2N0MA

The solution structure of the soluble form of the lipid-modified azurin from neisseria gonorrhoeae
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
b'ATAGNCAATVESNDNMQFNTKDIQVSKACKEFTITLKHTGTQPKASMGHNLVIAKAEDMDGVFKDGVGAADTDYVKPDDARVVAHTKLIGGGEESSLTLDPAKLADGDYKFACTFPGHGALMNGKVTLVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipid modified azurin protein
publication title The solution structure of the soluble form of the lipid-modified azurin from Neisseria gonorrhoeae, the electron donor of cytochrome c peroxidase.
pubmed doi rcsb
source organism Neisseria gonorrhoeae
molecule tags Metal binding protein
total genus 36
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2015-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2n0mA00
1KCWA 3QJSB 3FU9A 1ET8A 1TKWA 2FQFA 1SFDA 1NIDA 2VSMB 4A68A 4M4RB 4P5RA 2YXVA 1ILSA 2RACA 1N68A 3DKHA 3D12B 4HCFA 2CCWA 2XX1A 2FTAA 3PAZA 2PLTA 2GC4C 3NJMA 1NWPA 2XU9A 3N2JA 1WA2X 5I6PA 3X1FA 3T6VA 2IDSA 1RCYA 1DZ0A 2UX6A 1OCRB 1OE3A 2HX9A 2YXWA 2ZWNA 1GSKA 4G70B 3FSZA 2BW5A 1AS7A 1GY1A 2FT7A 3NJHA 2IDUA 2HRHA 1OOWA 4KO9A 3SBRA 1SF5A 3FS9A 1QLEB 4GP8B 2PPAA 3EH3B 1X9RA 4UF7C 4BK5C 1TU2A 3FU7B 2XXGA 3FPYA 2DWTA 2PPEA 1W8EA 1FA4A 2FQDA 2GC7C 3FQYA 2IH9A 1BXAA 5F7AA 7PAZA 4F7KA 3WKPA 3FQ2A 4A2GA 8PAZA 3JT2A 5D4IA 4E9VA 2DWSA 3OMNB 1M9WA 1FFTB 3CDZB 1BQ5A 2DV6A 1VLXA 1NIFA 3KW8A 1AZRA 2QT6A 4BWWA 2P80A 3WG7B 1MDAA 1L9RA 1FWXA 2J57A 1PLAA 9PCYA 4NERA 2YAHA 4KO7A 2HX8A 1URIA 5I5JA 2YAFA 3CVDA 2BHFA 2XV0A 4KNSA 3EH5B 4Q89A 2PCYA 1ZPUA 2VMJA 2E86A 3PPSA 3V9EA 5I6MA 3MX0B 3S8FB 2BP0A 5TK2A 4YSOA 2DYSB 3L45A 5PCYA 4AZUA 3ABLB 2UXFA 2WO3B 1J9TA 4HAKA 1ZIAA 3IEAA 1JOIA 2PP8A 2BP8B 4YVNA 2IDTA 4G7SB 5PAZA 1V10A 5B1JA 3TASA 1KGYE 2UX7A 1PLCA 2EIJB 4BWUA 3NJNA 4AKPA 1A3ZA 4KNTA 1AG6A 2YAOA 1A4BA 2YAQA 1XB3A 1KV7A 4G71B 3CVBA 3ABKB 4DP8X 1SHXA 3T6XA 3FSVA 1ASPA 2R7EB 3AG1B 5TK4A 1KCBA 5I6NA 2YARA 2PPFA 1AAJA 3S3BB 5B1KA 2H47C 1ASOA 1AS8A 1KDIA 3DTUB 2FQGA 4YSSA 2BO0A 2FT8A 1AG0A 2IWKA 4Q8BA 3CDZA 3C75A 1SJMA 6PCYA 1AANA 1E30A 2BZCA 4E9QA 5B7MA 4YSDA 4E9YA 4A2EA 1PZBA 5IY5B 2Q9OA 2PPCA 1E65A 3DIVA 1SNRA 3CVCA 3WNJA 1ILUA 4AKQA 3OM3B 1CYXA 2X88A 2YAEA 1JXFA 4YSTA 1OE1A 3WNIA 3FQ1A 1OE2A 1JZHA 2UXVA 3AZUA 1J9QA 2Y1AA 3TBCA 4HCIA 4YSEA 6PAZA 2HXAA 1ETJA 1WAEA 2UXGA 3PCYA 1NIEA 4E9SA 1UATA 5E9NA 1WS8A 3FSAA 4A67A 4BDVA 3GDCA 3IE9A 2R7EA 2PPDA 4GYBA 4YL4A 1PCSA 1RZQA 2MTAA 3SBPA 1AZCA 4PCYA 2FQEA 3KW7A 3NP4A 2J55A 4L0PB 3UGEA 2IWFA 3UAEA 4A66A 3EF4A 2GIMA 1JXDA 4BXSV 1JERA 3FU8A 3FYIB 2YAPA 2CBPA 3NSCA 4AI7A 2FJSA 1A4AA 1A4CA 2B08A 1ADWA 1PNCA 2J5WA 3NSDA 4G7RB 2OCCB 4TXVB 1XMEB 5I6OA 4K9JA 5B1AB 3AG3B 3UACA 1NPNA 3U25A 1PZAA 3CZUB 3NSYA 4AKOA 1J5CA 3ASOB 3BQVA 5B7FA 2QDWA 4DP2X 1E67A 3CG8A 4GP4B 5EHFA 1WA1X 2CUAA 4CSZA 1WA0X 4F2EA 3FT0A 3G5WA 2WSDA 3QJQB 4BWTA 1F56A 1IBYA 1EZLA 1JZEA 4EF3A 2P80D 2AZUA 3ASNB 2BZ7A 5B1JC 4M3HA 2XV3A 2VW6A 2JKWA 2IDQA 4DPCX 1BYOA 3IBOA 3OMIB 2I85A 3ZDWA 3HB3B 5B7EA 5FC9A 1JXGA 1NIAA 2XWZA 4JKNA 1AZUA 2IAAC 2HX7A 3NJKA 2HZHA 3NJJA 3ZX1A 2H3XC 2BW4A 1MZYA 2QDVA 5I5IA 4FAAB 2XX0A 2Y69B 1BQRA 1SDDB 4NAJA 4ZK8A 4A2DA 1WS7A 3GXUB 3H4FA 1SF3A 2W8CA 1AACA 3FU7A 3AG4B 3PLYA 1OF0A 1OCOB 1ASQA 3UABA 3QJTB 1AZNA 4KO5A 2VM4A 2IWEA 2BWDA 4KO6A 4E9XA 1YLBB 2FNWA 4N4YB 1V54B 1A65A 2ZONA 1NTDA 4DP7X 1GS6X 1KYAA 1GR7A 3AG2B 1NWOA 3ZIYA 4NB7A 1CC3A 3OD3A 4BXVA 1KBVA 5D4HA 1JVOA 1J9RA 4MFHA 3QPKA 2EIMB 1IBZA 3OQRA 1J9SA 4DP9X 4E9RA 2W88A 1N70A 1BAWA 3NSFA 4YSPA 3SQRA 3QJVB 1EHKB 3N55A 1BXVA 3JTBA 2YQBA 3X1GA 3IN0A 3BVDB 1BYPA 2X87A 1M56B 1OCZB 3FPXA 1V55B 2PCFA 4HCGA 2MRYA 1W6WA 1CURA 1NICA 2VN3A 1AIZA 4DP6X 3S3CB 3ZBMA 4CSPA 1RKRA 2FWLB 4AX3A 2JXMA 3NJGA 4GY4A 3PAVA 3T9WA 2BP8A 2I7OA 4KNUA 4FA7B 2VSKB 3QQXA 2GI0A 2EILB 1AOZA 2CJ3A 1GYCA 5AKRA 1E5YA 4QLWA 4JHVA 4WKXA 1PAZA 5AFAA 3AW5A 1M57B 2QPEB 2CAKA 4A2HA 2HLEB 4G7QB 4E9WA 3MBWB 4QKTA 1MG3C 1MZZA 1JZFA 1TEFA 2PP9A 3WI9A 1RZPA 1X9UA 1NZRA 1ZDQA 2OJ1A 1SFHA 3S3DB 2GBAA 1CUOA 4YVUA 5D4JA 2AVFA 2AZAA 1L9QA 2TSBA 2IH8A 3EHBB 1L9TA 2EIKB 1GY2A 1HFUA 3NYKA 3T71A 2GHZA 3AY2A 2XVBA 1J5DA 3WIAA 2QPDB 5F7BA 2XYBA 2BP0B 2H5UA 1A8ZA 3H56A 3ABGA 3ERXA 1ET5A 3FSWA 4W9ZA 2I7SA 1L9PA 3WKQA 4YSAA 1GS7A 1ZV2A 2VM3A 4N8UA 4YSCA 5LDUA 2XUWA 4YSQA 1GS8A 1I53A 1HAWA 1IUZA 2FT6A 4E9TA 3OMAB 1GW0A 1IKOP 2JFCA 1XB8A 1PY0A 1B3IA 4KOCA 1DYZA 2DYRB 2VW7A 4DP4X 3S8GB 1HAUA 5A7EA 1BEXA 1OCCB 3X1BA 2DY2A 5I5MA 1E5ZA 3TBBA 1AZBA 1PLBA 1AQ8A 3X1NA 1ZIBA 2IDFA 3PXLA 1AS6A 4RH4A 2XV2A 2XXFA 2ZXWB 3TA4D 4HHWA 1BQKA 1MG2C 4PAZA 3T6WA 1IC0A 1JZIA 2J56A 4HZ1A 5ANHA 5I6KA 3SBQA 1R1CA 5I28A 3HEIB 4DPAX 2N0MA 3QJUB 2NRDA 5B1BB 4UAHA 2Q5BA 3IN2A 2AANA 3H4HA 4HIPA 5I6LA 2EINB 2XLLA 2YAMA 7PCYA 1TEGA 1NINA 1NDTA 4A2FA 2A3TA 2GSMB 3EH4B 2TSAA 4DPBX 4JHUA 1PMYA 1T5KA 3QJRB 3GYRA 1JZJA 4KOBA 1PNDA 2WO2B 3X1EA 4ENZA 3V9CA 2BWIA 3UADA 4YSUA 3NJIA 4BDVB 5AZUA 1SHWA 4WTQA 5I26A 2HRGA 4DP0X 1CYWA 2CALA 2VW4A 3ABMB 4YSRA 3PAUA 1JVLA 2AFNA 1L9OA 1PZCA 3NJLA 3NP3A 4HALA 3RYMA 2OV0A 1W6LA 4GP5B 4W1TA 2B3IA 1L9SA 1JZGA 2GB2A 1OV8A 3NT0A 3UAAA 1SDDA 1NIBA 1BXUA 1KBWA 4P5SA 3TU6A 2LLNA 4GXFA 2ZOOA 4UANA 4F2FA 1NPJA 2UXTA 4DP1X 5B3SB 4HHGA 3NJFA 2PP7A 1ET7A 3FYEB 1QHQA 1ZDSA 1XB6A 1KDJA 1QNIA 1AR1B 3T6ZA 1PF3A 3X2QB 4X4KA 4DP5X 1ID2A 4G72B
chains in the Genus database with same CATH superfamily
3MJ6A 2XZCH 3QC5X 3W11C 4XI5D 2A9BA 3D9AH 1OZUA 3B7UX 4UIKH 1HL4A 4PLNC 3MUGB 3N0PB 1KGCD 1KSRA 4FMKA 1Q90A 2DD8L 2RCSL 3PIQB 4GG8B 5D2NB 4A7TA 3M8OL 3OTTA 4P4KA 5E5UB 3SGKA 1G9NH 4A37A 3NABH 5DEFB 1W15A 2DH2A 3QUGA 4ODVH 1N8ZA 3B9DA 2AJVH 1U8HB 5D1XD 3ULVF 4RGND 2VISB 4YXHH 1U3NA 4FYTA 1WA2X 5C07D 4NBZB 1C5BH 3CSFA 3G5VA 1NGWB 3D4CA 3FL7A 3W39A 1OCRB 1OE3A 4WHDA 4Z3TA 1T6BX 3HE6A 2WWKT 1P6AB 4HJ1A 4DERA 2F19L 4BFIB 3B7SA 1SYVB 5LNGA 3UYOD 3V79C 3NACH 5ICZA 3INUL 4OM0L 1S78C 2IGFH 3OLDA 4QI3A 3E0GA 5JMOC 2CK0H 3HUJB 2XKSA 2Q10A 2XXGA 3LVTA 5KYUA 4I18B 3LIZL 4XCCH 4WUUB 4Z7UB 3RVWC 2BVOB 3EXLA 4PJFB 2K6WA 1RPKA 1DUYA 1SQ2N 2JKNA 2QKSA 3I75B 1BXAA 3BKJH 1YDPA 3BVUA 3GSXA 3QVAA 3TM6A 43CAA 3GSVB 4LDEB 3SZ6A 3OB0K 2BCKB 4OCNC 3QK0A 3UG3A 3S48A 4H20H 4NENB 3GGWA 1QRND 4M8VA 3VRIB 3KW8A 2VH5H 3CN4A 3PL6B 4TSAL 5EOCH 2YHGA 3TN0D 4X9IA 5KYWB 5HJGA 2D7OA 1R5IB 4PLOB 1IV8A 4IBQA 1N0XL 1DEEA 2EIZA 1NLDH 3F5WA 3MLSH 2BHFA 3LZPA 3FCGA 1R75A 3GSQB 3FT3B 5FB8B 3CDGB 5E00B 1QKZL 3IU4H 2VIRB 1S7VA 1AI1H 2PP8A 3TA3C 3ZY7A 1F1GA 2GFBB 2KS0A 1J5IA 2EUZA 15C8H 2IFFH 1OKEA 5A16B 2ZPKH 2FX7L 3AB0C 5HYSA 4JRXE 4X4ZA 2R56L 2D7QA 3N1MC 1RIHL 1J8HD 2IIJA 5F7DA 3UJTL 3FFDB 5FYKU 3RPIA 3CZJA 2AS5M 3P3UA 2GY5A 4M5YL 1AQMA 4IRJA 4UT9L 2P5WB 5KVDH 4TUUA 1KV7A 1QSEA 3EYSH 1GHFH 3BDYL 3P11L 5EZJA 3ABKB 4L8DB 4CUCA 4Z7WB 1EDQA 2IALB 4EDXA 3TLRA 1NKOA 5LGKA 1FV1A 2PPFA 1IAOB 1JTPA 1VSCA 2NOYA 4QUOA 2MCPH 1KGXA 3HHRB 2E7DA 2VYRE 1AG0A 3O3AB 2YKKA 4D3CL 1WFUA 4XC3L 2DIJA 3RU8H 4C56D 4N0RA 5T3ZH 1GZQA 4EUPB 3P4NB 3AWFA 3H7BB 5D7JA 1AGEA 2DKUA 4ADJA 1W8OA 2L4OA 3QULB 4KTDH 5EC2A 3CVCA 2OMWB 2ZIDA 5GGVL 3CFDB 2IANA 4B3VA 5I74C 3V6FB 5J57B 5IBLC 5LHDA 1RIUH 2R2HA 3VGBA 5D5ME 2EABA 1EV2E 2Q3AA 4XN7A 3RIAF 2VDPH 3H9SD 1M7DA 2K4WA 2QQKL 2I26N 4LLVB 1HS6A 5FHAH 1KNOB 2R39A 4HX1B 4CVUA 4GO9A 1OAJA 5F89B 4UV7L 5F6IB 1BEYL 1U95B 1KJ2A 3VNZA 4Z3HA 3O8XD 5DR5H 4X6CF 1II4E 2NY0B 2YBRA 3N42F 3P3SA 35C8H 1GMEA 3V4UH 1S9VA 1L7IL 3NIFF 1UD8A 1FCGA 5IWLA 4LL9A 4QRSA 5HHOD 3HR6A 2MTAA 4X6DE 2ARJA 4MJID 4NZRH 4PTTA 3ARZA 5ERWB 1J0KA 3SPIA 3AMKA 4E42B 5IFJB 5EOTA 5I8KH 1NFIB 1K2DA 1SUHA 1SEBA 1GC1L 2WN3A 5FKAB 4MAZA 4IJ3B 3REWB 2CHWA 4ELMF 3C60B 5IJDC 4ZW3A 2VLME 4GKNB 4NCC2 2R9HC 1WWBX 4KHXL 4S0SD 2OL3L 3FC8A 3NA9H 2LU3A 2WQVA 2AAVA 2V9RA 1A47A 1OCWL 3KM2A 4FTVE 5FYJU 5F1OB 2WVSA 5I1AB 3QUZA 1FL3B 4JFDE 3U25A 3OKEB 3NSYA 1BVZA 1IGFH 3D18B 4KK6C 4ZFOB 3ASOB 4GRLB 2YD9A 5JR1H 3T3PB 2QDWA 2ENYA 1S5IH 2QKIC 1U91B 4GP4B 3ZE0B 5I19H 2NX5B 3CIQA 2A6IA 4GBXC 4RFNC 4MJHA 5C09E 1SY6A 1JK9A 5ALBH 3VCLB 2GJPA 1Y7VA 5CR1A 5IEHB 4G8IA 4Y19A 1MCWW 5JZ7D 1G7PA 2IXQB 3KJ6H 5CEZE 1G0YR 5JHBA 3TO2A 1A7BA 1BYOA 4WHTB 3RUGA 2Q3XA 3KPOB 1UJ3B 4A6YB 3L9BA 4YK4C 4WFHD 1A9EA 1U42A 3GHEH 1FBIL 2JLPA 3OKDB 3R4RA 3KLHC 2ZE0A 1RPUA 2HX7A 3N3EA 5EMYA 5KBNC 4AQEA 2XSKA 4UTCA 4M7ZC 4NZ8A 3RHWF 4LBAA 4PRHA 3QUXD 5CM1A 1QFWL 2QVFB 3U2IA 2GQHA 3NRFA 1CFVL 1ZT4B 3L7EA 4F1ZA 3U7WH 1AGBB 3CFJB 5IVXE 1TZGH 2WXRA 1JF1B 1Q9OA 3QJTB 1ZTXL 2EEDA 4KZCA 2D0HA 2E9JA 3RVXD 4TRPL 1MFNA 5CEYB 4BGLA 1YLBB 3V5HA 3ULVL 4DP7X 1RVFL 3FT4B 5KS9E 3ZTJH 1IGCL 1QFWM 1TKWB 3HZKA 4BXVA 1EHAA 2WXLA 2FH6A 3TEYA 5E5MB 3ARBB 3OQRA 4PJGF 1MCQA 3MI6A 3OPZH 4UOQA 1Z9OA 4XWGL 4DP9X 5C7XL 2DQIH 1AVAA 4PJAF 4FG2A 1MRCH 3MLZL 2C9VA 1EHKB 3FTWA 2AAAA 4OCSH 3EYVA 2HPOA 4QRPA 3SJVE 4J2XA 2V5TA 2UY6B 4HKJB 3MV9A 1OPGH 3ELQA 4ZMXA 1SZNA 5BS0B 4Q4IA 1R5VA 1CICC 4PREA 4NO0D 2P5WE 3MA9L 3QO0A 4MHHG 4WI4A 5DZLA 1TR7A 4PRID 4G5AA 4EN3C 3DJSA 3K0WA 3ARFD 2VSKB 3QIBA 5KWYC 3DRTA 1LEIA 5AW9B 5E2UL 1A4JB 3HC3H 4X0KA 1ULVA 4AYFA 2QLYA 4MS8D 4Y2OB 4ZTPH 1MAMH 3NUKA 4KKNA 3ULUD 1QI4A 5JPMC 4JPWH 5FUZH 4PJ9C 1UB6A 3OBAA 1MFAH 2JSFA 1BDYA 2WZPA 1RUPH 4HOXA 4LDLB 2O6FA 1RZ8B 5DTFB 3EH1A 1JS4A 5D9SB 3DUSB 4KRMB 2D7PA 4HMCA 5AAWC 2FBJL 1S7WA 5H37A 1C1EL 1TPXC 1NFAA 2QPUA 3BVNB 3KYKH 3NCJL 2X1PA 1IBGH 5SV3A 3IDGA 1MXGA 1L9TA 2UVEA 12E8H 4BH7A 5DJAB 2JV6A 3TT3H 2E6PA 3K80A 3L3HA 1RZJC 4AEHL 5F3HA 4MVBD 4IIZA 1GH7A 2QADB 4U0RB 4CBZA 1FYTB 4LCCC 4AYDC 3A0OA 3FRPG 3KVPA 1E9QB 1LWJA 1FNSH 2AQ1A 2I7SA 5DT1L 5E4EC 3MRNB 1TNNA 4M7LL 4ETYA 2F8IA 3L3JA 3SN6N 4YSQA 3EJZC 3IFPA 2BFVH 2WXQA 5MEOB 3ZTJG 2FK9A 5AYTA 3OMAB 4X5XB 1F45A 4YHML 1DBMH 2YD1A 4EI5B 5L2JA 2YD0A 1T2XA 3LRLA 3QIUC 4YXKH 4X5QA 2HSIA 2Y7MA 3GJFH 2C4FT 2WY3B 3KPSA 3TTYA 1TZIA 1AZBA 1N3NA 2EDBA 3BW9B 3HG2A 4GUPA 2VLKB 5TE7H 1XD1A 4U31A 2XWTB 3A4DA 4GW1B 3SKMA 3WE1A 1AY1L 1UGKA 2BCMA 5T3XL 4GFXA 3FU5A 1JRHH 1S7TA 1N18A 1U58A 5ESAB 2RQ8A 3WTSA 3RI5K 1A3LL 4XCNA 2F6AA 1TDQA 4LPCA 43C9B 1EH9A 2JELH 4JN1L 4V1DE 4X6BA 3M17B 3HPLA 1CGSL 2QJDA 1B90A 3LKRB 4X42A 2HMIC 3EFOA 4NQXA 4HULB 2D7TH 2DM2A 2AQSA 1DN2A 1V7ML 3POHA 5JUEH 2NX5E 2JJUA 1M7IB 1B6UA 4GQ9L 2BY1A 1KT2A 4DQOL 4WK2B 4I4WA 4PW3A 3VRLF 1T1XA 4K94H 1JGIA 1JV2B 1Q38A 3KXFA 2BRQA 3UTTB 4O2EA 3E9TA 3B8YA 3CSPA 2YPLD 4PYHA 4AGLA 1U33A 1AYRA 3Q13A 4OAWA 4ANUA 1KBKA 3AXIA 2BP5M 4UQ9A 5EU5B 1SMDA 4FXGC 2VTFA 3SQOL 5DLML 5C6TH 3OZKA 4P4KB 4ZD3L 5AVTB 3NJIA 1D7FA 5DYOA 1X5FA 4N5UA 3BUPA 2KDGA 1N8ZB 3DXAE 3GSNA 4QGTA 5JOFB 1CVSC 4PRAA 4E5XB 4JM4L 1BW8A 4OZIF 1TSHA 1ZLVH 4ABWA 1QLRB 1UXWB 2ADJA 5KVFL 1G7MA 4NZUL 4QCIA 5GZOD 3TPKA 2AQ2A 3GC3A 3HE6B 4OKDA 3KLDA 3P0VH 4YWGH 3BISA 1RSYA 3BWUF 2CQVA 4A55A 4JGUA 5CJ5A 5ICZB 1YNKH 4R7NA 1JZGA 2B1AL 1EZVX 1C5CH 3LQAC 4P2OA 2YOAA 4GAJL 1G6VK 4QNPF 4GXFA 4AQ8A 3TFKC 4MA8H 2DLHA 4NI3A 1MFCL 1KXQE 5KYUB 3MLTB 5DJZA 2Q0ZX 3QNZB 1DBAH 2MNWA 4M8UA 3CUPA 3HPJB 5IR1A 1AR1B 1PF3A 1YEJL 4KKAD 4MB3A 3GSXB 2J6EH 2D7NA 5GHWH 5DFTA 2F9BT 1CL7L 4NWTL 5IM7A 3BQUD 3H9YA 4BFJA 4W4OA 2UZYA 1IKFH 1D5BA 1XEUA 4HPYH 1JYXA 4MZ2A 4AVIA 2Z34A 2OS7A 5BS0E 5JHDA 1DEEB 1ZVSA 3F5WB 2OI9C 3V4PH 5HHNB 4JRYD 4GH7B 5IP4A 5EEWA 4Q6KA 4ZXBC 3V0JA 3HMWL 1ITCA 5DCCA 3N2JA 3A4FA 4J3WA 3R7RA 3C8HA 2NNFA 2Z8VC 4UT7L 2E7MA 4Y9CA 1S7VB 4HXAL 1W72A 3B2XA 3W0WB 4DN4L 4JQXC 3L1FA 2LAAA 1L9NA 5HYSB 1JGUH 4XO8A 3OZLA 4XO3A 5LXGH 1GPOL 4TNWF 5AZEH 5SWZD 3DX1A 3RPIB 5M94B 4OZ4A 4OZFB 4PQXA 1IFHL 1QSEB 5B39B 1IIKA 1KBGH 5EZJB 3WEMA 4BSWA 1A7PH 1KACB 4PJCB 4EDXB 3HZMB 1C08A 4RMRA 5D1QD 4JG1L 5AOLA 1FV1B 1F4WL 2GC7C 3LN4B 4JFQA 2XWJB 1FIEA 3QG7H 4YEFA 2VZUA 3GI8L 3BPOC 1HL5A 2DJSA 2DWSA 3D05A 1FYTE 4Q0XL 1AGCA 3APFA 3O6LL 3O45A 1MFVA 1GZQB 2ZTBA 5DWUL 2W91A 4OFYD 1MLBA 1BVKA 5EO9B 3KWUA 5D7JB 3WIHH 1MDAA 1NDGA 1J87A 3BH4A 1CTMA 1UD4A 3BKCH 2IANB 4O2CA 2DF3A 1S8DA 3L3OC 3V9EA 2Y0SA 3EJRA 3FAXA 4DKFL 4XCEB 2ITDA 3WY3A 3V6OC 3LS5H 4MD0B 5IHZB 2BS71 1WAAA 2P5PA 4YDLC 3U6XA 5AYQA 1NCAH 1CFMA 1TTCA 1FGNH 3RGVC 4FS0A 3CLWA 3U83A 1PLCA 5I24A 2BOCA 1F5WA 3QZPA 2WPGA 3IGAB 3L4TA 2ICEA 4FN0A 2NY6C 4M5ZH 3HI6H 2YBRB 5EEXA 5T1LD 3TBWA 2P5EA 5HYFA 4JZJC 3GMNA 1OT4A 3IFNL 4DP8X 1YEEL 5H4YA 1AFVH 3WUWG 4QHUB 2ISDA 2OAAA 1JHTA 3KVDD 5EF2A 1WJ3A 2ARJB 3L9YA 4HUUA 1YUHA 3GBML 4D9QD 4LCWE 2SODB 2XQBL 2YFNA 3T6QC 4IJTA 3CDZA 1RULL 4K5NA 1AXSA 3VSTA 3MNZA 4EKXA 6PCYA 4KTYA 1KULA 4XI5C 1FIGH 2WXPA 4LKCA 3F7PC 4OLVH 2ZXCA 4Y5VC 5IHUH 5LB1A 3JZ7A 4ALAC 4XBEH 3ULSB 1UT2A 4PYGA 1QUNA 5LXVA 3OXRA 1F2XK 4Y7OC 4O2FA 1VFAB 5BZXA 2Z7WA 3VWJD 3QUZB 1F90H 2YAEA 3D9AL 2WWKO 1HZHH 1ONQB 2XKNB 4NQUA 3UTQA 4ZZFA 1R3IH 2EVFA 4BV1A 5FYKH 1DQKA 4BCYA 2YEVB 5D1XC 4X6EA 4RGNC 3ARPA 4PUBH 3GMPA 1HSBA 2VDNH 1TYJA 3SCMA 4P3CL 3TP4A 4WTWA 25C8L 2A6IB 3PGCA 3FT1A 1G9NL 1FORH 3NABL 4P2QA 4ONOA 2DI7A 3JVGA 3OGOE 3P3TA 2ZUWA 2CBMA 4ODVL 4BEIA 4Y19B 2AJVL 2AI0H 2ZOTA 4H25B 1S3KH 2W95A 1IC5H 2HTKD 3LPFA 5EBLA 4A67A 1AYOA 2RA1A 2KBGA 2ALWA 1C5BL 3GDCA 3IFOB 4ONFL 5K9KB 3TO2B 2CRZA 4OB5L 4KKRA 3RUGB 5HPMA 3NP4A 1A9EB 4LCIH 2OJZH 4TNGA 3L3IA 4LOFA 1EGJH 1QEWB 5ECJE 4YIQA 1GKOA 3ASWA 2CK0L 4NQEB 4X4XA 1UXSA 4XODA 4XC1H 3UBXG 3PWNB 4FYQA 4K3HA 4YDVB 2QZ5A 1YMMD 1RJYB 4PRNB 2X6MA 4QWWC 5CSZA 5T5FH 4AL8H 1RERA 3TN0C 1JHLH 2YGOA 5B1AB 1BMWA 3O3BA 1Q9OB 4AYGA 4OQTH 1GZPA 4IW4C 3VB9A 2X6BA 2XTSA 4P57A 4TSCH 2AMUA 1WK0A 1RK1A 2DWEA 5EOCL 1LO5A 3HZKB 3RWIA 1X5XA 1P4LB 4JJOA 2LLLA 4G11A 3LKNA 4OZGA 4TQHA 1QG3A 3I6KA 4LAQH 1KC5H 2L7EA 1JWSA 4W9IC 5FEBA 3MLSL 2BIIA 4U4BA 4R6UA 1PX8A 2EADA 3TBYB 5IUSA 1ZSHA 2WZ6A 3QFDA 1MY7A 15C8L 1JPTL 3PV7A 4ODSL 1NIAA 4PRPB 3MRRA 3HNSL 4LSRL 2RIKA 3T5WA 2K7PA 1DJHA 1M71A 1P1ZA 1XSJA 2WCPA 2XWBB 3BAWA 3QIBB 3QQNA 2X28A 1LEIB 1T4WA 1I1FB 4J1UA 3R8BB 3LRSB 3CN3A 5KVDL 5FYLL 5DJXB 2VXVH 2LU5A 1GHFL 4OFVA 1LK2A 1R24A 3GXUB 2OQJB 3SIKA 1LQSR 4NQCB 3N44B 2QFPA 3TZVD 1UB6B 1TTFA 3CH8A 2MCPL 1XBRA 1CI3M 2X9YA 3BPLB 5GGRB 4HBQA 3IDXH 4JRXA 5GGTL 2ZONA 1M6OA 3QARA 4KWUA 2DDQH 3QIWA 4ORZC 4B5EA 3QDGA 1F4XH 4ZRGA 1NPUA 4HIJA 4MFHA 1CU4L 3VD9A 3C8DA 1J10A 3ALXA 4DUVA 1YQVL 2B1HH 2H4EA 3IDGB 1SRDA 3NVQA 3QJVB 1OLLA 4NO3A 4WSKA 4XP9H 5JYLA 4BH7B 1YEGH 1A1OA 3IN0A 2WLYA 1VADA 3FPXA 4IIQB 1UD2A 1FAIL 2JB5H 4HK0B 4FZEH 4LEBA 4AJWA 4KDTC 2W9DH 3U4BL 3PFQA 4MXQD 4DP6X 4UNVA 3VXMD 4F8TA 4N0YH 1IMHC 3WN6A 2CMRH 3ZMRA 3D0LB 1KWKA 4I85A 3L3JB 4AUJA 4JAMB 4N2BA 1JMXA 2D3JA 3QUMB 4WU5A 4F7CA 3R19A 4FA7B 1Z5HA 5DR5L 3IM1A 3MFFB 2YRBA 4HT1H 2YN5A 3TL5A 3C5ZB 3ZL4H 3S5LG 3U7AA 5D5MA 4OCYH 4XE0A 4HZLB 3DX7A 1KGCE 3AW5A 3SDXA 1A2YA 2WSPA 4HSAC 3MCYA 5JIPA 1TZIB 1H8SA 3ARVA 4FQQA 4KXZI 4Y9BA 4U1IB 5TE4H 2VZTA 2H32H 2WQUA 4JO1H 4FFZA 4GQRA 3D51A 1EDHA 4GUPB 5FLUA 4LQ1A 5T1DH 2V3FA 5HHVH 3U30B 3ISYA 3SKMB 4NUGL 5DURB 1X9UA 2OJ1A 5C07E 1S7TB 2G3ZA 3AREA 3RWCB 1ANUA 4XCNB 3PREA 2A77H 3Q2CA 4LIQE 3ILEA 3HS0A 4X6BB 2IBBA 3HPLB 3L4XA 4BCXA 4ZMLA 1ERNA 5CGMA 4NQXB 3O3UN 1IGFL 1IAIH 1VEPA 2AKRB 2BJML 3SYOA 4DAGL 1ET5A 1CJYA 1KT2B 1HXMA 1NEPA 1U8CB 2Z3FA 4I4WB 4OJEH 5IBUG 3ZUNC 1T1XB 5JR1L 4YFEA 3WFCL 1ZV2A 2VM3A 3VNYA 3LH9A 4XNYH 1Q0YH 4UTAH 1LDPH 5E8DH 5DJ6A 5DRNB 5BZDA 3T2OA 4C59B 1HIMH 2OMYB 2JFCA 2PXYB 4H0IA 4ZOEA 1QRNE 3KJ6L 2R0KL 1KZQA 1LO3H 4JFDA 3QUXC 2DRUA 3OHXB 4IBZA 5D55A 2C9XA 3SHSA 5F7MC 4MQ7A 3SOTA 5I8CA 1HZLA 2GT9A 3HS8A 5CZVH 4PJ7A 4DGUA 1I3GH 4H0HB 4KY1L 4HSCX 3GSNB 1KYDA 1X6LA 1U8PA 4UIMB 5HHQA 3DWTA 1Q1JL 3G6JF 1F6AB 5C09A 1AP2B 3BDBA 1G7MB 3ARRA 3NBNA 4QCIB 3T4YB 3RVXC 3TF7C 4O02A 4H8UA 4XP5H 3VI4F 5ANHA 3WNKA 1KIPB 3SBQA 4R7NB 3HZ3A 5I28A 3G7TA 1RP8A 4KRLB 4P2OB 3ZE1F 5DJCA 2NY2D 4UAHA 4NM4H 1J8HE 3BLKA 3CBKB 1QVOA 4LRIC 3W37A 5J12B 1NINA 3MRLA 2D31A 5DWPA 5IR1B 1ETB1 1ES0B 4NKIL 3DX2A 4JUTA 1U8LA 1TETH 1AD0A 1EVUA 3ZDXB 3QAQA 5IM7B 4J6RH 3E6HA 4F7MA 1XF1A 2EDTA 4JHUA 2ZCZA 4ZFZA 1U21A 5IVXA 3HB3C 5A2IH 1IRAY 2APSA 3MRFB 1KF9B 3ARFC 3BFOA 5FO7A 1FFRA 2Z35B 2GSIA 3UADA 5B3JE 2GJ6A 3OGCA 3O3DA 5DJYB 4G8GE 4HIEA 3WJMB 1T6VN 5KS9A 1MNNA 1E5CA 3TA3A 2CALA 4JG5A 3P77A 4YSRA 2VAAA 3VFRA 1R3HB 3ULUC 1Z32X 2F7IA 1KYFA 3I3EA 3O2VL 2OMUA 4XPBL 4L4TA 2VDLL 1TQCC 1KN2H 1K4DA 2BIHA 1Q72L 1UWYA 1AXIB 3B3IA 4QTFA 1MAML 1S7QB 4I2XA 4C83A 2C9SA 4D0DA 3ZDYE 3HJEA 1S7UA 2VDRH 2LLNA 4D9LL 2VM9A 2WLLB 1MFAL 5E7BA 4BSWB 3V95A 4DCQB 5EFIA 3LHAA 3MV8B 4P46C 1EEZA 1LD9A 1A1MA 2EDYA 3CSTA 4LU5H 4JFQB 1A5FH 4MVBC 4WEMB 2CBTA 2WXOA 3O4OB 2I27N 2F7OA 4X4ME 2GTWB 1CBVH 5HHOE 5KTEH 4N0UA 4MLSA 1OAYH 4MJIE 2EYTB 3EF7A 3O45B 1MCHA 3TNMA 4PB0H 1PKQE 4JR9L 12E8L 1E27A 4A2MA 1MLBB 1BVKB 4OJFH 2FNBA 3Q1SL 2BSSA 5F7YC 4XPGL 1XH2A 3WKNA 3WENA 1NDGB 3C5JB 3SE8H 3LKPA 4AVHA 1PG7H 3B2MA 5EZPA 4O2CB 1A9BA 1AGDA 3PAZA 2GC4C 4KTGA 4URKA 5I1KL 1TTAA 2K45A 2X4TA 4H88H 2AXWA 3OXSA 2XYCA 2HX9A 3VDBA 1S7SA 3X3GL 3CPUA 4G5ZH 3EO0B 1DBML 2ZYSA 4LPWA 1TO5A 4LSPH 2FT7A 3U7YH 2EDJA 1OOWA 1NCHA 3BZEA 4C57C 5IQNA 2BOCB 3EFDH 5CF3A 3QDJB 4GKLA 3CVHL 1MXDA 2JLLA 1OD7A 5IHWA 3VQ1C 2HPTA 2BP3A 4GB9A 4R90L 4U1NA 2VMCA 1NGYB 3VM7A 1FA4A 2OXGA 2X2JA 3QA3A 3WBDA 2YXMA 1JRHL 3F7QA 5BOZG 1TYRA 4POUB 4MNGE 1YUHB 3FQ2A 5C0AE 1XF2A 4B95C 1XZ0B 2BMKB 3IMRA 1MFBH 4XZUA 5EUKB 4GG6F 3GTVA 3CDZB 2ZUSA 1AXSB 1UZ6E 3GBEA 3MNZB 1T83C 4K3GA 2HJLA 1HWWA 4LKCB 1B0WA 3QJZA 4LCYA 3BUIA 4U33A 4Q9RL 4XWOC 2D7TL 1DVUA 3WG7B 3AS3A 3LH2H 4G2AA 1SJVA 4NUPA 4XMPL 5JUEL 1DO6A 3TEWA 5TJWK 2PCPB 2EYSA 4TYUA 3CVDA 4K94L 2B16A 3NPSB 4PGBA 3ME0A 1UA7A 2DLFH 2QKIA 4WY7L 3S8FB 2RH0A 4GXVL 1ZLUK 3ZE2F 4AZUA 2F58L 2BNUB 3UTQB 3FOLB 3E6FA 4CSTA 3D08A 1ZLUH 3KWTA 4YDKH 2D3VA 2VXTL 4YX2L 4G7SB 3M7FB 4QXGH 3SCMB 5C6TL 4CMHB 3FTGA 3MACH 4KI5F 1KGYE 3JTTA 3PGCB 5GZOC 4XN8A 1XGQA 4N6QA 1JNHA 2PYFA 4PJBE 5CKAA 3OJDB 3QHFH 4D8OA 5F7LB 5LNEA 4G71B 2XBDA 3GXNA 5EBLB 3WFEH 3D52A 1S3RA 1AHKA 3S2CA 5I6NA 2GKIA 3DX9B 4JM2F 1W80A 1AAJA 4YWGL 3P0VL 1UM6H 1ASOA 1P4IH 5HHMD 5J13C 3PWVA 5D2LB 3MRQA 4WU7B 4X99B 2J1WA 4YSSA 3L3IB 2AK4B 5FM4A 4KKAC 1REIA 1F41A 3VFSA 2VQ4A 3H3PH 4X4XB 4IDLA 3BQUC 1PFCA 3F6IA 1FNGA 4MA8L 4ORGA 1U3YA 3LEVH 1MCRA 4Z3FA 3BP6A 4ONHA 3HLAA 1DEDA 7TAAA 4NZJA 4OR1A 4ESKA 4OF6A 2J6EL 4G7VL 3RAJL 1JN6B 1GZPB 2X9XA 4EUPH 2YKLH 4ACTA 5AUMB 4PJXE 4LOUC 3SO3B 1H0DA 4P57B 3V4VB 1TT6A 4YSTA 3ULUE 1IKFL 3SDAD 1BQHA 1RK1B 1KN4L 5EZIH 2AEWA 2DWEB 4UT6A 3VGHA 5EEVA 4B9JA 2DQCH 2ERJC 5DQJA 3RWIB 3TBCA 3V5DB 3AQXA 4NO5B 4W93A 4OZGB 3WO3B 3I6KB 4NNXA 1GMIA 1KXQA 1JWSB 4IQHA 4Q9QH 4HIQA 4P9MH 4O58H 4HWBH 3ZDZE 4ZUWA 3PCYA 1T4KA 1QYGL 3P9LA 3SKOA 3WHE0 5I8OL 4ZMYA 1IT9H 1IO4C 1ADQA 5E6ZA 4PGDA 4EN3A 4HF5H 2R8SL 1OAKH 1K5WA 2EO9A 2ZCKL 4WWID 1H8LA 1AZCA 2XOTA 2GK0B 5FGBC 5HDBE 3MRRB 4QHMA 4U6TA 5D1QC 4I3SH 1M71B 1P1ZB 1CGXA 2WNGA 4PJEE 2XJLA 3NAAL 5HXMA 4UMGA 3GS4A 1HNGA 2DWYA 4MKTA 4N8VG 5JPMA 1UXMA 3FYIB 4ZOAA 5AZ2L 3HMXL 5BNXD 3EOYG 5EA0H 4PJ9A 3T3MB 2GEQA 1EERB 4KQ3L 3BD4A 4Y4HD 1U4FA 4YFDB 1G43A 3GK8H 3VWKD 1A4AA 1A7PL 1FDLH 3BE1H 3DOSA 2CHZA 2K9FB 3LH8A 5T1KA 1K3ZA 6FABL 3LPOA 2AJYL 5AAWA 1EZSA 3VXPB 2DIBA 4BFBD 3BMVA 2XFXA 4DVBB 5C0RL 2VR5A 4XMLH 5E03A 3QIWB 1OY3B 3BQVA 3L54A 3QDGB 3CG8A 5T33L 4N9GA 1WA0X 1PY9A 2WSDA 4LCCA 4OZHE 4IBWA 4G6JH 2VRKA 1XXDC 2EXSA 1TJMA 5FOJA 1XMWA 4NO3B 4I0CC 1NANI 5E24E 1N9PA 3FONB 3QO1A 1VADB 5EF0A 2EYRA 1X7TA 2ICWI 1U92A 3LS5L 1ZEAH 3ZQXA 3IBOA 3LRHA 3FT2B 3ZSSA 3CZGA 1IBBA 1QFWI 4KVCL 4BQ9A 4EUPG 2GI7A 1MI5B 4CVZA 3QIUA 4XNBA 3DTXA 3UJJL 1XR8B 3HI6L 5I17B 2EH8H 2QDVA 4FAAB 2D0FA 5BCAA 2XX0A 3QWRA 2Y69B 3NIGE 4A6YH 3BGAA 2ZUQC 2Z91A 1FG9C 3AMLA 4P2AA 4RDQF 1G94A 3SDXB 3JWDL 4ES8A 3CZFA 1AACA 3NEEA 4TUKH 3N06B 2VLRD 4FQQB 4ZNEE 5JNYA 5HYIA 2CO1A 1KGWA 4JY4A 5I1HL 4TVPH 5DHMC 4JVWA 5JW5A 4YHPA 3MFGB 1A65A 1N0LB 1YPZF 3QUKB 4R4ND 5DF0A 1HHGA 4LBEB 4OQ1A 2OYPA 5IHUL 5DGRA 3MJ7B 4PR5A 5DS8A 5FF6B 4ISVB 4Z95L 1I9JH 5F9JA 4YGVB 1A7OL 1F11A 4UT6H 5FOBB 2P26A 2KZWA 2F5AL 1LP9B 3ZHLA 3MYJB 2A0LD 1F90L 3JYBA 4LCWA 4R5XA 1R3IL 1BAFH 3ROLA 4L1HA 4L0ZA 1NCGA 1HXMB 3LOWA 3MX0A 5CILL 2HTKC 2J8UF 4PUBL 4BHUA 2L7UA 1OP3H 1MN4A 4FXGA 2J1XA 2COVD 3Q2LA 4ZDHA 2BP8A 3MMEA 2R1YB 2VJXA 4MCZA 4OIIH 5DJ6B 5E8PA 3JUYA 3CU7A 4IOIA 4NM8H 2NYYD 3DHMA 5D2LE 1BWWA 4WKXA 5AFAA 1HQ4A 1UOWA 4MQ7B 5I8CB 4FFYL 2GT9B 2HT3D 4PJ7B 2KLRA 3QYNA 3BSZH 3UP6A 4TLKA 4LCIL 3C12A 4Q7DA 1U8PB 3ULVD 1TEFA 3VXUD 3N41B 5JW4R 2AEOA 4U1KA 2UZIH 3H6JA 4O02B 4XC1L 2WNKA 1LMKA 2X42A 4WI0A 3NSXA 3SODB 1WV7T 4HFWA 1X5LA 2BVQB 4RSVA 3TJEL 5EUOF 4A7SA 1DP0A 5DJCB 1QAWA 4NKQB 4OQTL 3RG1C 1RZJH 1J5DA 1CLVA 2MCG1 4F8OA 1YYCA 4ZW8A 4ZX6A 3GWJA 4TSCL 3IDYC 2FBOJ 3L16A 5GIRA 1IBDA 3OAYK 2D31B 2EVIA 2PF6A 4NXSA 1W0VB 3UTZA 4PD4K 5IQLA 1AD0B 5D1QE 4L4VA 1ZE3C 1JD9A 1UUNA 4YSCA 1KC5L 3E6HB 4APXA 4F7MB 5I73B 1U8OB 3C6LC 3GPEA 4FXLA 4HDIA 4XXWC 1QACA 1BZQK 1BAGA 1RSFA 1UASA 3BZ5A 4NKOB 4ZXBA 5HVFB 2YRZA 5FO7B 4L8SC 2GSIB 3FQ4A 5D7IE 1IEHA 1BQHG 2GJ6B 1BEXA 3OGCB 4UQ2B 3K2UH 1H8NA 1XR9A 3HG1D 3P77B 1EJ6A 3X1NA 1Z9SA 2VAAB 3AB0B 4JQXA 3VFRB 2OBGA 3BJLA 3H2WA 3GI9H 5F3FA 4HHWA 1GCFA 2OMUB 3BVVA 5FYJL 1UEMA 4PAZA 4AMKH 4L4TB 4KZEH 3O81A 2OMZA 5HI3C 1K4DB 3HHMA 3OR6B 3UMTA 1X5MA 3EGDA 3QPXL 3IMVA 3B3IB 1CDIA 4I2XB 4C83B 1MAKA 2VJ0A 4D0DB 2CBQA 1UTDA 5AW6B 2ZQKA 4IYKA 3ARYA 4JPIA 1BOYA 3IDXL 3RZWA 5EFIB 2YAMA 4DTGH 3EG9B 1ODUA 2E9IA 1EEZB 3MSPA 3SGDH 2A3TA 1F97A 1F4XL 2GHWB 1KY6A 2XA8L 4X4YA 2ZF8A 3U1SH 2J88H 3O0LA 4N0UB 4MXQC 3MRGB 4R83A 3HJ0A 4HV8A 2B1HL 4D9QE 1X5AA 3TNMB 1WBZB 2NY5C 1E27B 5I74B 5LGHH 3L3OA 1QA9A 3NPZB 3X1EA 3I84A 5A40E 3DBXA 3NCYP 3LKPB 3EYQC 3T4AB 3HUJF 3V6OA 1LO0H 2W9DL 4PLJD 2JF1A 1HESA 4N0YL 3AGVA 2XZZA 1INDH 2QBWA 2CMRL 3TWCH 2ZXBA 4HISA 3RGVA 3ZZSA 3RA7H 4Z7UF 2VXQL 4JO3L 5CIPA 1HSAA 1OWRM 1KB5B 2Q3ZA 1I8UA 4Z7OE 1NCBL 4OLYH 5T3XD 3QPQD 3G5YA 3K8KA 5I18H 2V6HA 2CJTA 2CM6A 4HT1L 2JJVA 5D8JH 3ZL4L 2XBZA 2Z0UA 2ZWLT 3EOBA 1OVZA 4JZJA 4OGAC 5GSRA 3MCLH 3P9WB 1YEFH 3BZEB 4U3SB 1G7QA 4XVUD 4UMSA 2Y07H 5GSVB 5ID0A 1SDDA 1HHIA 1NIBA 1WF5A 5JW4Q 1E8ZA 1KV3A 5L4IA 2Z31D 4JO1L 4OCRL 4NZTL 1CL7I 2DLEA 2NY7L 4MTMA 4NC2B 3EYOA 2L7JA 1S46A 4U1NB 4QRQA 3LZNA 4KKLD 3RNQB 4RBPK 4WHCA 1A7QH 2CLRA 3EOTH 2A77L 4JHBA 4Y5VA 5DHVA 1XF2B 5LBSA 4U1SA 5GRYA 1UKTA 4XZUB 1FL6A 4RFOL 1PG7X 1ZD6A 5IK3A 1KPUB 1VFOA 1HHKA 2G9HA 2VC2H 1G4MA 4I0KA 5GRUL 5DFVD 4HQQH 2N0KA 1NM9A 4OU3A 3U4KA 5D1ZI 3CDCA 3CFBB 1EEYB 5D1XA 2X4QB 4HCFA 2CGZA 1YMME 3ME0B 2V7HB 3IGUA 4OT1L 2QKIB 5C07A 4AT6A 4Z7WF 4JB9L 3EJUA 3NJMA 4XNYL 4OJAA 4RFNB 2H41A 4K3JH 4M43H 4JG9A 3FCUB 5E8DL 4PJDE 3FKUS 2ZWNA 2D7MA 3SE3C 3DSNB 1Q8MA 4LF3A 3TT1H 4CC1A 1M3IA 3AM8C 1LO3L 4DKEL 1FNFA 4APQD 3JTTB 1NL0L 5CGTA 1DANU 1XGQB 3FF7A 1JZ4A 4B9PA 1I3GL 3E8UH 1H3VA 2B77A 2FUQA 2ZOUA 3W9DA 4EZKA 2VR6A 2W65A 4M62H 2HG0A 2PPEA 2V2WA 3RZCB 2NY2C 4GI6A 1MJ7L 3DJZA 3QEQA 3ILQC 3PYCA 2L3BA 2NDGA 4PS7A 1JNJA 3VM5A 3FB5A 2NZ1A 4OZFH 4XAKD 4I5BB 3PWVB 2XVKA 2MSPA 3UYRH 3MRQB 1J0YA 1QRNA 2E4TA 2A83A 3JWNC 3VFSB 3TN0A 4HGKC 4NGHH 4X7EC 5KVGL 4NM4L 2PTUA 4ORGB 1MFUA 3LEXA 2HVKA 4Y4FD 4E5XG 5IQ9A 4ONHB 5CEXB 1Q94A 2PCFB 5T5NF 3F7RA 3ESOA 4HUCA 4P59H 2B59B 4PMFA 1DLFH 1P6WA 4J3OD 5D1ZD 3H55A 3HRZC 5CGYD 3O6FC 1USZA 2WKGA 4FJ6A 4ZTEA 5DQJB 1PZ3A 2YUWA 2Y3NA 5HHXL 3MXWL 1S9WA 3EKCA 4LARL 1MSPA 1W91A 4NNXB 1IGJA 3HI5H 4OIFA 4RAVA 4KPHH 3ET9F 1I7RB 2WK2A 4KNTA 1I7ZA 1XTLA 1T4KB 4RRPG 1AC6A 4Y8AA 3SKOB 5C0FA 1H15A 3ECQA 4EN3B 3S5YA 1UWEH 2WXIA 4MXVF 2AJSH 5IW3A 2E3VA 2ZOKB 5D7LA 2XWDA 4N28A 3O4LB 2H47C 4PJ5E 5HYJD 2OZ4A 1UT9A 2JQMA 4UZGA 4QHMB 1TTRA 5DK3A 3VXME 4C56A 4DNLA 5I8EB 5E1HB 4WRLA 3TV3H 1JE6A 5JPMB 3V0FA 3Q0HA 1QPKA 4PJ9B 5B38A 4FJZA 3F64A 3DOSB 5IY5B 3WE6A 3NFSL 2GYSA 4S1RL 5T1KB 3RDTA 3C2AH 1ILUA 2W94A 1G7HB 5DEGB 3OM3B 4MQXD 1DANT 5KOMC 1FI8C 3M7OA 1WHOA 1TPXB 1WDAA 1OAYL 4HIXL 3H9SA 1TYEB 2BSED 2XFXB 5J5EA 2MFNA 3WNIA 2PW1A 1OE2A 3T0XA 4D8PA 1Y18A 5C9KA 3FU3A 4OZFG 1D2OA 4K7FB 4U2ZA 2YUZA 5CLYA 1DVTA 3HC0B 4I3RH 4YS4A 1N7MH 2ORBH 4LIQH 5IVOA 1DBJL 3CSGA 3SE8L 3X11A 1I8MA 2Y06H 1OXYA 2XY1A 4KDTA 4FNTA 5E4EB 4ERSL 3ECUA 1ZV5A 3AGWA 1NIEA 3CXHK 1RUKH 4E9SA 4X4MA 1NCCH 3QO1B 5FX3A 2VZVA 4HH9A 2JJTC 3DV6A 2EYRB 3E38A 4NNPH 4PLKD 3IE9A 4QLRA 4GYBA 5LAXA 1PCSA 1Z7JA 5A7BA 2O5XL 5E7FA 4JG0L 3PGDA 3HHSA 1G7LB 2L8AA 1PKQA 3MRDA 4FADA 3PS6A 3SKUD 3QIUB 1AIFA 3CMOL 1Y6NR 3OWEA 3RVVD 3VFMA 3DTXB 2GIMA 5BRZD 3DPDA 3CFKA 1G84A 2EUVA 2V0AA 4LFHD 1UQSA 1CVRA 3G9AB 1DFBH 2IPUG 2R29H 1SN5A 2BY2A 5ICUA 4PGEA 4FQXB 3Q1EA 5JA9A 1N5AB 3GJEB 2V8LA 3OMZA 3WSQH 3CZFB 2HB0A 1DN0A 4G7YL 4KKQA 2X4NA 3OLEA 2V7NA 5JNYB 1NCJA 4JY4B 1QATA 1KLGB 2Y5EA 3HW7A 5JW5B 5IESH 4KK8D 5HGGS 2CLZB 3LNIA 1JWUB 1HHGB 2FATH 3QQDA 1OAXH 4R7DA 1VEOA 3L1OH 3QFJD 4QRTA 4CSZA 5I0VA 4MJ2A 3FO9A 4K9EL 4LVHB 4JANA 2CSPA 1ZPLA 4G6FB 4EJ1C 1JZEA 1WTLA 4JBSA 5F1NA 2DLFL 3U2JA 2E7BA 5GS2D 3L3DA 3FQRA 3OR7A 4M3HA 2PW2B 1AO7D 1ZKAA 4CVXB 2XV3A 2X89D 2HG5A 3ROLB 4AW7A 1GJUA 1PS3A 1XGUA 1JZ8A 3HNVL 1RZKL 4QXGL 4EAEA 4FXGB 4N3UA 5KW9H 3MACL 1KCVH 4JM2C 4LKXB 4ZO7A 3SDDC 1F3RB 3MMEB 5CJBA 2GIYA 5DVKA 3CN2A 5BQ7B 3DO7B 1YN7B 1M42A 1NFDB 2WLNA 3ZU8A 1YEDA 1RZ7H 2R4SH 3H9HA 3LMJH 3CHQA 3WFEL 3KPNB 5FA3A 1Z9LA 2BNQB 3VGEA 2HWZL 4ZFGL 1E2WA 1D9KB 1E4WL 2B3RA 1IEBA 1HQ4B 4G6KL 4X9YA 2QR0B 4Y9EA 2H45A 1YQ2A 4XB3A 1CFSB 4X7SH 4E36A 4UZSA 4EXKA 3BUTA 2HFEA 4HHAA 3BUQA 4MB4A 1JVKA 5EO1A 3P1VA 4E9XA 2B7DT 4AYBA 2IJ0C 4PRBA 5BRQA 3OSVA 4U1KB 5IMKB 3PWPD 4ZMOA 2E5EA 4K5MA 3Q48A 1CC3A 1DR9A 2CRYA 2JKSA 4WI0B 4S1DC 2N1TE 3SDAC 9CGTA 5E94A 1ZLWK 4LRIA 5CU5A 4YHZL 4ZTOH 2AVGA 1ZLWH 3MRBA 4BELD 3NSFA 1ZT1B 2DJUA 1CGUA 3PWUA 5CCKH 5IQMA 3D06A 1BXVA 3OZ9H 3ALPA 2YKLL 1JI1A 4PEEA 4JNXA 2X87A 3C6EA 4FRWA 1A14H 5FDWB 5GGUA 5SX4I 4WJG3 4JFXB 5BUGA 3ZYJA 1QPPA 3MHZA 2NDFA 4P48A 3GNMH 4NO0A 3L5WA 3MCKA 2DQCL 4B9FA 1OTTD 2Q8BL 4PRIA 5CCGE 2O6DA 4FCAA 3ARFA 4JY5L 4NO2A 4L4VB 3HNTH 5ABDE 4N90D 3RY6C 3IF1A 4Q9QL 2BNRB 1P2CA 1PD6A 4P9ML 4HWBL 3WFDL 2IH3B 2QELA 1KTJA 1MJ8L 5E8OA 1RJLA 4U1HA 1NGQH 4ZXBB 1HEHC 5AOIA 5KOVC 3VFUB 3KYAA 4K7PH 3CXHJ 1OAKL 3LKOA 4UV4L 2CAKA 3UYPA 3NZ8B 4Y4HC 3AAZA 1UC6A 3VSQA 3R7QA 1EJFA 3PY9A 4E9WA 1MG3C 5TDNA 1Z9SB 4I3SL 1DVXA 4Y89A 1JZFA 3WD5H 4JMXA 4AVKA 1LVEA 2UUDK 4L2LA 5T3ZD 3CLEH 4JHWL 4KHTH 2UUDH 3WS6C 2OMZB 4CDGC 2GBAA 4MHHI 1DVFB 1GGIH 3GK8L 4LCUA 3RJQB 1UD3A 3BE1L 1NBCA 3FK3A 5CMAA 1VACB 3QR1A 4P46A 2O1AA 2XY2A 2C9QA 2K8MA 1KIQB 2XVBA 3OSKA 1X7QA 4JPIB 4GMSL 3WIAA 4X83A 3BPOB 5IROD 2HKFH 2GPZA 4PJEA 2X6CA 4WGWB 3FSWA 3M07A 4YHYB 3TVMC 4MCNA 2D2OA 4X4YB 5DK2A 5GJTH 4KJYA 3P0YL 3L9RA 1KTRL 2YD2A 2Z92A 4HV8B 3LIUA 3NG5A 1E8XA 2ZXDA 4L29A 3L3OB 1OAUL 4Y5YC 1OLZA 1FVDB 2YSSA 3DECA 3PPEA 5I16A 1GC1C 5H94B 1UD6A 1B3IA 4X8CA 2KZKA 3W2DL 1ZEAL 4LRNH 5HGAB 2A1WH 5HVGB 3TV8A 1VCBC 4FFWD 4M7JH 3ARDD 4FLQA 3MRJA 3LN9A 4FG0A 2OR8A 4H8WC 1QLEH 2IDFA 1U3HB 3I02B 5TDPA 1ZLEA 2XV2A 5DD5H 4KQ0A 1KIUB 3T8MA 3MLUH 2EDFA 2ZXWB 4F24A 4GXUN 2BDNL 3G5YB 3E8VA 3P2BA 3KPRB 1LE9A 4A6YL 2DH3A 2XWEA 3EOBB 5GSRB 1PZDA 4R4NC 4B9YA 4D0CA 1MW0A 4PI0A 4PY8I 3HEIB 4R8WH 4HS3A 4V2BA 2R1XB 1EXHA 1HHIB 4XNUL 2WBWB 3IN2A 4JFTA 1QEXA 3SE6A 3L95A 4TVPL 2VQ1B 4DT2A 3EYOB 3HVDA 1BPLB 3L5XL 1JF5A 3D33A 3F05A 2R69H 3KCPB 3BDXA 3EH4B 1T83A 1A1NA 2J6WA 1N4XH 5HHPA 2YPLA 1O0VA 2CLRB 2GUYA 2B2XL 1AR2A 1PMYA 4NQVB 4HG4J 3MNVB 2UWEF 3MRMA 1OB0A 4U6YB 2JI3A 5F97E 4ZNEA 2LT9A 4KMLB 3B9KB 3MGTA 1BAFL 5CJXC 5E6ID 2EUXA 4N2MA 3EJQA 1F3JA 1J0HA 5D1XB 1W16A 4RGNB 5F9WB 3KNBB 4WI9A 4EE2A 2AHIA 4N8CL 2HT3C 1MWOA 3QS3A 5GZOA 5FUOH 4AIZA 1N6UA 4RAHA 5EC1A 1JXKA 4Y2LA 2XWXA 4Y9GA 2LOEA 4YHKH 5ILTL 2DQFB 4P5SA 1UFGA 4OLWH 3C08L 1ZHLA 2ZUTA 3KLAA 1WITA 3W9DB 5B3SB 2FO8A 1EAPA 2V2WB 3ZN6A 1PSKL 3QEQB 4GNKB 3OKNA 4QHPA 1M7XA 1HHJA 1H6TA 3BC9A 3BQUA 1WFIA 1G6RB 2WHVA 2OTUA 1L0YA 4YQXH 4X8JA 3QQ3A 4PVLA 1NUDA 5D71H 4UI2A 2GITB 2HAZA 5DC0A 3VFWA 2FQFA 1NIDA 2AQPA 4L1TA 1JG9A 3TN0B 2BIPA 1RAMA 3GEFA 2QMKA 2Z0BA 1NDMB 3AUVA 2YR3A 4OD3H 4A68A 3LEXB 4BE5A 4A04A 1F00I 2MHAA 2HVKB 3UO8B 1MREH 2M1KA 4MWFB 5FV1L 4HIHB 4JRYA 3D69A 2Z93A 5I82A 5IV2A 5DUBA 3D4YA 3BT0A 2CE6A 5GGSA 4KMTH 4NN7B 4KZ0A 4Z7QB 5LWYL 4WWKD 4JPSA 1T21A 5EZLA 4RIRA 5GZND 1ZY9A 4LO9A 1CLZH 1CK0H 1RIVH 4DZBA 1DBKH 4P05A 4U1GC 3TJHD 4HLEA 3MLWL 2P8PA 1XGYH 3IU3A 1KCSH 1XEDA 1S9WB 4RAVB 5SWZA 3NFNA 3QISA 4Q14A 1JRHI 1I7ZB 1XAKA 3F01A 3T65B 5FGBA 2BHYA 3QRFM 3FUKA 3FU7B 1SJHB 4ZS7L 1H15B 5D1QA 1Z6JT 2RBLA 3B2VL 2X4RA 3KEDA 4Y88A 5D7LB 3MBWA 3KG5A 3EGXA 4WTZA 4XCFH 2H3KA 5A2FA 3UO1H 1QR1B 3MRKA 3JT2A 2VDMB 4KK5D 5D7IA 4H44C 5IG7A 4X98A 2KUTA 1BQ5A 2X9WA 1IM3D 2ADFH 3L3GB 4M29A 4OFQA 1E5AA 3MLVL 3FU6A 3CH1A 4UQCA 3W1ZA 3ZKND 1P7HL 3WE6B 1UENA 5FV2A 3RDTB 2E8ZA 4P5KB 1OP5H 1KB3A 3QT2A 2E86A 2BRRH 1JPSH 2A9NH 2VLRE 4KJPD 2AXJA 4PLJC 2JK5A 2BZDA 3QXTA 4MNQA 5A2AA 3RUGF 1UWXK 4C8XA 3FUMA 2PW1B 2P8MA 2C26A 3IEAA 1JOIA 4CDHA 5LGHL 4F58L 3MGAA 5EU3B 1J1OL 1X3DA 1Z3GL 3QPQC 1BVOA 4JZOB 3DJTA 3X14A 1I8MB 1LO0L 3N42B 4OH2A 5T1LA 4BWUA 3L2LA 4JW3A 3KL5A 1INDL 4DVRH 1NUGA 3O6MH 5DZVA 3NCXA 3RA7L 3MJ9L 5D6CA 2FB4L 4XVUC 3QXVA 4HH9B 3DV6B 2ADYA 1DQTA 1MF2H 3WN5C 1ZS2A 4H7VA 2Z31C 4Z7NE 5I18L 4HH8A 3HHSB 5FK9A 5GRVK 4IHOA 4P3DA 4K8RC 1R4XA 1AIFB 3MCLL 2BO0A 2FT8A 2DYPD 3B6SB 3BVWA 1YEFL 1SJEB 4KKLC 3RI5F 3UTPD 3VFMB 4ELMB 5IREA 2Y07L 4IOSD 4Q8BA 5BW7C 4AQAB 4R5TA 4PBDA 1MHEA 3LEYH 1UQSB 4ZX3A 1DCLA 4NKMA 4NQDD 1LNUA 2EEFA 3FFCD 3LD8C 5CJOH 1FVEA 4L3FA 3A47A 4U7KA 4GI9A 1QSVA 1HH9A 1OAZL 5GGSY 3S35H 3WS3A 4X7FC 2GSGA 2X4NB 4HS6A 2N59A 3NFPB 3EOTL 3LNDA 3K2MC 3P69A 3HAEB 1RK0B 4UOZA 2F8XC 1BQUA 1MCOH 1ZTXE 4R26H 2AF2A 1Y0LA 3MRPA 4PM1A 1UKSA 3ULVE 3VXUE 5DC9B 3DO4A 2Q2EB 2VLJD 1W0WB 3AXLA 3TBVB 1FHGA 3NN8A 1OGAD 3QORC 3V4VH 1NCNA 3GMLA 3IPBA 4TLTA 2X70A 2A5UA 4NZFA 3BUBA 3UTSD 4HK3J 4APQC 2X1WL 3L3DB 3FQRB 3OR7B 4M43L 5IMMA 1FFPB 2EDNA 3VH8B 3P30H 1MKFA 5ALCH 1XGUB 3GMMB 3CX2A 5EZOH 2X0VA 2Y7QA 3BCFA 1MW1A 1R19A 3DYMA 3ZHNA 2V5RA 1P4BH 1E3XA 4HMEA 2Y6TE 4WHYH 1E4XH 3QUYD 3BVXA 4PS3A 1UCTA 3UPCA 1BBDL 3PV6A 1Q0XH 2HKHL 3CMGA 4JREC 4WUKH 5FA3B 2WC7A 5HDQL 5C08A 3HTLX 1XMEB 1NKRA 3T0WA 3LSOA 4EI0A 2AEQH 1ZXQA 4QRUA 1PZSA 3MZTA 4Y4FC 3IMUA 5SWSA 3UYRL 1L0QA 1GOHA 2HFEB 1RZIA 5EO1B 1K5NB 2OXHA 3HG1E 1J5CA 2H1PL 4DWHA 3FCTB 4NGHL 2XQ0A 4Z76A 2FO1A 4J3OC 5D1ZC 1BFSA 3DDGA 5E94B 4PJAB 5I6XC 2D73A 5CGYC 4MZRA 1RH8A 3MRBB 2CU9A 4HK3N 3PNWA 1EZLA 4HAGA 5AVQB 3UBXI 1DLFL 3U9UB 1QI5A 1CD9B 4B9CA 1PDKB 3M1BA 1ZMYA 2BPBA 3RTQB 1VIWA 1HL9A 2WKOA 4HMDA 3C6LA 2JKWA 4Y4KB 1CFTB 1KB9K 3FT9A 4XXWA 4EPSA 3L5WB 3MCKB 3HB3B 1FE8L 3WHXA 3ZDWA 4J8RA 4PRIB 3O0RH 3CFQA 2PR4H 4NO2B 3B56A 4L8SA 3VXSB 2DI8A 2EDXA 3BX7C 4FABH 5K1NA 1MIMH 3IF1B 4N2LA 4WK4B 2CGYA 4KPHL 2RHEA 4FQLH 5KAQF 5E8OB 1P5UB 3SOBH 1RFDH 4QD2E 5KJ7E 4ODWB 4Y16B 1I75A 5KSBE 1UWEL 1SYSA 2W8CA 3Q2VA 5TTRA 1CXHA 3UYPB 4J4PD 2RFXA 4PRDA 5C0BA 4IS6A 1FLRH 3HFMH 4G9FB 4PY7B 2F53E 1NGPL 2JQAA 5TDNB 1NAMA 1V05A 1KGUA 4BZ2A 1WWWX 4XXDA 4MQXC 1HINH 1F02I 2K6YA 4ZUSA 5LQBH 3QNXA 3B5GA 2OMTB 1CF8H 2P43B 1WICA 2XVLA 1PY4A 5T3XE 3QPKA 1J0ZA 5CZRA 1J9SA 5CMAB 2NY1D 1W2KT 2BHUA 4P46B 4WHYG 4BE6A 4BK8A 3UAJD 2CH8A 3L4YA 3WFBH 3CFCL 4OD2A 1X4ZA 2YQBA 4R96A 5KEZA 4ZW5A 1X7QB 1BGXH 5HI4C 2CKBA 2YD8A 2NTFB 4JDEA 4X6CE 4JQIA 2BXYA 5DI8B 4YHOL 1HCFX 3T2QA 1IE5A 5BPPA 4KZDL 3G08A 2FWLB 3MBEB 4AX3A 4IOFD 5DK2B 4ZT1A 1N7ML 2ORBL 3NIFE 4E0RA 4K7PX 4KJYB 1FAKT 3H54A 3FH5A 2Z92B 4K5PA 4MD4A 3S88H 1XAUA 3J27A 3RVVC 1F6LL 5CN3A 1A6AB 5TQ2H 1RUKL 1NCCL 2GIXA 3VG9C 3LB6D 2VXUH 3CX5J 2H2PD 4F8PA 5A6LA 4TVUA 4K5OA 2ZSVA 1Q9KA 3GBLA 1N59B 3UEQA 2D03L 5K93A 2HTLD 4L3AA 2PP9A 1AGFA 4RMVA 2R0ZH 3V7AG 3KWXA 4ZUUA 1NCDL 2F5BH 1QFPA 1NZRA 1ZDQA 1XH3A 4KK8C 5KVFE 1LE9B 4MXWH 3V7MA 1R3KB 4KKCD 4WZ9A 3Q06A 3WSQL 2G5BB 4HS3B 4P0DA 3KR3L 5GJSH 2TSBA 2IH8A 3HBZA 5HJ3A 4E2OA 1ORQB 4GAGL 1G9NC 2E9BA 5IW1A 5CP3H 4ZFFA 3L95B 5CINH 2CKNA 2DMBA 4MDJA 2E76C 4FG4A 4E68A 3H56A 1GTFA 2ATPA 3F84A 3KYOA 3O6KH 4YZFF 5J1TC 5HHPB 4PP1D 4HZAA 4PG9A 2AEPH 4YPGA 5DZ9A 3KHQA 1I53A 3QCUH 1YG9A 3ARGD 4XAKE 1RUML 3MRMB 3SGEI 5KSAB 2G3MA 3HCVA 4UNIA 4YDNA 1LILA 1RPQA 2AV7A 3PHQB 3PJSA 1NMBH 4OVUA 2DYRB 3MGTB 5BVPH 5JHAA 3S98A 1FO0A 4IMKA 1CZ8L 1NC2D 2CDEA 3OJVC 1OCCB 5CN2A 5K69A 2W81C 3II2A 2FRGP 1C12A 2OJEA 1CD0A 3DYPA 3HBPA 3SE3A 4QHKI 4TL4A 5KW9L 3AM8A 1ACXA 2AGJL 1H6UA 3WKMH 4AIZB 1IGIH 5J1AA 1DQML 2AMGA 2VJ8A 1G7JB 1OALA 2ATKA 4U6HA 3BT2H 1K72A 1WZLA 1IBFA 3BH9A 4KQ4H 4PP2B 4KI5D 3B2PA 5I0YA 2EE3A 2N0MA 3U2SA 1A6TA 4UAOB 4I88A 1ZHLB 4WCYL 3KLAB 4PJGE 3SDYH 3F58H 4PJAE 4JKLA 4GRWE 4K0OA 3J7HA 4JFPB 2WUCH 3WDIA 2O61A 2R83A 1HHJB 5FLVA 2RR3A 4P2RD 2B20A 5C97A 1WCQA 2OTUB 2WQAA 3FF8A 2TSAA 4X8JB 2CKBH 1WAAF 1IFRA 4TSBH 1OTTC 1XF5B 4UWQB 4HD9A 5HYJE 2CPUA 4KOBA 1TCMA 2F8VA 2WO2B 2G75A 3F7VA 1A14L 3CFIC 2MHAB 2YEZA 4AGNA 2J71A 3PWJB 1X5GA 1KWGA 4YHNA 1G9MH 3D69B 2Z93B 3GLAA 4OW6A 5DUBB 5EOQH 4FQHA 2X4OB 3HRZA 5IB4B 3O6FA 2PCXA 1IQDA 1NBQA 2I07A 2YWZA 1T21B 5EZLB 1JVLA 3S9DB 3IAQA 1SGKA 4X8XA 3C09C 5FYJD 4FNPA 5E2VH 4Z7VA 3F00A 1O9WA 4XVTL 4LAJH 1WZ1H 3IU3B 1MPAL 5DRXB 5KUMA 3QUML 3OLIA 4RMWA 3THML 1OV8A 2FJHB 2WXNA 3NOIA 1KELL 2DWXA 4YBLC 3D39E 4O5LH 2DMHA 1J5OL 3T1FA 5C0ND 3PWLB 4OFKA 2FLBT 1WEJL 1E28A 2BS9A 1U3ZA 2X4RB 4H8HA 4RQQB 3MTRA 3UL4A 4KHTL 1KLFA 4I77L 1WH0A 3EGXB 1K6QL 4CL7A 5IROC 2CCLA 4CN4A 1O6SB 4PTUB 1PTZA 2E9GA 3MRKB 1JGDB 1XSIA 4DQAA 4X98B 1I31A 5ANME 5EF3A 5G55A 5BRZE 4GUOA 4B60A 4W6XB 2HKFL 3ZRCC 1YY8A 2DB8A 4EMZA 1N5YH 3P4OA 2WXMA 2XNAA 2X4SB 1UFUA 1K3IA 3K8LA 2XU9A 1WBXB 3DURB 4FFWC 3ARDC 1WFJA 4MNQB 4FL4C 2P8MB 4I87A 4WNJA 5ISZA 3UZVA 4PJ8D 2NCEA 3BO8B 4UYPA 4YMPA 2ZYHA 2PO6D 2VR4A 3BJ91 4LASL 2HRHA 4Z18A 2JJTA 2YPKB 3QFJE 5T1LB 2ZNXA 1TVHB 2GCYA 4GP8B 2APFA 2YK1H 5D6CB 3CSBA 3ESVF 5AAMC 4LGRB 4OVVA 2J2ZA 3MQIA 1JP5A 2F8OA 5CCHE 2NZ9D 3QZWG 3WNLA 3ARTA 5E0FA 5DZPA 1TMQA 5DK0A 5FK9B 4J8QA 1AO7E 3CFEB 1CG9B 2A9ML 3GSNL 4JRWA 2QSQA 2ZUQB 5DMGD 3CU1A 4KI1A 1EUUA 2X0WA 4S2SA 2P28B 2ZAHA 2VDOB 3VRLE 5K9OB 3T0EB 4OZGF 3BXNB 3NCWA 1LNUB 4XPTH 4YFLI 1ORSB 2A4EA 1FWXA 1FVEB 5DFAA 1T89C 2YJLA 4UM9D 1WT5C 1HXKA 3WS3B 2GSGB 3H3KA 1WP6A 2YIHA 3PPSA 3RFRA 5E6IC 5DQDH 1HXYA 4NKDA 1HZKA 3U0TA 2BOBA 1WZKA 5I1IL 1Y0LB 3DIFA 3MRPB 4BRVA 4N22A 1BZOA 4OGXL 3J07A 4OZIE 5EWIH 3CPLA 3K6IA 3PWPE 3NN8B 2ED7A 5C3TA 4QRRD 3TO4D 1QP1A 4LEOA 4HC1L 2LV4A 1NEZA 2CUIA 2WWMC 2X70B 1GGBH 5JLZA 1BD2A 2DQTL 4EOWH 3NZHH 2CUHA 4Z0XA 5C92A 1PU0A 1SHXA 4JM2A 3SDDA 4L3CA 5IMMB 4HOMA 5TK4A 2BXZA 4KAQH 4QPEA 3ZTNH 4QNPE 3Q5OA 2ZX9A 4FNRA 3B9AA 1P1VA 1I7UA 4M7LT 1AS8A 4NYLA 4U49A 3VD5A 4PS4L 3B1TA 2VDKB 4YHKL 4XNAA 3TCXA 3SB3A 1JNNL 3S35X 3M88A 4HETA 4ODHH 4N90E 3PV6B 4R4FL 2ATAA 4LLMB 1PZBA 1BX2A 3N40P 5C08B 5FYLE 5KVDE 1BA9A 1OB1A 1E65A 3UXFA 2HJKA 3VXNB 5IFAH 3S4SA 3WEXA 3FTVA 1IC4H 2JIXB 4QRUB 1NGZB 1SDAB 5SWSB 4J27A 1TQBB 3WY2A 3SDAA 1RZIB 4QXTA 1AQHA 1NSNL 4MA7L 2F54D 1N2RA 3CJJA 5D71L 5DYFA 4TTGA 3JVFC 5E5RB 4EZMA 2H1LM 4W9CC 5TF0A 5F7UA 2M2DA 5GZNC 5EIQA 3IB4A 4NBYB 4OD3L 1NLBH 1F1AA 4AYSA 3V4LA 3TJHC 3FHEA 1MREL 1YNLH 1G5AA 4HPOL 1ED3B 3IDYB 2DBLL 3BIBX 4TPRH 5D5MF 2R1WB 4YDZA 2N7AA 3SDXF 4F15C 2XRAH 4IRZH 4BQ8A 4GW4B 4BDVA 1KFAL 1CK0L 5EBWB 4YHIB 4JO8A 3C6LB 3HBGA 3RY6A 4N85A 1UVQB 2ZJSH 5KBDA 3SBPA 4G6MH 1KCSL 1JPGB 1D6VH 4J8RB 4MAYB 3V0HA 4Q97A 5D96B 4DFIA 3ZKMD 3BRGC 4FXKC 4X7TA 4OFDA 5TDOA 4LSUL 4E41D 5MHSE 1D6EB 4OSUL 3IDIB 4Y4HA 5HDRA 1BF2A 2CBPA 2F7PA 4KK5C 3I74A 4FZ8L 4HWEL 4YN3A 1QNZL 2W0FA 4NUJB 4UQ3B 2DD8H 1YAIA 1YY9C 4X6DF 3VXRB 1EBPA 4PRDB 1SJXA 1KGJA 2UYLB 4JEGB 4K23L 4ZW7A 1DJWA 1TNMA 2O5YL 3M8OH 1CDHA 4IS6B 4XCFL 3DROA 3WS6A 3K2KA 4L1SA 3E9UA 4LPUA 5AB1A 1AE6L 1NPNA 1PZAA 2TRYA 4GS7C 3TS8A 3PHAA 3CZUB 4DEPB 4LSDA 4XXDB 4Y1AA 2YPVA 3QNXB 5CHNB 4KJPC 4CAGA 1UH4A 1FVCB 3FAWA 2EXYD 1OIOA 4Z7AA 5J11B 3VXTA 4OM0H 1ZT7B 4OD2B 1ZS8B 3V0GA 3NGBC 2BRRL 4FQIL 3TVMA 3PQYB 1JPSL 2A9NL 4PJ7F 5EBMA 4DPCX 1FG2A 1P9MC 1XCXA 3LIZH 3NDYE 3G08B 4FYSA 2PTVA 5KBMA 4Y5YA 3LKQA 4XT1C 2HZHA 3N6YA 4ZZKA 4MD4B 3SPVB 3MREB 2DZEA 5IB5B 5I5IA 2OL3A 3L17A 5AD0B 2OK0H 3P3RA 3BKYH 2X7LA 5DD3H 2CO6B 3B8SA 4TSAH 1I8KA 4A2DA 1R5WB 1CLOL 1I1YA 2VLRA 2A6JA 5GRJL 4P23D 1N0XH 5AYUL 3UFIA 1HL8A 2L04A 1M4KA 3LYRA 3H8NA 1G1CA 3RTLA 2Y25A 1TTBA 2IWEA 1DQJA 4K94C 2XV6B 4DF9A 5SX5H 1R17A 1AGFB 4WUUD 1YEWA 4NHUA 1L3WA 5EORH 5JXAH 4ZUUB 1VHPA 2Y5QA 3LEYL 2C7UA 3OVUB 1LDSA 4OV6F 1XH3B 5EN2A 3ZIYA 3V0IA 2C3WA 3KGTA 2OSLA 2F74A 3ZHKA 3AJ7A 1EAJA 3MKKA 5CJOL 4DPRA 5KSVA 5IVXF 2YOCA 1TTUA 4M5SA 2W88A 3TH3T 2FX7H 3VU1A 4Y1SA 4OFPA 2XC8A 5HJ3B 4OI7A 2R56H 3PL6D 2AV1A 4ZJ9A 1RIHH 1K8DA 3UJTH 5IW1B 4TLSA 4ZFFB 1VESA 2JH2A 2WBXA 1S9YB 4HCGA 1YZZA 4UT9H 2FUTA 1MCOL 4W68A 5KS9F 5AVVB 3BDYH 3P11H 1MCLA 2ATPB 3LY6A 5A6MA 2MEJB 2ICWA 4IDJL 2Z4QA 2ZWZA 3O2DL 4YPGB 1TZOA 1RHFA 1T1WA 3V4VL 3PAVA 3V0WH 5CJXA 3KPQA 3I3DA 4X80L 1DVYA 1MHHB 1ZV9A 1M2OA 5DEJA 1AQKL 5CLZA 2FVNA 2P8LB 3KYNB 5GGVY 3HCVB 1L3NA 3FUNA 3PJSB 1UM5L 2QSCH 3QUYC 4OLZL 1B0GA 2KC0A 2QPEB 3H0TA 2NXYD 2P5WD 2HLEB 2OJEB 2ILLA 4G7QB 5A3ID 1T1YB 5GRZA 3VXUA 4NCDA 3G6JB 1P4BL 3KL3A 1IQWL 1E4XL 4XOBA 4BKSC 1NEZG 1CLCA 2E0PA 3KBEA 1SLWA 4OCLC 1JCKA 3SPJA 1R33A 4LESA 3ORJA 1I3VA 2ATKB 2QQKH 2Z8SA 3ZE1B 3BH9B 3T8XA 3LDBC 1J9CT 3AQDA 4PJIE 4X5WA 1A6TB 1BEYH 1P69B 5C7ZA 2EIKB 3LNHA 4WVRA 5KBPA 3S0PA 1DE4A 2XN9A 4QRBA 3PDOA 2XYBA 4OF0A 4WKZA 4HXBL 3GS7A 3IKCA 3EYUH 2O61B 3RNKB 1L0XA 3CFMA 4LVOC 4XNMA 4FC3E 1FQ9C 1CTNA 3QWOA 3S4SG 3QJOA 5E6RB 4XO9A 3RX8A 1M53A 2Y2TA 2HRPL 2G75B 1GC1H 3F7VB 2YEZB 5JPNC 3S8GB 1TZ8A 4FQHB 3X1BA 4KHXH 2R15A 2NY0D 3HRZB 2OL3H 3O6FB 4FQCL 4HU2A 3O0RL 2H9GA 2EH7L 1IQDB 2I07B 5B21A 4J4PC 4FABL 5C0CB 2R23B 4F9PC 2MQCA 4Z7VB 1INEL 4P2CG 4R97B 4W81A 3DGCR 3TIEB 5IEKA 4XBPA 3N85H 2CBOA 1UH2A 1OSPL 4LHUA 4NPYB 4ANWA 2YMOA 5FM5M 3V6ZB 3K2IA 3RJOA 3GHBL 2IADB 1C16B 1FLRL 3HFML 3NH7L 3ZMEA 3C60D 2Y1YA 2NY1C 4HD5A 1XGTA 5DMKB 3UAJC 1E28B 4MX7A 2EVJA 2NY3B 1JFQL 4NC1C 5LQBL 1NDTA 3BD3A 1PL3A 3EJYD 1CF8L 2QGBA 5B8CC 3FFOA 1G1YA 4NRYB 1HHHA 3HN3A 2YS4A 4HEPG 3PQYE 1NANH 5KSBA 4YBQD 4DPBX 1FBIH 2FR4A 2NQ3A 1WG3A 4GRLD 4IOFC 3UTPE 5A2KH 3MVSA 4AQ1B 3GIVB 3GMOB 5K1VA 4IU2A 3MRIA 2P24A 4MCMA 1BGXL 2NX5D 3GRBA 1QFWH 4JFHD 5AEAA 2FWOB 1CFVH 1Q9LA 1Z5LA 2NQDA 4OJCA 4S0TD 4NQDE 4S1SL 3FFCE 4H4NA 4KROC 3P4OB 4I48A 4DOHB 2H2PC 5CFHA 2PWDA 3UBFA 1ZTXH 1GAFL 2FLMA 3UZQA 3RYMA 4TRPH 5ISZB 3UZVB 3W3BA 3IJHA 2HTLC 3L7FB 4ZAKA 3ULVH 1RVFH 4CADB 3MRHA 1IGCH 2GY7B 4EI6A 1CIUA 2VXUL 3HA0A 4M3JA 3LZOA 3SKJL 2EKSA 3HOGA 3WN5A 2GCYB 2VLJE 2Z31A 3EJCA 3K4DA 5C7XH 4JFEA 4ZG1A 4TVPD 1CF1A 4HHGA 2J2ZB 3V6BR 1ET7A 4H1LA 5KYYA 3UTSE 4UNUA 5BW7A 3QQ4A 3X2QB 4HUKB 2ZXGA 3R4DA 5I0WA 1ET8A 1NCTA 1IM9B 3G6AA 3MA9H 4PP1C 4BSJA 2H8PA 4S1QH 4S2SB 2VSMB 4O02L 1HOEA 1E6OL 1DL7H 1JPFA 2KPWA 5I1JH 3ARBD 4G8AC 3ARGC 4P5RA 5E2UH 4Z77B 4JDVB 1EO5A 2WUBH 3CFNA 3QDMB 4PMEA 4HU8A 2WWNA 2ZNWA 3ZRFC 3HIZA 2FHFA 3WMQA 4ZI8A 1H9VA 3ZE2B 5MERA 4IRSA 2AEPL 4ODXB 8FABA 4NT6B 5I6PA 3U0TB 2BOBB 3O9WB 3QEHB 3QORA 3DIFB 4QAWA 2IDSA 2GJZB 2JI2A 1J88A 3TCLB 5BS0D 2Z8RA 3X13A 1KPVA 4APQA 1U8KB 1OP4A 1INQA 2V17L 3CPLB 1H3GA 1GW6A 4LEOB 1E42A 1XFPA 2FBJH 1OQXA 1C1EH 3QCVL 5I0ZA 3ES6B 1R3JA 1XD0A 4HLJA 4AL8C 1TU2A 2GJJA 3VI4E 5E8EB 1BD2B 3ELAT 1DUZA 4F8NA 3FPYA 3OKLA 4Z0XB 4JM2B 3MV7B 1MWAB 4ODUB 4L3CB 3ROOA 2DI9A 4NRXA 3SDDB 4AEHH 3BAYA 4DGVL 3ECWA 1IX2A 2OMBA 1UGNA 4PSPA 5HHMB 1FZOB 4BFRA 2ZP0T 4PVMA 5F7AA 4NYLB 3PNRB 4AENA 4JO4L 5DT1H 8PAZA 1BM7A 3T8VA 2HYMA 4PG2C 2NUPA 3MLPA 4XNXH 1SBBA 2Q6WA 4Y4FA 3GB7A 5AKVA 5JXED 4B27A 5GISL 1KIRA 3KMDA 5CO1A 1E6JL 1OB1B 2YAHA 5JIDA 3I9IA 2VDMH 2WKLA 1IEAA 4WEEA 2XG4A 4WW1B 1W0YT 2VMJA 3LXBA 2CIIA 5DJ2A 5D1ZA 5IB3A 4U6XB 2QADD 1N6VA 4QXTB 1G1OA 1FYTD 1WLHA 2UXFA 1N2RB 1XO8A 1WCBA 5ITFA 3EJSA 2YMTA 5H35A 1I4FA 2ICWJ 2K3TA 5PAZA 1AY1H 4UUJA 5T3XH 5DJ8A 3TASA 2DOCA 1KJVA 2UX7A 4JFWA 5E1IA 1MCSA 1A3LH 3NJNA 5DSCA 4HBCL 5EH1A 1AG6A 1AHWB 3FB8A 1XB3A 3T08A 4Z9KB 4EI5D 1XGRA 4F57L 1T6WA 4DO4A 2IC2A 4DK3A 3HS9A 3T6XA 2HLAA 3I50H 5EO0A 4CNIB 4NC1E 1JK8A 3T0DA 4QKXB 4FHKA 1V7MH 3A6BL 5J9PA 2OYKA 1GA2A 3VD1A 2ESVB 4FCHA 4GQ9H 4DQOH 3OKYA 3MOBL 2VLKD 4X7TB 5TDOB 5KN5A 2IWKA 1E50A 1GGTA 1KB5L 2DN7A 4UU9A 5AW1B 4WFFE 4PV8B 4ZSOA 2J8OA 3FO1A 3ILPA 5B7MA 2K0RA 1VGKB 2ED8A 5E0QA 2Q7AA 1EEQA 2QQNH 1YHPA 1EVTC 5HGBB 2DS4A 5JORA 1FZMA 1CTOA 4XRCA 3SQOH 4EQ3A 5DLMH 2LW3A 4JO5A 2ZP9A 4ZD3H 2I9LA 5LGYA 3HKFA 1CXLA 1XF3A 2W60A 2Q2LA 2IEPA 4Q2ZA 4XXCC 4I0PC 4Q4EA 4XNQA 1QZ1A 4Y1AB 2LVEA 1UCBL 4NQTA 5JMRA 3LQZA 3UTTD 5KVFH 4KV5E 4NN5C 4NZUH 4YSEA 2XTJB 1FH2A 4N0CC 2X2IA 3HAEH 4F8QA 4AG4L 4Y2NA 3I6LE 4P06A 3VXTB 2PO6C 2O30A 2CXGA 4R3SA 3OL2A 5IOPA 3TVMB 4YR6A 2PTTB 1HH6A 4MMZC 4P4KD 4LSSH 4JQVC 5EBMB 3SSGA 2J55A 4Y5YB 3LKQB 1YEJH 4PPTA 4CU8A 4ZMNA 4A66A 4RWYL 5F1SA 1CL7H 4NWTH 4M5TA 3TESA 4KX9A 4XMZA 3HE6D 2YBGA 3EFFB 2YAPA 4GMTL 5DMGC 4ZBJA 1G4RA 2W9LA 2Y5TA 3Q6FA 1U3JA 4CW1A 1I8KB 5TFSL 4GG6E 2FJGA 5J0BA 2A6JB 4QOKA 2VERN 2YD4A 4QJ3B 1C7TA 5E2WH 2W07A 1LE5B 1A3QA 2BSRA 3CCHA 5E9DB 1U6AH 2LU7A 4PBXA 1AD9B 4JCLA 1KEGL 3DMMD 3B9EA 3HMWH 4NHUB 4J3TA 2JKRM 1AR1D 3CAFA 1J1XL 3QFJA 1P7KA 4UT7H 2WYHA 4HXAH