4R2GC

Crystal structure of pgt124 fab bound to hiv-1 jrcsf gp120 core and to cd4
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
210
structure length
210
Chain Sequence
YVSPLSVALGETARISCGRQALGSRAVQWYQHKPGQAPILLIYNNQDRPSGIPERFSGTPDINFGTTATLTISGVEVGDEADYYCHMWDSRSGFSWSFGGATRLTVLSQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Surface protein gp160
publication title Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Immune system
total genus 35
structure length 210
sequence length 210
chains with identical sequence I, M, P
ec nomenclature
pdb deposition date 2014-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r2gC02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r2gC01
3ROOA 1U42A 5E5RB 4AENA 4YPJA 4YC2B 5GS2H 4MX7A 5MP6H 5C9KA 4JHWH 5BVJA 3PGCB 1T03L 3RGVD 3WL9B 5GRUL 4NUGH 3W11C 2LE9A 3WNLA 4BJLA 5EBLA 3C08H 1JHKH 3QIBA 4NQEA 4HH8A 2DLGA 1AY1L 5KOVC 5TQ0L 3QG6B 3IS1X 4A6YB 5GRJH 3KXFB 2G60L 2VR9A 3FO0L 4LPYA 5B3NA 2RQ8A 5CIPH 3FOLB 5E99H 4QTIH 5C6PB 3HR5A 2A1WL 4O00A 1XIWB 3MJ7B 4TPRL 1FZKA 2E7HA 3K74B 2Y07H 2VERN 5D2LF 5FO9B 5DTFA 3VFUB 3HZMA 4EI6B 3GMLA 4GG6A 4QF1B 1KJ2H 3V6OA 1I7ZA 5DDHA 5IT2H 2R8SH 4PG2A 1ZEAH 5E7FA 4IRJC 4PBXA 5EFIB 4FOMA 4LRIC 1QFWI 2VDLL 5F3HB 1KJ2A 4X6BB 2HP4A 5IHUL 5DJ0B 1JIBA 3LKRA 4P57B 4KK8D 3X13A 5T5NG 3LOWA 4WHTB 2BDNH 5BV7L 3C09B 4XI5D 5D2NA 2F53A 1QSVA 2J5LB 2AV1B 1KPRA 4M1DL 1DQLL 1KENL 5EORH 2P8LB 2BRRL 3MXWH 4DKAA 1KXTB 1KB9K 2VLMD 3O3DA 1F6AA 5CCKL 2BVOA 4PY7B 3CZJA 1DQML 5TE6H 5EUOE 4GBXB 4X7FC 1INQA 1F13A 1G6RL 4ODWB 4Y2DB 1QSEB 4AEHH 1BVKB 4U1IA 5L9DL 5C0CD 3S36X 2XFXB 2YUWA 1U93A 3IU4L 1DQDH 4KFZC 1MCOH 4KDVA 3JTSA 2R29H 2EIBA 1A6AA 4HDIA 5GISH 1GH7A 4LCWD 4FP8H 1NAKH 5AYUL 3OX8B 1KB9J 3O41A 3HZYA 4JQXC 3BXNB 4NT6A 5DUPL 3AREA 4AMKL 1SQ2N 5KSBF 3P0VL 3EYSL 1LE9A 2NW2B 2QHLA 5E0QA 5HVGB 4WO4C 3MC0A 3IDGB 1BF2A 3S3PA 4NWTL 4Q6IA 1FRGH 3HAEG 5DT1L 3TH4T 1G7PA 4HBCH 1RVFH 3HMWL 5F7EH 5EU6A 4R6UA 4J2XA 1FFNA 3H0TB 1AP2A 4X7SL 5D7KD 1PAMA 2ESVB 4GW5A 2B4CC 1FH5L 1Q9OA 4JG0L 4NC1E 5SX5K 3SDYH 2OX5A 5FYLL 3KNBB 5FIEA 5EZIH 3ARUA 5E2VL 3Q3GB 3VXTB 4KY1H 3GMRA 4ZG1A 5E8DH 1E4KA 2P8PB 3RWJA 3RWFB 3VE0A 4G5ZL 3JWNC 1FJ1B 3NCYP 1D7FA 2ZOLA 3EJJX 2BNQA 5GIRA 5MENB 3ZZ1A 4TSAL 1LWRA 4C56A 3T0AA 4PJGF 4XP4H 4ZAKB 2GT9A 4P2RD 2ZJSL 3RVVD 1N0LA 3BO8B 3MRGB 1ZT1A 4R90L 3T2NH 2QSQA 3O3BA 3JWOC 3LRHA 3QDGE 1Y0LB 2ITDA 4G9FB 3RJDA 2YHGA 5JHDB 4GSDH 3U7YH 4QWWD 2IH1B 2OR9L 4PRAA 1UCBL 3ZKND 1JYWA 4WUUA 2V5YA 3S7GA 2QEJA 2MKWA 3QO1A 1H3WM 2NY7H 5DMKA 5I1EL 1OAXH 1QACA 1ZVSA 3GDBA 1VACB 5EUOB 4L4VA 5E8EB 2IPTL 3O3EB 4JFYA 1MRFH 4EUPG 4Y4KB 4PJFF 2LU3A 1MUJB 3LKNA 4DN3L 5IQ7H 3VFMA 3E6HB 1NMCB 2GTWA 1GCFA 1J05B 5IP4A 3RZCB 2UV3A 4LGSB 3EIFA 4XBPB 4FFVD 2J8UA 1I9EA 2VAJA 2UZXB 2DWEA 4KKCD 1QLFB 4E42A 5JPNB 1NGPL 3M07A 4JFOA 3MBXL 4NO5A 1MWAL 4MWFB 5EC2A 5FOBA 3KLAA 1EVUA 5A40E 1U92A 2ZG1A 2A0LC 5GGSB 2I25N 1DUZB 1SYVB 2JJSC 5IJVB 2FD6L 2XWTA 1A3RH 1G7QA 4LCUA 1HH6A 2W59A 1JPGA 4Z5RB 4LKXA 1NGYA 4XB8A 3HLAA 2MMXA 2HTKC 4YHPA 4I1NB 1S9WB 1MCHA 5M94B 1VADA 2VITA 3WN5C 4FZ8L 2HVJA 2B8OT 3SKOB 4CN1A 5JXAL 2IBZX 3SE4C 1EXUB 2QV2A 3SDDD 5C0AD 5T3ZL 3L3HB 1E6JH 4RISH 1OGTB 2Y36H 5DVOA 4MDJA 2BVEA 3F6LA 3QI9C 5IB4B 3LV3B 5IFAL 3OBAA 4MSWA 1XGTB 3DGCR 3TWCH 4U7KA 1OP5H 4P3DA 4WWKC 1T3FB 1S78D 2VLRD 4HX1B 1CD0A 1NPUA 3UTPD 4MXWH 2Z4QB 4NN5B 5BV7C 2H2PD 4JO4H 3WCYA 5ALCL 5EU5A 3VRJA 3QDGB 2BOCB 3BQUC 1FNEB 3QJHA 2R4SH 3KPNA 4KI5F 5D2LB 4KXZI 3T1WA 3MRJB 2FLBT 5EBGA 3IXTA 3P4OA 1G1YA 5A2FA 5C0RH 5TH2A 5IOPB 2NXYC 2DYPB 1S5HB 4L9LB 5L2KD 3L9RA 4Y4FC 1E0OB 2V5TA 1DBMH 1WFNA 4AIZA 1JI2A 4HGMA 5EWIL 3WFDL 3PNWB 5EIIB 1T2JA 5DHVB 2HKFH 4XZUA 5J7CC 4KMTH 2GJ6D 4N0CC 3FO2A 1VFUA 1Q0XL 4ONHA 1HSBA 4KJPC 4RMTA 2IWGA 1BIIB 4O51A 3FO9B 3V5DB 3ZHLA 1WBZA 4WW1A 4AEIL 5T1DL 4PTUA 2BVYA 2DJSA 3ARBB 1PEWA 4POUB 2C1OA 4KZEL 1WAAA 3OJDB 5BOPA 4HBQA 4LLDB 1NANI 1O5DT 4MMZC 3UO1L 1QVOA 1NBYA 3OB0K 5KSAD 5C08A 3TFKC 4WUKH 3RIFF 2Z91B 4HLJA 5DEGB 3ESVF 3TJHC 1DBKL 3J7HA 2C1PA 2DN7A 5C0JA 4PJFE 2P24A 3CXHK 25C8L 3NGBC 5IVNA 3U30C 3H3PL 1A1MA 4LLVA 1A1OA 4ODUA 3MRDA 1OM3H 4XTRD 4G8GA 5C9JB 5L88H 2FR4A 3MR9A 4PRID 5D6DC 1FLTX 2YPLE 5FCSH 1WV7T 3IDNB 1B90A 4YDLC 1A6WL 1RFDH 4MA8H 3UAJC 4IRSC 3WYRA 1FCCA 1HILB 3OXSB 2AV7A 1NDMA 1C1EL 4NKIL 2YRPA 1YN6A 5I17B 5K9QG 1WK0A 2BVQB 3G5YB 1BQUA 1ZA3A 1RUAH 1KPVA 4HWNA 1KPUA 2HYMA 1JNHA 4HXAH 4BFIA 1WWCA 3GBMH 15C8H 3BRGC 1K4CA 1X5JA 2BVUA 2IADA 4XWGL 3S35X 3NPSC 3GMOB 1BECA 3OKKA 4OUUB 4JN1L 3H9SE 1IC4H 2X6MA 3PL6D 3TBVB 1S9XA 4LAQL 2OP4H 3W2DL 1V7NH 1SEBA 1NCBL 4HFWA 3OAYH 1R5WA 1RHHA 5DEFA 5KS9F 1EVTC 2WBJA 3HNSL 3ESUF 3L5HA 3TO4B 1JGUH 4TRPL 5IM7A 3WXVL 3GUTB 1EA9C 4NNYB 3GMMB 2YUXA 4P46A 3F7YA 4FTVD 2ID5A 3X17A 2NR6D 1P4IL 3RDTC 5IMKB 1KSRA 4WNQA 1D9KA 4DKDC 5K9QI 3O6KL 5E5MA 3DUHA 4MJ5B 2OTUA 4FRWA 4NKMB 3QRGH 1BZQK 4OF5A 4OF7A 2MQCA 3D2UA 4KKBD 1IEAA 1R24A 4O2EB 3VU2A 3OTTA 4POZC 2P4AB 4PJDA 5CFHA 4MNQE 4U1JB 1HZHH 1YYLH 4ETQB 4E41D 1NGQH 5GZNC 1VKXB 4PJFB 1AIFA 4NJ9H 2IH3B 4NUJA 4TSCH 1HHJA 3OGCB 4HS3B 5CJ8A 4XMKH 3BSZH 2DS4A 2JK5B 5HD8C 2JCCE 3UDWA 5I1JL 2LAGB 2UY7A 1INEL 2XG4A 4M6AA 2GY5A 2OJZH 3MTRA 5C92A 1KJVB 5GHWL 3S37H 1JRHH 4MVBC 2YPLB 3U0WH 3MV9B 4GAGH 1DBBH 2MQ0A 4RGMC 5SWZB 2X9WA 1JHLH 3V95A 4I3SH 5DRXB 1MCRA 4PJEA 5GGVH 1C5CH 3EYOA 3TIDA 1G7MA 3KPPA 3BKCH 4FQLH 3D39E 2HJLA 1J1XH 2JTDA 3KPQB 2OSLA 3MODH 2GITA 4TULH 1EO5A 1SY6L 1A7NL 4LOUD 4CN6A 1LO5B 2CDEB 3IDIB 5CP7A 3DV6B 3V5HA 1YQVL 3BRFA 4PRPE 3OKNA 1QKZL 3FT2B 3BKYH 3KPLA 2GSGB 3GI8H 5ACZA 3RHWF 3DBXB 5TFSL 1BAFL 3U9PL 1IAIM 2F8VA 2ADIB 2I60H 4QOKA 1YPZE 3MNWB 4CMHB 4X7EC 4P2OD 4XCCL 3EDFA 4X9IA 2OJEB 3H9SB 1KN4L 3TZVB 2Q7YB 1ETZA 4BFEA 4EEEA 1I7RB 5JMRA 4ZPTB 1QG3A 3LPFA 1FYTD 5BZWB 3S4SB 4P2CG 2MPAH 3FB6B 4FQ1L 4K2UH 3BPOC 5I9QC 5C70A 4JRYA 5EO1B 2BJMH 2NNAB 1QFUH 4GXVL 1LP9E 1IC7H 4HKZB 1U8JA 3T2PA 2P45B 3ULSA 3CH1A 4NP4H 5C2UB 3MLYL 3MUJA 4E5XB 1IGFH 1MJ7H 2WLYA 1LEGA 1UM4H 5FFLA 4PRBB 4OJFH 1VPOL 2QQKH 1H5BA 4ZPVA 5I76A 2QLVB 4DKEL 4OZIF 1LO4H 1ORQB 2GK0A 4MNQB 1G7LA 3IJHB 3TIEA 1KCVL 3VFWB 3RWIB 1YEGH 1EX0A 1S5IL 5JQ6L 2WWKT 5E6IB 1NAMB 4U6YB 4JG1H 5CJ5A 3EZJB 3SQOH 2NQCA 3PF2A 3T0EA 5HHNB 4M8VA 2ED8A 1B4JH 1UJTA 1K2DA 2NTFB 1KULA 1BBDH 2FIKA 4NDMA 4TVSa 1JV5A 2I5YH 5FYKU 4KHTL 4F7CB 1J0HA 2CIIB 3B6SA 4N5UA 1SM3L 5GSVB 2PTTA 2J1KA 3GO1L 3IJSA 4YBQD 3RGHA 1SYSB 1A6TA 4XNZB 1VFAB 4RDQF 3IAQA 3PWNA 1DUYA 5HHQA 3VH8B 4FA8A 4ZSOE 4MJIE 4OFYA 1UXWB 2FJFB 1R5VA 4PFEA 3D39B 2VUYA 3MBEA 4MDIA 5TF1L 3RWHB 1JWUA 3ETBF 1FZMA 1YJDL 3I75B 3QFJA 4PV8A 3OKOB 4HJ0C 4I3RH 3RFZC 4PRPB 4UOJA 3S36H 4YFDB 3C6LA 3D0VA 3C5SB 5JW4N 1CGUA 4H1LA 4LASL 3ES6A 4ZUTB 4JZJA 1YPZB 1NMBH 3DX8A 5CSZB 5L0QB 1ZLWH 2AEWA 2Y06L 3VXMD 1CWVA 1A6UH 1PDKA 2P5ED 2V2TA 2RB8A 3FB8B 3IXAA 3QNXB 5F7NC 3BZ4B 1FZOA 1T7ZA 4JPIA 1MQ8A 4B41A 3CLFH 5CEZD 3SBWC 3GKWL 3S97C 4GUPB 3AU1A 5DVLA 1P1ZA 1LP9B 4BKLB 3DX6B 1IEBB 5DHYA 3EFFA 4OM1L 4JY6B 4OUOA 3R0NA 4UTBL 2V5SA 2WMPA 5TE4H 1BFSA 1SY6A 4HLZG 2GHWB 3FQTA 3HNTH 5DHXB 5DJ2A 3OZ9H 1M1SA 2DM4A 4Z76A 2NY6B 3W81A 3U36A 3RA7L 3QRFM 1JF5A 3K2MC 4ZNEA 1JMXA 5K9KB 1IGYA 4OCLC 1M7IB 2VLKB 4HUVB 3GM8A 4H0HB 3MMEA 4OF3A 4RMUA 3S34H 1NBVH 4Z6AT 3O9WB 3B9KD 1I1YA 3ILQD 4I0PD 1ADQL 1C5BL 5KZCB 5SWSE 4HK3J 1Q9WA 1W8OA 3QG7H 3QIWD 5KTEH 1ZSDA 1XGQB 4JDZA 5F70A 2FB4L 1B6UA 4JREC 2R4RH 2EYRB 4M6NL 3SCMC 4ODVH 1YN7B 3QDJB 5KG9A 4LLUB 4NRYB 5IG7B 3UZQA 1OB1A 4PY8J 2VQ1B 2VXVL 4P3CL 4ZSOB 5DMYA 5DK3A 4MJIB 2V2XA 1GHFH 2B1HH 4FG6D 4KKAD 1RK0B 5IV2A 4UILH 1CT8A 3CSYA 3WLBA 3PWPA 2MHAA 1F5WA 1U8HB 4MB3A 4CW1B 1ZT4A 1AQDA 4KTDH 3PUCA 4M7ZB 4LHUB 3NMEA 3OG6B 1RMFL 1NLDH 2OTWA 4LKCB 1NFKA 3BVNB 4ZTPL 1H9VA 1FC2D 3BP5B 4JPVL 3SGKA 4MAUL 1W72H 1AFVH 3DTXB 3GHBH 4MZ2A 3ZT6A 1ZHNA 4YAQB 4KMLB 5DQDL 3IVKB 1FLRL 2VOTA 2IQAB 4OB5H 1NC4B 2Y9RT 4PRHE 2PR4L 5FOJA 1CU4L 1OSPH 4OGXH 1XCTB 5CBAA 1EGJL 4X6DA 3ARDC 1UG9A 3IKKA 4XVJL 5FYJH 3TA3D 2B7DT 4JN2B 3O4LA 1UWEH 3Q6GL 4MXVE 3BHBA 4MA7L 4K3JL 5I71B 1FFOB 1ORSB 4M7JH 3SDCD 2NY1C 1HYSC 5JNYA 1YY8A 4UAOB 2IGFL 3QH3A 5T33L 3MO1B 1VGKB 4UQ2A 4W81A 3SJVA 1GGYA 3IAPA 3UPRB 4ZTOH 3MLWL 1EHAA 4N1HB 4YGAB 2XN9A 3L3KB 2FECL 3TT1L 3AS3A 2YEZB 4JFPB 2APTA 5D7LE 5EA0L 1CBVH 2X4OA 5DJAA 2HLFC 2X4NB 3RNKB 3SDAB 3EO9H 2MCPH 3QNYA 3NCCB 3OR7B 5F88A 2ENSA 2VISA 4DCQA 3F5WA 1A22B 4XC1H 5SWSB 1T1YB 3ARGB 1HINH 3HE7B 4EQ3A 3FONA 3FAXA 4GAJL 1FIEA 4OF8A 3X12B 4JZOB 4UT7L 3GMPB 1MFAH 3UTTE 1IFHL 5D5MA 2E6JA 2ZWLT 4OZFA 2OK0H 1FFRA 4RX4A 1A6VH 4OZIB 4FXGB 2D31A 5T1KA 2ENYA 4OFVA 2WWMC 4QRUA 1AGCA 3T3ME 3D85B 1RZKH 5HGGS 2VXQH 4NBXB 3X3GL 4JO1H 3GJFH 1JF1B 4NQDD 3UYRL 1N59A 4LNRA 2F8OA 1YJDC 3GIZL 4DK6A 4XBGA 4G9DB 2ZSVB 5CSBA 5F9AC 4P9MH 2CXKA 2VLJD 5EU4B 4Z7OF 4I9WD 2EZ0C 4G6FB 4LSVL 5KJRL 1HWGB 1OLZA 4HWUA 4GW1B 1EO8H 4FFZH 4UUJB 4GKZA 1G7IB 5DURD 5DQJA 5DZLA 2JJVA 1NGWA 3LMJH 3BEVA 1ADQA 2DQHL 2ZUVA 1OP5K 3QUZC 1SHMA 2VLLA 5B38A 5MERB 2CIKA 3FOMA 1AQKH 2X7LB 4JQIL 1W0YT 4OGYH 2EXYD 4AZ8A 4L4TD 4O2FA 1QQDA 2VDPH 4UV7L 5ID0B 4LSTH 1N26A 1YECH 3MLZL 4WJ5B 3QR2A 3TPUA 2ADJB 5CP3A 5T5NF 3GSNB 3KPRD 3EJYC 4ZOEA 4NM8H 1MIEH 2AEPL 3DJ9A 1FL5A 1JTOA 4W6YB 2G9HA 1YMMD 4QRRB 1E28A 4R3SB 4U1NB 3V5KA 3GSQA 4U1HB 1CFQA 1T0NB 4WI9A 2V17L 5C0FA 1EFXA 1FO0B 5JW3H 2CLRA 3G6DH 1IM3A 4QRPA 4NQXA 3ZHKA 4KJQD 3U0PB 1NKOA 3MRCB 5DJ6A 3KYAA 3G6AA 4WW2A 5D1QD 3OSKA 5H37H 4JM2C 2VTFA 3N1FC 2FYYA 2NY0C 4APQA 4YHYC 4Q2ZB 2CDFA 3LKPA 3FB7A 3P9LA 3CFIC 2Q8BL 3MGAA 1OW0C 4Z9KB 1I3RA 3O6FA 4BZ1L 2IPUK 1ZWIA 2KL6A 2MWCA 4R7NB 1T7WA 4R4BA 4S1RL 1B9ZA 1TZHB 3GK8H 5ILTH 1XAUA 3VWKA 1FPTL 4ODSL 4X6EA 4LLMB 4ALAL 1EGJA 2W0FB 1ZTXH 2A9NL 4O2CB 3NCBB 4K23H 2QADB 3UTTB 3HI5L 5LG1A 5TQ2H 5JDSA 4XWOD 4G42B 4RFNC 2Y7QA 4Y5VC 3AXLA 4WFHD 2Y6SC 1R3LB 4ZD3L 4GW4A 3REWA 2ZZUT 3LEVH 3P0YL 4LRNL 1C12A 4TNWF 2WAHA 2QHRL 4LSUH 2QBWA 1MAML 3C9NB 2VNCA 5C09B 1CK0H 4M1GL 1TJIH 3GI9L 1KLUA 1M7DB 4TTDC 4NM4H 2AK4B 4NHUA 5CD5C 4MCZA 2PYED 3C2SA 2E8ZA 4HT1L 3BX7C 3SPVA 3ZKXB 4M4RA 2OBGA 5J6HA 4JO2L 1RUPL 4GRMB 3EHBC 3STZA 4MD4B 3GGWA 3WJLC 1V3JA 1EO7A 2APWA 1LO0L 3LS5L 3RTQB 4U3CA 3WE6B 4GRLA 3OKLB 4WENB 1H15B 5E56A 5F9WB 4AH2B 1N0XL 5HYJA 4HJGA 1INDL 4MNGE 3UJJH 2ARJA 1HQRB 3CVHL 1HHHB 4OD3H 3DYMA 4P5KA 1N6UA 5D71H 2XWBA 2GFBB 3QNZA 3R0MA 4P23A 1U3HA 3TVMD 5HDOA 1MLBB 3DYOA 4O4YH 1GSMA 2H9GA 1BJ1H 1J5OL 4P5MA 4QHMA 5DK2A 3TP4A 4EI5C 2VL4A 1I1AB 5IVZA 1UM6L 4E9LA 1YC8A 3U2SB 3C5ZB 1ZA6A 2V7NB 3O8XD 4Y16D 4EN3D 4Z77A 5D8JL 3L7EB 3M17A 2AABH 4N68A 1E4JA 1JHTA 3HCVA 5CBEA 3GJEB 3PL6B 4G8FB 4HD9A 3OPZH 4XMPL 5JW5B 3KYNA 2VXSH 4Z78B 5IROA 4MQTB 4QRQA 5DUMH 1YDPA 1QBAA 3VG0L 3OWEA 1NBQA 5E8PB 4XXDB 4YFLI 5ESAA 5GJSL 2MOVA 1E27A 5JXED 3QAZC 1N3NB 3U83A 3A0OA 1N6QL 1FVDA 3WLWC 2ZUYA 3O2DA 1CIUA 5IHBA 4B5EA 2XT1B 3T65A 4XNQB 4OD2A 5LWYL 3T0VA 4CRPA 2MNUA 1YY9C 2PXYA 4J12A 2BOBA 2B5IB 4JQVA 5GS2D 4U33A 4PJIA 5FXCH 3PQYA 3QIBD 1T22A 3BRDA 4NQED 5GGTL 3VI4F 3HG1E 3AFLA 1OTTD 5I15H 3TN0A 2CLZA 5F1IB 2Z0BA 1I7UA 3QCTH 3SDXA 3L3GA 5JIKA 1Q9LA 4NFDA 1C08B 5JUEL 5FF6A 3LQZA 4L5FH 5C07B 3STLA 3O2VL 4PJ7A 1XIWC 2ZPKH 4IMKC 4FQXA 3U4EA 4HSQA 2N7BA 2WANA 4G43B 4YDIH 5FGCE 3T77A 4ERSH 5I2IA 3ARWA 1KEML 3WDHA 3MNVA 1BZ7A 1X5FA 2HFFA 4JY4A 3NCMA 2B2XH 4MNGB 4YQXL 5DD1L 1AKJB 3DIFB 4HPOL 3QEGH 1QBMH 4BH7A 1ZKAA 1AHWB 4M5ZH 5IF0B 1I3GL 4K7PY 2PUQT 3FTGB 3P9WB 3HPLB 1CICA 1RIVL 4UI2A 2DLHA 1CDGA 3WKML 1YQ2A 1WBXA 2B4CH 2DD8H 4DAGH 1DTUA 2F53D 4OFDA 3HC0A 5F1NA 4PTTB 4YBHA 3HE6B 5HHME 5JIIA 4X4XA 1EEYA 1HOCA 4D9LH 3V4UL 5IHLB 4HIJA 4PJ8B 4KK9C 5F1SA 5IFHL 3MLSL 5TE7L 3QZWA 2JIXB 3CX5K 2IAMB 2OS7A 3OAZK 4F9PC 3HHRB 1YUHA 3DARA 1WCQA 4ZUUA 4IIQB 2PTUA 4L8SC 5F7MC 5A1AA 1V3LA 1M05B 4I48B 1UFUA 4LCCB 1RK1B 5GS1A 4XNUH 3CVHA 1DBAL 4LLWA 2NW3A 2RBLA 1ZGLA 3L5XH 3G6JA 3FQXA 1S8DA 3JWOH 1RIHH 3C87A 4TNWK 4Y8DC 5I1CL 5JOPD 3NIDE 3ARED 5C0BE 3IDJA 4G8IB 3T3PE 1ZV5A 4XPTL 1P7QA 1O7SA 2EKJA 2EDOA 3U1SL 4JLRA 2WLZA 3P77B 5EU6D 3SKJH 1QSFE 1U8NA 2X4UB 1RUKL 4I4WB 4XCNA 3WFHB 1YEDA 4HV8A 5DJCB 3V79C 3DHMA 3LD8B 2HTLC 1WT5A 4JKKA 1ZANL 4MB5A 5FA4A 3RU8L 1OAKL 4L8BB 1UJ3A 3EO1B 4Z0XB 3S5LB 4M3KB 4U49A 2P7TA 3P9MA 5MHSE 3DSFL 4ZS7L 2IALB 1F8TL 4KUZH 3QEQA 4WGVB 5FGCB 1S7UB 2Q20A 4JANB 2QQNH 3MFFA 2AJXL 3G5VA 3IF1A 1BBJB 1LEKA 4PJ5A 4PJHA 2D7MA 5INCB 2Z92A 4QHNA 4IRZL 4BYHA 1DQQA 3IKCA 4UT6L 1A3QA 1VFBA 4U6XA 3RUGF 4F15C 1Y6NR 3J8F7 1ZLWK 1FCGA 4J3UA 1J7VR 1HKLL 3GB7A 2BNQD 4QYOA 1CDHA 4GLRH 4C56D 2F74B 1AY1H 1CFTB 4MAYB 5TQ0H 2R23B 4LPTA 4XBEL 2G60H 1I1FA 3FO0H 5F71A 1EDQA 4XC3L 2A1WH 3MRIB 1S7SA 3PWPE 4ZOAA 4N9GB 5IEKA 4TPRH 2AGJL 2IBGA 5HHMB 4HFUL 2XQYG 4WUUD 5LKNA 2NXZD 2V5RA 1NSNL 3ZDZE 3W5NA 1WC7A 1T1XA 4FQQA 4JVPA 4XXCA 3SE3C 3QCUL 3ZHDA 2ZSWB 1MFBH 4XCFL 4L4VD 1AGBA 3DUUB 2VC2H 4IOFD 3MJ6A 4AYFA 4Y4KC 5IHUH 2WIIA 3QI9A 3DI2B 3CAFA 4X98A 3NTCL 1AXSA 1JGVL 3MUGB 5BV7H 5JLZA 2DQEL 1CL7H 1XF3A 4M1DH 1D5BB 1DQLH 1KENH 2ATKA 1JUFA 3ABZA 3TYGL 4S2SB 5TDPA 3B83A 1I8MA 2BRRH 2HVKB 5FYJE 3VFRA 3QXDB 3QO0B 4X5WB 5CCKH 4KC3B 3C60C 4QT5A 3IFNL 2NY2B 1DQMH 1DEEA 1AD9A 1DL7H 4RA0C 3HI6L 1G6RH 3MRFB 5DS8B 2BNRE 2K7QA 3JZ7A 5CS7A 3S96A 3IU4H 1TVBA 3PXHA 1HH9A 2OTPA 5FECA 4Y89A 4FMFA 2DQDL 3ALWA 2VB5A 1ZLUH 5AYUH 5EBWA 2H32H 4KV5F 5FDYA 5C0EA 1L7TL 3EDJA 1UB5B 2R39A 3HN3A 4PRHD 3NZ8B 1U41A 5DUPH 2E5EA 4HZLB 1F3DH 4OTXL 4P4KC 4AMKH 3MRHB 3EYSH 3P0VH 3VCLA 3PWJB 3LKQA 1J1OL 5F7FA 2C9AA 2DQGH 2R2HB 4NWTH 4NKOA 3WHE1 4PREB 5DT1H 1TTGA 2GTZB 3FHAA 1AGFA 2FL5B 3X11B 3HMWH 4AL8L 3BW9A 4Z7NE 4B53A 3AM8C 2A74B 4GKSB 4K94L 3PWUB 1IGML 1MPAL 1MJJA 4X7SH 2NTSP 1FH5H 3BEWB 1A1NA 2MQ3A 4LEOB 4P2QE 3V6BR 1WFTA 3DX9A 4JG0H 3U9UA 5IKCA 1I9JL 4NKQB 1S7QB 3CGTA 5F1OB 5FYLH 4AQ1B 1Y18A 5E2VH 5BW7C 1WSST 5D7LD 1A5FL 1NDGA 1KIRA 1HCFX 3NCEB 5DI8A 2A6KA 3HUJE 2Y1VA 2R0WL 1UCTA 2X9YA 3KAAA 4JEGB 3B43A 4G5ZH 5FHAH 4OKDA 5CJXC 4TSAH 4POYA 3ZYOA 1EHLL 2BXYA 2ZJSH 4P3WA 1F45A 4R90H 2JF1A 5IBLC 3TBTA 1T0MA 4O02H 4UDTA 1CD1B 3TYFA 3PDOB 4P4RA 3VRIA 2OR9H 5CGYC 1UCBH 3TCLA 3W0WB 4HS6B 1TXKA 5C08D 4RMQA 3L1OL 4PG9B 2EH7L 5E2UL 4X6CF 4TSBL 2YSSB 1KIPB 3WFBL 4K8RD 2ZUUA 5HDLA 4CNIA 4RGND 1AO7E 3CZFB 2IPTH 2OZ4L 2FWOB 3HI1B 2BCKA 2F15A 2PW2A 2Z31C 2BNRB 5I1LA 1QR1B 2O5ZL 4OAWB 4HPYL 1BD2E 4DN3H 5J12B 4N0YL 2WBKA 4JB9L 1X5IA 2I9TB 3GJFK 5DRZA 2BSRA 4G7YL 5I18L 4YNYA 4OZFG 4G8GD 4HIHB 3RX5A 3B9VA 5JDJA 4DZBB 3FO1B 3LDBB 3MV8E 1NGPH 3MBXH 3FQRB 3GSWB 1JZ4A 4LEXL 4MCYA 1MWAH 1TZIA 1D6EB 1C5DA 1NCNA 3FFCA 2FEEL 5HBBA 4ELKA 5EU7E 4XCEA 4P5TC 1KNOB 3OKEB 4UMGA 3MV7A 4NQDB 4Y19E 2FD6H 1CFBA 3LQAL 4I3GA 2VLJB 4GG6F 1TNMA 4P2QB 2NY4B 5B38G 3BZFA 2H8PA 2PW1A 2ZCKL 5CKGA 4KV5E 1AE6L 3GJFB 1CE1L 3DV4A 3V6FB 5GJTL 2AXJA 4FZ8H 1VFMA 1V7ML 3HC4H 5JXAH 4PD4J 2VO5A 5BRZE 4XHJC 5T3ZH 3DRQA 1RZ8A 1XGRB 2APXA 4HUXA 3RUGB 4KHXL 2AXGB 2EDYA 2OLDA 4XP5L 5IFAH 4L4TB 2WBJD 4K55A 4ONGH 4GQ9L 4X7TA 1RUML 3TO4C 3DXAE 4PS4L 1IL1B 2OI9B 1MOEA 1ODAA 4P46D 1QPXA 3QIUD 4RMRA 5CJOL 2X70A 1MY7A 4X4ZA 5EBMA 4YEFA 3HB3C 2BSSB 2ICWB 1IAKB 2VH5L 1D9KD 4Y5XA 4V1DE 4KZDL 1F42A 3PGDA 3L3JB 1NEZB 2E7MA 3D2UD 1OAUL 4J1UA 4D9RE 5J1AA 5HXMA 5FV2A 4N1EA 4NYLA 1AO7B 4R96B 5EWIH 4RWYL 3LVEA 4WTZA 1IVLA 3BIKB 5D7JB 2W1NA 1T20A 4U1GB 1BD2B 4JKPL 3WDJA 1J8HA 4IS6A 5EZLA 2KPNA 4R4ND 1IGTA 1U8KB 5LBSH 4MHHG 1XF2A 1AGDB 1IT9L 3ELAT 5AG8A 2W38A 3KJ4B 2HLAA 4AEIH 1ZK9A 5T1DH 1YNTB 3N50A 5CMAB 3MV8B 5FO8A 3LQMA 3RWGA 5IGXL 4KZEH 5IW6A 5IWLC 2F5AL 3A67L 2BVPB 5DR5L 4QRTA 5GQBA 1KCRL 3ARFC 4JFEB 1S7XA 5E03A 3IJYB 4X6CE 2UWEA 4QTHB 2A6JA 1XF4A 5I8CB 1DBKH 4GRWF 1REIA 2Q3AA 3VGHA 3DVNA 4K94C 1F4YL 4KROB 4Y19B 4X5XB 25C8H 1NCDL 2FJGB 3E6FB 3UC0L 3MZGB 2F5BH 5CHNA 3OV6A 4IEFB 2VDQL 4OV5B 1MI5B 2UZYB 3ZLQC 4LSPL 5DLML 4AEFA 8FABA 1NBZA 4QOKD 1SBSL 3KLHD 3VXSE 2D7TH 3KLSA 2A6IA 3HPJB 2HA1A 1A6WH 4MHHI 3JV6B 4CMHC 5DD5L 1PKOA 5DJXB 1FNGA 2ARJQ 2EYSB 3FKUS 4PRNB 4HG4J 1IKFH 3UBXA 5C0DA 4PGDB 3RVUD 1C1EH 4F33A 3WDIA 3JV0A 5L8LB 4NKIH 4JRYD 3FB5B 4ZS6D 1ZXQA 4IDJL 1P4BL 1I1RA 3LRGA 4PP1C 5JA9A 4OCSL 2CKNA 5B21A 4RCAA 4V1DB 5D1XA 4UBDD 3ARTA 1HK6A 1BJ1J 1A7OL 2G75A 4KI5C 4EKXA 4XWGH 1NGXA 2JB6A 4YDVB 3CFEA 4JN1H 5KBNC 1U58B 1R3IL 3SGJA 5FEBA 2C7UB 3W2DH 1KTDB 3ZDYE 3LH2L 1G7JB 3HG1D 1HXYB 3WHXA 3HNSH 3T4YB 5DO2C 4AIOA 2BY0A 3O8XB 4TRPH 4EN3B 2HFEA 3WXVH 5EZJB 3KPMA 2X9XA 3MREA 5GPRA 4N0FA 4ZFOB 3DUSA 3T0ED 5IMMA 1P4IH 1PQZA 4OZGE 2G2RB 4NQTA 4GXUN 4HKXA 3CUPB 2AI0H 1L0QA 1FV1A 3O6KH 2VQTA 5GGUA 5K59F 4XP1L 4W4OC 5AYQA 3CLEH 3RVTD 1UB6A 3ALPA 3BJ91 4X6CB 1BX2B 1KG0A 4XNZC 4OZHE 4XGZA 5DJYA 3RI5K 1U8QB 4H25A 3PJSB 4OFYD 4IRJB 4OGAD 1T1WB 4WEBL 3MBED 4OCXL 1PKQE 3QWOA 4AENB 3LQAC 1TVDA 4MX7B 4ELME 2Z93B 2R1YB 3EYQD 5I1JH 3QFJD 1INEH 4RIRA 4EDXA 3RGVC 3C6LD 3LN5B 1KXQE 4NOBA 4IHOA 1BFTA 4NQEB 5GHWH 4KRPB 1R3JA 4NSKA 1PBYA 5BZDA 4Q7DA 3Q6FA 3HR5B 3MRRA 5I8OH 5HGHB 2HRPL 3MROA 5DC9B 5GRVK 1WTLA 1H3GA 1A4JA 1V05A 1A7RL 2R1WA 1URLA 2VZTA 1OT1A 3VXOB 5A2IH 5DTFB 3HZMB 4PJ9A 5LGJB 4M6OL 1YQVH 2YD1A 3EYFA 3KYMB 5IVXA 35C8L 3GSNL 2NLJA 1LDPL 1UQSA 4YZFF 1F3JA 5E08L 5TFSH 1QUNA 4XT1C 1BAFH 3U9PH 2IPKB 5C0BD 3T4AA 4EVNA 4C4KT 4JR9L 4XCCH 5BJTA 1WFUA 5E8OA 2W0PA 2NY6C 4KK8C 1CZ8L 4PJCE 2G5BB 5F89B 5D2NB 1FO0L 3QZWG 1AGEA 1KPRB 3DROB 4JRXE 1A9BA 5IR1B 3BWAA 1WAAF 5EG6C 4FQ1H 1R5IA 3BP7A 3WNPA 3NFNA 3V0VA 5MHSD 2BVOB 4F3FB 3KHOA 3O9WC 3I6LD 5C0ND 4OCRH 4OZGB 5J1TC 1P9MC 43CAA 5I1HL 3MLYH 1QO3A 1ZHBA 4U1IB 4Z7QF 3BE1L 1T5XA 2GSIB 1JFQL 4I0CC 5IQ9A 3N1QC 1VPOH 4HDIB 4NBZB 2HMID 1CQYA 4DKEH 4HULB 4ZXBA 4OZHB 4RFOL 5I1KL 4WI6A 3VD4A 1KCVH 3HC3L 1PKQB 2RCSH 1OGAE 5JQ6H 2YD7A 3GRWL 1HQ4A 4ELMB 1LE9B 1DE4A 1VERA 3RX8A 4OT1L 4M7LL 2NY3D 1M6OA 2NX5E 3PWPD 1ONQB 4DVRL 4DZ8A 3VFGL 1FNFA 3GNML 2NYYC 2Z9TA 4M7ZC 4WHYH 4UINL 1FFNB 4KHTH 3MCG1 5BS0E 1IAOA 1SM3H 3OL2A 2VDRL 3VD5A 4YFLF 3GO1H 5EN2A 3V0AC 5C0GB 5CSGA 1A6PA 1UZ6F 1QRKA 1IEHA 2AJYL 4Y5YC 1F4WL 3U82B 3UTSE 1RAMA 3HFML 1L9MA 3DSNA 5EO9A 3B9EA 4PLJD 2VSCA 1YJDH 4WHCA 1HHGA 1MIML 4ISVA 3MOBL 3MRQA 4ZYKB 3O4LD 3Q1SH 1BEYL 4TVPD 3RKDD 4L4JA 5I71C 1AR2A 5H2BA 2GT9B 4UAOC 2XKUA 4U3HA 4EDWL 3Q0HA 2Y06H 3RVVC 3EYUL 2F54A 4CU6A 3SJVD 4X4MA 1WZMA 4GMSL 1MCWM 3UTQA 3QUYD 4F9LC 2XN9D 4F57L 3VXUE 4JRXB 2HJFB 1WUNT 3CFKB 4XPBH 1BOGA 3UTZA 1J87A 1U36A 1A7QL 3WNNA 3GKWH 5IUSA 1BWMA 5B4MD 3QO1B 4PJDF 3D6GA 5DMKB 2VDNL 2DMBA 5FYLE 1XR8A 1ZVSB 4WV1A 3OKMA 5B3JE 4OM1H 1KT2B 4R0LC 4WEMB 3M1BB 2V2WB 3MA7A 4YH6A 2VDMH 4O5LL 1A47A 4UTBH 2PCPB 4WFFD 3MLTB 3VFMB 3HE7C 2I9LA 3MRPB 5FA3B 2GTWB 1KB5L 4D2NA 3R1GL 4RX4D 3RA7H 5M95B 3PDDA 2R2BB 1HNGA 5T1KD 4TN9A 3QISA 4D8PB 2XRAL 7CGTA 4J3XA 1ZLUK 3F7VB 3ARRA 1OGAB 4FFVC 4E42B 3I3DA 4KKCC 2Q8AL 2CD0A 1L0XA 2VLRA 3KPSE 5BV7B 4PJEF 2NX5B 3KLAB 5D1ZA 1OQXA 3BQUB 3PP4L 4GFTB 1GZPB 4Q9RL 2FB4H 2XWTB 2DTSA 2NXYB 4FNLL 3FQUB 3VXRA 5LXGL 3B8YA 1QFWL 3O45A 1NGYB 3NCJL 5I66A 4MYWB 1G6RB 3HLAB 5EO0B 4YIQA 1TTFA 4JFFE 2VXVH 4P3CH 4YHPB 4M1CD 2VITB 5HYQB 3UTSB 2HVJB 4WEUD 4PJBA 5HGAB 4U1KB 3I3EA 3UJTL 1F2XK 3SDDC 4Y5VA 2H32B 2HWZL 1T21A 4HAGA 5ENWA 3BZEA 4CMMB 1PYWA 1RMFH 4TTGA 3K4ZA 4WRLA 3KLDA 4XNYL 2RGSA 4RZCA 4NQCA 4HUWA 3QUXA 4M9PA 4ZTPH 4P9HL 1ZVYA 4QXTA 4JPVH 2BERA 3U46A 4MAUH 4NQVA 1EFXD 4U2ZA 1FGNL 4QRPD 2H2PC 4J7RA 4NZTL 2GCYB 1FBIL 4R2GD 1W2KT 3AMKA 3QJHB 5DQDH 3KPNB 1WGOA 4PJAA 2BX5A 3VFSB 2YD4A 1FLRH 1GIGL 3EOAB 4L8DA 4WTWA 3NGBB 1GOFA 5ADOH 4HEME 1CU4H 2EH8L 4NQUA 3QEUA 2GY7B 3O6FD 3FT4A 5EB9A 3TNMA 3JV4A 1LE5B 3Q6GH 4FQHB 4B7IA 4MA7H 1R3KA 4PRIA 4HCRL 4NGHL 5T3ZE 2IGFH 1BM3L 4YDLB 3VWKD 3FO2B 5T33H 5E9DB 1HSBB 3WO4C 4RQQA 3DRTB 3S9DB 1B0GB 3K1KC 3LCYA 2QADC 2EIZA 2FCBA 3MLWH 1YEHL 3D9AH 1J0JA 4YR6A 3UMTA 1K9TA 2P5WA 2C1OB 2EDNA 1F97A 3TO2B 2B39A 3T8XB 5EA0H 5JZ7C 1NBYB 5AEAA 3RRQA 3KPSB 3RIAF 5KSAC 2CR3A 1MCLA 4OLWL 3OG4B 4RGNB 4HQQL 3DVGB 1L9NA 1ZT7A 2C1PB 3EO0A 3DLQR 2P24B 2A77L 4GAJH 5BRZD 5C7XH 4ZUSB 4JFDA 4HIIA 2UUDK 5FM5O 3NPSB 2FBJL 1WCBA 4WFGD 2FO4B 4Z7VE 1FC1A 3ZE0F 2XWJA 3DWTA 5DC4B 3CSBA 4XTRC 3HMXL 3MR9B 5D70L 3B3IB 1A6ZA 3DXAD 3X3GH 1CQKA 3G5XB 3RTQC 3UYRH 5ERWA 3GIZH 1KB5A 1TQCC 1JZ5A 5HYJD 3D69B 4WVRA 4LSVH 5KJRH 4HMCA 4I5BA 3MA9L 1CE6A 1SJHA 1YN6B 4JPWL 1U3HD 2Q87A 3PGCA 5CLWA 4LAJH 4K3EL 4D9RD 4DK3A 5F7YC 1ZA3B 3W11D 2DQHH 3BDXA 1KPVB 3NABL 1JNHB 3VA2C 3BPLC 4BFIB 2ITCB 1YNKL 1MVFA 4JQIH 3VFPA 5J8OA 1MRDL 1I1AC 2FX9L 4K3DL 4A6YA 3KXFA 3C5ZC 2IADB 3FOLA 3EJZD 2DKSA 4JDVB 1D5XB 1I85A 3MCLL 4HXBH 4M7LT 3TBSB 5IBTL 4MJ6B 3PL6C 4XP6L 1FG2B 5CJQL 1CF8L 1X6NA 5FO9A 4Y88A 1IGIL 1OSZA 4RGMB 2D9CA 4XPAL 3QB7C 4OQTL 4DKFL 3QHZL 4Z7UF 1SVCP 1BFOB 2I24N 5GRYA 2V17H 4QF1A 5CEZL 3G5ZB 5FGBA 2KQMA 4WNQB 1D9KB 4OZ4A 5SX4H 2VIRB 5EFIA 4I77L 5F3HA 2DICA 4M6ML 5DJ0A 4WTZG 4XX1G 3JWDL 4M43L 4P57A 5MI0C 4WHTA 2PXYD 1SEQL 4KKBC 5DQ9B 2Q6WA 2R15A 4M8QA 2Q8BH 3T0XA 4BZ1H 4HWBA 3QDME 1S3KH 2AV1A 5E00B 2WP3T 3PQYD 4JJ5B 1E6OH 4Q6YA 1AIFB 2P8LA 3L3OA 4I2XA 3MLRL 3ZMRA 1LD9B 1SJEB 3INUL 3TN0D 3QDAA 1FPTH 1MNUL 4ODSH 4Z7VB 4P2OA 4PY7A 3OF6A 4ALAH 2A9NH 3MV11 2XZAH 2BP3A 4YHIB 4GBXA 5JO5A 5CD3B 4Y2DA 4ODWA 1QSEA 5SWQB 1BVKA 1IKNC 4FQXD 3SKNA 4M61B 5D7IE 1AH1A 2O5XH 3QFDB 4ZD3H 3P11L 3BPOB 3MLUL 1U2HA 3P0YH 4LRNH 5HHOE 2QHRH 3UEZA 1MAMH 2YA0A 1G7MB 3KPPB 4M1GH 4D0DB 3GI9H 4A2LA 4NZRL 1FIGL 1A8JH 2OSLB 4P9HC 4HT1H 1J18A 4FFWD 1AHWC 4QRSB 4JO2H 1S7TB 2ZP0T 4XH2B 4N0UE 5CP7B 1CICD 1I8IB 3V5HB 4X6DF 3CJJA 1K5NB 1OCWH 3DECA 3KPLB 3FQWB 3UBXG 5IB2B 1LO0H 3H0TA 1A3LL 2YR3A 3HZVB 2HKHL 4PIRF 4OKVB 1IAIL 1N0XH 4XVSL 5FK9B 1HHIB 4WFEE 1INDH 4PJ8C 2F9BT 1DBJL 4KAQH 4JFHE 2SEBA 3WIHH 3SO3B 1B6DA 4HWZA 2DQIL 3Q3GA 3WIFB 3VXTA 1CFNA 2IAMC 4EOWL 1RHFA 4IIQC 4U1LB 2EEBA 4HS8L 3EOBB 3RWFA 1U8JB 4LCCC 5F6HI 4L3AA 1J5OH 1FJ1A 4CVUA 3FHQA 4L29A 1UM6H 4I18C 4ZAKA 1T4KB 1GPOL 1ZMYA 1A9EB 5EOCJ 3ZT5A 3CMGA 4KKLD 1LEGB 3BO8A 1XEDA 5D8JH 3MRGA 1EJOL 1UYWL 5D5MF 1KBGL 4QY8B 2OL3L 1P7QD 5I76B 5SX5H 1G7LB 4DOHB 1Y0LA 4XMPH 2XTJE 2AK1L 3TIEB 2I27N 3V9FA 5JHDA 3FMGL 2IH1A 1UH3A 4H5SB 2YKLL 3AY4C 3H8NA 2LFGA 3VG0H 1UGNA 4LPWA 3ZL4H 5MEQA 1QEWB 5CZVL 4QLRA 1K2DB 2WQRA 5EUOA 1VACA 1P7KB 3VA6A 1N6QH 4F37F 3O3EA 1JZ6A 4NDMB 3C5JA 1IC5H 3B6SB 3V0WH 2LU7A 2PTTB 3IJSB 5E2WL 5LWYH 2PO6A 4PJ5D 1J05A 4YBQC 4K7PL 1A6TB 1GOGA 4HC1L 3RZCA 5CKAA 1X3DA 1LEIA 2XKNB 1DCLA 2EO9A 2VR4A 4MDIB 5E7BA 4RAVB 5GGTH 1MVUB 1F00I 4KRLB 3W9EA 4MWFA 3RP1A 3ULUD 4MAYC 2DTML 1WEJL 4KGLA 2A0LD 4PV8B 1X4ZA 3IDXL 4WGWB 5JUEH 4TUKL 3C6LB 3D0VB 3G08B 3EDEA 5IJVA 1MHEB 3ES6B 1KEMH 4WDIB 5ITBL 4Z5RA 2CK0L 1U9KA 2FX7L 3IDUA 3ZDXE 3B9KA 1FVCB 4UT9L 2HFTA 4I0PA 4YQXH 5DD1H 4PJXE 2J2ZA 1H8SA 1S9WA 1Q8MA 4KVCH 4WW2F 4F80A 1JYVA 1FZOB 3SKOA 4JPIB 5I75C 2D7PA 4JREB 1NCUA 5FYKD 1T2QL 4DGYL 3AU1B 1OGTA 1RIUL 2H41A 1F90H 3QI9D 3QQ9D 1RIVH 4EJ1C 4P99A 3LV3A 5IB4A 1UA6L 3WKMH 5DHYB 1TENA 5TPWL 3EZ8A 1XGTA 1AXIB 5AUMB 1BOYA 2AJSL 2JELL 2M26A 2W92A 3JWDC 2F19L 1T3FA 2VDOH 3QPQD 3V4UH 4WU5B 3O3UN 1EBPA 2Z4QA 4Z76B 1YEFL 1C16A 3ZE2F 3U36B 3V8CA 1EEZB 3QDGA 5IFHH 3MLSH 5TE7H 2XTJB 5AAWA 1FNEA 1BLNB 1MH5B 3BN9D 5BS0D 3MRJA 3RL1B 2ORBL 4OD1L 1K8DA 5IOPA 3H7BB 1EPFA 2UVFA 4Z7UB 4L9LA 1GJIA 1I1YB 4QHLB 1N5AB 3LPWA 4Q0XL 2VZUA 3ILQC 1KEGL 3FFDB 3PNWA 5EIIA 4UV4L 1Q9KA 4UOW0 5DHVA 2ZNXA 4S0SD 1UZ8B 2XV6B 4N0CD 4WIQA 3K8LA 3AROA 2FSEB 5I1CH 1WJ3A 3QIWC 5K33A 1H3PL 1BIIA 1JYXA 4OLVL 4XPTH 5KG9B 3ARDB 1OB1B 4U1MB 3TA3A 1GYAA 3SGEI 2XA3A 3U1SH 1NFDE 3ARBA 2VWEC 4NN7C 1ITBB 2NY1B 3ARZA 3N06B 3OJDA 4EZMA 1G9ML 1ZANH 4FG6C 5IV2B 2OL3A 4KKAC 2Q76B 2EE6A 3RU8H 1OAKH 1S9YB 2Z91A 3FZUD 2MHAB 4AM0B 5DEGA 4WU7A 1ZT4B 1F6FB 3VXUD 1X5LA 4RAUB 4ZS7H 2HFGL 3S35L 2XG5A 1ACYL 2DL9A 4PGBA 2EDHA 2AJXH 4YE4L 4J3VA 5ISZE 1JGLL 4N90D 4HZAA 4IRZH 4UT6H 4EBQL 2YN3A 4Y4HA 3I50H 1FGVL 1HKLH 3L95A 2DOCA 3IDNA 3UAJD 3T2QA 3OB0H 1VGEL 5HI5D 4XBEH 1HILA 3OXSA 1BZ9B 1FORL 3BT2L 4A2MA 5CBAB 4XC3H 3GSRB 4X6DB 3N1PC 1MCKA 1S7VB 4KRNA 2C3WA 5I17A 2YPKB 5IESL 2ARWA 2BVQA 1YY8B 4MS8C 5JNYB 2AGJH 2V9TA 3SDCC 3G5YA 4UQ2B 4HFUH 4IOIB 3RAJL 2B1AL 3D25B 1IGJB 5DD3H 1F2QA 3FN0L 3QCUH 2KBGA 2YUVA 3ZTJH 3WXWL 4LSSH 4F2MA 1WZKA 3IETA 2BC4B 2R1XB 3GMOA 4OUUA 4XVTL 3MLPA 3ROLB 5J89A 3VFOB 5DJAB 1DVFB 3TBVA 3QUZB 5J12C 5JMOC 1KIUA 3BD3A 4JFFD 3NTCH 1WLHA 3BGMA 1JGVH 4M7KL 4PJIF 5F88B 3F5WB 3IAGC 4OCMC 2DQEH 3AB0C 4Q97A 2OM5A 3GUTA 1FN4B 2L7UA 5DD6B 3LDBC 2CKBL 3MJ9A 2C5DC 3RDTD 2BFVL 3SDXF 4OZFB 5IMKA 4ZNCD 2OQJA 4NC0B 3IFNH 4PJ7F 1UT9A 1N2RB 1NFDB 4Q58C 1JNNL 2KKQA 1EAJA 4MJ5A 2E7LC 4K7FB 1CGVA 5D9SA 1KLGB 4LNRB 1DFBL 4ODXB 4POZD 1JE6A 5F9JB 3MACL 2DQDH 1FVEB 4ETQA 4Z7WE 5INDB 4I0KA 1NL0L 2ADFL 1VKXA 4KUCD 2DLTA 1L7TH 4PJFA 2FEDC 4JM2B 5I8KL 3SGDI 5D1QA 3T0BA 3WS6C 2NY0B 2IH3A 1MJUL 4HS3A 1YEIL 4OTXH 3JVGC 1X5KA 1J1OH 4YDJB 1EZVX 1P6FA 4NUGL 1KJVA 3ECBA 2J8OA 3C08L 5HHVL 2CIKB 2YPLA 4AL8H 1T7XA 5I1IL 1TETL 5JA8B 4NZUL 1EEQA 4K94H 5DRXA 1IGMH 1MPAH 2DLEA 3M8OH 2FH6A 1FZJB 4JCMA 4RFNB 4GKNB 1K3ZA 2C4FT 1WIPA 3L5JA 2Y07L 4FQPA 1I9JH 3KPQA 4YUEH 5L8JB 1A5FH 4P2YA 1LO5A 2CDEA 2X1PA 3IDIA 4L9DA 4OBSA 3DV6A 3SN6N 2GQHA 1EFXB 5C0FB 1KJ2L 2CLRB 4NO0D 2R0WH 3FT2A 4QRPB 4GAYB 1YYML 2R8SL 2N1KA 3G6JF 4KJQC 4R2GB 3ULVD 2OR7A 4WW2B 2M1KA 2ADIA 5ICXB 3MNWA 3ZKSD 4APQB 2DKMA 3N0PB 4HWEL 3VGGA 4ZUVA 2OJEA 1A0QL 4U1GC 3FB7B 3H9SA 3TZVA 3P9LB 1J8HD 2H2SD 5GRVL 1I7RA 2AAVA 4ZPTA 4JKLA 4D0CA 1WVZA 5BZWA 1GL4B 1PX4A 4RFEB 4R97C 3V6ZB 3KJ4C 3VI3F 4JE4B 2HN7B 2QKIA 5HPOA 4X6EB 2NNAA 1TNNA 2J6EA 1XMWA 4HKZA 4J6RL 5TE6L 4ZOCA 5E2UH 2EH7H 4QKXB 4TSBH 4G3YL 3FRPA 1JWSB 4XWOC 1CGYA 4E5XA 2MKLC 2VKXA 4C4KO 2OZ4H 1G9MC 5MEOB 4PRBA 4M3JA 3K1DA 4PJHF 1C12B 2EDRA 4LLQA 4N0YH 4JB9H 5J9PA 3LIZL 4G7YH 4MNQA 1WBYA 1UEYA 4EI5B 3VFWA 1SVZA 3TBYB 4U2YA 2ATPB 3GSUB 4QHKI 4NHUB 1BP3B 5E6IA 4MCZB 1NAMA 4U6YA 1YZZA 2D0HA 3ULUF 2IQ9L 3QUMA 5HHNA 2JCCA 1CG9B 3V52L 1W0WA 4LEXH 3STZB 1W0VB 1T2XA 3GGWB 5HI4D 1JNJA 4MD5B 2L0DA 4F7CA 2CIIA 4H88L 2CKBA 5GSVA 4GRLB 5ACLA 1NCTA 4FXKB 3LQAH 2APVA 4ODHL 4DEPB 3EW3B 3QAZB 3TH2T 3SDYL 1BFVL 3ARXA 3G04B 2ZCKH 3D39A 5GGRB 1AE6H 5D1XD 3OAUL 4KY1L 1CE1H 3CFJB 4G80A 5GJTH 3RX7A 1BGXH 3QNZB 1PX3A 4P23B 5L6YH 1OQOA 1V7MH 2X4QB 4OM0L 3I75A 3OKOA 4PRPA 2H9GB 4P5MB 4KHXH 5DK2B 1IRAY 4YHML 3NIFF 5LGKA 3MZTA 1NH6A 1YPZA 3QULB 5CSZA 3O8XC 4Y16C 5DJZA 1NCAL 3ARSA 4EN3C 4X9FA 4XRCB 5CJOH 4YFEA 2ESVE 2KQNA 3ZKMD 1NCWL 3WSQL 3FB8A 3OB8A 3QNXA 1LO3L 2VH5H 1CGXA 4GSDL 2XA8L 1YDPB 5CIPA 4ZQKA 1AD0A 1UWXH 4KZDH 3B9DA 1T89A 5FKAB 3KYOB 4HAFA 5JW4M 1LP9A 2EDQA 3MRNB 1E27B 4GAFB 4BKLA 1IEBA 4LFHG 1FVDB 5JXEC 2YPVL 1I8LC 2R2CA 1QRNE 4RWYH 4YHZL 5HVWA 5MENE 6CGTA 1EUTA 1WWBX 4BSWA 4JKPH 1MCDA 4OLEA 3V7AG 1IT9H 5K9KA 3KPOA 2XQBL 5E1AA 4PJIB 1M7IA 2NCMA 3VGEA 1GOHA 4HUVA 4LARH 2KZ1B 3PIQA 1E4XI 3VI3E 1KFAH 2J3SA 4G9FE 3QIBC 3SHSA 2UYLA 5JHDE 5IBUG 3O3AB 1L6XA 4KRPC 5IGXH 1QBLL 3KGRA 4EQ2A 3O9WA 4QCIA 4RBPH 1OTTC 2F5AH 4RRPA 4WFED 3A67H 5DR5H 4LCIL 2JJWA 1EHNA 1KCRH 3L3GB 4UTAL 4JFHD 4L3EE 1Q9LB 5FF6B 3LQZB 4G7VL 1NEUA 3QA3B 1UH4A 3NCYS 4PJ7B 2HAZA 3WO3B 1QLEL 1KTLB 3O2WH 2DBLL 2KH2B 4L8SB 3CU1A 3MNZB 1F4YH 2EYRA 2X4RB 3TV3L 2J4WL 3RY6A 3MNVB 1BZ7B 1Z0MA 1YN7A 2HFFB 3QDJA 4NRYA 4PJ9D 5IG7A 1HE7A 1NCDH 2VQ1A 3UC0H 4ZSOA 4MJIA 1QLRB 1GC1L 3V6OC 1YMHA 4LSPH 4V2BA 5DLMH 1RK0A 5EU3A 4PG2C 5FYJU 1S9VB 2CDGA 3SGEH 3D5OF 1SBSH 5I73B 2Y36L 1RY7B 1U8HA 2LVEA 4CW1A 5DD5H 3VRLF 3QHFH 4LHUA 4QHUB 1MEXL 4LKCA 3PV7A 4YHLL 2YD9A 4WY7L 3TWCL 4M62L 3BVNA 5D2NC 4GO6B 2VN7A 4PB0L 3BP5A 5E2JA 2X1WL 4X4XB 3CMOL 4G6KL 3P30L 4BQ6A 3NVQA 1F58L 3ARPA 3DTXA 1KCSH 4IDJH 1P4BH 3VWJB 1PG7L 4YAQA 2VXUL 2R4SL 2W9DL 4OCSH 4WI7A 1TJHL 3WS3B 5DA4A 4J8RB 1Z9LA 3RWCB 2Y25A 4ZUUB 1NC4A 1G7HB 3GBLA 1A7OH 5FKPB 1XCTA 4F15B 3VFVA 3CVHB 4G6JL 2YZ1A 4YK4C 1ZGLB 4ZXBD 3NZHL 4YO0A 1S8DB 4L3CB 1FFOA 1ORSA 3LH2H 1CLYL 4QXUL 1QRNB 4JKMA 3CPLB 1KF9B 3MO1A 3MX0A 4CDGC 3IDJB 2QSTA 2XNAB 3AREC 3CFDB 4ORGA 3UPRA 4NZJA 2XI9A 1JPSL 5EOTA 3L3KA 4Q6IC 1MLCB 2BNUA 2YEZA 4U1SB 1U8NB 4JFPA 1CS6A 4K8RL 1YEDB 2V7HB 2Y23A 2X05A 3QPXH 5D2LE 3K81A 5FA4B 5ITFB 1JWMB 4WUKL 2X4NA 5AZEL 3RNKA 1J86A 1RU9H 2CO7B 3SDAA 1X4XA 5I6XC 4L3EB 2ILLA 3OR7A 4KUCF 5SWSA 1JN6B 3CNKA 2QQLH 3ARGA 2VAAB 4NIKB 1NC2B 3QEQB 2A6DB 4WEBH 3X12A 4JAMB 4JZOA 4OCXH 2O5YH 3BI9X 4NNPL 3GMPA 3ZE1F 1LEKB 3PXJA 3K8MA 2Z92B 1RULL 4OLZL 3IKCB 2DIAA 4DGIL 1MCEA 1VFBB 3FL7A 4U6XB 2VDKL 1E4KC 2IANE 5E24E 1DN2A 3IRZA 3D85A 4Q9QL 2HH0L 5DRWA 3WV0A 3R06B 4G9DA 2ZSVA 3ZT7A 4NN6B 4Y1AE 2FJHB 2E3VA 3GMQB 1IGCL 2KUTA 1I1FB 5EU4A 4LSRL 4MA1C 2DM3A 3UCRA 1ZOXA 2F54D 3C60B 5I1AB 3EDDA 5D4QA 2GJZB 4HMEA 2HRPH 4GW1A 5IMLA 4XNMA 2R56L 1IZKA 4UUJA 1A7RH 1G7IA 3LEYL 1B3JA 1LQSR 1ED3B 3PP3H 2YBRB 5HSFA 5IFJB 2NY5L 1XFPA 2E6PA 1CD8A 3UYOD 4AY0A 1OD9A 4PGCB 5H94B 5TF0A 4M6OH 5MERA 3QXAB 2X7LA 3ULVF 35C8H 3GSNH 3TNNB 1XGPA 2WINB 1LDPH 5E08H 5ID0A 3BD5A 4OFIA 2O93L 4WJ5A 4IOFC 3JV5A 4PRHA 2ADJA 4P4KB 3TGXA 3OQ3B 5KSBE 4JR9H 5D93C 5DRNB 2A73B 1JK8B 4X98B 2I26N 1CZ8H 5B8CA 1FO0H 4J4PA 4K7PX 1A14L 4U1NA 3H2WA 4R3SA 4LVNB 3B5TA 3IT8D 3VD3A 2ATKB 4F7MB 4U1HA 1NLBH 1N5YH 1T0NA 1I8MB 3Q5OA 2CH8A 7FABL 3PHQA 3RBSA 2UWEF 3MRCA 3B9AA 5D1ZD 4LHJB 1L4IA 1DEEB 1AD9B 4LL9A 5I1HH 1NFIB 5CJBA 1G1CA 3BUTA 2E27L 3BE1H 4Q2ZA 5D7LA 1TVBB 1JFQH 2O61B 1MHHA 5D72L 3VXRD 2Y5EA 3DMMA 3EGSA 2CGRL 3DURB 4H0GA 4R7NA 3BOVA 5C0EB 1MY5A 5I1KH 5T1LB 1RZGA 3HC3H 1TZHA 3E2HC 4XMKL 1G0YR 1OHQA 1CLOL 4FQ2L 4LLMA 1ZLVH 3GRWH 3N85L 4PJGE 3UTTA 3VCLB 4M7LH 2OJZL 1M7XA 2E9JA 4DVRH 4NKOB 2IANB 1A7BA 3VFGH 3HZKB 2OMNA 3GNMH 1TQBC 4BQCA 3NIGF 3V8OA 3NACL 1IAII 3FAWA 1Y6MR 3D3VE 5FGRA 4I3SL 4NQCD 3QUXD 3VJ6B 2EC8A 2VDRH 3EDKA 4LGPB 4Y1AB 4YHOH 5I1GL 3C9NA 2WP3O 4TTDD 4FQLL 4H20L 5DMJB 1U8LB 2COQA 3QJFA 2Z31B 5IJKA 2DQCL 1Y18B 3VG9C 3HFMH 5KVDL 3WKNA 4UNVA 3K7UA 1KIRB 4U7SA 2CPCA 4QNPF 5DI8B 4MD4A 4UIKL 43C9B 1MIMH 5E94B 3MOBH 3N1MC 4LVOC 4HIEB 3OR6A 3LRSB 4XPGL 4JY5L 3WE6A 3OKLA 1BEYH 1H15A 3MV9E 1IM9D 4AH2A 1J10A 2Z8VC 5SWZE 5KSBB 3VXNB 3EYUH 1QTYT 1K4DB 3CXHJ 5SV4A 4GMSH 1J12A 1HHHA 4P5TB 4JPKL 3F58H 2GFBA 2JKXA 4UDTB 5IK3B 4P4RB 4K2UL 3VRIB 4W6XB 3QCVL 5DUBB 2P5WD 1DSFL 1NUGA 1QFUL 3P4MB 3KS0H 1IC7L 4FQJL 5F9OH 4DN4L 1YEEL 2VDNH 1JL8A 3MGOB 1I1AA 1U8IB 4K8RC 3C5ZA 4RGNC 1IGFL 2PW2B 2V7NA 4NNXA 5BQ7B 1DN0B 4OJFL 2QQKL 4JFDD 1R0AH 5MEPA 4PGZA 5IMOB 4HF5L 3GJEA 4LPCA 4LQFH 4G8FA 5DZNA 3V7MA 1K85A 5JW5A 2EIDA 3R1GH 4Z78A 5DFTA 4BSVA 3MJ8A 5D6CA 2XRAH 4C83B 3LB6D 2HJKA 3IDYC 3SQOL 2C3HA 5E8PA 1Q94A 5EOQL 4PJGB 3WLWD 2IFFL 3QIUA 1TZIB 1C5DB 3FFCB 2VUOA 5JTWA 3TESA 4XCEB 1UACL 1WZ1L 4YPGA 3MV01 4XNQA 1XR9A 3MV7B 4NCC2 1QA9B 3H3BC 4F7PB 3D3VB 1WICA 4Q9RH 4KI5E 1AI1L 4FNLH 5LXGH 1QFWH 2YMXL 3CK0L 1CXLA 4S11A 5IVXF 3S3SA 3NCJH 4TYUA 1XF5B 2H8PB 2PW1B 1Q38A 2VE6B 3DV4B 1UC6A 5F1IA 5TDOB 2NY5C 3BPCA 3KXFD 1EJ6A 3E8UL 4YXLL 4R7DA 5L2JB 1C08A 2Q3ZA 2GEEA 3UJTH 3QYCA 3VMNA 3FT3A 4C54A 1JPST 2EDDA 2X1OA 1EAPB 4XNYH 1NMBL 3EBAA 2H45A 5T3XD 2WBJC 3F62A 3B2UD 4P9HH 3ARFB 4MNGA 5EBMB 2C3XA 1AKJA 4ZODA 1FGNH 5A43C 1D3CA 5ID1B 5DF0A 1HDMB 4Y5XB 2YRZA 5DYOB 1IZJA 1FBIH 1D9KC 1AHWA 5IF0A 4QGYA 3IGAA 4BZ2L 1GIGH 3FTGA 3HPLA 2BY2A 4J1UB 2EH8H 3F12A 4LFHD 2DWDB 1JPTL 2YRLA 4PTTA 3H9HB 1N8ZB 1RJZB 3HE6A 1ZE3C 4X9BA 4XPHL 4HCRH 4NGHH 3OZ9L 4AT6B 4KK9D 2FGWL 1KJMA 5EZLB 5I30L 4ENED 3OF6D 1A2YB 1KACB 1MCIA 3TBWB 1JTTA 4R4NC 3UDWC 2JIXA 5A16B 3QUKB 2IAMA 4GBXD 3FRPG 4JGMA 4Y2DD 1QSED 1EH9A 2ADGB 1U8PB 2X40A 3S34L 1NBVL 3AC0A 1M05A 4I48A 3RQ3A 2MTPA 4BQ9A 2VABA 2H6PA 2DQFB 1RK1A 1UKSA 3U79A 4W6WB 3BUYA 2MCG1 3SKMA 5EUKB 4JZNB 4OLWH 3QG7L 4HQQH 4TUOB 1QNZL 2A77H 4G8IA 3RIFK 3STBA 3KR3L 4FABH 1CGSL 2FRGP 3THML 2X4TB 1RJLB 3VDAA 5CHNB 1GHFL 3OAZH 1R3HA 2X4UA 2HTLD 4GT7A 3WFHA 2E6QA 4I4WA 3HAEH 3HMXH 5DJCA 3BPNB 3HG1A 5F72S 5KS9E 8FABB 2VLKE 4CKVX 4KQ4L 2CMRL 1KIQB 3KLHC 3EO1A 4Z0XA 3S5LA 4KTDL 2VLME 1FNHA 3U6RB 2D0FA 1NLDL 4RNRB 3ZSTA 2R69L 1GVIA 2IG2H 1RZIB 4QXGL 3DO7A 3MA9H 3SO3C 1S7UA 4NKDB 3Q48A 3RVUC 1BBJA 5C0CE 3CU7A 3ILPB 5INCA 4JPWH 4K3EH 2R0LL 4LCWE 4ZS6C 3RNQB 3QDJE 1ZLSL 3KYKL 4N8VA 2Z8WC 4X6FB 1YNKH 3ARQA 4HUUB 1FL6B 2R0ZL 3WIIH 1MRDH 4UBDC 1CFTA 4ZAKD 2FX9H 2R23A 2G75B 4TVPL 2JB6B 1UWXK 3MRIA 4WI8A 3MCLH 5C0IB 5J13B 4N9GA 3RGVB 3DVFA 3L3IB 4H26A 4XP6H 5CJQH 4R9HA 1CF8H 2BY3A 5JHDD 3WHXB 1MQKL 1MJ8H 4M5YL 3D0LB 4LPVA 4XPAH 4OQTH 4DKFH 2W60A 3KPMB 3QHZH 3N9GL 4NJAL 3MREB 5D7KE 4U7MA 5IMMB 2ZSWA 5CEZH 3WJJA 1P53A 4OQ1A 2GAZB 4PYHA 4Y4KD 1FV1B 5HYSA 1UADC 1UKQA 4EUPH 1NMAL 4ODBD 1B2WL 1Z3GL 4ZDHB 4D3CH 1T66D 3JWDH 2PO6D 4M43H 4IM8A 1SEQH 1TCRA 3PWVB 4FFYH 3MUGA 3RVTC 5CILL 4RBPK 3RZCD 1KG0B 4IMLA 4H25B 4EXKA 2WBWB 2BY1A 2B20A 4KDTA 1QYGH 4OGAC 5AD0B 4PJBF 4S2SA 2PKDA 5C0BA 2DQUH 3MLRH 5F8RC 2HVKA 1LDSA 3CDGB 3INUH 4P2RE 3QXDA 3QO0A 3MRKA 4RRPG 4X5WA 3EYQC 4L8CA 4RIRB 3O11B 5C86A 1QSFA 2CUMA 3QXWA 5DS8A 4IHOB 3C6LC 2QSVA 5KS9B 3HRZB 3P11H 2HT2D 3MLUH 4JZJC 1MHPL 2OXGA 5ESQB 4KXZH 1EUUA 1U95A 2B0SL 1OTUD 1PVHA 5K9OA 2AJZA 5FUOH 4NZRH 5FCUH 3NZ8A 1YNLL 3SO5A 1EZVY 3LMJL 1FIGH 12E8L 2PYFB 4HZLA 2DIJA 5C0CB 4OSUL 3ARVA 2CR6A 4LCWB 2GTZA 3EYFB 4LHUG 3X11A 4YHNB 4TUJB 5IVXB 4OZIE 1DLFH 4XCYA 4NO2A 2H3NA 3BMWA 2NLJB 1DEDA 4OIAA 1F3JB 5DJ8A 2A74A 1D6VL 1A3LH 4GKSA 3PWUA 1T04B 5TJWK 2HKHH 4XVSH 5F3BB 3BEWA 3L6FA 3Q5YA 4LEOA 3RHWK 1MIEL 2DI8A 1S7QA 1NANH 3QDGD 1LVEA 2DQIH 3LPGA 2XTJC 1A9BB 3H42L 4CVZB 4EOWH 1R5IB 2XKSA 1OWWA 2DYPD 3G6DL 4LCYB 4HS8H 5FUZL 4LK4A 1D5MB 4XP9L 43CAB 4Y5YB 4CN4A 1EMTH 3RBGA 3RZWA 1W72A 1LK2B 4PPTA 2K3TA 1GPOH 5J3HD 1S7WB 2X4SB 1MHCA 5IQ9B 4WI4A 5C0AE 5IBLD 1EJOH 1UYWH 2KZWA 5B39B 4PY8I 2VZVA 2HMIC 4D0BB 1CD1A 5CGYD 3ARBD 3GK8L 3DGGA 5HGBB 3FMGH 3NA4A 4XB7A 2YKLH 4QRRE 1DE4B 4P2RB 5GGQL 5DGQA 1GZQB 5KW9L 5HHXH 4PG9A 4YGVA 2YSSA 1KIPA 4JFXA 1QOKA 3UTPE 2NY3C 5GSRB 3K4DA 1TVHB 3CZFA 1UVQA 2FWOA 3QUYA 4QEGA 3HI1A 5FV1L 5CAYB 1QR1A 2BNRA 1OTSD 3BWUC 2WM0A 4OAWA 3BJLA 5HDBF 3ZSSA 2Y5TA 4LSUL 2I9TA 5E4EB 1RUQL 1H3TA 3ZTNL 5L2KE 4K7PH 3SGKC 3WUWB 1Q72L 4HC1H 4HIHA 4Y4HD 3FO1A 4R0LB 2DDQL 1KN2H 2X2YA 2QSCH 1LK3L 1PG7X 4BFGA 3FQRA 2GJ6E 4PLJC 2DTMH 1WEJH 2VZOA 3PP3K 3IDXH 4TUKH 1CVRA 4WCYL 4YDKL 4PLKD 1KNOA 3OKEA 3RL2A 4ZFGH 5H2BB 4JO3L 3OKYA 5AAMA 2CK0H 2FX7H 4P2QA 1RQ5A 3CD4A 1N4XL 3GJFA 3WS6A 3P4LA 5C09E 3V6FA 4HIXH 2AK4E 5EZOL 4XHJD 4J3SA 4UDUB 5DFWH 2R0KL 5L8KB 1UXSA 2XZQL 1XGRA 3HUJA 1T2QH 4DGYH 1VENA 1RIUH 3C2AH 2AXGA 2QL1A 5B4MC 2P46B 3ME0A 1DVFC 4ONFL 1XR8B 3SOBL 1BIHA 5TPWH 3TO4D 3VFNB 2L4OA 3KWWA 2AJSH 2JELH 3ORJA 3UROR 1IL1A 2F19H 3BZDA 3NOIA 2I9LB 5ANME 3QQ4B 1FL3B 3SDDB 5C0AB 3OPZL 1YEFH 2BSSA 2ICWA 1IAKA 1UENA 2ZKHL 4G8EA 3AVEA 3T0WA 3DX7B 4IDLA 4QO1A 1BWWA 5IB3B 2EYTB 4O58L 2ORBH 3L3JA 3O2DL 4OD1H 3FRUB 1NEZA 4OF6A 4K3GA 2EDKA 4LVHB 4AJ0A 1WFOA 1T83A 2VLRB 1IQDA 1ZLVK 4ZO7A 3AUVA 4Q0XH 5L7XL 5ICZB 1AO7A 5D1ZB 1KEGH 4R96A 5A2KH 3L5IA 4UV4H 2HT4D 3MLVL 1P84K 5E2TL 5D7JA 3BIKA 1Z0NA 1BD2A 4NPYA 4DUWA 3UXFA 2BHYA 1H3PH 1U8KA 2W65B 5L2KB 4OLVH 5I66B 4PP2A 4YIQB 2PETA 1CXFA 5AZ2L 1YNTA 2YPLD 5CMAA 3MV9D 3MV8A 4KPHH 3UJIL 4M1CC 6FABL 1TPXC 3GEWB 5SWZD 3QCTL 4PJBB 2BVPA 1G9MH 1IILE 2GJ6B 4FTVE 3WO4B 2VL5A 4X8JB 3IJYA 1T21B 2DBJA 5ENWB 4LF3A 4ZFZB 1PG7W 3CIQA 3WBDA 2DF3A 4ERSL 2HFGH 3F7PC 4YXKL 1AJ7L 4Y19A 3S35H 1U8OB 2YD2A 4RZCB 2YD6A 4X5XA 3MPCA 4HUWB 5TGBB 5GS0D 4QXTB 2DKUA 5KVMC 3E6FA 4NHCH 4YE4H 3U7WH 2EECA 1JGLH 1QPPA 4GJTB 4NQVB 5AWNL 5KSAB 4P59L 3K46A 4EBQH 1RURL 4XVUD 1FGVH 1MI5A 4UU9B 3NAAL 4E41E 4OV5A 5EPMA 1PLGL 3C8HA 2C3VB 5FAAA 4R2GC 1MREL 5JPMB 4WW2C 1R6VA 3CC5B 3PWLB 4KJYB 4L8DB 1P69B 3HPJA 4HUMB 5BRZA 3JV6A 1VGEH 4APQC 3H9SD 5DJXA 3TZVD 3BT2H 1FORH 2EYSA 4MMXC 3KVQA 3JV4B 3LEXA 4N1CA 3O6FC 2A9ML 2CRZA 5H35B 5C07E 4PRIB 3B8SA 5JQHC 4X0KA 3DXAA 1OPGL 4R8WL 2EE3A 1JGDB 1TQCB 3OKDA 3FB5A 5ANMB 3PABB 4BQBA 4PP1D 3GBNL 4N0RA 3RAJH 3VWKC 5DWUH 1BPVA 1FFPB 5EUOF 2B1AH 2EIZB 1V5JA 4Z7OE 1I3UA 1I8KB 4V1DA 3H9ZA 3FN0H 2LABA 5C8JB 1IQWL 3WXWH 3KS0J 4KI5D 4FQIL 3TC9A 1JZ8A 4DQOL 5E8NB 4XVTH 1A4KB 3D1MC 1TTUA 1U58A 2C7UA 2K7PA 5CUSL 3L5XL 4MNQD 2J88L 4K3HA 1KTDA 3CFBA 4P48A 3I6KA 4AG4L 5J06A 1G7JA 2RFXA 3W9DB 3BPLB 1HXYA 4M7KH 2ZCLL 3W39B 5LJYH 3EO0B 2APFA 5E6ID 5HJ3A 5EZJA 1BQHA 4DUXA 2FZ3B 4HIIB 4ZFOA 5FUCC 4BSJA 5HPMB 2BFVH 3SE8L 2G2RA 3L7FA 3CUPA 2HG5A 4C58B 1BMGA 5HY9B 1FYTE 4KTEL 4X4YB 1MFEL 1DFBH 1X4YA 1XZ0B 4GRLC 1KB5B 2C3GA 4FTVB 5JHLL 5I16B 3MACH 4X6CA 1BX2A 5ICYB 2E9IA 1J0ZA 5TDNA 1WTGT 1XCQB 3OJVC 4DEPC 1AC6A 1X5HA 1U8QA 2V9QA 4IRJA 2M8XA 1NL0H 2ADFH 3D39D 3E0GA 4LRIA 2QQNL 1CE6B 2Y4SA 3UPAA 5I8KH 1SJHB 4GXUM 2Z93A 2R1YA 4HEPG 4Y8AA 1MJUH 3GSOB 5MI0B 1YEIH 2Q86B 3A6CL 3AS2A 1FYHB 4P23C 1U3HC 4PRPD 4X99B 3ULUL 3LN5A 4JM4L 5HHVH 4OF0A 4E41B 1TJGL 3TF7C 2GJJA 3D48R 1Z5LB 1FNSL 3UX9B 3VFPB 3L3DB 1CD9B 5I1IH 3VXSA 1FDLL 1TETH 4NZUH 1EHXA 5BOZG 3EJZC 5HGHA 5HGDB 1D5IL 1MRCL 3O6ML 1G0XA 2UZIL 3IFPB 3VXOA 2AVGA 5IROC 1OSZB 5EC1A 3IS0X 5LGJA 1PEZA 2VRAA 1T1ZA 1I3VA 2RIKA 5FYKL 1J9CT 1MFBL 3KYMA 1MAJA 1YYMH 3UYPA 3NN8B 2VC2L 4OZ4B 1IMHC 4JQXA 2E7BA 2IPKA 4KK5C 3IDMA 4WO4A 1I4FB 1U91B 4HWEH 1KTRL 2NY6D 3NFSL 3I02A 1A0QH 1HEZA 2A83A 4XMLL 4HLZH 2Q6WB 2G5BA 4M8QB 5KSUB 2PXYC 5F89A 1CL7L 2IMMA 3DROA 2QTEA 2VSDA 4JQVC 5IR1A 1N7ML 2VLKD 2CRIA 3L3OB 4I2XB 3ZO0A 4PV9B 5I1DA 4K71C 3O9WD 1KCLA 4P2OB 3TN0C 4F3FA 3VXME 5CEXB 4J6RH 1JRHI 4OZGA 1OF2A 4MQ7B 2P5EE 5KZCD 5JO5B 1DL7L 4G3YH 4PRDB 2YWYA 5BXFB 3RY4A 5HI3C 4NRXB 4OLYL 1FYTB 3SKNB 2JLLA 2GSIA 4KK6D 4FQXC 5IBUB 1KC5L 2FX8L 2AKRA 1VCAA 5CEZE 3QDJD 3P4NA 5A2JH 1T5WB 3LIZH 4BH8B 4OZHA 1SMAA 5ETUB 4MJID 3EOYG 3U0TB 2ZOKA 4HKBB 3BP6B 1UH2A 1PKQA 4I18B 2EE9A 5DXWA 4O9HL 4ELMA 1SJXA 3CX5J 3CH8A 2DQGL 1F4XL 2IQ9H 1ONQA 3HS0B 4FFWC 5HHPA 4LMQI 5I73C 3V52H 3S5LG 2NYYD 1GAFL 4LHUD 1CICC 1T0PB 2IF7A 1KELL 2CXGA 1I7TB 2XXCB 1KUMA 4OCNC 1FHGA 3G9VA 5F6IB 4H88H 3W82A 2XPGB 3KDMB 3IFOA 4W70A 1EEUA 3GSVB 5C71A 3EOTL 4GRWH 5C0GA 4ODHH 4DTGL 2YC1B 3HAEB 2SEBB 1BFVH 4KI1A 1WZLA 4HWZB 5J6GB 5JR1L 4N8VG 3VWJC 3JTTB 3PG2A 4UQ3B 1CFNB 3OAUH 1NC4D 4P0DA 2CRYA 5DA0B 4OM0H 3LKSA 4M93B 2FBOJ 3LN4A 2RHEA 4NO3B 3BKML 4ZYKA 5FHAL 3E3QC 1T03H 5GS1C 4OLXL 5ADPL 2VWEE 5GRUH 4YHMH 4L29B 2C4XA 4DVBB 1HSAA 2ZNWA 1WIUA 3VI4E 4H1LG 5BMFL 2A2QT 4KKLC 1NCAH 1VEMA 2X1QA 4PJCA 3FN3A 5F44A 2RR3A 4O02L 1NCWH 2EKSA 3WSQH 1LO3H 2JJSA 4JRXA 2HJFA 5ECJE 1XGUB 2XA8H 5HYSG 4H0IA 3CFKA 1ZHKB 5CZXD 1Q1JL 1UWGL 2DQJL 1WT5C 2VJXA 2YN5A 1J1PL 5MEQB 3SDAD 1XT5A 3VXMB 1UJ3C 2P5EB 4S1SL 1KT2A 3WN5A 5SWSD 3M1BA 2V2WA 2YPVH 3ARGD 5I75B 2PCPA 3HE7D 5C3LD 3C5JB 2H26B 3SE4A 3DI3B 1M4KA 3MLTA 4YHZH 3MRPA 5FA3A 2VDLH 2PO6B 2N4IA 2R2BA 4D8PA 1B0RB 2XQBH 3D85D 1LEIB 3FCTB 4EUPB 3P73A 3F7VA 1VHPA 1OGAA 3MUZ1 4WWKA 2OXHA 1LMKA 1OAZL 3W9EB 1QBLH 4MZ3A 1UM5L 3WUZA 2NX5A 3W0WE 2H1PL 2AXFB 4NN6C 3QQ3A 4LCIH 4G6FD 3ULUC 4UTAH 5CEYB 4BK5A 3EAKA 3BQUA 3MQIA 4G7VH 1QLEH 1GZPA 3RVWD 1QFWM 1C7TA 1HI6B 2DBLH 3IU3A 5BS0A 2EDBA 4UIMB 5L9DH 3TV3H 3FQUA 2J4WH 4Y4FA 4KH2A 1HXMB 5IB1A 3B9KB 1ITCA 2F58L 1G6RA 4I0PB 5EO0A 4BQ8A 5DMIL 3OHXB 4XXCC 4GKOA 5HYQA 1RZJL 3UTSA 3HR6A 3GSXB 1GC1H 3HC4L 3QIWB 3A6OA 1MFDL 5HGAA 2ZUQC 4U1KA 2W9LA 4ZO6A 5IIEA 2H32A 4CMMA 1ZGLP 2EXWD 3QQ9C 4PGEB 1BJMA 1MEXH 4ONGL 4NN7B 4YHLH 4J4PD 4WY7H 1JYNA 4QRRD 4M62H 1MCFA 5HYFA 4PB0H 4NQDE 4ZUWB 4LVNC 3CMOH 4G6KH 4BZYA 1S7RB 3P30H 1NCCL 4KJWD 3QPQC 5ESVB 1F58H 1C16B 2VLJE 3VXPB 4HKJB 4I9WE 2GCYA 1BQLL 2P42B 3VXUA 1PG7H 3NFPB 2VXUH 2W9DH 3MRMA 3VFSA 1TJHH 3EOAA 3BN9C 1K8DB 3C6SB 3ULVL 5T5FL 3UTOA 1QFOA 3MYJB 3DMMD 1LE5A 4G6JH 2FGZA 4MD0B 4FQHA 3RUGE 1DDHB 5D6DA 1Q9KB 3NZHH 2X89A 1CLYH 4QXUH 1QP1A 4L4TE 1B88A 5E9DA 2AEIT 2JCCF 1CTOA 4IRSA 5LBSL 3UTTD 1RJYB 2QADD 3VW3L 3DRTA 1X7QB 1B0GA 4BFBD 3KPRE 1ES0B 2EDFA 1JPSH 3TA3B 4F8TA 1I9RL 3UP1A 1U8MB 4ORZC 1Z2KA 4K8RH 5JZ7D 3SDCB 4GS7C 3TO2A 1YMME 3LS4L 3T8XA 2OL3B 4LNVA 3KPSA 4MB4A 2VQUA 5AZEH 5JOFB 4WU7B 2V9RA 4M9OA 3FZUC 5C09D 3DVGA 1CTNA 5I1EH 2Q1EA 2AK4D 1FSKB 2R2EB 3VFTB 4ZUSA 4PGBB 2FO4A 4NNPH 3RVXC 2ZCHL 5BO1L 2F5BL 4YX2L 2AEQL 1RULH 4OLZH 4DGIH 1U2CA 2VDKH 4Y4HB 1J0KA 4JFFA 5F7DA 1JPFB 4HH9A 2X1XR 3AB0B 3B3IA 4Q9QH 2HH0H 3RTQD 3L95B 1DQTA 1YPZF 3G5XA 2D7TL 1TITA 4NQSB 3D69A 1IGCH 3RDTA 4LSRH 5HI5C 1IKFL 1J0YA 4JFEE 1BVLA 1DJSA 1NJ9B 3FQNB 1DQJA 5FB8B 2R56H 3LEYH 5IHZB 4WFHE 2UUDH 1P2CB 4GMTL 1MWAA 3T1FB 1G84A 2VZSA 1LHZA 1VEOA 3BDYL 1LP9F 2NY5H 3DETD 4LPXA 4J3TA 3BH8B 3ALXA 3GIVA 5I19L 4H8WL 1I1AD 2ITCA 3PHSA 3S8WA 4HUNB 1II4E 5J11B 5F9DC 2WWKO 3C5ZD 3QHTC 4F2MB 1MI5E 4MA3A 2PYEE 1OARL 3IETB 2ERJC 5DURB 1U0QA 3K2UL 3WD5L 2LAAA 4UOW1 4JDVA 1D5XA 5EOCL 3BH9A 5GZOD 2N7AA 5EH1A 2AJ3B 4F7TB 3TBSA 1PZ5B 3I9GL 1M71B 3RWDB 4MJ6A 1FG2A 3BGMB 2ICWJ 4UB0L 4ZOBA 2EE2A 2XY2A 1CFSB 1A14H 4E0RA 4RMWA 3OGOE 1BFOA 3U4BL 1NEZG 2Y72A 5IEHA 3MCKB 7FABH 4HHAB 3G5ZA 2AI0L 2OQJB 2MFNA 3KPRB 4MNHA 2V5MA 2VIRA 1HYRC 3D87B 5LGHL 4XPFL 3QWQB 5ALCH 3PHOA 3RPIA 3CCHB 1ERNA 4FZEL 4ZO8A 4Z0BL 5D9SB 2E27H 1YMMB 5IW1B 3CLEL 2HT3D 1MCJA 5DQ9A 5D72H 5A3ID 5FDWB 3CDFA 5DJDB 2CGRH 4NO0A