4R2GC

Crystal structure of pgt124 fab bound to hiv-1 jrcsf gp120 core and to cd4
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
210
structure length
210
Chain Sequence
b'YVSPLSVALGETARISCGRQALGSRAVQWYQHKPGQAPILLIYNNQDRPSGIPERFSGTPDINFGTTATLTISGVEVGDEADYYCHMWDSRSGFSWSFGGATRLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Surface protein gp160
publication title Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Immune system
total genus 35
structure length 210
sequence length 210
chains with identical sequence I, M, P
ec nomenclature
pdb deposition date 2014-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r2gC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r2gC01
1JIBA 1DJSA 1UB5A 4PRPB 4U6HA 4OI8A 2VAAA 3EYOA 4L4TE 4GSDL 4I3RH 4JG1H 4KRLB 3AAZA 3U36B 4LSQH 3RWHA 5ANME 4XNXL 4MNQD 1RUKH 3KPTA 1JZ7A 4R6UA 1T1ZA 5DQ9A 2Q3AA 3JTTB 3WLBA 3S35X 1DDHA 3T4AB 5FKAA 5T1LD 3IFLH 1BVKA 3KXFB 2NY6D 5L2KA 1C7TA 1N5AA 1VGEH 4D0DA 3ZKQD 1HXMA 2VQTA 2QKIB 2OBGA 3IRZA 4F57L 1U8KB 4PJEB 1FGNL 1P1ZA 5I15L 4OUUA 5GZND 4XPHL 3AMLA 2L4OA 2XQYG 3LS4L 4NUGH 3D85B 3LEYL 5KZCD 4NC2B 3T8XB 5K59F 2XXCB 1QFPA 4P4RB 4MLIA 3CDYA 2F54D 1A4KB 4YXKH 3MC0A 3U6RB 2ZZUT 4PJ7F 4KVCH 4PRPE 4TRPH 4KTDH 1F90L 1K85A 3PJSB 3RIFK 3C60C 3VA2C 4Z95H 2GKIA 1CGWA 4HFUL 3JV5A 2EC8A 1U42A 1KN2H 4G7YH 3NZHL 4CU8A 4P3CL 4XNZB 1NL0H 3LKRB 2NW2B 3UBXI 2BOBB 4LBEB 3KXFE 3NOIA 5T3ZE 2VIRB 4TPRH 4MCZA 1HDMA 2X5PA 3C5ZA 2HP4A 4P9HC 3U2SA 4M48H 4PJEE 5HI3C 3EYSH 2IQAB 2QBWA 4NZTL 2I26N 1PEWA 1JHLL 3MRJA 2AJUH 4JQVA 2QHRH 4BZ1H 2IFFL 3TT1L 4M7LL 3MRDA 4LOUD 1VADB 3DX9B 4U1LB 1MF2H 4DEPC 5FHAH 1N59B 2GAZB 2LFGA 4XAWH 4NM4H 1SYVA 4JFED 3TCXA 4EN3B 4N1EA 1NCUA 1PSKH 1H0DB 5C0GA 4GT7A 4GLRI 3V6OE 1KG0B 3EOBB 3RNQB 3MLWH 4JO3L 2OMNA 3L3JB 4GKZA 1KBGL 4FQXA 1ADQA 5DO2C 1FC2D 5J1AA 1JHKH 4X6EB 1NUFA 5C09D 2CLRA 2XPGB 4NQVB 1F3RB 1C5BL 1U8OB 3DOSA 1LE9B 2Y7QB 3K2UH 4N9OB 1HINL 1CS6A 1XH3B 2B39A 3MBEC 5ERWA 4NPYA 3HLAB 2Z31B 2WBJC 1TPXB 1BJ8A 4YHPA 5IHZA 4N8PA 1U8JA 3TBSA 2J6EL 4PJCA 1EXUB 3NVQA 3VMPA 3QNZB 2OJEA 1ZT1A 4RZCB 3B4NA 3BP7B 3O0RH 4FMFA 1YEJH 3HI1A 2C4XA 3GSWA 1EMTL 2R0WL 5IFHH 4HX1B 4MD4A 1Q9LA 2JF1A 3QI9B 4FFWD 2FX9L 4K8RD 2MOVA 3HC3L 1B2WH 3UYPA 1QOKA 3NTCL 3QIUA 3H3BC 1NCWH 4KKAC 4L8SC 5LBSH 3D5OF 1FVDB 4FABL 3Q6FB 3RPIB 3B9AA 4MA8L 1QR1B 5DUML 1UEMA 2OXHA 4XBEH 5I1AA 4P4KC 5JIPA 1I3GL 3V2AR 1TTUA 4JQXA 1VDGA 4BH7B 1W0WA 1Z5LA 5IMKB 5D1QA 3STLA 2O5XL 2O93L 4B7LA 4PG2A 3GI9L 5C7XH 5E4IA 3ZZ1A 3FAWA 1KEGL 4FG6C 1UZ6F 2ICWA 3ORJA 5L88L 4PTUA 5CCKH 2YD1A 1TETH 4F7MA 1CF8L 1GGUA 3KPRD 3DRTB 1RI8A 2VZ3A 4NM8L 1WV7T 1MFBH 3THML 4YX2L 3MGOA 4KKCC 5HY9A 4XP1L 5EOTA 5D7IF 1KTDA 2AABL 1Q0YL 4GRWF 2IEPA 4XB8A 1KJMB 1FL6B 1LO0H 2QADC 3D3VA 3G5YA 3G5VA 3BPLC 5DK0A 3I2CL 5C9JA 2CQVA 4OF3A 4TVPL 2X4OB 3SOBH 2A6IB 1OGAA 4N9GA 2VDLL 3VFMA 1S7UA 2HT3D 2P42B 5DJ6A 4FMKA 3BFOA 4BH8A 1XGRA 1UM4L 1L9MA 3B6SA 3JWDC 5CSZB 4Z7QF 5B3JE 5IP4A 4W4OC 4GLRH 2DWEB 4YAQB 2VLMD 4WGWB 3FO2B 2HLAB 4Y4HC 4PBWD 4ZO7A 1UC6A 4ELMF 3DUUB 4R7NA 4BK4A 1CDJA 3B2VH 2R9HD 5BV7C 5JPNA 2BFVH 4ZPTB 4R7DB 2Y06L 4QTIL 3VXNB 3T77A 4MQSB 4NCC2 2C7UA 3HNVH 5KVFL 1OLLA 1W72L 5ADPH 4UAOB 4OFDA 2W91A 4Z7UF 3AU1B 1IGFL 4KJPC 4Y5VC 3EKCA 3T65A 4KMTL 5IBUG 5DD1L 3VRIA 4QTHB 3FT4A 3E6HA 2FIKA 4H5SB 2M26A 1FZMB 3QWQB 4KRNA 1F11A 3WXWL 5CEYB 3KPSB 1A1NA 1K4DB 4Z0BH 3LKNA 3ALWA 4X4YA 1NDMA 5HGHB 4S1DD 2IPUG 5ALCH 2VJXA 1T2XA 2QR0A 5E2JA 3Q6GL 3HE6B 3J7HA 4QRTA 5JORB 1KC5H 4UT9H 3AREA 3ZHDA 2DQUL 1BZ9A 3HC0A 4LLYA 2J8UA 1BFVH 4JPWH 3MGTB 3A0OA 3DWTA 3WO4B 5F7KC 4OZHB 4I8DA 3QDGD 3ECBB 1SVCP 4K7PH 1UKTA 1J9CT 3PWVA 4PG9A 4PJDF 5DC9B 5TE6H 2X4SB 3V9FA 2DLHA 2XXMB 3QAZC 3MV9A 4HEME 3D1MC 2KH2B 3R8BB 5DFVC 4PRAB 2OQJB 3QNXA 3ZSTA 1YMHA 1PEZA 4XPBL 5C3LD 4XC1H 3PWPB 1M7DA 4YC2B 3KPSE 5TE7H 4AL8H 5IB3A 1DEDA 3BEWB 1TDQA 3E0GA 25C8H 1MNUH 4NZRL 4XPFH 1BFSA 2ARJB 5DD5H 3X14B 1EO7A 3U4AA 2D4FA 1KLGB 3DRQB 4H0GA 1CL7L 3ULVE 1HKLL 5B39G 3W2DH 3LKOA 1ZEAL 2AW2A 1WCQA 3NACH 3UDWA 4HJ0C 2CIKB 3EJJX 2AK1H 5K33A 5ILTH 2IG2H 2HTKC 4OZHE 3AS3A 1IAKA 4WV1C 2D0HA 2CRYA 1TVBB 2FSEA 4G6KH 2V2TB 1H5BA 2DN7A 4HC1H 1Q9WA 3FQUA 4JFFA 4XMPH 4QHMA 2XN9D 3U7WL 4HAFA 1RZIA 1MWAB 4GS7C 4P23D 2CSPA 1D5ZB 4XNQB 1NUGA 4K23H 3PWPE 4Z6AT 1G1YA 3C5ZC 3KYNA 4ONFH 4GG6F 1DQJA 4PY7A 3SJVB 5H35A 2DD8H 3I6GB 3V5DA 5DJ8A 3IDJB 1OGTA 4ISVA 4M7JH 4TQEH 2VR5A 5I75C 4HUWA 2P4AB 4YNYA 5GGSY 1WZMA 3I50H 4I18B 3IDYC 3RPKA 1WBYB 3G6AB 2YUXA 3RIAF 1J8HA 4AM0B 2W0KA 1LEKB 2R23A 2ERJB 3U4BH 2VXQL 5I8CB 1KPUA 3OJ2C 2GJ6D 5KSAD 4GG8B 4GQ9L 2DLFL 4BSJA 5HYEA 2PW2B 2KZWA 2OZ4L 3VFPB 4LPUA 1N6QL 3TIDB 3CFCL 2BDNL 5IMOA 4LIQH 3EIFA 3QUZB 4HJJL 1RZKC 4U3HA 1A7QH 2EDXA 5EO1A 4AYFA 2X89D 5CP3H 4HWNA 1JWMB 2NY1B 5C07D 3MJ9A 5I1HH 1KJ2A 3SKOB 5CEXB 4LLVA 3OR7A 1YEIL 3IDGA 4MJ6B 4GBXD 3H9YA 4ZXBB 1GOFA 2AV1B 3SJVE 5D5MB 1BIIA 1IRAY 4F58L 3R0NA 5GRVL 4J4PA 3MRRA 4EUPB 1A6TB 4O4YL 5IB2A 2A6JA 4UMGA 1ORSB 2NX5A 4M5ZH 4JFYA 2GK2A 4PGCA 2BMKA 4M1CC 4HCRA 1KCRH 3GSXB 4KZDL 3FTGB 5AAWA 2OP4L 4KZEL 1CE6A 3AS0A 3BKML 4LSUL 1ETZB 2XQYK 1T04A 2CMRH 4JGUA 2PW1B 3EYVB 1QVOA 2ITDB 2CDEA 5IG7A 3EYFB 4G8GD 2YSSB 4WTWA 5D96C 2MCG1 3ULSA 3IYLW 2OI9C 2XWBA 3FB8B 3V4VH 2Y5TA 3DX7A 4EQ3A 5E99H 3QWOA 4OM1H 1NKOA 3ARYA 3GI8L 3QEHA 3K4ZA 4N0CD 4FXGB 4JFHE 4UV7L 4P46D 1EA9C 2P8LA 1R6VA 4KQ3H 3ZDZE 1LK3L 4JY6A 4RGOH 4JQXC 5D1QC 2R0ZL 1XZ0B 5CZXC 4KVNL 2GTZA 3P0VH 4K3DH 5DEGA 1YEHH 3DBXA 5D5ME 1RZ8A 1HIMH 3RY6A 4KQ4L 3MLXL 1OAKH 1QLRA 4Q6IC 5DD6B 3TWCH 5FA4B 1PLGL 1U8HB 2HRPL 3MRLB 4RBPH 1FHGA 1D5IL 4QRRB 1QBMH 1PDKA 3Q1SH 4WUKL 3BXNB 2FX7L 1JNLH 1ZK9A 5IFJA 4IMKA 2OYPA 4NRYA 1MJ7H 5E1AA 4D9LH 2KZ1B 3M45A 4XT1C 2Q8BL 3N0PB 5J56B 3MJ7B 2FO1A 1YC7A 3KAAA 1SY6H 1UM5L 3LQZA 5GZNC 1F3DJ 4OBRA 1DBAL 3U82B 3AROA 3IS0X 3FAXA 2IFGA 5FYJH 3F6LA 2EDWA 3QRGL 1U8NA 3A6CH 1QACA 1ZT7B 3QZWA 1EPFA 2ICWJ 3OJVC 3F7QA 5I1IH 1NANI 5EIVA 4P9HH 4H26A 4OZGA 1SBBA 5FDWA 3VCLA 1I1YA 5IB5B 4WHTA 1U8IB 3QIBC 4PREA 4TSBH 3QDJE 1X5XA 3F7VB 2J88L 3HAEA 1FLRL 5KJRH 4PPTA 1MHCA 4QRRE 5JPMA 4OFYD 5ETUB 3EO9H 4G9FD 1HXYA 1V3JA 4E41D 3HRZA 1NAKH 4F33B 2IAND 4A6YL 1QP1A 2JJTC 4V1DA 2A2QT 1AC6A 2XZAL 1RFDL 4WO4A 4Y8AA 5JIKA 3O6LH 2X4UB 3MYZA 2QQNH 2EDRA 1DQTA 3JUZA 4HGWB 1KIRA 5HI5D 4LOUC 3NZ8A 4AIZA 4L8CB 4LPYA 5HI4D 1K4CA 4ZTPL 5TDNB 4Z18A 3ARGD 4HH9A 3PF2A 5IR1A 4YHIA 1N7ML 2UZXB 2KQNA 1AIFA 5I73C 4LLQA 1KJ3H 5MI0B 5JHDA 4NZUL 5GJTL 2M1KA 3ZKND 1XCTB 4EDXA 4URTB 3WN5C 3IKCA 4D0CA 1I1FB 1Z3GL 4JZNB 1IGYB 2R2BA 1X6LA 2HMID 3TN0A 3PL6A 2DOCA 4JJ5B 1CICB 3MXWL 2VDML 1J0JA 4Y1AA 4JE4B 1OQOA 3C09C 3KG5A 4JRYB 4K2UH 5KVMC 1T22B 1ONQA 1QHOA 4OV5B 4X5XA 4Y2OA 4S1SL 4L4TA 2XY2A 2UYLB 4GXVL 1HWGB 5E5MB 4EOWH 3WO3B 4OCYL 1WCBA 5ANMA 4LLMA 5T1KA 4NGHH 1P84K 4UTAH 3OV6A 3ARSA 4LQFH 3VFTB 4NO2A 1D9KA 4PJ7B 1II4E 1CT8B 2DYPD 1ED3A 3VGBA 3RHWK 1RZ7H 1JNNL 3DVNA 4RNRB 4NRZB 3CFDA 3QUXD 5D6DA 1FIGL 4F15B 1R3LA 3EGSB 2PYEB 4TNVF 1A3RL 3BD5A 1PY9A 4FFWC 5F71A 3U4EB 1HILB 1MFEL 4K8RC 1NBYA 2OCFD 2XI9A 2FBOJ 4MVBC 4DK3A 2PXYB 4FFYL 1TJIH 1MIMH 3BWAB 3CXHK 4JRYE 2VKXA 3VWJB 4RDQF 2B1AL 1FQ9C 4PRNB 2A73B 2AAVA 1E4XI 1NANH 5GGTH 4PRPA 5GJSH 4PV9B 4QRSB 3CH8A 3U36A 5K59E 4JN1H 3PGFL 2Z35B 5I16A 4JG0H 1D5BB 4CMHB 4XP5H 4OCWH 4PJ7E 3MOAH 1WJ3A 1T0NA 1TITA 3T4AA 4ALAL 1PJ9A 3P4OB 3VWKD 4BFEA 3KXFA 1TXKA 3WFDH 5AAMA 3JWDH 4Y0GA 3LD8C 2Y07L 1IGTB 4FQLH 4PB9H 1HH9A 2QKIA 2PYEE 4J12A 3W39B 3MQIA 1U8KA 4PJEA 5E6ZA 3CK0H 5EH1A 5BV7H 3LV3A 4JVWA 5F96H 4PD4K 3R1GL 3D85A 4RQQB 1ITBB 3VFUB 3TCLB 4WW1B 3PWNB 3MX0A 3IKKA 4U6TA 5ITBH 4P4RA 1JNHB 1MFNA 2HT3C 3EDFA 3G6DL 5JW4Q 1A4KA 3TJEH 3U6RA 4P3DB 4OF5A 2VSDA 2WUBL 4XVTL 4HUMB 2IADB 4P5MB 5IFAL 3V6OA 1JTTA 1ZXQA 3UZVB 4KJWD 3ARBA 5EOQH 4RWHA 2Q87A 3DGCR 2W1NA 2EDJA 2R9HC 1MPAL 3EOYG 1CG9A 3TVMD 3WXVL 2NW2A 3QCVH 4LBEA 1JYXA 4H1LG 1QG3A 1YMMB 2VIRA 1OY3B 2OR9L 5I2IA 4C56D 1LK2B 3IF1A 1M71B 1FORH 3TO4D 2IQAA 2K9UA 5DRWA 4HIHA 3IU4L 4XTRD 2VDQL 3GJEB 4JHWH 3F8UB 4S1DC 1VADA 3VGEA 2JJSC 3DX9A 4U1LA 1ROWA 3ZT7A 5L8KB 15C8L 1N59A 2BC4B 2GAZA 4EN3A 3ULVD 1QSFD 1C1EL 4FZEH 2DM3A 4FXLA 5I1EL 1H0DA 4HIEB 4LCYA 3SDDB 1QFHA 1QFWI 2HFGH 4Q74A 1KG0A 2AI0H 3RNQA 1XT5A 4Z76A 4POZD 4LHUB 1GIGH 4X6EA 4BELD 3UCRA 3KPQB 1YN7B 4PLKD 5D7IB 1FFNB 2BNRB 3HG1B 1UACL 2XPGA 3BW9B 4NQVA 4GRWB 3WIIH 1IC7H 4U1KB 1U8OA 3QEQB 1YMME 5JA8B 1LE9A 2Y7QA 5A16B 1QSEB 3UTSD 3WS6A 1IKNA 4NQCD 3VXRD 4M6MH 5FUOH 3K2MC 1M05B 1XH3A 2ESVA 4K3JH 4OB5L 3HLAA 1I8IB 4LAQH 3B9VA 3Q48A 1I9RL 1ZHLB 5DJXB 3QNZA 4PJXF 2BY0A 1FDLH 4RZCA 4JY5L 1S7SB 3BP7A 3LAFA 4JZJC 4YK4C 3BH8B 4E42A 4XMKH 1FPTH 4U6VL 4CVWA 1RZGB 4NKQB 1BHGA 4HX1A 4UIKL 4LFHD 1B0GA 3QI9A 4X4ZA 3VXSD 2BJML 3TC9A 1F4WH 3WNMA 1A7RH 4N0YH 1CD0A 4Z7UB 4FQIL 4QEGA 3TBYB 3T2NH 32C2B 1FVDA 2X4TB 2D03L 3UTQB 3Q6FA 5D7IE 3RPIA 3CGTA 1DUZB 1QR1A 2BNRE 3HG1E 3BX7C 1XF4B 4G6FD 4GRWE 1OLZA 1T7XA 2MCPH 5MP6H 3REVA 4FQCL 3KS0J 3QEQE 3LEVL 3RUGF 1MAKA 2GHWB 1QSEE 3ZHKA 5KSVB 4D9RE 5IMKA 4BH7A 3K4DA 4H8WC 1IAOA 1XR8A 3U9PL 5I76B 3F7PC 4N8VG 3Q0HA 4WFFD 5IROA 3NMEA 4Q9CA 5KVDH 1KXVC 3PHQB 3KYKH 2RR3A 1RZKH 3B5GA 1XF3B 1A7PH 2B1HL 3DRTA 4YHOH 1MCEA 5IMMB 4KHXL 5LWYL 3D39B 2PO6C 4G7VH 5HHVH 1RZFH 4MJ5B 2BNUB 4KJYB 4TYUA 1KJMA 5F8RC 4CN4A 4DN3H 4PJDB 1FL6A 5KSAC 4YHMH 3VA6A 4Z7UE 4OZFB 2BVTA 4LCWB 4NOBA 5F9OL 2X4OA 3ZYOA 2BP3A 5CD3B 1RAMA 2VISB 1OVZA 3GDBA 5D1ZA 4HIIB 4O5LL 4KV5E 2NZIA 5LXGL 3G9VA 3VFRA 4TVSa 5HHMB 1FLTX 5CSZA 3RU8H 1QFWH 2EH7H 4I5BB 4R9HA 4HBCL 1S5IH 2DWEA 3JWOC 6FABL 4YIQB 3FO2A 4WWID 5DJ0A 2HLAA 5E00B 3O8XB 3QUYA 3P11H 3DUUA 5DRNB 1N64L 2ICCA 3REWB 4ZPTA 3BYYA 4R7DA 1JHTB 4RMWA 3SDCD 3BZFA 3I3DA 1B9ZA 2H2PD 3D39E 1V7MH 4I3RL 4JG1L 3EOTH 4N0UA 3U46B 4QTHA 3TH2T 2WMPA 5E9DA 1FZMA 3AS1A 5BZWB 1V7NH 2P5ED 2AVGA 1WC7B 1A1MB 3DLQR 4YHYB 5IVNA 3IXTB 5CEYA 4PJDE 1LEIA 2AJYH 3RJDA 2R0LL 3MUJA 4JPIB 4LCWE 3CDCA 5HGHA 3B9EA 4RISH 1VGEL 1I9JH 4DKFL 1NCCH 3EHBC 3FZUD 3HE6A 4F9PA 1DTUA 5HHME 2R2HB 1TNNA 4YHNB 1TMCB 4MCYB 3C9NA 5MHSE 3GSUB 1FNHA 1HSBB 3MGTA 3OKEB 5EA0H 3NCYS 2G60L 1IGML 5CEZL 1GPOH 4LLAA 3ECBA 3O81A 1HE7A 3QDJD 1WF5A 4YXKL 1OWWA 2X4SA 4TRPL 4ODVH 2EDKA 4M6OH 9CGTA 1A6ZA 1Y0LA 3SCMD 2OQJA 1XMWA 1IQDB 4U2ZA 3QCTH 4GKNB 1KN2L 2FHBA 1NMBH 2B2XH 3CMOH 3OHXB 1NGZB 3PWPA 2OL3H 3L1OL 4HPOL 1QR4A 4JREB 2AS5M 1NL0L 2D2OA 4O2CB 4ZD3H 1N2RB 4WI7A 1M4KA 5JXED 5LGHH 3BEWA 1OQXA 4KC3B 1ZHNB 4YDKL 1AO7D 4TPRL 1KLGA 5FF6B 3DRQA 4P2QB 5CBAB 4LLWB 4X9IA 4AG4H 3LZFL 4M48L 3EYSL 2YD6A 4LDLB 5J11B 4Q6YA 2QHRL 4BZ1L 3RI5K 5F7EH 4X98B 3HCVB 2AQ1A 4NWUH 3V6OC 1I1CA 1TVBA 1A64A 1QA9A 5FHAL 4X6DF 2X41A 4ZFOB 2V2TA 3O6MH 1FCGA 1XFPA 3WCYA 4FNLH 4XXCA 4OLXH 4XNZC 5SWQB 1PSKL 2ZG2A 3MODL 3CFKB 3RA7L 4YBLB 1MFCH 3MLVH 4Z7OF 2HN7A 2A74A 3BSZL 4JDTH 4XCEB 3TPKA 1JHKL 1DFBH 3SJVA 4KK9D 3I6GA 1ZWIB 2AV7B 5DURD 5D9SB 3IDJA 2AKRA 2R4RH 4FN0A 5GZOC 1TJGH 2X6MA 4P2QE 3OPZH 2YWZA 3MV7B 1IM9D 3ARGC 2BSED 3G5XB 3H9SB 4I3SH 1WBYA 3DMMD 4LPTA 3ABZA 4AM0A 3MJ9L 2C1OB 1KLUB 1T4KB 5I8CA 3ZKNC 4RMQA 1HK6A 4GG8A 1K8DB 4EI5B 4YUEH 5IJVA 2A77H 4HMDA 3O9WD 2PW2A 3HE7A 3JTSB 3O0RL 4K7PY 1YEJL 2HMIC 3CCHB 4ACPA 5T3XE 5IFHL 4IMLA 1JZ8A 3QUZA 2UY7A 1JWUB 3VI3F 1KN4H 5JOFB 1GZPB 1B2WL 5JQ6H 5LKNA 4TTDD 1BZ7B 3SKOA 4NQDD 3HZKB 4MJ6A 4K8RH 1IKNC 3BUTA 2BCKB 5LBSL 4ZXBA 5D5MA 5BZDA 2Z31C 3KDMB 4P2OD 5GGRA 1A9BB 4XBEL 2V2WB 4KUCF 1A6TA 4XAKD 1YA5A 1ORSA 4UT7H 1ZHBB 3MV7E 5HXMA 2XACC 3V4PH 2IH3A 4M8VA 3H9SE 3Q5OA 4DKEH 3DROB 1UXWB 2YZ1A 5AD0B 4UIMB 1MOEA 3GSXA 5FYKH 3FTGA 3V0WL 3W9DB 4CAGA 2YA1A 1ETZA 4OAWB 2DIJA 4JO2H 1U0QA 2PW1A 3EYVA 2DBLH 2ITDA 3LRSB 4WCYL 3EYFA 4M6NH 3RKPA 2D7TH 4R2GB 5I30H 4MGXA 3LKPB 3UYRH 1N6UA 1QFOA 3QHTC 3VXPA 5MEND 2R8SL 5E2TH 1JYNA 3QEGL 1LO0L 4YEFA 3BGFC 3VGGA 4HUKB 2YBRB 4I0PD 2P46B 5FV2A 1XZ0A 3SGDH 3J8F7 3SOBL 4OGXH 4HUVB 3H7LA 1I8KB 2P45B 2EECA 5J89A 2QEJA 5DD6A 1JCKA 5HHQB 2JJVA 1YJDL 2D31A 2OS7A 3ARTA 3B9KB 4HIXH 3VWKC 4QRRA 2I5YH 5CFHA 2DQGH 4YHLL 3BXNA 1DBMH 1ZLVH 5BO1L 2E6QA 5FO7B 3B2VL 2BFVL 4LSRH 1MJ8H 1FL3B 1MCJA 1T3FB 3MCLH 4LLDB 3MJ7A 5LVEA 2QQKH 1UFUA 4WJ5B 3DIFB 1AXSB 4YLQT 2VNCA 4ZO9A 3HMXA 4XX1E 2ADFL 3B2UD 1ZT7A 3T0BA 4IOSD 1ZANL 5J57B 4HCRH 2FJFB 2IAMB 1BQHB 1HYRC 3N9GL 2ZCLH 3OKLB 2EDEA 1G7HB 3GGWA 5IB5A 3KYMA 4RMVA 5EBGA 4HZAA 1U8IA 5ALCL 5ECJE 4PLNC 4KJWC 1SQ2N 2JB5L 3F7VA 5GS0C 2C4FT 4I77L 3VXMD 4OBSA 1JPFB 5F7DB 4UT9L 3TVMC 4CVUA 4JANB 2E8YA 2E7BA 3LN4B 4U2YA 1BFVL 4JPWL 4TUKH 3RDTB 4NCDA 5ETUA 2WBKA 3MOBH 1CXFA 1B88A 3S6CA 4F33A 2VH5H 1H3PH 5EO9B 4K7PL 3OAUH 4KTEL 5JZ7C 3QQ9D 3TO4C 5SWSB 3QG7H 1AGEA 5TE6L 1KTLB 1CGVA 5DZLA 4DZBB 4BZYA 1KJVB 2X4UA 5SWZB 1PX3A 3OQ3B 3FMGL 4HGWA 4JM2F 3I9GH 4N5UA 1OCWH 4L8BB 4L8CA 5TDNA 3GRWA 4JKMA 2VDKL 2B0SH 2LV4A 2ZSVB 3HE6C 4F9PC 3ULVC 3RZCB 2FL5A 5AEAA 1XCTA 4EXKA 25C8L 1MNUL 5IM7B 5A2LH 4KMLB 1I1FA 5C0CD 5EC1B 4POZC 3BVNB 3P30L 3W2DL 4LARH 2WW8A 1NPUA 1NBVH 2ENSA 3AVEA 3NACL 1QO3B 1IGCL 1CICA 4PLKC 5TFSL 4JRYA 2AK1L 1I1AB 5TF0A 1QLFB 2IG2L 2CUIA 1T22A 5ID1B 4HLJA 4OV5A 1MCFA 4K55A 3UJJH 2J12B 1D7FA 4LFHG 4G6KL 1G6RH 2UYLA 3MJ8B 5J6HA 3NA9L 5E5MA 5SWSE 4HC1L 3NCYP 1KB5B 4XMPL 4NO0D 4YC2C 5FYLL 3VFTA 5SWZE 2DL2A 3EOAB 1R5WB 3KPLB 4PJ7A 5FGBC 1CT8A 3N1FC 5CIPB 2DS4A 3O4OB 1AGBB 1SBSL 2FR4B 4K23L 4PY8J 4NRZA 1KCSH 1IGIH 4H8WH 3BQUD 4ONFL 2DQDH 3E1F1 1IFHH 3WIFB 2PYEA 5E6ID 2DD8L 4G6AD 3QDMB 3RAJH 3UZEA 1HILA 2A9MH 4M7JL 4TQEL 4ZOEA 1DUYB 2F74B 3A67H 3I50L 5CINL 1QBLL 2PXYA 3ZE1F 2VLLB 3CXHJ 4X7SH 4EEEA 2XOTA 3BWAA 4XI5C 3NPSB 1YNKL 4NT6A 3G6JF 3OZ9L 3U4BL 3QCUL 4KKLC 4DW2H 4R4FH 3AGVA 2A73A 1O7SA 1CFBA 1MFDH 1CU4H 4WEBL 2XKUA 4PV9A 5F9AC 4QRSA 5DJDB 2I9LB 1I8LC 2Z35A 2HFFB 4KKNA 4LIQL 4A2LA 1D5BA 1GGYA 4IHOB 1A7QL 1MY7A 1L0QA 2OR7A 5J13C 1Z2KA 3GJFK 1X9QA 3BJ91 2JCCB 5C71A 4I18C 1IGTA 5D72H 3JWOH 3QDME 4R0LB 4C57C 3JSSA 4H0HB 1KGCE 1AGCB 4RFEB 3FQWB 5BVJB 5IGXH 1IL1B 4M5ZL 4RQQA 5CJQL 4DGIH 3L3GA 4OJFH 4Y2DB 5CWSB 3WDJA 4PS4L 3ZTNH 1UWEH 3PWNA 2ZCKH 2XZCH 1KCRL 4CMMB 3B5HA 1JI1A 1ZOXA 3SDAD 1IEAA 1MHEB 4EUPG 4WW2C 4DWHA 1HSAB 4HEPG 1J0KA 4F9LA 4OQTH 1DE4B 2K3TA 4P3DA 2CMRL 5HHMD 2XWJB 4AEIH 2YC1B 3E8UH 1PW3A 2NY1C 2IADA 4P5MA 3K0WA 1FL5B 4PJXB 2CGRH 3FFCB 4F7CB 2ZOKA 5E99L 4OM1L 1ZT4B 3SDCC 1T89C 1JNJA 2F19H 3GJFH 5IOPA 1KIQB 1U6AH 2NXYB 4KQ3L 2VWEC 4XCCL 4LHQB 1YMMA 1W8NA 4YWGH 2VDPH 1OP5K 2NTFB 1LK2A 3LKQB 2DKMA 1M71A 3UO1H 1OAKL 3TWCL 1JK8B 3SE4A 5ELIA 4QRUB 3GJEA 1AE6L 3AUVA 4KK5D 1GGCH 3Q1SL 3HNSH 2RCSH 2LTQB 5I1LB 1P4LB 3PABB 4PJ8D 3FZUC 1F4YH 2BC4A 4G6JL 5FO9A 3RX8A 4P48A 5T3ZH 5EBLA 3GFUA 4WGVB 3SDDA 3RWGB 5KSUA 3GHEH 1DANT 3T1WA 1C5CL 3BP5B 2EIZB 3GKWL 1YN6B 4PJXE 3FFCE 4PBXA 3NH7H 2AJVH 3MRGA 4CVZB 1F6AB 4LHUA 5EZJB 1FCCA 3ARFB 4LK4A 3KPQA 5D7IA 3KJ6H 4P9HL 1FFNA 1T7YA 2BNRA 3BW9A 3HG1A 1HI6B 1LE5B 1YEEL 1AD9B 2R56L 3QEQA 2RJMA 1E27B 1QSEA 4OLWL 1OP5H 4TSBL 3QHFL 2E7MA 1M05A 1CFSB 2ZKHH 3JBG7 4DUXA 1N6VA 1EERB 1I8IA 3HFMH 4PJBB 3RBGA 2RHEA 2DDQL 1ZHLA 5D2LF 1F02I 1S7QB 3EO9L 3SE8H 4UNVA 2YA0A 1NAKL 2DQCH 1YYMH 4NBXB 1S7SA 2YRPA 1N4XH 3D25A 3BH8A 1OARH 1H8NA 1WICA 1J88A 3DHMA 1IGJB 3O6LL 5ICZB 2QQNL 1X5AA 3R06B 3QIWD 4Z7UA 3MNZB 1JUFB 3TBYA 2EYSB 4NNXB 4WHDA 1RIVH 1T7ZA 5EORH 4NQTA 4J6RL 4YQXH 4LSTL 1VHPA 1DUZA 3OMZA 1OM3H 1KJ3L 5EU6B 4FS0A 5KVGH 2EEBA 2GUOB 5KSVA 4OIAA 4ERSH 4J3SA 5F70A 2AJ3A 4XRCB 4Y19D 4GW1B 4CNIB 5F7LB 3WHE1 5I76A 2A6DB 1G84A 1GOHA 1QRNB 2ADGB 4PJBE 5F9WB 5I8OH 4KK9C 5C0AB 3WUZA 1MVFA 1OTUC 4K2UL 3PHQA 2Z8RA 3L5IA 3U79A 2CK0H 3SHSA 2AQ3A 1DN0B 2ZSWB 4PJ5B 1XF3A 3TM6A 2F5AH 3UTTB 5IMMA 4AZ8A 1F58L 5CJOL 4EOWL 1YNTB 1BBDH 3DMMC 3RVUD 4MJ5A 2BNUA 3P9MB 3MRKB 4P5TD 2V7HB 4P9ML 1K3IA 1NFDB 1YZZA 3IJSB 3QR2A 4OZFA 4LCWA 4WWKD 3O9WC 5EUOA 1JP5A 5TJWK 1RZ7L 1IAIL 5CD3A 4LGSB 1MLCA 2VISA 4HIIA 1W72B 5EU6E 3ZKXB 1RMFH 1GAFH 1NGXB 5T1DH 4TTDC 4I5BA 5DDHB 4KWUA 5FM8A 3TLRA 3VRLF 3RX5A 5E00A 2XN9A 1QRNE 3O8XA 4IRZH 1AGDA 2I27N 5DRNA 3REWA 5C0AE 1U8QB 1JHTA 1EJ6A 2H41A 3HC4H 1IKFL 5GGUB 2EH8L 2NY3D 3MOQA 5I1JH 2GI7A 4PJ5E 3LPFA 3UTTE 4XC3H 3VJ6A 1C08B 3EFDH 4S10A 5GGRY 3U46A 3IDMB 4JN1L 4ODWB 3MRBA 4OKDA 1ZHKB 5BZWA 4JG0L 1WC7A 4ZAKB 4XP5L 1A1MA 5E95B 3IXTA 4OCWL 1NFDE 35C8H 3MOAL 2YUWA 3BE1H 1P4BH 1VKXB 5IEKB 3CFJB 4OLUH 3BWUC 4NQED 1RIHH 1S7RB 3WFDL 1A7NL 3JWDL 1ZAGA 2X9YA 4DVBB 2AXJA 3ULUF 1M7IB 3MRMB 4LMQI 3VXUE 2R2HA 3CK0L 3VWJC 2D7NA 1UJ3B 4YHNA 7FABH 1Z9LA 5C0BA 5BV7L 4MCYA 2DQFB 5F96L 4LQ1A 4ONHB 4QXTB 1RUPH 3OF6D 3GSUA 3JVGA 1HSBA 3R8QA 4I0PC 2A6KB 3OJDB 3SGJC 1A7OH 2EICA 5B38G 4M02A 4L29B 4HXBL 5DFWH 1HYSD 1H3VA 2XICA 1NC4B 1G9MC 1ZLSH 3TJEL 4CMHC 3FT3A 3SQOL 5MERB 5FGRA 4GBXA 5DJZB 1JGLH 2P5WD 4YGVB 4PGDA 2APWA 4WI6A 4JGMA 4OCRH 3SKUD 5LQBH 1P7KB 5E2UL 5EOQL 2P24B 4GKNA 3BHBB 1N0XH 1NGZA 3QH3B 5GS0H 2JE8A 5KG9B 3CLEH 1KPVB 1OAXH 3JV0A 3C5JB 4MXVF 2J8UF 4X8JB 5FF6A 5HD8D 4B0MM 4P2QA 4WY7L 2DMCA 4M00A 5CBAA 5I1CL 2X9XA 1N26A 3QNYB 4ODHH 3B2UC 3CUPB 1FORL 4Z77B 5A1AA 1UM6H 5DZOA 4HUNB 4QRQB 4G8GA 5D7SL 4XNUH 1DVFB 4F9LC 5JUEL 1M7XA 2D9CA 3LPWA 3LVEA 4X98A 3HCVA 4ZQKB 4ZUTB 4GMSL 5FIEA 5L0QC 4EKXA 4IRSB 4ZFOA 3WLWD 3V0AC 3L3IB 4YXHL 2E9BA 4FZEL 3OAZH 5DS8B 2Z9TA 4CRPA 3PDOB 4JM4L 1KEMH 2HFGL 2FGWH 3ULVH 4CW1A 3WKNA 3CFKA 3QDAA 5GS1B 2AI0L 3QUKB 1E6OH 5I1DB 5A2KH 3O3UN 4EZMA 3VE0B 1EH9A 3TT3L 1GIGL 5DEFB 3O4LB 3QQ9C 1CVSC 5IUSA 4DGVH 4LNVA 3C6LB 3QO0B 2AV7A 3OXSA 5D9SA 1IC7L 2YXFA 3LN9A 3VI3E 5GISL 4HS6B 4ZO6A 4WI4A 1E4XL 4CVXB 5I71B 1HQ4B 4RAVA 4YXLH 3MV7A 4M6ML 3G5XA 3H9SA 1AR1D 1F13A 4LAQL 4DJMA 4WHYH 4R97B 1T4KA 5DMJB 4X6FB 3SDDC 1TTFA 4B5EA 1K8DA 2R1YB 4EI5A 5E5UB 4G43B 4L9LB 1FDLL 3JTSA 4XNMB 3RTQD 3CCHA 4HHAB 5TDOB 3GO1L 3PUCA 4LPCA 2VC2L 3LPGA 5TQ2H 1UWXH 2GIYA 1JWUA 2BRQA 3ZL4H 1TZHB 1NMCB 5DJ2A 1F4WL 1A7RL 4N0YL 5JOFA 1GZPA 4OZIB 1BZ7A 1ND0B 3WKMH 3AB0B 3HZKA 5JIIA 5SX5H 3T2NL 2GCYB 3RIFF 5C86A 3O4LE 2BCKA 4JFZH 4LEXH 1BFTA 2BNQD 4U7SA 2AJZB 3KDMA 1ZTXH 2MCPL 5MP6L 1A9BA 2WQRA 2V2WA 5CSBA 1IT9H 4CDGC 4NHCH 3FQNB 4Z7VF 4FFZH 3DXAD 1FO0A 3NABL 4G5ZH 4YDLC 1MWAH 2AERT 3DROA 5BS0D 5AD0A 3BQUC 4UIMA 4EIGB 4DKDC 5E6IC 1H3UA 4G6AC 2BXZA 3W9DA 1S3KH 3STZB 1QKZH 3KYKL 2FLRT 3LRSA 2VXUL 4JFDB 3LKPA 4YFLF 4G7VL 4X6BB 3LDBC 4PLJC 4PP1D 1ORQB 1AQKH 4YO0B 1I85C 4G8EB 4S11A 4DN3L 4S1RH 4QGYA 4D9QE 4OZIE 3Q5TA 1ZLUH 2UUDK 1BGXH 2GTWB 4OLYL 1VFBB 4ZOBA 4JM2B 1I8KA 5HYJE 2VQUA 4WDIB 1H3GA 1Y6NR 5HHQA 3OB0H 3MXVH 4XVUD 4OF6A 1MCPH 3RU8L 1QFWL 3B9KA 4LCIH 4HDIB 3TZVB 1S5IL 1VERA 3Q3GB 3LQAL 1FE8H 3P11L 4KRPB 4LHJB 5FUCC 3NGBC 5FO7A 4O9HL 5ISZB 2FZ3A 2DI7A 1FYTB 1FL3A 3ZKSD 2I07B 5H2BB 2J8HA 1T3FA 3ZKMC 3MSPA 4PJAF 3UTPE 5EIIB 1C8PA 4JFDE 3DIFA 4WJ5A 5GGSB 1AXSA 1V7ML 3SBWC 3IJYB 4EUPH 5FOJA 1Z0NA 4DFIA 2AXGB 5KS9B 1GC1C 1V7NL 4XHJD 3SDAC 4B7IA 2W0LA 3DVFA 4HUXB 3QFJD 1E4WH 1Y6KR 3G08B 2FJFA 2IAMA 1BQHA 1HZHH 2GFBA 3CX5K 1UXSB 4A6YB 2M2DA 3OKLA 1G7HA 1Y18B 4MDJB 4RISL 5DD3H 1I9JL 1NEZB 2AEQH 2ZNXA 4UTBH 2NR6C 3O11B 1GL4B 5F7DA 1BPVA 4NN7C 4JANA 3F7RA 1OD9A 4L9DA 4KY1H 4P3WA 3LN4A 3RDTA 4PYHA 4GOSA 1UZ8B 4OKVB 4CJ1A 1EHNA 2V2XB 3C6SB 1J8KA 3NN8B 5E4EB 5GGVH 4AEFA 5EO9A 1FYTE 1J1XH 4GW5B 1QQDB 5SWSA 5IK3A 4D2NA 1KTLA 2XTJB 3BMWA 4ODVL 4DZBA 3EBAA 1KJVA 3G6JB 2OTUB 4M6OL 4PJGA 1E6JH 1IAIM 4KK5C 3H3KA 2W0FA 3EYUH 3FB7B 1INDH 1FVEB 2WWKT 3BPNB 4L8BA 2NNAB 5GGQH 3QCTL 1YECL 1NMBL 2B2XL 2ZSVA 1EFXB 2OL3L 4Q9QH 3RZCA 4ZD3L 2YK1H 5E5RB 1IARB 1FYHB 5LGHL 2IMMA 3P40A 5E08L 2NCMA 1H3WM 5IM7A 4QRPD 3JVGC 1U3YA 2VLKD 1UH2A 1WT5A 3BVNA 4P59H 4AG4L 3LMJL 1A14H 1QO3A 5ICYB 4Z7NF 4NZDA 1DL7H 1XCQB 3EZ8A 1I1AA 5IJKC 4L1DA 1MRFH 1QLFA 4NJAH 5F7EL 5ID1A 3UAJD 4P2RB 4NWUL 4XWOD 3QP3A 3U0WH 3SO3B 3U1SH 2QSCH 5KTEL 1RULL 1UB5B 1RUAH 5I1KH 3H42H 3MJ8A 1RZJC 4F80A 5EN2B 1F2QA 5I9QB 3ZE1E 3O6FD 2JK5B 4WFEE 4FNLL 2NZ9D 3TBWA 4OLXL 2XTJE 3RWHB 1KB5A 5L9DH 4R8WH 3G6JE 2VOTA 3K74B 1GJIA 3KPLA 1AR2A 1R5WA 3EOAA 4CU7A 2IPKB 2M8XA 4GXUN 3MCG1 2YUVA 5DA0B 5CIPA 5F6IC 1MFCL 1AGBA 5FKAB 5I8KL 4Z7WA 1DFBL 1EX0A 1NCDH 3BAEH 3OKMB 4R96A 2CUMA 3WIFA 5J11C 3QDMA 4YFDB 3S36H 1DP0A 2R4RL 4FTVB 3OPZL 1DUYA 2F74A 4HT1L 1FBIL 2F58L 2VLLA 5D7LD 2VN4A 4WEUD 3SKMA 1R3IH 1XIWB 2EIDA 3OJMB 4RA0C 1NAMH 1PX4A 4P2RE 5K9QG 5TF1H 5CLTA 5ITFB 5C0ND 1I7TB 2YWYA 4KROB 4L4VD 1V3KA 4H20H 5F7WC 1GGBL 4GKSB 4B41A 5CHNB 1PAMA 2HFFA 1BVZA 4P99A 4QCIB 3BKCL 4IHOA 1PZUB 1KN4L 2NY0B 4NQCA 3VXRA 1MCOH 1NFIB 4K8RL 2JCCA 5L2KE 2FNBA 1UADC 3WHXB 4R0LA 3NIFF 4C4KT 5CLWA 4BFGA 4P5TC 1G7QB 1T66C 4AIXA 3U2SB 4FTVE 1AGCA 4Y5XB 2J1KA 2ED9A 4F37K 5BVJA 4EI5C 1IL1A 1KB9K 4X80H 1AJ7H 3V4PL 4Y2DA 5CWSA 4KI5F 1E4KC 3VFGL 5HHPA 3KJ4B 4TOYH 2YPKB 3VXSA 4PJ9B 4CMMA 3MRDB 2Z92B 2ILLA 1MHEA 3HNTL 2EE9A 3GMOA 1JZ4A 1HSAA 1SYVB 4HK3J 3S9DB 3VXUD 2YC1A 3KLHD 2DBLL 3MLYH 5D2LB 1FL5A 1G1CA 4M43H 2PTVA 5IVOA 4KFZC 3UYRL 2XRAL 3QHZH 4F7CA 2WK2A 4MMXC 3QO1A 1G9NC 3TA3D 5JTWA 4GKZB 2DLTA 5E2TL 4RX4A 1V5JA 3RL2B 2I24N 3PWLB 4U1MB 5DR5H 1JPSH 3WDHA 3GB7B 3VDCA 3LQMA 3FRPG 3AS2A 4Q58C 1CGYA 2FWOB 5CP7B 2CLRB 1SVZA 2H26B 1HHGB 4HF5L 4U1GB 2NTFA 3LKQA 2VAJA 3MNVA 5J12B 3GMNA 1JK8A 2V5MA 1G9MH 4QRUA 4LRIA 3PGCA 1LO5B 5FAAA 4HIXL 4YHPB 2I5YL 3TBSB 5I1LA 3OKDB 1P4LA 4R2GC 1FJ1A 5BRZD 2JLLA 4TSAL 3LOWA 2OJEB 1ZT1B 2KPNA 1LO3H 2QL1A 2YD7A 4LSRL 3IDIB 3MCLL 3HI1B 4KK6C 4GAJH 3RWGA 2JJUA 2CH8A 5D2LE 1HH6B 4PRBB 3BP5A 3IDXH 2EIZA 4LASH 2C5DC 3P4LA 1HYSC 4CVZA 1F6AA 1PQZA 5EZJA 4ZS6D 3QIUB 4OLEA 1YQ2A 2J6EA 1FRGL 1B0RB 2FYYB 3HTLX 3QB7C 2BSSA 1JGDB 3DTXB 1HI6A 2EXWD 2ZCLL 1AD9A 1CFQB 3UJIH 3V52H 3B9KC 2VSCA 1FZJB 1E27A 4KDVA 5DUBA 1UQSB 1CFSA 5DSCB 4PJBA 5FM5M 4ZG1A 5IW1A 4X8XA 4XBGA 4H88H 4WHCA 1S7QA 5AYQA 4LKCA 3MOBL 4MAYD 5FYJU 4UBDC 3WIHH 4M9OA 4F7MB 1H3PL 1AGFB 1CE1H 4HSQA 2BERA 3QG7L 3ZSSA 1IGJA 4O58H 5ICZA 1DZBA 2VE6A 5F7HA 3WFBH 4KUCD 3R06A 1OCWL 3MNZA 4FZ8H 1B90A 3BYTA 5DK0B 3X12B 4F7PA 2EYSA 4NNXA 2XQBL 2JELH 3X3GH 2B0SL 1QFWM 4RDQG 1OGAB 4N9GB 1ACYH 5EU6A 1LILA 3P73B 4XMLH 2L0DA 1KUMA 1MHHB 2GUOA 3CMGA 3RDTC 3FB6A 4OD2B 3ARDB 5SV3A 4XRCA 3KHQA 3QRFM 4GW1A 4CNIA 2A6DA 2VMFA 3QA3A 4LARL 1NBVL 3FCTB 1QRNA 2ADGA 3VH8B 5C0AA 5FGCB 1H15B 2E9JA 3DUSA 1RJZA 2G9HB 3BT2H 4HWEH 3UJJL 1DN0A 2ZSWA 4PJ5A 4AEEA 1QPXA 3UTTA 2VLRD 3HHRB 3VRLE 1G6RL 5FYJD 1SEQH 3PP3K 1YNTA 1U3HB 3BKJH 1AR1C 2QHLA 5FEBA 2JB6B 2VXVH 3P9MA 3MRKA 4TUJA 4UILL 2P49B 5DVLA 1NFDA 5KSBF 3IJSA 1A1NB 2UZYB 1WAAE 1WT5C 5B3JF 1NC2B 3LKNB 4NHUA 3L5WB 2DQHH 4JDVB 1OGAE 2DQDL 1W72A 5C2BH 3D9AH 4Y88A 3TPUA 4Z0XB 1F4HA 5EULV 3P3YA 1I1AC 3UEZA 2A9ML 2IQ9H 4MDIA 2W59A 4QOKD 5DDHA 1YPZF 1LO4H 3MZTA 3A67L 4OQ1A 4LLYB 2AJXH 2NXZB 1X6NA 4QXWA 2H32A 3WFCH 4EDWH 4X7SL 2CRMA 3ULUE 5HYJD 3UROR 1JTPA 1U8QA 4KAQH 5FGCE 1T83A 1NCBH 3INUL 5GGUA 4DW2L 2ZJSH 2C3VB 3QPXH 4R4FL 3PXHA 2X4PB 4TN9A 3WJLA 1MEXH 2ENYA 3I6LE 1C08A 1JPST 3MV9B 3IDMA 4ODWA 2W9DH 1ZHKA 2BHZA 4APQB 4ZAKA 3BEVB 3T08A 1WFTA 1FG2B 1BX2B 4Y4FB 5E2VH 2IBZX 2XY1A 3KPNB 2I60L 3K4AA 4FRWA 3N06B 5AYUL 3OSKA 1S7RA 2F8OA 3KLAB 1K8IB 4LPWA 1M7IA 1WLHA 4O00A 5D7KE 5ENWB 4LF3B 3LCYA 1Y6MR 3LKOB 5F7NC 1AKJB 2DQFA 1JV5B 3S4SG 4ONHA 4QXTA 3SKNB 4MXVE 4PUBH 5EBMA 4I13B 1CDIA 2A6KA 3OJDA 4WUUD 3ZTNL 1UWEL 4L29A 2YPLD 2DMKA 5DZNA 2XZCL 4OZFH 5CMAA 3T3PF 1CDGA 3GHBH 1NC4A 4XVJH 2Y9RT 3GIZH 1GC1H 4NQDA 4OF0A 4OQTL 5MERA 1H5BB 1A3LH 4FXKB 4XVUC 5DJZA 4Y16B 4AEIL 1XGQA 5D7JD 3E8UL 2UY6A 4YGVA 3SPVB 3GUTB 4JFFB 5CUSH 3MV9E 4KKBC 3TZVD 2Q7YB 1R0AH 4XCYA 4U1NB 2P24A 1HOCA 3BHBA 4XPAH 4AEHH 2W9EL 3ZLQC 3EO1A 3CNKA 4NYLB 3IB4A 5CEZE 2PR4H 2F19L 1KPVA 3C5JA 3CC5B 5H35B 4XGZB 2VYRE 4X8JA 2CR6A 3QJFB 2DQIH 2A9NH 3N1QC 4Y2DC 4HKJB 3CVIH 4YWGL 5JW5A 5K9QI 3KVQA 5IQ7L 3WUWG 4Q2ZA 1KCUL 3QNYA 3IXAB 5HSFA 3CUPA 4Z77A 4YNYB 1PZ5A 3RHWF 3HMWL 4JGJA 4KKCD 4WTZG 4LSPH 4QRQA 2ZCHH 1LWRA 3JV6B 2W65B 2ORBH 4R4ND 4ZQKA 1GGCL 2J5LC 4QYOA 4ZUTA 5HYSB 2WQ8A 2RCSL 4Z7VB 4XP9L 5I0ZA 2E5EA 1I3VA 5T5FH 3T2OA 4H0IA 1F4YL 4U7MA 5D2NB 1J10A 5DS8A 2VITB 3PDOA 1GCFA 4JFFE 3BESR 3GHEL 3T0EB 2RIKA 2NXYC 5GS1A 3U7YH 4KDTC 3QUKA 4RCAA 2HA1A 3K8MA 5I1DA 2NY7H 2AJVL 5ADOH 3VE0A 2R69H 3V4UH 4LLVB 3HI6H 5DEFA 3O4LA 1N8ZB 2CXGA 3IDGB 5L8LB 1WIPA 1P53A 3C6LA 3QO0A 4Y4HD 3KJ6L 1MI5D 4JJHA 3WSQH 3MR9B 1YYLL 1EEYB 3VW3L 4HS6A 1P7QD 5JOPE 1VFMA 3VGAB 4C83A 4CVXA 1HQ4A 5BMFH 1MJJB 2ZKHL 2D7PA 4YR6B 2DM4A 2FHFA 3HFML 1RZJH 2AQ2A 2D7OA 5LAXB 2WINB 4HMCA 4LCCC 5FB8B 2R1YA 3AXLA 4Z7VE 4HK3N 2R2EB 4G43A 3EJZD 4FQJH 4LVEA 4PP2B 4L9LA 5T33L 2DQCL 1T04B 1YYML 1EGJH 3TBVA 3P2TA 1I9EA 4NRXB 2I9TA 4HHAA 4LVHC 2CRIA 5D2NE 1T1XA 3VD3A 2V5SA 3ARFC 2Y5TB 1TZHA 2C3GA 2X09A 3T0EE 4PJAB 3MUGB 4XWOC 3QEHB 4OZIA 4Z9KB 1ND0A 3VXMA 1TVHB 1J18A 3MACL 5CJXA 2GCYA 2P8LB 3OAYH 5AUMB 5ESAA 1MVUB 5EIQA 2DIAA 1TQBB 4JHAH 2NZ9C 3IVKB 1WITA 4MAUH 3UBXB 3VDBA 3DBXB 1OSPL 1YNLL 4IRJB 3P0YH 5IV2B 1AFVL 2APBA 4AQOA 5L2KD 5I8OL 4Y8DC 5IFJB 3X17A 3ELAT 2DQEH 4JCMA 3STZA 2CK0L 4EVNB 2OJZH 2F5AL 1DQDH 4JFDA 4G8IB 1L0YA 4X4ME 2VZUA 4YHKH 4KUZL 1NGYA 4M62L 3VMNA 1EEZB 4X6BA 1R3KB 3PP4H 1BWMA 2Y6SD 4YO0A 2YD9A 4G8EA 3PQYB 5D5MF 2BX5A 4PJAE 2JIXD 1LEGB 5C0NC 1VGKB 2R1WA 2WM0A 4PB0H 3O3AB 5DQJB 3VGDA 5FHBH 2DI8A 2HTKD 2Y72A 4JM2A 3OBAA 1OAYH 1I1YB 4WDIA 4I4WB 5F9WC 5DK2A 5HVHC 3LEXA 1GAFL 3HAEB 2VKWA 4M1GL 3TNMB 4HDIA 3IS1X 3Q3GA 5EU7E 2DTMH 1SMAA 4IRZL 2L7UA 1LD9A 5D93B 5EOCL 1UVQB 1HXYB 5ISZA 1FYTA 5ACZB 4WI3A 2I07A 5H2BA 1G9NH 3C5ZD 5I1JL 4YDIL 3WMSA 4Y4KB 1UB6B 5EIIA 2Y25A 5GGSA 2AK4B 3WFEH 2WP3O 3TJHD 3EFDL 3DV4A 2MMXA 5HVWA 3IJYA 2VXSL 4NWTL 2AXGA 2IH1B 5KS9A 1KIRB 4Y5YB 3PQYE 1K4CB 4HUXA 3W0WB 1YDPB 2NMSA 3ZKXC 3G08A 4NN6B 4UDTB 3BE1L 1P4BL 2HWZH 3MTRA 1UXSA 2NY4B 3KLHC 2E9IA 4A6YA 1Y18A 5SV4A 3GBNH 4D3CL 1S9XB 5E8EB 1NEZA 2CKBH 5C92A 1IZJA 5DJCB 4D0CB 3FO0H 5GXBB 4X9HA 3TA3C 3O11A 1X5ZA 2JJWA 3V7AE 1T83C 3MLTB 4FQXD 3H3PL 3TN0B 4HGKC 4LGRB 7FABL 1W2KT 3CPLB 3U7AA 4GRLB 1L0XA 1RUPL 3CSGA 1UZ8A 5HHOB 4OKVA 1JPTH 1A7OL 1TLKA 2V2XA 5T1MA 3UJTL 1KELL 3C6SA 3NN8A 5GRUL 4HUUA 1ZLWH 1P69B 3H2WA 2MPAL 2QQLH 4HWBA 4KK8C 4V1DE 1ZLSL 4GW5A 1QQDA 5FM5O 5CZVH 4HGMA 3G6JA 2AK4E 3HPJB 1JGLL 1BLNB 5EZLA 3ROLB 3T2QA 5L7XL 4QO1A 4OCRL 3FB7A 1FVEA 5LQBL 1CLOH 4I9WD 5GRWA 3KR3H 4MQTB 4QKXB 5HJ3B 1N0XL 1EFXA 3UTZB 4M1DH 1J1PH 4M1CD 3ARZA 4OD1L 5DT1H 3CLEL 1UJ3C 2VUYA 1MCQA 2Z0BA 3ZYJA 1JL8A 5IW3A 4OFIA 3DGGB 4YHZH 1BQUA 4ODHL 4ZS6C 4L4JA 3QIUD 1UM6L 4M03A 5JOEA 1K6QH 1XCQA 4XNUL 1AP2B 1R24B 2EXWC 4P2RA 5HHOE 1CIDA 3GSNH 1ZMYA 5DWUH 1DQMH 3UPAA 5J1TC 5EN2A 2JK5A 1MRCL 4ZFGH 2XFXB 3MUZ1 3NFNA 5CZXD 2GSGB 5D1QD 1FAIH 1AY1L 5C08B 4FFVD 1MJUL 5D6CA 5I16B 2FGWL 3CVHH 2IPKA 1L9NA 4OD3L 4MAYC 1E6OL 1T0NB 3UPRB 2G5BA 3CFIC 1M6OB 5FUZH 3MRIB 3OKMA 5EB9A 4DGVL 5JNYB 4WI8A 1UYWL 1HH9B 5E94B 5F6HI 4XXDB 1DVFC 4DUVA 1B4JL 2C4FU 4K94C 4FTVA 4HKXB 4YBHA 1EHAA 2YN3A 4DOHB 1MIEH 3LV3B 5FYLE 3D3VD 4BQ8A 4POYA 4IRSC 1EO8H 3K1DA 3L5JA 1P7HL 1XIWA 1OGAD 1YQVH 3NIFE 4S1QH 5FCUH 2YD3A 1FFPA 5ITFA 1I7TA 2E3VA 4KI5E 4LLUA 4GKSA 3FQTB 4AJ0A 5CHNA 3QIBD 4QCIA 5C08E 3ARBB 4Z5RA 3ULUD 4LVOB 3ZL4L 2MQ3A 5CAYB 1KPRB 1I7RB 4OGYH 1HNGA 1CG9B 3WKML 4KHTH 1F45A 1MAMH 1NFIA 3QT2A 5TPWL 3V8OA 1DLFH 5DA4A 1QFUH 5C0RH 2ZUWA 1BP3B 2AXHA 4JFZL 4LEXL 3WHXA 1O0VA 5L2JA 3LB6C 5I2IB 2BVEA 3P4NB 3IF1B 4R97C 1G7QA 3T4YB 5ALBH 3RGVB 4Y5XA 4NHCL 4DOHE 2VLJB 5DRWB 3DECA 1TZGH 3MYJB 4LIQE 4NNYB 4HIHB 4NFCA 1QSVA 4G5ZL 1J0IA 3S96B 3S36X 5CD5D 3LIZH 3HI5H 2BSRB 2YPKA 4PJ9A 2F53D 5CIPH 4RRPG 4OT1L 2Z92A 2ZUQC 3QIWA 1LDPH 1G7JB 2BHUA 5FK9B 1BM3H 5D2LA 3ARED 4LCYB 5D8JH 1S7VB 3RI5F 4JHBA 3ROOB 4XNXH 2AEPH 2EDOA 4Z76B 1AQKL 1T80A 2CXKA 4ESKA 1JPGB 3H8NA 3RL2A 4S1RL 3PWLA 4U1MA 3GB7A 2BY2A 4PJFF 4YJZL 3C60B 3VRJB 2FWOA 5CP7A 1BGXL 1MLBB 2H26A 1HHGA 2W07A 2YN5A 4XWGH 1GZQB 4WFHE 5GHWL 5IT2H 5FYKU 4GRMA 1MCWW 3U0TB 2QJDA 2ESVB 2YMXH 4L8DB 2VLJE 1LO5A 4XPHH 2V5TA 1WTGT 4UT6L 3LEYH 4HW6A 3OKDA 3ES6A 1FE8L 5BW7A 1AH1A 5EO0B 4PJIF 3S5LA 5M7QA 5IBLD 3IDIA 1LGVA 4E42B 4WWKA 2QSVA 5DMGD 5J8OA 3HZVB 2YR3A 1HH6A 4PRBA 1B0GB 1U91B 4Q0XL 3C08H 4R3SB 4DEPB 4JM2C 4MVBD 3NZHH 4P3CH 1HKFA 1RK0B 1B0RA 2FYYA 4YDJB 1HZHL 1JGDA 3DTXA 4NNPH 5D7JC 1CFQA 4MJIB 3REVB 5I8EB 1FZJA 3BPOC 3TZVC 4WU7B 5DD3L 5KSBB 4X99B 4BUHA 2AEQL 1RK1B 4MA1C 1UQSA 4UTBL 1FN4A 4MB5A 1IAOB 5DSCA 2ESVE 1XR8B 5FYKD 1FGVL 5IWLC 1KLFA 4NP4H 1NCAH 3CSPA 2VXTH 4KY1L 2IFFH 3D18A 3TT1H 2E7LA 2V5YA 3FN9A 1YPZB 4JN2B 5GGVL 3GBML 3GSQB 3MBEB 3VFOA 1AGFA 1J1XL 2WBJB 3MMEA 4TUOB 5F9DC 3S35L 4IJ3B 5E7BA 4ZSOB 3O2WL 2EE3A 1PKQB 4R4NC 1XF1A 1J8HD 5A40E 3EYUL 1INDL 5E6YA 4JO3H 3X12A 4M7KH 4U1HB 1WAAA 2BVQA 5DXWA 3WBDA 1S9VB 1T5XB 1P5UA 3P73A 5D1ZB 4BZ2L 4MJIE 2MHAB 1MHHA 4OD2A 5KSBE 5F88B 3VFRB 3ARDA 3HB3C 2DM7A 2WUCH 1EZVX 2RAMA 1HINH 4NBYB 3T3MF 5EWIH 5CJ5A 4P59L 4L8SB 5E4EC 1U8LB 1TVDA 3FCTA 4OFKA 2P5WA 4JLRB 3VH8A 5DJ0B 1DL7L 1H15A 3QUYB 2LE9A 4KH2A 4NJAL 2G9HA 2UVEA 1UENA 3U0WL 3U1SL 2X44D 3BZFB 1IM3B 2Q1EA 1YPZE 4J4PD 3VG0L 5EZIL 3S34L 1QLEH 1RUAL 5I1KL 2NX5D 1U3HA 5DJYB 1EMTH 2YRLA 2X2YA 4N0UB 1K9TA 4ZSOE 2JB6A 4R8WL 1PKQE 5E9DB 5JR1L 4KV5F 4CN1A 2BVOA 4QXUL 4FP8H 3EJZC 1LEIB 1JBJA 4I0KA 2H1PL 4HIJB 1NC2A 5D4QA 2XG5A 3L5WA 3ET9F 3F12B 4FABH 4JDVA 5TGBB 4MA8H 4PRIB 4JKPH 4Z0XA 4R90L 3BZEB 3VFVB 3S36L 1B3JA 4UNTA 2A0LD 2QADB 4N90E 5TE4L 3BPLB 5HYFA 1U3ZA 1JE6A 1JZ2A 3C9NB 2O5XH 4MX7A 2Z8WC 5I9QC 1O5DT 2E27L 3GI9H 1S78C 1R3IL 2DI9A 1NAML 3L3KB 2C3VA 1A6AB 2R0KH 5TF1L 3G9AB 4FQHB 2X4PA 4BQCA 4ODUB 4H20L 3D2UB 5EUOF 1A6ZB 3SQBA 3T3PE 1Y0LB 2XKNB 4N0UE 5BV7B 2AABH 4I48B 4APQA 2B4CC 2CRZA 1Q0YH 3BEVA 5B3NA 4Q7DA 5E9DE 4AIOA 5CKAA 1FG2A 1BX2A 1KENH 2NY5C 4Y4FA 4GAGH 3KPNA 3QWRA 5I1GH 3I2CH 2DJUA 4Y5VB 3VDAA 3KLAA 4QHKJ 1K8IA 3BO8A 4PRIE 3O6KH 2Y6SC 1UM4H 1XIWC 3NIDF 3V0VB 5ENWA 4LF3A 1VA9A 1AKJA 3TBTB 1JV5A 3SKNA 3RTQA 4JDZA 4MS8D 1KF9B 4X80L 1AJ7L 1DSFL 5AZ2L 4KROC 4TOYL 4IM8A 2ZG1A 4W4NA 5KOMC 3RL1B 4O2EB 5IBUB 1QA9B 4KXZI 4FXKA 3QPQD 4Y16A 4HZLB 3SPVA 3GUTA 2F9BT 3MLYL 1IGFH 3CXDH 3MV8B 2Q7YA 1H9VA 1WFOA 4X6CA 5DD1H 2EDQA 4PGEA 4U1NA 4HK0B 3OKOB 3PGDB 1RHFA 4NYLA 3WXWH 1XR9A 3PDGA 3DXAA 2HN7B 2A74B 4V1DD 1XF2B 5DR5L 5E8DL 3QAZB 1MSPA 3K81A 4Y5XC 3CC5A 3ZYZA 4WO4D 4XGZA 2EKJA 3TJHC 3QJFA 4JQVC 2AKRB 4HKJA 3N85H 5EBWB 5I74B 1P6AB 1BJ1J 4M93B 1PG7X 1UG9A 3IXAA 3PHOB 4ZDHA 4M7LT 3MRFA 4OTXH 2PO6D 2VZVA 2OX5A 4L5FH 2ARJQ 3JV6A 2W65A 2B20A 2DQUH 5F1IB 1T0PB 4M8QA 5HYSA 5JHDD 4Z7VA 1HHKA 3FJTA 3EDJA 3QSKB 1I9IH 5ID0B 5IJVB 1LO3L 2EZ0D 3HE7B 5D2NA 3U9UB 2HKHL 4FQXC 2VITA 3QQNA 4GAJL 4MXWL 3PL6D 4IMLB 3MV8E 1FG9C 3T0EA 1DR9A 4Y1AD 1Q9KB 4L3EB 3K7UA 4QNPF 1RPQA 1UWGH 4U1GC 1N8ZA 3DV6B 4L4TD 2PN5A 1VPOL 5B39B 3MR9A 1EEYA 1IVLA 3FHAA 5BZDB 4GS7B 2QSTA 5T1KD 3UJIL 3V52L 5GGRB 5E8NB 4AY0A 1OOAA 1D9KD 1MJJA 1YUHB 4QGTA 1HKLH 4RBPK 4YR6A 5BW7C 5DGRA 1CR9H 1A8JH 5FOBA 2RGSA 2IH3B 4ZTOH 4ZODA 4ZUVA 2R15A 4ZPVA 3ME0A 4EBQL 5LAXA 2WINA 5JO5B 5J6GB 5FB8A 4K7FA 4PP2A 2PYFA 2LAAA 2R2EA 1INQB 3WIHL 4LU5H 4NRXA 4MJ4A 4X4MA 5J7CC 1ZE3C 1CXLA 4W70A 2HH0L 1CE1L 2DQTH 3QIUC 3EHBD 4PIRF 5F7YC 3VXPB 1GGIH 4K3HA 1ITCA 4PJAA 3MUGA 4L3EE 5D1XA 1TVHA 2DF3A 4RIRB 1URLA 4K94H 2CDFA 4PRPD 5AUMA 1MVUA 3X3GL 3L7EB 2CLZB 5JXAL 5KAQG 3IVKA 1G7IB 3ILQD 2X42A 3HN3A 1WTLA 2AXFA 1ACYL 1I7ZB 3UBXA 2OTWA 4FFVC 4RSVA 3GIVB 4PG2C 1CDCA 2P7TB 1A5FL 4XMLL 2FECI 4KXZH 5D71H 1R3HB 1BFOB 1S5HB 1JYVA 2D31B 4IRJA 5HGBB 5EZOL 2YPVL 3CDGA 5IV2A 3KXFD 5IF0B 3I02B 5T3ZD 2V17H 5IVXF 2VXQH 1RUMH 4JRXB 5C0FB 4EVNA 4HWEL 3MA9L 1MRDL 1X3DA 4U1SA 1CD9B 4G8IA 2OZ4H 1Q94B 4J2XA 2P1YA 4NC0B 3D85D 1N6QH 1EEZA 1R3KA 3BKJL 4XNYL 4NIKB 3CFCH 3RQ3A 1J87A 4OM0H 1SJVA 3PQYA 2VXVL 3H9HB 1BD2B 4OLVH 1LEGA 1VGKA 2WWMD 5JIHA 3O3AA 5DQJA 5D96B 3ARDC 1YEIH 2OI9B 5MEQB 1E28A 1YEFH 3QULB 4F2MA 3GGWB 3KYMB 4WFGE 3RWEB 4I4WA 5C2BL 5JA9A 3ULUC 2P47B 3ARBD 1Q1JH 1OAUH 4O4YH 4AMKH 1KULA 1KTKE 3TNMA 5DD0H 4I2XB 1LO4L 3GSOB 1J5OH 5F7FA 4EDWL 4MNQB 3CH1B 3WFCL 1H8OA 4X0KA 1UVQA 1OTSC 4KAQL 4PRHA 2OP4H 4Q6IB 5C0DA 1NCBL 5ACZA 2ZUXA 4JRXE 3IU3B 4MNGB 2N56A 2ZJSL 3QPXL 2HKFH 4LSUH 5AZEL 4Y4KA 5JDSB 5T1LB 1UB6A 5HHXL 1NGQH 1AGEB 2AK4A 5AG9A 2DWDB 2NY6B 1MEXL 4OF8A 4H25B 5CD5C 2IH1A 2W9DL 5GZOD 4Y5YA 2X70B 3GI8H 1BD2E 1YDPA 3O45B 5E2VL 3W0WA 2VABB 1MCNA 4UDTA 2RQ8A 4XBPB 2FHCA 4N8CL 3WJJA 4EN3D 3L5HA 2FL5B 5KZCB 4P49A 3AREC 4XPTH 2W38A 4HWBL 1S9XA 5E8EA 5DJCA 2F54B 8FABB 4KQ4H 1CGSH 3MLXH 4MQ7B 2H3NA 3MLTA 1H8SA 1L7TH 1T6WA 4MA3B 3CPLA 1A6VH 2HRPH 4GRLA 4D8PA 4HQQH 1D5IH 5HHOA 4WUKH 3TESA 4MNQE 2OL3B 1IE5A 3GHBL 1ZS8B 5CILH 4MZ3A 4XVJL 1MCKA 4MNGE 3GMPA 4QHKI 5J6HB 1GC1L 2ESVD 3GNML 1A3LL 1A2YB 1DQLL 3HPJA 1UM5H 1BLNA 3ROLA 2Z31D 1BOYA 1DBAH 1TCMA 5CUSL 1RJLB 1BREA 1FV1A 1JGVL 1IEBB 4ZFFB 4XPAL 5ESVB 3QRGH 5HJ3A 3BP4B 5B4MD 5IBLC 4AH2B 3UTZA 1SYSB 2Q76A 4XZUB 2PR4L 2VDNH 4CU6A 5DMGC 3UDWC 1J1OL 1MCWM 2F5BH 1J11A 3QI9D 3FN0L 5EPMB 3BP6B 4N5EC 3DGGA 3CVIL 4HC1A 2F54E 2DMBA 5GSVA 1NSNH 4JFEB 1FFOB 3M8OL 1VFAB 5I73B 5F1NB 4LSPL 1MCLA 1AP2A 2ORBL 1H5BC 1R24A 2NYYD 3WN5B 4PR5B 4NT6B 4ZUSB 4PJGF 2IMNA 3BIKA 2Y4SA 5T5FL 2XFXA 3AM8A 2GSGA 2YEZB 5F3BB 2XZAH 5L6YH 5C09B 5C08A 3VXQA 3U7YL 3BDYH 1G9EA 4KPHH 3UPRA 3I75B 5ADOL 1A0QH 4OLZH 1A9EA 2R69L 3V4UL 1M6OA 1N7MH 3HI6L 4RFNC 3MRIA 5GQBA 2CIIB 5JNYA 1KCVH 4GAYB 5E94A 2ATPB 4NZUH 4XXDA 3CIQA 4HV8B 4ZS7H 4HKXA 4R26L 4F7EB 1P4IL 4PJFB 5BMFL 2YD4A 1GOGA 2EDNA 1EUTA 2IPUK 4JFEE 3L3GB 5CP3A 1RZJL 5D2NC 3MXWH 2VDMH 2ZWLT 5IHUL 5KW9H 4JPKH 1IEAB 2OMBA 4WI2A 1VEMA 5JW4M 1WSST 4BFBD 3PE9A 3RVXC 1EGJL 5HBBA 1T7VA 4GXVH 3FQTA 1D6EB 5C09E 5IW6B 4Z7WF 4PJIB 2ZOKB 5GS0D 43CAB 1KPRA 5DQDH 3E3QE 4ONGL 1I7RA 2VDRH 3VGAC 2ADJA 4J4PC 5IOPB 4KGJA 1ERNA 1F8TL 3QG6B 4JHAL 1T1YB 1MFAH 2MTPA 4MAUL 1F5WA 2VDOH 1A3RH 2X10A 1S7XB 3P4NA 5TQ0H 5E9DD 5JZ7D 4XVSH 3T4YA 3RGVA 4PJFE 2VLJA 3TP4A 1F97A 3MYJA 4NNYA 3JV4B 3KPSD 2VZ1A 3S96A 4FFYH 2BSRA 2BY3A 1B6DA 4GKOA 1CFNB 2DQEL 1L4IA 2BOCB 3DPBA 5F9JB 5FO9B 3HE6D 2A0LC 1LHZA 2B4CH 3DX8B 5EBLB 2NY5H 1G7JA 3BJLA 5FK9A 3BRFA 3GMLA 1S7VA 5KSUB 3ROOA 4YHKL 1BAFH 1EHLL 1WWCA 3PGFH 2JCCF 3PP4L 2FX8L 1TQBC 4PJIE 3LHPH 2BHYA 3MRGB 1JPGA 5J9PB 3SEPA 3RY6C 3C60A 3VRJA 1MLBA 5FHBL 2WWKO 4IRJC 2K7PA 1GZQA 4U49A 1OAYL 3EW3B 5EU7C 3QXWA 3H0TB 3MV01 4ONOA 3QZWG 1CVRA 4JFXB 5DLML 3U0TA 1EJOH 4UI2A 2R39A 4L8DA 4IMKC 3CD4A 2VLRA 3PWPD 3P9WB 3PWUB 1K3ZA 2ICWI 4E0RB 5EO0A 1EBAA 3HAEG 2FD6L 1YJDC 2CUHA 3MA7B 4X7TB 3D25B 3VMOA 1G9NL 3K8KA 1MCIA 5IVZB 5ABDE 2OR8A 4XP6L 3RWCB 3HZVA 12E8L 4MS8C 1J12A 1U91A 1WBXB 5HGDA 4H1LB 1KYOK 4R3SA 1CXHA 2N1KA 3N50A 2Z8VC 1MPAH 3RVVD 1RK0A 3WXVH 2HWZL 4YDJA 4BKLB 3QPQC 4XI5D 3GSVB 5FA3A 2VLME 4MJIA 5IMLB 1UGNA 5I8EA 4KKLD 3QDGB 4HWUA 4WU7A 2FBJH 3GBNL 5F7MC 5DMKB 4X99A 5KSBA 2CKBL 2OR9H 1RK1A 2C1PB 2HAZA 1S9WB 5D93C 2AJ3B 4KDWA 2VDQH 3LH2H 3SJVD 3BRGC 4WO4C 4X83A 1JPTL 4NKMB 1ADQH 5KVEH 1YY8B 1YPZA 4JN2A 3T3ME 3GSQA 4WW2F 3MBEA 3B5TA 2QQLL 4MMZC 4OI7A 2WBJA 4TSCH 4TUOA 1G7MB 3IAPA 2WBWB 5CZVL 4ZSOA 1PKQA 4NKIL 4TULH 3QUML 3QXAB 4ODBD 3BDBA 5E1HB 3JUYA 5HDOA 4YK4B 4JAMB 3KR3L 3W81A 4U1HA 2EZ0C 5EUOB 1J1PL 1CD1B 4WTXA 4UOW0 1S9VA 1MLCB 1T5XA 4WUUA 5DT1L 3TN0C 3PL6C 4PJBF 1FC1A 1JFQH 2MHAA 1G6RB 4J3VA 3QDGE 3RVWC 3QUZD 5KN5B 5F88A 1DBJL 5C1MB 4JFHD 1A47A 4L8SA 1JRHI 2NY1D 5E56A 3UC0H 1U8LA 1OPGL 2HG5B 4JLRA 3EDKA 1MQKL 2XN9B 1AGDB 1JGEB 4ZXBD 4P4KA 5C2UB 3U48A 3O2DL 3GSNL 1IM3A 4P23B 5DWUL 1D9KC 4KI1A 4M3KB 1UH4A 3VJ6B 5DJYA 4U6VH 1NBQA 4UIKH 1LP9F 1FAIL 4LSQL 2EDHA 3S3SA 1RUKL 3MRBB 3CVHL 1RJCA 5D6DC 1F3DH 1MH5A 4N1CA 3SDXA 3U0PA 2WNGA 3BKYH 4FQIH 1RHHB 1GH7A 1R3JB 2GEEA 3EDEA 3IFLL 4HIJA 3UYOD 5EUOE 5FUZL 3F12A 2D03H 3EJYC 4MNHB 5TGBA 1NEUA 4OV6F 3RY5A 4PRIA 4UDUB 1FIEA 3FOLB 4N8VB 3BZEA 3VFVA 2E7HA 3HR5B 2GJ6B 2ATKA 2Y1VA 3ARQA 2FIRT 5KSAB 1KTRL 1NCTA 4IIQB 4MZ2A 2G5RA 4HWZB 1MIEL 5C0BB 1TENA 3MRQB 3BGMB 4NUGL 4KI5C 3TV3H 4QF1B 1JF6A 2XN9E 3AM8C 4K3GA 3ILQC 5FXCH 1YQVL 1U8MB 4S1QL 5FCUL 3NIDE 3L3KA 1CDYA 1A6AA 3LY6A 4NSKB 2FDBP 3MLRH 4FQHA 5C07B 4ODUA 1NFDF 4KVCL 3FT3B 4W4OA 3B43A 4KTDL 1EO5A 1FFQA 2P8MB 4GBXB 5C6TH 5LWYH 3D2UA 3RWDB 4PGDB 3KYAA 4QRRD 2XKNA 3O3BB 4Z95L 3OWEA 4I48A 5MEPA 1RJYB 1A21A 4G7YL 2OSLB 3ULUH 1WVZA 4O51A 4ORGB 4OGYL 4KHTL 1MAML 4Y5VA 3LS5H 5F9OH 5F1SA 1DLFL 1QFUL 1Q0XH 5C0RL 4DTGH 3D0VB 2D3VA 1EAJA 5JDJA 3DURB 2GJ6E 1HHIB 3V0VA 2QTEA 5LXGH 2PTUA 3OGCB 3TBTA 3BN9C 3PV6B 2D7MA 1TZGL 5C0BE 2WWMC 2AJUL 4G8GB 4HBCH 1Q72H 1NGWB 3LIZL 1CDBA 3MO1B 3SGDI 3RL1A 1CQYA 4O2EA 2N4IA 3CDFA 3GJFB 3WNKA 1MF2L 3ARBC 4OF7A 3WS3B 2WIIB 4P46B 1LDPL 5CKGA 4XAWL 4NM4L 5C07E 4HZLA 1XF5B 2EDYA 1BM3L 3MV8A 1CLCA 5D8JL 5GS3A 4S0SD 2O26U 4CW1B 5CGMA 4HK0A 1WWBX 3OKOA 2AEPL 3PGDA 3VG9B 1A6WH 3MLWL 1JRHH 4YFLI 2DICA 1XF2A 1SM3H 3L3DB 4O2FA 2R0LH 1ZSDB 3RGVC 1OTUD 3OXSB 1AQDB 4K71B 5JQHC 2FATH 4XWGL 4NOFA 5EBWA 1VACB 4QNPE 5IT2L 4DKFH 3K2UL 5F3HA 5GRJH 4UOW1 4RAVB 2H2SD 3PHOA 2EO1A 2YMXL 3WNLA 3TF7C 4EN3C 5DYOB 5F1IA 4G8GE 1PBYA 1A7BA 5HDQH 2G60H 5TH2B 3NBNA 1IGMH 5CEZH 5ID0A 4BQ9A 4HXAH 3WDIA 2JIXA 3KLSA 2VR4A 1QD0A 3U9UA 5INCB 2VZSA 4ZNEE 4PV8A 3V6FB 5IVXB 1CICD 5CGYD 4JRYD 3C08L 1Q9KA 4WV1A 1EK3A 5DJ2B 4L3EA 5GPRA 4P57B 4JVPA 2EIBA 2NTSP 5DMIH 4WNQB 3WS6C 3DV6A 1NCWL 3L6FB 3L1OH 4HPOH 4QHUB 5B39A 3C8DA 4PBVC 3N1PC 4NNPL 4YDKH 1TPXC 4G9FB 5E8NA 4E41B 2IANB 1YUHA 4AK1A 4BFIB 4YGAB 3C8KA 5BVPH 1FO0B 5B4MC 3LZFH 4LSVH 1V05A 4NP4L 1NCAL 1X7QB 2VXTL 4HKZA 1ZLVK 1QZ1A 5C7XL 4X7EC 5JO5A 5J6GA 2PYED 3QI9C 4JFOA 1INQA 3MRPA 2RB8A 5CCKL 1TETL 3ARGB 4F37F 5IHBA 1MFBL 2OTPA 3L3HB 4RGNB 2PXYD 5IVXE 2OXGA 2NYYC 2DIBA 5HPOA 3MODH 4L3CB 4LPVA 1J0ZA 3RA7H 3VWJD 4JO4H 4LCUB 4PJHA 4RIRA 4M7KL 1QBBA 3T2PA 3BSZH 3L7EA 2CLZA 1G7IA 3B8YA 3WE6B 2Z93A 3MUY1 1G0YR 1I7ZA 5C6WH 3BI9X 4OGZA 2AGJH 3GIVA 2P7TA 4G9FE 5IROC 1VFOA 4E41E 1R3HA 1BFOA 1JTOA 3ARRA 1HHHB 2IANE 1S5HA 2WUCL 2HLFD 5HGBA 5EWIL 5K9KB 4IOFC 5IF0A 3I02A 3MRNA 3ESVF 3MJ9H 3UP1A 1KJ2H 4IJ3C 1X4YA 4JRXA 2MKWA 5C0FA 2FZ3B 3W5MA 2PCPB 2DYPB 1ZV5A 3HNVL 5I17B 5ADPL 4OZIF 1QLEL 3OKNB 1Q94A 3QUXB 4RGNE 1HHJB 1C16B 1UEYA 3H9HA 3MREA 4OCXH 1BD2A 5DVKA 5D1ZC 4FP8L 4B50A 3H7BB 2GFBB 4NBZB 4IOIB 5MEQA 2P8PB 3QULA 4Z0BL 1UCBH 5HGGS 5FECB 3RWEA 3ZTJH 4JKPL 4GW4B 4V2CB 2QV2A 4Z8FH 2CO6B 2KL6A 1U41A 3QUYC 3BGFB 3BGAA 2VL5B 1KC5L 4I2XA 2O5YH 3GSOA 4UAOC 3O3DA 2PTTB 4MNQA 3CH1A 1WK0A 2ZG3A 4HMEA 1YMMD 1OAZH 4X5WB 4Q6IA 3V0WH 2YUZA 1A6UH 3IU3A 4MNGA 2R0KL 2EXYD 5JDSA 5T1LA 4X7CC 3VWKB 2ICEA 5IK3B 2DWDA 3NCMA 4WCYH 4H25A 4PJGB 3DVGA 2W0FB 1NUDA 5HDBF 3OXRA 5IB1B 1CLYH 2R29H 5JW3H 2R8SH 2X70A 3O45A 1KENL 4XC1L 2VABA 4GAGL 5B8CB 3QEGH 4XBPA 5I1GL 4U1IB 1XGUB 3MUHL 5TE7L 4AL8L 3KLDA 2APTA 4JQIH 3SDDD 4XPFL 5DD5L 2F54A 4WHYG 3WO4C 4E5XB 4LGPB 5I6XB 3O6KL 8FABA 4JZOB 4MQ7A 3MROB 2W60B 3KS0H 4XH2B 4LHUD 1EVUA 1YJDH 4MA3A 4KGLA 2BNRD 2V5RA 3HG1D 3QIBA 5ILTL 6CGTA 2OL3A 4YHLH 2KBGA 2Q86B 3QEQD 3DO7B 5BO1H 3F7YB 1KT2B 5T5NF 1ZS8A 1QSED 5KS9F 4D9RD 3V6ZA 2ITCB 3TVMB 4QHNB 1A2YA 1P84J 3HRPA 3TBWB 2FRGP 1RJLA 3CXDL 4U0QB 4PJGE 3HAEH 2JJTA 2HVJB 1K2DA 2D7QA 4C56B 1IEBA 1DEEB 4ZFFA 5ESVA 1IJ9A 2ADFH 3BP4A 3TO4B 4AH2A 4NN5B 1ZANH 1SYSA 5J06A 1Z9MA 2HT2D 4XZUA 4Z7WB 3N9GH 2C26A 4R96B 3LN5B 4ZMAT 3HUJB 3MLSH 4YZFF 4U1JA 2F53A 1CXKA 5EPMA 3BP6A 3X3FH 1T2JA 3N85L 3Q2CA 1PD6A 2JB5H 1TTGA 2VRAA 4JFEA 4I77H 2NY2B 1FFOA 1QSFB 2DJ4A 1VFAA 4HS8H 1AXTH 4OTXL 5F1NA 3RVVC 1U58B 4L5FL 3V7MA 1NUNB 4PLJD 3WN5A 4XXCC 4PR5A 3SKMB 4ZUSA 3B9DA 4ODXB 1CXIA 1I9IL 1A22B 2GT9B 4KTEH 3F5WB 1OL0A 2EDTA 2YEZA 4QWWC 5F3BA 5C09A 4U6XB 2EEDA 3FMGH 2O61A 2BVPA 3UTSB 2ZNWA 1ZVHA 4C56E 4NQCB 3VXRB 3I75A 1UWGL 5C9KA 5I1HL 5I74C 3ILPB 2VDKH 4M93C 2CIIA 4Z7WE 3D39D 4GAYA 2ATPA 2N7AA 4HV8A 3HUJE 1D5XB 3WHE0 2NW3B 1YEDB 3ZKMD 4F7EA 4PJFA 4WI9A 2ERJC 3BPCB 4PD4J 1CDUA 1GSMA 1ZGLM 1MCDA 3P30H 1QSFE 2SEBB 4B53A 1CR9L 4LCWD 4ZTOL 3HE7C 1IGCH 5HHPB 5TFSH 3VXSB 1E0OB 5C0EB 3GMOB 3QUZC 4XP4H 4LU5L 1YY9C 3WEXB 5MHSD 3NA9H 2DQTL 1D6EA 5IW6A 4G6FB 3V4VL 4PJIA 5FYLH 4F8TA 3QO1B 3O8XD 1GGIL 4ZXBC 2NR6D 43CAA 1I7UB 4RFOH 3UTSE 1CD8A 3FOMB 3K8LA 4NQCE 4UOJA 3VXRE 1NBZB 3WFHB 4K94L 1SBSH 4RGOL 3IFOB 3QG6A 4ZUWB 2JCCE 2GJZB 1T1YA 3P0VL 4JY4B 4K3DL 1G0DA 1PVHA 1YEHL 4D94A 1S7XA 2GY7B 4ODSH 1HIML 3MNVB 3U30B 1A3QA 5D71L 1OB1B 2NLJA 5J13B 4G8FB 3GMNB 5H94B 3KPRA 2CLVB 4J3WA 3JV4A 3ZE0F 4DN4H 3PGCB 5CINH 1QBLH 4LMQE 2J3SA 1QBML 2ZPKH 3VXSE 1FJ1B 1JNLL 2V17L 3MBXH 3NFPB 1CFNA 1YNKH 4J3OC 3DO3A 3OZ9H 3QCUH 2BOCA 5F9JA 1RUML 1MJ7L 2GSIB 4D9LL 2MFNA 3DX8A 4WEBH 1REIA 3V95A 1SY6L 5C0BD 3VXOB 1WEJH 4WW2B 5FYJL 4OM0L 1E4JA 2X7LB 4NQXB 5J9PA 4OLVL 3ZYIA 1PQZB 3A6CL 3W9EB 1PGRB 1EAPB 5I1IL 3M1BA 2IC2A 1GVIA 2BSSB 3FB5B 2FJGB 1YEFL 4WFFE 3H0TA 1JN6B 4PRDB 5DUBB 4JFXA 3SDCB 1KFAH 1RURH 1OWRM 1Q1JL 1OAUL 4NKOB 4QT5B 4WI5A 1FZKB 4AMKL 5KJRL 1V8HA 5DD0L 5IW1B 4XBGB 5CJQH 1A02N 4UUJB 3PWUA 1J5OL 4PS4H 1X44A 1QYGH 4P2YA 4E0RA 2A1WH 4LKCB 2P5EB 4D0BA 1SMOA 3MA7A 4P2QD 4X7TA 1C5DA 2EYRB 3GMQA 1OT2A 5IVZA 2HKFL 4X5LA 3C87A 3RWCA 1NGQL 3LQAC 4U3CA 5GS2H 3DARA 4ENEC 3S7GA 3LRGA 1KYOJ 2ZUTA 2JJSA 1WBXA 4H1LA 2VE6B