2N0MA

The solution structure of the soluble form of the lipid-modified azurin from neisseria gonorrhoeae
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
ATAGNCAATVESNDNMQFNTKDIQVSKACKEFTITLKHTGTQPKASMGHNLVIAKAEDMDGVFKDGVGAADTDYVKPDDARVVAHTKLIGGGEESSLTLDPAKLADGDYKFACTFPGHGALMNGKVTLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipid modified azurin protein
publication title The solution structure of the soluble form of the lipid-modified azurin from Neisseria gonorrhoeae, the electron donor of cytochrome c peroxidase.
pubmed doi rcsb
source organism Neisseria gonorrhoeae
molecule tags Metal binding protein
total genus 36
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2015-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2n0mA00
1AANA 1GSKA 1BXAA 2XUWA 3JT2A 1OCCB 2VM3A 1E65A 4G71B 2ZWNA 4G72B 1BXUA 1QNIA 2I7SA 4YSCA 2BW4A 2VN3A 1BAWA 2IDUA 2XU9A 1OOWA 5I6LA 2XXGA 3AG4B 1AACA 1ILUA 1KDJA 1ZIBA 3FU7B 2BP0B 2X87A 1X9RA 3CDZB 1AOZA 4JKNA 3L45A 2BP8B 8PAZA 3NJIA 2H5UA 2IWKA 5IY5B 5FC9A 1DZ0A 1JXFA 3OMNB 1ETJA 3S3DB 3D12B 1J9TA 4DP5X 1OV8A 2VSKB 1GS8A 1KCBA 1ET5A 1IBZA 4HCIA 4AZUA 1J9QA 2OCCB 2IDFA 3OM3B 1AIZA 4KO9A 1L9QA 2FJSA 1GS6X 4KO5A 3ZX1A 4GP5B 1OCRB 1YLBB 1M56B 1NDTA 2YAMA 2HLEB 1QLEB 1AR1B 4M3HA 1FWXA 2YQBA 3FQ2A 9PCYA 1CURA 1F56A 3TU6A 3ZDWA 3S3CB 4DP2X 4N8UA 2GI0A 4Q89A 2IH9A 3FSZA 5E9NA 2W88A 4X4KA 3UAAA 4G7QB 4KO6A 1AZUA 4E9TA 1DYZA 3NJLA 3NJHA 3NSCA 1KGYE 4A66A 1QHQA 1ZDSA 3IBOA 3X1GA 1PY0A 1NIAA 3UABA 2HZHA 2PPAA 2A3TA 1SNRA 3OQRA 2JFCA 1EHKB 1PZCA 1WS8A 2FTAA 2PPDA 4M4RB 1MG3C 4L0PB 4A2HA 2AANA 1E5ZA 2DWSA 6PCYA 2AZUA 2VW7A 2W8CA 3T71A 5D4HA 3IE9A 4AKQA 2P80D 3H56A 4DP4X 2MTAA 5D4IA 2FWLB 1HAWA 4DP1X 3WG7B 5PAZA 4YSEA 2ZOOA 3CG8A 1BYPA 3WKPA 1UATA 4UAHA 1WA1X 3N2JA 5LDUA 1A65A 1BYOA 1W8EA 3KW7A 4PAZA 1AQ8A 4WTQA 4ENZA 4QLWA 1R1CA 4HCGA 3NJJA 2R7EA 3NJNA 2PPEA 1JVOA 4E9WA 1KCWA 1TKWA 2VM4A 3FQ1A 3QJUB 2E86A 5B7EA 1TEGA 2TSBA 2YXWA 4YSSA 1TEFA 4E9XA 2DWTA 2WSDA 3TASA 3UGEA 3TA4D 4YSAA 5EHFA 1NWOA 5I26A 5B1JA 4JHVA 1RKRA 2FQFA 3IN2A 2NRDA 1L9OA 4DPAX 1BEXA 1BQ5A 4DPCX 4AX3A 5PCYA 4BDVA 2Y69B 2HRHA 4A2EA 2PCFA 4YSOA 2HX9A 4E9RA 3EH3B 1ID2A 1HAUA 3T9WA 4YSQA 1OCOB 1JZEA 2IDQA 3CVCA 1PNCA 2DYSB 2B3IA 3IEAA 3AG2B 4KNSA 1PZAA 1E5YA 2ZONA 1E30A 1GR7A 3MBWB 3FT0A 3TBBA 2PCYA 1OE3A 3AZUA 2EILB 1MZZA 3OD3A 3ASOB 1GW0A 1M57B 1E67A 2UXGA 7PAZA 3N55A 5I6PA 2XX0A 3QQXA 2VMJA 4GXFA 1SHWA 2GC7C 2GIMA 2XWZA 1AS7A 4YVUA 1ASPA 5ANHA 2YARA 1ZV2A 2Q9OA 4CSZA 3T6WA 2GB2A 2UX7A 2H3XC 1ZIAA 2CALA 3S3BB 1I53A 1JVLA 2XLLA 4ZK8A 2J57A 3CVDA 5F7AA 4HAKA 1SFHA 1PCSA 4GP4B 2VW4A 3UADA 4P5RA 5B7FA 1NPJA 4HCFA 1JZHA 1KYAA 3ZIYA 5I28A 3FQYA 2CJ3A 2JXMA 2UXVA 3EH4B 1J9RA 1WA0X 2FQGA 2GSMB 4AI7A 5TK4A 3GDCA 2VW6A 1SDDA 1WA2X 2QPDB 3X1FA 1SFDA 2PP7A 3PPSA 2AVFA 1OCZB 1V54B 1FFTB 1B3IA 5B7MA 4PCYA 1ET7A 1NZRA 3NSFA 3IN0A 4WKXA 2XV2A 1ADWA 3CVBA 3DIVA 4W9ZA 1VLXA 5AKRA 2LLNA 1SF5A 3OMIB 4BXVA 2YAPA 1PZBA 2IWEA 2OV0A 3X1BA 1SJMA 1BXVA 3NT0A 1M9WA 1JXGA 3QJSB 5TK2A 2N0MA 3JTBA 4BK5C 1V55B 2XV0A 3ABKB 2QDVA 2AFNA 1A4AA 2R7EB 6PAZA 2BO0A 4HALA 5I5IA 3SBQA 4KOBA 4K9JA 1XB6A 4A2DA 2FNWA 3DTUB 2YAOA 3X1NA 3FU8A 3KW8A 1L9TA 3WIAA 1FA4A 3FSAA 1L9RA 1SF3A 3NJGA 3AW5A 3ABLB 2FQEA 3RYMA 3WI9A 3EH5B 3NJMA 1J5DA 2YAEA 3NJFA 5I5MA 1X9UA 4A2FA 4BDVB 1J5CA 3PAVA 1KDIA 2I85A 2YAFA 4HZ1A 3OMAB 1IUZA 3UACA 3ZBMA 1GY1A 2XVBA 3T6XA 5AZUA 1IC0A 1T5KA 2CAKA 1PLCA 3TBCA 3DKHA 2HX7A 1PMYA 2XX1A 1WS7A 4AKPA 1NIEA 2EIJB 4A2GA 2UXTA 1AS6A 4DP6X 4CSPA 1A3ZA 2FT7A 4FA7B 5I5JA 1JZGA 1RZPA 3FYIB 2DY2A 1CYXA 3FPYA 1ET8A 1AG0A 2PPFA 2X88A 1NIFA 3UAEA 2OJ1A 2IDTA 3V9CA 3X1EA 1OE2A 3G5WA 3NYKA 1AS8A 2AZAA 3FYEB 3MX0B 2J56A 5B1BB 4HHGA 2GBAA 2EINB 1PNDA 3ERXA 3NP3A 2I7OA 1AZCA 3SBPA 4F7KA 3AY2A 4NAJA 3HB3B 5F7BA 3NSYA 3GYRA 1L9SA 1ASOA 1GS7A 2IDSA 3AG3B 2H47C 1N70A 1SHXA 2YXVA 1PAZA 1CYWA 1W6WA 5B1KA 1NIDA 4A68A 4P5SA 1HFUA 1AZBA 2DYRB 1JXDA 1ZPUA 2PP8A 1OE1A 5B3SB 2UX6A 3PAZA 3FPXA 3ABGA 3H4HA 4MFHA 3H4FA 5B1AB 4N4YB 1NINA 3SBRA 4NERA 3FSWA 3PXLA 2TSAA 2XYBA 2J5WA 2ZXWB 1SDDB 3FSVA 1A4BA 3WNJA 4KNUA 2UXFA 5I6OA 5I6MA 4G70B 4BWWA 1IBYA 4YSRA 1BQKA 2JKWA 3NSDA 4YSDA 2J55A 4FAAB 4TXVB 2RACA 4F2FA 1L9PA 1NIBA 4DP7X 1ZDQA 3FU9A 2P80A 3AG1B 3C75A 3FU7A 2BP0A 2QT6A 3CDZA 3NP4A 4EF3A 1AZNA 1JZIA 2BP8A 2CUAA 2FT8A 1A4CA 4AKOA 3FS9A 4YSPA 2BWIA 4KO7A 4UANA 4G7SB 4BXSV 3U25A 3EHBB 1A8ZA 4UF7C 2BW5A 4GY4A 4DP0X 2HXAA 2QDWA 1XB8A 1GY2A 4BWUA 2Y1AA 1AZRA 1MZYA 2BZ7A 1EZLA 3NJKA 2CCWA 1BQRA 4YSUA 4Q8BA 2PP9A 2BHFA 3CZUB 4KNTA 3S8FB 2HX8A 2HRGA 2CBPA 2EIKB 5I6NA 5AFAA 1IKOP 2XV3A 3GXUB 2B08A 3SQRA 1PF3A 2EIMB 3S8GB 1AG6A 2FT6A 3QJQB 1CUOA 1XMEB 4YL4A 2GC4C 1NWPA 1PLAA 3X2QB 1MG2C 1AAJA 1J9SA 2BWDA 1KBVA 4E9VA 4F2EA 1CC3A 2GHZA 4KOCA 4DP9X 4YVNA 3BVDB 1WAEA 1V10A 3QJTB 2VSMB 1N68A 2BZCA 1ASQA 3PLYA 4A67A 2QPEB 2YAHA 3ABMB 3HEIB 1NICA 4DP8X 3ASNB 2YAQA 4HHWA 4JHUA 2FQDA 4RH4A 4QKTA 1JERA 1KBWA 1NTDA 2WO2B 2DV6A 7PCYA 4BWTA 1RZQA 1RCYA 2WO3B 4E9QA 3T6VA 4W1TA 4NB7A 1JZFA 1PLBA 1NPNA 1ILSA 1KV7A 3PCYA 2XXFA 5B1JC 3WNIA 5D4JA 3QPKA 1JOIA 1URIA 4E9YA 1MDAA 2IAAC 4E9SA 5I6KA 3PAUA 3V9EA 5A7EA 1OF0A 2IH8A 2Q5BA 2MRYA 4GP8B 2PPCA 4HIPA 2IWFA 4YSTA 1W6LA 1GYCA 1TU2A 1JZJA 3T6ZA 4DPBX 4G7RB 3WKQA 3EF4A 1XB3A 3QJRB 3BQVA 3QJVB 2PLTA 4GYBA
chains in the Genus database with same CATH superfamily
2GIYA 3F01A 4JANB 4Y16B 1ZLVH 1UD8A 4EUPB 3P2DA 3LNDA 3ZK0A 4X5RA 4F9PA 2A6IA 4MCZA 1JSYA 5ETUB 5KSBF 3GB7B 5IHZA 3CHOA 1S7WB 4YMPA 1R4XA 3WLBB 2DOCA 1UEYA 1FCGA 2X9ZA 4H20H 1QRNB 4R2GB 3VH8B 4XHJD 3TFKC 5JW5B 2UZYB 4EUPH 5DUJA 4C8XA 1JUFB 3GMOB 1KJVB 3ZLQC 3WJJA 3SE8L 2FO4B 2YRPA 5F9DC 4LVNB 1G7IB 1L7TL 2FRGP 4YBQD 4FE9A 3FQNA 3IE4A 5E6IA 3AQXA 2HTLC 3PABB 4QHMB 3WE6A 1UEMA 2Y2YA 4PJEB 4YIQB 3BPLB 2DKUA 3RGHA 5KYXA 3JV5A 1J9QA 1KB3A 3EO1A 4K8RC 1B9ZA 3HZYA 4LOUD 3WMSA 2FJSA 2CU9A 1L7TH 4IGBB 4ZYKA 3V4LA 2A73A 3MV8B 2YBGA 1M56B 5KOVC 2KT6A 1KC5L 2ZF8A 1WZLA 3D69B 2B8OT 3L2MA 1F56A 1W8OA 2ZAHA 3MUGB 5T1KD 3MTXA 3KYNA 2NY0C 4N8UA 8FABB 3ZZLA 5ACZA 4HFWB 3DROA 5C92A 5CKGA 1ZGLP 3IDGA 5DA4A 1AZUA 3MOAL 2APFA 4E9TA 3RFZA 4L29B 1KC5H 1IQWL 3RUGF 3NJHA 4LSPH 4JQIH 5EH1A 2N7AA 3ARFC 4KKAC 4M9PA 4GQQA 5CSGA 1D6VL 2VZ1A 2RR3A 4HEPA 3SKMA 5SWZB 5JHBA 1JWMA 1PS3A 3RE0A 3MOAH 3VGHA 3K2KA 4EDXA 1OXYA 1NGYA 2WLIB 1IQWH 2PTUA 3QJXA 3G9VA 4X6BA 4HPHA 5CLWA 1TFPA 3IFPA 4LXFA 4GG6A 4P99A 4GQ9H 4F3FB 2VW7A 2W8CA 3GDBA 3R4RA 1D6VH 5CZVH 5FGCB 3SDYL 4L4JA 4PJHA 4JCLA 2X0UA 2ARJA 5C09E 2RB8A 4OZHE 1WWAX 1HVXA 3MBEC 3QEQB 3QAQA 1WUNT 5KSAD 4P49A 1LM8V 4XXCA 1UATA 2WB1A 1LVEA 1A65A 4MLIA 3ROOB 3SDYH 3V4PB 2FX9L 1LYQA 5HYJA 4DJMA 1NCJA 3ZDXE 5FECA 2X9YA 3FB5B 3Q48A 4G9DB 4QUOA 3V4PL 5I1LA 4E9WA 3OKMA 4WFFD 4ZTPL 2E86A 4XXWA 4GRLB 4UAOB 1HTYA 2TSBA 5ISZB 2XA8L 1FZJA 1NC4D 5CNHA 3EG9B 3VQLA 2FX9H 3ZDZB 5BRQA 3HFML 4MJ6A 1QLRB 4GRMA 1WWWX 1MW1A 4RFNC 2APBA 2A1WL 1F41A 4UQ2B 4WKZB 4ZTPH 2XWTB 2EXSA 1G5GA 1QATA 2XA8H 4IIQB 5T5FL 1PZ5A 3K2MC 3BT2L 3AB0B 4NKMA 2A1WH 3R7RA 1Z9LA 1R3HA 1ZD6A 3NZHL 4JY6B 4A7SA 4AGQA 3RZCB 2V0AA 4JFED 4CJ0A 3KPMB 5ECJE 3MXWL 4MDJB 4PB0L 4KUCF 5LGJB 1MH5B 4FCHA 4IHBA 4F8LA 4HHAA 3GUFA 4P2OA 4QJ5B 3LHAA 3I84A 3CC5B 3CHRA 1KIQB 1ONQA 4OGZA 2WK2A 4DO5A 3MXWH 4PB0H 4EN3A 4A1RA 5HYSG 3LQAL 1E67A 1JV2A 2QR0B 2P7TA 1HZLA 3D05A 4Q14A 1DP0A 1WAPA 4MNHB 2XX0A 5HGAB 1RURH 2JCCF 3EAKA 5DS2A 1M2OA 1T66C 1TTBA 1CDCA 4L4TA 2ZOWA 2D7PA 4CSZA 2BHZA 2FE0A 4ZFFA 1UA6L 1VACA 2CO6B 3GJFA 4P5TD 5G5DA 3LQAH 5D1QD 3GSRA 3UTSE 1U3HA 2FGWL 4YDJB 1TTGA 1UOVA 4B7LA 3T3MB 1ITCA 3MUHL 5EBGA 4RIRA 3UFIA 2F7RA 2PTVA 1UA6H 1XCQA 3CNKA 1EJ6A 5T3ZH 2P48B 4IK7A 4F2MA 3F7LA 3LN4B 3T2NL 3HRZA 3D9AH 1E9OA 2FGWH 2BY2A 4KJPC 3D39B 2AJZA 1J10A 5AOJA 2X40A 4GXVL 4K7FB 3T8VA 4DFHA 1SFDA 4F9LA 3QBTB 3KLQA 2AVFA 4A7TA 1XDTT 3ATDA 1H19A 3MREA 5IUSA 3T2NH 2DWEB 2WANA 4LCYA 1CN4A 5GGRA 1N2RA 3VU1A 3GSOB 1NCGA 3B4NA 1XIWD 3FW6A 1EFQA 2XV2A 3QORA 2FCBA 4D7BA 3HKFA 4W9IC 3MROB 3VFSB 5I0XA 3BVVA 4I1PA 1CD1A 4PYHA 4URTB 3L08A 3AREB 4Y1TA 3FH5A 1SVCP 4MA1B 1R5VB 4IHOB 1AVAA 1RLWA 3OAZK 1SHMA 5FKPB 4M8UA 1QZNA 2NY2C 5IVXA 2H9GA 1ZKAA 5AENA 2L8AA 3ZKMC 4WWID 5I9QB 3RVVC 1TNMA 3AAZB 3HTLX 1UXWA 3BCFA 2BZDA 2IAND 3BSGA 1G7JA 4LNVA 1VZGA 5BRZB 2MKLC 4R5XA 1PBYA 5ICUA 4TNWF 1ACYH 3BPCB 1KN2L 4HSCX 1O6SA 1WICA 1Q9LB 3TO4C 4Y2NA 1TQVA 1S8DA 3BPOC 2B9BA 1KIPB 3IJYA 1D5BA 1YAZA 2P5ED 3UJTL 1D5IH 3GMRB 2YUZA 2UYLB 5B8CB 1IFHL 5HJ3A 1P0SE 4J23A 3ZUCA 4KQ0A 5J4MA 4ODWB 4I0PB 2DQFB 2F5AH 4U3XA 1N0XH 2WLNA 2HTKD 2YAFA 3DO7B 1TVHB 1KXVA 4KDVA 4JFFD 4Z3JA 3BRFA 4BQ8A 1E9QA 1LO5B 1IFHH 2Z31C 5K39A 3B7UX 3ZDYF 5H2BA 1WD8A 5DZNA 1T5KA 3T4YA 1GGTA 5EDXA 4PVBA 2EVJA 3ESOA 1CB4A 1UH2A 2WOYA 3CFIC 4FDWA 4M03A 1M9SA 3ULAB 3IETA 2CHNA 5JNYA 5DJAA 4XB7A 2IPKA 2DY2A 3FN9A 2KDGA 2AKRB 3B5GA 5TH2B 2ZWLT 3QIBA 3V9CA 1N5YL 1OE2A 1YEFH 4RGNB 1YYCA 1AS8A 2EYTB 2EINB 3CQPA 1QA9B 5GZOA 4JE4B 3F6JA 2WKGA 5GRVK 1Z9OA 4MS6A 5LWYL 3O9WB 3CSPA 2HRLA 2QQKL 5CU9A 1B6DA 1NFIB 4QHNA 1SEBB 4OU3A 3LEYL 3UDWC 5C9KA 3DK0A 4C47A 5EO1B 3UC2A 2CO4A 4ZSOB 1XGRA 2PP8A 3QR0A 2I07A 5LWYH 2OMXB 2W9LA 2QQKH 3DHJA 2ESVB 2PO6D 2VCOA 2F8XC 4Z7WB 4UNUA 2KLRA 4HKXA 1YEJH 2NXZD 1N59B 4PW4A 3TYFB 4CN4A 1X7QA 5CWSB 3ELAT 2C3VA 4IDJL 3EYSL 5BVPL 3WCYA 2YHGA 4PJBA 4F80A 1C12B 3H2QA 3KPLB 1PZ2A 4QYOB 2XNAA 3L7EA 2R29A 3KLAA 3AABA 1DBJL 1HWHB 1L9PA 2UY7A 2R69A 4LHUB 1J8SA 3L95A 4IDJH 4K7PY 5KVGH 3RWHA 3EYSH 5BVPH 3C75A 1L4IA 4QMEA 5EEYA 3IJSA 1U42A 4HZLB 5F9WB 1W80A 1DSFH 3CDZA 4I18B 3MRJB 3MOQA 2NPLX 2ZUUA 4S2SB 4XN4A 4S0HA 2AVGA 1DBJH 2VJ8A 4ES9A 4HUWA 3WY3A 1E90A 2GABA 4KVPA 4KJQD 4Q7DA 1QW9A 4G7SB 4UDUA 4GMSL 5CR8A 3IU3B 1A8ZA 4QRQB 2C8NA 4GY4A 4JDZA 3EKCA 1KZQA 5CGYC 4G8GE 3FSOA 4AITA 2O61A 4JPSA 2EJ1A 3EJYC 3NJKA 2ZUTA 4Z78A 5K9QG 3TYGL 3DTXA 3VD2A 2EVIA 4YDNA 2E9JA 5LBSA 4GMSH 1JPTH 4ZMXA 4X4ZA 2AK1H 2C4XA 2CBPA 2VN7A 5I1LB 3D30A 1U21A 2XV3A 3GXUB 4LCIL 4RFOL 5AB0A 2ICWB 5FYKE 2CHZA 4BJLA 2AEWA 5KSUB 3TYGH 2HG5B 4ANKA 4YDVB 2J8UE 3MJGX 4QTFA 1OP4A 1JD7A 3QPQC 2EC9T 4X7TB 4BFGA 1AG6A 1PY4A 3QNZB 3WIIL 5AAWA 3BZEA 4XPFL 3P9MA 4GRMB 3TNMA 4LCIH 5IB4A 4Q9BA 4RFOH 3DMMA 3HPLA 4HJ0C 3ZPDA 4CW1A 5C08B 1PLAA 3KLSA 3GO1L 2W07A 4PS7A 4O2CA 1USQA 4WU7B 2WZ6A 1F6LL 4WSGA 1YNKH 1NFDE 2BWDA 3L4CA 4XPFH 2GHZA 1C5DB 5MEPA 5T33L 2G0KA 1KJ2B 4JGJA 1A3QA 5IREA 2CLZA 4WI6A 3QIUA 3EYQC 1XL6A 3GO1H 3ABMB 2N7BA 2HVKA 1I4FB 1P4IL 2O4EA 2VUYA 2WQ8A 2YAQA 5C3LD 2XTSA 4PWKA 2PXYA 1ZRUA 1HCVA 2LU3A 2PWEA 2O30A 1RK1B 3FUKA 4EZLA 4GRWB 1BZ8A 3ARDB 3KL0A 4FMFA 4W1TA 5F9JA 4EI5C 3GUTB 4G9FA 1P4IH 3STLB 2BS8A 3H0TA 1ES0A 1M2VA 2A74C 3ALXA 1MIEL 4WUUA 3JWDC 3UJJL 1ACCA 3VFNA 3N1PC 5L2KE 1G5AA 5HD8D 4GS7C 3WD5L 1OL0A 4CVWA 3JWOL 4CKVX 3VMPA 1W6LA 4HK0B 5EUKB 1KWGA 4QRPB 3EF4A 1M7XA 4R7VA 1MIEH 4MXQD 4PJIA 4WZ9A 3UJJH 1ORSA 2YD6A 3SGJC 1U8CB 2VLJE 5T3XH 4AQ8A 4KX7A 2NY3C 3WD5H 2NXYD 3Q2VA 4WW2A 1JNNL 3JWOH 3LRGA 4PQXA 2W81C 1KIRB 4NWUL 3ARBD 2YMTA 4JM2B 2NY5C 2BVYA 3GZKA 4UQIM 4ZMYA 4QTHA 3FH8A 3OLEA 5DZLA 3VQ2C 1ETZB 1OOWA 4P23B 3BLPX 2F7IA 1OAUH 4P07A 5HPMB 1GIGL 3MRDA 1RP8A 2BNRD 5C9JA 4HULB 3W57A 1YJDL 1IAOB 3MA9L 4NWUH 4W70A 4JKNA 3ET9F 3F7VA 1KJMB 4XN8A 3ZZ1A 1THAA 3GS7A 3SE4C 2K7QA 4RMRA 5IROC 4J7RA 2Z93A 3BIKA 2CKBA 1VJSA 2YGQA 4IBQA 4QDGA 1GIGH 5DJDB 3QDJB 4JNXA 3HB3C 1JI1A 3W0WA 4I3RL 4NFCA 2K8QA 1YJDH 3STBA 1U2HA 1KBGH 4HAGA 3M6DA 4LLUA 2IQAB 5SWSE 1L6XA 5SWQA 3MLVL 4JY4B 4MMZA 1JWUB 4X4ME 4KKLD 2VB5A 1WHOA 4I3RH 4QRRE 1YEHL 1CVSC 1SLUA 2HLAA 1ZVHA 2X41A 3O8XB 1B2YA 1G7JB 4CC1A 3RWFA 4K07A 2CR3A 3QG6A 5IM7B 3MLVH 1U91A 1QFWM 2O6PA 5KTEL 2W88A 4R90L 4YDKL 2WMPB 2V7HB 2MNUA 4GXUN 1YEHH 4KO6A 5I76B 2DI8A 3RDTD 2OL3A 3CCHB 3ZDXF 5E56A 3CZKA 3IJEB 4QGYA 1IC7L 2YPLD 3DX6B 1H3GA 3BVXA 2E7LC 5CCKH 2WBXA 3LN5A 2PNDA 4PWJA 1SMAA 4Y16D 2OR7A 1HKLL 5KTEH 2BRQA 4R90H 4YDKH 3OQRA 5EEZA 1CFNA 5F7DB 4NQUA 3FNKA 3CFEA 2YPKA 4AM0A 4NRXB 1T0MA 4QEGA 4HIXL 1IC7H 3UAJA 2VH5L 4AG4H 1UJ3B 4MJIA 3W1ZA 4IBWA 3SJVE 1PGRB 2OMUA 1E43A 3EYOB 5I75B 4AKQA 2AJSL 1HKLH 2RIKA 3VW3L 2GFBA 3ZHNA 1Y18A 2FB4L 2ZOKA 2ENJA 1F18A 3BESR 4U1GB 5GGTH 1AQKL 2CGYA 5C7XL 4AUJA 3HHSB 4C59B 1L3WA 4HIXH 2AP2A 2VH5H 4ZS7L 4TLUA 1L5GA 2BIPA 2QVKA 1AQ8A 2Y7NA 4ZPTA 4Z7NF 2AJSH 3VW3H 2FB4H 2VXVL 1F11B 2OXGA 4KU1A 3P3RA 5A6LA 1AQKH 5C7XH 1H9VA 1ZTXL 2CD0A 3DETD 4PV9B 3QZWG 3NG5A 4H88L 3VXSE 3I75A 1TEGA 4XBPB 4ZS7H 4IGBD 3US9A 1GPOL 1JGDA 4HJEA 1HSBA 1J1PL 4KV5E 1RP9A 1E3FA 5IEHB 3RVTC 3O4LB 1E2WA 2GAZA 3EHBD 5CIPB 5JORB 1ZTXH 3TA4D 1ETB1 1UZ8B 4KGJA 3ZL4L 3ARPA 4BD4A 5B1JA 3G5XB 3ZL1A 1GPOH 1L9OA 1NCAL 1J1PH 4XNQB 4LKXA 4RZKA 4K5MA 5AALA 4NQEE 4U1LB 3KVPA 4JREB 1XGRB 1D5XB 2G5BA 1UUNA 4OCRL 3UOAB 1EQWA 1ZGLB 2PCFA 1DQJB 3ZL4H 3DNKA 5DT1L 4AJVA 5DHEA 4N1CA 3BH9A 4NSKB 1PLGL 4ELMF 5T1MB 5HHOD 1NCAH 1BLIA 1F5WA 2NMSA 4FYRA 3L3GA 1JHTA 4XCFL 5C0AB 4W68A 1DQQB 3VI3F 4OCRH 4PJ7F 1GYWA 3FQWA 3QH3B 5DT1H 1HEZA 4KQ4L 4NBZB 5EWIH 1PLGH 2YD4A 1MFAL 3MVSA 3QRBA 1JD9A 2CM6A 4N2IA 3CAFA 4XCFH 2UY7B 3TBTA 3PQYA 1A9VA 2BK8A 1IZJA 3QEQD 4GUQA 1MAJA 1JF5A 2GUOA 4E5XG 5E2UL 4I3SL 4BV1A 4P3CL 3NIFE 5GGVL 1MWOA 1IT9L 1MFAH 4GMTL 2LV4A 5IP4A 2CO1A 3T6WA 3LKRB 4OZFA 3HUJA 1CLYL 2O72A 3CFCH 4S1DD 4BCZA 5E2UH 4CBPA 3K6IA 4I3SH 4P3CH 1I1AC 4AV4A 3V6FA 5GGVH 3ULVE 5ISZD 3CLFL 1IT9H 3C87A 5IT2H 3TA3C 4GMTH 1IRAY 4Z5RA 1U8PA 5EPMA 1NPJA 1CLYH 2WBJD 1RZJC 5AW1B 4ZJ9A 1ZJAA 3ZVVA 3QQNA 3MRPB 4JRFA 3CLFH 2QGBA 4XCEA 2NTFA 2DEYX 3GDCA 2OI9C 1AHMA 2HJFA 3MSPA 1O5PA 2EYSA 4BKSC 2A4ZA 5KS9A 2CK0L 1TTFA 5H4ZA 3IPBA 1XGTB 5AVQB 1UWEL 5IW6B 4NN7B 3RKDD 3ARFA 1QFWI 4ZUWB 1ET7A 1BHGA 4Y19A 5DRZB 3U9PL 3N3EA 3VACA 4XT1C 1TLKA 3T65B 3C60C 3M88A 1GYAA 3L3IA 2W07B 4NYLB 4GIPD 5FLVA 4NN5B 2B1AL 1YVLA 4KTYA 1UWEH 4BH7B 3B6SB 5A16B 2R1XA 4NQSA 1EDQA 1LP9E 3QDGB 3U9PH 1NJ9B 3PNRB 5CFAA 3KHQA 3S8WA 2LHAA 5DVNA 1GCYA 2YIHA 3GI9L 3FO1A 1J88A 1LMKA 3VXRA 2C3XA 3P77A 1J7VR 2QGCA 4UT9A 2HN7A 3S3PA 4TQHA 4BUHA 2B1AH 6PAZA 2KZBA 1CU4H 3KPRB 5IJKC 2R8SH 3ILPB 1XR8B 1XCXA 3FRPA 5K9KA 1ADQA 3GI9H 4LPUA 1DJXA 5H37H 4L4VA 3APDA 3T2PA 3IYLW 3QFDB 4OLXL 5CHNA 2WVSA 1J8HA 1B6UA 2H7WA 4RSYA 2CSPA 3PJSB 3WIAA 4P8QA 1PL3A 2G3MA 2LW3A 4AZ8A 5K93A 4CDGC 1PD1A 1FL6B 5F1NB 4MQ7A 3V55A 3L9RB 1EAPB 3RYMA 3LQZA 5E9DE 1XF5A 4WV1C 3VFNB 4XAWL 3WI9A 2OYMA 1NAMA 5F3HB 4OLXH 4M5ZL 4O9HL 3PAVA 1MFEH 1OAJA 2EE3A 4TSBL 3IMUA 3MU3A 1IUZA 5E5RB 2DJSA 4PJIB 4Q97A 1LMIA 4ZNEE 1Y1UA 4XVOA 3TBCA 3EO9L 3BMVA 3UP6A 4M5ZH 4KK8C 4O9HH 5FHAL 1A2YA 2ID5A 1J0ZA 1KLFB 1Q9WA 2ZWZA 4MKMA 5DTFB 1JDCA 2Y7QA 4PHXA 2E27L 3N50A 1JGVL 4J3BA 4TSBH 3N42F 2ZSWB 3QJHB 1CYXA 5CD5C 5IMLA 3JWNH 3U83A 4NQVB 4U05A 1EEUA 2LAAA 3C5SA 3EO9H 1KNOA 1NUGA 2B5IC 3OKNA 4YFLF 5JZ7D 1NIFA 5GGQL 3NQKA 5FHAH 3C2SA 3ARED 3G5WA 3WNMA 3Q3GA 1S2EA 2E27H 1JGVH 2AZAA 4JVUA 3CXDL 4HHGA 4UQCA 1DEDA 1BVOA 2X70B 3CVHB 3IJHB 1OP3H 1ASOA 1F2QA 2L4OA 3AG3B 3CBKB 5FV1L 5GGQH 3DUUA 3CVHL 5BRZD 1JHKH 4K3DL 3V5KB 5J9PB 2XOTA 3GQFA 3QWNA 5EZLB 3CXDH 3I02A 4P46A 4F15B 3KWUA 3SD2A 5DJ6B 1TQUA 1E4KC 1DVUA 3V8CA 5JQ6L 5A2BA 3CVHH 2GQHA 3FRUB 3H4FA 3JBG7 4K3DH 1B0RB 2DTSA 2YD2A 3NCEB 3S98A 3FCBA 5HVHC 2Z65C 1PD0A 3AY4C 4GSQA 4N4YB 1N19A 3WN5B 4UDTA 3FAWA 3WHXB 4ZDHA 2K6YA 1E28B 5IFJB 2EEAA 1JFQL 1ORQA 4NRZB 1MAKA 5D7SH 4OZGF 5E8EB 5JQ6H 3W11D 3MRBA 1HHJB 1GGCL 1OAYL 1HS6A 4V1DB 3APCA 2NZ1A 4C4KT 2JKRM 4L8SB 4MD4A 3SDAB 3OKLA 4URKA 3C08L 4FG6C 5C3IA 3VXTA 3OKKA 2NR6C 1DJGA 3EBAA 1MFDL 2Z8WC 3JV4B 2W0FA 1JFQH 2ZTBA 1T04A 2VXUL 1G9ML 3MXVL 4HWBL 4NJAL 1HSAA 3MUZ1 4ZBJA 4OZIE 2JQMA 4WO4B 1SJVA 1LEGB 3U2IA 2MFNA 5LLIC 1FNGB 3SBWC 3SYAA 5FK9B 5HGDA 1PIFA 2IMMA 4OVUA 4JFEE 4M6OH 3AXHA 1MFDH 2VXUH 3MXVH 5AVUB 4HWBH 4NJAH 4YHML 5TTRA 4KMTL 2QKSA 1KY7A 4RGND 3O3UN 2BY3A 3R06A 1NFDF 3L6FB 3W9EB 3P3UA 4GQRA 2EEXA 5F8RC 1E9PB 2VR7A 4CVXB 5BMFL 5JHDB 3O9WD 4J3UA 4YHPA 3DJRA 2WCPA 3CZUB 4YHMH 5DD6A 4Z76B 4KMTH 2WZ5A 4X6CA 5I6NA 2EABA 5IB5A 4A04A 5CZXC 1M7DA 4ODTL 5BMFH 1LLAA 1HSBB 3TO4A 3QNFA 3G6JE 2AQ2A 5D1QE 3RNQB 1OLLA 3ZE0B 3T0AA 2XA3A 1H3WM 1RZFL 5H8DA 4C83A 3WO4B 4DK3A 4HG4K 3BN3B 4YHYB 5BUPA 1EIBA 1NGXA 3AT0A 2V8MA 3C8KA 4ODTH 1D6EB 3LH9A 4XP4L 3KR3L 4HW6A 1E3XA 4N6RB 4DEPB 4M9OA 1MSPA 1B2WL 1R3LB 2ARWA 5ICXA 5FYLE 3VGFA 4D0CA 3N85L 3GTNA 3OB0K 1KBVA 4E9VA 5D96C 2FJFB 1M71B 4Z7UE 2XN9A 1V10A 4PLKC 4LHUD 3VE0A 2XVGA 3O81A 3FTXA 4XPHH 4OM1L 5E24E 4L1DA 2MKWA 2XFXA 2OTWA 1HHIB 1NOAA 1QSVA 3F2LA 4CGTA 1JE6A 2FQDA 4RMVA 3RVWC 5I5RA 1OGAA 2AAVA 3GMMB 5J57B 4G6AC 1F6AB 1ZT1B 2AV1A 4OAWB 3BVWA 3OXRA 4KBPA 2C3WA 4FFWD 3SKNB 1R5WA 3BH4A 2BVQA 3D1MC 3KLLA 1LHZA 1W72B 2K4AA 3FT2B 4LGSB 2QFRA 5IG7A 5E5MA 4DZBA 1BPLB 1IKNC 4WI0B 4AJ0A 2HVJB 4IKNA 1W72L 5DD0L 5I8OL 4UNTA 2H8PA 4MDRA 2WWKT 3FFCA 1JN6B 1VADB 1WGVA 1XCTB 2HH0L 5HHQB 3HG5A 3D0LA 1EO5A 5CJ5A 4B95C 5D2LF 1IL1B 4MAYA 3BUQA 1P7QA 3QQDA 1LO3L 2AJUL 3BQVA 1W72H 2PLTA 4GYBA 4OR1A 5DD0H 2XUWA 3JT2A 4ZZFA 5ABZA 2C7UB 4GI6A 5I8OH 4G72B 1KB5A 2WXMA 4HF5L 4JFOA 3RY5A 5B4MC 1BVNT 2HH0H 3JYBA 1CS6A 2YD5A 3BOVA 2HT3C 2P5EE 1KTLB 3RWCA 2AJUH 4B9GA 5I6LA 4ZUUA 2HKFL 4LPWA 3QR2A 2EVFA 1KDJA 3BZDA 5A2AA 2IBGA 4HF5H 3T1FA 5DJYA 1AOZA 2E3VA 2FWSA 1IGYA 1XEDA 3VM7A 4MWFB 4CNIB 3QYMA 3Q6FA 2ATKB 3D50A 4DP5X 4CDHA 5FCUL 4NUJA 1PX4A 4M7KL 2P5WE 2IBZX 5EUOF 4TTGA 1FC2D 1G9NC 3VFVB 5ESVB 4AZUA 4IMLA 5DXWA 1WBZA 4P2AA 1WWCA 2UY6B 5EC2B 5FCUH 4A6YB 4M7KH 3CXHJ 5JIHA 3HBZA 2X1QA 3V5HB 4M93B 4IBSA 4TUJA 3MBEB 4DKAA 5EF1A 1INDH 4A6YL 3KPPA 2YD9A 3VMOA 3BN9D 2CXGA 1QVOB 1CE6B 4C4UA 2NDGA 4WU5A 3FO2A 3QAZB 1OEZW 2R2HB 4ORGB 1FPTL 5K9KB 3L1GA 4DGYL 5AEAA 4L4VB 4JQIA 3P2BA 4MXVE 4LDLB 4WI5A 1N12A 1U93A 2QQQA 3AM8A 4A6YH 2RAMA 1U3HD 1KBPA 1C7TA 2BIQA 4RFEA 2Q7YA 4PIRF 1PY0A 5LB1A 4UUJA 2LE9A 2BCKA 1F3JA 1P1ZB 2M2DA 3APMA 4PJ5E 4JQVC 4DGYH 2PPDA 3DPBA 3B9DA 4JM2D 1MG3C 1NC2B 3PV7A 1E5ZA 3MV9E 4OZ4B 2LABA 1J48A 1N6VA 2KS0A 5IF0A 4UWQB 3QRLA 2P80D 3UG5A 2O6EA 4LSTL 2C9SA 5EN2B 5F0MB 2MH4A 1HXYB 3QI9C 1YEKH 3CSFA 4FJ6A 3WG7B 1A2YB 1U8NB 1BX2B 4XVJL 1NUFA 1TZGL 3QORD 4N25A 4ALAL 1J11A 4LSTH 5IR1A 5HHME 1HN1A 4TUOA 2AXGB 2DM7A 4L8DB 5J13C 1M6OA 2VABB 4OLVH 1QKZL 5B38B 3VH8G 3BFWA 4OSUH 3HA0A 5C0IA 2MSPA 1DHKA 4XVJH 3VFOA 1M4KA 4AXWB 4ELKB 3OGCA 1XH2A 4ALAH 4EI5A 5K9OA 3TBSA 1TZAA 3U9UA 4NBXB 3JUYA 5IJVA 1QKZH 1R19A 5I26A 2A74A 4MB1A 5F0LB 2HT4C 4XMLL 2Z7ZA 3UPCA 2I69A 2Y3AA 1N4XL 5GGUA 4AW7A 5I24A 3O3EB 4DPCX 3WTYA 3QCTL 4A2EA 1JPGB 1CI3M 4HJSA 4EVNB 3EH3B 4XMLH 3SGJA 1CF1A 1N4XH 3VD9A 3I50L 1KUMA 1TJGL 2ZOUA 3FFOA 3IMRA 2X12A 4U0RC 3V4VB 2CDGB 1GKEA 3QCTH 5ILTL 1MCNA 2DLIA 1F1AA 3V4VL 3ZTDC 2GW5A 2FHBA 2H1XA 2E9IA 2QBWA 1KPVB 3TJPA 5D6DA 4F20A 1TJGH 1TZHA 3ASOB 5I15L 1BQHA 1KYFA 5CEZL 4IOIA 5HHNA 5ILTH 4N2HA 3Q5YA 1XAKA 1OF2B 4NZUL 4OT1L 5JIDA 5AL8A 1KJ3H 1MLCA 1FYTB 1HSAB 1SYSB 2GK0A 2PR4L 2Z6FA 4I13B 5EO0A 2XWZA 5HSFA 3SE4A 4QO1A 5ANHA 5IROA 2NX5E 5HGDB 2VISB 5I15H 3AGWA 3NFPA 2WXOA 5CEZH 5JQHC 1XF3A 5I1EL 2CLVA 1B88A 3QIBD 4I5BB 4NZUH 2KLSA 2XLLA 1YG9A 3PPEA 4OF8A 2PR4H 4OT1H 1VZHA 4HIIB 4ZX5A 2QVFB 1FVEA 1PCSA 1CIUA 1YEWA 2WSKA 2EICA 1FZKB 3MJ8B 3O4LD 4PJFA 3UADA 5F1IB 2OMWB 1QI4A 4UM9A 4X7SL 4ZFGH 3DA0A 3NCMA 4HETA 2Y0SA 4WEBL 3G08A 3R8BB 3BAJA 3BHBB 4LL9A 1NL0H 3K2UL 1H5BC 2ZX6A 1CCZA 5DZVA 3DVFA 4MD5B 3SDXA 2WLKA 4PJDB 3VFPB 2OJEB 4N1EA 4X7SH 2FEDC 3KCWA 5CJXC 4JJ5B 4WEBH 1N10A 3S37L 4G42B 4I8DA 3KYOB 2X6AA 3BPOB 3K2UH 2E7LA 4X42A 3QCVL 1PQZB 5D7EA 1YNTA 3CVBA 4N2CA 3L1EA 3QSKB 5EIQA 3SZKC 4ABUA 5J3HD 3BFOA 3BVNA 4PUBL 1AIFA 1EX0A 3CN3A 1SF5A 5B22A 3S37H 4HZAA 1F1DA 4WNQB 4Z0XB 3ROLA 3ZZSA 1PKQE 3SDDB 4N3TA 1K2DA 1YEIL 1DEEA 3FOMA 3IDUA 3QCVH 3QRGL 1DN2A 2Z31B 4GNKB 2BNRE 3REVB 1I7TA 4BK5C 5GS2H 3NJVA 4PUBH 3EJTA 2GTZA 1QNZL 5MEQB 1EK3A 1TKWB 4PGCB 4BH8B 4F92B 2EXYC 5E8OA 5KSVB 2BJMH 1YEIH 4OB5L 3QRGH 3UG4A 4M6ML 1P6WA 5CLXA 2D73A 2AK4A 1QNZH 3L3JB 1A22B 5BOPA 3ARYA 2EC9U 3BE1L 4P2QE 4X98B 1HXMA 3EYFA 4MX7B 4XO8A 5IW1A 1QSZA 1HWWA 4OB5H 3EH5B 5I16A 1CLZL 5KSBA 4M6MH 5F21B 3W3BA 5I5MA 1AGFA 4JJOA 4NI3A 5EC1B 5ENWB 5HVWA 3WUWA 4TQPA 1A6PA 3ZTNL 3BE1H 2GCYA 1T7WA 3NN8A 5EOCL 4LOEA 2F1EA 3RVXD 1CLZH 1VAHA 2XJLA 4B41A 3HZKB 4G8EB 4HIHB 1D2OA 4JG0L 1AI1L 3VD3A 3PWNA 2A6JA 2QV4A 1RUQH 4HS3A 5JDSA 4XNBA 1T5WA 1ZK5A 3SO3C 2Y25A 1SMDA 5EOCH 1RZPA 1ODUA 3FFDB 1SOSA 5DRNA 2P4AB 2F7PA 1O75A 3M45A 4Z3IA 1CFQA 1OSYA 5LKNA 3UAEA 5DFAA 1RIUL 1UWXH 2FIKA 3QDME 4JRYE 3QQ9D 4R0LB 1S5HB 3QDGD 1OGPA 3EYVA 3ERXA 1ZEAL 3BT0A 4AYSA 1AQHA 1MXGA 3QIUD 4PGEB 3P0YH 4V2CB 2IAMC 2HRPL 3FB6B 2JLPA 2I60L 4XO5A 5C0RL 4NP9A 3BWZA 4GQPH 1RIUH 2X7LA 2ZYHA 3J8F7 4G1EA 5EIIA 2YXVA 4QRTB 4M4PA 1R3KA 2UVFA 4XVSL 1YY8A 4OZIF 4HX1B 5AL0A 4IMLB 3O6FC 4YAQB 4N8CL 4DERA 3IKCA 1ZEAH 2E7MA 2Z8VC 2ZG3A 1RZKC 4PHZA 2HRPH 1MHHA 2I60H 3NEOA 1WAAE 4XAKD 1OARL 3T5WA 1F4WL 2VDNH 1I1AA 3ATEA 5A40E 4XVSH 2X42A 3BWAA 5AOLA 1NANH 3IJ8A 5FGSA 3VM5A 4N8CH 1MHCB 3FSWA 4WUUD 2IADB 4TUUA 4XPGL 4BUGA 4IRZA 4RNRA 1FO0A 2NTSP 2ZX7A 4MA3A 4N0RA 4X7DC 1BVZA 1W0WA 3GIVA 1AGCA 4RESB 1OARH 4X0KB 3FT4A 4MRCA 1FLTX 3QIWC 4Y89A 4BSVB 3OG4B 3BP4A 3DX9B 2DQJL 2BXYA 4NC1E 2AF2A 4D94A 3FQRB 2WQXA 2GJZB 3LY6A 3OBAA 2NYYD 1TCMA 4UBDC 4QR7A 1UOKA 2VE6B 3U6XA 4MB3A 1YY9D 5HHOE 1X5AA 3X12B 3D2UB 3HCVB 3HE6B 3C60A 1U33A 1Y7VA 4N28A 4BXSV 3BGAA 4U7SA 4DP0X 3P9LA 1QWUA 3RAJL 4BWUA 2X09A 5KYUB 1ZLEA 1QZ1A 4JHWL 3B9KC 4ZAKB 1QFOA 2CIIA 5IOPA 3W0WD 5IV2B 2Q3ZA 4OI7A 4LU5L 1KXTA 1J1XL 4IBUA 4P2RA 3NZUA 3B9AA 4I0KA 3PXJA 5KUKA 2F61A 1OGTA 1UXLA 2Z0UA 2ZNWA 3RL1A 2ZD0A 1FIGL 1RPKA 3K8MA 3OKOA 4IU2A 1UENA 5HHPB 3WDJA 3SE6A 3ARWA 4LU5H 5EDSA 4HWZA 1J1XH 2BOLA 1Q72L 5C86A 4BZ2L 2IGFL 2MQCA 3ETBF 3LKOA 4IJ3C 4MD0B 4WV1A 1JPST 1WBXA 5LG1A 1MQ8A 2AJ3B 2PYEA 4XCNA 1FIGH 4GS7B 2YBRA 1BOGA 3CFQA 4AEFA 2VR5A 1HHHA 3GS4A 3GSVB 4YQXL 3IBEA 4XPTH 1CC3A 4DP9X 1Q72H 4KK9D 5HYQA 5FB8B 1XF4A 3IRCA 2VUKA 2MIZA 1RUML 3BLKA 1ND0B 4NZRL 1IVTA 3BUBA 2EO1A 4MA7L 4HOMA 5FO9A 4O4YL 4ZFZA 2JCCA 2GBUA 4LF3B 5IB2B 4CADB 4YQXH 4ZODA 1MN4A 1YDPB 1HL5A 2V4LA 1JERA 1KBWA 2MOGA 3B9VA 4ALAC 1RUMH 2JB6B 2WUCL 3T0EC 5JW4Q 3FZUD 2XBZA 5IVZB 2EADA 2VWEC 4MA7H 4O4YH 3GEFA 1A1MA 4M56A 5I6XC 3KYKL 4NB7A 2LR4A 1BQHB 1U8QA 4R3SB 4LHUG 1J9CT 4NIKB 1ZA6A 2ZAIA 2XXFA 5CP3H 2WUCH 4E9YA 5JHDD 5EU6B 1MDAA 3VG9C 3GHPA 4K71B 5EZPA 1DE4A 4PRIA 5D7LB 5LXGL 3KYKH 1V27A 2ZPKL 5DWUL 2IWFA 4N0UA 3K6FA 3PWJA 3BO8B 4FQJL 2Q7NA 3QJRB 3L5HA 2OXHA 3H85A 3STZA 2AAAA 2ZWNA 3I3DA 3O6MH 5LXGH 4QOKB 3GSQA 3LEXB 2KQMA 3H7BB 4BSWB 4JPIA 3OKEB 2ZXAA 4IOSA 4FQJH 1MI5A 3AY4A 2WYIA 3EDEA 5JYMA 3AUWB 4LNRB 3JYCA 2BSRA 4AQ1B 3DV6A 1AACA 4L48A 1H6UA 4FOMA 4YS4A 3PWVA 3HAEH 1KPUA 1X9RA 2WOBA 2Q3AA 4M29A 4A37A 1RUPL 3JTTA 3GWJA 5JMOC 4XCYA 3TESA 2AQTA 3BYTA 1I7UA 2BHYA 1ZV9A 3L45A 3MA7B 2C3HA 4MXVF 2NQ3A 4UTAA 3X3GL 1PZ3A 2IWKA 4F5CA 5J12C 1CI5A 2NR6A 2DW5A 4R6UA 5B3JE 5FO8A 2OPCA 4G80A 1U2YA 2EACA 4OKVB 2DD8L 1RUPH 3LZPA 1KB9J 3R4DA 3SBWA 3V0DA 3X3GH 1M1XB 1I1RA 4PGDA 4PB9H 25C8L 1NDMA 1LD9A 2CRMA 2VTFA 2X4TA 3EGXB 1Z3RA 4R4BA 3TFKD 1JV5A 5T1LA 4LLMB 1HIML 3V6OC 5TQ0H 4UU9A 1E4WL 3PIQA 3EOBB 25C8H 1OAZH 2ZP0T 4N2AA 1U3YA 1V7NH 2HTLD 4HUXB 2EEBA 4QGTA 1BZEA 1HEJC 1BVKA 1P4BL 1I7RB 2VR3A 3HE7B 3LN9A 3QEUA 3VRIB 5FO2A 4HKBB 2ZXGA 1AO7B 1VCAA 1FSKB 3IBOA 1SUJA 1QX1A 4APXB 4RDQF 1YZZA 1HCYA 1BREA 1DSYA 1E4WH 3PHOB 4MMXC 1OSZA 5EIVA 3UABA 1KULA 2C1OA 2Y1YA 5DWPA 5DUMH 3BD4A 2D7MA 1EHKB 1P4BH 3VXPB 5E8DL 3RX5A 2R1YA 3P3YA 3WSQL 1A6AA 2NY0D 4XMKH 5GGTA 5CBEA 1DVQA 4FMVA 4GPVA 5BS0B 3KLHC 2FWLB 3DXAB 3AGVA 1NBVL 4OW6A 5AWNL 2YSSB 4Q9QL 5E8DH 4HS3B 1K5NA 1QSFA 2BM3A 3L2LA 1YC8A 4XNUL 4J39A 1XGUB 3ARFD 3WSQH 4KKAD 4ADGA 1VEPA 3L9YA 2VKXA 1E6OL 5E00A 3VWJB 5F3BB 3OKDA 3BPNB 3TEUA 1FNHA 4GAJL 5DFVC 3QG7L 1OSEA 2PW1A 5AWNH 1KCWA 2XC8A 2W95A 4Q9QH 1IGJA 1TVBB 3QJUB 4XNUH 3NZ8B 2IXQA 2XY1A 3H55A 1E6OH 1Q0XL 5CN1A 3EJZC 4M1CC 3TN0A 3O3BA 2ENQA 1T89C 3IS0X 3QG7H 4GAJH 3VXRD 3DVNB 1QYGL 3MBED 4K73A 3SGDI 1IGFL 3SCMC 3MRIB 5FYJL 1IKNA 1PYWB 4PTUB 1G7QA 4QKXB 4UTCA 1W9XA 5GISL 1Q0XH 4OJFL 1MCEA 4U1IA 1CT8B 4WENB 4V11A 1TYRA 5EZJA 4L4VD 3RUGB 2AQPA 1J8HD 1QYGH 1MY5A 1IGFH 2HT2C 4L3EA 2UV3A 3A6BL 2F7QA 2WXKA 4AIXA 3MV7B 1HL8A 3MOBL 2GPZA 4PJ6A 1W2KT 3TA3B 5GISH 1FVCB 1OCOB 4OJFH 5EU5B 3QZNA 3TBYB 3O41A 4ANVA 5I30L 3RWEA 4QRBA 2OMBA 5ABAA 1YYLL 1FO0B 1NC2D 3GIVB 4GJTB 1IC4H 1E5YA 3A6BH 3BJLA 4K94C 1E30A 3UP1A 2AI0L 2JKJA 3MOBH 4R7DB 4XO9A 5LGKA 5FDYA 3P30L 3N1QC 1I8IB 1T4KB 2ADJA 2OI9B 4P4RB 5I30H 2P8MB 4HKJB 4KKRA 3UXFA 1YYLH 2CHWA 2UVEA 4KDWA 3RNKB 3K6NA 4GKSB 2P44B 1CPUA 4POYA 2GSGB 2VL5B 4YVUA 7CGTA 2AI0H 4IJTA 4X5XB 2Q9OA 4PN6A 4LAQL 3IGLA 1U92B 2Y9RT 1U8OB 1X5GA 3HN5A 3X14B 1T20A 4U6YA 4Z3GA 1P1VA 4Z1PA 5IK3A 4U1HB 1TITA 4YZWA 4YZFF 1T0NB 5H35A 3CVDA 3P9LB 4WFGE 5KYYA 2WUBH 4GG6E 3E6HB 4OQTL 1X3DA 5J6GA 5E51A 3EW3B 4PJHE 5JPMC 4LAQH 3C5XA 4HK3N 2GKIA 4HYTB 1EA9C 3CFDA 4PREB 5HDOA 3OVUB 5I18H 2A9CA 2IALB 3ZIYA 4EXPX 4JFPA 3VSUA 1S7XA 1J9RA 3GLEA 4OQTH 2A7BA 2BS71 3ZTJH 1NGWA 3PFQA 1UM4H 3ULUE 1Z9SA 4U1JA 4ENEC 5HYJE 3QUKB 1OCZB 1UB5B 1JPFA 1XO8A 4YFLI 2VLRB 2RJMA 3H9HB 2BNUA 5ABDE 3ZR5A 4L1HA 2LOEA 2MOVA 4R97C 1FZOB 3DRTA 1U4FA 2QELA 2F19L 4JQVA 4X99B 3D18B 1EPFA 2WZPA 3V5DA 4QHKI 4RAVA 1ROWA 1FAIL 5HI5C 4KJPD 2VAAB 1BXVA 1F45A 1LWRA 2Z64C 5GGRY 5AB1A 4NHCL 4I1RA 1T2JA 1FE8L 1V55B 4HGWA 1GTFA 2F19H 1WCQA 4M1GL 4NQXA 3QI9A 1FYTD 2QQLL 1DSWA 4HALA 4PBWD 5D7IB 3DX7B 2VM9A 3ASWA 2I27N 3TBVB 1M05B 2CMRL 3L3DA 3BP6B 4FQLH 4QTIL 3NK4A 4M1GH 2PF6A 1FCCA 3LKNB 2K7PA 2V5MA 4Y2LA 3PGDA 1QPXA 2X4PA 2Q76A 2D9CA 4FG2A 2CMRH 5D4QA 2NY2D 1N64L 4QTIH 1FZMB 4FYTA 4PRIB 1X9UA 3ZKMD 1IAKB 3RVVD 1TMQA 1LXMA 3GMQB 1D9KC 5ID1A 3I6LD 3J27A 4KI5E 3CZFB 3TXAA 4L4TE 4MCYA 4FADA 1N64H 3TO4D 3N44F 4FA8A 4EE2A 3STZB 3LEVL 3SPVB 3K0WA 3SZ6A 1HOCB 1LO0H 4HD9A 1CL7I 4A2GA 4JPIB 1WFTA 3KDPB 4XWGL 3LKQB 4Y9BA 2AMUA 3U0WL 3MAWA 5I17B 1A3ZA 2FECL 3WS6C 1M3IA 3SEPA 5ID0B 1S7SA 4I2XA 2I25N 1XTMA 5DZOA 3WL9B 1Y0LB 3LEVH 1XSIA 1TNNA 5CGBA 5D2NC 1WC7B 3VU2A 4F2ME 1I8AA 3RPBA 2ZX5A 3JTTB 4XWGH 3FYEB 2QKIC 3L5WB 1G7PB 4GKZA 4APQB 2Z31D 3VFUB 1Z5LA 2OZNA 4M62L 4EO5A 1KFGA 1L6PA 3DBXA 3SO5A 1NFKA 4G80B 3KXFB 1SHXA 5GXBB 2A9NL 3JXAA 1WLHA 3BQUC 3ES6B 5DQ9B 1FN4A 1SN0A 4A68A 5CEXA 4YHKL 1OGAD 3DRQA 2CDFB 5IEKA 3VI4B 4LEBA 1LE9B 2GBVA 2H32B 3PAZA 4M62H 4GQZA 1KXHA 3BIBX 2A9NH 3O2VL 2OQJB 4YLCA 3BUPA 1O0VA 2H3NB 1NINA 4YHKH 1MCBA 1H3VA 2B3RA 5GS0C 5DLLA 1CXFA 5IVXE 1T1XA 5C2BH 2X3BA 3MJ9L 3SY6A 3O2VH 2HFTA 5DYOA 3E8UL 1H5BA 1XGPA 2J1ZA 5J1TC 2EUVA 1P7QD 2HJKA 3BRDA 3L17A 4G6FB 4PVMA 1Z9PA 3T0VA 3QW9A 3IB4A 1V8HA 4PRAB 4X9HA 3MJ9H 4OLYL 5CJXA 1FNSL 4PU2A 4H2CA 3E8UH 1G84A 1E5UI 3V9FA 5JPNB 3SQBB 3UTZA 2FLRT 5CBEB 4FEMA 1F4YH 1YEEL 1LGVA 1A0QL 1KCRH 1NMAL 3IF1B 4DPRA 4OLYH 3OF6A 4RZCB 3C6SB 1FNSH 2X6BA 2BSEA 2XACC 1QEWA 1HYSC 1OK0A 4XB3A 1U8MB 5AVWB 3BEWA 5CBAA 3RPIB 5HGBB 4ZW5A 2GTQA 4BK5A 3N0PB 1YEEH 2BHFA 1A0QH 1NMAH 2NNCA 3QNXB 1MHEB 1RZGB 3GI8L 3VD1A 2E76C 5EU3B 1JBJA 4TVPD 3HLAB 5DQJB 4WWKB 1DDTA 2QPFA 4F1ZA 1CXEA 4OF6A 3VWKB 2ROYA 1MCKA 4ODXA 4AGLA 3OAZH 5DJXA 4IKLA 5DYFA 5GGSB 1FGVL 2FT6A 3GI8H 4ELMA 5BJTB 3QJQB 1ZWIB 4OV6F 5IHUL 2UWEF 1RJZB 2BY1A 2IV8A 2DM3A 2FSEB 3S4SB 5TE7L 3V0VB 5F7MC 1O7DE 3VI3A 4PJ7A 1DVXA 4EKJA 2J4WL 3TT1L 5L2JB 3VNZA 2CRYA 1SJEA 5CM1A 1FGVH 3G6AB 4WHTB 4R7NA 4WWNA 1BG1A 3FTSA 3NPZB 4EEEA 4JZJB 5TE7H 4HJGB 2J4WH 2RTTA 3TT1H 1NICA 3AJ7A 2EO7A 2Q6WB 3ZU8A 5JR1L 3LKSB 4LP4A 4PSRA 4M61B 2R27A 2GJJA 4KNQA 2AS5M 1NBZA 3WEAA 1SUHA 4YBLC 4F7MA 3HE6D 1QFPA 5DUBA 3PL6B 3DSNB 1XMWA 3K4DA 1OTUC 4PJBE 2C4FT 5LDSA 3C5ZB 1ZSHA 5JR1H 4JFTA 3X17A 3DC0A 4UT6L 3KH3A 3CMGA 1I1FB 4NPKA 3HC2A 1O5DT 5ECGA 4JUSA 4Z7OE 2IAMA 2Z8SA 3LZQA 3PAUA 1UD6A 5LG6A 2F0CA 5GRVL 3K2IA 4XX1G 5F0PB 3VXOA 5IQLA 4W6WB 3HZMB 5FYKU 4UT6H 4LKCA 3B3IB 2GT9B 3F65A 3O6FA 3FUDA 3IK2A 3HI5L 4L37A 2WC7A 4RMTA 4TV3A 3B43A 3BXNB 3GSUA 1XWVA 1P5VB 2GJ6A 4EI5D 5KVDL 1ZT4B 2PUQT 4ZOBA 2OP4L 4EIGB 5CZKA 4HKZA 2ITCA 3GMLB 3QQ4A 3MRGA 3W38A 5TDNA 3HI5H 4DOHE 4B3EA 4YHNA 4HMEA 3MRHA 3SDCB 4LLQA 2E8ZA 2VKWA 3UTOA 1H8OA 2Z35A 1MCQA 5F6IB 5KVDH 5KYNA 4F27A 2NT0A 1UT9A 2BP0B 5AOMA 1YQ2A 3QIWA 4P9ML 1MWAB 2YRLA 2VITB 4D8PA 1JXFA 1ETJA 1MWAL 2N1KA 1BD2A 3DRTB 3WTWA 5DHXB 2VSKB 4F7TB 1S7RA 2G75B 4NO3B 4YHLL 4P9MH 1Z66A 4U1MB 3MRFB 4KXCA 2J8HA 1MWAH 4GP5B 5I71B 1YUKB 5MHSD 1FAKT 4J3SA 5FW8A 5AAMC 1MCCA 3UBXA 4HGWB 2YKLH 5CP7B 4WF7A 1AZVA 4DGUA 1E6JL 3NA9L 2GI0A 3B9KA 5D7LD 2IH9A 2DYPA 3HB3D 1RJYA 1I1YB 3BVUA 4X4KA 2XJKA 3HMXL 1N9PA 2APXA 1BFSA 4FLRA 4IDLA 1VENA 1IV8A 3GZOA 2FO8A 2Q86A 2EXWD 1CDIA 2NDFA 3SE9L 1E6JH 3ZRSA 3NA9H 4ZO8A 3QHZL 4G5AA 1LE5B 5DF0A 4G9FE 3HMXH 4POZC 4UM9D 3AXLA 3ULSB 4CU7A 1P2CB 1R3JA 4MJ5B 2A0LC 4Y2DC 1S5IH 3FQXA 3CFJA 4WUUE 4DEWA 4Y5XB 4LEOB 5A7BA 3H56A 2MTAA 3P73B 2Q8BL 2CBTA 3CBRA 4DP1X 5FA4B 1BBJA 4U6VL 3RX8A 4ZG1A 1A64A 2Z4QA 3M1BB 2NNXA 2O5YL 3RWDA 3P4NB 1JFHA 1IJ9A 5ESQB 2Q8BH 4YEFA 5I1AA 3LXAA 1ZA3B 1EO7A 2EDYA 3TX4A 3NESA 4B7IA 3LKPA 3T0EA 2O5YH 4R26L 2C26A 4XGZB 2Y5TA 1PX8A 4NHUA 3GXIA 3D4CA 3FTZA 3PAYA 5C09B 4OZHB 3WGVB 1T4WA 4Z7QB 1CDGA 2IOIA 2Z92A 3GRWA 1IEAA 5A2FA 2HFGL 2QSCL 5IMMA 3S5LB 1FC1A 3T6QC 4R26H 4HS6B 5ELIA 2YXFA 1SYVA 4OZGA 5CO1A 5ANMA 2JVUA 2ZYIA 4QRSA 5GSVA 3UCQA 3W0WE 2W60A 4BDVA 1NEZA 5CS7A 3ZDXB 3HE7D 1B4TA 1XF1A 2LLLA 1AO7D 1OPGL 5I8EA 3VRJB 2CUIA 2HFGH 2J21A 4X5WA 2LGNA 5DS8B 3TCTA 4M00A 5D6CB 2KL6A 4PVLA 3VFRA 3Q13A 4GEJA 3PV6A 4PS4L 4B9CA 4IOFC 4PJHF 4G6KL 1A4KA 3BYYA 2CGRH 3L48A 4P3DB 3AG2B 1OPGH 1CLOL 2VN4A 1XH0A 4XE0A 4DGIH 1YEDA 2EDMA 4WK4B 2YFNA 3DOSB 3UMTA 4X4YA 5BS0D 4LOVA 2F68X 2Y07L 4WNSA 4N2EA 3WJMA 4E9LA 2WP3O 4FNRA 1GW0A 4PS4H 3ULUF 4CVZA 3WU1A 3GJFK 4NENB 5CLZA 1CLOH 4N2KA 3T3PF 1SOKA 1K8IB 4DVBB 1SBSH 1TTAA 3K1KC 2WNKA 4NCC1 3MLRL 5IQOA 2V3EA 3VGAC 1DDHB 1UZGA 2APTA 3DJ9A 3SKOA 4EI0A 4ETQB 3G6DL 3HN3A 5FA3A 1URLA 1I3RA 2FUTA 2N3JA 3FUEA 2J57A 1CLCA 3LPFA 5DK0B 3EXLA 5BVJB 2B16A 4MJIE 2ADYA 4QXWA 3LZOA 1GGYA 3MLRH 1FORL 1FFQA 5DEFB 3TTYA 1CICB 5FYJD 3G6DH 4J4PA 5TDPB 1W0VB 3E2HC 4Y2OB 3PWPA 4Z95L 3V6OA 3KEHA 4LZKA 4O51A 3FO9B 3LCYA 5CXPA 5TK4A 3S37X 1C5CL 2Y2TA 4FKEA 1FORH 5JIPA 1UZ6E 3MRNB 4MS8C 2PP7A 2UZIL 2F1BA 4CILA 2JTYA 5DVLA 2MPAH 4Y4FB 2JELL 3FF7A 3UTSB 4DNLA 1FFTB 3FCTB 3T09A 1I1AD 4PCYA 4QHKJ 3MV7D 4Z95H 3ZO9A 5CILL 3ZE2E 4TQEH 4MMXA 4FFYA 3TA3D 1ZHBA 1C08B 1C5CH 3D3VA 2RCSL 2UZIH 4GW1B 2DI7A 5AKRA 1QASA 1WSST 4AYFB 2LLNA 3UO1L 5LJYH 2JELH 3DUHA 5GIRA 4BXVA 1IGTB 2FHFA 2IWEA 2F18A 4K55A 5CILH 2KDYA 5ITBL 1FV1A 5AW7B 4CN6A 1JXGA 1IVLA 3FQTA 1A25A 3KPOB 2BIOA 4G43A 2RCSH 4NQCA 4AL8C 4CL7A 3OC8A 4IMKC 1EVUA 2VXQA 4FI6A 3UO1H 1AR1C 4WWPA 1NDGA 2L7UA 3NGBC 1LWJA 1IGIL 5AVVB 4KOBA 4FKKA 4PRPA 2XIDA 3MLZL 1XB6A 3EYUH 3WS3A 5ITBH 1WBYA 3Q6GL 2WLZA 3FU8A 4AGMA 4F7MB 2BIIA 3I6GA 1PW3A 3C60D 4Y5VB 5DUBB 1L9TA 5D2LA 3FUMA 2V33A 5EMYA 5LAXB 1IGIH 1CD0A 3N41B 4XXDA 2EQDA 3ABLB 2R2BB 3MLZH 4H26B 4H1LA 3T0WA 3TNNB 4U3SA 3QFJA 3CHSA 1Q94B 3Q6GH 5CJQL 5AG9A 1X7SA 3BP7A 4MBRA 4RDBA 3PQYE 2YAEA 4Y4HC 3EJPA 2BXZA 4TVUA 1T89A 3MJ7A 4DK6A 1J5CA 4WW1A 1ZE3H 3SCMA 5I1KL 2WWMC 3KZ8A 1ED3A 4OCWL 2QHRL 3BZFA 4A7GF 2AQ3A 2FUQA 2G5UA 2IPUK 1EUUA 4HC1H 5DVPA 4GAAA 1CE1H 3BGFC 5L4JA 5CJQH 3MV01 2ED7A 5B39A 4PRHA 1T22B 3K81A 1NOFA 3A67L 3HUJE 2XZCL 3OHXB 4MBOA 3QA3A 4OCWH 1N3NB 1RUKL 2QHRH 3T2LA 2JJTC 2X1XR 2XV6B 4AQAA 3DJZA 3TV8A 1B0GB 4YO0B 5EUOA 1JF1B 4KUCD 5CKAA 1ET8A 1QAWA 2PYED 3L5JA 3O4OB 1ZMYA 2WLLB 4MNQB 1GC1L 4H2AA 2CK2A 3A67H 3MRMB 2XZCH 2WTOA 2P49B 5C6WH 1X44A 3NIGF 3PDGA 4GUPB 5E1AB 3HC0B 5ESAA 2JJUA 3VDAA 5JTWA 2VDRB 3QXAB 2DQMA 4I87A 2I7OA 1AZCA 1O7SA 4NKOA 4WTWA 5I8CA 4XMVA 5KS9E 1GC1H 1KTDB 1L9SA 2VDRL 4FQXA 3REWB 2ZKYA 2H47C 4NZTH 1WK0A 1I3VA 4KTGA 3UTQA 1FI8C 3V7AG 1XAUA 2IH1A 4HPOL 1W6WA 1FYHB 1NIDA 4PJGF 4Q2ZA 5DRXA 4XVUC 4Y19E 1HFUA 1PSKL 2XZZA 3FT1A 3S35X 4ZI8A 1CFSB 1M7IB 1IM9A 2I9LB 3NCJL 4YGVA 1MJJB 1XR9B 2VDRH 5B3SB 5D9SA 4H8WL 3MPCA 4I89A 4AGNA 2XRAL 3FBQA 3KPTA 4HPOH 3WTTA 3IGAB 4ZPVA 3AROA 4CMMA 3P0GB 1D7CA 1PSKH 4B53A 1KGCE 2SEBA 4PRID 1WQVT 5DJ2B 3L13A 3NCJH 3WNJA 2DYPB 5CCGE 3TIEB 3VXRE 4H8WH 4AT6B 4YSRA 1BQKA 3QUMH 2XRAH 2CLRA 4I4WA 4OGAC 3AQYA 3RG1C 5EBMA 2A83B 2JKXA 4JFDA 4F2FA 4EAEA 4FA6A 3UZQB 3F85A 2BNQA 3QEHB 1QHOA 2MMXA 3FU7A 3UBHA 1AGEB 1J8HE 1K72A 1T6BX 3FT3A 4LCWA 4EF3A 4JY5L 2BP8A 4IOSD 1ZSDB 1MI5D 3N42B 2FT8A 4X5LA 4BFIB 4H44C 2N7SA 1VKXA 4UANA 2PABA 1UD5A 3DVGB 1OWRM 4F8QA 2JKSA 4UF7C 4DCQB 3E8VA 5J56B 2HXAA 4RRPM 4JY5H 4RQQA 5DDHA 5DJZA 1BBJB 4OFYA 3F8UB 2VQ1A 4PRBA 4UQ3A 3DGGA 4FG6D 1KYUA 2JKIS 2X4QB 1BBDL 2NR6D 4B3VA 4X9FA 2N4IA 1G4RA 3KXFD 2JIXA 4FXKC 4QHLB 3WDIA 1RZIA 4IRJC 4G8IB 3SQRA 2Q10A 1EZVX 4U3HA 3LNEA 1MRDL 3MDJA 5E94B 4ERSL 1J0JA 3L54A 3EJSA 4JW3A 3VD4A 5CR1A 2GSIA 3U2SB 4XP6L 2X4UA 5T1LD 4G8GB 3U4EB 1HZHH 2DQUH 1ZS8A 3E1ZA 4P9HC 4L8BB 1FVDA 1X5MA 3HS0C 4L8CB 2OZ4H 4XNDA 2XZAL 3N40P 4ERSH 1EXUB 5GSVB 1J9SA 3RJDA 4XP6H 4B96A 1JL8A 4F2EA 4MJJA 4KOCA 1PDKA 1D9KA 3U6RA 1BEYL 4G6FD 5CZXD 1EAJA 1UJTA 3VXQB 1QSEA 4A67A 2XZAH 3C9NB 2J8UB 2XIIA 2E6JA 1S9VB 1BZ7B 3TWCL 1AKJB 3QDAA 4X8JA 1WO2A 4JPVH 4L3AA 1TDQA 4F7EB 1BEYH 2X4SA 2G5RA 3AU0A 5MEOA 3F7YA 2WNXA 4J3XA 4MQXC 4PVNA 5DO2C 3BJ91 5KJRL 5D2NA 1NFDB 1UQSA 1CL7L 4JZOA 3TWCH 2G2RA 4ZUSA 4TLTA 1NA8A 1JNHB 3RWIA 3UYPB 2QKIA 3QPXL 4U7KA 3QPKA 5E7FA 3HLKA 4PLKD 4Z3EA 3KS0H 1HHGB 3U0PB 4E9SA 5I74C 1OF0A 5ICZA 1P7BA 5KJRH 1VF5C 2AEOA 4WTZG 5I1DA 3QE5A 1A9EB 3HR5B 1ZHKA 2K1MA 3KPQA 2BC4A 3BQUA 5AYUH 4WWKD 3E3QC 4K5OA 3QPXH 2XQ0A 4N9GA 1GJWA 2C9VA 5DJCB 1BA9A 1L7IL 4Y4KC 4K7PL 3KLDA 5ERWB 1QNIA 5J7CC 1GZHA 3EGDA 4OLZL 4GT7A 3FHAA 3D25B 3PFUA 2XG5B 2IDUA 3CH1B 4OV5A 5E9DA 1A7BA 5K59F 4JFXB 1E8XA 5L2KB 5DVKA 3NAAL 3HAEA 1A9BA 3ZW3A 1ILUA 1CIDA 1L7IH 4K7PH 2XETA 1IBHA 2I26N 4X6CE 4L3ED 1Q8MA 4N2GA 4OLZH 4BQ6A 2R4RL 4M7ZC 3I6LE 3IS1X 2MWCA 2VLJB 1QWHA 2A6KA 3NAAH 4OF3A 5I0YA 4IM8A 4ISVA 2NW2B 3TH2T 3K71B 3S97C 5BQ7A 5H94A 2A9ML 1Q9KB 4HUUB 1KCBA 3KWWB 1IBZA 3IDYB 2HT3D 2R4RH 5IIEB 1THCA 4PJ9B 4ZFOA 4RMSA 3ZX1A 1BZ9B 2QJDA 5GJSL 5J1SC 3NVQA 3RP1A 2ZSVB 4I85A 2A9MH 3FTGB 1FWXA 1AHWA 1IKFH 2K6WA 4YE0A 3QUXC 4G11A 2XN9E 2YWYA 3PWLA 3L3HB 5GJSH 1FHNA 1ZVYA 3MLUL 3RRQA 2KERA 1H8NA 4P5KB 3UAAA 4J3OF 1WTLA 3LNHA 4LLYA 3T4AB 2E9BA 3KHOA 1Q0YH 2NSMA 4TNGA 1BQHG 1OGAE 1G94A 3H9SA 1FH2A 3RB5A 3WHE0 5SWSB 5DR5L 5I19L 5M95B 1NMCB 1MFBL 3MLUH 4LCCC 5C0EA 4Z7VA 3CDYA 3O3AB 2M8XA 2RQ8A 4M4RB 3BSZL 4QRRB 5DK2B 4XBGB 2DIAA 5F7NC 3W39B 1J05A 3WEXA 1ECZA 1JZDC 6PCYA 1Y1DA 2HA1A 4G6JL 4Y1AA 1LO2L 5DR5H 3SDCD 5I19H 3I2CL 2PR9A 1MFBH 3IXAA 5DMKB 3VXUA 3FFCE 1F3DH 3BSZH 4BKLA 3MUUA 4F7PB 4YSEA 5F1KC 2ZOOA 4OCLC 4G6JH 1IBBA 1NGQL 1LO2H 4PAZA 1QUNA 2HPOA 3I2CH 4WTQA 4Q9CA 4P2CG 2WTRB 4IRSA 2BIMA 3FOLA 4Y8DC 4AQZA 2XTJE 1I9EA 1S7UB 2XPGB 2WZPD 4ZMOA 2APVA 2D3VA 1QWNA 5E2JA 3OB0H 3AMLA 4NKDB 3W81A 3L2NA 2F15A 2CXKA 3GBML 5EA0L 5ESAB 3V0GA 3SJVB 4YSSA 2H0PA 5E03A 4I77L 4PR5A 1GGUA 3IT8D 2WSDA 1FG2A 2Z91A 3QI9D 3LDBB 5FV2A 1J5IA 2JK5A 1WYJA 1LO4L 2NY1C 3V0HA 2NY7L 2OFQA 1DO6A 3GBMH 5EA0H 3AWEA 3RGVC 1WV7T 5A2LH 5D1ZB 2H0JA 4I77H 2W9EL 3I9PA 4KC3B 2F8VA 4YGVB 1VDGA 4NN6C 3F12B 1LO4H 3PNWA 3VXSB 2NY7H 2OMTB 2V7NA 3KWXA 2DH3A 3L7FB 1A1OB 4M02A 1K8DA 1Q9OA 3TZVB 1XGQA 1HH6B 2W9EH 5JPMB 2BDNL 1NCWL 1AE6L 2DYSB 3H8NA 4KZCA 4QHUB 4UCFA 5JXAL 3B2VL 1PZAA 4GB9A 4JB9L 2E75C 3OR6B 5L88L 3F84A 3MBWB 4XZUB 3BUDA 3OKYA 5FO7A 1AP2A 1R3IH 2X4RA 2Z7WA 4NQEB 2BDNH 1NCWH 1ZJBA 1AE6H 1UXMA 4WEMB 3DJSA 3N55A 3B2VH 4U6XB 4I48A 4JB9H 2RBLA 4GXFA 1IAIL 1TQSA 3K91A 3FUNA 2JH2A 5L88H 4LLVA 4WY7L 2H4EA 3PHQA 3MO1A 2AJYH 3ZE2F 1ZV2A 2VYRE 4R97B 1HH9B 4K2UL 2WIMA 3FB7A 1SOXA 4LESA 1OHZA 3L4WA 1X5JA 2R0KL 2EIDA 1IAIH 3TJEL 1GZPA 3SY0A 3GGWB 4D0BA 3QUZB 2F54A 2YA0A 3QO1B 3ARGB 4K2UH 5HDBE 3NK3A 5C09D 2ZT9C 3HPJA 5SWZE 3PE9A 2R0KH 1S9WA 2QLYA 4Y1SA 3GXPA 4OQTA 1KYAA 4K0OA 3BKYH 1MVUA 1P5UC 3NIFB 3TJEH 2UXVA 5BXFA 3TEWA 2GSMB 2FQGA 1KLGB 4V33A 4J27A 5IB1A 4L0YA 2NY6C 4HH9B 4PIBA 3CLWA 5JW4N 4YDMA 2ITDA 2Y7MA 1HT6A 2A99A 4ODHL 4FJYA 5LNDA 4IS6B 4NQDA 2FL5A 3MCG1 3ULVL 2X2IA 4ZMWA 1AKPA 2R23B 4MAZA 4J3VA 2OBGA 4TLKA 4EJ1C 4Y2DA 4XNMA 2BSTA 3LSOB 3JZ7A 4ODHH 3QT2A 1YMMA 2CDEA 4YDLB 1T1ZB 1S7TB 3WELA 3LPOA 4W9FC 2N0MA 2BMKB 2XV0A 5CSBA 4OFIA 2D0HA 5F96H 1BIIA 2W80C 1JK9B 2AFNA 1BF8A 3GBEA 3BGMA 4FHJA 2NQCA 4U0QB 2FYVA 4Z9KB 4YPGB 3ESNA 2AQRA 2OYPA 4HMCA 3DTUB 3N40F 2L04A 1OB1B 2YR3A 5TGBA 4MMYA 5G4NA 4DZ8A 3VA2C 5F2FA 3V0IA 5IJDC 2DL9A 1DUYA 1OQXA 4WUKL 4AQOA 3OF6D 4XN7A 1QMUA 1UQSB 1WIUA 1CDUA 2BSED 3WDHA 1MW0A 1YN7A 3VGEA 2XWCA 3R1GL 1FFOA 3MR9B 4YE4L 1KLUA 1LP9B 3SOBL 2F74B 5L4FA 5MHSE 1QTSA 5D7KE 4OIFA 4MCNA 1U8KA 4WUKH 5KS9F 4HJTA 4HZ1A 4GAYB 4OF5A 3EZJB 4M3JA 2EXYD 2ALAA 3UACA 1G6RB 1G7MA 3R1GH 5DJ8A 1IC0A 3WUZA 3ULUC 4FI7A 2ZWKA 4PJXF 2XT1B 4GFXA 2Y24A 1G6RL 3OGOE 5ITFB 4CMHC 3UTSD 1NIEA 5JOFB 1N8ZA 4IEFB 1RLBA 2BVOB 4P3WA 1UWYA 2R0WH 3FYIB 1T5XA 4LLWB 5T3ZE 3M1CA 2Y23A 1T2XA 4BE5A 1F8TL 2MEJB 4PJFE 3V0WL 3LRSA 1G6RH 3ELQA 1A9BB 1UA3A 1IZKA 1FFRA 3QNYB 1ZXQA 1H15B 1V3JA 4WDIB 4LASL 5IQMA 2C4FU 2X2JA 5B1BB 1RZ8A 3SDXE 3G5ZB 1F8TH 5F7BA 1XD0A 2A6KB 3V0WH 3BEVB 1LK2B 1ECYA 1SY6L 2VXSL 4MLSA 4OUOA 4XX5A 4KKZA 4F93B 4LASH 4G1MB 4KFZC 3SSGA 2X05A 5JHAA 4GFTB 1CFTA 3UO8B 4Q6IC 2AQSA 2WTPA 4LO9A 5JW4R 3ZE1F 2VZVA 3JV6A 1SY6H 2VXSH 2YD1A 3KWTA 3CN4A 2Z1KA 43CAB 2CO3A 2WNGA 2AXFA 4MGXA 5TFSL 4AVIA 1DJHA 1HJBC 1MCJA 3Q8AA 2AV7A 3QJFA 2CPCA 4MYPA 2H26A 5J11C 2HYMA 3WLWC 4C56A 1JK8A 3UPAA 5JQIB 4YSDA 5KSAB 4ZUTA 4FL4B 3KCPB 5TFSH 4RA0C 3RA7L 2P1YA 1BAFL 2R56H 2ED9A 4FTVA 5ACLA 5HGHB 3GSNB 1H8LA 4FQHB 1F58L 3ISRA 2AK4E 4LRIC 1YNLL 3GSNL 1UD2A 1AZNA 2O1AA 1JNLL 5IESL 4HUNB 4N0FA 5JOPD 5EB9A 2CUAA 5T1JA 4EDWL 1NC4B 3FS9A 1HI6A 4Z3HA 3RBGA 3MNMA 5KSBE 2PCPA 4KZEL 1F58H 5ICYB 3OXSB 5DRWA 4RMBA 1YNLH 3GSNH 4MCMA 2XWJA 1RH8A 3QIWD 1NCBL 1JNLH 1OANA 4KXBA 3UX9B 5IESH 3NIDF 3UROR 2EIZB 3WHE1 1BQRA 4YSUA 3UYRL 4KZEH 4UBDD 4IMKA 4KNTA 3QWRA 1EBAA 4CU6A 1DJYA 4OZIB 1K4CB 3CQQA 1P7KA 4UIMA 3Q5OA 3CXHK 5INDA 1LILA 2NX5A 5HDQL 5AKVA 4J8RB 3UYRH 1JGEA 4JFEB 1T1WB 5BZDB 2X4OA 4KKBC 4M7LL 3SIKA 1AQDB 3KPNA 4OFDA 4IU3B 4RRPA 4PRDB 5HDQH 3C2AH 3KGTA 1CGXA 1S78C 2WIIA 3GMPB 5MENA 1G7HA 3B9KD 4QCIA 4Y4HA 1BYNA 2DYPD 1S9XA 3POHA 3IU4L 4NNXA 4M7LH 2XBTA 3IDJA 1P9MC 4YVNA 3S2AA 4BRVA 1PTZA 2VSMB 3R8QA 1ASQA 2EDHA 2YAHA 2D31B 3G6JB 5C8JB 5D1QB 3IU4H 2ZKHL 1SN5A 1NLBL 3M17B 5D5MF 5FM4A 5CAYB 2JJTA 4JHUA 3V6ZB 3KPSA 3GLDA 5IFHL 3WIHL 2WQSA 3TIDB 2G30A 4ODUA 1A6WL 4EIUA 3MMEB 3O0LA 1EANA 2YKKA 1S7QA 4V2BA 2QMKA 3RJQB 1QR1A 1PLBA 4OFVA 5I1CH 2ZKHH 4OVVA 3D0VA 1GJUA 4JPWL 1IQDB 3GSWA 3ARVA 5AD0B 2KLTA 5KVGE 2VZ3A 4Z7UB 5EO9A 5IFHH 1TZIA 1R24A 3GLAA 4AE1A 3MO1B 4W6YB 4FLQA 4RA3A 3WFBL 1DQDL 1KIUB 3ZHLA 1INQA 1CZ8H 2PMZA 1QLFB 3U30B 4JPWH 3T6ZA 2QSVA 4DPBX 1A5FL 4UT7L 5SX4H 1XIWB 1X9LA 2EDBA 2ICEC 1MLBB 3T0ED 4MDIB 5KYWA 5BZWB 4LSQL 2L7JA 3WFBH 5BV7L 5JO5A 1CXHA 4HMDA 5J89A 1DQDH 5C2UB 4JRXA 3KBHE 5HI4D 2J2ZB 2B15A 3EJRA 4G8GD 4P2QA 4RMWA 1S9WB 1A5FH 3SPCA 4UT7H 1PEZA 2EKSB 3BKML 2NUTB 3IXTA 1IM3B 2V6HA 2YD7A 1O7DC 4CN1A 1HK6A 2CO2A 3ECVA 4LSQH 4ZX6A 3AS0A 5BV7H 5TF1L 4MRBA 5IB1B 2YC1A 3L1OL 5L9DL 4LCVA 3GZQA 2UZXA 4F33B 2NZ9C 4JDVA 5TE6L 4P2RE 5FYKD 2DICA 3BKMH 4AMKL 1MPAH 3T77A 5SV3A 3UTTE 5KVMC 4H5SB 1YAIA 1XF2A 5TF1H 1RERA 1IBGL 3L1OH 5L9DH 3S4SG 4WFHE 3AUVA 3T2OA 1WCBB 1RK0A 1T3FA 2P24A 2MJWA 5TE6H 2P5EB 4AMKH 2H45A 4M8QB 5HVGB 2MQ0A 4R8WL 2BFVL 5C0FB 4NUQA 1CGYA 1NBYA 3A22A 1I8KA 1IBGH 1NDTA 4U33A 5GRUL 1QLEB 5KVFL 4FNPA 2YQGA 3SKJL 5C0JA 2HUEA 3M86A 1CG9A 5DGQA 1S7VB 3VXMA 1QHPA 5C07A 5MERB 1QLEL 3ZDWA 4PRNA 4R8WH 2BFVH 3L5IA 3QXWA 3HG1A 1C8PA 1Q38A 2DQDL 1UTDA 5KVFH 4G7QB 3S5YA 2P5WB 4FXKA 4AVHA 5KW9L 1L0QA 1YMHA 2EKJA 2L3BA 3NJLA 4LFHG 3MNWA 4KK5C 5CSZB 1QLEH 1ZDSA 4IRJA 3QEGL 1CDHA 4XNXL 2XWXA 4E68A 4KX9A 5F6HI 2V2XA 3D85A 2DQDH 3U1SL 5EORL 2X4NA 2ZOLB 4GW5B 4J2QA 1LEIA 1WJ3A 3DHUA 5FW7A 3CVIH 3QEGH 2VJ0A 4QXGL 4HDIA 3HS0A 4XNXH 3AS3A 4GUOA 1TVDA 3ECBA 4JG9A 2D0FA 1FH5L 1CDBA 5JIKA 3U1SH 1U8IB 4MAUH 4ZS6D 5EORH 1DFXA 1HDMA 3GKWL 1H6FA 2ZUYA 4XRCA 3HZVA 2GHWB 1EEYB 4N0UE 5T3XE 4QXGH 1BYPA 1CXKA 2VLJD 4K9EC 3KW7A 2BOBA 3GINA 1DCEA 2BOCA 3D3VD 4HP5A 1H0DA 1FH5H 3G5VB 4PJ5B 5AAWC 4XMXA 3CFBB 3MCKB 1VGEL 2PYFA 4YFEA 1JVOA 3R0MA 2ZKXA 2WBWB 3GXFA 3QISA 1MI5E 1WZ1L 3KDMB 1R5IA 3MV9B 4JFZL 4PJEF 4PMEA 4ANWA 2N0KA 4NDMB 3IVKB 1G43A 4RMUA 2DQIL 2D4FA 3KM1A 1HQRB 2DLEA 2FK9A 2VR9A 4E9XA 3KLHD 1VGEH 3G5YB 2J3SA 5KANI 1WZ1H 2FWOA 2FQFA 3QHFL 4JFZH 4JLRA 4F5CE 3RTQB 2HFEA 2DQIH 3VJ6B 4NFDA 1UM5L 1X5LA 1MIMH 2EE9A 5HHMB 5DFVD 3II2A 4JO3L 4L3CA 4MQTB 4YSOA 4UZSA 1CQKA 5GS1A 3QHFH 2ADIB 4X4XB 2CNYA 4YL9A 3UTPD 2YRZA 1B3JA 2WSPA 3CVCA 3QFJD 4GW4A 4YBQC 3NRQA 1BPVA 2JSFA 2DN7A 1UM5H 3QJFB 2GJPA 4Y4KA 2NOYA 4X6EB 3U46A 1TLMA 4LBEA 8CGTA 4UYPA 4NCC2 3MRRB 4IKJA 5AKTA 5E0QA 3Q2LA 5KZCB 1FF5A 2ZP8A 2FWUA 4PRHD 1GGIL 1QO3A 2HFFA 1UGKA 3MRCA 2EDLA 3ZDYE 1EFXA 1DANT 2KHAA 1SHWA 3NBNA 1RIHL 4BFNA