HKFA 5J7CC 5GS1C 5IBUG 5GJTL 3P3YA 4CNIB 2OM5A 1JYNA 5HXMA 4PRAB 5T33H 3VWKB 5IHZB 4RZCB 1DBAH 3DARA 4HMEA 4H20H 4NKOB 2ZKHH 5GSRA 3MLWH 4U0RB 5SWZB 4OBSA 2H1PH 3DURB 4EIZC 1ZA6B 1A1MB 2P42B 4X98B 3BZ4A 4PJCE 5KZCD 1DBKL 3KXFE 1QRKA 3MRGB 2APXA 5J12C 1XCQA 3SGKC 4EUPB 1CL7L 1BVLA 5BJTA 4OCSL 1OOAA 5ICXB 2B5IC 1JGDA 2X1QA 3WIHL 4PJ9D 1KFAL 1IAOA 3CH1B 4TVPD 5EU6D 2AW2A 4HK3J 3ZHKA 4WWKD 3FFCD 4PJCA 1NCDH 2VDKL 1N8ZA 2X44D 3KXFA 3Q6GL 1ZLSL 3DUHA 1MHPL 1CVRA 3CDCA 2NY5L 3BVNB 3LOWA 3HB3D 4OD3L 4LVHB 4NQCD 2EDLA 3KYOA 8FABB 4N0YH 5F9OH 1KNOA 1GC1C 1ZA3A 2VKWA 1W0VB 1MFNA 3K74B 2FX9L 1V7NL 3KHQA 1ZOXA 2Y72A 3T04D 5IFAH 4OZFH 1AGCA 1Z2KA 4XHJC 5T1LB 5KSVA 3QO0B 1JZ7A 5BMFH 3AUVA 1MI5D 2YPLE 2DTMH 3MJ9L 4N1CA 3EYUH 4U1KA 4JDZB 3VFRB 1AGBB 1KT2A 1MAJA 4R7DA 1Q38A 4PJXF 4EN3B 1Q9KA 2QADB 3RKDC 1KSRA 4UOJA 3WYRA 3MLYH 5JO5B 5D7LE 3RZCA 4U0QB 2YPLA 3MGTB 2P5ED 2AXHA 3IDGB 3LRSB 4GKOA 3VFTB 4NCDA 3ZDYF 4ELKB 2R15A 4X83A 3S35L 3WS3A 3L3IB 4LOUD 5T1KA 2F9BT 3BP5A 2BDNH 4YLQT 1QTYT 1CDHA 5D7LA 5F9WB 2M8XA 1A21A 3CGTA 4HC1H 4I3RL 4BFEA 4DK3A 3S5LA 1E6JH 1RY7B 2XWTA 3BMWA 1NFDE 5TDPB 3V6FB 1CD9B 3IF1B 3L3KA 3OKLA 1A02N 2IGFL 3V4PH 3V6OE 5HY9B 1CFTA 3VXSE 2J8UE 4YEFA 1YY9C 3SDXF 3GB7B 3M45A 2B1AL 4UV4H 1CFQB 1LO0L 3IRPX 3S34H 1N4XH 3VWJA 3AREC 2JK5B 5D1XB 3V6OA 2PW2B 1FFRA 2I26N 3NTCL 1L4IA 2J8UA 2NY4C 4HS3B 3VXSA 5MEQB 5JPMB 4J3UA 3MX0A 4M6ML 3SOBH 2DBLL 1MOEA 3DIFA 4Y5XB 1FO0H 1P1ZB 3WHE0 3E1F1 3INUH 5B3NA 4DFIA 1MCPL 1J1OL 5FF6A 3FB6B 4Q9RH 5I19L 3IDIB 4UILL 3AU1B 4UQ2B 2FWOA 4L4TE 1F13A 2PCPA 2R0ZH 4NN7B 1RZ7L 5EO1A 3QEHA 1C08A 5CEZE 3P30L 1QSFA 2Q6WB 3EYOA 2EYRB 1N59A 5LGHH 4L4TA 1CLYH 1G9MH 2HFGL 4HWZA 2R4RL 1F2XK 1J86A 4YHZL 3U0WH 1D5XA 3ZDZE 1JNNH 3FQNB 1JF6A 4P5TA 4R4BA 1DUZA 2XN9D 4FQQB 2FO4A 4ETQA 2AEQH 4N5UA 4RAVB 2M2DA 2O5ZH 3GGWA 2C3XA 3HLAB 5ECJE 2MTPA 3RUGF 3ZKQD 1JRHL 4HWUA 1V3LA 1WZ1H 4R3SA 3C6LD 3F6LA 4P57B 2Y25A 1MSPA 5FAAA 3VJ6A 3WNMA 2AK1H 4I1NB 4TUOA 5FOBA 3CFCL 4RMVA 4UU9A 5D93B 1HHHB 4HGKC 1MCWW 2X4NB 3PL6A 5CP7B 2GJZB 3B5TA 1RZIB 5JIHA 4DJMA 4MXQD 3VRJB 1NBZA 5JW5A 5HYIA 1RZKH 4DVRL 3EDJA 3RTQA 5C7XH 4JLRB 4LIQE 1PX4A 1EGJL 5EIQA 3GIVA 4IIQC 3NCFB 2B2XL 5AZEL 1S9XA 1IQDB 3FONB 4QRPD 3PHQB 4R9HA 5I8EA 5LCVL 2IADA 2F5BH 3STLB 2ZG3A 4HKBA 4ZSOB 3MV9B 1X5LA 3BISA 2VL4A 1DBML 3FFDA 4JHZA 1J18A 4X6DA 1XCTA 2EDYA 1JMXA 1MRFH 3QIWD 1L0YA 1MHEA 4KVCH 1G7LA 4RFNB 3HAEA 4LCCC 2NPLX 4HMCA 1MCBA 3C8KA 4BQ8A 4LFHG 4X5LA 3KPTA 1AHWC 2RCSH 3BH8A 4YWGL 1ITCA 2HTLC 1TJIL 4H8WL 1KCLA 4DVBB 3RJQB 4U6XA 4BKLB 1QBML 1JWMA 1AFVL 2LVCA 4MXVF 5C3LD 2VL5B 5HHQB 1MRDL 1PZ5A 3QO1A 4PRHB 3VXNB 1GGIL 1JPGB 3W2DH 2O61B 2HFFB 5DJXA 5F9JB 3KPMA 1KCUH 4HUXA 4U1GB 4C56E 2H2PD 4F8QA 4YNYB 3QEQE 3BE1L 4JPWL 3TPUB 3WHXB 2PO6A 1N5AB 5JNYB 1LO3L 4K7FB 2C1PA 3OGCB 1AD0A 4DAGL 1ED3B 3LEXB 2J4WH 1TCMA 1BP3B 4Z7UA 5HHPB 5ADPH 3WJJC 3P0GB 3QEQA 3MRIB 3KPRA 1MCEA 2ADGB 3G6AB 5IB2A 2R2HA 1F2QA 4EVNA 4O9HL 4MJ5B 1I1FB 1OAUL 5ADOL 2IBBA 3WFBH 2MCPL 1FH5H 4PJ8B 1WJ3A 4K23H 1OSZB 3C87A 2DQFB 5HJ3B 2R29H 5GRZA 1WBZA 4GAJL 4Z7OF 3IYLW 3N9GH 1EO5A 4YC2B 3ELAT 3L6FA 1G9NH 3O8XA 4YFDB 2HWZL 3CVHB 1KLGB 1IZJA 1JGEA 1AI1L 1U8OA 3MPCA 4LRIA 3ARGB 5C08B 5I71C 4KKBD 3ARPA 5IJVB 3TYGL 3DBXA 5EN2B 4GRMB 4ZUWB 4LGSB 4YDVA 2Y6SC 2VXSH 3MLUH 4PRBB 3SJVB 4ODTH 4OUUA 2HVKB 1QQDB 2NCMA 4NHCH 4NUJB 2GY7B 3C9NA 1QFWM 1ZGLM 1EHLL 4HIJB 3ILPA 2VR4A 2VO5A 4KUCD 1T0NB 3RWDA 4UUJB 5ESQB 3K2UL 1P4IH 4RISL 4L3CA 3B9KA 2NY6D 5F7DA 1XGPA 1FNEB 4XC3L 3T0EE 4LSUL 2FEDD 4PP1C 4F57L 2NXZD 1VERA 4JZJC 1GPOH 4X6EB 5GS0H 5IMKB 1DLFH 1HQRA 4F9PA 3BPNB 3CCHB 5C09D 5IW6B 5B39G 1UJ3C 3T0EA 4HPOH 4JRYE 4LL9A 1ZANH 3FMGL 4HQQH 4M5YH 5I2IA 5I0ZA 5FOJA 4O51A 3FB7A 2WIMA 4GMTL 4HMDA 1MLCA 3SGDI 3WIIL 2C3HA 1WBXA 1T3FB 3FB8A 1CD0A 4I0CC 4P2RB 4JRYA 1X9QA 3VG9C 1WF5A 5DJ6B 1G0XA 3O6ML 3LB6C 5CSGA 5HVHC 4MA7L 5EOTA 3LKNA 3IDMA 4PGEB 4PYGA 5HGHB 2P49B 2KH2B 1MQKL 1BX2A 2FJFA 3GFUA 4HX1B 4PREB 4CVWA 5GS0D 1R3KA 4KTEH 1JWUA 5KS9B 1AD9B 3RI5K 4LLUA 3L3DA 1NAMB 2HFEA 3QDGB 5D72L 5EOCL 2CDGB 4HIHB 3O2VL 1DQMH 3CSYB 5I75B 4LF3A 4G80B 2OZ4A 4NBZB 5E8PA 4ZQKB 4PGZA 1KPUB 5DGQA 3UJJL 1OY3B 5D5ME 5DRXB 4I3GA 2AK4A 3O3AB 4G8FB 4O2EB 2WUBH 4HHAB 3ZKMD 4CUCA 3O6FC 1IGIL 4MNQB 2P5EB 5F9AC 3IKCA 4E41D 4MJ6B 4CKVX 5D5MA 1DBKH 3ARQA 4ZTPL 1CL7H 4IHOB 4OCSH 2HA1A 1TCRB 4OSUL 1KFAH 4HWEL 3SQOL 4QHKJ 4RWHA 5SWZE 4CNIA 1GYAA 2VDKH 3NCJL 4PLJD 4PRAA 3SDDC 3Q6GH 3VWKA 5IHZA 1ZLSH 1MHPH 2NY5H 4KROB 4HAFA 3H7BB 4NKOA 5F96L 4OD3H 3WD5L 2UWEF 3QQNA 1JPTL 1O7VA 3BZFB 5SWZA 2D9QB 2QQLH 3DURA 4Y2OA 1ZA6A 3B3IB 4JFEB 2FX9H 1A1MA 1V7NH 4X98A 2AVGA 4DKFL 2HN7B 1GOFA 3MRGA 4EUPA 2QSTA 3V5HB 1ZTXL 3P4MA 5J89A 5ICXA 4Y1AD 1B0RB 3MJ9H 3EZ8A 3CH1A 4NP4H 2JIXB 3BDYL 3LS5L 4IDJL 3DXAD 1KPRB 1DEDA 1I1YB 4NFBA 3GM8A 3BVNA 4N5EC 1IVLA 2AXJA 3T0DA 1RUQH 4OCRL 3AXLB 2EC9T 5HHOD 3S35H 3TA3D 8FABA 1ODAA 5J11B 1W0VA 3TT1L 4P46A 1WIUA 4I3RH 4Y4FB 5ALCH 2E9IA 3HMXA 2C9AA 4M48H 1VFAA 1IT9H 3QO0A 2IGFH 3C8HA 4KK6C 1SJVA 3UTPE 3I6GA 4JDZA 4GBXB 3VFRA 4YO0A 2DIJA 2B1AH 1Q0XL 1T66C 3MOQA 4EDXB 1CLZL 4EN3A 5FA4B 1QYGL 2J1KA 3RGVB 5JO5A 1XIWB 4K8RL 2EEAA 3MGTA 1GL4B 3LRSA 3VFTA 3NTCH 3RRQA 2XI9A 4ELKA 3LKOB 1UWXK 4M6MH 2X09A 2DBLH 1S9YB 3L3IA 4ZUVB 4WI3A 2UY7A 2ARJQ 1YMHB 1INDL 1LILA 1MCPH 1J1OH 3PWPD 5I19H 2DS4A 2AQ3A 1OTUD 5TDPA 1E4KC 1JZ3A 3IF1A 4MQXC 2APWA 4MSWB 5HY9A 4OLEA 3GB7A 3QDHA 4IRSD 1UH4A 3S37X 1MWAL 5IBLC 3R0NA 1K8IB 1CFQA 2Y07L 4IJ3B 4NQXA 3PP3K 1NC4B 2HFGH 2JK5A 1IGML 3I3EA 2PW2A 3O2DL 1BFVL 2R4RH 1UKTA 3L9RB 4HS3A 4NHUB 5JPMA 3X12B 4Y5XA 5EIVA 1O7SA 1P1ZA 1G84A 1WWCA 4UDUB 3W5MA 3H9YA 2XWBB 5F9DC 4CU6A 3IDIA 3AU1A 4UQ2A 4PJ5B 5DO2D 3TN0D 5E08L 1JRHH 3MGAA 5D7JD 1CXLA 2YD1A 1G7QB 2BSTB 5HGDA 4LKXA 5DQDL 2YD3A 1BFOB 2Q6WA 1B88A 2EYRA 6FABH 3ARFD 3HS0A 1K8DB 4DOHB 5TDNB 2YD5A 1A3RL 1VGEH 3CFCH 4LVOC 5E94B 4UBDD 4OIBA 5K9QG 4F7EB 4WEBL 1QFOA 2UYLA 2GT9B 4K3DL 1L0QA 4KJWD 3FQNA 5DF0A 4FXGB 4FQQA 1MJUL 3KYMB 4RAVA 5HTSA 4DVRH 3HLAA 4WU5B 3U36A 4MNGB 1F4AA 1QOKA 2B2XH 4ODBD 4WW2B 4P57A 3RIAK 5BO1L 4OD1H 3HC4L 1A6AA 1S9WA 1GSMA 1HHHA 5IFHL 4EI6A 1DBMH 4I9WE 3D9AL 2X4NA 2R2EA 5CP7A 4W81A 4QLRA 1A6WL 1RZIA 4HT1L 3RWEB 4FQCL 5E6IC 4M93B 5DRZB 1DEEB 4M6OL 1U0QA 1RD6A 3E8UL 4Z0BL 2R39A 4ZSOE 3KS0J 3G5ZB 4JLRA 4P2OB 1U8IB 2PYED 1N64H 4OZGB 3UXFA 1ADQL 1RSFA 3GSNL 25C8H 1I8IB 1IQDA 2X40A 3FONA 5IHUL 3PHQA 5DSCB 1JZ5A 1QPPA 2AV7B 3STLA 2OCFD 4ZSOA 3MV9A 4LHJB 4YWGH 4GUPB 4O58L 1TJIH 2J12B 4H8WH 2VZTA 1MCRA 5DMIH 1QBMH 2R1XB 3TH3T 2GAZB 5HYJD 1AFVH 2BVQB 1BVKA 1EIBA 1MRDH 4I5BB 4NC2B 4J4PD 4I18B 5D70H 5BS0E 1CLCA 2CUMA 4XRCB 4LPVA 3JTSB 2AABL 4OV6F 1I85A 1IKNC 3BE1H 4JPWH 1PZUB 4DWHA 4HCRH 1XGTB 3ALPA 1LO3H 1C7TA 1OGAE 4OZGF 4DAGH 1EAJA 4NO0B 2WBJC 4LQ1A 2L4OA 3BKCH 4DVBA 1RFDH 4OZIE 1YEEH 1LP9F 3WIFA 4XHJD 2PTVA 2K1MA 4DTGL 3ORJA 2VL5A 1AQDB 4O9HH 5HHQA 3AY4A 1OAUH 4PRHA 3VXNA 5E5MB 5ADOH 1T2QL 3EYFB 1JPGA 3PWVA 2O61A 5F9JA 2BZDA 4OZIA 1NGYA 2BJML 4FQXC 3RKDD 3C09C 5DUML 4YNYA 5C09B 4GAJH 1ZLUK 2PF6A 2FSEA 1RPQA 1B4JL 3WHXA 1N5AA 5JNYA 5AD0B 4K7FA 5IFJB 1T7XA 1SEBB 3OGCA 2HWZH 4Y89A 1AI1H 3UDWA 2HLAB 5DMGC 2IWGA 4L8SC 3LEXA 3T1WA 3TYGH 4KKAC 1BHGA 4S1RL 2VDPL 3MRIA 5TE4L 4HJ0C 4HF5L 2ADGA 4FS0A 2IQ9L 4PJAB 1IM9B 3EKCA 1GGUA 3C5ZA 4MJ5A 1SJHB 2P4AB 4KQ3H 1I1FA 1YY9D 3WLBB 4APQC 4KUCF 3SKJL 3ABZA 4Y2DB 1KIRA 2GJ6B 4MAYB 5C08E 1OSZA 4NQED 1F3DJ 2CIKB 5B3JF 3O6LL 3ARED 5HJ3A 3DGCR 1EHLH 3RIAF 2NY4D 4WY7H 1X5YA 5IB3B 4MD4A 2IF7A 1PLGL 4HDIB 2EDTA 4NDMB 2ICWI 3K2UH 1KLGA 3CVHA 4RISH 1HXMA 4G6JH 4OFYA 5C08A 3JV6A 3ARGA 1KJ2A 1TITA 1N5YL 4L4VD 3UCRA 3UZQA 5IJVA 1NUDA 4YBQC 5EN2A 3RDTC 4GRMA 4I48A 2VXQL 4PR5A 2D7TL 4GKZB 4ZUWA 4F57H 3V5KB 3HZYA 5IUSA 3BKJH 5JW4M 2HRPL 3V2AR 5T3ZE 4PRBA 5J1SC 4LCIH 2HVKA 2P5WD 1QQDA 1BIHA 3X14B 3IAGC 5DUBB 2BMKB 3MYZA 3SKNB 2MPAH 3FMGH 3VXMD 2AJSH 2CSPA 4HIJA 3WIIH 4RFEB 3C08L 1T0NA 4UUJA 5ESQA 2YR3A 4IOFC 1MVUB 2CGRL 2ILLA 1FNEA 2NYYC 4X7CC 1VFBB 5GS3A 3S3JA 3O6MH 3SCMD 4MA7H 4OF8A 2MMXA 2WBKA 4X6EA 4OLZL 5IMKA 1GGBL 4U3CA 3CCHA 3N1MC 3QPQD 1OQXA 1J0JA 5IW6A 3W0WE 1V3JA 1NEZB 1IC4L 1T22A 4IS6B 1GIGH 1Z9SA 5ETUB 5EOCH 5IBTL 3T0WA 4XMKL 4JO4H 1I7RB 1QFWI 3MBXL 2Q8BL 4H1LB 2CIIB 3MBED 5HPOA 4P2RA 4KJPC 3UJJH 3E6FA 5C0AD 2OL3L 2ZUUA 5ID0B 2CK0L 1OAZH 3D39D 5J1AB 1SMAA 5DJ6A 5JIPA 5KS9E 4RGNC 5EZJB 2VZOA 4YR6B 1S7QB 2P8LA 4OFVA 3CX5K 4RRPG 4PGCA 4L3AA 5HGHA 4OLUL 4HX1A 4OZHE 1YNLH 3GMLA 4PREA 4QRRE 4J7RA 3CZFB 1WGOA 5KS9A 1AD9A 1TQBB 3H9HB 4S1QL 1NAMA 4YH6A 2CDGA 4HIHA 2W1NA 3CSYA 3HRZB 4NQUA 5ENWA 3BSZL 3GIZL 4G80A 2E6QA 4QRRA 3NCJH 5HHME 4ZQKA 5D2NC 1KPUA 5DRXA 3FT3B 5F96H 2Z91B 3CSPA 3CFIC 3GKZA 3LMJL 3O3AA 3WD5H 4G8FA 4O2EA 5GSVA 1PG7H 4KXZI 3T2OA 3OJVC 3NFNB 4YDLB 1A9BB 3QP3A 5DC0A 4MJ6A 2OR9L 3D0LB 4XAWH 1WBYB 4IHOA 2LQRA 4GG8B 1ZTXH 3VRLF 4U1LB 3WL9B 1T2XA 1TCRA 1LK2B 1FE8H 2HTLD 2IPUG 3BDYH 4IDJH 4M1CC 2OTWB 3MRJB 4OZFG 3ARBC 1B6UA 1MIEL 1FGVL 4N8VG 4YHML 4FFZL 4JFEE 1FRGH 3H7BA 4OCRH 1FNSH 3IXTB 1RJZB 3BZFA 1G9EA 1RZ8B 1T7WA 4KK8C 1DDHA 4N9GB 2Q1EA 4JFEA 2EIZA 2ZCHL 3HPLA 1EVUA 3ARDC 4I4WB 1D9KD 2HN7A 3FAXA 3Q6FB 1HKLL 1E6OL 4XT1C 1B0RA 1G7MB 5FUCC 4WTXA 3MNZB 2JIXA 3E2HC 1Q0XH 2HVJB 5JR1L 5I1IL 4HZAA 4H0IA 3QI9C 1JHLH 1QYGH 1I1YA 2HT2C 3VFUB 4Y88A 2ADJB 3T3PF 3AXLA 2R4SH 2YKLH 2Y23A 4TSBL 3RHWF 3MXVL 5ID1B 4AEEA 4WO4B 1INDH 4OD2B 4Y4FA 2P7TB 1XT5A 1C16B 3EYVB 4K55A 4U6TA 1ES0B 2J3SA 4YK4C 1TNNA 3UZEA 3UBXB 3MRRA 3QUXA 4GBXA 1LNUB 5E2TL 4G9FB 3ULVL 3PHSA 3UYRL 4EDXA 1F4HA 5FCUL 1U95B 2Y07H 1F4WL 5FA4A 3RGVA 5SWSE 2Y6SD 5CSBA 3O9WC 1XIWA 3O2DH 2YZ1A 2QHRL 5GGSY 1KTLB 4MGXA 5JUEL 4GAGL 4D94A 2I5YH 2YHGA 2QKIB 1S9YA 2VABB 4LEXH 4ZUVA 4PIRF 3HG1D 1YMHA 4TSAL 4Z78B 1CTNA 4GW1B 3JZ7A 3L7FB 1YEJH 2PN5A 3OMZA 3WN5C 5DUPL 2DDQL 5E08H 5DVMA 2G5RA 2ZUSA 3CFEB 3TBVB 1MCCA 4MSWA 2BVEA 3SBWC 1SEQH 4PLKC 5DQDH 3O4LB 5LGKA 4PP1D 1K8IA 1YPZF 2C4FT 1NCBH 5F1SA 1NUFA 1NC4A 1XF3A 1B6DA 1S7XA 2IALB 3MOBH 5GGUB 5D6DA 5AAWA 1V8HA 4NZTL 4MMZC 4PJ5E 4K3DH 2VXUH 5BW7A 3HNVH 3X12A 3ARTA 4NBXB 5D7KE 1ACZA 3OR7B 5C9JB 4UDUA 1MJUH 2XWBA 2P46B 5HYJB 4PJ5A 4XH2B 3F7RA 4DGYL 1I7ZB 1S78D 4MA3B 5HHXL 2DRUA 2CRYA 1G7QA 1FJ1B 2NY1C 2BSTA 1HWGB 1BFOA 3L3OB 1ZE3C 5BO1H 4IRJC 1P9MA 1FFNB 5TDNA 1QFWL 3VD7A 5E94A 5IFHH 1KIQB 3D9AH 2ADIB 2GT9A 3EDEA 1BZQK 1A6WH 4HT1H 3ZYZA 4FQCH 2A2QT 4FXGA 2EEDA 4L9LC 5A43C 2Y5TB 3KYMA 4M6OH 1N0LA 4DUVA 4Z0BH 4WU5A 1QA9B 1JPST 4MNGA 4WW2A 5F71A 1ADQH 3FQUB 3GSNH 3LH2L 1J0KA 5IHUH 2D0GA 3I2CH 3TV3L 3O6FD 5F44A 1ETZB 1ZT4B 1A7BA 4Z77A 3SY0B 1RJYB 2UVFA 4K71B 3RWEA 3OB8A 5ERWB 5I6XC 3OJMB 1YEIH 4S11A 1X7QB 5DD0L 1IGJB 1DUYB 2EZ0C 4CN1A 1AP2B 1FYTB 3QCTL 1GHFL 2DQCH 1DEEA 2NXYC 4AZ8A 1MUJB 1RUAL 1XF4B 2C3GA 3G5ZA 2AABH 4P2OA 3SDDD 4KY1L 1U8IA 4V2BA 1LDPL 5FIEA 4OZGA 1A6UH 2AXGB 1GGTA 1KLFA 1I8IA 2OJZL 4NZUH 4OGZA 5DSCA 4CRPA 2V2WB 1U6AL 2AV7A 1EBPA 3IFOB 2BX5A 3UPCA 2OI9C 3TH4T 4M6AA 3QIBB 3F7PC 1HXYB 1MCOL 2R1XA 1JGVH 2NY2C 2GAZA 4OQTL 4PGDB 4P2CG 5IQ7H 2BVQA 2D03L 4I5BA 3IU3B 4M7LT 4HGWB 4I18A 1T2QH 4G7VH 4XRCA 3JTSA 1AO7D 5DUMH 4TYUA 1B4JH 1XGTA 1WK0A 3HE7C 4ENED 4NC1E 2YWYA 1BD2B 3K0WA 1P2CB 3LEVL 4ZUTA 2R2BB 4NO0A 1ZLVK 3KYAA 5BOPA 4YEEA 3IDXL 1CFNB 2VDPH 4S1RH 1MH5B 4ZPTB 5TE4H 1Z9OA 4FZ8L 2IQ9H 4M43L 5DS8B 4KK6D 1AQDA 4NSKB 4WI2A 5E5MA 3SKJH 4E9LA 4U6YB 1T66D 5DJAB 4IDLA 5MENB 2EH8H 3O6LH 2UZYB 3ZHLA 2I27N 1T1YB 3EW3B 3EFFB 4PJAE 4KI5C 5AD0A 1PLGH 5IFJA 4QCIB 5GIRA 3VFPB 2WWKO 3RL2B 2DQJL 2HLAA 1GOGA 5DQJB 1YEHL 2IAMA 1UWEL 3UTTD 2VAJA 3VMNA 2D7TH 1KGCE 4PJAA 4MQXD 4U1SB 1IM9A 3U9UB 1QLFB 2HRPH 1ZT7B 1R0AL 1SJHA 3WLBA 1SVCP 2CKBB 3IFLL 4Y2DA 1I3GH 1OAKL 2CIKA 4MD5B 5SX5H 1LEKB 2DQIH 2H41A 7FABH 3NFPB 1X5AA 5IB3A 1T03L 3C08H 4HDIA 4WTZG 3PABB 5FB8B 5K9OA 2NY0B 2CGRH 4X9HA 3ULUE 4CW1B 3TWCL 2Z8WC 4GKZA 3V5KA 4R0LC 3KAAA 4MHHG 1GGBH 1H3UA 2YSSB 4OCYL 1WISA 3U46B 3X14A 4JR9H 4MYWB 2BMKA 5C07B 5E8DH 3SKNA 3PF2A 4GAYB 1N6UA 5IBTH 1VFMA 2KBGA 2A38A 4JQXC 1T5XB 1K3ZA 1FZOB 3HR5B 1DVFA 4RFEA 4O02L 3MBXH 2Q8BH 1I9IL 4V1DD 1MVUA 3EOYG 1U8PB 1VFBA 3GJEA 3SDAB 5BOZG 1PX3A 3MRCA 5F7FA 3EYQC 1QBBA 4X5WA 4K3EH 1NEZG 1TQCB 1PQZB 4I0PA 4IS6A 5KANG 5LXGH 4S1QH 5ETUA 4QTIH 2F8OA 4L29B 5E8EA 5HYEA 1JYWA 4RDQF 1I3RB 4XXCC 1RZFL 4UTAL 3BSZH 3GIZH 1I7RA 2PXYC 4H1LA 2CIIA 3RVXC 3P0VH 2H8PA 3T3ME 1VFOA 5ID0A 5D1QA 3LMJH 5J1AA 4Y4HC 3WIHA 4MLSA 5EZJA 3VXTB 1S7QA 2LTQB 5JTWA 3MLRH 2JJWA 2NY3C 4LK4A 4R2GB 5DYOB 3ZE0F 2V7NB 2OR9H 3CZFA 2O26U 2EDNA 3OG4B 5GS2D 4JO2H 3FN0H 3H9HA 1IGCH 1WEJL 4FTVB 2EC8A 3ARYA 1WICA 3HRZA 1MIEH 1UZ8B 4GRWB 3DRTB 3WFHB 3FT3A 2Z91A 3SKOA 4Z7NE 1U2HA 1V3KA 1NCWH 2ICCA 2X1WL 3NFNA 4OT1H 4QRQB 1A5FH 1A9BA 2ZCHH 3ALWA 2XFXB 1UB6B 5E7FA 3D0LA 1WBYA 2VLMD 1CQKA 2G2RB 3HPJB 1MVFA 1HKLH 4U1LA 3WL9A 1LK2A 1F45A 5E2WL 2VE6B 3WFDH 3NIFE 3ARVA 4RAUA 2P1YA 2OTWA 4ODVH 3MRJA 2GI7A 3WJLC 5JR1H 5I1IH 2BRQA 1I8MA 1FNHA 4I3SL 5IEKA 4UT6L 1J1XL 1IZKA 3IXTA 1RJZA 1OP5H 1RZ8A 2JJVA 1HKFA 4HKJB 4TSBH 3L1OH 4FQJL 1OF2A 3MXVH 3DTXA 1JHTB 1MWAB 4ZO6A 1AQKL 5JOEA 1ZHBB 5DVKA 3Q6FA 1TPXC 2LABA 4PP2A 5DMGD 2YPKB 2EH7H 3B2VH 1G7MA 2W65A 3MNZA 1W0YT 5E2TH 1P7HL 3D85B 3RVVD 4HJ0D 3UYRH 5FCUH 4XNZC 2C1OB 1F4WH 1HK6A 4M4RA 4GRLC 1F5WA 2E3VA 5DEFB 4KPHL 4APQD 3VFUA 4HS6B 1BQHB 2ADJA 5JUEH 3NPZB 2KQMA 3KPOB 4R97C 5C0CD 4F7MB 3SDCD 5ID1A 4WO4A 2D9CA 4TSAH 1OQOA 4OD2A 3WXWL 3UBXG 2FHCA 1C16A 4CMHB 1KCSL 1ES0A 1PKOA 3FL7A 5F70A 3MR9B 4QRTB 4JFFD 4YBQD 1LNUA 4HXAL 1G7IB 4WFHE 1U95A 3T0XA 1P6AB 4MCYB 3UTOA 4GSDH 3MTRA 4QHLB 2F15A 4NZTH 1KTLA 1L7TH 3QWOB 1HZHH 2QKIA 4WNQB 1ACYL 2VABA 5ABDE 2X4TB 2ZSWB 4E5XA 5DHXB 4Z78A 4JRXB 3VFMB 4GW1A 3KPSD 3SPVB 4XPTL 3LY6A 4ONGL 5C2BH 4KHTL 1BECA 1C1EL 3MJ8B 2E8ZA 1QBLL 2BSED 1U3HD 3CFEA 3TBVA 5J6GB 3QDMB 5HHXH 5MP6H 2NYYD 4HLJA 3AB0C 2DTSA 2HT4C 3O4LA 3DYOA 3JWOC 2LE9A 3AVEA 4IBLT 1QFWH 3TVMD 1MQ8A 4Q9BA 2IALA 3DPBA 5GGUA 3MRBB 1CF8L 1EGJA 1QG3A 3QUMB 5DZNA 4GQ9L 2C3WA 5H94B 4YE4H 3GSNB 2FEEI 5FECB 1SBSL 2X2YA 5CJ5A 3OR7A 5IROC 1LQSR 2VXTH 3HZVB 3GBLA 4XH2A 4J12A 3B9AA 1C5DA 3U6RB 5DURB 4KJPD 3OWEA 4QHKI 1I7ZA 4MA3A 3LD8C 4X6FB 4P5KB 1FJ1A 2HKHL 2XOTA 5KSAB 2GTZB 3L3OA 4W6WB 4JO3L 4B41A 4RGND 1N6QL 2JELH 1UH3A 2ZCLL 5EB9A 2X70A 3RTQC 3LN5B 4HFUL 4XC1L 1T20B 4JG0H 2ADIA 1BQLL 1KCRH 1RAMA 2MOVA 5FGRA 3ECBB 4KXZH 5DD0H 5HDOA 3BEWB 1GHFH 2IFGA 1EEZB 4M9PA 1RUAH 4PJIF 4KY1H 1X6LA 2CDFB 1QA9A 4MQTB 1I7UB 5I30H 3FQUA 3JSSA 5T5FH 2GY5A 5KVGL 3WNLA 4JM4L 3VGBA 3MV7B 3MJ6A 1FYTE 2WINB 1ETZA 1ZT4A 4UINH 5BZWB 2O5XL 3RZWA 1H0DB 1BWWA 3SY0A 5KVMC 4OQTH 1RJYA 1EH9A 1X7QA 1IGJA 1DUYA 2D03H 2FHFA 1AP2A 1FYTA 3OX8B 4M7JL 4M1CD 1MUJA 4G9DB 1XF4A 1HEZB 4YBLC 1E4WL 4QY8B 4ZS6C 15C8L 5E5RB 1BZ7B 2IFFH 1CDGA 2AXGA 2DQDH 1QVOA 1CTOA 1BJMA 4YHNB 2V2WA 3EO0B 5T1MB 1NAKH 4KK8D 3VH8G 3MMEB 2DYPD 4G6ML 4XI5C 3IFOA 3DLQR 3LEVH 2NY7H 1UA6L 1N2RB 3QIBA 4AL8L 3IDXH 1HXYA 1P5VA 4TN9A 4PGDA 3QAZB 4FZ8H 3BXNB 3DV4B 4TNVF 3JUYA 2QSCL 5C9KA 4JE4B 5ACLA 3IU3A 2FDBP 1G0DA 1BEYL 4RMRA 4OBRA 3RWHB 4RX4D 2I9LB 1BD2E 1KXTB 2JJTA 3S4SG 5CCKH 3BKYL 3QI9D 2VXVL 2CLVA 4JM2C 1I1CA 1J05B 2HT2D 3LCYA 3N1FC 4X4YB 1DP0A 1WZKA 5CD5D 2EDXA 1J12A 3RL1B 2J5LC 5E95B 1BD2A 2HJKB 5C0DB 2DQJH 2WIIA 4X6CB 1I8LC 4RGMC 1YEHH 1UWEH 4ZPTA 1CFNA 1BJ1J 1MH5A 4BFIB 2NMSA 5DS8A 4LSPH 3MREB 1S7SB 5J1TC 4JG1L 3ZE2F 3DJ9A 3AMLA 3IFLH 4U6YA 5DJAA 5MENA 1OAKH 3B9VA 2FATL 5CGYC 5FO9B 2RIKA 1MJJB 4M3KB 4EIGB 1R24B 1T1YA 4BELD 3EFFA 1T03H 3CX5J 3SO3B 1AXTL 1PKQB 4QCIA 5HGAB 3RL2A 1JF5A 3SE4C 5CEZL 1RQ5A 5DQJA 3TWCH 1IJ9A 4H88L 3WFCH 1TFHA 1MFAL 3LAFA 4U1SA 3U9UA 1KN2L 1QLFA 4JKPL 4X6CF 4ZAKB 1FLTX 2X41A 4RGOL 1ZT7A 1UG9A 3ZE1E 1LO2L 3IETA 3QZWG 2BVOB 3MQIA 2GTWA 4MJ2A 4OCYH 5EIIB 3H0TB 4RSVA 2CKBA 4EQ3A 4J3VA 3OAZH 1OW0A 4MD5A 2OL3B 4LSSL 1LEKA 1NSNH 4PG2A 5MHSD 3CU1A 4L3ED 3NFPA 4ODSL 3VA6A 3FT2B 5AUMB 3T0EC 1I9IH 3PWJA 2A9NL 4S0SD 4ZXBD 4CW1A 1FFOB 4NKQB 4DZ8B 4PYHA 3PJSB 3QNXB 2HTKC 1UENA 4RDQG 2FEEL 5KW9H 2YSSA 1FSKB 2NY1D 3U46A 1F4XL 1WIPA 4IRJD 1H3TA 1OWWA 3NGBB 1BLNB 1Z9MA 4OCMC 4XNUL 4GAYA 2NTSP 3NPSB 3EFDL 2AJXH 5EO0B 1T5XA 4LIQL 1FZOA 1RZFH 2WNGA 3FQWB 4PGBB 2ZG1A 5J6HA 1UGNA 1U8PA 3T2PA 3O11B 4HPYH 2VDLH 3SDAA 1HI6A 4PJBF 1S9VB 5B38B 2AJYL 3IDYB 5HBBA 5IV2B 3MO1B 2X1XR 4N9OB 4PJHB 1YQVL 2DQGL 1PQZA 1MHHB 5L8JB 3MLVH 1EJ6A 4I77H 4LHUB 3S7GA 4ZFOB 4OF0A 4M8QB 4L29A 1CGUA 1I3RA 1J8KA 4MXVE 2F53D 1GH7A 1EERB 2VLRD 3MYJB 3UTZB 4GG6F 5A2IH 3VXRD 1M7DB 2NXYD 2ZUWA 2HMID 5E1AA 1NMBL 5F3HA 3VXTA 5HVFB 4TVSa 4MJID 4FTVE 1YJDL 3VWKC 1EXUB 4R96A 5D6CB 1A3QA 1EEYB 5DYOA 2DL2A 2V7NA 3GHBL 2X4UB 5L8KB 1A1OA 1TJGL 5FM5O 3D3VE 3DX7B 5D7IF 4U0RC 5E2WH 4FTVA 5IG7A 4Z9KB 5GJSL 5F7YC 1UZ8A 3O3UN 3D3VA 4Q97A 3WFHA 3ESVF 3T09A 2VDOL 4QRUB 4UT6H 3WS6A 2F58L 3S9DB 4HLZH 4P3DB 1KEGH 2A9ML 4FQJH 1DL7L 4QRQA 4JY6B 4Q0XL 3FHQA 4P99A 5MEPB 1JZ6A 1YMMD 1AQKH 3RVTD 1UB6A 4GW4B 1XGUB 3TJHC 2PKDA 4K7PY 2G2RA 3HPJA 4JKWA 5ANMB 4LVHC 1DQTA 4PB9L 2VE6A 4P2QB 2VWEE 4HWBA 5DRNB 5IMOB 2ID5A 3V7MA 2B20A 4X8JB 3SQBA 1IAKB 4K3HA 2MCG1 4KPHH 2ZUYA 3GMRB 1CDCA 2X89A 4HKJA 5AEAA 2VJXA 5C6TL 2QTEA 2QADC 1JHTA 1MWAA 4G6AD 3MRQB 4OKVB 3ZKXB 1J88A 2DQEL 1CICB 3WXWH 1K4CB 5IVXF 3OAUL 4KHXH 4YHOL 1KCSH 1ZHBA 3CH8A 2VLKE 2YPKA 5HDQH 3C60B 4L1HA 4LARL 4N68A 4AIXA 5EU5B 3D85A 1ERNA 5T3XD 3GZKA 4HXAH 1QFHA 1P7QB 5E8NA 5DEFA 1MCKA 1BQHA 4C83B 5JXAH 3KPOA 7CGTA 5H37H 3BJ91 1GGCL 5JIIA 3IFPB 5I9QB 4YHKH 4ORGB 4QWWC 5D1XC 1X4ZA 3ZDXE 4XPTH 1TTGA 3B8YA 4ONGH 3Q5OA 5HPMB 4NNPL 1C1EH 4NOBA 1RMFL 4DKAA 5FO8A 3MR9A 4QRTA 4K7PL 2YD6A 2GUOA 5GGSB 4L4JA 3D87B 3FTGB 1G7IA 2AV1B 1I1AD 1Y0LA 2DF3A 4NN7C 5CJOL 4X7SL 4QHLA 1CCZA 4IMKA 5GZNC 1CF8H 3I85A 3PDGA 2VLJD 3EO1B 2WQRA 1YEFH 4GQ9H 3QWOA 5KTEL 1DBJL 3BDXA 4WNQA 3QDME 3NAAL 4QXUL 2ZSWA 4GLRI 4JRXA 3VFMA 3SPVA 2OR7A 1KB5A 3DI2B 3GBNL 5J6GA 1JBJA 2AGJH 2GITB 3QDMA 4HULB 1JP5A 2LAAA 1LDSA 4IRZL 4XWGH 4JO3H 1N6QH 3JWNC 4MWFB 2ZCLH 1PSKL 3FFCE 3EYQD 4HFUH 3MRHB 3MRBA 2Z31B 2EIBA 3QUMA 3L5XL 1BQLH 3R4DA 5H94A 4R4FH 5FECA 3IS0X 4L1DA 1F00I 5FHAL 1WIOA 4WEUD 5IVZB 2BSSB 5FCSH 3SE3C 4HIXL 5HD8D 3KPLB 3RVUD 4K07A 5D93C 1BF2A 3B9EA 3HZVA 1WQVT 3REVB 2FBOJ 2Q3AA 4MZ2A 2DQTL 3U6RA 4UTBH 1RIVH 3SGJC 4U33A 3ZMRA 4JFHD 3IDUA 4X6FA 2I25N 5KSAA 2GTZA 5KVGH 3MV11 4BZYA 3FB5B 5HSFA 4DQOL 5CLWA 5F97E 4R26H 1T20A 2O5XH 4U7MA 3BGFB 4F7PB 2BFVL 2E9JA 3QT2A 3DETC 3ECBA 4XP9H 2J7LA 3BEWA 4M7JH 4F7TB 5CFHA 3ZT7A 2BNQD 1EEZA 4L8DB 1E4WH 2ZZUT 15C8H 1I7UA 3R1GL 2VZUA 4GKSB 1BBJB 2EDOA 4HG4J 4RFNC 3JWDL 3WV0A 4G6MH 2WINA 3KXFD 3LEYL 4FQHA 2XKSA 5BZWA 4Z7WB 5ILTL 1KTRL 4PJEF 1H0DA 1I85C 2XT1B 5ISZB 4AL8H 3HUJF 5KJRL 5F8RC 1MJ8L 4LAQL 2C4XA 3OX8A 1BEYH 1TVDA 3KJ6L 4G9DA 1HEZA 3CFDB 3TO4B 2XA3A 3BKYH 2VXVH 3TBTB 3NBNA 2KQNA 4QY8A 5BVPL 2FRGP 1BZ7A 4KC3B 1FZJB 5E5UB 1KACB 5DK0B 4YHNA 2X4SB 4LDEB 3EO0A 4RCAA 5DJ0B 2EO1A 2VOTA 3RIFK 2CMRL 3MMEA 4U4BA 4U1GC 1W8OA 2FL5B 4QRSA 5B8CC 1N2RA 2YPLD 5EC2A 2I60L 2D7PA 2V5SA 3BXNA 2VITB 4D9QD 1WWAX 3DV4A 5KSBB 2GHWB 4RMUA 5T1KD 4AIZB 4JG1H 3JBG7 1EHXA 3RWHA 4PV9B 4YUEL 5D7LD 3OZ9L 1FCGA 4DFHA 5JORB 4V2CB 4X4YA 4Y19D 3HE6B 2GK0B 1HCFX 4UZGA 4P5MB 4Y8DC 1KJMB 3RL1A 3SGEI 4PJ8C 4AMKL 2Z92B 2HJKA 5C0DA 1HN1A 1F3RB 4X6CA 2KKQA 5CEZH 3VWJD 1WV7T 1KF9B 2DD8L 3NZ8B 4BFIA 4YC2C 4RFOL 3DHMA 3C6LA 5EU4B 3FO0L 1CGWA 1KN2H 3GNML 3JWOH 3MREA 1S7SA 1LO2H 3ARGC 3D69B 2G75B 3GEWB 1J5OH 5F6HJ 4WJ5B 5SX4I 1D7FA 4LSSH 4J6RL 5FO9A 1INQB 1MJJA 2XRAL 1R24A 1T7YA 1Q9OB 2W38A 3D5OF 4ODSH 2HYMA 1A7RL 1AE6H 1QSFD 3C6SA 1PKQA 3CJJA 4JFYB 4UDTB 4QRPE 5HGAA 3H3BC 2LV4A 2A9NH 3C5SA 1IEHA 4WCYH 4L4TD 4PJ7B 5DQ9B 2X05A 1BAFL 4PRNB 2CJUL 4QOKB 3TF7C 3ULSA 3QULB 1IEBB 2BVOA 5EIIA 4QXWA 2AJUL 3H0TA 4G6FD 2HT4D 1F4XH 2JJSC 5CBEB 4J3WA 2ZPKL 2OL3A 3U4EB 1RV6X 2OJEB 3KR3H 4XNUH 3PDDA 4IOSD 1YEKL 5J12B 3QHZL 3W9DB 3BQUB 2B5IB 3U2SB 3T1FB 1S7TA 5AUMA 1OTTC 4JFZH 5K93A 2Z8RA 1BMGA 3G04B 1FFOA 3C2AL 4DZ8A 3HNSL 4PRIB 2DQUL 3PL6D 3PJSA 2AJYH 5I1HH 2VUYA 4LGRB 3QHFH 3QNXA 4NRXB 3HAEH 4FZEH 4PJ9C 2YA2A 4WVRA 3WDIA 1OB1B 4NFCA 4XNMA 3PE9A 5HYFA 1CGYA 1BLNA 3RTQD 4QHNB 4PLOB 5IP4A 5EO0A 1YC8A 3HB3C 4KUZH 4ODXB 3FQWA 4PGBA 4QF1B 2VKXA 1GAFL 4PJHE 3HZMB 3O3EB 2VDMH 3O11A 1IKFL 1OCWL 1UM5H 1NMBH 1PYWB 1Q9WB 1S9VA 5B38A 1DN0A 1ZLWK 3MO1A 1YJDH 3QSKB 4PJHA 4YDKH 3D2UB 5GRWA 3GHBH 5FM4A 1MHHA 1TJGH 4KU1A 4MS8D 4XP5L 2VDQL 1A47A 1EFXB 1Y6KR 4ZFOA 4KRPD 5IQ9B 3RPIB 5CJQH 3LRHA 5K59E 3V7AG 5HYSG 5KVFL 1JUFB 3MYJA 4LP4A 2V7HB 5HGBB 4TNWK 2FGWL 1M7DA 2B8OT 2VDOH 4WENB 1TVHB 2I9TA 3JV4B 3S36X 3HC0B 2A9MH 4ZS6D 1DL7H 5HDBF 4Q0XH 1EXUA 5D6CA 1EEYA 5TQ2L 1OL0A 4P2YA 2X4UA 4Y5VB 4WHTB 1UXSA 1ZHLA 2IAND 1MCDA 3DX7A 4ISVB 2ZSVB 2RR3A 2BVUA 4JPVH 5JZ7D 1IBGL 2PO6D 4HH8A 1UCBL 4UMGA 1NQBA 3V6ZB 3S98A 4F3FB 4S1SL 5FUOL 4ODUB 4QRUA 5M95B 5DR5L 1T0MB 3V52L 5ANME 5C6PB 3QEQD 1OP3K 3NFSL 4P3DA 5DGRA 4EI5B 3KPRD 5C6TH 4JY6A 1U8NB 4P2QE 4HSQA 5MEPA 4M7ZC 2DQEH 1CGSL 3BPLB 3FOLB 4OAWB 1XGUA 3OXRA 2JKXA 3OAUH 5ANMA 1Z9LA 1QLRB 4LSVH 2XACC 4P2QA 5F7KC 2XZCL 5J11C 3LPGA 4LARH 3CVHL 5K33A 5DRNA 2WWKT 3HI6L 1FVCB 1TIUA 4Y4FC 5IMOA 1KJ2L 1ZWIB 1F6FB 3M17A 3IU4L 2Z35B 3O8XD 4X8JA 3VD5A 1IGFL 3TPKA 4LASH 4GAFB 1IAKA 3P4LA 4XCCL 4H25B 5CAYB 1ZV5A 3L3HB 4JZOB 5FO7A 4RWYL 2X1PA 3GMRA 4XCFH 3QXWA 1GGCH 1BJ8A 5CGYD 3TBSB 4OKVA 3RGVC 1CICA 5BRZB 1XIWC 1HH9B 4WGVB 1K4CA 2FYYB 2AQ1A 5T3ZL 1RUMH 4NNPH 3S36L 1RMFH 3C60A 3RWFB 5IW1B 5EU5A 3EZJB 2FX8L 4PTTA 2C5DC 2UZXB 4CU7A 4X7SH 4C4KT 3B9KD 1T7ZA 4XBPB 2XZAL 4C83A 5I74B 5DMYA 4PV8B 5E9DB 4U6VL 3WFEL 1WZLA 1ZEAL 3RP1A 2VQ1B 3IFPA 3NAAH 2BOBB 1A64A 4WTZA 5SV4A 1A1NB 1UH2A 2W0PA 3KS0H 5D6DC 5GSRB 5EUOF 4E41E 3T0ED 1NGWB 4CMMB 3GBNH 1TZHA 2XQYK 2ATPB 2OZ4H 3OTTA 1KENL 5GGSA 3RY5A 3FTGA 4TNWF 1B0GB 2AV1A 2I24N 3UJIL 5FGBA 1XCQB 2YRPA 2HTKD 1PSKH 4U7SA 4E41A 3CAFA 1YDPB 4PRPB 5EOQH 3VI4F 1F6AB 2FGZA 4JRYD 4Q74A 4CVXB 3EO1A 3L5XH 3NCYS 5IHLB 1PGRB 3ROLB 5DT1H 3RNQB 1FNLA 2FLBT 5FHAH 1FLRL 1NL0L 5HI4C 2MSPA 3RJDA 3D25B 3VI3F 2HP4A 1RHFA 1NAML 4HUUB 1NC2B 2DQTH 3KYOB 2YN3A 4ZNCD 2GITA 2XA8L 3NIGE 4M4PA 5T1DL 4LSQL 1JHKL 3ETBF 3CDFA 3KLSA 4MWFA 4DQOH 5DWUL 3RX8A 2OTPA 3MRHA 1MFDH 3UEZA 4KDWA 2Z31A 2EE9A 4ZODA 3VRLE 1WTLA 2AK4D 3OKNB 2BFVH 5IVZA 2BSSA 1L7IL 3KPLA 3D1MC 3RZCB 4EUPH 4PJCF 1FORL 4HGMA 3REVA 3SKUD 1ZKAA 1NLBL 4KRLB 3MXWH 3WS3B 1BM3L 3FQXB 4M9OA 4M93C 3R1GH 2VISB 4OJFH 5D7LB 1KYOK 2DM3A 3S5LB 2EDBA 1EHNA 2W59A 3FB5A 3I3DA 3JWDH 4YX2H 3P11L 4P2OC 3VWKD 2NLJB 4FQPA 3GHEH 1Z3GH 1CFTB 4F7PA 5FUZL 1FC2D 1NFDB 3OF6A 4LAQH 5SWZD 3HMXH 4TUJA 4F7TA 3QUZA 1KEML 2F19L 3RWCB 3FQRB 4LQFL 3VXSB 4L8DA 1F3DH 4W4OC 1RI8A 3BD5A 4Z7WE 2IC2A 3ISWA 4GKSA 2AJ3B 1JFQL 1F58H 4I18C 4JAMB 2PCPB 4Z7WA 3OKDB 5ISZA 2CO7B 3TJHD 2V6HA 5DLML 5LJYH 3DMMB 1UQSB 4FNLL 3VXUB 4JFDB 3QJHB 1S5HB 1S9KC 4JZJB 4YUEH 4AEFA 3OZ9H 1D5XB 5AYUL 1T1WB 3V4VL 3CFDA 2ICES 4XP4L 4P5TB 3TBTA 4OLVL 5T1LD 1UJ3B 3BMVA 4R6UA 4LPTA 1FZJA 1MLBB 2NY6C 2O93L 2J8UF 4ETQB 5DK0A 1G9NC 5KSBE 1QD0A 5DJ0A 5FEBA 5JXEC 4AMKH 2FL5A 4EN3D 2QADD 2XZQH 1WAAA 1NUGA 1LE5B 2DD8H 5I73C 2H26B 4CL7A 3UTPD 2VITA 3FO0H 5KSBA 3GNMH 1FCCA 5DRWB 4ESKA 3K1DA 4PV9A 3I84A 4TSCL 2Q20A 4YZFF 2PNDA 3IDNA 4M03A 1RZJL 4J6RH 4IMLB 1DQQB 3LN4B 2XRAH 4H26B 4ZUUA 2Q76B 3HE6A 2GK0A 4JJ5B 4KV5E 1A7RH 4YGVB 5KN5A 4P5MA 1KJMA 2SEBB 2Z92A 4MAYC 3ZO0A 3NZ8A 5D1XD 1QSZA 5IVNA 1BAFH 3ZDZF 5LQBL 5EU4A 4AJ0A 2CJUH 4KZEL 2D7OA 5A1AA 1WC7B 2AJUH 3D69A 4LPUA 2G75A 3FFDB 4GLRH 2VMFA 3IAPA 4WJ5A 2Q8AH 4HFWB 3UAJD 2XWJA 4PFEA 4AQOA 1INQA 2HFTA 4PJ7E 2PYEE 3QHZH 2CO6B 2B39A 2A1WL 4K2UL 4UDTA 1VESA 5DJDB 2VZ1A 4HJJH 5KVEL 5J8OA 1DR9A 2X6MA 1P4BL 1YN6B 4F37K 4PJ7A 2PYEA 5DQ9A 2DQUH 1CE6B 4PRNA 3MROA 5DFWH 4QOKA 4PJDB 1LK3L 3QULA 1IEBA 1QUNA 3V8CA 1SY6L 1OP9A 3GSRB 3O45B 1CD1B 2BNRB 2F8XC 5CBEA 4YFEA 3U4EA 4PLJC 2OJEA 2R56L 3NZHH 4PRIE 4JGJA 1PAMA 1DQJB 2J8HA 3T1FA 4GO6B 2QJDA 3CD4A 1NMCB 4X6DF 5CJXC 1MAKA 3G04A 5D96C 2IPTL 4AQ1B 4G3YL 4PRIA 1OCWH 3MRNA 4HUVB 2C1PB 1KXQE 3CFJB 4C56B 4NRXA 5TFSL 5GGTL 1JTOA 3FCTB 1AXSA 2ZUVA 3OQ3B 4U1MB 5DHYB 1OB1A 1KJ3L 4XP5H 4I9WD 2VDQH 2R2HB 4QYOB 3VXQB 4O4YH 1VB9A 1EO8L 2BC4B 1TENA 1N7ML 4ODXA 2NX5B 2YS4A 3AS2A 5KVFH 4QF1A 3DETD 2NY5C 1J0HA 1I9EA 3HZMA 4R7NA 3MV9D 2FGWH 3MRPB 3P0YL 2CQVA 4HBCL 1PYWA 1Q9WA 3FRPA 3QEUB 2A6IB 3NIDE 1U8OB 1Z6JT 4GXUN 1ORQB 5TQ2H 3D2UA 5F7EL 3U0PA 1VENA 5D7SL 3W5NA 3TV3H 1EFXA 4Z7UF 1BOYA 2AJVH 4NQEE 4YDLC 4HK3N 3RPIA 3V0WL 3BN9C 3NCMA 1IBGH 2V7HA 5HGBA 2N4IA 3HC3L 2YBRA 1UCBH 4NQDB 1CR9L 4JREB 1L9NA 4GXVH 4NQEA 3KVQA 5FUOH 1TVHA 2D7NA 3JV4A 3LKQA 3RWDB 3HC0A 2JCCB 3WXVL 4CDGC 1MAMH 3FJTA 4J23A 1CGSH 1J8HB 2R69L 3LDBC 2R23B 3VGAC 1F11B 4IRSC 4PRHD 4DW2H 4Y5VA 4WHTA 4OFIA 4ISVA 4K9EL 2MQ0A 3EO9L 3QRFM 2XZCH 3A6CL 4XX1G 3CVHH 4N1HB 3VXME 1A7NH 3HI6H 2MQCA 1KJ2H 1WWBX 1YECL 2ZUQC 5F7LB 3SGEH 3V6ZA 1S8DB 1HHKA 2APVA 5IK3B 4OFPA 4F3FA 2VR5A 3P4NB 4ODUA 5I1DB 5I2IB 1T0MA 4XPGL 2EKSB 3BJLA 4EI5A 1QRNB 3VXMA 1MLCB 4POZD 3DO3A 1YEDB 1J0ZA 4BYHA 3FB8B 1U8NA 3UP1A 4HZLB 3WUWG 4XPHL 4CJ0A 3EAKA 4OAWA 2NNAB 3JVGA 5H37G 3BPOC 3WNKA 4PJ8D 4YFLI 2IBZY 5SX4H 3LKNB 1HH6B 3EYSL 1V05A 3IDMB 4UBDC 5DD5L 5I18L 4WO4C 1BX2B 4ZMAT 3ET9F 1FVCA 2FX8H 1W72B 1ZWIA 3MNVB 4FHBD 1JRHI 2Z35A 1R3HB 4OFYD 5C08D 4H25A 3ARGD 5I1KL 2HFEB 1NUNB 1G0YR 2XZAH 3L3HA 1D3CA 4JZOA 4CVZB 5DEZA 3WFEH 4U6VH 1EJOL 3PXJA 5C0AE 2AQ2A 1ZEAH 4OGYL 1LWRA 1Q9LB 3TCLB 3ULUL 1EZVY 1D5ZB 3TBSA 4XVUC 2BVYA 5BRZA 4TTDD 3SJVD 5E6IB 1HH9A 2FYYA 1DCLA 1HSBA 3E3QC 3RWFA 4PY8J 2ZCKL 1FG2B 5IW1A 3IKCB 5E9DE 4JHWL 3ZKSD 1KENH 4IIQA 5D5MB 2VDNL 5T5NF 3UJIH 3B2UD 2HJLB 5L0QC 4LCWB 4XBPA 4PV8A 5E9DA 1A8JH 4PJGB 3Q2CA 2C7UB 3WNOA 5GHWL 2X4OB 4TULL 2VQ1A 4K94L 4A6YB 4WV1C 1FLRH 2BOBA 3DSFH 1NL0H 4O5LL 1NCAL 1A1NA 4YGAB 5D8JL 1FN4B 3EBAA 3WO4B 1NAMH 1OTTD 1NGWA 4PRPE 4CMMA 1L6ZA 4PJFB 5FHBL 3BGAA 4A2MA 2XA8H 2ATPA 4P4RB 4JCLA 4LCCA 1B0GA 1JHKH 1BFTA 2A6DB 3OKMA 2N56A 3LPWA 5EZOL 3P4MB 1YDPA 4PRPA 1AR1D 1F6AA 4P2RD 3T4YB 4KMLB 4J4PC 5D5MF 4CVXA 1RHHA 5KOVC 3ROLA 1V7ML 3MJGX 4WUKL 5DD3L 2WBJB 3RNQA 3DVFA 2DLEA 4LRNL 1ZMYA 1FDLL 3GBML 2Y36L 3D25A 4XCEB 1FORH 2YMXL 5IEHB 3WBDA 4HUUA 1NLBH 2V9QA 1NC2A 2UVEA 3TZVB 1BM3H 1NGZB 2P45B 4X4XB 2X4RB 4KKLD 4FQXB 4P46B 3QDGD 3U7WL 3C09B 2BK8A 3K8KA 5I1LB 1VFAB 4QRRD 4H8WC 3CSGA 3QDJB 3I6GB 4YO0B 5LGJA 1N6VA 3OKNA 5F7MC 4NJ9L 1IQWL 5FUZH 3T4AB 1IGTB 3WJJA 2WLZA 1E27B 4X80H 4MNQD 3PIQB 2WZPD 1KEMH 4JQVC 5AZ2L 3MA7A 4LQFH 3PQYB 4XTRC 2WWMC 5JW4N 4K71C 2VRAA 2E27L 3FQXA 1DTUA 4N8CL 2VISA 3KJ4B 5F88B 5C1MB 3IRZA 4HIEA 1JFQH 2H2SD 3LVEA 3K80A 4MD0B 5EZLA 4J2XA 4ZD3L 3VCLB 2Q7YA 4JDTL 3PP4L 2NLJA 5CZVH 3B6SB 3EJZC 4KROD 2ESVB 4XVSH 1CZ8L 3JV5A 4X99B 5D1ZB 3RDTB 1EMTH 1NFDA 3LZFL 4NQXB 2YA1A 4MZ3A 3LV3B 3RWCA 3FQRA 3LS4H 4JFED 3P73B 3HG1E 4K3JH 3VDAA 3V4VH 1U3YA 4XP4H 1PD6A 5CKGA 4NKIL 3GSUB 5IOPB 5I8KL 3BUTA 3M8OL 1PG7W 2GFBA 2AJ3A 5E70A 4TQEL 2JIXD 3HG1A 3OL2A 4JAMA 5LAXB 3VXUE 2JJTC 5E2VL 4JFDE 2XY1A 3N06B 1AXIB 3OKDA 4PG9A 5HGDB 4LKXB 2FZ3B 3HS0B 1IMHC 1QACA 3NA9L 2CUIA 3DMMA 1UQSA 4NIKB 3VXUA 3VGGA 2B4CL 3QJHA 4JFDA 1S5HA 4LLDB 2UYLB 4JZJA 1HHIB 4Y4FD 1EUTA 4Y5YB 1T1WA 1A7PL 1UT9A 1KTKE 1RZJH 1UJ3A 4XAKE 1FVDB 1MLBA 2VDRL 5TQ0L 1KCVH 4Y16B 4GBXD 4RMTA 3SCMC 2EE3A 3U36B 3RGVD 1LE5A 1CGXA 2X9XA 3QPQC 4QXGL 1XIWD 3HN3A 3I6KB 5EUKA 3IAQA 1IARB 5K9JL 2H26A 5EWIL 3OKYA 3RQ3A 4KZEH 1UACH 1A6AB 1S9WB 5DRWA 4EI6B 1MREH 4OM0L 5K9KB 2R2EB 1UADC 2EDJA 5F7HA 1A9EB 4P9MH 2QLVB 4CVUA 2P43B 3MBEC 4IMLA 1DQQA 3LN4A 4H26A 12E8H 4O2CB 2Q76A 4JJ5A 1BGXL 4YGVA 2A1WH 4K2UH 3MUJA 2QQNL 2SEBA 2Y06H 1LO4L 5KVEH 1IC7L 1OW0C 1LD9B 1NC4D 1A7OL 2ITCB 2W0KA 1EAPB 3UJTL 3PHOB 2ARWA 4J3TA 4RIRB 1LK3H 5EFIB 5I1EL 5IMLB 2J88L 2YOCA 3N1QC 1DFBL 1WC7A 1NGXB 2NY0C 4BK4A 3RAJH 3DV6B 1WFUA 3O6FA 5FK9A 3DVGB 4HFWA 4G6KH 1CT8B 1MRCL 4PJ5D 1BVKB 1UWXH 2R56H 1MFEH 3HAEG 2ED7A 3DUSB 2PETA 2DQHL 1GRWA 4PJDE 1CXKA 5I1AB 2VZSA 5DJDA 3NA4A 3TLRA 2F54B 4UIMB 4C58B 1ULVA 1YN6A 3ARBB 5HI4D 2BNRE 3UYPA 4LNRB 1PJ9A 2GSGB 4UV7H 4G3YH 5HHNB 4PJIE