2N0MA

The solution structure of the soluble form of the lipid-modified azurin from neisseria gonorrhoeae
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
ATAGNCAATVESNDNMQFNTKDIQVSKACKEFTITLKHTGTQPKASMGHNLVIAKAEDMDGVFKDGVGAADTDYVKPDDARVVAHTKLIGGGEESSLTLDPAKLADGDYKFACTFPGHGALMNGKVTLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Lipid modified azurin protein
publication title The solution structure of the soluble form of the lipid-modified azurin from Neisseria gonorrhoeae, the electron donor of cytochrome c peroxidase.
pubmed doi rcsb
source organism Neisseria gonorrhoeae
total genus 36
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2015-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2n0mA00
2MTAA 3FT0A 5B1AB 2FJSA 5B7EA 1A4BA 4BK5C 1CC3A 2XUWA 3BVDB 4FAAB 1PY0A 2BWDA 2FT7A 3IEAA 4GP4B 1L9PA 7PAZA 3ERXA 1KYAA 2IDFA 2W88A 5D4HA 3S8GB 4BXSV 3RYMA 1ASQA 4L0PB 1AZNA 1I53A 1V10A 2XV2A 1SNRA 1KV7A 1PNCA 5D4JA 1L9TA 1ET7A 2PP9A 1AQ8A 2VM4A 2YAQA 1AZUA 1WS8A 1GR7A 2BP8B 2IH9A 2GHZA 2QPEB 1OOWA 3AZUA 3UACA 4DP7X 2X87A 1HFUA 2XU9A 1VLXA 2ZWNA 3MX0B 3OMNB 3CG8A 2UX6A 2YXWA 3ABKB 2FT6A 3NJIA 3UADA 2P80A 3NSFA 2FQGA 4KOCA 3NJGA 5B1BB 1XB6A 3G5WA 3AG3B 3ASOB 1PMYA 2R7EB 3PAZA 1SFDA 3SBRA 1CYWA 3S3BB 1AG0A 2IDUA 2XV3A 2ZOOA 3NJHA 1J9RA 3X1NA 2IH8A 4KO5A 1NWOA 5I26A 4NAJA 2HX8A 2FTAA 2PP8A 4KOBA 1JZHA 4AKQA 1CYXA 1TEFA 4MFHA 2PCYA 4PAZA 1ASOA 5AKRA 1SHXA 3JT2A 4KO6A 3OQRA 2OCCB 4HIPA 1PZCA 2CAKA 3UAEA 3BQVA 1AZRA 4E9YA 1FA4A 2AFNA 1UATA 3H4FA 1NIEA 2IWFA 4DP5X 4GXFA 2IWEA 1NWPA 1E65A 2YARA 3KW7A 2AVFA 2EINB 3TBCA 2WO3B 1OF0A 4A2GA 4DP1X 1OCCB 3NSDA 1JVLA 2HRGA 2AZUA 1NPNA 4KNTA 1SDDA 3V9CA 2W8CA 2YAEA 3PPSA 5FC9A 1JXFA 2UXFA 1XB8A 5IY5B 3FQYA 2BP0B 2BZ7A 2J56A 1KCWA 2Y69B 5I28A 1MDAA 1AS7A 2AANA 2VW6A 4BWUA 4DPCX 2YQBA 3FYEB 2EIJB 1PF3A 3NP3A 5I6MA 1NIAA 1PAZA 2P80D 3IE9A 1NICA 3L45A 1OE1A 3AW5A 5I6LA 3DKHA 1NTDA 4GP5B 1L9QA 5I6NA 1AG6A 3QJSB 3TASA 4CSPA 3QJTB 2DWSA 1PCSA 2CJ3A 4DPBX 3HB3B 1W8EA 4YSSA 1IUZA 2WSDA 5B1JC 1A4CA 3FPXA 4EF3A 3GYRA 2XXGA 3NJKA 1AR1B 2GB2A 1OCRB 4F2FA 3GXUB 2RACA 3MBWB 3ZBMA 3FU9A 3X2QB 1J9SA 1HAUA 2XV0A 4E9WA 3GDCA 1ZIAA 3DTUB 3X1FA 1A65A 4BDVB 2IAAC 1AZBA 1JXDA 3EH3B 4W1TA 4A68A 3X1BA 1DYZA 4G7RB 4BWWA 3QJVB 1BQ5A 4BWTA 2HX7A 2PPDA 1WA1X 1MG3C 3NJNA 3T6XA 1BXAA 3FU7B 2AZAA 3HEIB 2CUAA 3WIAA 1AZCA 4KNUA 2YAFA 2CBPA 2QDVA 4G70B 4G7SB 3AG4B 2DY2A 2BW4A 1GYCA 4AX3A 2HXAA 1J5DA 1GW0A 3D12B 5D4IA 4DP4X 4FA7B 6PAZA 3PXLA 3OM3B 2EIMB 3WNIA 2FWLB 3WKPA 1CUOA 5B1KA 3X1GA 3ABMB 2GI0A 3T6ZA 1MZZA 2JXMA 2OV0A 3QPKA 4X4KA 5PAZA 3IN2A 2E86A 4WKXA 2B08A 5I6PA 3DIVA 4YSOA 4F7KA 4UAHA 2UX7A 4ENZA 4TXVB 2XYBA 4AKPA 2I85A 3FSVA 1AOZA 1NIFA 2VW7A 4AKOA 1JZJA 1NIBA 1WA2X 1EZLA 4E9XA 2B3IA 3AG1B 1SHWA 1ZDSA 3AY2A 5TK4A 4QLWA 2WO2B 4DP2X 3CDZA 2IDTA 3NJJA 5I6KA 1XMEB 2VSKB 1QLEB 2Q9OA 3H4HA 3WG7B 3FSWA 1KGYE 2FT8A 2I7OA 4HALA 4A2FA 1FWXA 2HLEB 8PAZA 7PCYA 1NDTA 2VN3A 5A7EA 1BYPA 3ABLB 3UAAA 2UXTA 1JOIA 1GS6X 2VMJA 1SJMA 3PAUA 2FQDA 1KBWA 5LDUA 1N70A 1GS7A 3NP4A 1WAEA 4DP0X 2X88A 2XX1A 4P5RA 4A2HA 2DWTA 4DP9X 4HZ1A 1J9TA 4HAKA 2XXFA 1BYOA 4G7QB 3SBPA 1PLAA 1BXUA 1RCYA 2HX9A 4QKTA 1WS7A 1ZDQA 2BP8A 1QHQA 3EHBB 1KDIA 1SFHA 3NJMA 4JKNA 4E9SA 5AZUA 1N68A 1BEXA 2DYRB 2YXVA 4F2EA 4YSCA 3ZDWA 1ID2A 5F7BA 4GY4A 2CALA 2PPEA 3FQ1A 2PP7A 5B1JA 2ZXWB 3EF4A 1JERA 4M3HA 4E9VA 2FQFA 3H56A 2BWIA 1URIA 3EH5B 4HCGA 1B3IA 4YSTA 1OE2A 2R7EA 4JHVA 5PCYA 6PCYA 3OMAB 4YSPA 2PPAA 1KCBA 3SBQA 3FQ2A 3JTBA 1AIZA 2Q5BA 1RZQA 1E5YA 2YAOA 3CVDA 4YVNA 3EH4B 1F56A 2MRYA 1M56B 1AS6A 2VW4A 3C75A 4YSUA 1J5CA 2OJ1A 1ETJA 1GS8A 1BQRA 2XX0A 1OCZB 2QDWA 3NJLA 2GBAA 3T71A 3TBBA 1SF5A 4KNSA 9PCYA 1PLBA 4M4RB 3NSCA 1NIDA 4YSRA 4HCIA 1IKOP 1V55B 1E30A 1M57B 3CZUB 3IBOA 1TKWA 2HRHA 1GSKA 3UABA 3ASNB 2JKWA 2GC4C 4E9QA 3T6VA 2UXVA 1E67A 4AZUA 2PPCA 1A4AA 1MZYA 1NPJA 1RKRA 2XVBA 2YAPA 3FS9A 2BP0A 1OV8A 1L9OA 2YAHA 3OD3A 1YLBB 3AG2B 5B7FA 3U25A 1EHKB 4N4YB 1SDDB 3TA4D 2YAMA 2CCWA 2ZONA 1HAWA 3FSAA 3CVBA 2IDSA 1T5KA 2H5UA 4BXVA 1AANA 1L9SA 2TSBA 2JFCA 2J55A 2XWZA 1QNIA 4GP8B 4DP8X 1OCOB 5E9NA 1E5ZA 4YSAA 2UXGA 4KO7A 1KDJA 1TU2A 4YSQA 4ZK8A 1GY2A 1JVOA 5EHFA 3SQRA 1RZPA 5I5IA 1XB3A 2PPFA 3N2JA 3T6WA 2H47C 1R1CA 1BQKA 4NB7A 4YSDA 4E9TA 4DPAX 2PCFA 3N55A 1ASPA 2XLLA 4UANA 5I6OA 1ILSA 4BDVA 1MG2C 4NERA 4A2EA 4N8UA 4UF7C 1SF3A 3ZX1A 3X1EA 3QJRB 2DYSB 4W9ZA 3QJQB 1X9UA 1PNDA 3T9WA 1ET5A 1KBVA 2FQEA 1J9QA 5I5MA 1JZGA 4G72B 5AFAA 3V9EA 2H3XC 3PCYA 2QT6A 3WI9A 2GIMA 3FYIB 1L9RA 1NINA 3FU7A 3PLYA 4WTQA 2LLNA 4YVUA 5TK2A 1JZIA 4JHUA 2N0MA 1A8ZA 2J5WA 2EILB 3UGEA 1OE3A 1TEGA 2NRDA 4A2DA 3NYKA 4YSEA 2A3TA 3IN0A 3S8FB 1DZ0A 2GC7C 4Q8BA 3WKQA 4HHWA 5F7AA 1PZBA 1AACA 4HCFA 3FSZA 1ZV2A 4AI7A 2VSMB 3S3DB 2DV6A 5B3SB 1ADWA 2I7SA 1PZAA 3NSYA 4K9JA 2IDQA 2TSAA 1GY1A 3WNJA 1ET8A 1M9WA 1BXVA 3ZIYA 4A67A 2EIKB 1JXGA 2QPDB 4DP6X 2BW5A 1PLCA 4RH4A 1X9RA 3ABGA 3QJUB 3TU6A 2PLTA 2BHFA 1WA0X 3PAVA 4GYBA 1FFTB 4PCYA 2HZHA 2IWKA 1NZRA 1W6LA 3NT0A 1JZEA 4CSZA 1JZFA 1AS8A 2J57A 4KO9A 3NJFA 4P5SA 3KW8A 5ANHA 1A3ZA 4E9RA 3CVCA 3S3CB 4YL4A 3QQXA 2GSMB 2BO0A 1BAWA 2Y1AA 2FNWA 1CURA 3CDZB 1AAJA 3FU8A 1V54B 4G71B 1ILUA 4A66A 2VM3A 5I5JA 1ZPUA 1IBYA 3FPYA 4HHGA 1W6WA 4Q89A 1IBZA 1IC0A 5B7MA 3OMIB 2BZCA 1ZIBA
chains in the Genus database with same CATH superfamily
5HYJB 3PWLA 1YNLH 2UYLA 1MFDL 4PGZA 4JX0A 3RDTD 4K4KA 3RIAF 2NY1B 3AC0A 1G6VK 2D7NA 4Y2DA 5HYFA 5AOZA 1PY0A 1KLGB 5HHNB 3PP4L 1XH3B 3D09A 1I3RB 3QULA 5EU5B 2PYEB 2WBJA 3GXMA 1MSPA 2BERA 4GO9A 4XBGA 1HL9A 2A73A 3ZHFA 1C7TA 5F1SA 1MFMA 4GAJL 4W6YB 1DLFL 1FIEA 2CO7A 2O6PA 5I6XB 1JZ8A 3U1SL 1A2YB 1T83A 1DQDH 4X5LA 4NI6A 3FO1B 1N6QH 2XFGB 5FM5M 4K7PH 4Z3GA 1KMGA 4G8FB 1HE8A 4J3XA 1HQ4B 1HFUA 2XU9A 2OZ4A 2ADIB 2A38A 4L4VB 4P5MB 4WK4B 4FP8H 4WUKH 4YDLC 2KHAA 4LOVA 3CDFA 1TZGL 4IMLB 1PEWA 3I02A 3KYKH 2PXYD 4MMZB 1QYGL 2D0HA 2Q20A 2RH0A 4JPIB 3NZUA 4KJYB 3WSQH 4DGVL 2BS8A 1A14H 2FL5B 3NCYS 5IKCB 4DK5A 3L3GA 43C9B 1NH6A 3LYRA 1F58H 2F15A 3K2UL 4CN1A 3HG1D 5ENWA 5C0GA 4PSRA 1U58A 1U3JA 4KO5A 1I1FB 4NO2A 3FRUA 3VTMA 1QEXA 3TN0B 5LWYH 3NEOA 2X89A 4F33A 4LCWD 4PAZA 5EFIB 3Q05A 2NYYC 1Q9LA 4FNSA 3UO1L 5AW7B 4U3XA 1XIWC 3SYAA 4KO6A 3U2JA 1DEDA 1SYSB 2OCCB 5AALA 3UG3A 3K8MA 5IQNA 4BFJA 4K7FB 3BQVA 1AZRA 1UACH 4AGMA 4Y5YB 2R51A 4P07A 3SY0B 2NCEA 3BT0A 3FW6A 2F08A 3OJVC 4X4XB 2PW2A 5I9QC 5DK2B 3PJSA 3WEOA 4NPKA 5EIIG 1F4XL 3SD2A 2N56A 3VJ6A 1FZKB 1OAXH 2CLZA 4D3CH 3QYMA 2YMOA 2PN5A 4S1SL 5C6TH 4GSQA 4HT1L 4PLKD 3C60A 4XMPH 5H37A 2ZXDA 3H42L 1DQMH 4MXWL 5L2KE 4XAKD 4Z7VE 5F9WB 4B0MB 2CK2A 4FTVE 5D1ZI 2EYSB 2X05A 1ZLVK 1NOLA 3ZDZF 2VABA 2NUTB 5MEND 3JTSB 3HLAB 3KWXA 2FHCA 3QQDA 3MODH 4OAWA 4DPCX 4IBVA 5D1ZD 4O00A 5I6MA 3CFBA 1A6UL 1NICA 1VFUA 2MMXA 2X40A 4JLRA 4LSUH 4PU2A 1K2DA 4WV1B 4H2CA 4FDWA 5DMKB 3TBTB 4KWUA 1DE4B 2DTMH 1I1AD 3BAEL 3OPZH 1DDTA 4QRFA 1RZKH 3MRJA 4NC2B 3LEYL 3U4AA 2VC2L 3WHXA 2ID5A 5D55A 3B7TA 1PG7X 1QLEH 1YEJL 3KVDD 4LL4A 3MNZA 5HGGS 2OMUB 2EUWA 1G1OA 3CFTA 4N8VG 1AR1B 1CG9A 4CU7A 1FVCB 4PJAA 4UM9B 2AERT 1U95A 4OZFG 1DUZB 3DRQB 1HAUA 5HDBB 4R90H 1M53A 2AABH 4OFPA 2BWQA 4D9RD 4S0HA 1MW0A 2XBTA 3VSVA 4YHOH 3H7LA 4D9LL 4ZW8A 1TTFA 3RZWA 3JXAA 3NG5A 1MJJA 3FUFA 4NPYA 1X5IA 2Y25A 4JRXA 4P5KB 3KCPA 4UT9H 3QJVB 2AAAA 3MCKB 5E2VH 3QG7H 4JKMA 5TFSL 3N40F 3NJNA 2K1MA 4P2CG 3L1EA 1LGVA 3MJ8B 2AJXH 5FUOL 3L4XA 2H3KA 1FC1A 4MXVF 3GKZA 4KK8D 4YDKH 4JZJB 3WNNA 3SE8L 2YAFA 4Z7UB 4XO3A 5IFJB 4I18C 4KVPA 1P7KA 5IMKB 3NCYP 4P4RB 2CGYA 4KRPC 2WQUA 4OKVB 1PJWA 1UOWA 1F2QA 4EI0A 2Y2YA 2RD0A 1SOQA 3ROOB 5JO5A 3IJ9A 4NS0A 2FWLB 3N43F 1C12A 2XKNB 5ANMA 4D0BA 1QNZL 3NABL 4M61A 5I0WA 1KTDA 1VPOH 4BM7A 5DZOA 3HMWL 3QPKA 1E8XA 4K71C 1IJ9A 2H0PA 3LXCA 3NRPA 1MREH 4XMKL 1HT6A 1U36A 2EXYD 3OKOA 4AUYA 4ENZA 4U7MA 2BSRA 2OW6A 3FT4B 4XO9A 4AEHL 4NYLB 2VW7A 1UOVA 2AEPH 3QXAA 4KUCD 5DJ8A 1YY8A 4A6YA 5BRZD 4X6BA 3U30B 4E9XA 4HETA 2V2TA 4KKAC 5D1QC 4PGBA 4ZS6C 3ALWA 1LP9A 4PY8J 2IDTA 3W5NA 2YZ8A 1OGPA 1QI5A 2X1QA 3GSNL 3U0WH 1CDIA 1D9KC 3DRTB 3RTQD 1T4WA 1UUSA 2Y24A 2ZOKB 3B6SB 3D85B 3VXNB 3IXAB 2IANB 1CICD 5C07E 2EDHA 5LGJB 3HS0B 2NOYA 3QORB 1U4EA 1HL5A 4PJDF 4W4NA 3GLZA 4Z7WA 4WWPA 3EO1A 2KH2B 3GDBA 2AXGB 5FYKD 4Y4KB 1MCWW 5TQ2H 3SPVB 5CKAA 2HFGH 3CFMA 4FTVD 1N70A 2YXMA 2ORBH 4KJPC 2VR7A 4GQPH 1YMMD 1LO0L 4P59H 4PJCE 5FK9A 4PJHE 2Z8VC 1QFHA 1RJLB 4FQHB 4G7QB 2HFFA 4NLHA 2WXJA 4N1HB 3RLSA 3VRLF 4YZFE 1AGEA 3D5OF 3FQTB 2W9EH 4OJAA 4LSTH 5AZUA 4JY6B 1R5IB 3UBXB 3L2MA 3QUMH 5C3IA 1RZ8A 1FH5H 1CDHA 1JPGB 1Z3GH 2CALA 4E9LA 1GGTA 5LQBH 4CVWA 3AU0A 4N8CH 4M3HA 2IAMA 5FGBC 4NUQA 3SDDD 1R3JB 3ULVE 3K1KC 4OF6A 3O3AB 1IM3A 4Q7DA 1KXQE 3OBAA 4IKKA 3FL7A 2OTUB 2BSTA 1IGCL 3EH2A 3FOMA 4POUB 3MGOB 5ES4B 3E1F1 1TFHA 3SBQA 3LKNA 1JGDB 4X80H 4LEXH 4QGYA 4K8RH 1KJVB 3MRLB 1JZ2A 3QXUA 4M8QA 4PRHB 2XWTB 5I15H 3IDNB 4RAUB 2UZYA 2N3JA 2OJ1A 1BOGB 1SXBA 2L7UA 5GS1C 1GS8A 3CU1A 4YC2C 1EEZA 3ARDC 1JPFB 1PL3A 2QHRH 2X10A 3MYJA 4M7KL 4X6CB 2HTLD 5A6MA 2R0WL 1H19A 1VFBB 3KDPB 1RJYB 4PJIE 3NESA 3A47A 3LPGA 1XT5A 1RIHL 3GJEA 2ARJB 2IBZX 5J6GA 1MRDH 3E6FA 2VO5A 3S36L 3VRJA 1A7RL 4P8QA 1P84J 1BZDA 3AY4C 3EYUL 5EOQH 1K5NA 3PWJA 4EOWH 5B8CB 1ZXKA 3U36B 4FFVD 2VDPB 4HXBH 5CU5A 2R0KH 3TEZA 3L6FB 2DQUL 1ORSB 3CWGA 5FIEA 3VWJC 3DV6B 3P4OA 1MCDA 5BO1H 2YAMA 2CCWA 3SE3A 3T2PA 3LH8A 5LCVH 1OWRM 2CWRA 3CSFA 4HFUL 1VB9A 5HJ3A 4NQEA 4C59B 1ZVHA 3VB9A 2BVPA 4BQCA 3CVIH 4XH2A 2XWZA 1RJZB 5HYQA 2W81C 1HZHH 3SKMA 3FFDA 1WE5A 2VN5A 5F7UA 2UXGA 5EBLA 4YSQA 2F53B 1I8AA 5DMJB 3UROR 5I17A 2VZVA 2JMRA 4AC2A 1GY2A 3D87B 4AK2A 3SDAD 2D03L 5K9QI 4LK4A 4EDXB 5C07D 1G0XA 1JNHA 3II1A 5CCJA 4LLAA 5E8DH 1I8LC 4HS6A 4CRPA 1OTSD 3V52H 5DJYA 2P8PB 4U1SB 3KPMA 3VFWA 2JCCF 4ZMOA 1GGCL 2O6EA 3X13A 3QJQB 4GW1B 1HDMB 2FO8A 3DBXB 4XMZA 1SYVB 4J39A 4U6VH 3V6BR 3GI9L 4PJAE 5CZXD 3S4SB 4H8WC 2MQ0A 4H0LC 4NQVA 5D9SA 2NY6B 2CSPA 4JM2A 5INCB 1Q0YL 4FMKA 1I8KB 3KLSA 2NR6C 4RFNC 1IFRA 5KSAA 4QF1B 3ETBF 2JNZA 2A3TA 3WO4B 1NBYB 4FQIH 1LEGA 1PZDA 4YE4H 4JRXE 1S9KC 4IGBA 5GZOD 3KPPA 4R7NB 5ITFA 3QT2A 2YSSB 2VTFA 4ACTA 4HS8L 4TV3A 1DLHB 2DMHA 3AXIA 5D7JD 3POHA 1DO6A 5D4QA 1C16A 2EACA 2P43B 4JFWA 2BFVL 4Y1AE 2NX5B 4XGZA 1N12A 5I2IA 4MKTA 3BQUC 5EOTB 3MUUA 3OGCB 1PLCA 2B0SH 1EVUA 2RA1A 3B9KA 5ALBL 2CPCA 4A2MA 2LE9A 5C9KA 3C2SA 1D5ZB 4P3CH 1GOFA 2G3ZA 1L4IA 3K6SA 1U3NA 5TQ0L 4LVHB 1NZRA 4QOKE 2DBLL 3ZE1B 5I5RA 1JZEA 3N1FC 1K5WA 1C8QA 2EE9A 1OSPH 3ARXA 5E6IA 5HYJD 1ROWA 4IMKC 1IT9L 3NJFA 2BDNH 3K80A 1FFQA 4LO9A 4ODUA 3RHWK 2ADJA 5FUZH 2FUQA 4QXTA 3CVCA 3WXWH 3MTRA 1F1DA 1KN4L 1F97A 4HKJB 5ETUA 5ADPH 2Y3NA 2XA3A 3MROB 4S0SD 5D1XC 5CF3A 5BCAA 4JDTL 5C7XL 3JQOB 3OXRB 1T3FB 3KL0A 4DVBB 2JIXA 3FU3A 3CJJA 1XCQA 4M48H 4P2OD 4ONOA 5DVPA 2O61B 3HKFA 5FYKL 3OMIB 2X88A 4WK2B 4DERA 2MTAA 2WTRB 2QTEA 1AO7B 2BNQD 5A43C 2XUWA 1JPSH 1WFUA 3T8VA 2BJML 3T0EB 15C8L 3GLEA 4KHTH 4XWOD 3IU3B 3BDYH 4J3UA 2ICWA 1KYAA 1YNTB 3RGVA 2ZCKL 3CSBA 4FFZL 1UZ6E 3QEUB 2EDWA 4BXSV 3LVTA 4ZXBA 1TYEB 3FXIC 1E9PB 4K3DL 4APQA 3REVA 2CUIA 5D7LB 1J1XL 5DTFA 5FHAL 1JXJA 2WXKA 4OZGA 4I1NB 1OHZA 3HPLB 4OD1L 4L48A 2YAQA 2CGRH 3FHQA 4WHCA 3TCTA 3ZT6A 3BKML 2ZG3A 1JNLH 3IPFA 3PP3K 4KKQA 1LM8V 1X7QB 4MRCA 4OI7A 2RALA 2VYRE 3TYFA 3MX0B 4NZRH 1KTLB 1MQKH 1OK0A 2EH8L 1KUMA 2V33A 4LKXA 4WI0A 2ATKB 1BD2A 4TQIA 1M6UA 5SWSE 3WMQA 4X7SL 3KLHC 3AJ7A 3M8OH 4TF4A 2OMBA 2HJKB 4GAGL 3ZL2A 5HVFB 3BP7A 1IBGH 4N1EA 2G4EA 4KUZL 2JVUA 4JO2H 3Q6GH 1QBML 1FZMB 2A0LC 2HLFD 4HUWA 4L4TA 1I3GL 1UFGA 5DS1A 3IJ8A 1OAQH 4D8PA 3WFDL 4LMQE 2ARJQ 4HWNA 1RUAL 1BM3L 1HNYA 4PJ6A 5H2BB 3WFHB 3NFSL 1A3QA 1OP5K 3K7UA 5AKRA 3A6OA 2IFFL 1AGBA 4FQXB 4X4MA 2Q8BH 2FSEA 2Z0BA 3N1QC 3OAYH 3G04B 2J73A 2Q7NA 3B2XA 4GI8A 4MMXA 5D7IB 3LHPH 2X4RA 3FT3A 3CN4A 3FUNA 1P7QA 1PSKH 3RIAK 1IL1A 1GPOH 2D3NA 1FO0L 1NGYA 2CIIB 2YBRA 2GJJA 3COOA 3CPLA 4GXVH 5GIRB 1QKZL 3KVPA 5FDWA 3KPSE 2EINB 3QIBC 3D08A 3SPHA 1D7CA 2DN7A 5CBEB 3HE7B 3MRCB 3M1BB 4XMVA 5EUOA 2AI0L 4EBQH 3BPNC 1JVLA 4AENA 1HZKA 1PG7W 4Y1AD 1CBJA 4MNQA 3WN5B 2VZUA 1QA9B 4YUEL 4ODSL 3VG9C 5FC9A 3MLPA 2IV9A 1EFXB 5IY5B 3UAJD 4F8QA 4DGUA 4NWUL 3UL4A 3HN3A 2FO4A 4ZX4A 3MRRA 2ICEB 3VI3E 3D3VB 1MDAA 1AS7A 3HLKA 3RWEA 1XGUB 1A6AA 4X9YA 2A4CA 3ZOAA 3QQ4A 5HHQA 1S7XB 3G6DH 3NP3A 4LP5A 3VFOA 4O58L 4JFPB 1N59A 1AR1D 4QOKD 4NJAL 2B1AH 4V33A 1H6UA 4QRTB 5KVEH 5HVHC 1MLCA 4QO1A 1P6AB 2C3HA 2LV4A 5IW3A 1CXKA 1ZCRA 4L0YA 4I3GA 2DQTL 4WU7B 3UOAB 5AKVA 1T21B 4H25B 4J3OD 2W91A 4YAQB 3VXMA 3CMGA 4OCNC 1RMFL 4OCXL 3HZVB 4A7TA 3GRBA 1AHMA 2XVLA 4LIQH 5DUBA 4LVOB 5C9JB 3JZ7A 1MIML 3GUTB 3VFMA 2H8PA 1FE8H 2VDNH 25C8H 4NENB 3B3IB 1FC2D 1K72A 3O4LE 4BRVA 4BUGA 3N3EA 1A1NB 5D70L 3ZDZE 4I5BB 2ZKHL 2MKLC 2OL3A 5E8PA 2VQUA 2B1HH 4YX2L 2NY3C 4NRZB 3I50H 3QFJB 1CMOA 3GMNA 1JWSB 5TE6L 2J5LC 1KBGL 1JTPA 1QFWM 3B37A 4LGPB 2QQNL 3MUHL 4KH2A 3IETA 1MAMH 4FG6D 3CLFH 2VLKA 3L2NA 1I9RL 4WY7H 4DKTA 1U91B 4AQ1A 4DVRL 4PJBF 4N0UB 1WWAX 4R4BA 5I73C 3CFCH 1K8IA 5I71C 3CC5A 2CBPA 4N5EC 1BGXL 2WXOA 4I3RH 2E3VA 3GBNL 3OZ9H 5HHME 3D48R 1N5AB 3KL3A 1KGXA 6PAZA 2XTJB 3PXLA 2JJTC 2CKBL 2N0KA 1TLMA 3EZJB 4TSCL 4YHZH 4Y5XA 5SWSD 4Y4FC 1XF3A 1SHSA 3BKCH 2A9CA 2CK0H 3GMOB 3OKYA 4HIJB 3WY2A 3QH3B 3BAIA 2JXMA 1IC5L 3KLQA 4HCRH 4PM1A 3VO0A 5IT2L 1B9ZA 2FDBP 2WLJA 3CVHB 2W92A 3MPCA 4PRDB 5I6PA 3UX9B 4DOHB 1X5ZA 1AGDB 2BRRL 2Q86A 4WO4D 1GTFA 2AJ3B 3FQNB 4TXVB 3U6RA 1S9WA 4MCZA 4S1QH 2XZQH 1LILA 4I0PC 3QHZL 4HQQH 5C0AA 3RILA 1DSWA 3D33A 5L2JA 1XX9C 4JRYB 1EH9A 2B3IA 4Y4KD 2EDJA 3VFTB 4HPOL 4PJ9B 2P24B 3VSQA 1Z3RA 2E8YA 4LBAA 3F12A 2CRYA 2B8OT 2NY2B 4DKFL 5DHVB 4PJXA 2WLMA 2I7OA 3OVUB 4Q4EA 3DTXB 3QEHB 2OMWA 4QXUL 1NDTA 2FR4B 3KPSD 3C5XA 1FFNA 4PWGA 2HJFA 5JPNC 3GZOA 3BWZA 3EJTA 4AQAA 1B6DA 3I3BA 1E9QB 1FYTD 4BUQA 3VCLB 1UD8A 3B2VL 4XVOA 2F5BL 1KBWA 3K4DA 2MH4A 2VXQH 3ORJA 4OFQA 4ORZC 3BPCA 2X5PA 3ARQA 1O5DT 1BW8A 2KQNA 4L1SA 3WMSA 2BX5A 2FATL 2V5YA 1LO4H 4ZDHB 3LQAL 5F7LB 5FS5A 1K3IA 1BX2A 3BWAB 3GEWB 2DWXA 4F2EA 2VITB 2HKHL 3Q2NA 3ZDWA 5DJ2A 4Y4HD 4I88A 1SBBA 3WLWD 3D2UB 3RFRA 3V5HB 4FKKA 2PCPA 3LB6D 4X7EC 5HI3D 4XCFL 2PP7A 4BQ9A 2ZXWB 4WKZB 4OZGE 1JERA 4QT5B 4X9BA 2DH2A 3ZTNH 2WVVA 1OPGH 2WAQA 4E2OA 1FBIL 3QIUB 1WEJL 1CGXA 3MA7A 5PCYA 1QLRB 3O4LD 1NCTA 4PCKA 2A74B 1KGCE 3NMEA 1CL7I 3F58H 5ALCH 4ZZKA 4P5TC 4JFDD 2IFGA 2YJLA 2EKJA 1C5BL 2G9KA 3KD4A 5DJZB 4HXAL 4OF0A 4ZFZB 1BD2E 4M8RA 4NM4H 2VL4A 4QXWA 5JIHA 4LSQH 4URKA 3VRLE 3MRGB 4DN3L 2NY0C 1NUGA 3JWOH 4N24A 1CTMA 3NIGE 1RHHA 3EBHA 2YLHA 3FO2A 3PS6A 4L4TE 4LDLB 4Z7OE 4V1DE 3QUZA 2WKLA 4JGMA 4D0DB 1XF4A 3MOBL 3CK0H 3SCMC 1RLWA 5JHDB 3LXUX 2OR9H 4XWGH 2M8XA 4HCIA 1TZIB 2JI2A 3HHSB 1E30A 2CHDA 4HKBB 5I30L 2FJHA 2ZPKL 5E94A 4ZUSB 1E3XA 4X4ME 1GSKA 3N9GL 1DVFC 1F45A 4F57H 1E50A 1T1ZB 4M03A 3S48A 2EZ0D 4UU9B 3V0AC 3H9SA 2A6KA 2V7NB 2XN9B 4OV6F 1KCUL 2CNYA 3NPZB 4YHNA 3SDYH 3RBGA 4U1MB 4L9LB 4OM1L 2F53D 4Z7QE 4JB9H 5HGDB 5DZ9A 2HJLA 1NGPL 2ZCZA 1UWFA 4Y5VB 5EUOE 1O7DE 3BUYA 1XSJA 4OLUH 2H0FA 1Z9SB 2ZONA 2D2OA 3PAYA 1KENH 1XGRA 2B14A 1KLFA 1K4DA 2PWDA 1L9SA 4PYHA 3NCBB 3ARFB 2FBRA 3SPJA 4ECNA 1WBZA 1QNIA 3JV4A 4H8VA 4ZUUB 4ZOAA 5ICXA 1MCOL 3O41B 3SKOA 1PG7H 4QWWC 5CINL 4HA1A 3T2NH 1GGUA 4G42B 2A6IB 2BNRA 2R4RH 4B50A 1WC7A 1LLAA 3FTXA 4XNZB 3KPRD 4JANA 5KWYC 4QYAA 4DK6A 1JVOA 5ID0A 4L8CA 4KXCA 3N2JA 1TVHB 3IDYB 1F4WL 3PV6B 7TAAA 2OM5A 1R17A 2D0GA 2EICA 4UOW1 4ELMB 5AVWB 3WENA 3VXSE 5C0EB 5IEKA 2OMZB 3VXME 1AKPA 1HZLA 4ZMWA 1JK8A 5EZLB 4HSCX 3DHMA 3X1EA 1T6WA 2QLYA 1CR9L 1JDCA 1X9UA 2RGSA 1RFDH 1L5GA 1YEFL 4H1LH 3TO4C 1A5FL 3CXHJ 4BZ2A 2KPWA 2Z8SA 3NK4A 4PG9A 1FL3A 4N0RA 3T1FA 1FGNH 1NMCB 1UFUA 1G1KA 2I69A 3I6LE 2HLAA 2ICWJ 3QRFM 2JB6A 1G4MA 3GIZL 4KTDH 3TBVB 1H15A 2K78A 3EGDB 2R56H 5J56B 1NEPA 4LQ1A 3C5ZC 3UZQA 4S11A 3MLWL 4QRPB 1XSOA 2WZPD 1CQKA 4YDVA 4OT1H 4HKXA 4ZUWB 3EOAB 2VJ8A 2MNUA 4I9WE 4GRLA 4OR1A 3CZFA 3OLDA 4ZW6A 1T1WB 5D7EA 1UVQA 3U1QA 2DQIH 2JCCE 1RUKL 3GS7A 5I1LB 2CE6A 5SX4H 1ET8A 1HIML 4HIHB 3ZIYA 1FNLA 4Q9QL 4OCMC 1XF2A 4A67A 4HG4J 4RMTA 5AD0B 4KFMA 2CCVA 4RISH 1M6OA 2ZKMX 1RU9H 2V8MA 3HBPA 2AJZB 4NP4H 1WICA 2Z31D 3ARGB 2OQJB 2B20A 3QIWB 2DQDH 3QDMD 5A2JH 1SQMA 3OJDA 4JFFA 1UWGH 4GXUM 1OKEA 2QR0A 4ODVL 4V1DD 3DHJA 1HINL 3V8CA 3BLKA 4KKCC 4UM8A 1G9NL 5C0AE 4R2GB 4G9FB 5J3HC 5C92A 1V05A 2XWCA 5IREA 1AGFA 3ARSA 5I1JL 2B77A 1LMIA 1Y18B 5C0JB 2KLSA 4NKIH 5JHLL 5CP7B 4P48A 2BSDA 1R24B 2GABA 3M86A 3FO0H 4MD0B 1SN5A 2HVKB 2IV8A 1JMZA 1YNLL 3FOLB 2FJSA 4BFIB 3IKCA 1L3WA 1DQVA 2R39A 3B2DC 2ZIDA 3H0TA 1D6EB 1S7WB 4NN6B 4PTUA 3ESOA 3VXRE 4A55A 3CMOH 2AVGA 5AW0B 2VMDA 2DQ6A 4Z76A 5F6IC 2DW5A 3AWGA 3V6OC 4F24A 2XV6B 3ZKSD 5JOFA 2GITA 2WXIA 4S1DD 2VUYA 5DGQA 3GNMH 1NGXB 4ZT1A 5AW1B 5F1NA 3IGAB 1DQDL 4U1JB 1R33A 3V7MA 4F92B 1EEYB 3Q8FA 1OB1A 1N6QL 4K7PL 4IU2B 2YD3A 1KNOA 4KV5F 5E00B 3CPUA 2FAUA 2X87A 3BLBA 1A7PH 3IXTA 3LNDA 4J8QA 4YOKA 3ZKXC 4WUKL 2YXWA 4GJTB 3ABKB 3KYKL 5CEZE 2P80A 2YWYA 3F7VA 4BYHA 4KOCA 2G2RA 3WSQL 3VXSD 1A14L 1XGTA 4NUJA 5B1BB 1ZEAH 3Q9QA 1M7IA 1F58L 1CTOA 1FUNA 4PEEA 1M71B 4P2AA 2QADD 4J4PC 1CL7L 1RK1B 1WZAA 1YVLA 2ZOOA 4K8RD 1SY6H 4P9HC 4ZPVA 2B16A 1HU8A 3DTDA 2GSGB 2F0CA 2BVOB 4L3ED 2WP3O 2W0KA 2FVNA 1CGSH 3EGSA 4WW2F 1T22B 3QNXB 4HUNB 4RWYH 2NY7H 4TVPH 1NBVH 4IW4C 4WF7A 1OLZA 1UACL 3OJMB 3NCMA 2X38A 4OV5B 3SDCB 3NVQA 3ZL1A 1JSYA 1OARH 2LABA 2EO7A 2NNFA 2PNDA 3ARBB 3BMWA 4DP5X 2DKUA 2R2EB 5TDPB 4I9WD 1NBZA 1OAXL 4D3CL 3FO9B 2JTYA 3QQNA 3TA3B 5L2KB 5C6TL 2IBGA 1DQML 4TUJA 3O3BB 2Q8AL 5B39G 5C0NC 2NY1C 5HVGB 5FEBA 3I9AA 2W0FA 4NO3B 2N4IA 1I1YB 5HDWA 2KBGA 1VHPA 4ANXA 2QVKA 4F9PA 3DV4B 5JXED 4Q6IB 3MBEB 3MODL 3MI6A 1CDBA 1U2YA 4BWUA 2FIKB 1F3JA 3EF7A 1NKRA 2VQ1A 4LHQB 5AL0A 4FJYA 2Y1VA 1P1ZA 4G80B 2FEJA 4LSUL 2OYPA 4JFOA 1E3ZA 2WJ5A 4E0RB 1UKTA 2WWOA 3T3MB 3V0WH 5ABZA 2DTML 2BVQA 3CC1A 2H6PB 2H6OA 1HHIA 3OPZL 5AVTB 4EO5A 3BT2L 4WUUA 1MHPH 5E1GA 4ZTPH 3RURA 5ID1A 4J2XA 3MLXH 2DWSA 4K0OA 1U0QA 2DM4A 3QCTH 3GMLB 3QDJB 2IGTA 4GMSH 1MRFH 4OGXL 2F7QA 4LSRL 3WTVA 2BMKB 5D2NA 3ZMNA 2ROXA 4WJ5A 3G6JF 5JUEL 2BNRE 2F6AA 3AS1A 3HVNA 5DFAA 4FXTA 5AWNH 3IS0X 4A7VA 4CU8A 1U3HA 1ITCA 1VACA 2B5IB 2H32A 5E8OA 4R90L 1O0VA 3PDGA 2DTSA 1HKFA 3OC5A 3VXRD 1SEBB 1UJ3C 4YHOL 3BKYH 3T65B 4AV5A 3C6LC 4OF5A 3EH3B 5L8KB 4HZLA 4UT9L 3U9PL 4NZTH 5E2VL 1XAUA 3QG7L 5CEXB 2VDLB 1NM9A 2WMPB 3BSHA 1PD6A 4ICXA 3B9VA 3D0LB 4I18A 2AJXL 4FADA 1DJYA 3FU7B 4YDKL 3FQWA 3HEIB 4O5LH 1XZ0A 4PJFA 5T1JA 3WIAA 3DX6A 2X1XR 2APTA 1ZE3C 3EYFA 3EADA 1JNJA 2WXRA 1WCBB 5TD4A 3BDXA 5DD0H 2Z1PA 1GW0A 1MH5A 5F9JB 2P26A 4OW6A 5K9OB 2CR3A 3TZVC 5IQ9A 4RGNC 2A2QT 3WL9B 1ZHKA 1VPOL 2V9UA 4XN8A 4JJOA 3ZUCA 1DCEA 3CUPA 3KWTA 2OV0A 1T20B 1MREL 2NY2D 3BZEB 4AVJA 4YSOA 4XXCA 3P69A 4UAHA 3WS3B 3MRNB 4D0CA 4N9OB 4PV1C 1YDPA 2AEPL 4KH9A 1AOZA 3MR9B 4U2ZA 3QXDA 1YO4A 4BFFA 1U8LA 4LCUB 3MRDB 3FRPB 3AG1B 1BMGA 4TQPA 1J5OH 4GG8B 3S88H 2MOGA 3SO3C 2ZUYA 4QTHB 4RFOL 3ZTJH 3O9WC 2L0DA 1UB6A 2WKGA 4GBXC 4UDUB 1GC1H 1TEYA 3PXJA 5KJ7E 3DSNB 3UTSB 4YHPA 4NO0B 5FM8A 2YEZB 1M7XA 4IRSD 3BRDA 4LIQE 2CDFA 2X1WL 2PKDA 2R0LH 3QCVH 1EAOA 2FJFB 1MHHA 2ZWZA 4J3WA 4EZLA 5TQ2L 2YRBA 2VMJA 2X9ZA 4DUWA 2QQKH 3WJJC 2HFGL 1WV7T 2ORBL 4XO5A 2IMMA 5LDUA 4UQCA 5AEAA 2CO6B 1EEQA 1NC2D 4GUOA 1TTRA 3PYCA 1JZ3A 1FNAA 1U30A 5E2UL 1RUMH 3PWLB 1I75A 2UYLB 1KCVL 1HESA 4MA1B 2WINA 2D7MA 5FO8A 4Y2DB 4ZAKA 2XXFA 3BPOC 5JIMA 2IBBA 3QG6A 3IRZA 2GYSA 3I75A 3VAEA 2XY2A 4TUUA 3QULB 4JDVA 3QQ9C 2WBJB 2W9EL 4LSTL 1PKOA 3MMEA 1ND0A 4K3HA 4XBGB 2V9RA 5FGBA 3QUML 4UI2A 4IHOA 2A73B 4JZJC 1FH5L 4EUPH 5F0JB 1VKXA 5LQBL 2CO7B 2PPEA 5J06A 4N8CL 3W11C 3DX4A 5L6YL 1QUNA 5K39A 1UTDA 1AKJA 3S35X 1FL6A 5ECJE 4P46D 5E7FA 1OE2A 2R2CA 4XMUA 2R7EA 1MFEH 2F74A 5DYOA 5K5YA 2Q7YA 1X6LA 2VWEE 4X80L 4J6RH 4LEXL 4UB0L 3SOTA 5DI8A 3AUVA 3I02B 4K8RL 4WNSA 5MHSE 3ARDA 3CFQA 1AZVA 3PRZA 4BH7A 4RIRA 3K2IA 2LFEA 2CHZA 1K8DA 1O7SA 3C75A 3L3GB 4IDJH 2IADA 3RWJA 4YSUA 3NFPA 2DOCA 2QHRL 4LEOA 5ENWB 5IB5B 5C0GB 1TQSA 3QUKA 1U58B 4DWHA 1YEIH 1EHLH 1EZSA 3DHUA 3RUGF 4HULB 2GBAA 1UM6H 3FRUB 4NO2B 3KG5A 3BSZA 3PL6D 1KC5H 1UASA 4MJIE 4YL9A 4NQCA 3BZ5A 3ZIMA 3ZDYB 4F33B 4PGEA 1W80A 4Q97A 1Q9LB 2DJUA 1NIDA 1MRDL 1UHVA 2YD4A 3L81A 2AMGA 3HS0C 2WBWB 1E4KC 2LFGA 1SHMA 4PGCA 5EOQL 3AACA 3RY5A 2KC0A 2JLPA 4WTZA 4EOWL 5I1DA 1IZJA 5EZIH 2A83A 3DURA 4M6MH 1F41A 2YMXH 1VCAA 4MS8C 2HVBA 4BKLA 4AZUA 3ILDA 5CLYA 2PW2B 3PJSB 2R0KL 2VISA 3TGXA 2IQAA 1J1PH 3N50A 4RBPK 2CLZB 3M7OA 3VJ6B 2VE6A 3HPJA 3MO1A 4XPFH 5B7FA 2E76C 5BO1L 3C60B 1KYUA 2J8UA 4Y2NA 5LCVL 2E46A 4J8RA 1E7VA 3IGUA 3TVMD 3FMGH 2OK0H 3CVIL 2VABB 2WNGA 2WLYA 3EDEA 4U7SA 4RWHA 3QQDB 2J55A 1HZHL 1IC4H 5GJTH 1EGJH 1J7VR 4OAWB 3GIVA 1JDAA 2VH5H 3CFBB 2EVGA 1IBBA 1HC1A 3ESUF 1E5ZA 3PGCA 3BGFC 2GTWA 4JLRB 2OW7A 4PRPE 5T8IA 1K2DB 1IAKA 2XT1B 2HFTA 3INOA 3HAEG 4ILDA 3DIFA 3QZWG 3WY1A 2AJUH 5FHBH 3MRJB 1C5DA 3WHXB 1KJ3H 4WUUE 4NB7A 1MJ7H 2DI8A 5JA9A 4K3EL 3V52L 4DPAX 1CT8A 1BF8A 1DP0A 3MNZB 4PWHA 5IB4A 4F1SA 2AS5M 5D2NE 2Q3AA 1VJSA 1CG9B 2EADA 4BRJA 1QW8A 3AREA 4U6VL 4PJAB 4L23A 5DMGD 4P06A 1HEZA 1U95B 1NUDA 2I5YL 5G5DA 3VGAB 3DMMD 3I2CH 3B8YA 3PLYA 5TK2A 4ZX3A 5A6LA 3P4MA 4QD2E 1BJ8A 1MJJB 3K6NA 4NPYB 4JRFA 3I9IA 1TEGA 4JRXB 3KCPB 4FQIL 2WWNA 4GIPD 4YE4L 3WTYA 4M1DL 2Y36H 2G3XA 4OJYA 2HG0A 1E3FA 1QOKA 4JQXC 1NLDL 2VSMB 2DV6A 2VMCA 3ZDXF 3QAZB 3BQUA 4H88H 1TVDA 5AVYB 2RJMA 1LO3H 4PJFE 5K1NA 1P7KB 4Y7MA 2NY4C 4U31A 3MV8E 1EQWA 3TXAA 1H3VA 2B0SL 3ESMA 4P2QE 5JO5B 4Q9RL 5HPMA 4P2RE 1C12B 3SBWC 2C1PA 4P3CL 5ANMB 4PW4A 3TJHC 4D0BB 4JN2A 3GF8A 4M61B 1KTDB 3W0WE 4AYSA 1SVCP 4LCCC 4D2NA 3K71A 4EN3D 3GZKA 4ZJ9A 4FJZA 5K9QG 5K59F 5HI4C 2QV4A 3OKOB 2ZNWA 2BSRB 5IJKC 3L4UA 5GPRA 2BDNL 3UH8A 2G5BA 4TTDD 1T6BX 5FUZL 5CGBA 3WXWL 4MJID 2XQYA 3QXAB 5DJ8B 5ANHA 1YY8B 3U4BL 2HT3D 3B56A 4X6BB 4A6YB 1UZGA 2V2TB 1A7QH 2M26A 1OQXA 2BO0A 2CJSA 3MLUL 4PGBB 3MA9H 4ABVA 4H0GA 1LP9B 2FNWA 4HJ0D 1P7HL 4M48L 3ZTDC 2WB7A 8CGTA 5JW4N 3SDXA 2VM3A 2HA1A 1ZPUA 3GGWA 4XCNA 2AHIA 2WLNA 3FFCA 3JVGC 4H4NA 4ODXA 5B1AB 1JPSL 1T66D 3C9NA 4WU5A 4F7TA 4YJZL 3WFZA 4BGDA 4UT7H 4KHTL 1KGJA 4RRPM 4Z7WB 3BDYL 3R8BB 3EO1B 2ZP9A 2XTLA 4G43A 4U7KA 1XGYH 5CN3A 2NYKA 1MCKA 4PB9H 3PE9A 3VG0H 4PJ5A 2NY6C 4WHYH 5FK9B 5H4YA 4GH7B 3WO4C 2CGRL 5EZOH 2HFFB 2UWEA 4O51A 1JNLL 1FJ1A 1GR7A 3F7QA 4XMWA 3F01A 2VR6A 1AGEB 4PRPD 1E4JA 4JG9A 1WTLA 5CSZA 3S37L 3UACA 1TDQA 3T2OA 2RTTA 3FNKA 1MQKL 2Z1KA 1PZ2A 1YEDA 1DR9A 3B43A 4FKEA 4NZRL 4DQOH 1SLXA 5I1CH 3MNWA 4H8QA 1RZ8B 2BIHA 1F6FB 3QNZA 1PFOA 4M9OA 1RPQA 2V3EA 3LPFA 3M8OL 4PJ8A 5AG8A 1HCYA 3UG5A 4KY1H 2IAMB 1IBGL 1N19A 4LBEA 4AM0A 4AVIA 3VFSA 1P84K 2DQCL 4JO2L 1TQVA 4B6ZA 1IM3B 1DQJA 2ALAA 2Y5TA 1QBLL 2ITFA 2BSTB 3SDCD 1F18A 4RZCA 1E5AA 1MUJA 1OAQL 3FOMB 4OFYD 5TJWK 2P5WA 2KERA 1UGNA 4UUJA 3LKNB 4FOMA 1PGRB 3K6IA 2PP8A 4MRBA 3WEMA 4M8QB 2FX8H 2NLJA 2CO4A 5JDSA 4DFHA 4KK6C 2G3MA 4ZW7A 2UZYB 4H13C 1P0SE 1FRGH 2Q8BL 3ILQC 4XX5A 2NW2A 3GS4A 3Q1SH 1BJ1H 1EEZB 1NCOA 1YY9D 2IH3A 5CBAA 1ODAA 3LHPL 3MYJB 5FM4A 5HI5D 2W80C 5AAMA 4JAMA 1PSKL 2W59A 1IIIA 2XIDA 3LMJL 4GXVL 5CEYA 3BIBX 2YOAA 1NWPA 4NQCE 1DCLA 4XPTH 3GJEB 1I85C 2KZBA 5J6GB 2R1YA 4EBQL 1WWCA 3E6FB 1A6TA 3VRJB 1QSFE 2WWMD 3H53A 5D7KE 2HRGA 5DFVC 2OAAA 1WBYA 1K5NB 3C6EA 4JFUA 3T0EC 1SM3H 4KROB 3MV8D 3PWJB 4R8WL 4LT7A 2ZCLH 4HAGA 4P2QD 4UBDC 5F6HJ 3WFBH 5F70A 3A6CH 4P2RD 3KLKA 1KCWA 5I8EA 4XT1C 3G6DL 3W0WD 1IMHC 2BSED 3FYEB 1MCIA 2EIJB 4EUPA 5IQ7H 2DIJA 4N2CA 3VGDA 3P4OB 1KELH 3IE9A 5KVEL 2BHYA 4AIEA 3OC8A 2VZTA 3I6KA 4K9EH 4G8GA 5HJ3B 4NQEB 5GSRA 1U4FA 1CU4L 4JCMA 4IBUA 2BVPB 4IYKA 2LAGB 3O4OB 4XOCA 4XH2B 4QRRE 5HYQB 3SKMB 4PVLA 3FFDB 4XC1H 4YSSA 4LIQL 1MHEA 3WFEH 1LE9A 1VADA 4KJQC 3ESPA 5EBLB 2VDNL 5I17B 25C8L 4AC4A 4N2MA 1FAKT 4EF3A 4PP2A 5C09A 1JNHB 1WFJA 2B1HL 3B9EA 3T2LA 1TT6A 3C09B 1BQLH 4JFYA 4HS6B 4JQIH 1WRFA 2XV0A 3B7RL 4UT6H 3KXFA 5FPIA 5DJYB 5AOJA 3KPMB 3L1GA 4Q52A 3VFWB 3VFNA 3HR6A 3X13B 2JELH 1IEAA 1MAML 1OTUD 4G7RB 1KF9B 2EEBA 3CLFL 4W9FC 5DSCA 4FQXC 1EBAA 3SJVE 3HNVL 4JE0A 4WY7L 2H6UA 2C9SA 3K5RA 4U0RC 4TVPE 1LYQA 2PTUA 4B9IA 4NQVB 5D9SB 3CFCL 4JM2B 2PTVA 1MI5D 4AYGA 2ZX7A 5AOLA 3V0DA 4JFTA 1T5XA 4I3RL 5KSAB 4G7SB 3PWNA 3CTTA 3OZ9L 5SX4I 1LEGB 3HE7C 3RZCD 4Q74A 3E6HA 4ZOEA 1KWKA 1Y07A 2XNAA 4IGBB 2FLMA 3KPPB 5ITFB 2Y1ZA 2WPGA 3WN5C 3BKCL 3LCYA 1JRHH 2CK0L 3ZZSA 1U9KA 5I19L 4HCRL 4I0PA 2ZX6A 3F7LA 4H8PA 4J3OG 2DIEA 2BSSA 1C16B 4XGZB 4S1QL 2XZQL 2CO2A 5I2IB 4R4FH 2XYBA 4HQQL 3M45A 3BUDA 2YPVA 4Q0XH 4FHJA 4PLJC 3B9KB 1KY6A 2WLIA 3UIYA 1NIFA 3NIDF 2KT6A 4XVSH 2QKSA 1L0PA 4JFXA 1IU1A 4HP5A 3RKPA 3UYPA 4LF3A 4YPGA 3K6SB 3FN0H 1K85A 4NC1E 3EYVA 1KCSL 3B5TA 1NOAA 4GI9A 4U05A 1FDLH 4JQVC 4GAAA 5E6IB 1QLEB 5SWZA 2VDQL 2NXYD 4ODUB 3WTUA 3LZPA 4XTRD 1E4HA 4HJJH 5BUAA 2ADJB 4QXTB 3V2AR 4IK6A 5ETUB 5LN4A 3SIKA 4MQXC 3WJLC 3KL5A 3VACA 4FXKC 1QSFD 2V2XA 5D7KD 2JIXB 2XWEA 5E99H 4D8OA 1XCQB 4BQ6A 2VOTA 2VXQL 4OSUH 4FXLA 1CE1H 5AVZB 2X3CA 1J0YA 4DP0X 1II4E 2RFXA 4W9EC 3BRFA 3BCDA 1LO4L 4G6KH 2P44B 1NCGA 2K3TA 4GT7A 3DOSA 2ICWB 1IFHH 3FF8A 2R2BA 3RGVB 4B97A 4EDWH 2DQHH 1SFHA 4ZXBB 1YEGL 1I4FA 4APQB 3REVB 2NCMA 5DTFB 3O8XA 4M5TA 5D7SH 3FJTA 2VDRL 4NUGH 3EF4A 1T6VN 4P5TA 1OPGL 2BIPA 1QFWH 2W0PA 2XTJC 1TJMA 1FH2A 4OIAA 2J6EH 5H8DA 3TYFB 2C4FT 4G8IA 3OKKA 4TUKH 3ES6A 1BP3B 5ALCL 5E6RB 4OQTA 5I1KH 3T3PB 3QR1A 4LKXB 4WI0B 4QHLA 1BD2B 3E8UL 4NM4L 1XL4A 4LSQL 2PABA 4HEPG 3BP7B 1A21A 5GRUH 2MRYA 5KJRH 4ZMQA 3JWOL 3NIGB 4IU3A 3ZYOA 4L4TB 4HUWB 4TUOA 4Z7OB 1WITA 3ABZA 1OPOA 4DSYA 4D8PB 4OI8A 1IAMA 4OFKA 1R5WA 2Y5QA 4XNMA 1SGKA 3ZO0A 4IRJD 4PJ9C 3CK0L 3SJVD 2J1XA 3MXVH 2OR9L 4XWGL 4TVPD 3Q1EA 1XDTT 4CVXA 1DVFA 1B6UA 2I32A 4KKZA 2E47A 4XPGH 1KXVC 3DJSA 1AGBB 3EYSH 4MCYA 4NNXA 4JZOA 1PD1A 3QWOA 2FSEB 2EEDA 3AS2A 4MMXB 5IVXF 1HHKA 2DZEA 1RQ5A 2YQGA 2VRQA 2X4RB 1CPUA 3BVUA 4Z7AA 4Z3JA 2EXTA 2Y6TE 3WYRA 1P7QB 1IL1B 3OX8A 1NGYB 2YBRB 3CPLB 5F71A 2XOTA 1OL0A 2ENSA 3BC9A 4APXA 4Z7QB 3SDYL 5D96C 5FDWB 1HWWA 4W81A 4M6AA 4DFIA 3KDMA 1Q9OA 1C7SA 4JB9L 4PWJA 2NPLX 5DJXA 5EUOB 3BWUF 2HPOA 3RFZC 5J89A 3UAFA 4AENB 4MJ2A 4OLUL 4MNQB 4HFWA 1KENL 1A9BA 1WT5A 3RVXD 4WAFA 3EKCA 3VQMA 4POYA 1ZTXH 2FO4B 3G9VA 3MRRB 2TSBA 3H9YA 1HL4A 3ASWA 2C34A 4A7SA 3V6ZA 3RWEB 1A6AB 2YKKA 1S6NA 1PG7L 3MDJA 3QQ4B 3ESNA 3T2NL 5HHQB 3VFOB 5C0CD 1N59B 2R4RL 5F7NC 1KPVA 4MX7A 3V9FA 1KDJA 1MFBL 1MLCB 4QO1B 2LU4A 1WFOA 1UA6H 5EUKA 3BUQA 3FU5A 3CH8A 4K5LA 4XBMA 5LBSH 2NT1A 2JJSA 2UY7A 3KEDA 5CD5C 3NIFF 3U48A 3MV9D 1R1CA 2R1XA 1RZJH 2R29H 3VXMB 2A74C 1CIUA 4YSDA 5EU7C 4RAVA 5DK0B 2FEDD 4BA0A 1OD7A 2QGDA 2X9YA 5DUBB 1KGUA 5DA0B 3FZUD 3LPPA 2H8PB 4YN3A 3VFMB 3L08A 4N8UA 4Q14A 3DK2A 2M1KA 1RFDL 3D2TA 1D6VH 3APCA 4W9ZA 4ETQA 4FFTA 1F1GA 2B4CH 4LAQH 2OL3B 3BAYA 5E8PB 2AXHA 1FGNL 3C5ZA 3WI9A 2GIMA 2D7OA 2W9DL 3GMNB 4KTDL 2HT4C 3ZY7A 3FSOA 4TRPL 4M7LH 2R56L 3KXFE 4B7LA 2DQMA 3RWHA 2PWEA 1BOYA 1TZHA 3IETB 3WTSA 4HV8A 2UZPA 3RIFK 2AGJH 4OT1L 4Q8BA 2A77H 2VLKB 1F3DH 4HCFA 3H7BA 3MTXA 4AQ1B 4P57A 1PZAA 1BVNT 2OPCA 4R4BB 4LB8A 4Z3IA 2G5UA 1K8IB 1LD9A 2DQIL 3ZZLA 3CC5B 3US9A 1GY1A 3RA7H 5EEVA 3WNJA 4HEMA 4QHPA 1JHTA 2ZUSA 3HB3D 4ORGA 4RISL 3KE0A 1ODUA 4Y5VC 1RU9L 1JCVA 4XOAA 4JG0H 3B5GA 4NP4L 1XF3B 1RPUA 1EJ8A 5JDJA 5EA0H 4HC1A 2DQDL 2BVYA 2JXMB 4M29A 3L3KA 4NO5A 3ARFC 3IJHA 1UWGL 5C08D 4F15B 2Q86B 2X0UA 3W39A 3U6RB 2C4XA 1E40A 1S9WB 2VR8A 4MCZB 5FUCE 4CJ0A 5C0AB 1UD4A 4NHUA 5L2JB 5FYLH 3T6QC 4XNZC 4ERSH 4RA3A 4KBPA 5IROA 3ZDXE 2K7QA 3GUFA 3K8LA 1NM4A 3PF2A 3HE6C 4XXDA 3IDYC 2ZCHH 4NKIL 5GS0D 4FFYA 3F12B 3N1PC 3ELQA 3O6FA 1CF1A 3ZE2E 1T03H 4PJXB 5F96L 5SWZE 1KB5A 2YO3A 3SYOA 3WTTA 5GHWH 3V6OA 3H55A 2Y3AA 1FFNB 2F58L 1IEBA 4F37K 2HJFB 3CMOL 3AAZA 3S96A 4C8XA 3DX0A 3GWJA 4AQAB 5K59E 5AZ2H 2CHXA 4OZFA 4BE6A 7PAZA 4O02H 3HS8A 4FQJL 4GFXA 2W65A 5D4HA 2WIIA 3LZQA 4L8DA 3GINA 4JVPA 3BPCB 5LUMA 2BNUA 5BQDA 1J86A 3UTTD 3GNML 2CBOA 3A21A 2CBTA 1P53A 4M9PA 1TPXB 2V5RA 2EDNA 3S35H 1BX2B 1QRND 1JWUA 4W6XB 1NAKH 3GXPA 4ODTH 1A7PL 2AQ2A 2LU5A 2VB5A 3C5SA 2YA1A 1WIPA 3DX8A 1V3KA 2IVFC 1IM9D 3CN1A 3GTVA 4B0MM 5DJ2B 1A66A 5IBLC 2R0ZH 3CQPA 3QSKB 3DBSA 2PCPB 2ZTBA 4J4PA 4LLDA 3NCCB 3L9RA 1D5RA 4DZBA 1N0XH 1ZEAL 4AV4A 3VM7A 4HISA 5JXAH 1AQKH 2WVVB 5JPMC 1AE6H 4N2GA 3ECUA 3MA7B 3RVTC 1SY6L 4GI6A 3R8QA 3TEXA 1CVRA 1MY7A 4U6HA 3GK8H 3QIWC 1QASA 5M95B 1CGSL 2HX8A 2FWSA 1CB4A 4PJGF 5DZVA 4RWYL 1S7QA 2Z35A 5IHBA 2NY7L 2CRIA 1FSKC 3WKYA 4JFSA 4TVPL 1NBVL 2HFEA 3V4VA 1T0PB 1RHHB 4P4KD 3FO2B 4Z9KB 1ACCA 1MAJA 4PJEF 3OAZH 3QUZB 5ELIA 2NTSP 5JOPE 1OARL 3L3HA 3TT1H 1CFSA 1XF4B 3IPEA 2IWFA 5L0QB 4CGTA 3EW3B 3HI6H 4ODBD 4DH2A 3DX7A 3U46A 1W0VA 5I66A 1KT2A 1P6FA 4YLCA 4XHJD 4P49A 1JFHA 2FJHB 5E94B 4NQED 3SYPA 3B7YA 4FNUA 1F02I 3B2PA 2DDQH 2AZUA 2FBJH 3M1OA 4NN6C 2P45B 3H9SB 4LU5H 2A6KB 1L0YA 3SKJH 4WK0B 4UQBA 1BLNA 3STZA 4YHNB 3HS9A 4FQLL 2VDOB 5E5RB 3D69A 2HJLB 2OMTA 2WYTA 3BUYB 5DCCA 4KK8C 3V0WL 4G8EA 2HRLA 5T3XH 4ENED 1EFQA 3VGEA 1UM5L 4ZMPA 4NZ8A 1XGRB 4YBQD 1KLFB 1K4DB 1SQ2N 3QUHA 1MHPL 4FL4C 4IEFA 2EC8A 4ZTPL 2LGNA 1CO1A 2C7UA 3MLXL 5DVOA 2IXQA 2GBUA 1WBZB 3HG5A 3QCTL 3JV4B 4NUMA 5A3ID 4O2CA 5FCUH 5ICXB 4GMSL 4N2BA 4MHHG 3SKOB 1MRFL 4N3UA 4WWID 2XWDA 3ZSTA 2BNRB 1XCTA 1WC7B 4GG6A 2GG1A 2ILLA 3BPLB 4FQQA 4DN4H 5EF3A 1A4KA 4PJ7A 4JANB 2QMKA 1XO8A 5T1LD 5ID0B 1UJ3A 5AWNL 1IFGA 3DX9A 3QUYD 2E7LA 4L8CB 1AMXA 3R19A 2EXYC 4M5YH 2EDTA 2KS0A 5DHXB 5BV7H 3BKYL 1UXSA 1MFAH 4ADGA 3QP3A 5ITBH 3PQYA 1TVBA 1JK8B 1ZVSA 5EWIH 2BPBA 3MRKA 4HG4K 4CW1A 4BSJA 4NZTL 4A68A 1BPLB 1L5GB 4HWBH 1JV2A 5IZ7A 3NA4A 1ACXA 4PG9B 3RTQC 5KVGH 1IB5A 3OB0H 3T1FB 1HI6A 1G6RL 4XNUL 3ZW3A 4KDVA 2HLAB 4O5LL 3NSJA 2JB6B 1NMAL 1FL5A 1H15B 5KSBA 3ARBC 5DRWA 5IJVA 2PO6D 3TZVA 3LXBA 3PHSA 4AGLA 1U2HA 2QDVA 3FTSA 5D6CA 1J48A 3UZQB 3AG4B 2ZF8A 5C2UB 3TA3C 4BKTC 5DD0L 3X3GH 1J8RA 1R5VA 4HKXB 4LSVL 5BZWA 1JVKA 1IC7H 4HLZG 2EIMB 3WNIA 3RVVC 4GRLB 4Y19A 3CZFB 3DK0A 3WKPA 2GY5A 2H7WA 1UVQB 2JB5H 4ZMZA 1MZZA 2EC9U 3BISA 5KYNA 2MCAA 3K6FA 2B08A 1XF2B 1X44A 2UX7A 4HEME 4IOSD 1M6OB 5GRVL 3E9TA 5HVWA 2I85A 3J8F7 2G0KA 3O9WA 4GBXA 5DT1H 4W9JC 2P5EE 5LBSA 1IE4A 1J5OL 2CD0A 3B9DA 3S88L 3HVDA 5HHOA 3LKRA 2WO2B 3OJDB 2CUMA 4JFFB 1BF5A 3IU4H 3TF7C 3SDDC 1GC1L 1TNMA 2QR0B 4GRWF 1ACYH 2YPLE 3GPEA 2XICA 4H2AA 3GXIA 1NANI 1TJHH 4UM8B 5HBBA 1KGYE 2FT8A 2OMYA 5FW7A 2R0LL 3QCVL 4XI5D 2YS4A 1AGFB 5I1GL 3DJTA 4ZQTA 5KZCB 2QQKL 1A6ZA 1X4ZA 1Q0XH 2VN4A 1G4RA 3L3DA 4Z3EA 4DQAA 3NIDE 5D5ME 4A7GA 1GRWA 1NEUA 3IKCB 3JV0A 1PZ5A 2WXGA 4OJCA 2L3BA 1MIEH 2QVMA 3H0TB 4I1RA 4PTUB 5KG9A 4LE8A 3QPQD 4YDNA 4Z76B 4CMHC 3L17A 2BP8A 1EDQA 2W07A 3Q13A 5EB9A 3WAKA 5JOFB 5KS9F 3FTYA 2GITB 4OF8A 3U4BH 1BEXA 2WB1A 4UNTA 3T5WA 2WGXA 3KS0J 5F1NB 1Z5HA 1JBJA 5B1JA 2X2YA 1OB1B 3VD2A 4XPAH 3Q0HA 2FQFA 1CN4A 1KNOB 4S2SA 2BWIA 3LRSA 3EH5B 4NHCH 4AYEC 1B3IA 4LOUC 2E9IA 1MFEL 3IXTB 2QPFA 4J6RL 2J88H 3F05A 3UTOA 3F7VB 1NLBH 2G2RB 2DEXX 3IFLH 1XGTB 4IDJL 4NUJB 4JCLA 2YQ2A 1M7IB 2H2PD 4LLMA 5ISZA 4OZIF 1H9DA 1QTPA 1YEIL 1EHLL 3OF6D 3IDXH 1GMEA 1UM6L 4NKQB 1MWAA 1KC5L 4GKNA 3PNWA 1BJ1J 3K74B 3K72A 2I9LA 4I4WA 4PW3A 3ZKND 1HQRA 4L8SA 3EGSB 4CU6A 3WS6A 2V5MA 4JFZH 5IB1A 2UUDH 1BLIA 1LO5A 5E2JA 5I9QB 4ZX6A 5EZIL 5CHNA 1OTSC 1WWBX 4KRLB 2YMXL 4M6ML 3WHE1 1J1PL 1MHCA 4AZ8A 1NBZB 1OV8A 3W57A 1QPKA 4XPFL 1DJSA 3PP4H 2X4UA 3DO3A 4OCYL 4MA1C 4TUJB 5K1VA 1RY7B 4Y2DC 2W0FB 4PGJA 3FAWA 5G2NA 3FMGL 2OK0L 3DETD 4BZ1H 3CVBA 3MUJA 2WNKA 3B3BA 3NFNA 3QNYA 1DANT 1E6JH 4KKLD 5AW6B 2K4WA 5GJTL 1IC4L 3UG4A 3ZZQA 1EGJL 4MAZA 2ZWYA 3ZQ9A 1WGVA 3RNQA 1TTBA 2P5ED 1F3JB 2NNXA 2VQ1B 3CQFA 3A6BH 2DICA 3LNHA 1OCOB 5E9NA 2GTQA 4JFOB 5IVXE 4Z7NE 3EJQA 3VD1A 2H0EA 1RVFH 3ULVC 4M43L 2AJYH 2YPLD 4G9DA 2BVQB 2HMID 5DZAA 1L3NA 1HHIB 3B2UD 2X3AA 2QSQA 1B4RA 1PLGL 2AJUL 1AIFA 4PS8A 4JRLA 5FHBL 4WUUB 2I26N 1KJ3L 4WSKA 5ID1B 4QIRA 2UZXA 3MBWA 2HG5A 1MJ7L 1QYGH 1EWHA 4PR5A 4ZFOA 2EE3A 4DGVH 4J3TA 4E9TA 2J8UF 3UTQA 3BFWA 3J27A 5D2NB 4WJ5B 1ILSA 5BS0A 4R7DA 5LKNA 1G9MH 5E1IA 1NCCH 3TONA 3QJRB 3AB0B 1RURH 4GB9A 5FWRA 1NDMA 4CDHA 4PJ7E 3UTPE 1U3HB 1VACB 4QDGA 2H32B 2FQEA 4ZQKA 5E8OB 3L54A 2K9FB 3A4AA 3I2CL 5IW6A 4PREA 3PCYA 5JTWA 2XWXA 3UO1H 4Y2LA 1L9RA 2YGVA 4UOZA 4Z77A 2LLNA 3K4AA 4X6DA 1Y6MR 2N0MA 4HZLB 3ULUH 2H1LM 3H8NA 3II3A 1R75A 2WQWA 3VD0A 5DJ6A 2B1OA 3HTLX 2Y36L 4XVUD 3NIFE 2FX7H 3IRPX 1NEZG 4P2OC 2DLFH 1NFDA 1DEEA 4I18B 4IBTA 5E4IA 1AACA 1ZPLA 2D3VA 2YC1A 2BLFA 4TVSa 3UBFA 1VDGA 2XWJA 1JRHI 4H88L 3FQWB 4PJFB 1XZ0B 5FW6A 1JHLH 3EYQC 1LO3L 4S1SH 5MI0C 3R4RA 1NUNB 5T1MA 3UMTA 4XWOC 3EYFB 1ZLUK 4EIUA 1GAFH 2NDFA 4LCCA 1NCNA 1I9JH 2DKSA 4N26A 1MH5B 1XVSA 1J8SA 3C60C 5IBTH 4DP6X 2BW5A 2FECL 5EPMA 2Q10A 5IQ9B 1X9RA 3ABGA 1GTNA 4BGLA 5CR1A 2N59A 1ZHKB 5IJKA 1H0DA 4MQSB 3T0BA 3TWCH 3CUPB 2BHFA 2NMSA 3QUGA 1DUYA 1KBPA 1ZTXE 5JW4Q 1LNUA 4IKJA 4OM0H 4D0CB 1YDPB 3BAEH 4PWKA 1Z0NA 1QZNA 2F1EA 3QXDB 3CZGA 1A7QL 2A1WL 1U8LB 2DI7A 3MA9L 3OKEA 3ULUF 4GQ9H 2WQXA 3JVGA 1UA7A 5FKAA 2YWZA 3BVNA 4ZFQA 1UB6B 2C3VA 4LHUA 2JQZA 4C55A 4YHPB 4Y88A 1IBZA 2GJPA 3R1GH 4UT7L 2CDFB 1J8HE 2NZ9C 3RPIA 3HMXH 1MHHB 1UM4H 3VGFA 3TJEH 1XGYL 2HT2C 4D9LH 1LXMA 2WW8A 4PB9L 3VG0L 1TSRA 1QVOA 4JS7A 1UZ8A 2X09A 5TFSH 5G4NA 2WINB 3VWKD 5FO8B 4ZAKB 1R3HA 5EV7A 1PNCA 4TNWF 5EZOL 5KUMA 4AH2A 4NQQA 3EHBC 3QG6B 3HR5A 3I75B 4DEPB 4JDVB 3TFKC 1B4LA 2APXA 2FE0A 5I8CA 1QFWI 3ZVVA 2E6PA 2EDKA 2VXTH 1ND0B 1OOWA 2QPEB 3MMEB 4DQOL 5I1CL 4A2LA 4FNPA 4KHXH 4U1GB 4KKPA 4IHOB 4QHKJ 3CG8A 3ZUNC 1VKXB 4QR7A 4UZSA 5LXVA 4KY1L 1IKNA 4RLDA 1QUNB 3HZ3A 2WCPA 5K39B 1AKJB 5E9DA 1L0XA 3HRPA 1G7JA 1A0QL 1FL6B 3CSPA 4HMCA 3PWPA 4KGJA 1RUQH 4QAWA 4QRUA 3QYNA 2R7EB 4XMKH 3S3BB 2F74B 5DYOB 2Q7YB 4Q56A 4ZPTA 3ZK0A 1ZY9A 1D5BA 5DI8B 3IE4A 5AB2A 3ARDB 3VI4F 5CJXC 4BH7B 5DD3H 4RIRB 4X50A 4M4RA 2MFNA 1K8DB 2HVJA 1LE5A 3RWJB 2IADB 3Q1SL 4ZSOE 5F7EL 3RVWD 3NFPB 1UWXK 4LEOB 3QO1A 3V4PA 5A2IH 2V3DA 3H9SD 3QUKB 4JKWA 4E41A 4UMGA 5FYLE 5ISZE 1PZCA 4BHUI 5EC2A 3BAXA 4B7IA 4TSAL 1UATA 2XRAH 3JWDL 1CLVA 4PGEB 4NQCB 1NIEA 5HDLA 5EIVA 3WEXA 1R3IH 2DMGA 4XPTL 4UYQA 4XP9H 3AT8A 4P23D 1IGJA 4IRZA 4OUUA 3NJXA 5F7MC 1U8QA 2ITDA 2KYIA 3EYOA 4PGCB 5I1DB 1SDDA 2A83B 3DURB 2ZCLL 3SGJC 4UDTA 4JUTA 4BKLB 3WFBL 3HNSH 1R6VA 3QWRA 4WI2A 2XXCB 2UXFA 3A6CL 1ZD6A 2VISB 5IGXH 2IQAB 3MGAA 3D9AH 4XRCA 3D39A 1B0GA 2VE6B 1XXFC 3HPJB 3MO1B 5C0BA 5IQ7L 1VGKA 1KELL 2J8UB 3V4LA 4G5ZH 2K4AA 4IKIA 4A63A 4K9EL 4NQDD 4NZDA 4J8RB 1T7YA 1RPKA 4ZBJA 4FKHA 3QXVA 5BQ7A 5T3ZH 4B9PA 5JZ7D 2Y7OA 1B2WH 5L9DH 5JQHC 1BHGA 2MOQA 5FB8A 5EO1A 1LK3H 3GIVB 1T7XA 4U6XA 4WNQA 1HX0A 2V5TA 2DJMA 4XC1L 3WFEL 3PGCB 3ATFA 2GTWB 1WAAA 4GKSA 1IGCH 4KKRA 1IAKB 1E5BA 2IAMC 2JCWA 3GYRA 4CVZA 3DIFB 3SHSA 1GOGA 2JH2A 4WO4C 1C5DB 2GJ6A 1DFXA 3IJSA 1AHWA 1BQLL 1J8HD 4JQIL 4Z18A 3WIHH 3BJLA 4UT6L 4KVCH 1G7QA 2ATPA 4AGOA 3DX1A 3PUUA 1M7UA 3AMKA 5IB4B 3UEZA 3TH2T 3H3PH 4FE9A 4OD2A 3WY4A 4AVHA 4XP1H 1O7VA 2XN2A 3AREB 1HEZB 3DO4A 4UV7H 2HX7A 2PPDA 4RFNB 3OJ2C 3K8KA 4X8XA 5G5DB 3IGKA 3RPKA 2DLEA 1RIHH 2Q7AA 5D2LF 1NAML 1O75A 3P4MB 1Z2KA 4NKMA 1AZCA 2QSTA 1KXHA 4B60A 1KWGA 4G59C 4MAUL 4LP8A 1WF5A 3RX8A 3F84A 1FP5A 1JRHL 5FAAA 4L3FA 4KROC 1MXGA 3JWNG 1OVZA 3K91A 4JFFD 3BQUB 3GMRA 1RHFA 4Z3HA 3APFA 2DI9A 2Y2TA 4XCYA 4R4FL 1J87A 4Q0XL 1TQCC 3F04A 5HPMB 2CMRH 2IDCA 4MMYA 3VMNA 3I6SA 4ZMYA 2C1PB 4JN2B 1QSEE 4S1RL 5T3XE 3FN0L 4CC1A 4FC3E 3K71B 5LNGA 4OZHA 4JPQA 4CUCA 3N44B 1SHWA 4HJIA 1FDLL 1HILB 3EFOB 1AHKA 4YDZA 2AKRA 1OGAD 5FYLD 3ETTA 2Q0ZX 3LIZH 3QUXC 4HJJL 4MNGA 3WJLA 2G5BB 4MZRA 4FXKA 2Y2WA 5J57B 1I3UA 3ET9F 3S8WA 4YBLC 5E99L 5EOCH 1ORQA 4Y8AA 4WO0A 2NXZB 3LKOA 1VCBC 4OSUL 5H94A 3SDXB 4MDIA 3GGWB 4XCNB 5J7CC 4XN7A 3FFCB 3H9ZA 4ODXB 4YPJA 2VM9A 1MCRA 3C9NB 4WU5B 4F7TB 4G6KL 5CWSA 1J9TA 3FBKA 1H3TA 1OAZH 3CAFA 3LKSA 1W72L 5GZNA 1IFHL 1XBDA 1Q0YH 4NLAA 5CIPH 2DQHL 4G43B 4RX4A 4XOEA 3FH7A 3SBPA 4EDWL 1FG2B 1ZDQA 5KVGE 1PY4A 1ED3A 4MBOA 4PJ5B 5CD3A 4WFFE 4M8VA 5D7SL 4UAOB 1JZ6A 3MLSH 5KSAC 3WDIA 3IM1A 5F7BA 2UWEB 4O51B 2FGWH 1FJ1B 3P73A 1PYWA 4KX8A 4Y16A 1QFWL 3UEQA 4IGBC 3INUH 3ESVF 2J6EL 5CSZB 4TUKL 5HHPA 5I1KL 4QNPF 1XIWD 1YEDB 2NSMA 2YRPA 4F7CA 3QC5X 3MNWB 2OJEA 5GGTH 1X7SA 5I18L 3W2DH 4NFBA 5MEQA 5ALBH 2FLBT 3QEQE 4PJ8B 4OKDA 5DHYA 3MVSA 1ZLVH 2WXQA 1QFUL 3ECVA 2P8LA 1G5GA 3CVDA 2YAOA 1DVXA 4LBEB 5GRUL 4AM0B 5KJRL 1MDTA 1OXYA 1T2QL 4MAYD 2VRAA 3B9KC 2DBLH 3IVKA 2Y5TB 3AXLA 4RZCB 1MUJB 3PWPE 1OCZB 2P5WB 3AQYA 5HJGA 4UUJB 5HDRA 3TO2A 4B41A 3MXVL 1RZKC 2NSQA 2E5EA 2BM3A 1O9ZA 2V9QA 1GXEA 1JN6A 2NLJB 5JDSB 3U1PA 2FH6A 2OTPA 4XPGL 5F7KC 3WAJA 1B3JA 2F54E 3EYSL 1TXKA 1M2VA 2NW2B 3N85H 5CLWA 4UILH 2IH3B 4M3KB 3CZUB 2WO4A 2X28A 4MQ7A 5CBAB 1A1OA 1M2OA 2JSFA 4JAMB 4KFZC 5HDOA 1TO4A 2DYPA 5FYKH 3RFZA 2GC4C 2MSPA 3LH9A 1PD0A 3BPNB 5CEYB 2QPUA 4U1NA 4BCYA 2OR8A 3BRGC 1A4AA 4X9GA 3DNKA 2R1YB 1CFTA 2VZ3A 1A6TB 3VXUD 3QXTA 5DC9B 1WBYB 2CBQA 4FFZH 3CZLA 2WYZA 2K0RA 3BAJA 4M5ZH 3OSVA 2J21A 4JY5H 3RGVC 4JO8A 1UC6A 3BUBA 2R23A 4ZXBC 5I8EB 2JFCA 2Z8WC 1QSED 1HCVA 5T3XD 4F5CE 4EUPB 3D39E 2H1XA 3DXAD 1ZSDA 1I8MA 2JI3A 1WFNA 4GSDH 3DA0A 3I6KB 1UA6L 2EE6A 4G8GB 4P3DA 2YOCA 3D06A 3ISWA 1NC4A 2EH8H 5GSRB 5EHFA 3ZHLA 3IDGA 2WUBH 1RZJL 2WD0A 5KBNC 2R29L 1QR1A 2H47C 5FLVA 2MJWA 3FCBA 5I74B 4LSPH 3BH4A 1OCWH 3W38A 1MHEB 1HOCA 1LE9B 1VADB 1XMWA 2YPKA 5K93A 2Z31C 5INDA 1CLYH 5C0FA 2ZUTA 2QFRA 1RL1A 2NY3B 2YR3A 5C1MB 32C2A 4AIZA 3BVTA 1D6VL 2FO1A 3UP6A 3PDDA 2X2IA 2B4CL 4LAQL 3HAEH 2J5LB 4KRPD 4PP2B 3CLEH 5C09B 1KBVA 3HUJA 4A7QA 4L5FE 3GSNA 4JFYB 3V9EA 1NBCA 3DROA 1OWWA 2AP2A 2Q6WA 2VSDA 4ESKA 4M7LL 3KXFB 3ZTEA 5EU6A 2X6MA 3NDYE 1HWHB 4YVUA 1ZK9A 3VXTA 3VFNB 4F7EA 4OI9A 1TZAA 3FQXB 1IEAB 3MV7E 2AGJL 2BHZA 2IPTH 3RDTA 5DSCB 2A77L 3PPEA 4WFFD 5I73B 3S8FB 2JJWA 1ZLSH 4MMXC 1WFMA 5F9DC 2IDQA 2HSIA 1F00I 1WLHA 2AI0H 4FS0A 1T5XB 3P3TA 4KKAD 3RA7L 4EQ3A 3PWNB 5D1QD 4ZS6D 4JKLA 4YUEH 1O7DC 5LGHH 2ETWA 3E6HB 2NYZA 4YMPA 1DBBH 2XNAB 4RESB 4JG0L 1D9KD 3E3QC 4ZFFA 3QEQD 2X6BA 3ARWA 5B39A 3MREA 4NCDA 2XN0A 3LVEA 5EA0L 3MLZH 4TQ8A 1RSFA 1FVDA 4I0PB 1MRCL 1FNFA 5DVKA 4L1HA 4U1LA 4ZNEA 3TF4A 2BSSB 4NJAH 1HN1A 2HZHA 5IG7A 1E0OB 2AQ3A 2JE8A 3HE6A 1AJ7H 2PXYA 1THCA 4KJPD 5FYLL 1XF1A 4AMWA 2WLIB 3SQBA 4ERSL 3CHRA 4JFXB 2XC8A 3S3CB 3UYPB 4LF3B 3QQXA 4YPGB 1XGQA 2F54D 2MKWA 3EYVB 3HG1A 4JGJA 2ZCHL 4N2AA 4U1KA 3TYGH 4I1PA 4MS6A 5EBGA 4XNYH 1T03L 5SWZB 1WSST 4WWKD 4A66A 2ED9A 1DBKL 2V4LA 3OG4B 2YUZA 3MCG1 4LCWA 5F3BA 2C3WA 4K8RC 2BZCA 1FZJA 4HUKB 4QRBA 1Z0MA 4YX2H 2CLRA 2WXPA 3FHAA 3ZHDA 1LDSA 2IWGA 2OZNA 3HI1A 4F58H 1S2EA 5AZ2L 2V2XB 4O02L 2XTSA 1WZMA 5MEPA 2QQNH 4KKBC 4I85A 1FAIH 6FABL 3ZKQD 2RFXB 3K5SA 3NGBB 4IHBA 5KBLA 2XZAL 4NC0B 4BUHA 4GLRH 5JORA 2OMVA 5LNDA 3ULUE 1FFRA 3DOSB 3EAKA 1NAKL 2R2BB 2O6FA 3F5WA 1SZNA 1ZHBA 4ODTL 4HK0A 2ATAA 4JK0D 1QD0A 2J2ZA 1TF4A 5GISH 1MQ8A 4P04A 2IG2H 5MENA 1I4FB 4KI1A 2D0FA 5D1ZA 2CKBH 5C97A 1FNEA 1N0XL 2FWUA 2B59A 4YO0A 3MFGB 1KTJA 5JXAL 1AQKL 4P5TB 4QRAA 3ZTJG 2RAMA 2MQGA 4Y5XC 1BFVL 2D7TH 2Y6SD 1I1AA 1NCBH 3OKKB 2PCXA 2GQHA 3ES6B 3GK8L 4G8IB 3UC0H 2QKIC 3CE1A 4QHLB 2NY0B 1EUUA 5HGBA 1XD0A 2WUCH 5CCHE 1DVZA 1PY9A 1TETL 1F13A 3MCYA 4IU3B 5KBMA 4TUOB 4KK9D 3VWJD 3EJCA 3K6DA 3MV7D 1GYAA 3MNMA 4IJ3B 1R5WB 2CAKA 4XNMB 3TT1L 4X42A 1AH1A 5ACLA 1QHPA 2YGQA 1FA4A 2PETA 3HI6L 3ARTA 2M2DA 1T7ZA 3RAJH 3ZT5A 4CVXB 1DVFB 3AABA 5CLXA 1E65A 1ETB1 3HC2A 3VUAA 4MCYB 4NNXB 4JZOB 3QWOB 2WKOA 3GBDA 2DDQL 4U49A 2FBJL 8FABA 1HHKB 3B2VH 1D2OA 1LWRA 1T80A 3E38A 4LU5L 4MD5A 2YAEA 2DWYA 3OX8B 3SKJL 4TNWK 4IS6A 4APXB 4ALAH 1EO8L 2FATH 3JBG7 3KDMB 1Q9OB 5DJXB 2NSXA 3RY4A 4AQZA 5A2KH 4D94A 1JG9A 2APBA 4JL2A 2HN7A 4OJEH 2D73A 3O45A 5T3XL 4AGNA 5DJAA 3DJ9A 1RZGA 1YZZA 4HFWB 1A9BB 3VGGA 1OE1A 1ETZA 3E1ZA 1TPXC 3ZE0B 4DIXA 1LEIB 2YA2A 3BP5A 3R18A 4UTBH 4LOEA 1AFVH 1RJCA 3IMUA 5FCUL 3V6ZB 4CSPA 1JNNH 5CILL 5FGCE 3RWFA 2A5UA 3D0AA 2L04A 4KTYA 4GMTH 4DN4L 3QZMA 1KPVB 4MX7B 1E2WA 3S37X 4N5UA 2WLLA 3RBSA 5SX5K 1OGTA 2AITA 5EUKB 2NR6D 2GB2A 2UY7B 1G5AA 4M5YL 4HJTA 5BRZA 3MC0A 4K15A 2R1XB 5BV7L 4UTAH 1TJGH 1J9SA 1G7PA 1MFAL 1E8YA 4RAVB 1ZE3H 5FGSA 3N0PB 3QHFH 1P4LA 4JG1H 5ITBL 5KVMC 3MLYL 1NJ9A 5EWIL 4XP5H 3RTQA 4GQQA 2ESVE 3D0VA 5K69A 3DI3B 1CICA 4MVBC 4HWBL 4FN0A 4ETQB 3HCVA 5BJTA 1WYJA 4BWWA 1ZXQA 1BQ5A 5KVGL 1N9PA 3C5ZB 1U8HA 1DHKA 3QUZC 3ULUD 3HUJE 4IRSC 4ONFH 1BXAA 2ZKWA 4Z7VA 4GG6F 2VMFA 3P40A 4IJTA 2WQVA 4FTVA 4X6EA 5EU6E 1YMMA 2J44A 3BX7C 2GVYA 4K2UH 3N9GH 1WHPA 3RWHB 1TZHB 1WDAA 3NZHH 4HV8B 5EG6C 3NDZE 4X5RA 1IC7L 1U8IA 3D12B 3WNLA 3V7AG 4FFZA 5ERWA 3D4CA 3H7BB 3OM3B 1ZTMA 2Q3ZA 4P57B 2JB5L 4PSPA 1UB5A 1LD9B 1OSEA 5D1XD 3Q48A 3ZR6A 4FULA 1JHTB 3WFCH 1U8MA 2AK4D 4ORGB 3LTVA 1IARB 3AT9A 2FYYA 2DLGA 1BREA 5DT1L 4JREB 3FSVA 3SDDA 1MVUB 2ERJC 2X42A 5KSBF 4AQEA 3L3KB 5T3ZE 4NO5B 2JLLA 4J3OH 3IJHB 4XR8C 1VRSA 3IU4L 1XEDA 1UQSA 4ZNEE 1ACYL 5CJBA 3W39B 3NJJA 1XMEB 3PP3H 2ZUUA 3FCGA 3QC6X 1TJHL 3QRGH 2I27N 5E6SB 1W0WA 1KJ2L 3BPLC 2X9XA 4NHUB 2DIBA 3D52A 4XHQA 3RHWF 2YUWA 3BE1H 1UCTA 2F7OA 2LOEA 1FWXA 3VXOA 4PVMA 2OXHA 3WE6A 4XXDB 1BYPA 5CJQH 3FF7A 1Q0XL 1X5FA 3NEXA 4N28A 5EU3A 1XH0A 3O6FB 3RRQA 1S7VA 1PW3A 4FQ1H<