4R2GC

Crystal structure of pgt124 fab bound to hiv-1 jrcsf gp120 core and to cd4
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
210
structure length
210
Chain Sequence
YVSPLSVALGETARISCGRQALGSRAVQWYQHKPGQAPILLIYNNQDRPSGIPERFSGTPDINFGTTATLTISGVEVGDEADYYCHMWDSRSGFSWSFGGATRLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Surface protein gp160
publication title Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
total genus 35
structure length 210
sequence length 210
chains with identical sequence I, M, P
ec nomenclature
pdb deposition date 2014-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r2gC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r2gC01
5J3HD 3MR9B 2F58H 1P7QB 4F7MA 5B38B 3ZYJA 3A0OA 5I17B 3VXMB 1WZ1L 3ZHKA 3D69B 2E7HA 4PJDF 1XCQA 2X4SB 3RGVA 4RMWA 3RU8H 4K71C 1JCKA 2Z8RA 5SWSE 4D8PB 2G75B 4U1LA 5D5MF 5CMAA 4MJ5A 4XVSH 3MV8A 2FNBA 4F33B 1OP9A 2OL3L 3P30H 1I7TB 1MCKA 3RHWF 1MCSA 4BYHA 4NPYB 5FUZH 4ZFZB 5D2NB 3UTSE 5BXFB 1F4WL 5DC0A 2XY1A 4PD4K 3QXDB 1RJLB 2BSTA 4S2SB 3TVMB 4KTDH 5E8OB 1GZPB 2ZCKH 4LIQL 1YNLL 3IFPB 5IMMA 4HC1H 5DHYB 5LKNA 3FAXA 1I9JL 3C8KA 3GMMA 4PV8A 2OZ4A 3ALWA 5LWYL 4MJID 4K3DL 1ZS8B 1K5NB 3FFCE 1J12A 3H3PL 4G6KL 3PABB 1II4E 4AG4L 4FTVA 3QR2A 5CKGA 1A6TB 3W9DB 4Z78B 1Z5LA 4YZFF 1K6QH 4HUUA 1EEYA 2RCSH 3BP7A 4U2YA 3DRTA 1PSKL 1U8MB 2A2QT 3JV0A 2VYRE 1DUZA 1S8DA 5DEZA 5EDXA 4UUJB 1T5XB 5KZCB 3QCTL 3HR5B 3QEHA 4MQTB 4N68A 3RNQB 2FHBA 3BISA 5DJYB 4XX1E 2W91A 4Y1AD 4NC1C 4FNLH 1XF2A 4X8JA 1FZJB 5IBLD 1ORQB 5IKCA 3FJTA 1ED3A 1D3CA 2CRIA 1ZHLA 1U9KA 1I1CA 4P49A 1MREL 1CICD 1T22A 1WFNA 1KJ2B 4Q9CA 1V7NH 4IRJB 5D72L 1ITBB 1PQZB 5ERWB 3DSFH 4XP6L 5I8OL 3SDYL 2QL1A 2X09A 5SWSB 5HHQA 1T83A 1WTLA 2DIJA 3KNBB 5DHVB 1DQJB 4OFPA 3TM6A 2YA1A 3FTGB 3OKEA 1Z3GH 3LKRB 2CO6B 4I1NB 3TCXA 4GT7A 2ZUXA 1ZAGA 4WTWA 3W0WA 2W9EH 4F9PA 1R3LB 2GIYA 4HDIB 5EUOF 3S37H 3OR7B 3UTSB 2DD8L 3JUYA 3OX8B 4OCLC 3MLZL 5CEXB 3HRZA 1G7LA 1LEGA 4J3XA 5IVZB 5MENE 3C5ZC 3IFNL 3KLHD 2FEDD 4LSVL 4R97B 2DLFH 4WGVB 3FFCB 4M6AA 4QRSB 1GAFL 3PGDA 4Z0XB 4BZYA 2KZ1B 4KJYB 3EO1A 15C8H 4NQEA 4OLUH 5IOPA 4QHMB 4PGBB 3PHOB 4X99A 2B4CC 3T0XA 4YHKH 4X6CE 5HHOD 5I8EA 3SDXF 4CMMA 2ENYA 2OR7A 3MFFA 5TGBB 1U3YA 3FRPA 5I71B 5KAQF 5L8LB 1T4KB 2EICA 3QIUB 4LRNL 4PB9H 2PO6B 4LGPB 1D9KC 4JVUA 1ZEAH 2E8YA 3FQWA 4L29B 4R0LC 3W11D 3H42L 4TSBL 5KSAB 5HJ3A 4MB5A 3GSNL 5F3BA 3MJ9L 3U30B 4GRWF 2R23A 3T08A 3KPSE 2Q7YA 1N0XL 4CGTA 3PJSB 1WZKA 3TYFA 4JGMA 2XZAL 4FMKA 2GAZB 4N90D 4GRLA 3OJDA 3N0PB 2DQJL 3P73B 1DSFH 3ARZA 1P4BH 3ZT5A 1E4XL 1YC7A 3MLWL 4CN4A 4GSDL 1AGDB 3MA9H 2QHRL 4KRMB 5JIHA 4IRSA 3TH2T 2X44D 2G60L 2FJGA 2YHGA 4LARL 4JPIA 2V5TA 3GGWB 4JO1L 2IAMA 1VEPA 4YHZL 2BC4B 4LCWD 5C9JA 1ZLSL 4RWYL 2D7NA 3TZVB 4WDIB 1UYWH 2EH8L 4PG9A 5JXEA 4KQ4L 4UV4H 2VJXA 2R1WB 2NY4D 1IEBA 3QXVA 2CIKB 3O6FB 4PTUB 5FO7B 4YXHH 3PE9A 1J18A 2NLJA 1UVQA 3K8KA 1AP2B 3QEQE 1YMHB 2X4TB 4R3SA 2LVCA 2FZ3B 1U8JA 5IK3B 4Q6YA 3EBAA 1QSFE 2NY4C 4PJ5D 5SWZA 1J7VR 4C4KO 5JOFA 1YECH 2BRQA 1NBZB 3OGCA 3OMZA 4XNXH 4X6CB 4JO2H 3BVNB 4M93B 2XKSA 4FFYL 1F4YH 1EV2E 1DFBH 1A6VH 2XZZA 4NN7C 1KJVA 5EOCL 3D2UA 5FYJD 4ZAKD 5JTWA 3BPLC 2JJWA 1ZOXA 3BGMA 3A67H 3S4SB 1I1AA 2IBZX 3LN4A 3BMVA 1SYVB 3T2QA 5F6HI 1BQSA 4JQXA 5HVFB 3WNPA 4OZIA 1UA6H 5JHLH 1YPZF 2IH3A 4ZS6D 1AO7D 5I1CH 2OXGA 1DBBH 4GQ9L 3P4LA 2F54D 4Y2DB 4NBZB 3KPSB 5GISH 3FRUA 3Q6GL 3QIBA 4U1IB 1OM3H 1X5YA 2MQCA 4NZTH 5I74B 3F7VB 3D9AH 3MRRA 4ODVL 4J8RA 1IAIH 4G9FE 4M5ZL 3V7AG 4OUUA 3UJJH 3PHSA 1NCCH 1X7QB 5L2KE 5HHVH 2VDOH 4PRPD 4YGAB 1CFVH 3RAJH 2GK0B 4ZOAA 4HPYH 4AH2A 1J8HD 5D93C 4WFFE 5BVJA 1IARB 2FH8A 3GBLA 2H3NA 1T03L 4QRTA 4XC1H 3UTTB 1T1XA 1ITCA 1WBZB 4Y19D 4B53A 5F72S 3QEQB 3O6ML 4DGYL 4KGLA 1NH6A 5D7KD 1QSFB 4D9RD 4DKDC 4MQ7B 3VJ6A 2C7UB 4KROB 1LEIA 1CVRA 1G7JA 1HOCB 3MA7A 1RI8A 3UXFA 3EJJX 1MQKH 5DLML 1LHZA 1WZLA 5HPMA 3AROA 5DJAB 4MA3B 2YXMA 3HAEA 4FQLH 4NKDB 4X6DF 5IB4B 4WW2B 1MCOH 4HUWB 1FIGH 1DR9A 1MAMH 1JZ8A 1A3RH 2CKBH 5BMFH 2QADC 4XAKD 1BQHA 5F44A 1HH6A 4P4KB 4MSWA 1DBKL 3X3FL 5IV2A 4GKZA 5C0CE 4OLVL 1KB5A 1MH5B 4AENA 2C3GA 1PZUB 4P3WA 4HJ0C 4XNMB 4X83A 3OAZH 4O4YL 1IM3A 4JN1H 3FT2A 4N9OB 3I50H 1CWVA 1T1WB 4QTHA 4XCEA 2OR9L 1L0XA 4I3RL 2CJUH 4MNQD 4Y1AA 4R4FL 2VR5A 2IQ9L 3SOBL 4G9FB 1EBAA 1X5LA 5SWQB 2AW2A 2VLJD 4WVRA 3ARGD 4NHCH 3CXDL 1XF3A 3C60B 3OG6B 2J4WH 2XN9A 5E2WH 4FQXD 2Q86A 3IU4L 1JVKA 1KCLA 1L4IA 2EDYA 3VFSB 1INQA 1FNGA 4I0PC 4ORGA 2VLMD 5JPNB 1X4ZA 5EC1B 4GS7C 1AE6L 4QO1A 3K0WA 3BEVB 4KJWD 3DROB 4Y8AA 1XH3A 2IPUK 4E41E 4QT5A 4YDJB 5ANMA 3C5ZA 3KPNB 2DJ4A 4ZPTA 3MRMB 5DDHB 5J56B 3BGFC 3DV4B 4I5BA 3UO1L 5HHXL 1INDH 5EFIB 1QLFA 3IKCA 4OLZL 1LMKA 2ITCA 1NC2B 3H6JA 3LKQB 3OAUH 4HC1A 5E8NB 3KJ4B 5EOQL 3GKWH 4K23L 1ZVSA 1KGCE 2PXYD 3WFEL 3PWUB 2ARJQ 3VFOA 5ESAB 5F7LB 3MBEC 4PJCE 1RZ8A 5EU7E 3ULVE 3UYRL 4JAMB 3FB5B 4AIZB 1LO5B 1VADA 5FK9A 2AJZA 3B9KC 1BIHA 1F58L 3U79A 4S1SL 1NEZB 4H1LB 5HY9B 2IALB 3VXSD 4CU6A 5C0CB 3SQBA 4YPGA 5HHOA 1NJ9A 4U1GB 5IHZB 4ZO7A 5IMLA 1PLGH 1A21A 1D9KA 4WEBH 3HPJA 4HW6A 1CDGA 4R0LA 4OIIL 4HK0A 1KTRL 4TUOA 1QTYT 3OZ9H 3DO7B 1A7PL 5L2JB 3STZB 4XGZA 2NXYC 1RMFL 3WIFA 2Q76A 1G7MB 1I1FB 2EDLA 3S3SA 1S5IH 4XCYB 2ZKHH 5GGTH 3CVHH 4P23B 4Y8DC 4QRRE 4GBXB 4AMKH 4XXDB 3SKMA 3ZE0E 1I4FA 1JK8A 4CJ1A 3MV8E 3BIBX 1CZ8H 2NY6C 2PW2A 2IF7A 4GUPA 2GITB 3E8UL 5I76A 4BSWB 4EN3C 4KI5F 2VXUH 3GI8L 4FXLA 1TPXB 5DK0A 4NQDA 4QOKD 2OCFD 1FYTB 4KKAC 4MX7A 2BNUA 1MCPL 5EZLB 1BREA 2OX5A 2R0ZH 3DMMD 1N8ZA 4POZD 3MO1B 3WE6A 1V8HA 4R96A 3LSOA 2QLVB 1ZWIA 1FG2A 3CFJA 4PJCB 1D5BB 3N9GL 5DQ9B 4WTXA 3INUL 4J7RA 1MCNA 2WUCL 4U1NB 5BW7C 3QUKA 1JMXA 2DDQH 3GUTB 4JPWH 2WM0A 3V2AR 5EBGA 3QNXA 2VC2H 4M1CC 1EO5A 5EPMB 4D0BB 3OF6D 4JREC 2R1XB 3ILPA 3I2CL 3KJ6L 5C0EA 4JHAH 3LKPB 1MCBA 4LSDA 4BQCA 4LOUD 1RIHH 4WWID 1EHXA 4MMZC 1IZKA 2BK8A 4AIOA 2R1YA 1MIEL 1PGRB 1RUKH 5K9JL 3VDCA 4M02A 4ODXA 4DW2H 5D7IA 4X80H 5GS1B 4JKLA 4YDIL 5A3ID 5B4MD 1M71B 2C3VB 5DVMA 1O7SA 2F54A 1H3VA 5ENWB 2WZPD 3WEXA 1CFQA 4QRRB 5BOPA 2V9RA 1BEYH 3O2VL 2CD0A 5M7QA 4ZUTB 4GG6F 1AI1L 2GHWB 1JF5A 2OM5A 2X1XR 1FN4A 4PJ7E 4GLRI 2YK1H 4MLIA 3DVNB 2R29L 3AXLA 3W0WE 3CVIL 1L7IL 1TMCB 5E99H 4X9HA 1IGIH 1M05A 4NKIL 2VQUA 1MSPA 4M1GH 1EH9A 1LQSR 4WU5A 3QHZH 4NCC1 3HE7D 4TRPL 2BY0A 1J8HA 1VFMA 1JV5A 2Y72A 2EIDA 3CH1A 4FQQA 4FRWA 5MERB 2B39A 1MEXL 4OCYH 3EYVB 5CWSB 3A6CH 4HIXH 1UKTA 1CIUA 4JZNB 1HWHB 4LCUA 5C0BD 1WBXA 1I7UB 2PYEE 3THMH 4YC2C 4RGND 1T5WB 4XCNA 3DVGB 4S10A 4YHPB 4JQIL 4WI8A 5GJTL 1YEIL 1NUFA 1U8QA 4XCFH 1L9MA 1ACYL 4G5ZL 3QDMD 4APQB 4MHHI 4WV1C 5HI5D 3HI5L 3FN0L 3I6GA 1BVKB 5DJ8B 5D1ZD 1K9TA 4JFPB 5GPRA 1MJ8H 1CBVH 1EPFA 2DTSA 5CUSL 1G0DA 1OTSC 4LLVB 3OXSA 4HBCL 4K8RL 1MNUH 1JHKH 2YOCA 5D1ZC 2IJ0C 2O5ZL 5IJVB 3DPBA 3S3PA 4ZMAT 1C7SA 1HXMA 3K1DA 4KMTH 2NXZB 1IC1A 2RGSA 4MNQA 3OB8A 2XTJE 8FABA 2YEZA 1NDGA 5EBLA 1TCRB 5H37G 1I7RB 3HPLA 3TJHC 4PJ7B 5CHNB 3U0TA 4L3CB 2I60L 1HZHH 5KG9A 4I0PA 1DLHA 3QWQB 1CU4H 3VMNA 1IGTB 3LVEA 2FIKA 1ZT1A 3QPXH 1G1CA 5E95B 3CFBB 1G9NL 4O2FA 5KVDL 4PP2A 3L95A 1TQBB 5CGYC 1YYML 3AREB 1F97A 4Z5RA 1A9BB 1YY9C 2ZPKL 3Q0HA 2AQ3A 4J3OC 5ACZB 4NKOB 3HMXH 1NC4A 3QFDB 3WFZA 5CBAA 3X14A 5A2IH 2PYEB 5D7LB 1LO2L 3SE8L 4LSUH 5I19L 1JRHI 4M6OH 2PF6A 3HG1D 3CDYA 5HYSB 3QHFH 3HNVH 5EZIL 3KYNB 3VH8B 2PXYA 3B9KA 4XMPH 4U6YA 3SDCD 5DFTA 2IH1A 4XPGL 5DWUL 4YHNB 1FCGA 2AKRB 2MCG1 5CS7A 1Q9KA 1T21A 2Q6WB 2Q8AL 1WZ1H 1OAZL 2CR6A 3VXSA 2E9BA 3L7FB 2DYPD 1MHHB 2VITA 2NY2C 3F7QA 2H6PA 4Z6AT 5CLWA 3I6KA 2V7NB 2EXWD 1T66D 3K46A 1LILA 4PJDA 1RULL 2OL3H 1C16B 3WKML 4TVPE 4WFED 5EO0B 3U4EA 5GS2D 3DI2B 1WC7A 4FP8L 4JPVL 4N8VA 1TZGL 3TH4T 1F4WH 4NC0B 5C0JB 1BX2B 1SEBB 4C55A 3Q6FB 1K85A 4LIQH 1H0DB 1YNLH 3FL7A 1JE6A 4JFDD 1YN6A 3NZHL 1KCVL 3GJEB 1I9JH 5EBMA 3RL1B 4D9QD 5LWYH 2FR4A 4K3DH 3H3PH 1YQVL 4G6KH 4AG4H 2BVYA 4EN3A 3DETD 4Y2OA 1QLRB 1NBYB 3FOMA 3IS0X 5J1AA 3RVVD 1P69B 3MRNB 1I8MA 4XHJC 1P2CA 5DK2A 4RIRA 1MCEA 4K2UL 3DVFA 5TPWL 1TETL 3PXHA 1PSKH 1TDQA 4QOKA 3RZCD 1FYHB 4U1JA 3RVVC 5HPOA 1X5HA 3JTSB 5TH2A 5IW6B 3QCTH 3VGEA 5FB8A 5BW7A 2YZ8A 3GRWL 1FH5L 4OFKA 3TF7C 3RZCC 1V7ML 1XZ0B 5E6IB 2DLHA 2V17L 3JV4B 4FOMA 5CKAA 4YR6B 4JANA 1MREH 4C54A 4G8GE 4TUJB 1UC6A 3SPVB 5D72H 1FFQA 1BBJB 2ORBL 1KG0B 1VESA 4XP6H 3S36X 5I8OH 3BKCL 3SDYH 4HIJB 1MCJA 2HT2C 3DXAD 4P9HC 4LF3B 5KVEL 4E9LA 1KCSL 1FL3A 5TQ0L 2E3VA 2NZ9D 4NCDA 4ZNCD 5FOJA 2ZJSL 4EQ2A 2DD8H 4CMHC 4HT1L 3MLZH 2NTFB 4JCMA 3GMOB 1HKLL 3VWKD 2NZ9C 4FG6D 3BRGC 2H26B 2ZSVA 3C6LB 3CVHA 3IFNH 4LSVH 5JPMB 2V9TA 3MRHA 1GAFH 2VMFA 2HJFB 1P7KA 4FHBD 2NY5L 4QRQB 1VFBB 5FKAA 1BAFL 5MI0B 3ZL4L 1S9XA 1EFXD 4P2OD 3UZEA 3QIWB 4G3YL 4N0UB 4P2YA 4XBPA 1N26A 4O51B 1K8DA 2MMXA 3KPOB 2VUYA 4JFHD 4NJAL 3E6FA 2CO7B 1NAMA 2R2HA 3LZFL 4LRNH 4U49A 4WTZG 1OARL 2GJ6E 3OXRB 1U92A 3HZMB 3GK8L 3H42H 4TSBH 3ZKXB 3L9RA 4ZD3L 1NLDH 3IU3A 2JCCF 3LN5B 4U7SA 3GSNH 1NGXB 4HEME 1ZLVK 3VFWB 4G8GB 1U93B 2EIZA 4OIBA 4JJ5B 3P9LB 1N0XH 3RTQC 1JF1A 4WV1A 5IEKA 2Y36L 2FBJL 2DQJH 2DMBA 1BZ9A 3NIDF 4H5SB 4Z9KB 3AS2A 4NQSA 1E4XH 3MLWH 3V5DB 4GSDH 2QHRH 3QAZC 4KC3B 3ZDZF 4LHJB 5D1ZA 1YUHA 1C1EL 3QULB 2G60H 3RQ3A 4LARH 2YD8A 1FVCB 1DVFD 2VKWA 1FFRA 4M7LL 4JO1H 5D2LE 4YHZH 1U8HB 3UTZA 5IHLB 1SJHA 2DLIA 5ESQB 4HX1A 1ZLSH 4KRLB 1QQDA 5CEZL 1P4LB 4NRZA 4LLAA 2EH8H 4KQ4H 1AC6A 5JZ7C 3VGDA 4G6AD 5KTEL 4I2XA 4XTRC 3RWGB 3CSPA 5T3ZL 2V2TB 4KI5C 3V6ZB 2YSSA 1RJYB 2AEIT 4OZGB 3BXNA 3REVA 4ZO9A 1G6RL 5M95B 4NNXB 3STBA 2R39A 4FFYH 5F3HA 4OKVB 2WK2A 2Z8SA 4LMQE 5TF1L 5EOCH 1A4KB 4PBXA 3FCTB 4H26B 4HKBA 1AD9B 2AXFB 3PGCB 4ZPVA 1OGAE 2GJ6B 1FRGL 5DJ6B 1TJIL 2ATPB 1TTGA 1F4HA 5I16A 3DBXA 4GXVL 4MA1B 2ICCA 4MWFB 5A16B 3MRLB 5T3XD 5IQ7L 4GQ9H 4U05A 3ZKMD 5HYQA 1D5ZA 4X7SL 4JQVC 2VISB 1UQSA 3U46A 3Q6GH 3SY0A 3IDYB 5HI3D 1WBYA 4PYGA 3VG0L 3UPRA 2F53E 4NUJB 3QQ9C 3FZUD 3LD8C 4ODVH 5C71A 2C5DC 2GSIA 2Z35A 4M5ZH 3SO3C 2PTVA 2B5IB 1M6OB 3PQYA 2NW2B 1KPRA 1WK0A 4RDQG 2WBJD 4WO4B 4HH8A 3IAPA 1NFDA 3LS5L 5D7IE 3VFPA 5D2LB 4OFIA 4KH2A 4X98A 4K7PX 2A9ML 4OSUL 5FO8B 2WSKA 2DQUL 3QFJA 4P4RA 4TQEL 4ZTOL 1T03H 1S7VA 3OPZL 3B4NA 5FM5M 1HHGB 4CVXB 3O6MH 5DRNB 2N56A 3TYGL 4ZXBB 4DGYH 2F5BL 1YMMD 4KWUA 1HCFX 3UJTL 1A1OA 3EHBC 4HZLB 3MRCB 3ZE1F 4ZUWA 3JBG7 4P99A 4MDJA 4NRYB 4J1UA 4N5EC 4ENED 4N9GA 5DLMH 2BVQA 5FGRA 1T0MA 4LBEA 3C9NA 1RZFL 3HC0B 5ELIA 1UWXK 5C0IA 3R4DA 4QY8A 1OGAB 4QWWC 4QF1A 2EXYD 3HMXA 4ENEC 4XRCA 2NW3A 1HSAB 4KV5F 5AD0A 1XR9A 1DBKH 2PN5A 1TQCC 3X3FH 5IEHA 3E0GA 4OLVH 4MD5A 5FCUL 4YHIA 4NCC2 3BPNB 3RZCA 4O4YH 1OB1A 1KENL 32C2B 4JFQB 5BRZD 3RX8A 1Y6KR 2FWOA 4I3RH 2AABL 4KRNA 2F53B 3RKDD 3VE0A 3RUGE 4R4FH 3HB3C 2ZG2A 3FO9B 2IQ9H 4D0CA 3B9DA 3SOBH 4BFIB 4OZFB 4Z77A 4M03A 4UDUA 1N5AB 1Q9LB 4LDEB 4WFHE 2X10A 3CXDH 3T0AA 3QPQC 1JPST 3CX5J 3OQ3B 2CGRL 4NOBA 3L7EB 5K59F 3FQUB 4FFVD 3ZTJG 3IU4H 3EAKA 1U58B 3LKSB 4V1DD 4M1DL 1UEMA 3BEWB 3K81A 4LPUA 1UJ3B 3DXAA 1FFPB 3UBXA 1FC2D 2NQCA 2FL5B 4X9GA 1S7QA 2NYYC 3HZYB 1AE6H 5DD5L 1A6ZB 1JYXA 3G6AA 3GMLA 4HV8A 4HK3N 4FABL 4EEEA 3KYAA 4YO0B 4J3SA 5K9KB 3UMTA 1A7OL 3UO1H 4OZHA 4BKLA 5D93B 4PRBA 5HHXH 3VXRB 3ESUF 5EOQH 4BFGA 4K23H 3MJ7A 3D0VB 1X5ZA 3WFEH 1S9YB 3QO1B 4F15B 1QRNA 1HEZA 2PW1A 4AM0B 2XACC 4ZOBA 4FQIL 3UYRH 4N0CC 4OAWB 3FQXA 2HFGL 2F74A 1F58H 4K94L 4S1SH 4PJBF 5DMKB 5ITFB 4F7EB 5HVGB 1BF8A 3U7WL 1I8IA 4Z7UB 3NBNA 3PWPE 1IKFL 5E2TL 4HUVA 1NKRA 4PRIA 1UM5L 4KQ3L 2E5EA 2CDFB 4JY6A 3H9SA 1LE9B 5DD0L 4OIIH 4AT6B 4P3CL 1Q9OB 1YEDA 2IMNA 5HHME 2GUOA 1A7PH 3RUGB 4W4NA 2EDKA 3U6RB 4IJ3C 1RMFH 2DM3A 3CDGB 1MJ7L 5F9OL 2WLZA 3RTQA 2I25N 4PLJD 3CCHA 3SE3C 3PWNB 3BE1L 1WCQA 1XGQA 2AJ3A 4OI7A 4QHKJ 1J1OL 4NSKB 3MV7B 4P2QD 2HLFD 5FO9A 3EYUL 4Q0XL 1YY8B 4PJDE 2JTDA 2XQYG 3U2SB 5IMOB 3E8UH 5KSUB 4XPBL 3ZKSD 1EEQA 5D5ME 3GI8H 5KOMC 2Q3AA 1JFQL 1MCPH 4U1SB 4DEPB 3KG5A 1RU9L 5KG9B 3BQUD 2JIXD 4M48L 4OGAC 5IWLC 1YQ2A 2OMBA 2HYMA 2DM2A 3TBTA 3WS3B 4OB5L 2EO1A 1CGTA 1QFWI 5DMGD 1ROWA 5M94B 3N9GH 1IGML 3TPKA 3INUH 4Y16B 2WUCH 5HXMA 3F12B 3IS1X 2X4RB 1QSEB 2IMMA 4WIQA 4I18C 4QHNB 4CW1A 2DWEB 1EXUA 4OQTL 4WW1A 4JKPL 2X05A 2EEBA 4HGWA 3DWTA 4YZFE 1KJ2L 4QRUA 3PWPB 3MBEB 2EC8A 5C9KA 1WCBA 4C56D 3F5WB 4TULL 1W0VA 4QCIA 3I2CH 3KJ6H 1GYAA 4KRPD 4TTDC 5HHMB 4PGDA 1OSPL 3V0WL 1JWMB 2EYTA 2E7LC 4XPHL 4JQVA 1MIEH 5ILTL 2FATL 5K9JH 1EERB 1I7ZB 2WIIB 1QSZA 4ZUSB 2ZSWB 4GO6B 4YDIH 3LIZL 3GSNA 2D7MA 3SKOB 3IGAB 3MJ9A 1BF2A 1ZLUH 3QB7C 2D7OA 4UDTA 2O61A 4LCCC 1W72B 3MNWB 3QG6B 1N2RB 5GGRB 3PL6D 2BMKB 2D9CA 2BFVL 2ED9A 3O2VH 5C2BL 1S9WB 5EG6C 1AQKL 3VI3F 4ZFOB 1D6EB 4NC2B 3ROOB 3LQAL 1MVUA 1AI1H 4IOFC 4M00A 2BY1A 4GW1B 4MXQD 2R29H 5GGVY 3CVIH 1GL4B 5D5MB 1L7IH 5DHXB 3VXNB 4BQ9A 3QUYC 2P8PA 5D7JB 4NKIH 2G9HA 1CN4A 1EMTL 4MS8C 1IQWL 5EUOE 4I3SL 4TRPH 4DJMA 2NY6B 2MWCA 5EOTB 1OOAA 2UVFA 2WBWB 1MEXH 3PV6A 1W0WB 1N3NB 4P2RE 1UB5A 3DI3B 2G5BB 5D1XB 5BZWB 4MNHB 1EEZA 1MJUL 3MUGB 1VACA 1L0QA 3G6JF 2P4AB 3M1BB 1IT9L 2A73B 4JQIH 3LKNA 2DWDB 1UXWB 3LRGA 5GJTH 4MZ3A 1YEIH 1D7FA 3CFKB 3D39D 1RZGA 1ACYH 4X6BB 3B5TA 1DL7L 4G5ZH 3DURA 1CTNA 1N6UA 3O2DL 2BSSA 3SDXE 3WL9A 2HN7A 1CGUA 2XNAB 2D9QB 3C2SA 3HI5H 3FN0H 4MA7L 4XBGA 1TXKA 3VRJB 3PDOA 5DD3L 1FNFA 4WHDA 4ISVA 5CUSH 2ICWA 2N4IA 5T1KD 5HGHB 1IEAA 4HBCH 4K8RH 4LCIL 1JNLL 4JREB 1H3GA 5B38G 1X5KA 3IJHA 2O5ZH 4OUOA 5F6IB 3IJSA 5DJZA 5BRZA 1FC1A 3BHBB 4DKFL 5DJDB 1IAOA 4NQXB 1EVTC 1AH1A 2Z4QA 2VZOA 4GRWE 4JM2D 1WAAF 5DYOA 5J6HA 3GMNB 3DECA 4P3DA 3QG7L 3TNMB 4H0GA 1FVEA 2I60H 2P5WD 4GAJL 3VWJD 1CFTA 1PD6A 4LPWA 3KPQB 4ODSL 4ZSOA 2C3XA 2QJDA 1DQML 4YAQB 3WDIA 3D3VE 2BHZA 4TUKL 2LU7A 3GNML 2Z31C 5KVDH 5EUOB 3QCVL 2X9YA 1GCFA 3RIAF 1YYMH 3MYJB 1U8NB 3WUWB 4HHAB 2W59A 2HG5A 3W2DL 3NA4A 3OAYK 5L9DL 1QVOB 2CXGA 2ZPKH 5DFWH 2ZNWA 4P2RB 1UH2A 1XGUB 3S8WA 2ADIA 4MAUL 1LO2H 3SE8H 4F9LC 2XPGB 4ZQKA 3EFFB 4Q2ZA 5DQJA 4O2EB 5I19H 1OAKL 3CFDA 3TIEA 5KSBF 3BJ91 1A6AB 4PJAB 3LEXA 5EZIH 1IM9B 2V5RA 3WNMA 4BELD 2MQ3A 2BSRA 4JFYA 1XR8A 3TFKC 3SDXB 1AGCA 4XPGH 5DWUH 3WHE0 3DJ9A 2VL4A 3T0EB 1LE5A 1JWUA 4U3XA 3IXAB 3QDGE 4XVJL 4E5XA 5GS0D 2H41A 1K4CA 2Q8AH 4GKOA 2CDEA 1OAZH 4UI2A 4JFED 1J1XL 4K8RD 2FSEA 4JRWA 3G04B 5F1NA 1VEOA 2C1OA 2WMPA 1ERNA 1YPZE 1T3FB 2AI0L 4KKCD 5HSFA 4GW5A 4G8FB 1XEDA 2NX5A 4WI4A 1RULH 1URLA 1FL5A 3QUMB 4K8RC 3SE3A 2D0HA 4FN0A 1RZJL 2EDHA 4GRWB 3WKMH 3LDBC 4JG1L 4NRXA 4NQCD 4FP8H 4JPVH 1TZGH 1ZHBB 4KUCD 4DVBA 4JZJC 1A7NL 4PG2C 4PJXF 2HT3D 3QNYA 4W6XB 1KLUA 2BX5A 3D3VB 4JFXB 3NZHH 1KCVH 2X6MA 3EYFA 3L5XL 4HS8L 1YQVH 5E70A 3TO4D 1HILB 2AVGA 2HT3C 5B3NA 3IRZA 3IDJB 5ICYB 5JHDA 3VFUA 3HZKA 5EU4A 2R4SL 4OLXL 1G9NC 4DTGL 3DYPA 2A77L 1HHIA 1SMOA 4X5LA 3S5LA 2M8XA 4K2UH 5I75C 4HIEB 5TPWH 1TETH 3HKFA 1A7QL 3LV3A 4GKSB 5HDOA 3ZDYF 1FV1A 1AHWB 5FM4A 3HCVA 2AEWA 4JHBA 1S7WA 4LDLB 4QHLB 3O6LL 4ONGL 5FOBA 3RIFK 5IB1B 1U42A 4MQXC 4OFYA 3GRWH 1FH5H 1V7MH 3QH3A 4I18A 2IFGA 3WHXB 2V17H 1RVFL 5I1LB 5CSZB 5DO2D 4GH7B 3QDGB 1DANT 4K7FA 4RRPG 4X6DE 1BBDL 1MFAL 1NBQA 4NO5B 4N1CA 4U0RC 1FGNL 4U0QB 2ORBH 3VXPA 2D03L 3SO5A 3GSWB 3BKCH 4RA0C 1JTOA 3VFVA 3I9GL 2E7LA 4C56A 2C4FT 1YPZB 2EKJA 5IIEA 5KVEH 2V6HA 1KCSH 5TQ0H 2YD5A 4M8QB 2HFEA 3IDGB 5J12B 2ZJSH 4LCCA 2V7HA 3SDAB 4G6FD 5KSVB 4QKXB 1P1ZB 3K2MC 1DDHA 1RK1B 2J5LC 1HKLH 2I07A 2R2EA 2X1PA 1EBPA 4LLDB 1JI1A 1NFIB 1U95B 1AXIB 2DRUA 2BNQE 3U9PL 3S96A 4L9LB 4PJHE 3W82A 1S3KL 5F9JA 1V3KA 5J11C 3QUYA 3TBSB 3A6OA 1KCKA 1NDMA 4WRLA 2NY5H 4LHQB 1BMGA 1BAFH 4LSQL 3ZL4H 3OTTA 5DUPL 3SDDC 1S7TA 5HYJA 1Z9SA 3OHXA 1JZ6A 2HKFL 4G3YH 3O3AA 4LASL 4C58B 2VERN 4LIQE 3EYSL 1GGUA 2MNUA 5FF6B 4U6HB 1NGPL 4NJAH 2P8MB 4M5YL 3LZFH 1MLCA 3EYOA 3KDMB 4RFEA 2CDGA 1QRNE 1OARH 3GI9L 3MRBA 2XICA 1CD9B 1HE7A 4RZCB 3P0VL 5C07B 2ITDA 5KANI 4UU9A 3GK8H 1JPGB 2Y9RT 4BH7B 4ZD3H 4EUPB 4OV5A 3KPMA 2GFBB 4X6DB 1AGEA 1NCUA 3S4SG 2VSCA 4L8CB 5DVNA 3L3IA 2Y36H 4HIHA 2JCCA 2FBJH 4L8SC 1DQQA 3PDGA 3QUXC 4PRIE 4J3VA 5JO5A 1A1NA 3H9SE 3FAWA 1S5HB 4JRXE 4HUXA 1VPOL 2SEBB 5FA4A 4BUHA 3QQ3A 2ZOLB 4KPHL 3SJVE 3QO0B 1A7RL 1C1EH 5B21A 3EJYD 3MRIB 4UT9L 3DGGA 4TSCL 4M7LH 4HJGB 4PY8I 2Z0BA 1CFSA 1MPAL 5FGCB 4LKCA 5HYFA 4N8CL 3FFDB 5CEZH 5J6GB 2L0DA 4PJ8B 4E0RB 1T89C 1PBYA 5HHPB 4TNWF 5KTEH 1JUFA 2I27N 4FXGB 4OM0L 2BNQB 5T3ZH 4PJHB 1Q94B 5EU6D 4BSJA 4P5TB 4FXKA 2BNRD 1ONQA 3OBAA 3N1MC 2B20A 5T5NF 5C08A 1VEMA 3IKKA 4OD1L 3BMWA 2FJHA 3ULVL 5SX5K 2Z31A 2P5WA 1G6RH 3G5ZA 3VWJA 1D5MB 4NN6C 2NY5C 3FB7B 2LU3A 4DVRL 3KXFD 4KI5E 3W9EA 5TF1H 4PRHE 2APVA 2D31B 2YD2A 2RB8A 3RDTD 4F9LA 4UBDC 4JRYD 4BFBD 5BZDA 1FRGH 1Q9WA 1TJIH 3DTXB 3RWCB 1U3HB 4DN3L 4LLUB 2L7JA 5ISZD 4GXVH 5LG1A 4PLKD 4Y4FB 2VLKA 2VE6A 5IQ7H 1BOGA 3VI4E 4X7SH 4XVUD 2ESVE 1MJJB 5EN2A 1P5UA 3MODL 2ADJA 5C8JB 1RQ5A 1E27B 4PLKC 4QRPA 3VG0H 2A9NL 4JFFA 4WEUD 2EKSB 3CC5B 3OR6B 3QI9B 3H9SB 4JRXB 5BJTA 3WFCL 1GC1L 5HI4D 2AK4B 4DOHB 4YK4C 3SJVB 1VENA 4NYLB 2HFTA 2EYRA 2CLRB 4Y4HB 4P5MA 3LS5H 5C0AB 4JFEA 4L3EE 4PREA 4OSUH 2A9MH 3RWIB 4EXPX 5DEGB 5CEZD 1CXIA 1KTLA 2CUMA 2DQUH 3MV9B 2W0FB 4MDIB 2Z92A 4TQEH 4OD3L 4ZTOH 5I1DA 5T3ZD 2YC1B 1RUQL 1Z6JT 1GOHA 1JGEA 5GQBA 3RI5K 2JJVA 3OPZH 4JZJA 1E4KC 4KKLC 2YRZA 1I3RB 5GRJH 5IROA 4Y88A 4G42B 3TYGH 1MOEA 5DRZA 2VLRB 5GGVL 1B4RA 4RAHA 4QNPF 4WHTB 1T2JA 2F5BH 1KIRA 4GG6E 2KH2B 3UJTH 2IFFL 1ZT4A 4PRDA 5D6CA 4DZBA 3QWOB 3VFRA 3L5WA 5E2VL 4X4ZA 3B9EA 5JOPE 4PRHB 3MNZB 4OFDA 3RNKB 4L4VE 2VIRB 1AKJA 1JIBA 4YHYC 1RZFH 1A22B 3RPIA 4LNRB 3A6BL 4ELKB 3CFEA 4NBYB 3QUZC 3VG9C 4UIKL 2M26A 2OJZL 2EECA 3W5MA 3JWNC 3L6FA 4WFGE 5E2JA 5FCUH 4ZO6A 2XA3A 1KUMA 5C0FB 4Q58C 2ESVB 4YEFA 1KENH 4I0CC 3U0PB 4ZFFA 3S37X 4JFOB 4KXZH 1QZ1A 1U91A 2YBRA 3IFOA 1TVHB 4JY5H 4PJEF 1NEZG 2AABH 4H1LG 5DVLA 4EI5D 3TIDA 3DYOA 3BSZL 5ADPL 5INCA 2DAVA 3VXUD 1IL1A 1OP5K 3TN0C 3QQNA 1NCWL 3HC3L 4UAOC 1J8KA 2NY3D 3VD5A 3REWA 2EDFA 2CGRH 1UENA 2VAAA 4L3EB 5C09E 3FB8A 1IVLA 3S88L 4M1DH 3EJZC 3ULUL 3EDEA 5E9DE 2X4PA 2FIRT 4LQ1A 1TVBB 5DD5H 5AUMA 2CSPA 1S7SA 3WUZA 4FABH 2P5EE 1G7IB 3HUJE 4X6EA 5EOCJ 3KYMB 1A7OH 1KF9B 4ZSOE 5FDWA 4GG6B 5D7SL 2GJJA 2ARJA 1OAYL 3BKML 2WWMC 4WW2F 1WSST 5IFHL 3SDDA 4L4VB 2ICWJ 2MKWA 3WV0A 4WUUE 4FQIH 5HD8D 1AFVL 2HFGH 3MRGA 3DV6A 3P0YL 4K94H 4ZUVB 4KJQC 1S7RB 2VDKL 3ECBB 3U7WH 5TE4L 3LRHA 4LNVA 1JGDA 5FM5O 1IKFH 5E2TH 4YDKL 2A6JA 4PJBA 1UM5H 4KQ3H 2AP2A 3ARFB 5DRWA 5DD0H 3GRWA 3RWJA 4P3CH 4JY4B 1M7DA 2EZ0D 3T2NL 3MLSL 1MUJB 4DFHA 1MJ7H 3MTRA 2NY1C 3G9AB 4NO2A 5F9OH 1UB6A 3F7YB 4MXWL 3BUYB 4WWKC 3QUXA 3BE1H 1JZ2A 5SV4A 1J1OH 2BRRH 1TTUA 1ZHKA 2HMID 1NCDL 4DUWA 5GSRB 1J0JA 1I9IL 5C09B 5EULV 4HFWB 3MROB 3EYUH 2H8PA 3VMPA 2AAVA 1JTTA 4ZYKA 5IT2L 4Q0XH 1CE6B 1TJHL 3V4VH 2EIBA 2FLBT 5E9DB 1AR1C 1P4IL 2YA2A 2HMIC 3VFTA 4XPBH 5J6HB 2P44B 4GXUN 3NFNB 1T89A 2P5EB 1JFQH 3KPLA 3HUJB 5DUBB 1RU9H 3DX8A 2CIIB 4M48H 5HHNA 4L9DA 4OB5H 3M17B 2D2OA 3EDJA 2GTZB 1LDSA 1F3JB 1MFDL 5JHDE 1IGMH 4CADB 2AXJA 2HG5B 3O4OC 4WUUB 4LK4A 2N1KA 4UIMB 2E7CA 2VDQL 1XIWD 3QJHB 3EOAB 4OLWL 4X4XA 2DIAA 3OKLB 5ETUA 4U31A 5BS0A 3OKDA 4OQTH 3VXMD 3LHPL 4JKPH 1PKQA 3VMOA 4WU7A 1KJ2H 4CL7A 3AY4C 3EO9L 4K94C 3KXFA 1EA9C 4RFNB 3IDMB 4TULH 1FO0B 2I9TA 5CD3A 5F7FA 5GGRY 2EE9A 5IB3B 3BUTA 3FT4B 5KN5A 5DHVH 1OSPH 3V0WH 4XPHH 2W60A 1QNZL 2FATH 5ILTH 5D9SA 3IDIA 4MJIB 2R56L 3LIZH 3H7BB 3P4NB 1MCIA 1YNKL 2F5AL 1T6VN 3OJMB 5JW4Q 5IG7B 3ARXA 3BAEL 3QDJD 3Q2CA 4QXTB 4EI6A 5GRYA 1GZQA 1FHGA 2X41A 1C8PA 4DN4L 4HS3B 2BFVH 5D2NC 4IJ3B 5C2BH 3L3HB 1U8PA 1AQKH 3MLYL 2ZG1A 3LQAH 3TVMC 4NO3B 3V6FB 2UYLB 4MZ2A 3BP6A 3C5SA 1CD1A 3O3BA 3O9WB 5INDA 5EUKB 2V2WB 35C8L 4KY1L 5I1AB 3FB6B 1QO3A 1EMTH 2YPLD 2RIKA 3K74B 5DJCA 5F88B 1E4KA 4GKNA 5CJOL 1MCHA 1IQWH 1SJEA 5CJXC 2HJLB 3ZKND 2ICEB 4I3SH 3KPRA 5F7DA 4BSVA 1F3DH 1K2DB 2V2XA 4F2MA 5KZCD 1CICB 3MREA 2YUZA 3RGHA 5DD1L 5FYKE 4L4TA 3BZEB 1RAMA 1TITA 2WBKA 4U1MB 2XA8L 1MJUH 5DI8B 1BD2A 4OTXL 1IT9H 3FQRA 1I1YA 5LGJA 1R3JA 1XGRB 2C9AA 1BM3L 1F42A 5AG9A 3IDNB 3AFLA 5BOZG 2E9IA 3G6JA 1DL7H 1WTGT 5ABDE 1MCCA 2LFGA 3O2DH 4KDVA 4L5FL 4NNYA 3JWOL 1OGTA 4LCWE 4Z7VF 3L3DB 2IADA 4MA7H 3CZJA 3P77A 5C1MB 4YIQA 4IRJC 4UNUA 1MCDA 1FFNA 5DD3H 1RIUL 2VXVL 1MAJA 1HHJA 2IPTL 1DE4B 1OCWL 5HYSG 3O4LE 3T8XA 3VH8G 4PJGF 4P46C 4LCIH 1JNLH 1UZ8A 5A40E 2X70B 5IFJB 4ZNEA 4DKFH 4PJ5E 1IQDA 3TN0A 2JCCE 3RPKA 5E56A 5IB5B 3V8OA 4DKAA 3FFCD 2GT9B 3ELAT 1XAUA 3O3UN 2FYYA 5EZJA 3QG7H 4MLSA 3JV6B 3KHQA 4I48A 4XBEL 5FYJE 4S1DD 3NIDE 4GAJH 1F45A 1KFAL 4ODSH 1I3UA 4R97C 5FKPA 3LQAC 2LV4A 3QYCA 4HGKC 3TCLA 3TO2A 4ELMB 1DQMH 4UV7L 4PJFA 3GMPA 3ZDZE 4TUKH 4Q9QL 3ZMRA 3V6OE 1LNUB 1U8OA 3ARDD 1CK0L 3VXOA 2FLRT 3GNMH 3QCVH 1CD8A 5DRXA 4KK6D 5T1LD 3W2DH 3CFIC 4L8BB 1FNAA 2PO6D 4HULB 3SCMD 25C8L 1TFHA 2DQFA 1QUNA 2B4CL 4KUCF 4YBLB 4MAUH 5I71C 4QYOB 3QIUC 5KSAD 4KZDL 1OLLA 4Z7WA 1OAKH 1KTDB 1HK6A 2PO6C 4A2LA 1AXSA 4LLQB 4OCRL 5JW5B 4KKBD 1MLBA 4F3FB 1ORSA 4F7PA 4MCYA 2FH6A 2GI7A 4K07A 1HCVA 4PRPE 5C2UB 5KSBA 4LCWB 1ZLWK 4NKQB 1ZT7A 3U30C 1RK0B 3CLFL 4XVJH 5IW1A 1P9MC 3IVKA 4LVHB 1YEJH 5F1IA 3O4LB 5ID0B 2VLKE 2OSLA 1J1XH 4Y19E 5HGBA 1LD9B 2WLYA 1H15A 3R8BB 1TZHA 3C6SB 1WFTA 4D9RE 1UWEL 4PJ5B 2AI0H 3SGKC 4QRPE 1QR1A 4JFFE 4WWKA 4M6ML 5MEND 1RZJH 1Z0MA 5DTFA 2X9XA 4JG1H 3OKMB 3W39B 3TZVC 3IF1B 1F00I 3GIVA 5DQDL 4F7CB 4H20L 4ZAKB 1OAUL 1A7NH 2VDPL 2ENSA 3ULUF 3O6FC 1ZA6A 4RCAA 3L5XH 1H5BA 4XAKE 4KDWA 4HS8H 3O6KL 4PJXA 3MOAL 1AO7B 5E8EA 2J8UA 2A6DB 5K33A 5SX4H 1S9VB 4A6YB 2R4SH 2EDJA 1ZKAA 4OLXH 4M93C 4Y4KD 1H8NA 4DTGH 2A77H 4AL8L 1HHKA 2UV3A 1B0GA 1XGPA 12E8L 1A7QH 1N64L 4U6XB 3UAJD 3IJYA 2ZUVA 5BQ7B 1CFBA 2VLJE 3O6LH 4ONGH 1NGWA 4ZDHB 1KJ3L 3MJ8A 4MYWB 1KIPA 1RVFH 3ARBB 2I9LA 4PRPB 4HAFA 4PTTA 3ZE1E 3H3BC 2IPKB 4Y2DC 3TBYB 3MR9A 1P7QA 4X5XB 5B38A 3AY4A 5EH1A 5GS3A 3MACL 1BBDH 1MFAH 5I74C 1FGNH 5HYIA 1NCTA 5I17A 3C5JB 3LB6D 3VXMA 4Y19B 2D03H 4Y7MA 3D69A 4KV5E 3I9GH 1D5XB 2X4SA 2Z8WC 1T0NB 4QLRA 4YUEL 5D96B 4CDGC 2G75A 3LB6C 4D8PA 1ZGLP 4F33A 1TIUA 1I7TA 4BQ6A 3UC0L 3QEQD 2HA1A 5EWIL 1B90A 1H3XA 4NPYA 4DFIA 2KQNA 5J9PB 4ZFZA 5CSBA 3FO1B 4P0DA 1QSFD 4PGZA 5D2NA 4E42B 5BXFA 5JW4N 4ZFGL 1R3HB 2OXHA 3QXDA 1RJLA 4KROD 4S2SA 3TVMA 3BN9C 1Y6MR 3NTCL 4W70A 5E8OA 1GZPA 4K3GA 3IFPA 1HH9B 2MHAB 5DHYA 3U9PH 1ZSDB 2JB5L 5FIEA 1S3KH 5K59E 4JN2B 5D1QD 1ZS8A 1K5NA 3MRKB 3PABA 4KROC 4F57L 4W6YB 4UMGA 1KIQB 4LSQH 1OP3K 5DUPH 1A6TA 5E4EB 3W9DA 4Z78A 2HKFH 1NKOA 3BWAB 5AYQA 3L3JB 1CD0A 4H1LH 3WO3B 4EJ1C 4WW2C 4LASH 3X13B 3GIZL 3EYSH 1U8MA 2VLJB 1NGPH 3ARGB 3IDXL 4M5YH 1SBBA 4UUJA 1T5XA 4P4KC 3PWLB 3HR5A 3GI9H 5T5FL 2IC2A 4C57C 3ZHLA 4PR5B 3RNQA 5DJYA 3P0VH 5I75B 5E8PB 5J89A 1S78C 4FQXB 1FZJA 1ORQA 1QG3A 4NBXB 4G7VL 4JE4B 3C60D 1EAPB 4OQTA 5L2KD 3O3DB 1KJ2A 4CRPA 3B5HA 4ODUB 1RZIB 4IOIB 4IRJA 4XP4L 1PQZA 4PJBE 5ERWA 3LEYL 3WLBB 3C60C 3PP3K 1VPOH 5SWSA 4WFFD 1DN2A 3KNBA 5DHVA 2YN3A 4KPHH 1DQJA 1A7RH 4UT9H 1CDYA 3FTGA 4Z76B 4KUZL 2WQ8A 4TSCH 3LKRA 1MPAH 5DVOA 3BKJL 4UT7L 4N8CH 3C08L 1R3LA 4OJFL 4HDIA 1DBML 1JWSB 3OR7A 3UTSA 2CKBB 3OX8A 3S34L 4K3HA 5CEXA 1YEGL 5D4QA 1F11B 4PJIB 1X4YA 1NC2D 5MEOB 4OM0H 5IVZA 1KBGL 3K4DA 4B7IA 2WWKO 1CFNB 5JA8B 3FFCA 3BDXA 1AJ7L 4EXKA 4QRSA 2W38A 4MAYC 4OD1H 4Z0XA 4GXUM 3R8QA 3KJ4C 5GJSL 3ULVH 4KJYA 1ULVA 3G5YB 1ZHNB 4HCRL 4QHMA 4PGBA 3PHOA 4DVRH 1IMHC 4UTBL 4PS4L 5LGKA 5TGBA 4O2CB 3BDBA 5H8DA 1T04B 1KPUB 1T4KA 3QIUA 4NO0B 1WZMA 1F02I 4U1GC 4DN3H 2PO6A 3OJ2C 3C8DA 2XI9A 1QYGL 4R7DB 4L29A 3VCLB 3D18B 5KSAA 1XF1A 3MODH 5IM7B 3ZSTA 1LK3L 3RWFB 3PJSA 2A9NH 3X11B 1P9MA 2GAZA 3O2DA 1W72L 4GBXD 1KC5L 3WFCH 3P73A 1GC1H 4CNIB 3DMMB 4HUKB 4ZFOL 5I8KL 1AGDA 4P23C 5I6XB 4I3GA 4GBXC 1LO4L 4E41D 2PTTB 2ZUSA 3SGKA 4DQOL 4L8SB 5F7KC 3GGWA 4OZFG 2BC4A 5C0BE 4PJ9D 4OD3H 3TZVA 4WDIA 1RUQH 1TPXC 1VFAB 3RWDA 2R1WA 4G8EB 3ES6B 2CIKA 3O6FA 4PTUA 5FO7A 4OZGF 4XNZC 3PHQB 3TLRA 2QSQA 5GGVH 3MLRL 4ZS7L 1AP2A 1YMHA 2X4TA 3ULVD 1OL0A 2FZ3A 1NCNA 5IK3A 3VI3E 2GSGB 2IFFH 4LPVA 4BA8A 1RUAL 3F58L 5F7YC 4PBWD 1NBZA 1EEUA 5EU7C 4X6CA 3ULVC 3BVNA 5E2VH 3I02B 1E4JA 3EW3B 3R0NA 3EGSB 1IGYB 2YRLA 5EU5B 3RVXD 1CLZL 3A6BH 4L4TE 3S4SA 4UIKH 2OJZH 1SYVA 3PDDA 3NN8B 4ETQB 1C5DB 2Z93B 1BD2E 1YNTB 2K7PA 5J7CC 3WDHA 5B3JF 4I77L 4Y2DA 3NA9L 3NFPB 3K2UH 3KPSA 1RUML 4I9WE 3RGVD 4Y5VB 1K4DB 3V4UL 1FIEA 3Q48A 4U1IA 1UEYA 1FE8L 3L1OH 5IVXB 1ZANL 3BSZH 3F7VA 5ADPH 1Z0NA 5CIPB 1G7QB 1NCWH 3HC3H 2AQ2A 3MV8D 1R5VB 2DI8A 3HE7B 1FZOB 5D2LF 5I18L 1GC1C 2J1KA 1YC8A 1X7QA 2F15A 3S88H 1CLOL 4P59L 5C0BB 4N0FB 3ULUH 3ILQD 3RA7L 4PRAB 4RGNB 2GK0A 1BLNB 1W0YT 2VSDA 1IGJB 3HI1B 3K4AA 5I30L 4EVNB 3HG1E 5MEPB 4XPFL 4FTVD 3G08B 3UTTA 3WNKA 3S6CA 1WBZA 1JBJA 1NANI 3QEQA 2D7TL 1WAAE 3UX9B 4LPTA 3QDMB 3MLUL 2D0GA 1QSFA 3MQIA 4DCQB 4MQ7A 5D7SH 2C7UA 1OAYH 3BKMH 2VB5A 2FX7L 5IFHH 1EK3A 4BZ1L 1HOCA 2BJML 1NGQL 3DYMA 3FOLB 5DJAA 4MA3A 4APQD 1AFVH 4XWOD 4NKDA 5IB4A 1NAML 4WW2A 4HUWA 3P0YH 3ZYZA 4O58L 2YPKB 1SJVA 2R2CA 3P4MB 1KTKE 2VDKH 3ZT6A 5TE4H 2EE3A 4P4KA 4APQC 2UVEA 1HSBB 2ZP0T 1MH5A 4YDKH 4JB9L 4XNMA 1DEEB 5I2IB 4HFUL 3SGEI 3QUZB 3T2NH 4JFDE 1T1WA 3MLSH 5KSBE 3QUML 4D9QE 2ID5A 4MXWH 5EO1B 4BZ2L 1UKSA 4G9FA 1R6VA 5SWQA 4ORZC 3W0WD 1JZ3A 3C60A 2NXZC 1NCDH 5L7XL 1I9IH 2OS7A 1LEKB 4YX2L 4X9BA 5C0NC 4MCZB 5IT2H 4IMLB 4OFVA 1TJHH 1JL8A 1QFPA 1A64A 3UTQB 1DN0B 3VFSA 1P4IH 1EO8L 4NDMB 1EUTA 3HG1B 5JPNA 1BVLB 4UOJA 2ZUYA 4NOFA 2WIMA 5EC1A 3ULUC 2A83B 3D25B 2KKQA 3BEVA 3DROA 1TQBC 5GRZA 1JHTB 3NPZB 3SDCB 4NQED 3AREC 3TJEL 4YDJA 4OF3A 3BX7C 1QACA 2L7UA 4FQJL 3KPNA 2JJSC 4U1HB 5I1IL 3MRMA 5DDHA 3DV4A 3ORJA 1RUPL 5EFIA 2CLZB 1RJZB 3TPUB 1KYOJ 3LKQA 1NC2A 4PJXE 5E8NA 2YD1A 1XGTB 1MFDH 3B9VA 2DYPB 4R6UA 3PWUA 1PKOA 5ESAA 4ETYA 5LGHL 2ZUWA 2VDQH 4FFWC 3C09B 4FZEH 4OLWH 2DQTL 4JAMA 3FB5A 4AIZA 1LO5A 4Z7UF 2J88L 4MD4B 1DUYB 3QCUL 3LHPH 3VRIB 3DVIA 4ZTPL 2IG2L 1NEZA 4H1LA 5HY9A 1UG9A 2IALA 4YNYB 5BO1L 3EO9H 2X1WL 5C0CA 5IHZA 4RBPK 1AGBB 4PUBL 1EZVX 2W0LA 5TDPB 1TZIB 2HRLA 2QV2A 3ZDYE 5C0GB 3T0WA 1HYSD 2APTA 3SQOL 2XWBB 3QHTC 4JFDB 5GZNC 2AEQL 1TNMA 1QNZH 2KUTA 3DO7A 1GRWA 1FORL 2VZVA 5L2JA 3I3DA 2XTJD 3STZA 2R56H 1S7UB 1DP0A 1YNKH 2F5AH 3F8UB 1G7MA 1HQRB 1I1FA 1DQLL 2AV7B 8CGTA 3BAEH 4ODTL 5GGSB 2IAMD 4XCYA 4DN4H 3KPPB 3CZFB 1MHCB 1RZKL 4P23A 3MLYH 2E9WA 4Z95L 3G5VB 4GBXA 5JXED 2A6KB 4XXDA 5JR1L 5FUCE 4C83B 5JQHC 4RGMB 4IIQB 3T77B 2ZOKB 4JFHE 1MAKA 2FECL 4MVBC 1MY5A 4HKZB 4HWZB 35C8H 4KY1H 2GITA 4BSWA 3PNWB 3DRQB 5F8RC 1KACB 3VW3L 5JW4M 5D2NE 2ZCLL 1FYTA 3T3PF 5CJOH 1NGYB 5EZLA 2LTQB 1KEGL 1ZGLB 3MO1A 4PJXB 2ICES 4UINL 5DD1H 3MUZ1 5GZOD 2CRZA 4PJCA 1D5BA 2BCKB 2XA8H 5DQ9A 1I1AD 4LVEA 5A2FA 4OTXH 3UDWC 4U1NA 2CUIA 2OL3B 3K80A 3BIKB 3D48R 4Y5XC 5E6IC 1HDMB 1BM3H 2JLLA 5GZOC 3LMJL 3RL2B 2Y7QB 5EPMA 4D0BA 5B39B 4JZOB 4L5FH 4LQFL 4X8XA 4M7LT 3HS0B 3JWOH 3QP3A 1C5CL 1WT5C 2R1XA 3GSQB 1RIUH 1HHHB 2VXVH 3VWKB 2IPTH 5IHBA 1CR9L 3GSRB 1OCWH 1U8KB 3IYLW 3LKPA 4M3KB 4TVPD 2RR3A 3GO1L 3L3KB 2P42B 5GS1A 4XNQB 1M71A 2C3VA 5KAQG 4P9HL 1EFXB 4P2OB 5ENWA 4HS6B 4QRRA 2RHEA 4YJZL 1ZV5A 5I1HL 5C0DB 2NY0C 4ZUTA 4NIKB 3NCMA 2HRPL 4XBEH 4L8DB 3FHAA 3V5HB 3C6LC 1KFAH 2DM7A 1T1YB 3DVNA 4UV7H 1UWXH 4Q9QH 5EA0L 1O0VA 1CK0H 3DX9B 1FGVL 5MI0C 1CGVA 4XI5C 4X4YB 3QIWC 1G0XA 2P1YA 3JWDL 4QGYA 5MERA 2WW8A 4X7TB 25C8H 3GMRB 2DQHL 3E3QC 3F6IA 2B4CH 3EYVA 5CWSA 2GJZB 1VFOA 2O93L 2VKXA 4NWUL 3CSGA 4OD2B 1REIA 3DHMA 4JZNA 5CSGA 4KZDH 1I7UA 4OCRH 1T5WA 3DVGA 2PETA 2DI9A 1AR2A 4YHPA 1DVFB 2X4QB 3ZKXC 3MGOB 1EDQA 2J12B 2MJWA 2R0KL 3OB0H 3CLFH 2ZUTA 5GIRB 4APQA 3TBVB 2B0SL 4R2GC 5LJYH 1LO0L 1BVKA 1Z2KA 5DJ8A 3AB0B 3JWOC 2QR0B 4JFPA 3Q3GB 1BFOB 4LLVA 4HIIB 3LRSB 2XN9D 3HE6C 1UWEH 4M4PA 5IJVA 4YDVB 3H9HB 1QPXA 1KOAA 4M6MH 4Z7OF 2IEPA 5IVOA 3GB7B 5TFSL 3V4PL 5CCKL 2QBWA 3MSPA 4KMQA 5LAXB 4P46B 1X5AA 2H2SC 3ALXA 4LHUB 2UZXB 3P3YA 3VGBA 5DQDH 3E6HB 4H20H 1TCRA 1OAUH 2VDPH 1I7RA 1F3DJ 2UWEB 4PJ7A 3UJIL 1VKXB 5CHNA 4L3CA 1HNGA 3JXAA 3WFBL 4KK9C 3C5ZD 1KXVC 3O6KH 4DKEL 1CDCA 5F1SA 1IGTA 2C1PB 3BESR 3MOAH 1FDLL 4OF8A 4OCXL 3RIFF 2FO4B 3CFBA 3MUHL 1LP9F 3ARTA 1BJ8A 2DLEA 3OKOB 1FJ1B 1FBIL 3AREA 4AL8H 2N7AA 1A9BA 3DX7B 1I8LC 12E8H 5ACZA 2A0LD 4NKOA 2DJSA 1N64H 3QFDA 1U6AL 4ZODA 2PYEA 4PJAF 5D7LA 3ZO0A 1JI2A 2VRAA 1ZA3B 1KJ3H 4QNPE 2WBJB 2A0LC 4OV6F 4MA1C 5K9OB 5HYSA 1D9KD 2DM4A 3KYNA 1A5FL 3VH8A 1CLCA 4LPCA 4X5WB 3BYTA 4YHNA 4OBSA 4OZFH 3JTTB 2AKRA 3IDYC 3MACH 4BJLA 1KXTB 4U7KA 4GAGL 2Q6WA 2PYFB 4PGEA 2OQJB 2XKNB 4XPAL 3CAFA 3V0VB 4WI3A 2KPNA 3L7FA 4Z18A 2B5IC 1MHHA 1BZQK 1WQVT 4WO4C 2F9BT 2V7NA 7CGTA 2CH8A 4YUEH 1M7IB 4Z7NF 2Q20A 4GJTB 1FZKB 1HWGB 3MNVB 1C16A 3UC0H 1AQDB 4CN6A 2NNAB 4PJEE 5EWIH 5EO0A 4J23A 1NCBL 4RQQB 5IMKB 3NZ8B 3T0BA 5AZ2L 4ZFGH 5C0JA 1BX2A 1SEBA 4NQDD 3NTCH 3Q6FA 3CNKA 1CL7L 1H0DA 4ZXBC 4IM8A 1XF4B 2JB5H 2OTUB 3RL1A 3GJEA 3N85L 2K7QA 5EIIB 1IBGL 4JLRB 4F57H 2D4DA 3RWDB 1CDBA 1C5BL 1QLRA 1NBYA 3TT3L 4U4BA 1VGKB 4AYFA 3UTTE 2VWEE 1XF5B 4D0DB 3MRNA 4OCWL 2OTWB 4YGVB 4CU7A 1CDUA 1NCAL 3DOSA 4XH2B 3GIZH 3UBXG 1KEML 3QNZB 1XMWA 3IDXH 2GTWB 3JTSA 5IW6A 4TNWK 2OBGA 3VGFA 5T5FH 3UDWA 3I84A 3CFCL 2F53D 4LPYA 3BPNC 2KBGA 1MIML 4P2QE 1KULA 1XZ0A 5E6IA 3ZLQC 4V1DB 3JV4A 3P9MB 1IILE 4YR6A 4GAYB 3NGBB 2VABB 1WT5A 4TUJA 3RP1A 4XCCL 3SPVA 4OM1L 1BBJA 4MJ4A 3MLTA 4XP4H 3TNNB 1KG0A 3LEYH 5EO9B 4YPJA 2V5SA 4HIJA 1MQ8A 1SVZA 4LF3A 2KL6A 3ZDXF 4KUZH 5DC4B 1CGSL 5FDYA 4PJEB 2XTLA 1SEQL 3BKJH 3QWRD 4UT7H 3C08H 4OJFH 1DBMH 1UJ3C 2A74B 4HKJB 4HMEA 1MWAB 1NUDA 1CTOA 4HKXB 2HJKB 4RAVB 3S34H 1YEGH 2NTFA 3GMOA 1JPFB 3BP4B 2H26A 4RISL 1KBGH 3C6LA 5FV1L 5JPMA 4YDLC 3WIHL 1AJ7H 2JB6B 2C4XA 2HJFA 4Z0BL 2AJXL 5GJSH 4QRQA 1VFBA 3STLB 3RJQB 4F15C 4HCRH 1JGLL 2FBOJ 5JORB 3CPLB 3QIWA 4N0UA 4UTBH 4PS4H 1WUNT 4N0YL 4O51A 4Q9RL 3IXTB 3MLPA 3KPOA 1FO0L 1A2YB 4KJPC 2QADD 1IAII 1WVZA 1WWCA 5C6PB 4P2QB 5ID1B 3OXRA 3ARYA 1QYGH 3HZMA 4HJ0D 1AC0A 2MTPA 4WFHD 3RVTC 5GSVB 1BJ1H 3WNOA 4Q6IB 3LN5A 2ZUUA 4KK8C 1NGXA 3VFWA 1M7XA 2EDRA 4G8GA 5AAWA 1U93A 1LK3H 4RNRB 4JJ5A 2PCPB 1GGIL 3P9LA 4WJ5B 3HNSL 4ONHB 4MB3A 1W72H 5CGTA 4QHKI 3CUPB 3U9UB 1A1MB 2EE2A 3BQUB 4H5SA 2JIXB 3RI5F 5I8KH 2WP3O 3V5DA 4R4NC 1CXFA 2CLVB 3KHOA 1BIIB 1LO4H 3QULA 4DQOH 1FVCA 2R9HC 2QEJA 4XB8A 1A9EB 4NWTH 1U8HA 4I0PD 5ESQA 1CGXA 2NR6C 2HVJB 2XV6B 3JVGC 4PJHF 1P4LA 4J4PD 1OTUC 3ZZ1A 3QEUB 4DEPC 3WNLA 3SGJC 1N59B 3V8CA 3RWGA 4IS6B 2V2TA 1KV3A 3EFDL 3MLRH 4ZS7H 3X3GL 3O8XC 4J4PC 5IUSA 2VLLB 3V6ZA 1RJYA 3D85B 2R0WL 4HWNA 1NC4D 4OZGA 1RUAH 3F58H 3CU7A 4IOSD 4P57B 1FYTE 2EYSB 4NNXA 4Y16C 3L3GB 4M9OA 3MBED 5DMIL 3ZHDA 1I8LA 4OKVA 4HPOL 2OP4L 1BFSA 4MAYB 1A4KA 3FCTA 4H26A 1AD9A 2AXFA 1CLZH 3B9KD 3PGCA 2Y5TB 2GJ6A 5DJ6A 1MFCL 3PL6B 2ATPA 5ESVB 3G6DL 3T3MF 2X40A 4J3WA 5EC2B 4MWFA 2DICA 2E9JA 4DK3A 5A16A 3MRLA 1U3JA 1RJCA 4I77H 4BM7A 3NA9H 2VR9A 5D6DC 1RUMH 2VISA 5IVNA 3GFUA 3V4UH 1FE8H 1F6AB 3DO3A 3U83A 3ARQA 1G7HB 1ZANH 2NXYD 4NUJA 3WJJC 4R8WL 3VD3A 3HZVB 5I18H 1M6OA 4Y0GA 4Z7VE 2NW2A 1RSFA 4WO4A 3T65B 3PXJA 1R3KB 5D2LA 1CLOH 4KDTC 4P59H 4PJGE 3RA7H 5FO8A 1J5OL 4G8IB 4UTAL 2NY6D 5I30H 5D7JC 2H2PC 1RHHB 1KLGB 1EJ6A 4XPFH 4EN3D 1YJDL 3D39B 2QTEA 5FHBL 1HHGA 4KKAD 1BZ7B 4CVXA 1V3LA 5FYKL 2D7TH 5DRNA 4ZXBA 3O45B 3U1SL 3LQZB 3MLUH 3VGAB 1E28B 2R2BB 5D1XC 4D3CL 4LLYB 4HZLA 2FX7H 5DMYA 1VERA 3MRCA 4BZ1H 3RFZC 2BJMH 3NIFF 5T1MB 1NGQH 2Y6SC 4NRYA 4XNZB 5T1KB 3AS0A 3BZ4B 1X6NA 3I85A 1NAMH 2AJUL 3FQTB 3HC0A 4M1CD 4O58H 4IHOB 5F70A 1OGAA 3VI4F 5FHAL 5HDBF 1OSZB 1HSAA 4JM2B 4ODWB 3MV01 5C3TA 2Y23A 4ERSL 4JGJA 4JB9H 4R7NB 2XWJB 4JKWA 1EJOL 32C2A 4JFQA 4HFUH 2EDXA 2WINB 2VDLL 3N1PC 3QUMH 2W0PA 2F53A 5SV3A 4GRWH 5E1AB 4JDZB 5F6IC 4BZ2H 3FO2B 3FO9A 1O7VA 1I9RL 4BFIA 4OZFA 5CP3H 5H94B 3I3EA 3I3BA 4PY7B 2MKLC 3LY6A 1N5AA 1Q9LA 4Z7VB 3BH9B 5FYJL 3HC4L 4B5EA 5L7XH 2LE9A 1RD6A 3ZTNL 3DUSB 4YX2H 3L7EA 3FQUA 5C7XL 4GG8B 3HN3A 4HWEL 2W9DL 3U0WL 3GZKA 4PJGB 4ODBD 1U58A 3LKSA 3ET9F 1KSRA 2OMNA 3I6LE 1WWWX 3BEWA 4DUVA 1EO8H 1UJ3A 1FFPA 4A6YL 2FL5A 3HZYA 4P2RD 5GRUL 1A6ZA 1AD0B 5CBEB 3OKKB 3N1FC 2EDOA 3PWVB 3QWRA 4JG0L 4YO0A 3TJEH 3K1KC 4FQJH 1IZJA 4S1RL 5I1IH 5K9KA 1PJ9A 2Y25A 4OLEA 4CJ0A 2WNGA 1RUPH 3VXRA 5IW3A 3E1F1 1MFBL 2A6IB 3ULUE 3D0VA 1I9EA 3PV7A 1VA9A 1S9YA 3QO1A 3VGHA 5LGHH 4AM0A 5E00B 4OAWA 2J88H 4UOW0 4UQ2B 3QCUH 3CGTA 4X4ME 4ZTPH 2IG2H 3HA0A 2XFXB 5DMKA 5KS9B 5BO1H 5ITFA 3T0EC 1B3JA 4F7EA 5D7LE 1EX0A 4NQCB 4PUBH 4Z7UA 5E5UB 3VDAA 1NBVL 2VTFA 3AAZB 3S5LG 3SQOH 1EHAA 2CDFA 1NL0L 1LE9A 4FQHB 4AT6A 3VFMB 1Q9OA 2AEQH 4XNXL 3EOBB 1N0LA 3RUGA 1FORH 5CP7B 1OTSD 3U6RA 2Z9TA 4G9DB 3TO4B 3CDGA 5JW3L 1DQLH 1PEWA 3PWNA 4ODTH 4OZIF 5IESL 1EFQA 1MCLA 5IF0B 4TPRL 2OJEB 3B2UC 1RZKH 4NSKA 1CYGA 1LWRA 3MV7A 4L1HA 4Z95H 5SX5H 3F65A 2PNDA 5DS8B 5JR1H 1A3LL 4PRNB 3TJHD 1YY8A 4O5LL 3HUJF 3ROLB 1JN6B 3U2SA 2ZNXA 3T4AB 4U6TA 5CZXD 1R5IB 5IMOA 4S0TD 5KSUA 5F21B 3JVGA 3GBML 5K9QG 3VW3H 3UYPA 4OF5A 2ZCLH 1U3ZA 4U1SA 1J0HA 2P7TB 3SGJA 1KEGH 3MX0A 4KU1A 5CGYD 1W8OA 2MOVA 4HGMA 5CZXC 2PUQT 1CGYA 5CGMA 4J4PA 1YY9D 3WS3A 3L5JA 4UINH 5CINL 1AHWC 1S7XB 2NY7L 1JNHB 4OBRA 5I8CB 3K4ZA 4Y16A 3NH7L 3F12A 2X4RA 2DL2A 1QSEA 2BOBB 4EUPH 4QHNA 4HCRA 1A0QL 5E5MB 4RMSA 4HBQA 3BW9B 2HFFB 3LMJH 2DWEA 1I3VA 2XY2A 4NHUB 3M8OL 4LQFH 3MMEB 3PWPA 3MBEA 3QRGL 1C5CH 3F5WA 4CVWA 1PDKA 1RURL 5IQ9B 1I8KB 1CR9H 1IEHA 2Y1VA 1JWMA 4NKMB 1YEHL 4YEEA 1GH7A 3GO1H 3H9YA 5H35B 1V3MA 4LCYB 1OW0C 2NY2D 3PQYD 1I7ZA 5D6DA 1PYWB 5EU6E 2WIIA 4ZUSA 2BNRE 2FHCA 2ZSWA 3S98A 4PGEB 3SKOA 3IGAA 3S35L 1OT1A 1EAJA 3WJJA 3WXWL 3BPCB 5J12C 2CKBL 3P4OB 4P9HH 4ONOA 1BVZA 5MHSE 1W72A 3MNWA 3QG6A 1N2RA 5GGRA 5AZEL 3SDAC 4CUCA 1DZBA 2XIDA 4G80B 3QFJD 2BMKA 3EDFA 2X4OB 4F58L 1S9WA 5I1HH 4ZFOA 4I4WB 4L3AA 1D6EA 4M9PA 5IJKC 3ROOA 2HRPH 3VXTB 5E08L 1RZKC 4LDOB 2P45B 4KDTA 3RWHB 3TV3L 4GW1A 4YWGL 5JUEL 4L9LC 5D5MA 5DURB 1A4JB 3VXNA 5EA0H 3B43A 4B0MM 5D7JA 3CK0L 3TA3B 3B3IB 1EIBA 3DHJA 1BHGA 4ZUUB 3VXQB 3SGDH 3JWDH 3HMWL 5EOTA 4M61B 4QXUL 5I1EL 4XHJD 1QEWB 5ICXB 5D8JL 1QOKA 2DQHH 1W0WA 1N3NA 1IRAY 2EH7L 3EDDA 2G5BA 2ZUQB 5D1XA 4NWUH 5BZWA 4MNHA 4X6FB 4PV9B 1MRDL 3MUGA 2E7MA 1OP5H 3M1BA 4WI9A 1FFOB 4N0UE 2A73A 1BPVA 2DWDA 1UXWA 4PLOB 1BP3B 3CFKA 5E6YA 2R0KH 3E3QE 3UBXI 4X6BA 2JJTC 1KPVB 2UUDK 2XNAA 1V05A 2B0SH 1P6FA 4XMLL 5ALBL 1LO0H 3GMQB 4Y5XB 3VRJA 4JKKA 5I0DA 3HFML 1BWWA 3J8F7 4H88L 2OI9B 1MHEB 5J13B 5AAMA 5EU6B 3R1GL 2WV3A 1YA5A 2BNRB 1A6PA 4F7TB 5HGHA 5JDSB 2HT2D 2IANE 1M4KA 1OQXA 2GQHA 3MLTB 5F9DC 3V95A 3BHBA 5TFSH 3V4PH 5DJDA 1QA9B 1FZMB 4NQXA 5CCKH 3EOYG 1U2HA 1DBJL 5IR1B 2XRAL 4PJ8C 4ELMF 3GMNA 3VD4A 3X12B 4EDXB 3TNMA 3UJIH 4C4KT 3RDTB 4JRYB 3DSNA 3WFBH 3KPQA 4P5TC 1D6VL 4DKEH 4PGCB 4YAQA 3M07A 4X9IA 4NN5B 5ISZB 1FDLH 3S9DB 4OCXH 2VUOA 2NY0B 5EUOA 4RFOL 1FBIH 4PB0L 3MYJA 1U8NA 3WUWA 4HHAA 3EO0B 2BZDA 1QRND 1QVOA 4QXGL 2VXTL 5DR5L 4P2RA 3RY4A 4MQSB 1U6AH 1XGUA 1BECA 3JWDC 3SGEH 3VXUE 4OZGE 2XPGA 5FGSA 3EFFA 4O2EA 1U3HC 5I0ZA 5HGAB 3SBWC 4Y4FC 1A6AA 4PJAA 1IM9A 1A5FH 4PRID 4LEOB 3QI9D 3H9SD 3SDXA 3T0EA 3BKYL 3IXAA 4S0SD 3SJVD 1RIVL 4Z8FL 2M2DA 4GAGH 4LLMB 4UQ3B 2W92A 3RTQD 3QI9C 4XPAH 2FO1A 3J7HA 1GPOL 4XPTL 1V5JA 3MJ9H 2FDBP 4MD0B 2IANB 1T1ZA 3G04A 2AJSL 2X89D 4R2GB 2XZAH 4Y4HC 1T3FA 2ATKB 5B3JE 2H32B 4G8FA 3QUMA 3T4YB 3ISWA 3MLXL 3QA3B 5DD6B 4R4BB 5KBNC 1ZE3C 1NCBH 5CP3A 5FM8A 1WLHA 4NZDA 1PFCA 1ZHBA 5AZ2H 3HE6B 2IQAB 5IBUG 1CL7H 5JZ7D 2XG5A 4XTRD 1NSNL 3D3VA 4JFXA 1U2CA 4RWYH 3N85H 4KI5D 5DGQA 2AV1B 1IBGH 1HILA 1C5BH 4XZUB 3IDJA 3BH8B 2APWA 4W4OC 2NPLX 5ICYA 3TT3H 4LSPL 4OCWH 4EI5B 1NCAH 1T20B 4HIEA 1KEMH 4GKSA 3VXUB 4YHLL 1AHWA 2NY3B 5C92A 4OCNC 1P84K 5BVPL 4KAQL 5GRXG 1L9NA 2P8LB 4QHLA 4O02L 4HLZH 4J2XA 3RVWC 2HTLD 4OT1L 5IB1A 3GSOB 1E4XI 2CKNA 3CFCH 4NZUL 1MIMH 3WHXA 4HG4K 4YXKL 4K9EC 5I1LA 5CSZA 3N1QC 2HTLC 5FCSH 3QDGA 4MA8L 2ED7A 1ZMYA 5DFVC 4KK5C 1ETZB 5F1OB 1HI6B 2G2RB 3BO8B 4NO5A 4XCCH 4OM1H 3D1MC 4F8TA 4L3ED 5DT1L 3QQ9D 1Y18B 5E2UL 2E7BA 3GSWA 5F71A 3DUUB 1RZ7L 1OW0A 2P24B 1YPZA 1PX3A 4RSVA 4NFCA 1QFOA 4AIXA 4M8QA 2C3HA 1L7TL 1CGSH 2YUVA 1PG7L 1SEQH 5A2JH 1KN2L 3IDGA 3OV6A 3AS1A 5E8DL 2MPAL 3SDAA 2N7BA 1FVDB 5ADOL 5KSVA 3G5XB 4UT6L 1P1ZA 3KS0H 4GRLC 1RK1A 2HVKB 1X5GA 5IBTL 5IJKA 2Q3ZA 3EZ8A 3H3KA 2GCYB 4LLDA 4RISH 1U95A 1NFIA 5JLZB 1F4XL 1PEZA 1J0ZA 4JPKL 3WIHH 5JOPD 4WHYG 4L4VD 4L9LA 1UCTA 4Z0BH 1W2KT 4IRSC 5HGDB 2AJXH 3TBSA 1BQUA 3MRDB 1B0RB 2ICWI 3GSVB 3EHBD 1JGLH 1JRHL 4EOWL 2B7DT 4RMRA 4WFGD 1HN1A 2MFNA 4N5ED 1A02N 1KT2B 2DQEL 1HXYB 1KN4L 4N0YH 4Q9RH 2XQYK 3VXRE 3ARFD 5FF6A 4PP1C 4U6HA 1FO0H 2P8MA 1K3ZA 4RAUB 4LGSB 4QWWD 3KDMA 1EHLL 2XQBL 3B5GA 4JDTL 4Q9BA 4RZCA 3ARFC 1FNSL 5FEBA 5C07A 5JNYB 1I3GL 3QXUA 1JPGA 1KNOB 3T1FB 1YZZA 4BH7A 4EUPA 4YFLI 5I15L 2JK5B 2GFBA 2JJTA 1DCLA 4X6DA 5DZOA 1QHPA 1FPTL 3GSUB 3FQNB 3T09A 1GGIH 5DSCB 4L8CA 3HNSH 3UTPD 4Z7UE 43CAB 1J05B 3HB3D 4KI1A 1R5WB 1IAIM 1FLRL 2Y06L 2VL5B 5E9DD 3O41B 1S5HA 2OR9H 3U36B 2SEBA 3QPQD 3KYOB 3D0LB 2ZOLA 2EO9A 3QO0A 1U0QA 3MRIA 5L6YL 4HJGA 1IGFL 4PJIF 4YBQC 5I9QB 3FFDA 3EOTL 3QIBC 1XIWB 5B8CB 5J6GA 4E0RA 4PJ8A 2NYYD 5HHPA 3MV7E 5J3HC 4FXGA 2BNQA 2X7LB 4PJHA 1Q94A 3EFDH 1UACL 4P5TA 2W65B 3X3GH 4WUUD 1T7VA 1RFDL 2I26N 3MGTB 3BD5A 2R0WH 3L5HA 1KYOK 4URTB 1ZLWH 4OIAA 1XFPA 1G6VK 4KKNA 5BV7B 1D5MA 5DJXB 3FB7A 2FD6L 4YDLB 2EDTA 5DMIH 5HVHB 2VN4A 3MPCA 4HPOH 2OP4H 4OLZH 5BCAA 4N0CD 3T3PE 2D31A 1F8TL 3GHBL 3QDJB 3KLAB 1MFCH 3DTXA 3RWCA 2DQIL 3WXVL 1U3HA 1MI5E 3G6DH 2YMXL 4RFNC 4LLUA 4HZAA 4NT6B 3SBWA 1QSEE 4Y4FA 1NUNB 4M7KL 1MJJA 2FJFB 3IETB 5C70A 5C8JA 3B6SB 1X3DA 3VU2A 5FFLA 1SYSA 1E27A 1C08B 1FL6B 1RV6X 2YPLB 1GIGL 2EKSA 3CC5A 3OR6A 3QI9A 1PX4A 2NX5D 4R8WH 2X4NB 4JRXA 4MHHG 2AK4A 4MNGE 3SJVA 3O9WD 4NYLA 1E6JL 2CLRA 4Y4HA 2QSCL 3NCJL 5C0AA 1IC5L 4B50A 3RWIA 5DEGA 1ES0B 3DLQR 3BZFB 3O9WC 1J5OH 2W07A 3MV9A 5A2LH 4UTAH 2W0FA 4MDIA 2X89A 2H9GB 2YC1A 1J0YA 5IBLC 1F5WA 1OF2B 1YJDH 5JHDD 5F7HA 5FHBH 1I3RA 5FYKH 5CEYB 4G42A 1OY3B 1AGFB 3U1SH 2VLRA 1CICC 1C12B 4OGAD 4LL9A 4WHTA 5J57B 4HWBL 1IAKB 3ULSB 3MCKB 4D3CH 1R24B 2UY6A 4W4OA 4V2BA 5K9QI 3UP1A 3PIQB 3BRFA 1TJGL 3QWOA 1JP5A 2X4UB 4Y5YB 2BVPB 5FYLE 3O8XB 4PRHA 3RX7A 1QSVA 3MNZA 3RNKA 2VIRA 4OFYD 3VA6A 1BJ1J 2AJUH 1UGNA 2NTSP 4D9LL 5LXGL 5TQ2L 1RY7B 3MRFB 4LNRA 5FHAH 4ELKA 1KB9J 1MI5B 4GMSL 1U8LB 2A38A 4FQCL 4HEPG 3AMLA 3O3EB 4RMVA 4JEGB 4ERSH 5C0FA 4LKXB 4GW4B 1U41A 1PY9A 3QEGL 2ESVA 5IVXF 1EJOH 1MHPL 3U0PA 3KLHC 4LLWB 4TTDD 2FEDC 4JFOA 5IB2B 2R69L 2VDLH 4YH6A 1TVHA 3D5OF 3VGGA 3VFNB 1JJUA 1QBBA 3ARDB 2BDNL 1I9RH 4TNVK 3I75B 4MNGB 5T1LB 5GGUB 1Y0LB 5FYJH 3KR3L 3HC4H 2NMSA 6CGTA 1BQLL 3ZTNH 3GM0A 4NQVB 3SCMB 1OP3H 5C7XH 4L3EA 3S7GA 4HWEH 2W9DH 3U0WH 5KVMC 4IEFB 5F96L 2QKIB 2R15A 1F2XK 4IOFD 1NLDL 1AY1L 5JOEA 5FXCH 3DX6B 3DIFB 5T3XL 4A6YH 2LVEA 4D94A 1WJ3A 1TVBA 2CQVA 2RFXB 5GRUH 1U8IB 3QUYD 5FYKD 1S9KC 1HQ4B 4JFZL 4Z7OE 3W11C 5JMOC 4JG0H 4MS8D 2AXGB 1G7IA 1B0WA 4S1RH 2VR4A 1YJDC 3GHEL 5HYJD 2IBZY 5B22A 4F37K 3KYMA 4HH9B 2BY2A 5J0BA 3PGFL 4GG6A 3BPOB 1CG9B 1MFBH 4YBLC 1J11A 1DEDA 1KJMB 2VQTA 1FQ9C 3PF2A 4L4VA 2ZWLT 2J3SA 4LAJH 1YN7B 4POYA 3H7LA 3PP3H 3FN9A 1LP9E 5MENB 3O4LD 4ZUVA 4JDVB 4N8PA 2QQNL 1S7RA 3ECBA 2BVOB 4X7CC 1NBVH 4HAGA 4JHWL 4LVHC 4IMKC 5F9WB 3ARFA 3KLDA 1NL0H 4M7ZB 4PJAE 1YYLL 4JY4A 4Y89A 4GRMB 3BP5B 5B39G 1MUJA 3T0EE 1FNEB 5JW3H 4CVZB 3BZDA 3F7YA 1B4JL 3BUYA 4Y4KB 5HGGS 5IESH 2ERJB 4TPRH 5E4IA 5GSRA 5C09A 4HFWA 5HVWA 1O5DT 3MROA 4ZAKC 4MJ6B 3RJDA 1A3LH 3K8MA 1CE6A 5F89B 4XAWL 3O0RL 4O5LH 5E9DA 4H25B 1DTUA 3F7PC 3V6OC 3WN5B 3LKOB 3GBMH 5DA4A 1H9VA 5C08D 3NFNA 4ZS6C 5TDOB 4Z7NE 2P5EA 1MCRA 3CIQA 3HUJA 3O11B 2Z31D 5DUBA 1NFDF 4AQOA 1ND0B 2CIIA 2EC9U 1PG7W 3E2HB 3F62A 1JYWA 5CINH 5D70L 3M17A 3WIHA 1B6DA 1G9NH 2GTZA 2NY7H 3BT2L 1F3JA 3ARBD 4WHCA 4AK1A 1Q0YL 5I73B 4CADA 2CUHA 4WUUA 4UIMA 3NH7H 3D87B 5KJRL 3QJHA 3EOAA 5EIVA 1LP9B 3OKLA 1A0QH 3MUY1 5I66B 2VLKD 3ARBC 1DJSA 4P5KB 4U3HA 3M8OH 1NGZB 3TFKD 3GEWB 3WHE1 5E94B 1GGBL 3QRGH 4G6ML 5IGXL 3IDMA 3WFHB 43C9B 1FO0A 1RURH 4QRPD 1JHLL 4JFFD 5TDNB 5IB3A 5MEQB 3SN6N 3FT4A 5EBWB 3AU1B 1FNHA 4AZ8A 2XT1B 1YEHH 3MRPB 4MJIA 5D1QB 5D96C 4AEFA 3S35H 3H7BA 3P4NA 1J10A 1PZ5B 5IG7A 1MWAL 3WXWH 1G9ML 1SY6L 4QXTA 3ZKQD 1I85C 2VZ1A 1UCBL 5AZEH 3FT3B 5IFAL 2KZWA 1T1ZB 3LH2L 4HS3A 3FONB 4F58H 1JZ5A 2Z91B 3L3HA 3FHQA 5FA3B 4WNQB 5E08H 4NO3A 3V6FA 1Q8MA 1R3IL 2UYLA 1T2XA 3TV3H 2XKUA 4YWGH 2D3VA 3CXHJ 3BI9X 5JUEH 5E03A 3O9WA 2D0FA 5EUKA 2V2WA 1CXHA 1UXSB 3ZDXE 3CK0H 5I1AA 3FB6A 1FNLA 4LHUG 1NMCB 5F88A 4XVTL 3H2WA 3BDYL 5E4EC 4UB0L 1T7ZA 3RWEB 2BXZA 2HJLA 2ADFL 2ICEA 5FECB 1P7HL 1K2DA 1JGUL 1CICA 3HMWH 4QXUH 1BFVL 4OZ4B 5DJ2B 5I1EH 1JF6A 5L2KB 1SMAA 3SKNB 5D8JH 3K3QA 5CILL 1AKJD 2EH7H 3ARGC 3BZEA 5DJ0B 2GY5A 1MRDH 4U1MA 5DI8A 1F13A 5IWLA 4X0KB 2BVTA 3PWJB 3KVQA 4MQXD 1XGRA 1X6LA 4FQXC 1T7YA 4BH8B 4OZHF 3IDNA 1MCFA 4G43B 2VXQL 3GJFB 1J88A 5E5RB 4WUKL 4XMLH 5T5NG 5ALBH 3L3DA 4NNPL 1ZGLM 4KJWC 3HFMH 4DZ8B 4H88H 5C07E 1DE4A 3V5KB 3V6BR 3R1GH 4U1KB 3MOBL 2X42A 3VD7A 4W68A 4WHYH 1K8IB 3KWWB 4XX1G 2X70A 5IFJA 5KW9L 2PXYC 2J8HA 1DBJH 3MRJB 5IB5A 2HLAB 1VB9A 2XRAH 2GT9A 3OKYA 4PFEA 3TBWB 1LK2B 4JR9L 4K3JL 4MMXC 5EU3B 3JV6A 3TWCL 5FGCE 4ELMA 1D6VH 4HT1H 4QHUB 1YDPB 4YHOL 4R9HA 3QXAB 4ACPA 1LNUA 5IP4A 1QFWL