1TFPA

Transthyretin (formerly known as prealbumin)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
CPLMVKVLDAVRGSPAANVAVKVFKKAADGTWQDFATGKTTEFGEIHELTTEEQFVEGVYRVEFDTSSYWKGLGLSPFHEYADVVFTANDSGHRHYTIAALLSPFSYSTTAVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of transthyretin from chicken.
pubmed doi rcsb
molecule tags Transport (thyroxine)
molecule keywords TRANSTHYRETIN
total genus 21
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 1tfpA00
3CFNA 1Y1DA 4HJUA 4N85A 4KY2A 4AC2A 5DWPA 4ABVA 4I89A 5CLZA 3SSGA 5CLYA 4WNSA 5EN3A 1TZ8A 3M1OA 1SN2A 4N87A 4PMEA 3NEEA 3GS7A 3OZLA 1F41A 1FH2A 4DEWA 4HISA 4L1SA 1IJNA 1DVZA 3DJTA 2PABA 1ETA1 5AKSA 3KGSA 4PVLA 4TQIA 3Q1EA 4N86A 5CM1A 5IHHA 5BOJA 3GS4A 1SN5A 5CN3A 1X7TA 2FBRA 2G5UA 2QGCA 2WQAA 3KGTA 4IKIA 4Y9BA 2H0EA 5FW7A 3W3BA 4QXVA 4IKLA 4IKJA 4TM9A 4Y9CA 5AL0A 3TFBA 3CXFA 4FI7A 2G4EA 5AL8A 3IPBA 3NG5A 3ESNA 3FC8A 3P3UA 1E3FA 3OZKA 3CN1A 1QABA 1THAA 5EZPA 1FHNA 2F8IA 3GLZA 4PWEA 3D2TA 4PWIA 4Q14A 4TNFA 3NEXA 2FLMA 4PVMA 5DEJA 4Y9EA 1IE4A 4IK6A 3A4DA 3BT0A 1ICTA 3ESPA 4ABQA 3P3RA 3HJ0A 3IMRA 4HIQA 3I9IA 3DK2A 3U2JA 4D7BA 3IPEA 2G3XA 2F7IA 3GS0A 4FI6A 5E4OA 5TTRA 4ABWA 4DERA 1DVTA 1TTBA 1TYRA 1OO2A 3NESA 2H4EA 4PVNA 4DESA 1TTCA 2H1XA 1GKOA 2G2PA 5JIQA 4I87A 4TNGA 3CN2A 5L4IA 1KGJA 2QGEA 1F86A 3IWVA 3CN4A 3DIDA 5FW6A 5E4AA 4WO0A 1BZ8A 4IKKA 5K1NA 4PWJA 2G9KA 2TRHA 3I9PA 3NEOA 4TL5A 4MRCA 3GRGA 4TLUA 4ANKA 5CLXA 1RLBA 4PM1A 4Y9GA 2QELA 5AYTA 5CR1A 1E4HA 3TCTA 3CFQA 4TKWA 2QGBA 4YDMA 4PWGA 2H0FA 2B16A 3CN3A 1ZD6A 2NOYA 4DEUA 5JIDA 3B56A 3P3SA 1DVSA 3DGDA 1QWHA 3DK0A 3IMUA 3P3TA 2QGDA 3IWUA 3DO4A 4PWHA 2GPZA 2ROXA 4PWKA 1BM7A 2B14A 4TNEA 3A4FA 2G4GA 4L1TA 4FI8A 1KGIA 4PWFA 3CFMA 4MRBA 1TSHA 1ETB1 2H6UA 3KGUA 5CNHA 1IIIA 1BMZA 2G2NA 4QYAA 4TQPA 5FO2A 2TRYA 3D7PA 5HJGA 3U2IA 5JIMA 4DETA 1DVXA 5FW8A 2G3ZA 3QVAA 3A4EA 4TL4A 4HJSA 4YDNA 4HJTA 1GKEA 5AKTA 3DJSA 5E23A 1IIKA 1DVQA 1TTRA 4WNJA 3CN0A 4TLTA 5L4FA 4TLKA 1E5AA 1SOQA 1SN0A 1TLMA 1X7SA 3ESOA 4IIZA 3I9AA 3CBRA 1G1OA 5A6IA 2B77A 3IMSA 3IMVA 3CFTA 1BZEA 2IGLA 2B9AA 4TQ8A 2H0JA 2GABA 5L4MA 4Y9FA 3FCBA 4PMFA 4AC4A 1TT6A 3GRBA 3IMWA 1Z7JA 4ACTA 1DVUA 1DVYA 2QPFA 4TLSA 1ZCRA 3IMTA 1SOKA 5K1JA 2ROYA 1BZDA 1THCA 4I85A 4ABUA 3BSZA 3GPSA 3DJRA 3DJZA 4TQHA 1TTAA 4QRFA 1U21A 5AKVA 1TFPA 4IK7A 5L4JA 2B15A 4MASA
chains in the Genus database with same CATH superfamily
1GSMA 1R33A 1RURH 3QQ3A 1YNKL 2V9TA 3N9GL 5DLMH 4FN0A 1AHMA 2J2ZB 3QORC 3QJZA 5DD6A 1A66A 3PL6C 2B39A 4ZSOB 4HPOL 4S1DC 4TQEL 4OFVA 5AZ2L 2DQTL 4Y4KB 3AVEA 3NFPA 1NJ9A 2VDPB 4GMSH 5AKSA 2XN9A 3NIFB 5AWNH 1MJ7L 4F9LC 3T0DA 3P0GB 5I0VA 1IGCL 2UZIH 5E4EC 3MRFA 4FCAA 1F97A 3QG7H 3ESNA 3CDGA 3BDBA 3PDOA 3CG8A 5GRVL 2ICEA 2X1PA 1BOGB 4IBYA 3SE4C 4PGBA 1KGYE 1BD2E 4G6FB 4I4WB 2DI7A 1HC1A 3V0EA 1HILB 1A65A 3QT2A 5C9JB 3ZMRA 2Y2WA 3NTCH 4KRPD 2W1NA 5KSVA 2Z31D 3BQUB 4PVNA 1BXXA 4J4PD 4U4BA 3EBIA 1MCKA 3FRPA 5FFLA 2IPKB 2WNXA 3P0VH 3RUGF 5LKNA 2P42B 1JNLL 5DZAA 2UYLA 1QWUA 2IVFC 3VMNA 4YHYC 1MREL 1NDGA 1BJ1J 3T2QA 1OCWH 2EH8H 2D2OA 2XQYG 1EPFA 1QO3A 4LIQL 3KCPB 5MI0C 2XA8H 1KT2B 5LGJA 3LVEA 2PYED 3KM2A 3QDGE 1ZHNB 3GSOA 4IRJB 5JQ6L 1KYAA 5HGHA 4PG2A 2XZQL 4CADB 3FO9A 4FLOA 2FNBA 3ZUCA 2J25A 2GPZA 3Q0HA 5JYLA 1RZ8B 1D7CA 3THML 1UA6H 1JZ3A 5CILL 2P8MA 5DJYB 2J5LC 3R1GH 4PGEB 4FZEL 3D7PA 1AY1L 2XZCH 4E9LA 1BG1A 3MNDA 4LHUG 5KYUB 4RAVB 3TA3A 1ZA3A 3BCDA 2F53E 2MNJB 3FAXA 4L4TE 3HB3B 4ODXB 3WHE0 5H37A 4M1DH 2P48B 4R84A 3CFKB 5BO1L 2FBJL 2PR4L 4PRHE 3CVDA 3H53A 3HC3L 4L5FE 1BQHA 1T3FB 2EYTB 4QHNB 1L5GA 4U1HB 1FNAA 1SYSB 2H3NA 3I6LE 5LG1A 1FHGA 4YHPB 3ZDZB 1JPTL 2HT2C 3Q9PA 4OZFH 1KCSL 1JFQH 5E1IA 5LCVL 5HXMA 3TS8A 1VACB 3ZL4H 2QADD 1BP3B 2DQHH 3OR6A 3HC4L 3V0FA 1DQJB 1MW1A 1ZLUK 3QDMD 2A74B 2KT6A 4JAMA 5C6TL 5JOFA 4XH2B 3TT3L 2AK1L 2VABA 3IJ9A 1X4YA 2VLKA 5FECB 32C2A 2AK4A 1B0WA 2RJMA 5F8QC 1SHSA 3GO1L 3LIZL 3VXQB 2IPTH 4OM0H 4CSSA 4FFZH 3VWKD 4TQIA 1S7RB 4NM8L 3K6FA 2ICCA 3QYCA 3IAPA 2GY5A 2K4AA 4F7MB 2AXWA 3GSNL 3QUZD 5TDNA 4L2LA 1YEIH 4HUVB 4I18A 3VXOA 1P1VA 4AUJA 3N41F 3QISA 2HFEA 4OR1A 4NRYA 1JI1A 1LO4H 1WP6A 1XIWA 3G6JF 3M1BA 3IBOA 4H25B 4PG9B 5F7DB 2NY3C 8PAZA 5HJDA 2ARJQ 1JPGA 3Q5OA 3A4DA 5T33H 5EF1A 4NQEA 5DRNB 3KYMB 3O41A 5E0FA 5FA3A 3LN4A 1QBML 1HK6A 1MCPH 2IWKA 3L5XL 2FGWH 3IGKA 2JCWA 1GXEA 2W9LA 3Q6FB 2FQGA 4TVPE 2GJJA 4W1TA 5L4IA 5EN2A 1O5PA 4ZMQA 1WCQA 4M6OH 1TKWA 2EIJB 1GHFH 1ZTXL 2G9KA 2VSKB 4HA1A 4AQ8C 2F9BT 2MQ3A 3W39A 4N5EC 1GOFA 1JNHB 1CGUA 2VUKA 3VH8B 1Z32X 1II4E 1WFIA 3B56A 4A2FA 3LRSB 1HL5A 4TTDD 1CL7I 4UOJA 4GS7C 3RAJL 1S9WA 5IHUH 2DMBA 4HP5A 4KBPA 5F2FA 4M5YH 1N9PA 3FSZA 1MAJA 3JTSB 3RBSA 3HS9A 1A9EA 1KB5B 1QZ1A 2KL6A 3X11A 5HTSA 1TTUA 5I0DA 2E6QA 3KXFD 4JFTA 1PW3A 4JS7A 2ZNXA 1NBYA 4LCWE 4TRPL 5E1GA 2CIKA 2HFEB 4LSTH 3VFGH 2R1YA 1SXBA 3VXRB 4FMFA 4K8RC 4O9HH 3NJIA 1A6UL 1P84K 2A6JB 4IRSD 1WITA 2NXYD 3QULB 5C09E 1HX0A 3U9UA 1MH5A 2EDEA 2GFBB 1SHWA 1GCFA 1AGBA 3E8VA 1EAPB 2BC4B 2EINB 3G5XB 5ALCH 4DPAX 5I6PA 3FMGL 1D2PA 4NGHL 3S8GB 1UUNA 3U36B 4JFDB 5DJZA 3C6EA 1CDIA 5D7HA 3D3VD 1FGNH 3AG4B 6FABL 4O58L 3MLRL 5DZJA 4M1CC 1VKXA 1SJXA 3AY2A 2EDXA 3TO4D 4F1SA 3W38A 1TUPA 3HZKB 3FUIA 3GS7A 1TU2B 3FAWA 2IV8A 4OT1H 1C16A 4M6NL 3IDMA 3GXFA 3Q06A 3VSUA 3I75B 2BIQA 2HVBA 3EHBB 1Z0MA 3A22A 2YA2A 4G8AC 1URZA 1T83C 5E6UB 1WAAE 3RVUD 4NAQA 4R7XA 3T71A 3TWCL 5ID0B 3WNNA 1OP9A 1L5GB 2CE6A 4DTGL 4GUQA 4QCIB 3ES6B 4FA7B 3QZWB 1GJWA 3FQTB 3LH2H 3OZKA 3PWVA 4CBZA 1RI8A 1SZNA 2XBDA 3QZBA 2DQDL 2FIRT 4M7LT 3SO3C 3U0WL 1FCCA 4LPUA 4FNLH 2J8OA 3ZKQD 1AMYA 1HXYA 2JJSA 2EVIA 3OB0K 4RAVA 3DX8A 3IU3B 5T3XH 3B9DA 3SPHA 3UXFA 2V8MA 1U8MB 1MEXL 2CGRH 2K0RA 1MXDA 5JW4Q 1A4KA 5D7JA 1HL9A 3NQIA 4JE4B 3US0A 4HLZH 2COVD 5F88B 2MPAL 3T65B 4AT6B 3QDJD 2ZKMX 2JCCB 35C8H 4U1SB 3B9KC 4HF5H 5HGHB 4EI0A 5LGHL 4WKXA 4PJ7B 3OAUL 4EZKA 4AQEB 3ZX1A 5IMOA 1PKOA 3LXAA 4GQZA 4RISH 1ZDQA 4AE1A 2F1AA 1KULA 1KC5H 2PXYD 2XWRA 4C8XA 4N0UB 2VDMH 3A5VA 3DX6B 1DUYB 1MDAA 4QRTB 3TBSB 5FOBB 3VXUE 4OSUH 1A7OH 2XTJD 3BH8A 4BK8A 5E6IB 1REIA 5J7CC 1KY6A 3GSWA 3WSQH 2ZXAA 3FQNA 4FXKB 3BMVA 3VCLA 1WBYB 3FZUC 2QKIC 1PZDA 2DDQH 5JHMA 1JCKA 3LS5L 1A02N 4YE4L 4PRDB 3ZE0F 3UJIL 2E7CA 3OSVA 4NZTH 5C9JA 4DSYA 1N5YL 5ESVA 3UTSA 3IGAB 3QXTA 4OF3A 4D9QD 4ZMNA 3EOTL 3TBBA 3LKRA 3L3JB 1DZ0A 4HBCH 3T8VA 5IFHH 4G7VH 2MTPA 1NBZB 4G7QB 3TTSA 3CZKA 3AG2B 1BMWA 4TUOB 2Z4QB 4PIRF 3VFTB 2BS8A 2XTSA 3FK3A 4QNPF 3ZUNC 3HRPA 3ZVVA 4HKXB 1LWRA 5B39A 4EUPA 5C0CD 1BFVL 1Q0YL 3MBED 1MFBL 1VZIA 4N2DA 1FG9C 2R4SL 3QQ3B 2GTQA 4ZT1A 3WLWC 4TNVF 2Z65C 4NQTA 2PO6B 4CW1B 3BP6B 3VFWA 3VD5A 1A8ZA 3K72A 5DJXB 3VDCA 3SD5A 4RSYA 4WAFA 2FSEA 2V5RA 1TVHB 3DROB 5CU9A 4PJCA 3SDDA 4I1NB 1UWEL 4DUXA 5CSGA 3TIDB 5FW7A 4EQ3A 1NM9A 2W9DL 1MFEH 3CVHH 2KLTA 4ALAH 4U6XA 4BSWB 1RIUH 2EKSB 2VMDA 2ZCLL 4X0KA 2VLKD 1TITA 3MROA 5ETUB 3ZZQA 1IGYB 4Y1SA 1G4MA 1YEHL 5DVPA 3RKDD 3LRHA 2XV2A 4XPFL 4LCCA 3V0VB 3A23A 4U6HB 5L8KB 4NC2B 3BEVB 4U1MA 2VZ3A 4PP2A 4A04A 3OMAB 1XGYL 2LW3A 2ZT9C 2VL5A 3GSRB 4TMPA 4PI2A 5CJXA 3A24A 3UIYA 4BFKA 4R8WL 1MWAL 1PIFA 1MLCA 3QB7C 5DD1L 2CKBL 1VFAB 2VMEA 3IJHA 2X70A 4PRNA 4NQCE 1F86A 1SOSA 4LCUA 4WW2C 3WJMB 3ZYJA 1Q9LA 2ZKWA 2AI0H 3NACL 4B9JA 3VJ6B 4NKOB 5IQMA 4CVZB 1ACYH 2CLZB 2BSRB 4HUWB 5AW6B 3NZHH 1AGEA 3CCHB 5EEVA 1U6AL 3APDA 3D48R 1TFHA 2KDYA 1RSYA 4BWWA 1E2VA 1QFWH 4X9GA 4HXAL 2ZCKL 4KXDA 4NUPA 3O2DA 4L8SA 3QJRB 5I1LA 1D5BA 1EGJH 4L4VA 5IUCA 1AXSB 3FU7A 4OQTH 4K7PY 3PGFL 2B1HH 4E42A 5EZIH 3ULVC 3EYUL 4UM9A 4UQAA 1BVKA 3ARFD 2X3BA 3D87B 1M6UA 1RHHB 3WTXA 2FEDD 1KDJA 4QAWA 4GRWF 4U0QB 1MHEA 4PJXE 4L3CB 1UD4A 4FFVC 4NLAA 1QLEH 5E8PA 3TT1H 1UT9A 2NX5E 2BSTB 1KYFA 1CGVA 2UX7A 3SZKC 3WFBH 2YBRA 2FE0A 4JO2H 2NR6A 1MCNA 3I85A 3U6XA 3DBSA 5FWRA 1DQML 1JDCA 4FXLA 2XC8A 1SPDA 2RR3A 5E03A 3EOBB 1GGCL 1IGFH 1EK3A 4AUUA 1GGIL 2VLLB 3QXAA 2VXTL 1KCVH 1JXGA 4V2BA 2Q7YA 4JY6A 5CEXA 2YUXA 2WQ8A 4LFHG 4UZUA 2V37A 3QIUC 3MOBL 4H44C 4TTDC 2XNAB 4HOXA 3K7UA 4CC1A 5B38G 5KSBE 5DJZB 1E43A 1ZSDB 1SDDA 1HSBB 4G82A 1QR1A 1PL3A 3UO1L 3C60D 1TPXB 1UQSB 4AWJC 1U8NA 5AB9A 3OXRB 1OOAA 4I13B 4XPGL 5I8OL 3EIFA 4M02A 1YMMB 3U9UB 3HAEH 2B59A 4H8UA 1HHJB 2AGJL 1JSYA 4WI9A 4E9SA 2JKWA 1D9KD 3R19A 4M7LH 4X9BA 1KPUA 3OR7A 1RZKL 1X5XA 1AZUA 4XO5A 4H0GA 4AW7A 1SNRA 4OGYL 4MQ7B 2K6WA 2D7NA 3SKJH 2XETA 3RY6A 5JTWA 1QUNA 3GQFA 4QOKD 3TBYB 3CGTA 3IGUA 5HYQA 3IPEA 4DERA 5BQDA 3ZTNL 5JMRA 4NUJA 5KS9F 3I9GH 3GJEA 4HEPA 4WCYH 3UGUA 1BF8A 1IX2A 2H1XA 4K5LA 4N6RA 2K9UA 7FABH 3JVGC 3MLSL 2A2QT 2XKNA 2ZKHH 3MXVH 1E5CA 3ATFA 4PGDB 1OTTC 1S7SA 1TQUA 2BJML 4JKMA 1OF0A 1CD1A 5I1KL 1J88A 5B1KA 4HLEA 2ED9A 3V5KA 3CQQA 3RWHB 1HOEA 4PWGA 4JE0A 5TGBA 3WN5A 5IK3A 4NERA 4NUQA 5K33A 2E27L 3BKCH 1ACXA 2NTSP 5JOEA 3BEWA 3DDGA 2FWOB 3LNIA 5ITBL 4WWOA 3OV6A 2OCJA 4NWTL 4U2ZA 4LSVL 5DI8B 2JQAA 2NXYB 2GI0A 4M8UA 4HCGA 2EH7H 3HLKA 3LRKA 4FYQA 3FO2B 4DGIL 1TG8A 1B2WH 4XNXH 3UTPD 4IOIA 1TO4A 3I6SA 3UZEA 3DX0A 4I18B 1DCLA 1OAQH 3HPLB 3NQKA 1NFDB 2ICWJ 3UBXI 1N0LA 3SCMB 1WPCA 4QHLA 2B3RA 2WMPA 3U7YL 4AEIH 3JUYA 4JPVL 5I76B 1OF2A 1ZIBA 1ZJBA 2OR8A 1HCVA 1ZEAL 1HHIA 4BRJA 3DV6A 3EYVA 4LL4A 5A2CA 3R8BB 1OAKL 1V3KA 2QVMA 4UQ2A 5FYLE 5INCB 5IP4A 4LVHC 3NIFE 1BD2A 1RIHH 3EO1B 4GP8B 5EZOL 4DGVL 4FQQA 3FPYA 2IMMA 3QJVB 3IKCA 3O6FC 3E6FA 4XXWC 1RK0A 4MAUH 4JPVH 3U83A 4PB0L 3OZLA 5LNEA 1FH2A 1J10A 3TESA 4OJEH 2FT7A 4LPYA 3ZKMD 5EORH 5BVJA 1G7LA 5BS0B 3BZDA 1WHOA 4H2CA 4NYLB 4BWTA 4K8RD 1T4KA 1WEJL 4QO1A 1MG2C 3R0MA 4YSEA 3DOIA 1JIBA 5C0NC 1AOZA 5I82A 5F0MB 3PWNB 2VDPL 1ZPUA 2XRAH 1Y07A 4JHAL 1S7WB 2VSMB 3WLBB 1RPQA 1MI5B 3V6OC 3LH8A 5F1NB 2RACA 3FL7A 1DEDA 4N22A 1A0QL 5JA9A 3E6FB 4PRAA 4OLWH 1FNHA 1MHCB 5IHZB 1D5RA 4W4OA 3RWFA 4N2HA 2H6PA 1G5AA 2ADJA 1RL1A 3F5WB 4E2OA 2E27H 2XVKA 3Q8CA 1UXWB 1Q1PA 3DV6B 3N91A 2JF1A 2VDRL 2Z7UA 4ZAKC 3WKQA 2BSDA 4Z7OB 2DQEH 3HE7B 2UXFA 4CVXA 2Y9RT 1PY4A 4GG6F 1OB0A 2AQ3A 4PPTA 3TYGH 3LZRA 3WNPA 1F3JB 3DV4B 4HLJA 4GW1A 4PRHA 2YGNA 3PABA 4H13C 1QEWA 1WTLA 4EI6A 4G8GA 5C07E 1JYWA 2WOYA 4FX5A 5C0RL 4WCYL 1CO1A 2FJSA 3I9GL 1QTSA 2AV7A 1QBAA 2CWRA 4KUZH 3MN8A 1RKRA 3F7VA 2AJZB 3V4VH 4LLVB 8FABA 4FYTA 2UZXB 3BWAA 3SGKC 2G5BA 3IFNH 1SLWA 4AYBA 1TZGL 4N20A 5CAYB 2VR6A 4X7TB 5CZRA 1DDHB 5CJXC 1PG7W 2I85A 3ZYZA 4E41B 1KXQA 4M7LL 2BNUB 2ICEB 3CHRA 1D7FA 1CGWA 4P46B 3ECVA 1MNNA 3M7OA 3B8SA 1U3ZA 4D9RD 4GRMB 4JFEB 4AW4A 1WZLA 5IROA 4X7SH 4HOWA 1T66D 4TQ8A 4EI5D 4D9LH 5J3HD 4M03A 4OIAA 1IO4C 2ESVE 5D72L 4J1UA 4W81A 5CFAA 4POZD 1R6VA 3TL5A 1ZPLA 1UT1A 2ZG1A 3KHOA 2VZUA 4JZJA 2DQEL 1KGWA 3U46B 2BWIA 1WTGT 5DO8A 2OXGB 1Y1DA 3BMWA 4NZUH 4LASL 5MENA 3ZE1B 3VW3L 3QRLA 2ZYSA 4N87A 1U3HA 3K3QA 2VMJA 3QARA 5CCGE 4A7TA 5IVXF 5LAXA 2DIEA 1J0HA 1JHKL 4PJ8B 2ZAHA 1T7VA 2AFNA 2WPGA 1MCRA 4BJLA 4RAUB 1T2QL 5EFIB 5I6KA 5AVQB 4E5XA 3T3PF 4GRMA 4OCLC 1ZHKB 3O6ML 4Y9CA 3MRHA 2GITA 5DU7A 3SBWC 2LU3A 1HHJA 2C9VA 4HD5A 1QHQA 4S1SH 1R34A 4FZ8H 4Q14A 5DRZA 4LLUA 4OI9A 4XNBA 3L5JA 3KL0A 2DY2A 2YR3A 1SM3L 4R7LA 5IOPB 1BQLL 1QR1B 2AJVH 4G8FB 4Y5VC 2Q9OA 5EZIL 2Q8AL 5HHNB 5KTEL 1MJ8L 1PZAA 1NGXA 1ZGLA 2RH0A 4HWZB 3EADA 4HWNA 4NQXA 5JHDB 3VM5A 2IBGA 4AE0A 1OW0C 4LNRB 4A7QA 2ZUQC 3X1EA 4XPBH 4G83A 1J8HA 1EMTL 1K2DA 1LO5B 1TZHB 3IS0X 4HS8H 1URIA 1JYVA 4X9IA 3TJHD 5CFHA 4Q6IC 3S4SB 3QXAB 3U82B 1JGVH 2AF2A 3FB6B 3J07A 2LTQB 2I5YL 3MX0B 3QJHB 3B2VH 2JCCF 2P8LA 4TKWA 4A7UA 5I2IA 1B0RB 2VE6A 4O2CA 1R5WA 4JFPB 5INCA 1MFCL 3OAWA 5FKAA 4G7RB 2D7TL 3B9KA 3KNBB 1KIPA 3ZQ9A 2X6BA 3WEAA 4XX5A 4CSTA 4EIUA 1A3QA 5HHOD 2V8LA 1OAQL 1TQBC 4J8QA 5HHOB 2BVOA 4M7JL 2VIRB 2YK1H 1WC7B 1UWYA 4PBWD 3PQYB 5IBLC 3RVWC 4OD3H 1B2WL 5JR1H 1QR4A 2AP2A 4H88L 3GUTA 4WI2A 4U3SB 4CSZA 2PYFB 3KWWA 4NNXB 4IU3A 1GYUA 4L4VB 2EXWD 3V4PL 1WS8A 3NDZE 5E51A 1UWEH 1PZ5A 1NMBL 1GOHA 2QHRL 1CFNA 5GGUA 3E8UL 3OKEB 1JBJA 2Y5EA 1HZKA 4IJ3B 4DKFH 1L0PA 4XBGA 2BO0A 1WWAX 2BHFA 2EEFA 3ERXA 4HQQH 4OLXH 5HHXL 1BMGA 1H8NA 1LK2B 2B3IA 2EXYC 1MCSA 5AW8B 5K9KB 1KF9B 5KOVC 5JW4M 3BEWB 2HLFD 2NDGA 3BAWA 4UTAA 5B1JC 4I9WD 1R3IL 4BUHA 2APBA 2OZ4H 3BP4B 5FAAA 4PJ5D 1YPZE 5GRVK 2CPUA 3V5KB 3C9NB 1S9XB 5T5FA 1UJTA 2ZICA 4TSAL 3F7PC 2NCMA 2EDDA 5EZJA 3REWB 2WLLB 1N7ML 4A7GA 1KTLB 4UT9A 4Z7NE 5IFHL 2R69L 4S10A 1SN5A 3QUHA 1ORSA 3ZHFA 3PHOB 1TEFA 3VD4A 1H15A 1SMAA 4KHXH 1BYPA 3IXAA 2YEQA 4JG5A 1EEUA 4WKZA 4ZPTA 4PJXF 3GHEH 3MLXH 5D1ZC 2BFVH 2AK4D 5D7IB 3NIDF 1RZKH 1H3PH 4JKLA 3TCLB 1P6FA 1RERA 4LHUD 3WJJA 4IK6A 3I3BA 3LNEA 1YC7A 4HKJB 4KK8D 4MX7B 3AT9A 4IEFA 4WTZG 5D2NA 3UC0H 1RZFL 1RJYB 1ITCA 4JRYB 4ZMXA 5I8OH 4N2BA 4XNQA 4S0TD 2UX6A 4GMTL 1IKFL 3WIIH 3HHSB 5E8OB 3WE6B 3L4CA 3FOLB 1KGJA 3NSJA 3C8KA 4GW5B 4WV1B 2DB8A 4H8WC 1BJ8A 1CJYA 3QIBD 1WBZA 4WI4A 1RSFA 4FGMA 4IRSB 3QDME 5E9DA 4KGLA 4TL5A 4XOCA 3DETC 1MHPH 35C8L 4MAYC 5D7JC 1ZAGA 1YEDA 3F2LA 2F6AA 5B38B 2VQUA 3RVTD 2MPAH 3FBKA 1YN6A 2LFGA 3FJTA 1RZJC 5EO9B 2PCFB 3MV9E 4R0LA 1DQMH 4RFNB 1MJUL 4AV0A 1KMGA 4MJ6B 1NCHA 5F1KC 4BZ2L 5FEBA 5K9JH 3HC0A 1W72L 5ESVB 4RRPA 1HNYA 3FRPG 1ZHLB 4GP5B 4O51A 4LEOB 1NCAH 4BH7A 5EOQL 2DMCA 2H8PA 1U93A 3QDHA 4LSPH 1UWXH 1YYLL 4K7PH 1JZ8A 4MVBC 3D0VB 3RE0A 5EBMB 5E8DL 1QRNE 3D0VA 4WTXA 4GP4B 1F02I 3ZRSA 3IEAA 4XP5L 4NO0D 2YD1A 3LMJL 1ECYA 1IL1A 1DUZB 2HKHL 3INUH 5MHSD 3G5ZA 5A3ID 4OI7A 4Q9QL 1A7BA 3KBFA 2GABA 4GEIA 1EGJL 1JVLA 3HZVB 4GKZA 3EJRA 4Y9FA 1EJFA 1ZT4A 4OD2B 3WKPA 1RUKH 1F6FB 3MO1B 3OXRA 4FTDA 4HEPG 3VTMA 4AJVA 1R9FA 2OZNA 3DNKA 1CB4A 4NN5C 1XR8B 1OEZW 5I1LB 4GYBA 1HI6A 1ZA6B 2OMXA 1TVDA 1JYNA 1JV5B 3CXDL 5EWIH 1FO0H 3WEBA 2CKBH 7TAAA 2N0MA 3CLWA 1AZZC 1I1RA 3AWGA 4CVZA 2XIBA 3AREB 4IDLA 2YAQA 1CIUA 1DSFH 1U8OB 1XGYH 2HYMA 1NIDA 1T1YB 3MV8E 4Y5YB 2KQMA 3S36X 4N8CH 5CM1A 4LSTL 4F8QA 2ZOUA 1F4YH 4IKLA 2MCPL 4JFFB 4HJ0D 1S7TB 2YUZA 4KROD 4S11A 1S9YB 1YEHH 2J5LB 3OM3B 5EZLB 2ADYA 3S98A 2HJKA 2ZCLH 2EVFA 3P54A 5C70A 3QFGA 3ZKNC 3EDEA 1JHLH 4P2RB 4XB7A 3KH4A 1IUZA 3UTQA 1WIUA 1NCNA 2FX9L 2QSQA 2P47B 3S0PA 1JK8A 2EDJA 4BSJA 4DO6A 1KPVA 3SCMC 2ZSWB 3X13B 5KYWB 4X7EC 2AQRA 4PJ8C 4WIQA 1RIVL 1DR9A 4X99A 2BNQB 4GLRI 4LDCA 4XCYB 3KWTA 3PHQB 1NC2D 1S9XA 1TJMA 5L2KA 3SPGA 1R3JB 3VD9A 3ILQD 2DV6A 3MO1A 2C5DC 5EUOB 3A6CH 2DWEB 4P5TB 1ML0A 2P3YA 2V5TA 1VERA 5I1CL 3VRLF 1UB6A 1FE8H 1UJ3C 1XZ0A 3QWRA 4YNYB 4J23A 1ZS8A 3RUGB 5K9OA 1ANUA 4UQ3B 1E4WH 1OT4A 2Q76B 2WB1A 2YD6A 3KGRA 3MRGB 4YVNA 2CO6B 1RJLB 3IJHB 4PRNB 3FF8A 1CYGA 2FGWL 5EMYA 1MCPL 2CO4A 1OARH 3ILEA 4ZUUA 3QUZA 3VB8A 1F00I 2OSXA 4FNUA 2FVNA 2D2CC 5G4OA 3UADA 3VI4A 3R0NA 2BOCA 1S4IA 2WWNA 2OL3A 3HZMA 2WTOA 4I3RL 1CS6A 4B7IA 3RWCA 3EOAA 1ERNA 1DQTA 3CZLA 3W37A 4U49A 1NMAH 4H26B 1O5DT 2DDQL 4WO4D 3QWNA 3NK3A 3PQYA 5L4FA 1XHHA 1WUZA 4WI0A 5GJTH 4FFZL 3JZYA 1IM9A 3DIFA 3GZPA 2FIKB 3LIZH 4FQHB 4C4UA 4ICXA 5I5JA 5E6IC 4PMFA 1XXFC 3ULVF 2FSEB 3TT3H 4KRMB 3KMDA 4OUOA 4O2CB 5I0XA 1R3JA 3M45A 3OAUH 5DD0L 3QPXH 4GW4A 4Y2LA 2NSQA 1DHKA 3VFMB 2KH2B 4CN4A 1WICA 4QRBA 5CCHE 1N6QL 4EN3B 2YAEA 4L37A 3LQAC 5BMFL 2OTWA 4KY2A 4BELD 2Z1KA 4G8EA 4I5BA 4S1RH 4AQEA 5AW0B 4P5TA 1RUPL 4MA7H 2XZAL 2V2XA 3QEHA 3NEEA 4FG6C 5FA4A 4F7EA 4OZIE 1KELH 3NRPA 5L2KB 2GJ6A 4CC4C 3N06B 1S9VA 4EUPH 3LZFH 3UZEC 4TUOA 3U6XS 4NRYB 3HC3H 4S1QH 1J48A 2FBJH 2PR4H 1I3VA 2YGOA 4PJGF 4PJ6A 1A7QH 5IFJA 43C9A 3C5SA 1MIEH 4I77H 4NHUB 2IDSA 3S3BB 4FNLL 3RHWK 3QDMA 2WQVA 5E9DE 3T77A 2IANA 3ARZA 4KKPA 4QIRA 4J3OG 5FYJD 1J18A 3IRZA 3UTSB 2O5NA 3HG5A 1J05A 3QQ9C 1S7UB 1UXMA 2OPCA 4Y9EA 3N04A 2WXIA 4HSQA 5D7EA 1X9UA 1SQMA 3SYQA 1BVLB 5KSAC 2GB2A 5I19H 5JLZA 3CVHA 3K71A 1U92B 1Y18B 5KS9B 5EFIA 1DBAH 2UWEB 4WWKD 4OT1L 3CMOL 5ADOH 3PJSB 3SBRA 2AJUH 5HYFA 1VACA 2BVUA 5FF6A 3RY6C 3LSOB 2AQ1A 2VXQL 1OKEA 1A1OA 2V3DA 2VDQL 4GQQA 4IMLA 5IR1B 1CMOA 3SKNA 1ZWIA 2XA8L 5C0DB 1H8OA 2D7QA 3LEXA 2WO4A 3EF4A 4AENA 1MREH 5FYKL 3A21A 4X8XA 4Y2OA 3FMGH 1ZT4B 4OD2A 1JNLH 1CLZL 2GSMB 3BUQA 3L5IA 4JPWL 1NEPA 3S5YA 3T2OA 1UB5A 4ODXA 4ZUTB 3IJ8A 4HGKC 1ADQA 2XX0A 3HG1D 5J9PB 5BZDB 2H6UA 2C9RA 1N0XL 3KAAA 1GMIA 3BO8B 1MCBA 4KVNH 3QUXD 1OIOA 5D7IF 4HLZG 1GYVA 3UAJA 2MHAB 2AEWA 5FV1L 3C60C 4F3FB 3QG7L 4Z78B 4KKBC 2RHEA 4KRNA 1I75A 3O4OC 3VXSE 4HD9A 4H0HB 4NN6C 4XVSL 4WK4B 1PSKL 2WLHA 1A7NH 2WZ5A 4H8PA 3C6LD 3UCQA 2WLIA 4GMSL 3RL2B 3H9SB 3L4YA 3JT0A 1NCIA 3C5ZD 4D0CA 2IAMB 5GZND 3DVNA 2HT4D 1I7UB 1NFAA 1NCTA 3N9GH 4HYTB 2HSIA 1NDGB 5F7BA 2XV3A 2WBJA 2CDFB 1IBBA 1WIOA 4NM4L 1I8MB 1TZHA 4ZQKA 5BNXD 5F9DC 4FHKA 3HNSH 4GW1B 2XI9A 4D94A 1VCAA 4GBXD 4XP6L 4MDIA 2RCSH 2YKKA 5CR8A 2YD9A 2XHNA 4G5ZH 5B38A 4WLCA 4HWZA 5KANG 4W9DC 4PR5A 3T6VA 4XC1L 2DYRB 1YEFL 2D4FA 1UXWA 1RPUA 1A4BA 4OJCA 5I9QC 1EAPA 3CTTA 4H20H 4HSCX 3WS3A 5GSVA 4FLSA 4PTTA 1D5MA 1MFVA 4KRLB 2P8PB 4I8DA 4ONHB 5GISH 4H8QA 1G7MA 1CXLA 2C3WA 2O5XL 2VDLH 2XT1B 3KYNA 5T33L 4JPIA 1HKFA 1NCOA 1UADC 1NCWL 4ZSOE 4Z7QE 3EBGA 2EC8A 3NFNB 3VWJC 4RVBA 1LO4L 3SGEH 1NBYB 1RZIB 4AV4A 3P02A 3UGEA 1CQYA 2J73A 3MGAA 5I8CA 3ZDZE 3SDYL 3OKLA 1PNCA 1VB9A 4LDEB 3CX2A 1MSPA 4OLUL 3IFPA 2XFGB 1UD6A 5KSBA 1MF2L 5DD5L 4ZMYA 4NM8H 5DYOA 3RPIA 3I6GA 3FTSA 4HK3N 1R1CA 4OM0L 2PXYA 4HFUH 2CBTA 3S7GA 3X3FL 1AO7B 1UFUA 4GG8B 1BVOA 4DGWC 2A38A 2MEJB 3BPCA 3TV8A 3UTZB 3VRIA 1NIBA 4IJTA 5GS0D 4IBZA 3DVFA 4UDUB 3HC4H 2Z0UA 4WHDA 2DJ4A 4YBLC 1I9JH 1ROCA 2BRRH 3G04A 1IGIH 1D5IL 3LEVL 4AGOA 4AMKL 1LVEA 4XN5A 3BP4A 5AG8A 3QXDA 4NWUL 3VSTA 4NKQB 3HG1E 4ODHL 4DWHA 3GI9H 1HXMB 1CGYA 5H94B 1C08B 4C54A 3VGAC 4MD4A 1E3ZA 4LVOC 3PP3H 1NGPL 1BXAA 1KTDA 5IHWA 3ARDD 2CUHA 2ESVA 3CLEH 4MRBA 4M1DL 3J8F7 5SX4H 3V4UH 2TRYA 1R24A 3ILPA 3MKGA 3OKEA 3SGKA 1T0NA 3DYOA 3ZGHA 4D7PA 4WJ5B 4U1KB 4Y89A 1GA2A 1OOWA 4YHNB 4A37A 3KPRE 3E7JA 1XIWB 4AQOA 1CURA 4NNXA 3DIVA 2AV7B 1F6LL 1H6FA 2C9PA 2XTJE 4Z7OE 2NY2B 3SGJA 1IEAB 4BCYA 5HYIA 3IN2A 5SWSD 4EI6B 2NNAA 9CGTA 2WNWA 5IB2A 3DX2A 1BZ7B 3V6ZA 4JFHD 4FQXA 5IG7B 4ZMOA 5KVEH 4JO4L 3T1FA 1L7TH 2HZHA 4M7KL 1COBA 4OGXH 4Z7IA 1QTPA 3VB9A 4RBPH 5CLYA 2E4TA 3D30A 3QCUL 4GSQA 1Q9OA 2CUMA 4K8RH 1CT8B 1OCWL 2EH8L 1K2DB 1LO5A 2VMCA 2NQCA 3QUML 3FS9A 4KFZC 1HWWA 4LMQE 4YDJA 4C56E 4NS0A 4ODSL 4JJOA 3QJHA 2RB8A 1N59A 3FQUA 4WHTB 3FB6A 2W07A 1YEEL 3S4SA 2F7OA 4BKLA 4KVCH 2BSSA 2DWDA 2VISA 3MBWA 3ULUH 2FYYA 4TUKL 1E4JA 4JDVB 4JDEB 4YFLI 4PJ9B 3QEUB 1A5FL 3BQUA 4A6YB 3ARFB 2VQ4A 5IFAL 1H6UA 4Y1AA 2F8XC 3FU6A 5HHNA 3CN1A 2L8AA 4Y4HD 3ULUE 4NB7A 2WD0A 5JHLH 4K3DL 1Q4NX 3D34A 4FS0A 3MRMB 2J1KA 4M1GH 4PJ8A 3AAZB 5A6MA 1ZANL 2YA0A 3OX8B 3ZHDA 4F5CA 1TYRA 3TV3H 1OALA 3SE3A 5IV2B 3WO3B 4LIQE 1D6VL 4OJDH 5FFGA 4AL8H 4Z3TA 1K6QL 1VJSA 1KZQA 3MZTA 2OBGA 4MNQB 5KVDE 1KFAL 2TRHA 4ZO8A 1BW8A 2J2ZA 4U1LB 5BO0D 2AXGB 5CIPH 1KIRA 1ZT7A 3C2SA 1Z2KA 5LWYH 4MZIA 5CGYC 4PREA 5EHFA 1X5AA 3H2WA 3P2TA 4RNRB 4ZFOL 4WI5A 3QUKB 5KW9L 1IE5A 4PBDA 4LCWD 1OSYA 2ROXA 4XWGL 1MAML 4M43H 4NJ9L 2FX7L 5HYSG 4HS3A 2A77H 4C55A 1VPOL 1QBLL 1C5DA 3UYPA 3X14B 1Z0NA 5F7YC 3UFIA 1Q9KA 4G3YH 2VERA 5LCVA 1T7WA 1D9KC 4KMLB 1E3XA 5T1DH 2Q2EB 3CFBA 2VDMB 2WIIB 4WWKC 3IETA 1N3NA 3L54A 1CFBA 1EX0A 2YD7A 4X6BA 4EO5A 1G9HA 3DSNA 1KTKE 2FK9A 5CBEB 3EJSA 4ZX3A 3GJFA 4PREB 4CN6A 4YK4B 3IDNA 2DYPA 4HJJH 3U30C 1EAJA 1KACB 4XVUC 1QAWA 3KE0A 3RZCD 4DW2H 4P59L 4M7ZC 3M1CA 1T7XA 2CGYA 5TQ0H 1EZVX 2ICWA 4AENB 2P5WA 3MRLA 3UABA 3C60B 2X6UA 4P5TC 4OZHB 4GRLD 1K3ZA 1VAHA 4BSVB 1RZ7H 4ZFFA 3UTSD 4JHWL 2G75B 2NT0A 3ARDA 2ISDA 4K71B 3WFCL 4R4NC 2I32A 1MLCB 3BKYH 1AS8A 1E5BA 3I84A 3CVIL 4UM8B 3JWOH 4IBSA 4ZDHB 3F5WA 1VIWA 1FZOA 2M26A 3IJSB 4G8IA 4U1MB 3TH3T 2A74C 2YXVA 1XGQB 3EO0A 3MRNA 4FFYH 3PNWB 1P5VA 3T9WA 2AKRA 3IJYB 2Z35B 4UMGA 3TN0A 3GK8H 4XR8C 1WYJA 5F1NA 4OI8A 2X5PA 1TJIH 5F96H 2BY2A 2GEEA 1IFHH 3P73B 1QSEE 3BDYL 4GXVH 3GSQB 4JRXB 1ZLDA 1M7IA 4ALAC 2XN9D 3BPNC 5FFOA 1B90A 1HU8A 4OCWH 4I0PC 5I8KL 1L9RA 3SKUD 2ETWA 2CRZA 3QXWA 3QNFA 3V52H 2XN1A 3A0OA 1WD8A 3L4TA 1B0IA 2UXVA 1TVHA 4FKEA 3BVNA 2DQFA 5JHDE 3SPIA 1QRND 2OSYA 4K94H 1MQKL 4IKKA 2GTWB 3OPZL 4P9HL 3WFZA 4OF6A 2QVTA 4W93A 1HHIB 3QI9D 4Y16C 4RMBA 4LVHB 4GW4B 2F53B 2RTTA 4XBEH 5AD0B 1JAEA 1JHTA 5K39B 1T03H 5CEZE 1FNEA 3CSFA 3FTZA 3HPLA 1NANI 2HKAA 2YD4A 3A4FA 2GCYB 5FGSA 5HGDA 1UZGA 3CFMA 1INQA 2AQQA 1XCQB 3VFRB 4U6YB 1CYXA 4RFOH 4HXBH 5DRXA 1N0LB 3SCMA 5HVHB 4HU2A 5IEKA 5BV7H 4AXWB 2LLNA 4OZHE 2QPSA 3PWLA 3CH1A 3DJSA 1KTBA 2QQNL 5GZOC 4TULH 2BOCB 2OL3B 3BSGA 2LGNA 3DARA 1A4AA 4D8PA 1KOAA 3APMA 2ZUYA 1G7HB 4QJ4B 5ALBH 3MLZL 5M94B 5FYLD 2PP9A 2ZQKA 1VEOA 3KVDD 3TEZA 3GMOA 3SGJC 4I3SH 1NH6A 4HHGA 4ACTA 5JDSA 4L0ZA 3HA0A 4LCUB 4HULB 2NXZB 3RUGA 5K9OB 4UDUA 1JNNL 5DJDA 2ID5A 2QEJA 2BMKA 1YEJL 5CJBA 1NGZB 1ZV9A 1QUPA 1DQKA 2VN7A 3MNZA 4ZFQA 1WVZA 4QLRA 4CNIB 5HSFA 2R1WB 4BK4A 4HUNB 4XCYA 4NUJB 5FYLH 2JELH 1NL0H 1F4XL 4OFKA 5I30L 3QEQB 4F2MA 2X4QB 4X4YB 3WNOA 3QQNA 2XQBH 3CAFA 1EIBA 2ZZUT 2UZPA 1BLNB 2EUVA 3D52A 3EJCA 4FQIH 5HDBF 3P4LA 1KLFA 4ONGH 5M95B 1DYZA 2AQSA 2VLRD 4BFBD 3QCTH 1YDPB 1T21B 1RZIA 2Q3AA 2OXHA 1JN6B 3ARXA 1KPUB 3F12B 3OR7B 5C97A 5JPNB 1BF2A 5JXAL 3VFOA 1QFWM 4RFOL 1BFSA 4WW2F 1DJWA 5I18H 4K3JL 3VMPA 2NY6B 4A7VA 1SDYA 3QZWA 3KPPB 1AZRA 4P9MH 1JDDA 4PTTB 4JPKL 3SY0B 5IMKB 1Y1UA 4P46C 4R7DA 1AJ7L 2VM9A 2P46B 4ZUSA 4G7YH 3WIAA 4ZX6A 3RZCB 2CBQA 3KPLB 2PO6C 4MXWL 1FNGB 3NUKA 3X1NA 1IC7L 3WIHA 4RGNC 4XBEL 2YZ1A 3BN9C 2HX8A 3GJFK 2ZCHL 3O0RL 2R9HC 2JIXD 4X5WB 4ELKB 5CEXB 3QJFA 1OANA 1U8PA 3IGLA 2Q7YB 2Z4QA 2EE3A 1NBVL 1CXKA 4JQXC 5E2TH 3DX1A 1KJ2H 6PCYA 1KJVB 3D05A 3FTUA 2QGBA 1J5HA 3U36A 4ANVA 2EDLA 2JSFA 3V6BR 2BC4A 3V52L 3IPFA 4NUMA 4Z95H 1KN4L 4HZLB 3RPKA 2GFBA 2VC2H 2DWXA 3Q13A 3HE7C 2WUCH 3C6LA 3GBLA 4Q56A 2OYLA 3WV0A 4JY5L 3K4DA 1VCBC 5DHEA 1UH2A 2DZEA 2OMVA 2P4AB 5C0IB 1NBQA 2AERT 3BGFC 1SBSH 3C5XA 1PF3A 1AGDB 5CEYB 5ISZE 2IPUK 4OAWA 3GIVA 5DA0B 5A1AA 1M2OA 3K2IA 4XVTH 5F70A 2NXZC 3L7EB 5EUOE 4IIZA 1J11A 4LBEA 3ROOB 5BV7C 3QHZH 1LDPL 1Q94A 2MQGA 5H2BA 1QLFA 1ADQH 5DMKB 4BCXA 2O61A 1S9WB 3KPQA 4TLSA 1CGSL 3E3QE 4ODUA 1MNUL 2BIIA 2HG5B 4ORGA 5I1AA 4JHBA 4KI1A 1NBVH 4F58L 2C1OB 4QNPE 4JRFA 2NY5L 4XMLH 1UOKA 2P44B 2QR0B 1O7VA 4KZCA 3AITA 3BH4A 4ACPA 4GAGH 5EN3A 1PTZA 3T6ZA 3G6JE 1DJZA 2ZXGA 3JV6A 1KBKA 4N8VA 3NA9H 1NLBL 1ZHBA 3EDKA 5L0QB 2RGSA 1S7UA 2ZPKH 4P9ML 5E95B 2ATAA 5EOTB 3V8OA 2WINA 4K3JH 3MSPA 1Z5LA 2CKBA 4ISVB 3COOA 3QO0A 2Z6FA 1LL1A 1EH9A 1I8KB 2ZYIA 3VXMA 2QL1A 1SVCP 4Y4FB 5HYJE 1NPJA 1QBLH 3DXAE 4YSQA 3QCVH 4JZOB 4WFEE 5CSBA 3UX9B 3PAZA 3RB5A 1J5OH 1HHHB 4NI6A 1MIMH 2CG9X 4UAHA 4PW3A 3F7KA 4ZQTA 4DESA 2XG5B 3MFFA 2BP3A 4YXHL 3R8QA 3SDCC 1PQZB 5CGMA 2ZF8A 3JT2A 4B9IA 3OKOA 1IBHA 2BIOA 3C9NA 4PJ7F 2QVIA 1D6EA 4JN2A 4UU9B 2CDEA 4Y1AE 4ATWA 5DJXA 5SWZE 2CLRB 2WANA 2WBXA 1CI3M 1KFAH 1V54B 3EYOB 4ERSL 1DBMH 5LNGA 3QWOA 4NC1E 1MG3C 4L4TD 1PKQE 2VQ1A 4OZFA 3FB7A 4LSUH 3T4YB 3S35X 4KPHH 3B2PA 4QOKB 3DK0A 2ZIDA 3MLZH 4G9FD 4L4JA 1D7DA 3TNMA 3ZDWA 4C57C 3AS3A 3T4AC 2VUOA 4KKLC 1YNTA 1ZVSA 4AQAA 2IWEA 3SDXF 4N9OB 2JH2A 1KUMA 1TSHA 3L9YA 4HHAA 5F93C 3FO1A 4S1DD 2D31B 5FPIA 2QQNH 2YPVA 2WCPA 3X11B 1J9RA 2QFRA 4YZWA 3QJQB 3SYCA 3HHRB 2EADA 4L5FL 4HJTA 3ZZ1A 1WCBB 2ADIA 3D0LA 5GRWA 3ZGIA 2IQAA 2JB6B 1PVHA 1FAKT 5DS2A 3TOPA 1I3UA 4KXAA 2FWSA 5E6IA 4DK6A 2EAEA 1Z3GH 4WZ9A 4TNWF 5G2NA 2RQ8A 1JXFA 1RJLA 1UG9A 3SE4A 1FL5A 2YZ8A 3CC1A 4APXB 4N0UA 4P4KA 5I16A 1W6LA 4MA3A 3GMQB 3ZE1F 3ZSTA 4POYA 4UYPA 1CXEA 1ZCRA 4OBSA 3IMTA 4H40A 3CWGA 5FDWA 5JQIB 4KH2A 2WZAA 1ZHNA 3GSOB 4GKSA 1G9EA 3M6DA 4IBUA 2C4FT 2VDOH 5DJAB 4LDOB 2N1TE 2YLKA 1Q72H 1DVFC 3GI8H 3BHBB 1KYOJ 1KPVB 3BUYA 2X12A 3D08A 1WUNT 1NC4A 3IGFA 1HNGA 1L7TL 1RV6X 5GRJH 1BECA 1R3KB 4KY1L 5D1ZA 1ETZB 2AJ3A 1RZPA 3DLQR 5DTFB 1NAMB 5GRUL 2PF6A 2VLME 1HQRA 4P5RA 3FTVA 1OCCB 4IOSD 3E1F1 4L3FA 2WN3A 4N68A 4ODWB 1XF3B 5DXWA 3TU6A 4DH2A 4XAWH 1QI5A 1QSFE 3P30H 5ELIA 5FHAL 1KYUA 5J3HC 2MRYA 5GS2D 4PWIA 3MRJA 3SDCB 2ZOTA 2FEEI 1FORL 1G9MH 4B9ZA 1ILUA 2GY7B 4LAJH 1JWUA 3QFJA 2O6EA 3FFDB 4RMVA 4PG2C 5J56B 5ANME 5J6GB 3GMLA 5DFTA 2XTLA 3G3LA 5B39G 3ILDA 2DLGA 1XB3A 5IJVB 3K2UH 3R7RA 4PJ9D 3BRDA 1KBGH 4RCAA 5DR5L 2PN5A 5BXFB 1HI6B 3LD8C 2H6OA 4MD5B 4X6DF 3AQXA 3ZMEA 3IDMB 3OKDA 5IQ9A 1OM3L 4X8JB 2VDNH 4JFDA 2I69A 3FCUB 2XIIA 5ISZA 2IANE 2OJZL 2H1PH 4X5LA 5CLXA 2FAUA 4HIXH 4NN5B 4P59H 4G42B 1ZVNA 2NLJA 1ND0A 3QAQA 1IM9D 3T3PB 4ELMF 3VGGA 3UBXB 1YAIA 2O5ZH 2QQQA 2E47A 2VWEC 4ONFH 4EEEA 3BP7B 2NY4C 5AZUA 1W8NA 1MCOH 2HH0L 3FFCE 3GEFA 1MF2H 4R26L 3FTGA 2DTSA 3O6FB 2G5RA 4DT2A 3WFHA 1ZLUH 3U7WH 2X42A 1OD7A 1UD5A 3CN0A 4M9PA 4U6VL 5G55A 3HC0B 1B4JL 5GISL 4AG4H 1MAMH 1WGOA 2YD5A 1J8SA 5CHNA 5DVLA 1KT2A 2A99A 4J8RB 1KYOK 5JO5B 2EUWA 1YEFH 3L5WB 5A7BA 2QSCL 2YQBA 2JXMB 1BOYA 2CNYA 2YAOA 3HLAB 4GSDL 4R97C 5LWYL 1BM3H 2BSED 1I53A 3LEYL 4LKXA 2BW5A 3CUPB 3I02A 3DXAA 3HNSL 2NT1A 4W9IC 3D3VE 3BGMB 3ILQC 4E0RA 3E3QC 5KOMC 5LUMA 4H8VA 1E9PB 3DOHA 4JRYA 3ARPA 3CQPA 5J13B 4FERA 3D39E 2J6WA 1ZANH 4KX9A 1WZAA 1A7NL 3B7YA 3EFDL 4I88A 3P4MA 4QXVA 5BRZA 3ZDYF 1IGJA 2B1AH 1QPKA 2CHNA 3EJZC 1OQOA 3O8XD 3WMPA 3IXAB 2DBLH 2EIZA 3S2CA 4JBSA 4TNFA 1WA2X 1U95B 4OAWB 1PKQA 4QDGA 4DP8X 1AGDA 1A5FH 1CLOH 2HRPH 1JZHA 1FL3B 1VADA 3D25A 4ZODA 1D5ZB 2CALA 1TYEB 2H1LM 2OM5A 1T4KB 3JV0A 4OZIA 4I2XB 1JPFB 4HS6B 4BGLA 1RUMH 3JXAA 4AYGA 1UATA 3GD1C 4HCRL 4QRRB 3US9A 4LNVA 4Z77A 2CR6A 2AJYH 3KLKA 3OLEA 5JOFB 2QHLA 1FAIL 4ODSH 1JGUL 1HKLL 3WNJA 1DP0A 2MIZA 4PD4J 1PDKB 3VXQA 3C5JB 3H0TB 2ZF9A 32C2B 3F58L 2Z8RA 1QLRA 5D7KE 1JZJA 5EBGA 3Q8EA 4OJYA 5ERWA 3NRFA 4J3WA 1QNZL 1X4XA 1PAZA 3L4UA 4N25A 3LB6C 4J3OH 1SJHB 4F8NA 2H3NB 2Z7WA 1FFRA 2VXSL 4OFIA 2H5UA 3LS4L 4N1HB 4Y7OC 3T0ED 3IK2A 5ICUA 3TFKD 2QQKL 1LO0H 4ZS6C 5DGRA 5K69A 5CKGA 4TQPA 2C3VB 1Y6MR 3DO7A 2CO7B 1CXHA 3GTNA 1F4AA 4CU8A 1RP9A 2OYKA 2H26A 3VXNB 3D50A 3ZHLA 5BRPA 3B7UX 3NIFF 1GGBH 2N7AA 5KZCD 1A7PH 2VZOA 4Q4EA 1N26A 4CADA 4QXWA 4JCMA 3WXVL 4MCYA 1MLBB 5L4MA 4PBVC 2EVJA 4JGUA 4G1EA 1IQDA 4S1RL 1HDMA 5DJAA 2CD0A 1OGAA 3O0LA 5DRWA 1T1WA 1DBJL 4W70A 1N6QH 3MC0A 3KR3L 4AYFB 4CNIA 4HC1H 5PCYA 5AW2B 3O4LA 3OKMB 1B9KA 4CMHB 1J8HB 3KPRA 1K85A 1IVLA 5ID1A 5EC1A 4M6ML 2ZUQB 1AG6A 2ZYRA 4M8QB 5KN5B 3OF6D 2JK5B 3Q2CA 4N3UA 4U1JA 3N42F 1X5FA 1DVFA 3NCXA 1QSZA 4NQDA 4PJ7E 4WSKA 1WCBA 4ZNCD 4EOWL 5I1IL 1AR1C 1LWJA 4X6FA 1OB1A 3B2UC 3Q6GH 3V6FB 4XBPA 3NOIA 2IXQA 1HILA 4F20A 2BW4A 1YN7B 2FLMA 4L0PB 1M7DA 4E5XB 1I82A 1MJJA 1G7PB 4UWQB 2CDGB 3L3IB 1CZ8L 5D2LE 2ZWLT 5AW1B 4RDBA 4H0IA 3VWJA 3HEIB 1MHHB 3UAEA 2ITCA 1V27A 3Q2WA 5EU5A 5MENB 2H32A 4MSWB 2G2PA 1E42A 2G3MA 2OXGA 1TLKA 3HR5B 1UQSA 4GQPH 4JX0A 5K39A 4MQSB 1MN4A 2CM5A 4WO0A 4ZMLA 3T09A 4YX2H 2DJSA 3RRQA 2F53A 4UM9D 5DD6B 5F7WC 3UAAA 5JNYB 3EO9H 3HJEA 1AVAA 2R0KH 2XPGB 3L4XA 4OM1H 1PG7H 4RLDA 1JK9B 1E9OB 1HQ4B 1Y0LB 1KTRL 4JY6B 3KPMA 4LVEA 3BYTA 4PJAE 4P8QA 4F9LA 2EC9T 2DMKA 4ILDA 4PB9H 1Z5HA 2F74B 1X6LA 4OZ4A 2FX9H 5ICZA 3AS2A 1O6SA 4GKNA 4NDMA 4XVSH 5DJ6A 2Y1AA 5L88L 3DSFL 1LP9B 2VN6A 2OCCB 4D9QE 4JPSA 1XGPB 4YHKL 3CZEA 1B6DA 5AW9B 1A6PA 3REVB 3DUSB 1KENH 1RHHA 2APWA 3EOYG 1GL4B 3MLTB 2CU9A 2WP3O 4TLKA 3C09C 3QA3A 1YZZA 4EVNB 2WAHA 2HN7A 4NZRL 4YK4C 1K8DA 2D0FA 1NIAA 2XSKA 3PABB 1HEHC 2AMUA 4MMXC 2WOBA 1Z9SB 3M8OL 3QH3A 4BGDA 3LKPA 3CFCH 2DQUL 1FO0L 1CDYA 4CVXB 4NO2A 3T2PA 4BINA 5IQLA 4NXSA 2HTKC 3FUMA 4MXQC 4ADIA 1PFCA 2NMSA 4Z0XB 4JANA 5DHYB 1CN4A 4BCZA 4GQ9L 5HGBB 2O61B 3SE8L 4PJIE 1RUKL 3BKJL 1ASPA 1JGDB 3GSVB 4GIAA 3VTTA 4M4RB 5BCAA 3KLLA 3O9WC 3DUUB 3ROOA 4C83B 1DBAL 5ADOL 1AOHA 2HKHH 3TJEH 5I6NA 4NENA 4TPRH 5I19L 1P53A 3LQAH 1MRFH 2EEAA 4PJCF 4DKAA 4QRRD 5EU6A 2Q6WA 1RJCA 2Z31B 3MMEB 3FONA 1R3HA 3PUCA 4KOBA 2AVGA 1A9VA 4FQCL 3DHUA 3EYSL 2P5WE 3C6LB 3CPLA 3JYBA 5C09B 2BY3A 3BZFA 2ZUUA 3EFOA 1CD8A 4NKDB 2PYEB 1IAIH 5GIRA 3QIUA 3MRRB 1L4IA 1J1PL 1P4LA 4KTEH 5IBLD 2XZAH 1RUPH 4MA7L 2DYSB 4MMZB 3IB4A 1DL7L 5HI4D 3N2JA 4PHXA 1FFNB 4WNQB 4CC4A 3C5ZC 4P5SA 3STLB 1IBGL 1HQ4A 1QHPA 4OGQC 4Y16B 1JYXA 4BDVA 2VTFA 5DD0H 1BIIA 2J55A 3L9EA 4LVNB 1CG9A 1IM3B 2FQFA 1TZIA 4IHOB 2BFGA 1QSEA 3DO3A 3FT4B 1CUOA 4OV6F 1ID2A 2DQ6A 5F72S 5GJTL 1BM7A 1F3DJ 4NT6A 3DI3B 2I60H 2EDMA 4DP2X 4Z3HA 1L7IL 3BFWA 2G2NA 4YDIH 3MRRA 3SE6A 3A6OA 2PYEA 5GIRB 3ZJAA 2BVTA 5T1JA 1UC6A 4G9FB 1HFUA 5K5YA 4DOHB 1MW2A 2AAAA 3GNML 4B9YA 1OB1B 3VXMD 1R3HB 3SQBA 1DJHA 3ZTCC 4JK0D 4JDZA 1VZHA 4X6DA 3L2LA 1HS6A 1ZTMA 3O3BA 4FXTA 4NQDE 2WVVB 2CIIB 4UNUA 3EGSB 4H1LB 3VI3F 3SKMA 1XH2A 4TSAH 4BUGA 5J1SC 3O9WB 4NENB 2HKFL 2EC9U 2MQ0A 2OZ4L 3DVGA 3P77B 2NY2C 3DXAD 4LBAA 4N2NA 4ABUA 3DJRA 1RULH 4OQTA 1T6WA 3GSVA 4GUOA 4R4BA 2BSEA 3G5VA 2YS4A 4X42A 1MY5A 4XCCL 3NJNA 2YMXH 2YUWA 3X3GH 2WXOA 2Z31C 4ABVA 4EBQL 5HHXH 4UTBH 3F64A 4PJXA 3U9PL 1M2VA 1JZEA 4XN2A 2L7QA 2VJ0A 3TLRA 4D8PB 4KKAD 2IFFH 2MSPA 4MCYB 4ZAKD 1RVFH 1WE5A 3CSYB 1MRDH 3KYKL 4HWBA 1A3LH 1JHLL 5E8EB 2J72A 4AQ1A 5DUJA 2AQTA 3DO7B 2HN7B 4PLJC 1R75A 1TJXA 4OKDA 3RUGE 2F8IA 1FVCA 3P11L 5FYKD 1KJ3L 3BAEH 1J1OH 2AW2A 4PJAA 2GHZA 2OULB 1CLYL 4AIOA 2F08A 5EO0A 1OE2A 5AZEL 3W9EB 1S2EA 3PXLA 4YHIA 3DHMA 3S5LB 2D7TH 3D18A 2EZ0D 1H5BC 4FP8H 3RNKB 3MV7D 3D09A 1G0XA 3NH7H 1QP1A 1TU2A 1EDHA 2QGEA 2XNAA 2QPDB 2JB5L 4M93B 2XJLA 3RWDA 2CHZA 4A2GA 4A38A 5D6CB 2X9WA 2CKNA 3ME0B 4P48A 3CFEA 5DHDA 1OW0A 4APQC 2VCOA 4XE5B 2ZUWA 4XPBL 2RBLA 1FL3A 1VADB 2WP3T 1K5WA 5B22A 4LARL 4YHZH 5BVPH 4M8VA 4J28A 3B2MA 3BZFB 5KTEH 1I1AB 1AANA 2Q5BA 4KI5F 2H32B 3WNLA 3IS1X 4H8WL 5ICXB 1KJMA 2PPCA 3ATDA 5JMOC 1MCCA 4XP5H 3WEXA 4LLDA 2OR9H 1P4IL 3C75A 4FC3E 3TZVC 3WEMA 2BPBA 3QUGA 2Z92B 4LSPL 4IIQC 1HWGB 3O6MH 1DSYA 4IDJL 1UEMA 5EOQH 3MLWL 5C0BA 3WUZA 2OK0L 4JFEE 4XI5D 4PJFA 4DUVA 1T2QH 2EYRB 2D3LA 1BVZA 1W72H 5I6XC 2F58H 3JTSA 4ZOEA 4AYMC 3MGOA 2VLRA 1MJUH 3N5AA 4XOAA 3SJVE 2P8PA 3B37A 3ORJA 4ONHA 3DX4A 3FQXA 4OUUB 3MODH 3E80A 1BHGA 3ABGA 5CBAB 1G7QB 5D2NC 2ZOLB 3HRZC 3VJ6A 3ZKND 2FT8A 2E6PA 2IALA 1MHPL 2KPWA 4DP5X 3ULVE 4G6AC 4HMEA 1H3VA 3UAJC 1X5HA 4Z7UB 3H3PL 1JXKA 1EFXD 4MNHB 4QHUB 4XPTH 5B7FA 2X28A 1XH0A 2JJSC 4A7GF 1KCLA 4KZ0A 3HLAA 4GRLB 4MLSA 4D9LL 2WQSA 2R69A 1YLBB 1G1CA 2KZKA 3LOWA 4GMTH 5EN2B 5AW4B 3HE6D 1OTUD 4X7SL 3GSNA 4MB5A 3PP4H 2VZTA 2OSWA 1ZRUA 5BOJA 3RFZA 1H5BA 2N1KA 2O72A 5F9OL 1P5UA 2APXA 4JKNA 1CFQB 1SJVA 2JCCE 4HIIB 3D2UB 2D8KA 3P3UA 2BFVL 3LRMA 4TSBH 3BRGC 2ZWZA 3M1BB 4NPKA 3ROLB 4YWGL 1WAEA 4WI6A 2BVQA 4GAAA 3O4LE 4BFNA 2XV0A 5IMMA 5ICZB 3S8WA 2HT3D 2G3XA 4JHZA 4HGWA 4Y4KC 3LJ3A 3DRTA 3RWGB 1DVTA 2DM4A 5A16B 2NLJB 3AU0A 3CSPA 2HFTA 2R51A 4M6AA 4CW1A 3ZT5A 3EFFB 5ISZB 4BK5A 1GCYA 1KV3A 2BY1A 5ESQA 3UTOA 4OZHF 3ELAT 2M2DA 4CSPA 2DWYA 1IGML 3QORD 2W0KA 2VXUL 2VDRH 3F6IA 4KKAC 3BXNB 3EYQC 3VQ1C 1IT9H 1A3RH 3LTVA 4POUB 2OFQA 1ASQA 5C0DA 4ORZC 1C5CH 4UQ9A 3SDDD 3P3SA 1X5LA 5IR1A 4I0PB 5HGGS 4PSPA 4O2EA 3E8UH 4GSUA 1KWGA 1TENA 3NT0A 2DAVA 4CBPA 5IM7A 1BX2B 1T3FA 1WFJA 2ED6A 4LK4A 3ZT6A 2SODB 3BRFA 1BEYL 1U41A 2JKXA 1JPFA 3D07A 1RFDH 3O45B 4HS6A 3BAIA 4L1DA 1C7TA 4V1DB 3D85A 3O45A 4V1DA 2PPDA 3ARFA 4I9XA 4F33B 5ICYB 1IIKA 4NQQA 1R5IB 2FNWA 3SE3C 4DGUA 4M93C 3BUTA 2IANB 4H1LG 4K94C 1E8XA 3BH8B 2W94A 3G5WA 3RU8L 1R3LA 4Y19A 3FQUB 4FLHA 2A5UA 4FFTA 1FP5A 1MFCH 1QRNB 2R56H 1OGTA 1UD2A 3O2WH 3WTYA 3T0XA 3W9DB 3FO9B 5ADPH 1U3NA 1SOKA 4Z7UF 4X98A 4KHTH 4UNIA 4YSRA 4TVPH 5LB1A 5C92A 5ESQB 2WQRA 2X2IA 2BCKA 2ZP0T 2W81C 3OKYA 3H9SD 1NUFA 2AJSH 2A9AA 2EIBA 5ADPL 3SSGA 1E4XI 4O02B 4A2LA 4DHLA 5IVXA 1I7ZB 4OIIL 2BOBB 3T4AA 5E7FA 5IJBC 5J1AB 5FUCC 1LM8V 2ZWYA 3IU4L 2ZX6A 3SDAD 3QS2A 1BQLH 4DJMA 4KQ4L 1WFNA 5HI3C 4DCQA 2ADGB 4KGJA 2YSSB 3FC8A 4AJWA 4MXVE 1IMHC 4G6MH 2IQAB 5J6HB 2WWMD 4DGIH 2QJDA 5IM7B 1DLFL 1AACA 2PW2B 1U8KA 2HG0A 3HW7A 1CFTA 4HIHA 1QZNA 3KPSD 3Q8BA 4DEWA 3BWSA 4O5LL 4G5AA 5HI5D 2ZP9A 2DQCH 1I3GH 3DX7B 4XTRC 4PGJA 3VFSA 3QUZB 2EXYD 5DC4B 2X1QA 4F9PC 3QNYA 3D85D 1GZQA 3VW3H 2VO8A 3PWPA 5BS0D 1QLRB 1L3NA 3GRWH 3GMNA 4P3DB 2GEQA 1FYTA 4QPEA 3LPWA 1Q9WB 4Q52A 1SXAA 2BJMH 3W57A 1NDTA 1FNSH 2AV1A 4M5ZH 1JVKA 2DWEA 5D1ZI 5C0BE 5FO7A 4DN4L 3FQXB 2ZKHL 1S7VA 2O6PA 1OAUH 5D4HA 1SEQH 3ECWA 2XA3A 4Z7AA 5HYJA 3QULA 3OKOB 4KAQH 3L3HB 3VQ2C 1CVSC 1O9ZA 1OSZB 5F1OB 2MMXA 2NRDA 2BVQB 4RETB 1AQDA 3RGBA 4XCEA 5C0BB 4KMTL 3UTTD 1KCRL 1PX4A 1HL4A 2MWCA 3IFPB 3SODB 2BDNH 1RHFA 2Z92A 2QQLH 2BSBA 3L2NA 1GGYA 4FHJA 4JZOA 1RK1B 4OLZH 3MJ9L 3FHAA 2Y24A 3MLVL 5KSUA 1L0YA 4OLZL 3WEXB 5TFSH 5EF3A 5ACZA 1FCGA 1AZCA 4MFHA 4TLTA 2VQTA 4BHUI 1OSPH 4KMTH 3PG2A 4BXSV 2ZWSA 1OLZA 1AKJA 4LO9A 3V4VL 1YY9D 4ZPVB 4QHUA 2Y69B 2Q2LA 3HR6A 5C0RH 3SE9H 3V4PA 1B0GB 3UDWA 1KCUL 5TF1L 5HYSB 1G7IB 1NAMH 3RIFK 4L23A 2BZCA 5TDOB 4XPTL 3MRBA 3VRJA 3H3PH 2MJWA 1H0DA 3GSXB 3O3EA 3RWDB 1FNSL 2PXYC 4PJ8D 4DIXA 4PJ5A 1A21A 3TIEB 3HI1A 2N4IA 3HFFA 2AS5M 3EAKA 5TH2B 2IQ9L 4RDQF 4IM8A 4ZRGA 3VQLA 2VXTH 5GS2H 3VDBA 3TGXA 2A6IA 1GW6A 2DLHA 3OAZH 1FH5H 4PJFB 3V5HA 5ISZD 1NKOA 4YEEA 3KDMB 4YE0A 4G11A 3OLDA 4R0LC 1J9TA 2J71A 3SOTA 1HAWA 1I3GL 5B7MA 4YHMH 4NBXB 3UBHA 4BQ8A 1OHZA 4NQSA 3ETBJ 4F9PA 3AROA 3MLWH 1P1ZA 4OCSH 2ZKYA 5J1TC 1TQCC 4QRPE 4K3EL 2WUBH 3PPEA 1THAA 1FSKC 3TEUA 2C9SA 1M6OB 3GLZA 4G6ML 4MAYA 2NW3B 4P2RD 4MCZB 5FXCH 3TNNB 2X44D 3QDGA 3T0EB 1DTUA 4TNWK 2E3VA 3N1GC 4JL2A 5C0IA 4YSTA 1P84J 3QRBA 4AY0A 4YDZA 4DUWA 5EIIG 2R0ZL 5EORL 4GPVA 4X5XB 5BVPL 5B4MD 4OQTL 3UEZA 3IXTB 1EJ8A 1XGUA 2XWXA 4OLYL 4TN9A 5EB9A 3O8XA 1XT5A 2FECI 5F6HJ 1DQJA 1FPTH 4L8BA 3L1OL 4M00A 1NMCC 1DVFD 1HH9B 2LU5A 4LT7A 5EZOH 4QOKA 5DC9B 4DGVH 4Z8FH 2AVFA 4JRLA 1S7QA 4NIYE 3E9TA 4OCMC 3OZ9H 2CMRH 3TBWA 5BXFA 2H0FA 4IRSA 4IKNA 3VD0A 4U1IB 5D1ZD 2R56L 5IMKA 3D12B 1GC1C 2WXKA 1MWAH 1QWHA 2R23A 5J6GA 4OZGB 3B5HA 4U1NB 3SKOA 1T2XA 3T1WA 3RZCA 1ID5I 3AXLB 5GGSY 4B96A 4R7DB 3SDCA 2OXHB 4PHZA 2D3NA 1C12B 3B83A 5CEZD 4UQBA 2PNDA 3DRTB 4CUCA 4RQQB 3SQOL 2L04A 2F7PA 1FV1B 4E9QA 1OP3K 2EH7L 4HG4J 3GDCA 2W9DH 3S36L 4C47A 2W5PA 4N5UA 2KLSA 1EJOH 2ED7A 5LVEA 5D7LD 3QO0B 3FUJA 1PFOA 3FT4A 1Z9LA 1UEYA 1Z3RA 4P2RE 5F9WB 2IFFL 3QZPA 5ITBH 4BQ6A 1RZKC 5DGQA 5IB3B 5IZ7A 5AVZB 2BS9A 4QRPD 4Z5RA 1A3RL 2YPKA 2YMXL 2MOVA 2HJFA 2VXUH 1G6RL 1ZK9A 2ZG2A 5MP6H 1BGXH 3L45A 4W4OC 2UYLB 1AH1A 1Q0YH 1FFNA 1HN1A 3BWUF 4WNQA 5BW7A 4MMZA 4JZNA 1PEZA 1G7HA 2W65B 1BJ1H 3RDTC 5DJ8A 1YY8B 1SFDA 3RVWD 1HHKA 5EIIA 4PV9B 5EU7E 5T1KB 1OWRM 4KI5E 1QVOB 3FZUD 2J8UA 4YPGB 1DE4B 1IJNA 3KLHC 4RGOH 1QSED 4YSDA 1PZ5B 4DPRA 1SUHA 1M9SA 2NY1C 1NTDA 2XWZA 3PDOB 3IF1B 2GSIA 3SKJL 3BYYA 5AB2A 1H3GA 3RQ3A 3A4AA 3OKKA 2LE9A 5CO1A 2A9NH 1R46A 3KPNA 4Z0BH 5I8EA 1LP9F 1SJMA 2OCFD 3GHBH 15C8H 4HHAB 3UJIH 4D0DB 2ERJB 2ZKXA 4EUPG 4ZNEA 2X1WL 4FULA 4Q6IB 5IOKA 4ABQA 3QUYB 1EZUA 2BIPA 2EDYA 4QRQA 2DKUA 4D7BA 5HHOA 3WSQL 1NIFA 2DL9A 3PP4L 1N70A 1WS7A 4PJGB 3WTVA 5FV2A 1CD9B 3T0AA 3EG9B 4OIBA 1A7OL 5DDHA 1MI5E 4Y1AD 3U4AA 3VE0B 2I9TA 5FX3A 1QACA 2DJUA 3QWOB 4XHQA 3ATAA 1QHOA 2M8XA 4WDIA 4R3SA 3ARBA 2A1WH 2R29L 4RISL 1I4FA 1IEBA 4P23A 2PWDA 5EV7A 1JTPA 4E9WA 1B0RA 3NEOA 4ANKA 3MBXH 4ZTOH 4HF5L 1L6XA 2XQYK 5JW4N 4XC3L 1OLLA 4J12A 2DQIH 1KCVL 1TJGH 2ICWI 2GTWA 4GUPB 2IC2A 5JIDA 5GZNC 2HLEB 3TZVB 4WGKA 1SVZA 2CGRL 1MEXH 3IMUA 3ZQXA 3ARGC 2F58L 1CICA 5AOLA 2ZX8A 4NP9A 3MLTA 3LQZA 4ZXBA 1A4CA 5D5ME 2AKRB 3IJYA 4XVJL 3S3DB 2X6VA 3K8KA 4KDWA 3AM8C 3RX9A 5EU4B 2OK0H 4DVBA 4K9EC 2E7HA 1OV8A 3U0WH 3NJXA 5EO0B 2WINB 4NQUA 5GGSB 5HI4C 1JZIA 4DTGH 2OW7A 2K7PA 1SJEB 4JFUA 5EF0A 1NMCB 1FFOB 4BEIA 2HPOA 1BAWA 1JZGA 1FVCB 1U8OA 1UJ3A 2EO9A 4H8WH 3EYUH 1ZHKA 4NQDD 4G8IB 2FDBP 3ARWA 3N55A 4LSQH 2FJFB 4E36A 5HGBA 4PY7B 3QPKA 1LNUB 5B3JF 4Z7QF 2HT3C 4AGNA 3CDFA 4WWKA 1PZBA 3H9SE 3JVGA 2PTTA 3MNWA 4HXAH 3SE8H 2X4QA 2K4WA 1GYCA 4OB5H 4I85A 2EZ0C 3QQ4A 3RG1C 2EIEA 3NJJA 5DZOA 3HFMH 3HMWH 3ARBB 4ES9A 3ZIYA 5F44A 5SV3A 2WN2A 1TEGA 4A55A 3OXSA 1JD9A 3OTTA 1E8WA 1U8IA 5I75C 2ITCB 3GBEA 3H9HB 1W72A 2X41A 1OP5K 5GZOD 1DQDL 4KNSA 3T0WA 5JW5B 1LEKA 4IS6B 4H7VA 3FU5A 3DSNB 3QG6B 4XPHH 2XPYA 4TRPH 5DQ9A 3KGTA 4RIRA 3WY4A 4D0DA 3N44F 1EAOA 4QWWC 5CEYA 4XBPB 1KJ3H 2D3JA 2EDBA 3OMIB 3WGVB 4MCMA 4AYID 3QUMB 4YHKH 2XDHA 1S8DB 1XH1A 2HXAA 3P1VA 4RMTA 1L0QA 3ARGD 5KJ7E 4NQDB 1AZBA 2XWTB 5IBTH 3KYKH 4ZX4A 3S2AA 5IEKB 1FJ1B 1OAZL 2F0CA 3D4ZA 3MTXA 2DEXX 4MWFA 4U6YA 1JG9A 2PCFA 2Q20A 3HG4A 5ENWA 1XF2B 3WKMH 2GJ6E 4WRLA 3RAJH 5F3HA 1YY8A 1INQB 3EDFA 2Z93B 3QFDB 4JZNB 4LGRB 1MCJA 4UTBL 1BF5A 3G6AA 5E4AA 4DP4X 4OM1L 3Q8FA 3BVUA 2A9BA 4HZAA 4Z7WA 1GHFL 1ZTXH 5C1MB 1SMOA 3LKNB 1G1YA 3KLAB 4AZ8B 2HKFH 1OK0A 5AKRA 4CMHC 1EXUA 1KIQA 2GHWB 3AWEA 4O2FA 5CSZA 3GGWB 3VFNB 5BUGA 3TM6A 3NGBB 4WGWB 1Y7VA 3C08H 5DWUL 3GHPA 1MFMA 4HKJA 1G43A 1YECH 2H26B 1JXDA 1CZ8H 2IWFA 2PUQT 1NDMA 5JIMA 2CBPA 5HDLA 1DVXA 2XU9A 3HUJB 3FOMA 2NQDA 1IFRA 3RWEA 5EIVA 4NZTL 2C3GA 1I7TA 1E65A 4NRXA 1JD7A 2Y4SA 2VISB 4YE4H 3T2LA 3LS5H 3KLHD 4WI8A 2YFOA 4R4ND 3VWJD 4NUGH 5I1IH 2WQWA 1IZKA 5D96C 1HEJC 4PU2A 3CMGA 4WHTA 1PU0A 1V3LA 1ZVYA 3Q43A 3QEQA 4F2MB 4PJCE 2R23B 5FHBH 3RX5A 1ORQA 5EU6B 1HH6A 3B2UD 1WHPA 1EUUA 2ZUXA 5CN1A 2BSSB 5KUMA 2KS0A 2R1WA 3CDZA 2BH0A 3C8HA 4M6MH 5DFVC 3TEYA 1ODUA 5FCSH 4LLYA 1U58A 1CGTA 1KG0B 1N8OE 1TFPA 1OZUA 1MLBA 4OFYA 1JFQL 1KN2H 1FO0B 5CMAB 3FTWA 3VGEA 1M57B 4LCCC 1CFNB 1TEYA 1J1PH 4WHCA 3F04A 3NIGE 3WXVH 3GPEA 5JORA 5D2LF 3HI5H 1A7PL 3KWWB 3U4BL 1QOKA 2ZOKA 5DRXB 4PSRA 1P7QD 3QA3B 2C7UA 3B8YA 4Y1TA 5IROC 1G4RA 4BFJA 2QKSA 1IB5A 1NCBL 1HIMH 1KJ2B 4NC1C 1DBBL 4XMUA 1UA6L 4EAEA 1B4TA 4ZZFA 5IGXH 3MQIA 4LP4A 4TPRL 1XMEB 3GJFH 5CMAA 1QQDB 2CJUH 4LSDA 4M56A 5C0CE 5ITFA 4N6QA 3DGGA 4PTUA 3HZYB 4MD0A 3AY4C 4MMXB 3TJPA 3KL3A 5B1AB 4GQ9H 4RA0C 4PJBE 6FABH 2ARJB 2Y36H 4TLUA 4RNRA 2XTJB 5T1LB 4Y9GA 5LNDA 1EO5A 5DEGA 1IC0A 3MNMA 3RZCC 5AW5B 5CIPB 5ALCL 2E86A 1UM4H 4GXFA 4Y2DA 1FFPA 1KXTB 1P5UC 2PLTA 4HUKB 3P0VL 3CFCL 4PJDB 3CZGA 2WYZA 1N5AA 3OLGA 4X6EA 3O3DA 1K5NA 3WFEL 5C8JA 1Z9OA 4H0LC 4QT5A 2C9XA 4ZTEA 1RH8A 1S5IH 1T20A 3GJEB 3RNQA 3P73A 1AD0B 3HS0A 3GMMA 3LDBB 3VFGL 3E0GA 2ED8A 3RWEB 4Y4HC 4EDWL 3PWUA 2V2TB 1E7VA 2GBTA 1KENL 1GSKA 3ISRA 2DPKA 1JTOA 2VT0A 1AS7A 5I1HH 3E38A 4BFOA 5FW8A 1P5VB 3MV7E 1NEZB 2MTAA 3CNKA 4CN1A 4IGBA 2F19L 5C9KA 3IJSA 4Z6AT 4L8DA 4U1GC 3D51A 4UBDD 3DSFH 2UZIL 5AVYB 1AE6H 2Y22A 4IRZH 4L8DB 4G1MA 3D6GA 4AKQA 3H4FA 3QORA 5E2VL 1WT5C 4E0RB 3ESOA 4Y5VA 3KYNB 3BGMA 2G75A 2HRLA 5AZ2H 3KBEA 4EDXA 2YFNA 4PB9L 5HYJB 2MCAA 3GMMB 4U7MA 5GJSL 4Q6KA 3MV7B 5AG9A 4F15C 4F8LA 2BZDA 4G71B 5E6RB 1AZNA 3RYMA 1UWGL 3PYCA 4BUQA 4EJ1C 3BX7C 4GSDH 4GSRA 4HIPA 3KPRB 4LVNC 3CZJA 3TFKC 1BZ9A 4TUJA 2KZ1B 3ATEA 5J11B 3B43A 5L7XH 2E7LA 3QZWG 2ZNWA 3WNMA 5I1JH 3EOBA 5K59E 4PVLA 3AQZA 1I9RH 3PWPE 1CE1L 6TAAA 4Y5YC 2FO1A 5EA0L 3VQMA 1F90L 4A63A 4FI7A 3TEXA 4FA8A 1MW3A 2OJEB 3QAZC 1NQBA 5EUKA 4ETQA 3RB7A 1YUHB 3TO4A 4RWYL 4PWEA 3O6KL 4AQ8A 4O02H 3BP5B 3GZQA 3DI2B 5E5LA 1CPUA 2B4CH 3GSNH 3VXNA 4N90D 2OI9B 4JM2C 4MLIA 5D70H 1JZFA 2JKSA 5IBUG 3SDXB 1N6VA 1BYOA 3VYPA 4MHHI 4CGUB 1DFBH 3IDJA 3HKFA 2J8UE 3GO1H 2HWZH 3BH9B 4ONFL 4XMVA 4LVOB 1E2ZA 4GS7B 4KK9D 4Z7VF 2CRIA 2CLVA 3MRPA 1EBAA 2WKOA 5CJQH 5TE4L 2Z91B 1DJGA 1SUJA 2WAQA 2GI7A 3GMQA 1DBJH 5D7LB 4DOHE 4KRPB 4PRIB 2W60B 3EJZD 2B16A 1NICA 4LSRL 4G9DB 4P4KB 5I16B 3NIGB 4ZNEE 3WJMA 4KXZH 1KG0A 1UXSA 1FL5B 5DR5H 1AGCB 1W16A 5IHZA 4RSVA 5HHOE 1KCKA 5IW1B 3MV11 2KBGA 1VEMA 5BO1H 3HC2A 2VN3A 3ESMA 4LGSB 2B9BA 1LWHA 2YOCA 4XXCA 3UZQA 3GXUB 4U6HA 4PJ9C 3CFJB 3APNA 2GK0A 5CCKH 1HQRB 2R2HB 2Y7MA 1EZVY 3CHQA 1DO5A 1FYTD 2Z3FA 5D1ZB 2VLKE 3S34L 4X0KB 3R1GL 4R2GB 4BSWA 2J44A 1UOVA 4OFDA 4KMQA 4NHUA 3VO0A 4BKLB 3PDDA 1JGLH 1X5IA 4XXWA 4ESKA 2YA1A 3MUGB 5F89A 4OGAD 2WXQA 2NYKA 3FB7B 4LPVA 3LS4H 2XZQH 4DAGH 2QDWA 1NFDF 4MAYD 4RZCB 5DFAA 5I9QB 2VR9A 5GGRB 3FQ1A 5FA4B 3QJUB 5JIIA 4WVRA 1NCJA 2NY6C 3K72B 1DEEA 1OPGL 4LL1A 5F7LB 4QHKI 1D6EB 3KBHE 1A7RH 2D3VA 3NABL 2C9AA 2A4ZA 5JXEC 4LZKA 1HKLH 4HEMA 4AL8C 5E70A 3BKML 1HVXA 2XWEA 4HKXA 4JFWA 4LKXB 4HCRH 4HGWB 3RWGA 1UGNA 4PW9A 5FUOH 5IB2B 4CRPA 2GSGA 2DQMA 1A22B 1Z3GL 3HN3A 1XH3A 3L95B 2HRPL 1A6VL 3D5OF 2WLKA 2FJHB 2D31A 3H9SA 4GUCA 5IB1B 3S88H 3T2NL 1NCCL 3RGVA 1E3FA 1W80A 1QABA 2A83A 3MDJA 4FNRA 2DBLL 1UHVA 3JV4A 4QTIH 2ZD0A 2A9ML 3FPXA 3KLQA 5DEJA 3FO0H 4ZG1A 3V9EA 3VG9B 2G0KA 4PRDA 5AWNL 1A6WH 1Z1WA 1HL8A 2XYCA 4BIKA 1WWCA 2VQ1B 4OZFB 2CGZA 2W65A 2XFXA 4TQEH 3GSWB 4GI9A 4HPOH 4RIRB 5E5MB 3LH9A 3C6SB 3UBGA 1OP4A 2P26A 4Z7UA 2I24N 3DX6A 3NCJH 1R47A 2VM3A 3A6BH 4RMUA 2M83A 1EFXA 5KANI 2GT9A 4UUJA 4G6JH 4RRPG 3VXRD 4G7SB 4BFEA 5C0EA 1JL8A 3TCTA 4Q0XL 4JO3H 4JRYD 4B5EA 2HFFB 2AC0A 5B21A 3EKCA 3RILA 3UZVB 1UM6H 4DZBA 4P2RA 4JG0L 2XWJB 3GRWA 1T0MB 1JGEA 4FNSA 3RPBA 3WCYA 3I50L 4HH8A 1XGRA 1XSOA 2IH1B 1HHGA 4A7SA 1IZJA 3M46A 1X5KA 4U6VH 6CGTA 5TF0A 1OAYH 3UTTB 1XF5A 2OJ1A 3VFUB 2HCZX 3VGBA 3UEQA 4MJIE 1BVLA 1ZHBB 5AAPA 1RCYA 3QFJB 2YLHA 1Z6JT 3FU3A 4OZGA 2VXVH 2H2SD 3MXWH 3K6DA 4F7KA 3BDXA 5IW6A 2DTML 3G6JA 2ZPKL 2WSPA 1SN0A 3QIWC 3ZQWA 1QFUL 5IREA 4U2YA 1U8JB 1BZEA 3ZZSA 1SDDB 2JJWA 1I31A 3IDYB 1P7HL 4QXUL 2X0UA 4GXUN 4ZXBB 4UT7L 3ME0A 1K4DA 4PCKA 4UIMA 5AENA 1LJMA 3MRKB 2VRQA 3BAKA 2F54D 2NUPB 1CFSA 1YEGH 2GTZB 3SDDC 1GAFH