5FM5O

Crystal structure of the myomesin:obscurin-like-1 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
97
structure length
97
Chain Sequence
PLGSGILMAPKTFWVNEGKHAKFRCYVMGKPEPEIEWHWEGRPLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSAVQLHVKEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Binding of Myomesin to Obscurin-Like-1 at the Muscle M-Band Provides a Strategy for Isoform-Specific Mechanical Protection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords MYOMESIN-1
total genus 17
structure length 97
sequence length 97
chains with identical sequence P
ec nomenclature
pdb deposition date 2015-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5fm5O00
2F54B 1KCUH 3VFNB 2NY7L 1N5YH 4QYOA 3LRHA 3MBEB 1I8LC 3CX5K 3LB6D 2V6HA 1X5HA 3I9GH 1HHKB 3VFSB 4BZYA 3FTGA 4CDHA 5K59E 1YEIL 1CFNA 2VNCA 2PKDA 5DJ6A 4MQXD 3R8BB 4JKWA 3V5HA 1NGWB 3LD8B 2MCPH 4OD1L 5D7LA 2JF1A 2VQ1B 2ESVD 1Y0LB 5IIEA 3VXMD 3BPNB 2IH1B 3P4NB 4OCWH 3VFVB 3K2UL 4XBPB 3HUJF 1HHJB 5GGRY 2P44B 1WCQA 5ESVA 4Q9QL 4M7LH 3CU1A 2J8OA 3K80A 3EO9L 3KS0J 4JJ5A 5JZ7D 1M1SA 2Y4SA 3S37H 4PGCB 4MA8H 2CIKA 1YJDC 3T3MF 4IOIB 1NCBL 4DUVA 1X3DA 3PUCA 2NY6D 3HE6A 5C09A 5D7JA 3RL1B 4PP2B 1EAPA 1NDGA 1OGAD 1T1WB 4MVBD 2P43B 4G80A 1J1OL 2UVEA 3FAWA 4ZTOH 4LF3A 3UTSE 3EYOB 4PRIE 4TQEH 5DS8B 2HFTA 1MQ8A 3SKMA 1NMCC 3DRTA 4WFFD 2PN5A 35C8H 5EBMA 4TN9A 2FIKA 1IAIH 1KELL 1U92A 3BQUB 2NY0B 3SDAB 1N7MH 1EV2E 3VA6A 3L3IB 3OXRB 3T0AA 1VADB 5IJKC 1I1AB 3KLSA 2JIXD 4QXGH 5F3BA 4Q7DA 4Z7UF 4FP8H 2G5BA 1Z5LA 2YWYA 1U58B 4OLYL 2CKBL 4RGND 3TO4B 1FFNA 2GTWA 3OPZL 3GI9H 4QWWC 4LSPL 5CFHA 2W0FA 2Q7YB 2LTQC 2Z35A 4YNYA 3RY6A 1IEAA 1DL7H 3DVGB 5C0GA 3ZTNL 2X4TA 3CFKB 2GI7A 1V7MH 5F3HB 1NAKH 3D9AH 5BV7C 3QPXH 3SCMB 4EQ2A 3IDMA 1W72A 4JQVA 3EZ8A 2GK0A 4LMQI 1UJ3C 2OL3H 1HQ4B 5IW1B 5FGCE 1IGYB 4MCYB 4AEIH 1FL5A 2O5XL 1WV7T 3RTQC 3BKCL 5HJ3B 4RRPA 3TBTB 5D1XC 5F1OB 2HKFH 4YHKH 3VXRD 4Z0XA 3TA3B 4LLWA 1FZKA 4JHWL 1S8DA 5JMOC 5A2JH 2XOTA 4QOKE 2P45B 5IBUB 3VWKC 4MS8D 2HVJA 2DM2A 4I5BB 1E28A 4ELMA 1YC8A 3CAFA 5AZEH 5INDA 1JZ4A 4CU8A 3D2UD 4YBLB 2JCCF 2A0LD 5H37H 2DMCA 3OHXA 4ONFL 3WFDH 2W9EH 5F1NA 2F54E 4XP9L 3ARFB 2DLIA 4LKCA 1ORSA 3DBXB 3NGBC 4OD2B 3S98A 4GH7B 4AENA 4GG6E 3OKKA 2DYPD 3Q2CA 2R56L 1MHEB 3O4LE 5I66B 5HHPB 1GGYA 3FFCB 3CGTA 4RGNE 3NOIA 5DD6B 3T0EE 5F7MC 43CAA 5F7EL 2BVTA 3SDAA 4A2MA 4DCQA 4J4PA 3NN8A 1UVQA 2FWOA 1KIQB 1T22B 4D94A 1IC5H 1UZ8A 1Q9OB 1WWBX 2IMNA 1UKSA 4G43B 1XF1A 1SEQH 3G6DL 4EN3B 5FYLE 3AREB 3S35X 2VDRH 3D18B 5CMAA 4WWKB 1L9MA 4X6CF 4JFQA 5IOPA 1CD0A 1ZMYA 3WFCL 5C07A 4M5ZL 4KK6C 4NUGH 3VH8B 3C2AH 2RCSH 2GJ6E 1UJ3A 3BD5A 3S5LG 1K2DA 3MA9L 4ZSOB 4KHTL 4OZHE 1LEKB 1CFTB 2WWKO 3DXAA 2V5TA 1S9XB 5ETUB 1EO8H 1CWVA 1S78C 3KPRA 1FQ9C 4XCFH 3ULSB 5JUEL 2OJZL 4HKZB 4JHAH 4RBPH 4M6OH 1QSEE 1RZJH 1FIGH 2NXYD 2BVEA 4Z7NF 2AAVA 1BZ7A 3B9DA 4MS8C 3U0WH 1A6UL 1IQDA 4KROD 2I60H 5FYKL 3PXJA 4EI5C 2CO6B 1DBMH 1P9MC 4Q2ZB 2ZOLB 5GIRB 5MEQA 3ORJA 1JGUL 2BVUA 1SQ2N 3DRQA 4Q0XL 4RFNC 3OKMB 4PJCA 5F7DA 1JI2A 3B9KA 5DMGD 4QHKJ 4E0RA 5TDPB 3RVTD 3BPLB 5F1IA 3F12B 3OKEA 2EDBA 3IU3B 3QIWB 4PJIF 1KIRB 4JRXD 1IKFH 1T0MA 3TF7C 4YC2C 5FUZL 1AFVL 3BGFC 3B9KC 5D2LB 4R4BB 2APBA 2XZQH 3G5YA 5GGTH 1KG0B 2CR3A 2EIZB 1NLBH 4UTAH 4AIOA 3V0VA 4IEFB 1SYVA 2XYCA 2ZWLT 4I3SH 1OD7A 4KI5F 5IHUH 1DJSA 4UDTB 2IF7A 2Z92B 5E94A 3MUGB 1MAKA 3G9AB 1N5AB 1R3HA 4JQIH 4D9LL 4BH8B 2AKRB 2AGJL 4FXKA 1A9BB 4Z5RB 5C0IA 5AWNH 4LLVA 5D1QB 3REWA 3VFMB 1S7XA 4G7VH 3OKNA 2H32H 3CJJA 4JFZH 5HYEA 5E1HB 5FUOL 3O3UN 4UIKH 3TO4D 4ZFFA 4K8RL 3IAPA 1FG9C 4U7SA 2D7OA 3G5VB 5DI8B 3ULUL 3GJEB 2AK1H 3GMNA 3TWCH 1RZKL 1EA9C 1GRWA 5TJWK 2PTVA 1ZT7A 5D2LA 3N1PC 3SEPA 3HZYB 5AD0A 1KXVC 4NQUA 4X6DA 2XY2A 2NYYC 5EN2B 3RIAF 4ISVA 1UJTA 5E8PA 2K7PA 3HAEB 1D9KB 3CMGA 4OFVA 4MLIA 2CDEB 4ZTPL 3QULA 3VFVA 3R0NA 1H3PL 4UI2A 2NR6D 4TTDD 3QYCA 1R3JB 1YY9C 5DHYB 3T4AA 3ULUE 3K8KA 4U2ZA 5C6TH 3TCLA 4OLWL 3ESUF 2X42A 4U7KA 2CK0H 1CK0L 4ZUTA 3OG4B 3K46A 2EC8A 5JORB 4JZNB 4Z6AT 4LKXA 5D96B 5DD5H 3TYFB 3HA0A 3IDUA 3K8MA 2BHZA 2VLKA 4PGDA 5GRVL 4IRZL 2VB5A 3QCTH 5BS0B 1ZT1B 1FO0H 1EHXA 2NZ9D 1LMKA 3PDOA 4WI5A 4FQ1L 2ZKHL 1KIPA 1PKQB 1KNOB 1AJ7L 1YDPA 2YPVL 1JUFB 1I85C 1F6LL 2NTSP 2VL4A 3TVMB 1KT2A 3V0WL 4FQHA 3NZHL 4JDVA 5CJQL 3MBED 4L3AA 1TJIL 4CAGA 1IC1A 3IJHA 4GW5B 1CDIA 2QR0B 2X9WA 1RV6X 2EXYD 3A67L 4F7CA 5J57B 5T1LA 2GAZB 3UC0H 4WDIA 3GI9L 5TH2A 3GHBH 4C83B 2QKIA 5GGUB 2QADC 4I0PD 5C70A 5DWUH 4PUBH 1X4XA 3FFCD 3FRUB 1QEWA 2OR7A 2GK2A 5I1EL 3RTQA 2VKXA 1MY7A 3DMMD 3V5DB 3NIFF 2XWBA 4XMPH 3KXFB 4TVPD 1EK3A 3C60C 4QRUA 1K8DB 4MQ7A 1I8KA 1P7QA 5BCAA 3T3PF 2FNBA 1YC7A 5BVPH 3FKUS 4PJFB 4N0YL 2VZSA 2N4IA 4QXUH 4XNQA 5FYKE 1OTUC 4FXKB 2VSDA 5E8OA 4AH2B 3T4YA 1JPGB 2YKLL 5BV7H 3EBAA 3QEHA 5CEYB 3OX8A 5GPRA 4S1RH 1KJ2H 3UTZA 5J9PA 4NGHL 1ZOXA 3C08L 3DBXA 4OD2A 5E9DE 2X4PB 5I1DB 4LIQE 3GSWA 4OBRA 1QLEH 5CWSB 4QXTA 3BKML 4F3FB 4J6RH 1FO0L 4MJ4A 3PP4H 4HT1L 4O9HH 4W4OC 1WBXB 3EGSB 2IPUK 4G8FA 1U8LB 4CN1A 1EZVX 3BPCA 2F53A 3BIAX 4DKAA 4MCZA 3O8XA 2AJ3B 1I1AD 2HLFC 1KLFA 1HOCB 2ADGA 3DHMA 5EU7C 2VDNH 5DYOB 4RGNB 1I9JL 3HG1A 2VDQL 4GAYA 3GHBL 1QQDB 4Z18A 4NT6A 1ZSDB 3HG1E 4JO2L 5FA4A 1UXWB 2Q6WB 3QIWD 4L29A 4P9ML 3ROOA 5CBEB 1JNHA 3MZTA 4JRXB 1LILA 4GRLA 4NO3B 5IOPB 1RJZA 1S3KL 2C1OA 2DJ4A 4QXTB 1P6AB 4L8DA 4ODXB 3TV3H 5LAXB 3U0PA 3NTCH 1MREH 3IKCA 3LN9A 4I3RH 4C4KO 4HQQH 5IESL 5D93B 4OD3L 3OAYH 4EJ1C 4BQCA 4NQEE 1J0ZA 2EIBA 4WWKA 3HZVA 5L7XH 4NOFA 4PRID 5IM7B 1LD9A 2Q8AL 3MJ6A 4XPTL 4G5ZH 3LN4A 1NANI 2F8OA 4LLYB 4LVEA 4O58L 1BOYA 4J4PD 3OSKA 3SDDC 1RU9L 5D72L 5FHBH 3CC5B 2D0HA 2EDTA 1CE6B 4PLJD 4OJFL 3V95A 1ZA3A 5IB4B 5T1KD 5IBLD 2CMRH 3JV4B 4YE4H 1KENL 3FO0H 5D7IF 1U8QA 4PGZA 4WDIB 4LSQH 3F7QA 2PETA 4WFEE 1MHEA 5H37G 4AL8H 1PSKL 1BZ9A 4RMTA 3FQNA 3DMMC 1P1ZA 2B4CH 4U2YA 3V6ZA 3ZDYE 8CGTA 1OLZA 3MLTB 4MQTB 1M71A 1TZGL 4IRJA 3MJ7B 2IQAA 4PTUA 4LLUA 4U1IB 4G6JL 5I16A 1A7BA 5JW4R 3HNVL 4QTHB 4HWBA 1QSZA 2PTUA 2QEJA 4Y19E 3DMMA 3T09A 1ZTXL 4JPIA 1ORQA 4PS4H 3BXNA 5L2KA 4MD0A 1FZMA 2IWGA 2BSRB 4QEGA 1C5DB 3DUSA 1H8OA 1DTUA 3MGTA 4U6YA 4JY6B 4YWGL 1TZHB 4PLOB 5GGSY 4GAYB 4JGUA 3WFZA 2FSEA 5C71A 4JFDA 1UH4A 4HXBL 3LKPB 1JV5A 4YFLF 5IB1B 5L2JA 1P4BL 2ADGB 3MV7E 3MRLA 3SDDA 4F7TB 3SJVD 1OOAA 1U95B 1XR9B 3GSOB 4GG6B 2FYYB 4OLVH 4I2XE 3JUZA 4KKAD 2DMKA 4ENED 3DOSA 4KUCD 1FVCB 5EH1A 1QBBA 1T04B 1SYSB 1XF4B 2R4SL 5DD3L 5EUKA 5CUSH 2NTFA 5BVJA 1ZS8B 1MCPH 4NQSB 3MJ9H 2VO5A 5DWUL 2ATPB 1BF2A 1T2JA 4JFFD 1YEKH 5CHNB 4KROB 4NKOA 4HUUB 1RIHH 3MCLL 2W07A 2VXVH 3N0PB 3VE0B 3SGEI 2IFGA 3FJTA 1LDSA 1ES0A 2GTWB 2XZZA 4Y4FB 4YDJA 1T7XA 3CUPA 4WFHD 1WZMA 3O9WD 1KJMB 3TESA 3QNXA 5DRNA 2L4OA 1AO7A 3FO9B 4DZ8B 4XVUC 2OYPA 1HI6B 5TE4L 1X6NA 5IROA 1N8ZB 1T1ZB 1MI5B 2YMXH 4PJXB 4XVTH 5C0AE 4IS6B 5F7NC 1BVKB 5JDSA 2CK2A 4JM2B 3HNTL 4OV6F 1CU4L 2BOCB 2X4NA 1C12A 4NKMB 4NM8H 4PRHB 4F37K 4PJ9C 1B4RA 4YBQD 4FQHB 4M7JL 5F9JA 4E9LA 4FFYH 5L88L 2AEPL 4HKBA 3MRCB 5FXCH 3BT2H 2B8OT 3TH4T 2BNRA 1JP5A 2QKIB 4LCWE 5EO0B 2H1PL 4UT7H 2C9AA 3PWUB 4BSVA 4GRMA 3NFSL 3DGGB 3LSOB 4PV9B 5T1LB 3L95A 4JKKA 1R5VA 3ARDC 4UTBH 4XCYA 5MHSD 5HGDA 3CVIL 4G9DB 3VG0H 2XKUA 2EDHA 3VXNA 5GZNC 5A43C 4ZUTB 1HXYA 5D1QD 3O9WA 3OKDB 1XIWC 5AUMA 4ODVH 3TVMA 1FNEA 4KI5E 1SMOA 3DSFH 4KMTL 4UIKL 5KSBB 2C3VB 3ILQC 2GITB 4I77L 3ZL4L 1NGQH 4MA7L 2VN7A 5DO2D 2IQ9L 5HYJD 3SHSA 3BAEH 2LU3A 5DJ8B 5LGJA 4OM0H 1K4CA 3V6FA 2HG5B 2VLRA 2DQHL 5D7LB 3CX2A 1VCAA 3T8XA 1JRHL 3RA7H 3ULSA 3PL6C 2P8PA 3CZJA 5F89A 2BERA 2BXYA 3QXUA 4JM2C 1NSNL 2EE3A 1R0AH 3DUHA 4S1QL 5EUOE 1TCRA 5GGRA 4HULB 3CMOL 4AZ8A 5AYUL 3ZHLA 5CBAA 5D9SB 3QFJD 3QIBC 1CQKA 1T7WA 4KUCF 5C09D 2E7CA 2RIKA 4DN3H 4X9FA 4XP4L 4BQ8A 1JF1B 2P24A 1QP1A 4ZS7H 4XMLL 4XP6L 3CFDA 3GMMA 1X5JA 4FQLL 4HIXH 5E2VH 4BZ2H 2NY4D 1B0RB 4KXZH 3RWDA 3QDAA 2BNQE 1CXIA 3VU2A 2ZCLH 5T5FH 4C58B 4DAGL 5DQDH 3D39D 5HDBE 2XWBB 3VXSE 4M8QB 4XPHH 2FDBP 3OKNB 5GS2H 1A6ZB 1TZIB 4JY5H 4D0DB 3UDWA 3WS6C 1KG0A 1IAKB 3M45A 3QH3A 2V2XB 1U41A 2P5WB 4NQDA 1SY6A 3D85B 5FCUL 2YPLD 2J8UB 5KS9A 3A6CL 4K7PH 4JZOB 3MLXL 1BD2D 3MLYL 4KRMB 3MLPA 1MCBA 4H20H 3C5JB 4FMKA 5GGRB 2FH8A 3OPZH 4FN0A 3QO1A 2L7UA 4X5WA 4BQ9A 4OGZA 4PB0H 4YXKL 2B5IB 1IM9A 2AP2A 4FXGA 4MD4B 2BVYA 4H25B 1OWWA 2P24B 3CZFB 5HHQA 3T1FA 3I6GB 3IDYB 1OAXH 5KTEL 3KPQB 1U36A 2D7TH 3BUYA 1I7RA 1A6AB 1G7QA 1AQDB 2FX8H 4UUJA 3UPRA 3ZLQC 4RDQF 5KS9F 3G08B 3MACL 4MZ3A 1KC5L 4X7SH 4NSKA 5C0AA 4ZXBB 3QZWG 3Q6GL 4GKOA 1MREL 2O61B 1T5XB 3WN5C 4C54A 3B9KB 3QPXL 3HMXL 1KSRA 4WV1C 1QSFE 5F7LB 2JB6A 3BPOB 3C09C 4HUVB 2CIIA 3HNVH 4OZHB 1M7IB 3FT4B 2B1HH 3K4AA 1HDMA 4IRJB 4E5XA 3F62A 3RVVD 5KVEH 3WSQL 4XB8A 1IJ9A 1NL0L 4K94H 1KUMA 3I3EA 1QLEL 3D87B 4P59L 4IMKC 2O26U 2XIDA 4GMTH 2DQTH 4YK4C 4QTHA 5EO9A 2D4FA 5DD3H 1CI5A 3OKLA 5JIPA 5E1AA 4HWZB 4MJ6A 5I1IL 2ESVB 5DA4A 4YNYB 2QL1A 1FFOA 3MA7B 1F42A 5DJYA 1BHGA 3MLTA 1Y18B 4PG2C 5SV3A 3VCLB 4H5SB 1HQRA 2VABA 1BBDL 3QI9C 3KDMB 4NN5B 1V5JA 3S36L 5HVHC 2E8YA 4C57C 2FEDD 4WUUD 3QDJD 1UZ6F 4CN6A 1MJUL 3ROLB 4GMSL 5K9JH 3N85H 3L3DA 1CLOL 5CJXC 1XGTA 5CP3H 4OZGE 3GSNL 2E6QA 2IG2H 2QQLL 4JM2D 1LK2A 2UUDH 5AYQA 4PJHA 3ARFA 5I2IA 2I27N 1FC2D 1MCOH 5FYKD 4PRHD 1UENA 4JPWH 4BSJA 2QSQA 1AO7D 3SN6N 5HVGB 4Y5XA 1NCBH 3C5ZC 4YXHH 3E3QC 3KYOA 1K8IB 4H88L 4NRXA 1INEH 5IQ7L 3Q1SL 1YMMA 1ZGLB 3NFSH 3JWOL 1YY9D 2IPUG 4YHPA 1A1MB 5E4IA 4EVNB 3QXWA 2OR8A 4RGNC 5DZOA 2E6PA 3QUXD 4KKCD 4XNXL 3AXLB 5EULV 4ELME 3PF2A 3SQOL 1JE6A 4F7MA 1HSBB 3WNMA 2VZOA 5BS0D 2H1PH 4IRSD 3WLBB 5JUEH 1AQKH 1H9VA 1GZPB 2Z93A 4M5ZH 2Z31A 3NFNA 5GRZA 4L3ED 3IFNH 1IAMA 3GZKA 5BZDA 4O4YH 3RGVD 1GAFL 5LWYH 5HYJB 3JVGC 3NIDE 3S36X 3HI1A 3BZEA 1FZMB 2NW3A 3DTXA 3C5SB 1HDMB 1A8JH 1ZHLA 2GKIA 1G7HB 1RHFA 1KCSH 1A2YA 2YWZA 2E7LA 1KXQE 4J1UB 1NC2D 1DUZB 1N6UA 4LLUB 1WBYB 1RVFL 2AJ3A 3VGBA 3G08A 4HFWA 4KJYA 3L1OL 1JPTH 2A73B 2DQGH 3DMMB 1HILA 3EO9H 3P3YA 3BGMA 4N8CH 4ZO8A 3FMGH 5E00A 3D18A 5CMAB 5BS0E 5J13C 4X6DF 3D0VB 1KCVL 4AT6B 3HRZB 4GUPB 5HPMB 4FQLH 1JCKA 2DM3A 2OTUA 4JN2A 3L9RA 5C2BL 4RAUB 2EDEA 1V7NH 1A0QH 3TCXA 1HSAA 4PYGA 1T7YA 4K9EC 3B6SB 4QCIB 3SKUD 3C5ZD 4OF8A 3OB0K 3QZWB 2VDOL 4OI7A 2QBWA 4RMWA 4XC1H 1EHNA 1UH3A 1CVSC 1BD2B 4WNQB 3W11C 4GAGL 3QR2A 2YBRA 4F57H 4UQ3A 3OG6B 1BJMA 2G2RB 4Z7WA 1J5OL 1E6JH 5IVXE 1YECL 3MRPA 1J0HA 2Y36L 3M07A 1AD0B 5JOPD 1RZKH 3O4OC 4BUGA 2VDMH 1LHZA 4J23A 4N90D 2AQ1A 4HF5H 1DDHB 1PLGL 3L6FB 5F44A 4M43L 3ARYA 5IMKB 1INQA 1JTPA 1UXWA 2Q6WA 4QY8A 4IOIA 1W8OA 4LARL 1TTUA 5SWZE 4LEOB 1NC4A 4HPOL 4N1EA 4ZXBD 5F7EH 4NNYB 3WCYA 1FAIL 3QEQB 3CLFH 3RY4A 3HFML 3MZGB 2D7TL 4DN3L 1EDQA 4P9HH 2PXYB 1KN4L 4FQJH 3CCHA 2JB5H 3RIAK 4MSWB 1FRGH 4MCZB 3IGAA 3W39A 1JHLL 5I73B 2W60B 4WY7L 1D9KA 2OSLA 4DJMA 5DVLA 4ZD3L 3QHFL 3BUYB 4ODBD 1VSCA 1FNSL 1ZT7B 3B9VA 2FBJH 5DHYA 1LWRA 3QUYB 5DI8A 5MHSE 5DA0B 2A77H 1AI1L 1SJEB 1A6WH 4FQPA 5CD5D 4YBLC 3TO4A 3TP4A 4QKXB 1ED3B 3UYRH 1L9NA 2BC4A 4U6XA 1BWMA 4I9WE 1KPVB 1B0GB 2OMNA 1DEEA 3I02A 4F57L 2D3VA 1KN2H 3PGFH 2W9EL 4QRTA 4XPBL 5CCKL 4K2UL 3BH8A 4WUUB 5I1LB 5FKPB 1MFNA 2WUCH 4AEFA 1DE4A 2GEEA 4I2XA 4P23B 4J3XA 4WI3A 2EDKA 1LGVA 2Y7QB 3HI5H 4ORGB 1NPUA 1A4JA 3VXQA 5JW4N 1UB6A 1MIMH 2X4QB 3S4SA 3V5KA 1J05B 1W0VB 1MCJA 4I48A 3IAGC 1HQRB 4LRNL 4MQ7B 4XAKE 1S9KC 1LE5B 3CFBB 1BVLA 4P9HL 1YEHH 1RZFH 3PNWA 4X9GA 1ZLVH 4WI4A 2VERN 3O2DL 1IGIL 3BP6B 4FQIL 5EZLA 1B0RA 2OXHA 3D0LA 4M48H 4OI8A 2VDRL 1CF8L 1H8NA 2XZAL 5D7SH 5DURB 5J7CC 2R2HB 4ZS6C 1G9MH 3ZE0F 5DFWH 4IRSB 4DFIA 5ADOL 5JIIA 5EUKB 2BY1A 3MLZH 2E27L 3QXDB 1PVHA 2ICES 1ND0A 4HS8L 3L5JA 2F54D 1R3KA 1U95A 4OLXH 4R2GB 3RNKB 1OW0C 2C7UB 2XWTB 4EI5D 4HC1H 1U8PB 2AXFB 3MV7D 1DUYA 4Q6IB 4RCAA 4LQFH 4DGVH 5D1ZC 4JDVB 2MKLC 5DUPH 1KJ3L 1SBBA 5BRZE 2V5RA 5CSZB 4M1GL 4XI5D 1YN7A 3U0WL 1HNFA 2VLKD 3ISWA 5T1MA 2R1YA 4ZFZA 2XWTA 3NCYP 1YYLL 4DW2H 3RDTA 4HLZH 2DQUH 1SM3L 5KG9A 5F9WB 1UACL 3WNOA 3VD3A 2ADIB 3OKDA 5I0ZA 4RMSA 5T5NF 4QRRE 1CFTA 1HKLH 5EZJA 2VLLA 2UV3A 4ODUA 2OK0H 1R3KB 3MNZB 3SDXA 4UV7L 1MCWW 2P47B 3LSOA 1N59A 3GSQA 3VFUA 2GT9A 4JKMA 4BUHA 5FUCC 2FHFA 5DD5L 5IR1B 2XFXB 4DUWA 3T0BA 5SWZA 5GRXG 4KRPD 4PJEA 1UM6L 5D6DA 5EO1B 1I8MB 4HHAA 1BLNB 4NQXB 3EDDA 1BVLB 2C26A 4NWUH 5D7IE 5HYJE 1DE4B 5JW3H 3IFNL 3P73A 1KCUL 3HRZA 4U0RB 1FVDA 4PG9B 1LO4H 1XGQB 4MQSB 5CZVH 4L4VE 5FK9B 1FNLA 1X5IA 5C0BA 3Q48A 5T1DL 2XKNA 4LCCC 1A4JB 1MNUL 4X5XA 2IPTH 3DV6A 3D39A 3QDGB 5GS0D 4HV8A 2XN9E 3T0DA 4KK5C 3F7VB 1A7NH 4N0CC 5ITBH 3TN0A 3MV9B 3QIWA 3IU3A 4MDJB 4O51A 4L8DB 3WD5L 1TQCB 1CIDA 2E5EA 4HXAL 1YY8A 5JIHA 3VI4E 4L5FH 5ALCH 2BCKB 5I8OL 3MJ8B 3CLEL 1FG2A 5E2UL 3HMWH 3PHOA 2VWEE 4PJIB 2MWCA 3C5SA 4LGPB 1MCOL 2IALB 4HZLA 1HQ4A 5IW1A 3L3OB 3L7FA 3VG9C 1U3JA 3E6FB 3WHXA 4JPVL 5IG7B 4GKZB 3U0TB 1KJVA 3RGVA 4LSSH 3RUGE 4JRYA 4ODWA 4N8VA 3HE6C 4KJQC 4UILL 1E4XI 2EDNA 4PBWD 4HQQL 1U8HA 5GRVK 4BKLA 4HEME 5ICXA 3GIVB 2CRMA 1LDPH 1OSZA 2J8HA 5DJ2A 3UJIL 1PKQE 3H8NA 4MXQC 3L5XL 3QUXB 4ZFGH 2NY5C 4R96A 1BBJA 1NCWH 1GJIA 3G6AA 3WKMH 3LKOA 4YJZL 3VH8A 5JXEC 1H0DA 2R1XA 3P4LA 4QTIH 2JELH 3S7GA 4L3EB 2BCKA 4TVPL 3JV4A 5INCA 1EEYB 4U1NB 1DSFL 1T4KB 4LHUB 3PWVB 1IBGH 5DLMH 3MJ7A 1AIFB 2R4RL 4G43A 5FYKU 3C6LD 3RI5F 4A6YH 3KS0H 2R9HD 4D9QE 1CIUA 4A6YA 3WFEH 4JREB 4P23D 1U8NA 2OJEA 1AGDA 3WJJA 5IF0A 3OAZK 3T4YB 5J8OA 3A0OA 4UNVA 1NC2B 4ZS6D 2YN5A 3VXME 1U9KA 3KGRA 1YNKH 1F4YL 4JFYA 2AS5M 1HI6A 3U6RB 1TJHL 1RJLB 2X7LA 3GBNL 2IAMB 4E41A 2F9BT 3O6LH 4OCSL 3TJEH 5A2FA 2JKXA 2B1AH 4TRPH 1DZBA 4LRNH 3EYVA 5DJCB 3KPLB 4HHAB 1EXUA 1ZT4A 3WXWH 3RU8H 5HD8C 3D5OF 3VGAB 5GS0L 2VXUL 4Z7NE 3HMXA 1AD9A 3TN0D 1EVUA 1ONQA 3TT1H 3GBML 1BFTA 4PJDB 1S7RB 4NKIH 1SYSA 1XF4A 3HAEG 4WCYH 3AGVA 3VXOA 1VGEL 1KPUB 3GSXB 5FECB 4DKFH 5MEOA 2H9GB 3C9NB 4R2GD 3FHQA 5GSVB 4IRJD 5C1MB 4RGMB 4BSWB 3ZZ1A 4Y4KD 1I3RA 3KLHC 1NGYB 4N9OB 2HJLB 1JZ8A 3GM8A 3OAUH 4FRWA 1XR8B 4OZGB 5D72H 3R4DA 5ID1B 4TYUA 3ARGC 3L3OA 4NT6B 3UBXA 3V52H 5HGGS 2DICA 4BK4A 4LFHG 3LB6C 2HT3C 1VACA 3HG1B 3V4PH 1OCWH 4HUVA 5EB9A 3WNLA 3WFEL 3NIGF 1AO7E 4FOMA 1VHPA 4YHLL 3T04D 2X4TB 2YSSB 2A6IB 5K9KA 4GKZA 3U0TA 4L9LA 1E6OH 1HKLL 4Z76B 1I1YA 2F53B 2G9HB 4X8JA 1ZK9A 2E7MA 1F5WA 4DVRL 5FB8B 1F4XL 2AI0H 4G6KL 2ZZUT 2MQCA 1UACH 2I5YH 4IRSA 1PZUB 3TBSB 4PJAF 2JB5L 3LEXB 3OF6D 4XPFL 1F4AA 1HN1A 1FFPB 3IU4L 3RUGA 2DDQH 1PZ5B 4YIQA 4FFYL 5L88H 4C4KT 5LGHL 5BQ7B 2Z8WC 4PJAA 1LE5A 2FIKB 5GISH 4YHPB 1YEDA 4LLYA 4LSUH 3BVNA 4WFFE 1ZHNB 4JFOB 5C0CE 3H42H 3MOAH 4JHWH 4X6FA 5FO9B 5MEND 1MFCL 1QKZH 4HCRL 1D5MB 3TBWA 1GCFA 4Y4FD 1U8NB 5IF0B 1LK2B 1J0IA 5KSBE 4P3CH 4PJ5A 4JDZA 3MUY1 4LLAA 3O4LB 5BW7A 4GS7C 2BK8A 3I2CH 3ULVF 1WTLA 5SWZB 3NA9H 4KI1A 4ODXA 5CINH 4NOBA 2FX9H 3T0EB 4G6JH 2ICWA 1MI5D 4LSQL 3B3IA 4P4KD 4UV4H 3RVUD 3V7AE 3DIFB 3QQ9D 3F65A 3T77A 1HH9A 1LVEA 4V1DA 5A40E 2A6DB 4HC1A 4LHJB 3V4PL 5DJ8A 2ID5A 2F74B 4QT5B 5IKCA 1U8KA 4OGYH 3LQZA 3P0VL 4HUXA 3QNZB 3OXSA 4M3JA 4HUNB 3QNYB 4K71B 5C3LD 3SPVA 2HFEA 1Y6KR 4TUKL 4P57A 1AFVH 4H8WH 3VDAA 2MQ0A 4PJ8A 1MAML 1JTTA 4P2OA 4ONOA 3L5XH 2VDPH 3PDDA 3U9UB 3WSQH 3F6IA 4ZUUB 5CZXC 4LLMB 4TNWF 1HHHB 1A6TA 5EN2A 3P9WB 1JGDB 4U49A 5HHQB 1IC7L 2EZ0D 4ZAKB 1MCPL 2X41A 2XA8H 4U1GB 4CNIA 4OLVL 1D6VL 1C5CH 4LIQH 5IBTL 5D2NC 5ACMA 3UPCA 2F58H 5AZEL 1BOGA 3QWRA 1DDHA 1I7RB 2NMSA 4LDOB 3U2SA 4FTVD 1II4E 2DQFA 5C3TA 1MVFA 4MMZC 4ZO9A 4CVXA 4XP9H 1ZHNA 4JFOA 5KJRH 1TENA 3TYGL 1WGOA 1Q9OA 5L0QC 3MROB 3HZKB 5DC0A 3RZCD 3UX9B 1TLKA 4HK3J 3KAAA 4PJAB 1J10A 1IM3B 3GGWA 5JXAH 1DBKH 5FKPA 3IFLL 1TTGA 4JPWL 2GSIA 1YPZF 5DO2C 3IDGB 4KQ3L 4XAKD 2PXYC 3O6LL 4UT6H 3VFUB 4UOW1 4HUMB 5GQBA 3X17A 2GAZA 5CGYD 2FIRT 3D2UB 2R0ZL 4Z7VB 1U6AH 3EOAA 3EYFA 3HPJB 3ARXA 3V6BR 2E7HA 1WK0A 4ZPTB 1N0XL 4XP6H 3S96B 2P5EA 4Y4KB 2FEEL 3SJVA 3RIFK 3GHEH 2XQBL 2HTLC 3QHZH 2ZOLA 4KK9C 2JCCE 4U6XB 5HYQA 3V6FB 3KYMB 1MJ7H 1T0MB 3KPRE 1BPVA 4JY5L 2NY3B 1Z6JT 4I3GA 1BQHB 1IQDB 4GAFB 3LN5B 3M17B 4F9LC 4KK5D 3MFGB 1MJJB 5F1IB 1RFDL 2KZ1B 4P2RE 5HYSB 2GJ6A 2ENYA 2IPTL 5F70A 4ZAKA 3KHQA 5KSUA 2RQ8A 2DYPA 5F88B 3LPGA 1HXYB 3PP3H 4MWFB 5FO8B 3ULUH 2DTML 4FMFA 3FN0L 3OR6A 1WICA 2YRLA 2ADJB 3CMOH 1OAQL 5I1EH 5I15L 5KJRL 2DQHH 5E2UH 4DVRH 2VDLL 2FZ3B 2Z0BA 1IGCH 1JVKA 4BZ1H 3MOBL 3QNYA 4J8RB 4ETQB 1GSMA 4AEIL 4Y16A 3H9SA 2Q7YA 2W0FB 3LKRA 3G5VA 5T3ZD 4JRXE 4NFCA 4NRZA 2FR4B 1T83A 4Y4HA 5D5MF 3BP7A 5DJCA 4M1CD 4L4TD 3CFBA 4M3KB 3MLSL 1NJ9B 4GW1A 4F7PB 5C2UB 4KKAC 1H5BB 43CAB 2UWEE 4XCEB 3WUZA 2R0ZH 3P77B 3X3GH 1D5BB 4D9LH 2A6KB 3FQRB 3QDJA 5ALBL 3DO7A 2UYLA 4GG8B 1DQJB 4WU5B 2HJKB 3NCMA 3BQUA 1G9EA 3QCTL 2BOBB 3OJDB 5ENWB 3VD5A 4RFEB 1E0OB 4J3WA 1JI1A 4WW1A 4XPHL 3EYOA 3P30L 5JMRA 5DQ9A 4NQCE 5J3HD 5J4MA 4XNUL 4Q6IC 2NZIA 3N1QC 1N5YL 3R1GL 1EHLH 3T0ED 1W8NA 3C6LB 3P0YL 2DQDH 2NYYD 2APVA 2VC2H 4F2MA 3H9YA 3E6HB 2BRRH 5FDWA 2HRPL 1XZ0B 3ARZA 4QHMA 5B38A 1MQKL 2VL5B 1G0YR 3W9EB 1JGEA 1S7TB 4MA1C 1B2WL 2Y06H 1BQUA 2CKBB 5D2LF 3C6SA 4J1UA 4KZEH 1PZ5A 2A74A 5C0BE 2FB4H 2VISB 4UV4L 4Z0XB 3HS0B 3TA3A 1ZWIA 1TXKA 4GKNB 4P3DB 1OTTC 2J8UE 2QQLH 2PW1B 3MXWH 2DL9A 5I1HL 1NCCH 4EKXA 5E08H 1MAMH 1QRKA 1MEXH 4TOYL 4JG0H 4R8WL 1IGJB 5F72S 1NL0H 2FHBA 2VQ1A 1EEZB 2DD8L 5DJXA 4OZHA 4WU7A 5EIVA 5IEKA 3VXUA 3FQXA 3BE1H 3FQUB 3L3GA 3AROA 4JANA 4QRPE 2O61A 1AGBB 4KHTH 4CMMB 1JZ3A 5I1DA 4XCNA 5IVNA 1KJVB 2HH0L 3RGVB 5I1JH 5L7XL 2F19H 1NFIB 2EE6A 4PGEB 4PRBB 4ERSL 4YXLL 5B38G 5EOCL 3CSGA 4HZLB 4LVHC 3KYMA 1UM5L 3EGSA 2W59A 3QG7H 4XMKL 2C3GA 1FG2B 1KPRB 4X4ZA 4F3FA 2JJSC 2VISA 1XIWA 1VEMA 3BQUC 4JB9H 1BAFL 1MFDL 5FF6B 5HHVL 3SDXF 1A7PH 1R5WA 5DFTA 3ARTA 4BFIB 5IB2A 4XP5H 3QBTB 3DROB 3PHSA 1HH6B 2IG2L 4XVSL 5B38B 5KS9B 1RIUH 2EO1A 5DC4B 4YHLH 5J12C 3RHWK 2Y07H 1F3DJ 1VB9A 5C0FB 3PIQA 3MV9D 2H32A 1D5BA 1BFSA 1FE8L 1T7VA 4K2UH 4QXUL 3FFCA 5K93A 1ZANL 1RPQA 5DTFA 1Q9WB 5EG6C 2J6EA 1R3IL 3UJJL 2Q76B 4H8WL 3KVQA 4K94C 3MRKA 4U31A 5JNYA 4RISL 4NDMB 1EAJA 2BFVL 3U2SB 1BVZA 4BH7B 2AV7B 1FNSH 4S1RL 2ED8A 3TNNB 2FJHB 4A6YB 1YEEL 3GUTB 2J4WH 1I7ZA 5EA0L 5AZ2H 5I1KH 4AMKH 3MNVB 3TPKA 4D9QD 1OSZB 4PJ8D 5DJ2B 3LKSA 1G9ML 2JIXB 4JO4H 5DYOA 4BQ6A 1FPTL 1JZ6A 3O81A 1MCNA 1NDMB 3B4NA 4BFGA 4QOKA 1MH5A 1IGTB 1CBVH 3BPOC 1N64L 3D69A 2DBLL 3GMRA 3MV7A 5F8RC 3ROOB 1INDL 3G6JF 4ZFZB 3DLQR 4P0DA 4WUUE 5D1XB 3MCKB 4YR6A 1Y0LA 2X4SB 2NNAA 4ZO6A 5IEHB 3BPNC 3I75B 1KCSL 5KOMC 2IFFL 5EOQL 3NBNA 4HK0A 3GKWH 4QHLB 4WVRA 2NQCA 5DT1L 2K9UA 4JRWA 4HAFA 3C2SA 2PYFA 3JV0A 3ZHKA 2LVEA 2IAMC 3ZT6A 1WEJH 2CLZA 1EFQA 2VUOA 1OWRM 2EDYA 1FAIH 3CSYB 2YK1H 5TF1H 1T6VN 1SM3H 1U58A 4NJ9H 2I25N 4L8SB 1BQSA 1WAAA 5B3NA 2HLAA 3JSSA 3U36A 1C5BL 3TA3D 4P46C 5TF0A 5C0IB 4HDIA 4O2EA 4Z0BH 5I1AA 4YGVB 2EEBA 3SE9L 2RR3A 5ICYB 3TEUA 4AIZB 3VXTA 4OCYH 1YEJH 3X3FH 3WIHL 5E7BA 1BX2B 2XNAA 2FO4B 2JCCB 3DX7A 2BNUA 4MJIB 5E8EB 1FNGA 1J1XH 4KY1L 1KACB 2CR6A 5J6HA 5F7HA 3RWDB 2C5DC 3FO2A 1S7XB 4XPGL 4DK3A 3SE8L 4GAJL 2FEEI 4PTTA 1QEWB 5I8CB 4GJTB 1VPOH 1ZLWK 2Q86A 1FJ1B 1JYWA 3VFRA 4R7NA 3ARFD 3RL2B 4MDIB 5EORH 2COQA 2YPLB 2HTKD 3NPSB 3D25A 5KSAD 2EICA 4DOHE 1P84K 15C8H 4FZ8L 1PYWB 1J0JA 1LP9F 1MRFL 3QXVA 2BRQA 4LCYA 2PYEB 5SWSB 4MNHB 4PJFF 4PRAA 1JZ7A 5IR1A 1A7QH 1V7ML 4BJLA 3AS1A 1YDPB 2XPGB 1FV1B 4G8IB 1BGXL 2FZ3A 3ZDXE 2D31A 5DR5L 3HR5A 1EH9A 2YUWA 4NC0B 3V7MA 4MAYA 5D1XA 5FM5O 1UKQA 1LEGA 3LMJL 4ODUB 1K3ZA 1B2WH 2Y06L 3DSNA 4IDLA 4RAVA 1W2KT 1MH5B 5LKNA 3VDBA 1HHGB 3HC0B 4POYA 4HKZA 4XP1L 1T0NA 3LAFA 1A7OH 4YPGB 1RURH 3DPBA 1TZHA 5ANME 1MIEH 5IVXF 5F7WC 1C08A 4WI7A 5K9QI 5D6CB 5E5UB 2C3WA 1INQB 4ZG1A 2LE9A 3GSNB 2HAZA 3ARBB 5D7SL 3RVWD 5EBLA 3MV7B 3WIIH 2FO1A 4ZTOL 4QT5A 1A1OA 5IKCB 1W0WB 3NPZB 4RWYH 1G1CA 3W0WA 1FYHB 2Z9TA 4YPGA 2VZTA 4C56E 4ZNEA 1P4LA 2NY3D 5A2KH 2E9JA 5HD8D 3T0WA 3T1WA 2DLHA 3MTRA 3IDYC 3BRGC 2R4RH 3RWFB 1LO5B 3MRGA 4K3DH 5F6HI 4I48B 2R2EB 5MENE 4KV5F 1YEFL 4ODSL 4BSVB 2L0DA 1JWSB 5I18H 2ZCHL 4M1GH 3O4LD 1QBLH 5EU3B 4UQ2B 1FE8H 1RMFH 4YHMH 1R3IH 2BXZA 4MXWH 2LFGA 4NC1E 3STLB 1BX2A 1RIUL 3MXWL 1UVQB 1IC5L 2FWOB 3GMLA 3SOBH 1RJLA 2DIJA 3P2TA 3FT3A 2ATPA 3NTCL 1NEUA 5IMOB 2OR9H 3GBNH 4PTTB 2EDOA 1I3GL 4MA3B 4XT1C 2DQFB 3LZFH 5KOVC 4HUWB 5ADOH 5J1SC 4CBPA 3CFJB 5C0DA 4IOSD 4OD3H 1XF2B 3ZKMC 8FABB 1F2XK 1KIRA 5FYJH 3HB3C 3BZDA 4HBCH 4WEBH 2ZUUA 4GKSA 3V0VB 5HPMA 1UQSA 5EPMA 1OAKL 3VWJA 2F19L 5ITFA 1NFDE 4M1DL 4URTB 4MAYD 4IRZH 1DQQA 4F9PA 2OMBA 5CJXA 2FGWL 3CXDL 2GQHA 3ARRA 2GIYA 1OP9A 3SDAC 5DJXB 4PJHE 1C1EH 1NLDH 4JY6A 4NZTL 5IVXB 3WJJC 4PRBA 1X5FA 4LP4A 5DRZB 3MODH 2N7AA 4QHUB 1S8DB 1Z9OA 2YRZA 4CMMA 2Y5TA 1IEHA 3ZDYF 1BM3L 4ETYA 3P9LA 4UAOC 3MRJB 4LVNB 2N56A 1HSBA 3AB0B 5H94B 1KB5H 1RUML 2IBGA 3MRDB 5GIRA 4XH2B 2CKBA 2J5LC 1D9KD 4PLJC 3MNVA 2OXGA 4MCYA 1UZ6E 2HT4D 1T66D 1NAKL 1G7MB 4XVJL 5HI3D 5ECJE 2PW1A 4JG1H 4NCC2 1S7RA 3BD3A 1IGTA 1MRCL 4YDIL 1JNLL 1OP5H 3U4EB 3SCMA 5I16B 2JIXA 1QLRB 1OQXA 1IEAB 3DVGA 3FAXA 4KPHH 4OZ4A 5CLWA 1UCBH 4U0RC 2G2RA 1IVLA 2BSSA 5CGTA 2Q76A 4LCCB 1PY9A 1XF2A 1EIBA 4HIIB 2ZCLL 5T5FL 4G6KH 5DJ0A 1CFQA 5EOCJ 3OGCB 5D70L 4XP4H 2PO6B 4XAWL 4Q9RL 5IMOA 5EZOL 5FK9A 3MRPB 4JO3H 5TDOA 3OKOB 5IB3B 1OF2B 4Y4FA 4YDJB 1Q72H 1UZ8B 3X11A 3L9RB 4R2GC 12E8L 3MJ9A 3KHOA 1FFOB 4V2CB 4LVNC 2ARJQ 1P9MA 3BGFB 1NGZB 5IFHL 4AT6A 1BAFH 1MFDH 2VLKE 5IW6A 3D48R 1MELA 3KPNA 4IDJL 4R0LB 1NMBH 4C83A 5I19L 2EECA 4N68A 4NQSA 3M8OL 5JXED 4KQ4H 3E1F1 3JWDL 5CD3A 4APQC 3W9DB 1CLZL 3IDNB 5C09B 1K3IA 5I76B 4ODTL 1XF3B 5GRUL 5KANG 3JV6B 3K2MC 5E03A 3L3HA 4NPYA 1TQBB 2G9HA 3VGFA 2Y72A 4IMKA 5KS9E 2R9HC 4WO4A 2ITDB 2ESVA 4P2OC 4JZJC 4D9RD 3VXPA 5JLZB 4YQXH 4M9OA 3CSBA 3BW9B 4N8VG 1CLOH 2CLVB 4GRWE 4O5LL 5BRZA 1J18A 4P2CG 3E8UL 2NY1B 2RBLA 3S3PA 3VFSA 4X6BB 2DDQL 4Y5XC 3SE9H 4M5YL 5I75B 4KPHL 2F54A 5D96C 1L4IA 4LQ1A 3MRFB 3I6GA 2CLVA 1CG9A 3VFTB 2X2YA 2H2SC 5J6GB 5JHDB 5ITFB 3SKJH 3CVIH 3TZVC 3VG0L 1TVDA 3WNKA 5DRZA 2NXZB 1R5IB 3BWAB 4EVNA 3ARUA 4XPAL 3L3HB 2ED9A 3AREC 4PP1C 3BIKA 1T6WA 2ITCB 5CJOL 3VRIB 1P2CB 4K8RH 4WHTB 4P3CL 4K3JL 3RX8A 3NZ8A 1WF5A 5EOTB 5ILTH 4LGRB 3RY6C 4XNQB 1MHCA 4PRPD 1YEGL 2CUIA 1WCBB 1TJIH 1FVDB 4PG9A 1NCUA 1FYTD 1N4XL 1RZIA 4JKPH 1A3RL 4JREC 1X9QA 2DL2A 1MCHA 3FO0L 5J9PB 4I4WA 2EYSA 1MCEA 1XGPB 1FJ1A 4CVXB 1CFBA 1ERNA 3MLVH 3DO7B 1A9BA 3BDBA 3H9ZA 5KVMC 1AP2B 4LAQH 4ORGA 1NDGB 4DQOH 3IDIA 2HN7B 4P2RA 4OLWH 5DEFA 4H5SA 2ZP0T 2XN9A 4TSCL 3UROR 3ULUD 5LQBH 1TCRB 4DKFL 1KN4H 3H0TA 3IKCB 5DZLA 4APQA 4WUUA 1FBIH 5JW5B 5FO7A 1YEJL 3GKZA 3X3FL 4PJ5D 3MV01 3OR7A 1OAZL 5C0EA 3W0WB 4Z7VE 4J7RA 3WKNA 4HXBH 3V6OC 5HI5D 1H3VA 2K3TA 3R0MA 5ACZA 2PW2A 3ARBA 4U6TA 2LV4A 3IJHB 4WJ5B 1T20A 2BY3A 3CU7A 5JORA 3I3BA 3MREA 3QUXA 3U4BH 3WNPA 2VR5A 1AR1D 3LEVL 3A6CH 4K7PL 5FOJA 3GHEL 1P4LB 5D1ZD 1KIUA 1RAMA 3D6GA 3HC0A 3OAUL 1UADC 1ZLSH 5KVFL 3RWHB 3QUKB 1FH5L 5K9QG 4NRYA 3G04B 4JFFA 1YYML 4YUEL 5KAQG 5TQ2H 3K81A 2J88H 4PGDB 5KSVB 5JPNA 3QEGL 3F7RA 5CEXB 3AS2A 4JO1H 1OAXL 5KTEH 1NDMA 1HYSC 4OSUH 1OGTA 3VD4A 1KLUA 4LRIC 5E2JA 2AABL 3EJZD 1XGUB 3RTQD 1EBPA 2H26B 1YY8B 3BN3B 4W6YB 3WEXA 4X6DE 3SGJA 3SE3A 7CGTA 1HHKA 4HJ0C 1FHGA 2FECI 1FSKC 3QJFB 4O2FB 2CDFA 3UJTL 1G9NC 4MMXC 3GK8L 2HP4A 3OX8B 4H26B 2I5YL 1Q9LB 1TETL 3REWB 3BWUC 3VFMA 5KVEL 2R29H 1T0PB 1GH7A 3MOBH 3QSKB 4TVSa 3SJVB 1Q9KB 1A02N 3PABB 2B2XL 2F53E 1CGTA 5CP3A 1AXIB 1CF8H 2XZAH 1I7TB 1CDYA 3T0XA 3GMQB 3EOAB 2EXWC 1JGVL 3N9GH 4GBXA 4V1DE 1T22A 5IESH 3IFPA 2Z91B 2G75B 4NUJB 3DVNA 3QIUD 4C56D 3RVTC 3BSZL 2J8UA 3EOTL 4O02L 1R6VA 4S11A 3QUMA 4X99A 1B6UA 1YECH 1T21A 3DUUA 2NY6C 2EYRB 2V2XA 3P0YH 5FM5M 3MLWH 5IUSA 1F11A 4YDVB 5FB8A 1OY3B 5J6HB 4OZIF 4RAUA 1N59B 3GSQB 5JXEA 2ADFH 1A9EA 3H3PH 4OI9A 5JZ7C 4O2FA 3O6KL 1TTFA 2J3SA 4M93B 2CDGA 5JQ6H 1F3RB 4H1LA 4P5TD 3MRQA 4DW2L 1JV5B 1HINL 3X14A 1X7QB 2PCPB 4MXWL 2I9TB 4L8SA 1A6TB 1JWMA 5GRUH 5A1AA 5IEHA 4X6CB 3V79C 1I1AC 2HLFD 5JPNB 3NCFB 1OGAB 5I6XC 2DWDA 3C5ZB 1RIVH 3DXAE 4YXHL 2CXGA 3U79A 3MRMB 4E0RB 4W4OA 3B2VH 1YNLL 1DLFH 2CXKA 3GK8H 1ZHBA 4ZUWB 3QIUC 1D5XA 2HKFL 1CLYH 4G6AD 4NGHH 5JHDD 3PJSB 4YHZH 1R24A 3QQ4B 2YD7A 4RIRA 4W70A 5HHME 4RAVB 4ZUUA 2D7NA 5HYJA 3RWJB 5CD5C 1UXSA 3QCUL 1IQWL 1XF3A 2XTJC 1NBQA 4QRRA 5JPMB 3L95B 4MAYB 4EBQH 3IB4A 3FHAA 5KSBF 4UT9H 3EJYD 2M26A 1HH9B 4V1DB 5E9DA 4MJID 1ZWIB 5DFVC 5SX5K 2B20A 3L7EA 3T0EA 3ULVC 4OJFH 3EOTH 4O02H 4RQQA 4ONFH 1F13A 4P3WA 4POZC 4G9DA 5KN5A 1PYWA 5E6IA 1U8KB 3IDNA 2YOCA 4ODTH 4KK8C 2XT1B 4KH2A 4P4KA 2VLME 2MQ3A 3VFRB 1D5ZB 3U6RA 3EJYC 4M03A 4PJXF 3V5KB 3S4SB 4OFPA 2XACC 3MRCA 4Z5RA 3L1OH 4W6XB 5SWSD 5DRXB 5I15H 5BZWA 3MUGA 4L4TB 5I8OH 2P7TB 1ZANH 4LPCA 4Y89A 2R56H 3QFJB 1OF2A 3PGCA 1U6AL 3MR9B 1EUUA 5MENA 3MQIA 4FFZL 2FX8L 5IWLC 3GJFH 1T89C 1RUQL 4NYLB 2ZUYA 3MO1B 1XIWB 2DI7A 4K3GA 1OB1A 3UTQB 4X7SL 3C8KA 4U4BA 3ZKXB 1XGPA 1AGDB 3A6BH 4HG4K 4J3SA 3U1SL 1LE9B 1YNLH 2A73A 3WFCH 1YEHL 1B0WA 2NR6C 1VENA 2OTUB 4NM8L 4Y4KC 5FGBA 4RBPK 3HC3L 4HS3A 1RQ5A 4XZUB 1GOHA 3LCYA 5FF6A 4IRJC 4BA8A 3ULVD 1G1YA 4HX1A 4JANB 1WCBA 3STZA 1T2QL 1KPRA 2Z8SA 2NTFB 5CJOH 5BVJB 3DSFL 3VRIA 1RUPL 5CBEA 5KVFH 1UG9A 2AEIT 4Y8AA 4KGJA 1MOEA 2VIRB 1R5IA 3BWAA 1S9VA 1PG7H 2X6MA 3EDEA 4X6BA 5HHVH 4P5KA 4WV1B 4B7LA 1G0DA 2GW5A 5F88A 3KJ4C 3AS3A 4OUOA 4QOKB 4OUUA 3MRIB 1DBML 2F5BH 1P7KA 2VXQH 1A2YB 5F96L 4P5TC 1Q1JH 1S9YA 2VLMD 3LKSB 3QG6A 2VN4A 4QLRA 1A64A 2ITDA 2BVOA 4Y19D 2WZPD 4BSWA 4YLQT 2DWDB 3C5ZA 3DI2B 1WEJL 4KJPC 4K7FA 2G60L 5EC2B 5IVXA 3CVHH 4TNVF 6CGTA 3TJEL 3CFJA 5E5MA 4GRLC 3CZFA 3OKYA 1YQ2A 1LNUB 4EXKA 1CDBA 3ABZA 2QHLA 3JWNC 5DMKA 4LU5H 4RGMC 3REVB 1IKNC 1PDKA 1AY1H 3ZSTA 4PJFE 4NYLA 4EI5B 1KTKE 5FGSA 3VXMA 5GS0H 2IQAB 4PTUB 2VXTH 1YUHB 3EYUH 1IL1B 4HW6A 4PRPA 4MDJA 5MERB 3BT2L 1HIML 3QUZA 4M8VA 5C0NC 5KVGH 2YBRB 4Z7WF 1F3DH 5L2KE 3GBMH 1U8MA 2AVGA 2XA3A 4KJWD 5JW3L 5IB3A 5FDWB 4GQPH 2UYLB 4QRPD 4WU5A 2XKNB 3EYQC 4OZIB 4NWTL 3WL9A 5GGTL 3B9AA 1GGBL 2NX5B 4KRNA 1Q38A 5TH2B 3TIDA 1LQSR 4OB5L 1OVZA 1VPOL 5MENB 4YEFA 2WAHA 5DQ9B 1DP0A 4PV8A 4OF3A 2ZOKB 4JAMB 3SGDI 1U93B 1U8MB 3TFKD 4UDUB 5DS8A 3SKMB 3RNQB 5IROC 4U1KB 4U05A 2OTWA 4J8RA 5TDOB 3P9MA 3DNKA 4P5TB 3KWWB 4M6NL 4M62L 3QDJB 4QNPF 1U3HA 1MLCA 1EVTC 3IXAB 4P23C 2E8ZA 5HHNB 2DQCL 4P4KB 5EO9B 3BX7C 3HMWL 3TT3H 5SWSE 1CDHA 3AU1A 1VFUA 4EIZC 1KTLB 4LCCA 2RAMA 1HZHH 2VXSH 5CLTA 3DURA 5DQJA 5IIEB 1S7QA 2JK5B 1B9ZA 1UYWH 3EDKA 4LAJH 3KYKH 4UB0H 2YA1A 3EJZC 4P4RA 4N5UA 3KLDA 1D7FA 5ID0A 3JTTA 3MOQA 2Z4QB 4X6EB 2OL3L 4R97B 3G6AB 3RNKA 1PD6A 5I1CL 3WBDA 4F37F 4PJ8B 4L1HA 1OAZH 1CLCA 2C3VA 2J12B 1JHKL 5I71B 2HFEB 1A7OL 1V7NL 2R2HA 3MRQB 3GMOA 1FC1A 3H42L 5F9WC 3MREB 5J06A 2DLGA 2X1OA 5CJQH 4HGWA 3DX9A 1BZQK 2UWEF 1ND0B 5IJVA 4WHCA 4KKBC 4ZPVB 4LOUC 4GSDL 3RPIA 2X4OB 2ZKHH 1T3FA 2YPLE 1FV1A 4G8IA 2X89D 1KCRL 2X4QA 4EUPA 1DSFH 3O45B 1EERB 2AKRA 3GI8H 5JQ6L 3PXHA 1JWUB 4NKMA 3Q5YA 3DGCR 2XZCL 5D1ZA 1VGKA 1YQVL 3VMOA 1OD9A 2GY5A 3DYOA 4LLVB 3O45A 3KR3H 4PJCE 2FGZA 3TO2A 5CIPA 1H3GA 2JJUA 1J8HB 1DLFL 1EEUA 3V8OA 5F9OH 1QVOB 1ZAGA 4QRQB 4WCYL 1SYVB 3RKDD 3RWFA 1TVBB 3ARGB 3OKEB 3TFKC 4IIQC 4XBEL 4NQDE 2GY7B 4BZ2L 3WHE1 4NN5C 5FDYA 1OAUL 3RP1A 1RUKH 1Q94B 3VGHA 4FABL 1OP3K 4R3SA 2ITCA 5E9DB 3JBG7 1PEZA 1W0WA 3QIBB 3V0WH 3FOLA 4XXCC 1U2HA 4G8GB 3QO0B 3GMRB 4XNXH 1KB5A 4QWWD 2VLLB 4XCFL 3JTTB 3PJSA 3I3DA 4K3DL 4X0KB 4GRWF 1UWXH 2IC2A 4JFFE 1ULVA 4KRLB 1C1EL 5T33L 1I9JH 4IJ3B 1S7WB 4ZXBA 5DQJB 1DEDA 1ZT1A 1CD8A 3LQAC 3LN5A 4KJWC 2R1YB 3ZO0A 5SWQB 3UPRB 3D69B 4FQXA 3OBAA 1JPTL 2ZUQC 3FB5B 4OIAA 2XXCB 2EE2A 3QUYC 4GXVH 3VWKA 3CFCL 3ZYZA 1Q1JL 2A6JB 3K1DA 4F7EA 1BEYL 4MNGB 1FVEB 2Q3ZA 1KCVH 4LCUA 3OAYK 4QY8B 4UILH 2BOCA 2X4NB 3TV3L 2NW2A 2BP3A 1UJ3B 1QSEA 5DMIL 3TNNA 1JFQL 1KIQA 3VXRA 4XP1H 4Y5VB 1QVOA 32C2B 1ZLUK 4MD5A 2P48B 5FYJL 3RL2A 5E2TL 1GPOH 3Q3GB 1MLBB 4QRPB 5CILH 5CIPB 1A3QA 2AGJH 4LCWD 4XAWH 1O0VA 1ZGLP 4Q9RH 4DZ8A 1A1NA 3O2DH 4EN3A 4DN4H 3GM0A 4UAOB 2NX5D 1VDGA 1MPAH 4QRSA 4PJDE 2W0PA 3OZ9L 4PJ5B 2J5LB 2NPLX 4XNMB 2WBJB 4ZOBA 1E4KC 5D70H 3MOAL 5F6IC 5EU5B 4PD4J 3SKOA 3QQNA 1DANU 2Q86B 2IADA 1LNUA 1KPVA 3NPSC 1D5IH 3PWJB 3QPQC 5HTSA 5F8QC 4DGVL 1FVCA 2Y7QA 3B5GA 4N0CD 2V7HB 5D1ZB 1HXMB 3BZFB 1ES0B 2ZPKH 2P42B 5HXMA 4Y4FC 5GJTH 1ZGLM 1FFQA 1KJ3H 3V7AG 3BZ4B 1DN0B 2VXSL 2BDNL 4H1LG 2Q8BH 1KV3A 4JM2F 1AGBA 1CFVH 5ICYA 5DJDB 4I8DA 1TZGH 1WITA 3CLFL 4XB7A 3VXUB 5IEKB 4JQXA 2R1XB 2W0LA 1ZHLB 4MJ5B 4JRXA 3JWDC 3PQYB 1S3KH 2P1YA 1MRDL 5FA3A 4OGAD 5T3XD 1QSFB 2H8PA 1JHLH 3L5WB 5DK2B 3WIIL 4TUOB 2VTFA 4KC3B 2WLYA 3PHQA 2ZG1A 4MB4A 4XNYH 2YD2A 2JJVA 3OKMA 4PJCB 4HJGB 1OARH 4JQVC 4MJ2A 2IH3A 4PJBE 1E4XL 1MWAL 2HFFB 2NW3B 4LK4A 3FN9A 4M1DH 1FFNB 4OLZH 5C92A 5T1KB 4DVBA 1KTLA 2VR9A 2F58L 3VJ6B 2FJGA 1W72B 3IDJB 4MHHG 4TNWK 2CJUL 2ERJC 2VLRE 3WYRA 2LABA 4V2BA 3MV11 2VAAA 1J11A 3QDMA 3KPNB 1KCRH 3U48A 3GSWB 4D0CA 1G6RL 4NP4L 2VZUA 3O3BA 3AXLA 4JFEE 3Q5OA 4LPYA 4PJHB 1RJCA 3CK0L 3DYPA 5DD0H 2VLJB 1EXUB 1ZT4B 3CFIC 43C9A 4HF5L 3HE7D 5IMKA 4DKEL 1Z5LB 2V9TA 3VD9A 2V5MA 5C0CA 4X98B 4XBGA 5E6ZA 5E99H 1WIOA 2B39A 3MJ9L 1ZA3B 5JNYB 4I18A 1A5FH 1SY6H 4HXAH 1QO3B 2OZ4H 4Z77A 3WV0A 2BSTB 3O3EB 4MNQE 5D2NB 2ZOKA 4JAMA 1YQVH 4W4NA 2R1WB 1IL1A 5MERA 1J7VR 3VDCA 1QA9B 3MLVL 4LPUA 5JQHC 4EQ3A 2BJML 4M48L 2O5YH 5DD6A 5C9KA 1BJ8A 1MHCB 4XWOC 5L2KD 1D5ZA 3LEXA 4GRLB 4XVTL 5JO5B 4I5BA 2SEBA 3MNZA 3LS4L 4XTRD 1MJ7L 2FJFB 3IXTB 1QRNE 5EZIL 3WFBL 3CSPA 1BIIA 1XH3B 3BGAA 3RZWA 5I9QC 1DLHA 4RMQA 5ERWB 5HHMB 2BMKB 5J11C 2OZ4A 5DJAA 1DUZA 1OAUH 3TPUA 5KSUB 3LEVH 2FGWH 3CXDH 3WKML 3RIFF 4K7PY 4GBXD 5DJ6B 1OPGL 5CP7A 3SY0A 5T3ZH 5A16A 2WK2A 4F9PC 2ADJA 4POUB 1N7ML 4LSDA 2EEDA 3UTPE 2LAGB 3OJMB 4NP4H 4ZNCD 5F7KC 5FO8A 3C09B 5KW9L 3F5WA 5DUML 3FT4A 1FNFA 3MRDA 2X44D 3GJFB 4RAHA 3FFCE 4HMEA 3BJLA 2APXA 4OLYH 2DWEB 2AABH 5DJDA 5D5ME 1MJ8L 4U1HB 1UQSB 2EH7H 3NABH 3L5WA 3IFOB 5DK2A 3B2UC 4UB0L 5T3XE 4HWEH 2MMXA 5FHAL 3FQNB 2AJVL 5ESAA 5EIQA 3H7BB 2N1KA 2Z93B 3O2DA 4X80L 1CU4H 5IQ9B 1U3ZA 4X7FC 5C0BB 3AUVA 2HKHH 2MCG1 1DVFB 4WO4D 1MEXL 4U1JB 4R8WH 4PBXA 4LASH 1R0AL 5IV2B 1J1OH 5EUOB 5C0GB 5CEZH 4LSTL 1XIWD 3HI6L 3SDCB 4WTXA 1U92B 4NO2B 4KAQH 4QRUB 2XQYK 3EKCA 1L6ZA 1TPXC 4R4FH 2VDKL 2VITB 5C0DB 4MXQD 1OP3H 3AMKA 1VGEH 5D1QA 1QO3A 3PABA 4CADB 3FB6B 3NAAH 1BD2E 4X99B 1YNTB 4N0FB 4LHUD 1V3KA 4XPAH 2F5AH 2D9CA 4AL8L 2G75A 4G7YH 2HRPH 3BYTA 3J8F7 3QFJA 2DQJH 2EYTB 3SKNA 2X1PA 5E4EB 1YN6B 5HGAA 3V6OA 2X9XA 1JYXA 2LQRA 3R1GH 3QI9B 4D8PB 1DQJA 1FVEA 1KENH 1WFOA 3T8XB 1N6QL 3D9AL 4OFKA 4J2XA 1RZGB 2BNQA 1X5KA 3D3VE 5E6ID 5EU6D 3QRGL 1BOGB 5DT1H 3U9UA 1OLLA 4Q58C 4MAUH 1SJXA 4JG0L 5D6CA 1QSFD 3KPPA 1ZSDA 1Q0XH 1YZZA 2JJTA 4BYHA 4YAQA 5C08A 4YWGH 3WMSA 4F15C 1UWGL 5DSCA 3K74B 4S1DC 1T89A 5DVMA 1S7SA 3EZJB 2AJVH 1GOFA 3EOBB 5BOPA 2PR4L 1TFHA 4LLMA 5C09E 1LDPL 3PDOB 2AXFA 4PJGA 4JGMA 4XCYB 2B2XH 3RWJA 4LVOB 1F2QA 4N9GB 3S3JA 4WI9A 3IAQA 1PAMA 2YD6A 3C8DA 3D85D 3PGDA 4ISVB 1N0LA 2BY2A 2OL3B 3W81A 5GS1C 3TH3T 1REIA 5IHUL 3ULUC 3KYNB 4LDLB 1TMCB 3U83A 1F8TL 4PG2A 1A21A 2CDGB 1YEKL 1CCZA 5F9DC 1KLGA 1S5IL 3JVGA 1F90H 1C16B 1OGAA 4Y4HC 5HDBF 3L5HA 1AQDA 3MLYH 3MLXH 3AMLA 2X70A 4X6DB 1J05A 15C8L 3HZYA 3O11B 5AD0B 1GVIA 3BP5B 4H25A 4ZO7A 4R0LC 2OP4L 5I1IH 4JB9L 2J88L 3GMNB 3LDBC 2UUDK 5GHWL 2JJWA 2DMBA 5FYKH 4XP5L 4ZFOB 3INUL 3GMLB 1K9TA 1EX0A 4Z7VA 3TM6A 3UJJH 3BMVA 3HZKA 1J86A 1EMTH 3MLUH 1RZIB 3WXWL 4KMQA 3RU8L 1JWUA 3BDYH 3WL9B 5KBNC 3QNXB 5DRNB 2FHCA 1CE1H 1KGCE 1DR9A 4WO4C 4TSAL 3HMXH 3BIKB 1HH6A 4ZOEA 3D1MC 2GUOA 3SDXB 5D71L 5HVHB 1XR9A 1ORSB 4AENB 1C16A 4PJGF 2IBZX 5B39A 4LCWB 4ZS7L 3D0VA 5I1LA 3RUGB 3EYSL 3LOWA 1E27B 1ZS8A 4HDIB 3DYMA 1QPXA 3WIHH 4JFDB 3IJSA 4HD9A 3ECBB 4LBEA 4BFEA 4NWUL 5JR1L 3QWRD 2RCSL 3C8HA 2WUBH 2I26N 2EC9U 4WENB 4YR6B 4S1SH 4Q74A 1I1YB 1RULH 2C1PB 3WO4C 1UEYA 3W39B 1M05B 4GLRH 4OGXL 2X4UB 1YPZA 3LPWA 4GW4A 4JO1L 1CDCA 2PXYA 2UZIH 4H1LH 1EJ6A 3KYNA 1DN2A 2NY0C 2C3XA 3VI3F 5GRWA 5J3HC 5AUMB 1LO3L 1NUDA 1JGDA 3IF1B 4Z7QE 1TQCC 4RA0C 3TH2T 3EUUA 4Q97A 1DQLH 2AJSL 2EC9T 1E4WH 3KPPB 1KEML 4RMRA 3B9EA 4N90E 3FQTB 5CP7B 3UMTA 1L7TH 4XMPL 1KFAH 3SGKC 2R29L 4HKBB 5FO7B 1EFXB 2R2BA 2YC1B 3UO1H 4LEOA 4JN1L 4PRHA 3VXRE 1JMZA 3OXSB 4JCLA 1A1MA 4ORZC 3PNWB 3O3EA 4KQ3H 4TPRL 2EDLA 3C60A 3ZTJG 4ENEC 3BEVB 3OB0H 5FKAA 2HT4C 4TNVK 1KEGH 1HYRC 4Z0BL 2DOCA 3LQMA 3T0EC 2PO6D 2ICWB 1LEIA 1UGNA 5C0RH 4BH8A 2J6EL 4YO0B 3PWPB 4HGMA 3RVXD 4KZDL 3U30C 2OJEB 5ANMB 4XC1L 3QWQB 1KB9J 4YHIB 4RFEA 3IDXH 4Z77B 4M4RA 3LV3B 3MGAA 1T1YB 4FTVB 5EUOA 4RGOL 4X7EC 3TIDB 4G8GD 4YXKH 4K8RD 5INCB 2X10A 1FGNL 5IHLB 1A3LL 3OTTA 2R0KH 4X98A 4XVSH 4Y2DB 2AW2A 2Y6SC 1ACYL 4YHOL 3UPAA 1WZ1L 4RX4A 2DN7A 4OQTA 3CNKA 4DGYH 1KB5L 1RUMH 3M1BB 1BFVL 4L9LB 4OT1H 3LKQB 1F6FB 2KKQA 4NQEA 3ESVF 1CDJA 2W91A 1FZKB 1OM3H 4JJHA 1UWGH 2VDML 4M7KL 4WI2A 3DRQB 3TBSA 3ZDXF 2VDLH 4WW2C 2R39A 2HKHL 2NY1D 4QXWA 5D93C 1AGCA 1WC7A 1JMXA 3QEQE 1FSKB 4FFVC 3WDJA 4HFWB 1G9MC 1P5UA 3HAEH 4PJEE 1IQWH 3BXNB 1ADQL 5B8CC 4PJ9A 4ZD3H 3SBWC 5J6GA 3U1SH 3ILPB 4Q9BA 4HUKB 4EN3C 3MRMA 3RWGB 1NCDH 3NZHH 1F58H 1FL5B 3BRDA 2VDPL 2EDRA 1LP9E 2H9GA 3C9NA 1N2RB 2OBGA 2V17H 4FQ1H 3NCJL 3VH8G 4QOKD 3SY0B 1JPGA 2BY0A 3PP4L 5FV2A 2WBJD 4DWHA 4MD4A 1I8IB 2IADB 4OQTL 1DBJH 3FT3B 3GMPB 4ZPTA 4D3CL 1AE6H 1AXTH 4CRPA 1EHLL 1A6WL 2BZDA 1SVZA 5E70A 5FYLH 5I19H 3D2UA 4YHIA 4IMLB 3BZFA 2BVPA 2R0KL 1U91A 4MNGE 1TVHB 3DHJA 5E7FA 3V4VH 2V2TB 4Q0XH 2EDJA 4OFYA 1BZ9B 1BBDH 4R97C 2FX7H 2ZUSA 3ULUF 2V2WB 3PWPA 4WTZA 2PXYD 5JXAL 2XKSA 4AH2A 2P5WA 3RAJH 4LPVA 1BP3B 5CZXD 3MXVL 3NCCB 4YDLC 4D0DA 5FHAH 1ZLVK 3LV3A 4GW1B 4F7PA 5DUBA 2NY3C 4XNMA 1IKNA 4NKDA 3VXUD 2V2TA 4NQVB 4UBDD 2W1NA 4Q9CA 2JJSA 3MA7A 2HJKA 1JJUA 3O6FA 3PWVA 5CKAA 4D0CB 1MIML 1T03L 5TGBA 3OKLB 3O11A 4BM7A 1KTRL 1WT5C 1F45A 1J87A 4I3RL 4HT1H 3OGCA 5L6YH 2Y5EA 2VLRD 4X8XA 4RZCA 3KJ4B 4XPGH 1PW3A 3JTSA 1F02I 1WWWX 1ZVYA 2BSSB 1SVCP 1LK3H 1PG7L 2WP3T 3QFDB 2HMID 3QQ4A 4RIRB 3MODL 2ZNXA 5I6XB 1TPXB 3SBWA 4KUZH 5BJTB 3NFPA 1JNNL 2CIIB 3HE7C 5H94A 2V17L 4XC3L 5FUOH 1U8HB 1YMMD 3MLZL 1T5XA 1MRFH 2Y5TB 4PJ9B 1N6VA 3VJ6A 4HJ0D 4P5KB 1S7VB 5FHBL 1LEGB 3QDHA 1RJYB 3P4NA 4OGXH 1A7QL 4UIMB 5BZDB 3VFNA 1CGSL 5BO1L 1IFHH 2WBWB 2UY6A 1XGRB 3GIVA 3UAJC 4TUJA 2FEDC 4G8EB 4WI8A 4PRAB 4OGYL 3OB8A 1HZHL 3IFLH 2X4UA 4WJ5A 2DKMA 4QHUA 2M1KA 3VG9B 3LQAL 2DQGL 1BIHA 4FFVD 2B7DT 3BPCB 4EUPG 5B3JE 3QXDA 1MRCH 4YDIH 5E2WH 4QHMB 1JFQH 1W0VA 3LHPH 3PWUA 5EO0A 3NIFE 1K8IA 1OT2A 5E24E 5B21A 4KKLC 3C6LA 3CX5J 5AEAA 2ZNWA 4Y16D 4MA8L 1K6QH 3HKFA 2YD4A 1AKJA 5EZLB 3VXSD 4JDZB 5MI0B 2QJDA 3T0VA 3UTTD 3PE9A 2YPVH 1VFBA 3EO1A 3KYAA 5BW7C 4ZFOA 3CPLA 4YH6A 1X5GA 2H2PC 1I7TA 2GCYA 3QXAA 3JWOC 3MPCA 3ARDA 5H8DA 2GFBB 5C08D 2QSCL 2Y36H 1K4DB 4DZBB 4K55A 4ZNEE 2XI9A 4YE4L 4JFXA 4KZDH 2DQDL 4JLRA 4HKXB 4WHYH 4AK1A 1S9WB 1ACYH 3STLA 1A7RH 1QSEB 1H3WM 4GBXB 3T3ME 1RU9H 1MFEH 1SJEA 4HIHB 1KYOK 2OP4H 3LIZL 5J1TC 1LO4L 5CZVL 6FABL 4G42B 5TQ2L 3DWTA 2R2BB 4I0PA 3K2UH 2ADIA 2JJTC 4G6AC 1JUFA 2AXGB 3N1MC 4F58H 1JK8B 5HHOD 3S4SG 2E9WA 2RGSA 3MRGB 3ARGD 4CJ1A 3DV4B 5GS0C 1A4KB 1DQDH 4YFLI 5I1HH 1RJYA 3S35L 3DETC 3W2DH 3QEUA 3MCG1 5T1MB 1L0XA 3QDJE 1F3JB 3WXVL 2DWEA 2HFGH 2FB4L 4LSSL 4J3UA 4EDWL 5DMIH 5MP6H 4JCMA 3TCLB 3AM8C 5MI0C 1DVFC 5EIIA 1KNOA 3B43A 3QIBD 4FNLH 4L8SC 4YAQB 4QGTA 2B5IC 1AI1H 5F9AC 3NIDF 4WY7H 4D2NA 5SX4H 3HCVB 3O2VH 3O0RH 4LSVL 2CDEA 2AJYL 5GS1A 3AM8A 4OLZL 3L6FA 4OCYL 2ORBH 4PJ5E 2K1MA 5CS7A 4BH7A 1FZOB 2ATKB 3QDGD 4P4RB 4XMKH 1VEPA 4XNUH 4O2CB 4XWGH 1E4JA 1CXFA 4K9EL 3S96A 4HC1L 5HHOE 1BMGA 1K5NA 4ALAH 3UZEA 3ARGA 3LRSB 2GTZB 5DEFB 1ODAA 1NAMA 2ARWA 1RK1B 3DGGA 4P2QB 4CGTA 1GL4B 4FQ2H 1AP2A 1K4DA 3WS3B 3I6LD 3S88L 4X7TB 4AM0B 1RZ7L 2Q1EA 4IIQB 4XVJH 2Z8VC 3QXAB 5HGAB 3BVNB 1VGKB 4NBXB 3H0TB 2DQIH 1FORL 2JCCA 5IHZB 3SDYL 1J8HE 4XBEH 4F80A 4I18B 1DQDL 2XTJB 4N0FA 3LMJH 1FFPA 3QQ9C 4M7JH 1JPSH 3GRWH 4R4BA 3WUWG 4GXUM 5F9OL 5E5MB 4HIEA 4U1SA 1T3FB 3F58L 2EYSB 4YFDB 3ZDZF 5H35A 2CDFB 2V9RA 4PRPB 1MCLA 2CLZB 4NHUA 5C0RL 3UZQA 4XPTH 2BJMH 1NCWL 2H26A 1MPAL 2CPCA 5F7DB 3PWNA 5IB1A 3X12A 5L2JB 4KDTA 1DEEB 3EO0A 1BJ1J 1KLUB 2QHRH 5FCSH 3LKOB 1KELH 3IJYB 1VA9A 3DTXB 1OPGH 4DVBB 5C0JB 5IWLA 1N2RA 4GG6A 4D3CH 1I9RH 1A7PL 1EUTA 1WZLA 1A14L 4XH2A 2VC2L 5SX5H 4OM0L 4GFTB 3JV5A 1I3UA 1P4IH 5MEQB 2B4CL 3PQYD 4I1NB 4S1DD 1A6VH 5DJAB 1NEZG 4X6CE 3ZL4H 5HJ3A 2AV1A 3ZSSA 5MEPB 3G6JE 3HI1B 1DANT 4HUXB 3ZT5A 3VFWA 1U8LA 3JV6A 3MRRA 5M94B 1CVRA 1QLFB 5A16B 3VXOB 1TJGL 1EPFA 2NXZC 2A6DA 2OLDA 2NLJA 3EW3B 4GRMB 4L9LC 2FECL 4DEPC 4F7MB 3CXHK 3EHBC 4WEUD 4G6ML 5CZKA 2MHAB 2BMKA 2ZG3A 3GSVB 2DD8H 1KF9B 2ZUVA 1EHAA 3ARBD 5TPWL 5HSFA 5DC9B 2ZSVB 3X11B 1NLBL 4UTAL 1VFAB 5MEOB 1T66C 4MX7B 1IKFL 3IXTA 4N0UB 3GO1H 5EU6A 1U93A 1CZ8L 3BKYH 4RZCB 3QPQD 4HWBH 1JIBA 3FONB 2NX5A 3OJ2C 4ZAKC 2H32B 3NAAL 3KWWA 1PG7W 4KDWA 1I7UB 4M7LT 3MMEB 2F5AL 2VITA 2W65A 3LH2L 3U82B 2GSGA 3O3DB 4Z8FL 3CH1A 4P2RD 4NO2A 5A3IC 3O6KH 4JQIL 4GUPA 1Q0YH 1QBML 1VEOA 1M4KA 4ACPA 1DVFA 4A6YL 3AY4C 1UB5B 3E0GA 2WWMD 5HDLA 2UVFA 4Y5VA 2ZPKL 1NJ9A 4S0SD 4LVHB 3JZ7A 1EJOH 2BHUA 3NH7H 1UEMA 4JN2B 2YD5A 4PY7A 4LKCB 4XNZC 4ZUSA 1JYVA 3AFLA 5JDJA 3ALPA 1NBZA 4P2QE 2YSSA 1SBSL 3OF6A 1HHIA 4HWEL 1ZHBB 3LRGA 3T65B 4ONHA 5KG9B 1OARL 4L3CA 2EO9A 2FSEB 3IDJA 4WGVB 5INDB 1MJJA 3O2WL 4Y0GA 2BSED 3VFWB 4L4TE 4WEMB 3TYFA 1RUQH 1LP9B 5HHMD 3DUSB 1C5DA 2X40A 1Q0XL 1T80A 4N5EC 1HIMH 4NJAH 4UT9L 1WJ3A 3Q1SH 1QFWL 4FXGB 2ZSWB 4ZFGL 3MLRL 2PR4H 3U9PL 5IBLC 3ULVE 4K94L 2CKNA 5GSRA 5CEYA 1G7LB 2EIDA 5FOBB 1J12A 2NCMA 3TC9A 1YMMB 1AQKL 4ZQKB 4P3DA 1F4WH 4PB9H 1SEBA 1MFEL 3KG5A 3VFPA 1G7JA 2MTPA 4NN7B 4O4YL 1GAFH 4ZYKB 4OKVA 1QBLL 3UTPD 1CXLA 1G9NL 3L3JB 3H9HA 3D3VA 1IFHL 5I2IB 4LIQL 1HKFA 1NBVL 4OZFB 4WWKC 3CH1B 5DR5H 1RK0B 2WV3A 3UTTA 2YUXA 4LSRH 1NFDB 2R8SH 5IVOA 3TO2B 2ICWJ 2PNDA 3HPLA 3WLWD 5BV7B 1OB1B 4S1QH 2P8LB 1XFPA 4MHHI 1T1WA 2HFGL 5F21B 4JQXC 5ACLA 1SBSH 4JFEB 2WSKA 1CXKA 2WIIA 1RK1A 1INEL 1UH2A 4I2XB 3GSNH 4V1DD 4LP5A 2Y23A 3EDFA 3ZE1F 3ZTJH 3DETD 4MQXC 1P84J 3V5DA 4RNRB 2BOBA 1AKJB 3OJDA 4N8CL 3PWPE 5E6YA 4G3YH 2O5YL 3MUZ1 1FRGL 4Y1AE 4O2CA 4AEEA 5FYJD 3NMEA 1FLTX 4R7DA 4L3EA 3QHFH 2H2PD 2YKLH 4NO3A 4NKQB 5DQDL 3PL6A 1GYAA 1J1XL 2B0SH 4FQXB 1CDUA 4N9GA 1U0QA 2GTZA 1HWHB 3FFDB 3FZUD 3C08H 1HYSD 3HB3D 1Q8MA 4P2OB 3VWJD 1BBJB 5IW3A 4P99A 1QQDA 4ESKA 4PGCA 3PP3K 1A14H 1YMHA 2X4RB 1BM3H 1IT9L 5BXFB 4FS0A 3QUMH 1A7RL 2KZWA 2VE6B 4M93C 1R3JA 2IEPA 4FG6D 3UBXG 4PYHA 4NNPL 2C7UA 1IE5A 4I9WD 4HWNA 4G8GA 3FO1B 1NCTA 4K3HA 1BF8A 5DUMH 2G60H 2X09A 3CVHL 1N4XH 1P53A 5DHVA 3VWJC 3DX6B 1FAKT 1WUNT 4P9HC 2BNRB 3U7WH 4Z7OE 4DGIL 3UAJD 1D5XB 4M43H 2WINA 5BJTA 4MZ2A 3KJ6H 2HT2D 2JK5A 4LCYB 1PY4A 1KC5H 3O6FD 1DQLL 5K33A 3V4UH 4P2YA 3SDDD 3TBYB 1QSVA 2GUOB 4N1HB 2YXFA 3HUJB 3HAEA 3U7YH 3GO1L 2VDKH 3ZT7A 1MUJB 4MJIE 1AGFB 5SV4A 3IKKA 5D7IB 4WHDA 3MRNA 3FB6A 4HIJA 2HMIC 3P9MB 5CEZL 4LSTH 5LGHH 1GGBH 1IAKA 3ARDB 4LDEB 2VDOH 3GJEA 2APWA 3S5LB 5DHVH 2QLVB 3O8XC 3FN3A 4UDTA 3IETB 4CUCA 4R4FL 4O9HL 4HH8A 5KZCB 4X4YB 2B0SL 2QTEA 4XWGL 4S1SL 4WFGE 4HH9B 4YHYC 1F00I 4HIJB 2XFXA 5HHPA 2ZUQB 3HPLB 3NZ8B 5EOTA 4WHTA 1XAUA 3O6MH 1IMHC 2VUYA 1BQHG 1P4IL 5DMJB 3RQ3A 5D9SA 1G7PB 3WNNA 4NC1C 4EIGB 4IOFC 1MCWM 4YIQB 2YEZB 1LO0H 2QSTA 1UWXK 3I85A 4UINH 3JUYA 4YGVA 4AG4H 4MGXA 2JTDA 1KT2B 1CG9B 3VFTA 4G8EA 3RPKA 3HFMH 4CVWA 4H0HB 4NFDA 3FCTA 4HS6A 2BC4B 2R0WL 5D7JC 1CGWA 1PKQA 2OSLB 1DFBH 4NQCA 4BZ1L 1J1PH 1IM9D 3VXUE 3KJ6L 3QCVL 2XWJB 2OR9L 4U1HA 4NRYB 2L7JA 5LBSH 5HYIA 3STBA 5CSZA 1WSST 1ADQH 1GHFL 4LLWB 4KTDL 3F58H 1NH6A 1CGVA 3LKPA 1LO2H 3SPVB 3MV8B 1IILE 3T4AB 5IBUG 1NC4B 1P6FA 1W72L 4PLKD 1F3JA 2C3HA 2EKJA 2R2CA 1MAJA 1N0XH 3TZVB 1I7ZB 1KJ2B 2J6EH 4XCCL 1ORQB 1A4KA 3G5ZA 3BKCH 3VXSB 1FP5A 2BNQB 2CH8A 4GKNA 4NZUL 4A2LA 3BE1L 3P30H 1S7SB 1FNEB 1Q94A 1F8TH 2WBJC 3QEQA 1WFNA 1HWGB 5F9JB 4OLXL 4AY0A 3LKQA 1YEGH 5C08B 4PRDB 1YEIH 4WFGD 3W9EA 1K2DB 3O3DA 4J3VA 3WJLA 4LQFL 2KL6A 1FIEA 4UZGA 1VKXA 5F96H 4Z78B 2M8XA 2MCPL 5CUSL 3I6KA 4MDIA 3QT2A 3T77B 3QB7C 4B5EA 1KN2L 3PGFL 1EFXD 2FD6H 1DBJL 1O7VA 2DS4A 2K7QA 2P8MA 1CFVL 1M6OB 4XBGB 4OV5B 4HEPG 2VRAA 3MR9A 4L5FL 5ALCL 3TA3C 4PRNA 4HIIA 3PG2A 5AG9A 5GGVH 1L7TL 3HE6D 1XGTB 4KJQD 5JHLL 4P23A 4NKDB 4L4TA 2UWEA 4JY4A 3E8UH 3MMEA 3SGEH 2FX7L 4HUUA 1X4ZA 2A9MH 3VXTB 3GSVA 2QQKL 2NXYC 2CUMA 1OTTD 2VXTL 4JFYB 5TE4H 3SDXE 2A6KA 3FQRA 1SEQL 3KDMA 1MCFA 3ARQA 3RL1A 4KDTC 3H7BA 1ACZA 1T04A 4RX4D 1SJHB 5JOEA 2H6PB 5DHXB 2HVJB 1G7LA 5FOBA 2WUBL 2W38A 4L29B 4C59B 1GPOL 3LD8C 1QR1A 1CLYL 4ZDHA 4P5MB 5EZOH 2HH0H 5LAXA 3U0PB 2HJFA 4XCNB 2QV2A 4U1NA 1VFOA 1G7JB 2CRIA 5DXWA 3T2OA 4QF1A 1P7KB 3H3BC 4YFEA 1JNNH 1ZKAA 5IMMB 4K8RC 4JO4L 3GJFA 3QUZC 3MUJA 5L6YL 4ZQKA 4HS8H 3AC0A 3ET9F 4FXLA 5ESAB 1BWWA 1RULL 2PTTA 3VGDA 1X5ZA 2ESVE 3P0GB 3IFOA 3IT8D 9CGTA 1H15A 3QG6B 3PQYE 1MNUH 3NFNB 3JWDH 2FBOJ 1JTOA 2Z31B 2XG5A 1PSKH 1U8OB 5JIKA 3MRIA 3VFGH 3VXPB 1YPZB 4GW4B 3NFPB 3F5WB 1NFDF 3K8LA 2IQ9H 4CDGC 4OAWB 4MAYC 2KH2B 3S36H 3UBXB 4NFBA 1SJVA 4DQOL 1I4FA 5BO1H 2AK4A 5HYQB 4HIEB 4M7LL 5E9DD 3U7WL 3WLWC 1ONQB 4F8TA 5HI4C 5C6WH 3V9FA 2HYMA 2N7BA 3SKOB 4DN4L 4WO4B 3EYFB 3HPJA 3BZ4A 5L9DL 3WFHB 4EI6A 3BMWA 4UQ3B 2UWEB 3M1BA 3SDCD 1RSFA 3HC4L 1FDLH 4UDUA 5TFSL 4XNYL 4H88H 5IQ7H 5C07D 1NGXB 1FCCA 5LCVL 4E41B 3MNWA 4UU9B