1TFPA

Transthyretin (formerly known as prealbumin)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
b'CPLMVKVLDAVRGSPAANVAVKVFKKAADGTWQDFATGKTTEFGEIHELTTEEQFVEGVYRVEFDTSSYWKGLGLSPFHEYADVVFTANDSGHRHYTIAALLSPFSYSTTAVVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSTHYRETIN
publication title The crystal structure of transthyretin from chicken.
pubmed doi rcsb
molecule tags Transport (thyroxine)
total genus 21
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 1tfpA00
4YDMA 3U2IA 4TLSA 5CNHA 2PABA 3DK0A 4ABUA 1F41A 1IIIA 4TNFA 5L4FA 2QELA 4AC2A 2H6UA 4PWFA 4TNGA 3GPSA 4I87A 2G4GA 1TTRA 4AC4A 1Y1DA 1U21A 5DWPA 4DESA 3GS7A 2GPZA 4L1SA 3IMRA 5AL0A 1OO2A 4PMFA 1GKOA 3IMTA 1ETB1 1BZDA 1TZ8A 4MRCA 4DEWA 3P3UA 5L4MA 3IMUA 4Y9GA 1SN0A 1BZEA 1TFPA 2TRHA 1ZCRA 3P3TA 4HISA 3DJSA 4HJTA 4PWIA 1FHNA 1DVUA 3CBRA 3FC8A 3GRBA 3NEEA 5AKTA 3CN3A 4TLKA 1E4HA 4DETA 4N85A 3GLZA 5K1JA 1THAA 5A6IA 2G5UA 3IWVA 2G9KA 5AYTA 2F7IA 4DERA 3ESNA 4IK7A 5DEJA 1KGJA 3TFBA 2B14A 4FI6A 3M1OA 4I85A 1BMZA 4IKIA 4TLTA 3TCTA 4QRFA 4ANKA 1SOKA 4PWGA 4N86A 3IMSA 5HJGA 2FLMA 2G3ZA 2NOYA 1Z7JA 3CFNA 3FCBA 3CFTA 4PM1A 4YDNA 3IMVA 4QXVA 2G2PA 2H0EA 4IKKA 4L1TA 3P3RA 2QGCA 3IMWA 4WNJA 1TYRA 2QGDA 3NESA 3GRGA 3W3BA 2F8IA 2GABA 4Y9CA 1DVZA 2H0FA 1E5AA 4Y9BA 1SN2A 3NG5A 3NEOA 1BZ8A 1G1OA 4TQHA 3KGTA 1ICTA 4WO0A 3U2JA 3CXFA 3DO4A 3OZLA 4DEUA 4KY2A 1SOQA 3CN0A 5CLXA 3CN4A 1THCA 5CM1A 1TT6A 1DVQA 2B77A 2WQAA 4Q14A 3SSGA 3A4FA 3GS4A 3D7PA 4TKWA 4IKLA 3HJ0A 5AKSA 5FO2A 4PWJA 5CLZA 2QGBA 4TLUA 5AL8A 2IGLA 2QGEA 4ABQA 5JIDA 4TQ8A 4FI7A 3KGUA 3CFMA 3DIDA 5JIMA 2H1XA 3B56A 3NEXA 4TQPA 1DVSA 5CR1A 1TSHA 1TTAA 1E3FA 2H4EA 5E23A 4TL5A 5L4JA 4MASA 3DK2A 5EZPA 5FW6A 4ABVA 1KGIA 1F86A 1RLBA 1IJNA 2FBRA 3A4DA 3BT0A 3DGDA 5EN3A 1ETA1 5BOJA 3OZKA 4TL4A 1X7SA 4PWKA 4PWEA 4TM9A 3DJRA 3IPEA 3D2TA 2H0JA 2QPFA 4HJUA 4WNSA 1TLMA 2TRYA 3I9PA 1IIKA 1X7TA 3BSZA 4I89A 3GS0A 1SN5A 2G4EA 4IIZA 2G3XA 5JIQA 4MRBA 1DVYA 2ROYA 4HIQA 3ESOA 2B9AA 3IWUA 3KGSA 1TTCA 1ZD6A 1BM7A 3A4EA 5K1NA 4PVLA 4ACTA 3CFQA 3Q1EA 4IK6A 4PVMA 4FI8A 1QABA 1GKEA 4HJSA 4ABWA 1IE4A 5CN3A 4PMEA 1QWHA 1FH2A 5E4AA 3IPBA 4PVNA 5L4IA 3DJTA 4IKJA 3QVAA 4D7BA 5AKVA 5FW7A 3CN2A 3ESPA 4PWHA 1DVXA 3I9AA 5TTRA 5E4OA 5IHHA 2B15A 3P3SA 5FW8A 2G2NA 4Y9FA 2ROXA 2B16A 3I9IA 4Y9EA 5CLYA 4QYAA 4TNEA 1TTBA 3DJZA 4N87A 4TQIA 3CN1A 1DVTA
chains in the Genus database with same CATH superfamily
3ZSSA 5I1JL 1QR1B 4ZX5A 2WW8A 2QSTA 5D2LA 3PJNA 5IB1A 4B9PA 5KVEH 3OC5A 1V10A 3N1QC 3QUHA 3W81A 5IJVA 4QTHA 5JHLL 2MJWA 1T04A 5LG1A 5E8PA 4KJPD 5JIHA 1E8YA 2Z7YA 4AL8H 1EUTA 3TBSB 4ZNEA 2AQ3A 3K2KA 3BP6B 1FFNB 2UY6B 2IBGA 3FK3A 2OMXA 2A0LC 5I1LB 5EA0L 5ESQA 5AOZA 1SJHA 2QPDB 2XVLA 2R1XB 4LHUB 4Z7VE 5K1JA 3VXTA 2VWEE 1UFUA 2WQVA 4TPRL 2K0RA 2H5UA 4OFYA 4DVBB 5A40E 5DT1L 2QSCH 2CBTA 1F4YH 1ZIBA 5DJDA 5K5YA 2XPYA 3E9UA 1UADC 1K2DA 4UYQA 2H3KA 4QRQB 2WM0A 3HCVA 1NBZB 4YFLF 1W8EA 4BCXA 2YBRA 2AEIT 4GMSH 4ODHL 1LDPL 2W95A 2Z8WC 4PBDA 4ETYA 1R3IL 1IZJA 3IN2A 4HXBL 4HU8A 2XFXA 4KU1A 1KBPA 4Z7OB 1BZ8A 3QHTC 1RCYA 2OSLA 5GRUH 4U0RB 3P4OA 7FABH 3CXHJ 3VG9B 5DVKA 2EO9A 3ZOAA 4YC2B 1T83C 2W9EL 4NN6C 2Q3ZA 5EDXA 1YEWA 3MRFA 1Z3GL 4RNRB 1DJGA 5F2FA 3OAZH 5T5FA 4KMTL 3NP3A 1AGCA 3KLLA 3HC4H 3O8XA 3L3JA 1KIQB 4JRXE 2EDNA 2AEWA 4MAZA 4ZS7H 1FA4A 4OCXH 3DRQB 1BM3H 1H15B 1Q94B 1OK8A 5INCA 3OR6B 5E7FA 3C60A 1JRHL 4NLAA 1K4DB 5L2JB 3EHBD 1BQUA 1X5ZA 2BMKA 5EORL 1U93A 1EHAA 2AJUL 3BWAB 4RA3A 5K1VA 3LXUX 1WCBB 2R51A 3LRLA 1ZKAA 5F7AA 2L7QA 3GNML 1MHEB 4R5TA 1IL1B 5ETUA 4F2ME 1IM3B 2ADJA 4I3RL 4M7KL 1CZ8H 3QZWG 4W9KC 2WTPA 5MP6H 4RAUB 5FECA 1WF5A 2R0KH 3D5OF 4JFDD 1JHKH 5ADOH 2VLRD 3KLAA 4K8RD 3PQYD 4X7CC 3ARXA 1IEBB 3MRBB 5DO2D 1QG3A 1AY1L 1QA9A 2LU5A 3NCYP 4GW1B 2BH0A 2KQNA 4IEFB 4QT5A 4Y9FA 3RVTC 2HVJB 2IWEA 3MCLH 3NCFB 3GSVB 1CGSH 3TEWA 3L3DA 3O45A 1RZ8B 3NYKA 2Y6SC 2GIXA 1ROWA 1HYSD 5E5MB 4UQAA 1OAYH 2FRGP 4NQCB 1XQ4A 4DZ8A 4ZG1A 5A16B 3AADB 1QBLH 3BP5B 2VMDA 3LNIA 5C6TL 3ZYJA 3OAZK 35C8H 5TDNB 5F8RC 4BCYA 5T3XL 2GBVA 4WEMB 4GRMB 2F19H 5F1NB 4UM9B 4IRSD 1ML0A 3QULB 4MXQD 5D7IB 5FWQA 1VEMA 2OK0L 3DJ9A 3N43B 4AMWA 1MJJB 2UVEA 3G5YB 1G7MB 1DUYB 4G9FD 4FFTA 1S7XB 2A9BA 5E2TL 1I3GH 3BP4A 4IBQA 5TE6L 5J9PB 2IWFA 4YHOL 4YFEA 3IGAA 5C70A 1CTOA 1V55B 2ZKHL 2WQ8A 1CT8B 4PN6A 3VW3H 1U8HB 4XT1C 1DVFA 4BKSC 4U1LA 4XMKL 4AEIL 1S7VA 2F54A 4HQQL 1A7OL 2XYBA 1E4WL 1QEXA 3MBXH 2OP4L 4JY5L 4NQEE 3VXSE 3X13A 1TYRA 2YUWA 2WXMA 1Q9LA 3AITA 1Q9KB 5FCUH 2J8UF 3BPLB 5EEWA 3BLKA 1AXIB 3A67L 3P9WB 3T4AC 4X7SH 1QP1A 4PGEB 3U2JA 1B0RB 5DURB 1FRGL 1QR4A 5F1KC 4J2XA 1TUPA 1G87A 4YQXL 1PPIA 3LD8C 1WAPA 4X9IA 1WUZA 2EIZA 3PPEA 4BFKA 2XBTA 4PSRA 2DB8A 2PPEA 2YA2A 3IJSB 2EUXA 4IBUA 4OT1H 3CSPA 4HZLB 4WO4B 1B4TA 1PIGA 3V0DA 4I77L 3VXRD 3VYNA 1P5VA 2AJ3B 5DVLA 2CR0A 2CHWA 3MGTB 1NAKL 5EU6D 1ETZB 3Q9QA 1UZ8B 2KBGA 1H5BB 3JWOL 2JKJA 3GS0A 3D4CA 3T6WA 2DM4A 4XPBH 3OM3B 1FFTB 3K2MC 2A38A 1J87A 3WFDL 2HTKC 1JPTL 5C2BL 3C2AL 3ZKSD 2I25N 2EH7H 4EOWH 4U1HB 1IQDA 5C09A 5EEZA 2I32A 3SBPA 5CZXC 4NJAH 3RZWA 4JANA 3SGDI 3O9WA 3MXVH 1DANT 5ISZB 1R75A 4Q9QL 2ZOWA 1MI5D 3AUVA 2X1XR 1Z9PA 1ITBB 3P2BA 2ZX8A 1X6LA 4GUPB 3BUBA 5DFWH 1AFVL 4PUBH 5C9JA 1ZE3H 5D2NE 2BNRD 2VO8A 4CSTA 1X5MA 3GXTA 3L95B 4NP4L 2OLDA 5HHXL 5LBGA 2UWEE 4AH2B 1EBAA 3SJVA 3T1FB 1FORL 2P5ED 4YPJA 2H6UA 3O2WH 3WS3B 4WLCA 4A37A 4E5XG 1PD0A 1VB9A 1ZHLB 4FXKC 5ACMA 4RDBA 4PJDE 1G9ML 3RGVA 4HUVB 5GS0D 4MD5B 5DYOB 2V5MA 3IMUA 1BECA 4F9LA 2BNUA 4ISVA 3RPIB 1DN0B 5LCVL 1JZ2A 4UBDD 5ALCH 1AGBB 3I6LD 5FGRA 4ZMVA 4JKKA 1JGDA 2FEEI 1QLRB 4FQIH 4CMMA 4YE4H 5SX4I 3LXBA 3ECBB 4GP8B 1JMXA 3QIBC 2GCYB 4JQXA 1CFMA 5JHDA 1JGVH 1XF3A 1CD1A 1TJGH 2NSXA 4PREA 4ESKA 1F0LA 5FUZL 4OM1H 5LVEA 4P57B 3TNMB 4LARL 3QQ4A 4NQUA 2XCMC 3SDXE 4AX3A 5I9QB 3O3AB 4KJYA 4LIQL 5CCKH 3DMMD 1E3ZA 4WFGD 4YSCA 2KDGA 4MLIA 2NZ1A 3H7LA 1Z9SA 3GBML 4F20A 4XN4A 3SDYH 4L8BA 1Z9OA 4GEIA 4UB0H 1IGYA 3CXFA 1BA9A 2X6MA 3P54A 2QLVB 1A6TB 5KVGE 4O9HL 4GAYB 3UROR 1FBIL 5GJSH 1F11A 1KGCE 3T0VA 5DMKA 3IKCA 5I8CB 1EMTH 3MUUA 3ZE2E 4M03A 4FS0A 2GEEA 3RWCB 4QF1A 4Y4HB 3VXUB 4PRDB 2AJVL 2BRRL 4PJXA 3BO8A 1BVNT 2O6CA 2W81C 3LZOA 5C0CB 1L9QA 5D1QC 1INEL 4HGWB 3D39E 3SPHA 1GGIH 4UV4H 2Y36L 3AREB 1NTDA 1FYHB 1D5XA 4DT2A 4ZTPL 1Y0LB 3T77A 3DDGA 3KPNB 1CGTA 4QI3A 2AFNA 2XWBA 4N2NA 1E5CA 3QUKB 3MREB 2WSKA 3QUZB 2FK9A 5EPMA 5T3XD 3PGCB 3BDXA 4HIJB 4D9LH 2A73A 5LCVA 3Q1EA 4JFZL 2J71A 4EPSA 5CEXB 2O5NA 5T1LB 2VXQH 3NCJH 2Z64C 3BFWA 2AV7A 4OQTL 4B6ZA 4LLVB 2X5PA 1L6ZA 4UOZA 1O7DE 4Z7VB 3MLPA 4HA1A 3LQZA 3GXIA 1NZRA 3QDAA 1ID2A 2EDXA 4XGZB 4XN5A 1RHHB 2HG5A 4HUWA 3VD2A 2MHAA 2WXHA 2QVMA 1HNGA 5GGTH 2FD6H 1MW2A 2EDKA 4FCAA 5I74B 2YA0A 1MUJB 5HYJA 2WYTA 3LV3A 5B38G 2APXA 3WNMA 3ZO0A 3PWPE 3MR9A 5TE7L 3CHXA 4GSDL 3MLXH 4NZFA 3K71B 3WXWH 5DRZB 2AJZA 4EN2A 1NEUA 1Y18A 4ETQB 2BP0B 3VACA 3HI6L 4E2OA 1HOEA 2TRHA 3HN3A 5HGDB 3WIAA 4QHKJ 4CUCA 3HR5B 4Y5VB 3RDTD 3WDIA 3ETTA 4M3HA 1DBAL 3O6LL 4D0CA 1SHMA 2DW5A 3ZR5A 1CDYA 2EDLA 1MFBH 1UD4A 4R4NC 3TV8A 4LOVA 2BJML 5KS9F 3QA3B 5AW4B 4BINA 3Q7JA 5DFVD 5A2AA 3EBIA 5I30H 1U8LB 2QPEB 4I9XA 4O02H 3PWUB 4QRPB 4QO1B 3CFNA 2R2HA 3B3IA 1ODUA 3BI9X 3ZZ1A 3VWJC 1BD2B 2J56A 2VDOH 4YDNA 2QSCL 1QI4A 1F4YL 2OW6A 4J3BA 5DRXA 1SYVB 1MCCA 2V7NA 1HQ4A 4F7CB 5T1JA 3MRHA 2OYMA 2FJHA 2B3RA 2PCFB 2IF7A 1S4IA 3D09A 1MNUL 2BOCB 1E5AA 2VDLH 4Z3JA 3MRLB 4LL4A 4GMSL 1G6RH 2WO3B 1MCDA 2ODHA 2XXGA 3LPWA 3F2LA 4TV3A 4F3FB 5TFSH 3K72A 3U0PA 1NM9A 4KI5D 3OX8A 4W6WB 4F2MB 5ES4B 3S5ZA 1ZPUA 2EC9U 1TMCB 1JPEA 1VGEH 1WG3A 3THMH 3E6FB 4G7RB 3GXPA 4B9ZA 2DY2A 1VHPA 4Q89A 4HF5L 5DJDB 2F61A 3X12A 1F4AA 2QQNL 1WD8A 1U3NA 1S9XA 4I1RA 3QHFL 1PZBA 1QLEH 3EADA 4R90L 3MRCB 3OQ3B 4MA3B 5DEGB 5E5RB 5TE4H 3SE4C 4MJ4A 2APWA 3HC4L 4TVPE 4AWJC 5L8JB 4JZNA 4YDJA 1RLWA 2WLLA 5DS1A 3WG7B 1BM3L 3S96B 1F45A 4UZGA 4JRYD 2OSLB 2ICEA 3ARVA 5A3ID 3WLBA 3RVTD 3IF1A 4N0RA 2KKQA 3FHEA 3JV5A 4Z0BH 5JW5B 2DEXX 3N42F 3JYCA 4XVTH 2J1KA 2ZXWB 3HHSB 1A4CA 3V6OC 4KDWA 2IGFH 1QWHA 3H9HB 3QQ9D 3ZGIA 3JVGA 5C97A 4WY7H 4CSSA 4XOCA 2UXVA 2JCCE 1YUHA 4RLDA 1CZ8L 3GI9H 5MP6L 3DPDA 2OMVA 3M86A 5E2WL 2R0KL 3ECUA 4ENEC 5ADOL 1JHKL 1BZOA 2H3NA 1LD9B 4M00A 4CW1B 1H19A 4PYGA 1I9JH 4P2OB 4BM7A 4BXVA 3Q8BA 1GYWA 2AJXL 2BSBA 3ETSA 4QXUL 5A6LA 1Z6JT 4X8CA 1IT9H 3U0TB 3QUZC 1FPTL 3HBGA 4OCSL 1NLDL 4R97C 4NQEB 5MHSD 3BRFA 3R8QA 5TPWH 1M6UA 2LOEA 3NP4A 5CJQH 3VCLB 3V10A 1OAYL 3FT2B 2HLFD 2OMNA 1ED3B 4GRLA 5ETUB 4XHJD 2FCBA 3WU1A 3MLYL 1U4FA 4QHLA 1QBLL 5BPPA 2VRKA 1CXEA 2DV6A 2VL5B 1HQRA 4F5CE 4OLXH 2LVEA 5F89A 5IB5A 3DX0A 1J5OH 2F19L 2PYEE 4A04A 4MFHA 2WY3B 1JK9B 2Y23A 5C1MB 3IDJA 3P4MA 4HBQA 4J3OF 3VRLE 3KW8A 5T3ZH 1XB3A 2APFA 4XB3A 3WEMA 3FHQA 3KMDA 2W0LA 1KJ2B 2EXYC 4JO8A 1M7UA 4JK0D 1TCRA 5DRNB 2VM9A 4ADJA 3FMGH 2W07B 2Y5TB 3F12B 3CFJA 3VW3L 2CLVA 4BDVA 5T33H 3DO7B 4F7TB 3RKDD 1I9EA 2J55A 3P02A 1T2XA 5SX5H 3H7BA 1H8NA 1SN2A 1VADB 3MBXL 4HKXB 1G0YR 2ZWYA 3MZGB 4BH8A 4GW4A 2HLAA 5FF6B 2HSIA 4Y8DC 3ISWA 4G7YL 4X7SL 1I7UA 4R26H 2QJDA 3GFUA 1KTRL 2PPAA 1XSJA 1S9WA 2R1WA 3OQRA 4I18B 5FS5A 1VESA 1ZANH 3V4PB 2XUWA 3ZT5A 3STBA 5IQ7H 5GIRB 3BN9D 5IG7B 4JE4B 4UIMB 1OOAA 1QEWB 4P46A 3RTQB 2X4OA 3A4DA 1G7QA 2V5RA 4NYLA 5E4EC 5D2NB 4OT1L 1CL7H 5CP7A 5KVFE 5I19H 2VITB 2UWEB 2JF1A 4YIQB 3FCTB 5ANHA 2CD0A 3FUEA 4FFZA 2P24B 3MV7B 3UYOD 3S88H 5C07D 3H9ZA 1FFRA 3W0WE 4L3ED 2G30A 3OZ9L 1IRAY 1IM9A 2ZUUA 1KMGA 4XPBL 1G4RA 4XMWA 3OD3A 5I16A 4EAEA 5CN3A 1TKWA 4KRPD 1K8DA 3DX9A 1T0NB 4ES8A 3KVDD 1BW8A 2VABB 4XR8C 4GMTL 4NJAL 5D4IA 5C08E 2EZ0C 2ZPKH 4PV9B 1NM4A 4UMSA 4NO2B 2CDGA 2AABH 5SX5K 2X4NB 1E8XA 2ZJSH 1OAZH 2G60H 4GPVA 3SE8L 3S3CB 2QADD 3ML8A 2EDWA 3ZIMA 2EDFA 2DTSA 3MNZA 2LU7A 3AC0A 3FRPG 1BEYL 1I1YB 2APVA 1N9PA 3RWIB 2ARWA 1OP3H 1CO1A 2EIBA 2JIXA 1WC7A 4MRCA 3ASNB 4N2GA 1IQDB 3HA0A 3MJ6A 5F0LB 5FA4B 1I1AA 1XIWD 3K5SA 3U4EA 4XMPL 5FO9B 3MLTA 4LLMB 3O9WB 3HAEH 3O8XC 3OR7B 4XNZB 2FE0A 1OAXH 3NCEB 1PZ2A 5JOFA 1P6AB 5D5ME 2V0AA 3PIQB 1C1EL 4J3OH 3HNVH 4P2OC 5AYTA 3QS2A 3AU1A 3WN5A 3WY3A 3RAJL 1BGXL 1G7IB 4QHUA 4TMPA 1LNUB 3C60C 3VI4B 2D2OA 1KV7A 3T8XB 4OCYH 1IKOP 1HSBA 2IPUG 4YE4L 3N1MC 4JPVH 5EOCL 1DQDL 2R0LH 1TJGL 2EDYA 3NIFB 1F3RB 4OM1L 1IC1A 4L8DA 3PUUA 3L9YA 5C0DB 5CCKL 2H2PD 5E6SB 4O2CA 4A2MA 2DQ6A 3QDMA 4GO9A 2VDMB 4N4YB 4JR9L 5DMGC 3A4FA 4HPOH 3HMXH 1V3JA 4IGBD 5FFLA 3CXDH 2WUCL 1CFTA 3K8KA 3SDYL 5IJCC 4IBWA 4UB0L 3CC5B 2ZUWA 1JE6A 4CMMB 4F33B 4QRUB 1NCIA 1O6SB 2BSEA 5GJSL 1DJYA 4DUXA 1IC4L 1SLUA 1TSHA 4LU5H 4WK0B 2MWCA 1GL4B 1RP9A 2XTJD 3IDIB 5DJ8B 5CGYC 1OP3K 4OFVA 4LQ1A 1ZHBB 3K6NA 4KKPA 3KVPA 1U8OB 2VT0A 1ETA1 3V4VA 4ZTOL 4IU2B 5E9DB 3QO1B 4OCWH 4UT6L 1QRNA 1MCLA 3EAKA 3R7QA 1OPGH 1PZ5B 2CXGA 3GEFA 3MRKA 5EV7A 3I85A 1GGIL 2J3SA 1BYOA 3UC2A 1DCLA 1W72H 2VSDA 3IJ8A 1MDAA 3K0YA 4RFNB 1LXMA 3ZYOA 1EEZB 1MIEH 4UTCA 5AZEH 3DBXA 1RURH 3IPBA 1DVFC 4D9LL 4E9VA 3OXSB 1U8IA 4GH7B 5D7LB 5AG9A 2DQDL 2VXQL 2PP9A 3AT0A 3OAUH 3VYPA 3F83A 2YUZA 3GRWL 4JDVB 2BHFA 4JG0L 5IQMA 2IO5A 2IQ9L 3MRIA 2MQ3A 3AXHA 1KLUB 5E2JA 2NYYC 3UC0L 5E1HB 3K1DA 1EANA 3D0VB 1JTPA 4KAQL 4RFEA 5F7MC 4R3SA 4R7LA 1I7RB 1UQSA 3UAJD 4NNYA 1EBPA 3DC0A 5C0RH 1TZ8A 3UTPD 2WGXA 2A73B 2Q8BH 1KXTA 1IZKA 5FFGA 1MIMH 4HEPG 4UOJA 1S78C 4D2NA 3MLXL 5AD0B 5IUCA 4ZODA 4ZOCA 2CJTA 1DVUA 1E40A 1F6LL 3JTTB 2WSDA 2JLPA 4P23B 3L4ZA 5E6IB 2P42B 4QPEA 4UILH 3ARRA 3S0PA 4N0YH 2AQ1A 4ONFH 1W0VA 2NCMA 3TASA 2LFGA 4BKTC 3HNSH 1YN6A 3QQDB 2E3VA 5KW9L 5BMFH 5FB8A 5D7JD 1BX2A 2B2XH 2CKBL 3TT1H 3AS2A 5LXGL 4AXWB 5CJ8A 5I30L 1XTLA 4LCVA 4O02L 3T4YA 4C57C 1KC5H 2ZKYA 4KK8D 4J28A 3A6OA 2QKIA 5F7UA 2IALA 3RWEB 2VDOL 2AXJA 1C12A 3O9WC 4DGYL 2V7HB 3FU9A 3PNWA 4HHAA 3ULSA 5C0NC 4MCNA 2AXGA 3E2HB 2H8PB 3KYMA 3MROA 4BFOA 4EVNA 2HKAA 2VDLL 4OLZL 3SSGA 2FGWL 3LMJL 2OQJA 1JZGA 2R39A 4CADB 1EGJH 4PWJA 4QTIL 2VXQA 1GPOH 4QD2E 3BEWB 3LZNA 4R5VA 5AYUL 4DH2A 1A6VH 4BEIA 5KBKA 2NSMA 2JCCB 4OLVH 2MTPA 3THML 1RULH 3OHXA 4QRTB 4PJCB 4OGAD 3ULVE 1XF2A 4ELKA 2XICA 3RGVC 1HHHA 4F8OA 4LSPH 3I74A 1E9PA 2ZP9A 5GGTA 4HOMA 4F9LC 1C5DB 1CYXA 1QLEL 5FO7A 5TE4L 5DQDH 5IF0B 3HUJE 3U6XS 5GSVB 4MNHA 4G42A 5EU4A 4BA0A 1UXSA 3CFCL 3E1ZA 1KUMA 4RRPG 1GKEA 4HJSA 2MNUA 3FJTA 1HILB 1N59B 1IBYA 3U6RA 3CSTA 3LN5A 3MU3A 4FEIA 4N90D 4FMKA 5EF0A 4MA7L 2D3LA 4XVTL 5CBAB 3O3EA 1XMEB 2PYEB 1BFVH 4BFBD 5KOVC 4ZZKA 1Q0EA 2CA3A 1XR8B 2XKUA 3ALXA 1XSKA 3O6KH 4ODBD 3VXPA 1JV5A 1X5LA 4MMXB 4B9IA 1BBDH 1LO3L 3ARWA 4N24A 4O02A 1AG0A 4EJ1C 3I6SA 5I73B 1LK3H 5K9JL 3T6QC 3VSTA 5H94A 3QJFA 3I75A 1ZVYA 2PETA 1I9JL 2D03H 3LRHA 1DFBL 1U2YA 4RFNC 3REVB 5JDSB 3PDGA 4Z7UE 5DK0B 4BFJA 1NC2B 3DETC 1MWAB 4PJ7E 2G3NA 2FWLB 4W9EC 1P84K 2A0LD 3BT2H 1G6RA 3QQNA 3IJHB 1E28A 3A5VA 3KPLB 3NPSC 4NXKA 5CJQL 2XJKA 4S0SD 4D8OA 1GOHA 1FAKT 2K6WA 2OL3B 1T5WB 2ZWZA 4LCWE 3HS0A 1WDAA 3VFSB 4UYPA 2XSKA 1KGJA 2IOMA 1WAEA 2APTA 3PG2A 2YD4A 2J8HA 4CC1A 4JFFA 4A7GF 3EKCA 3OXRA 4AEFA 4OIAA 3ARUA 3UBFA 1UACH 4OFDA 2KMWA 3LRSB 2G2RB 3NESA 3TBWB 3CVHH 3OMZA 4HSQA 4Y9CA 3FMGL 3WNNA 2ESVA 2LVCA 4GG8B 5I1AB 4UTBH 3ARGB 2WO2B 3DLQR 3MNWA 5D1ZB 5E6IC 4LNRB 4HWUA 3W0WB 4ANXA 1E5BA 3D52A 3LEYH 1XH1A 2BOBA 2Q3AA 2Y1ZA 2DQJH 3Q48A 5HXMA 3GLDA 5KWYC 1DBMH 4RGNE 3L08A 3SDXF 4YZWA 4AVKA 3AACA 1A3LH 1T5XB 3QIUD 3C5XA 1JPSH 2CCWA 3FNKA 1CXFA 4L1BA 3FU6A 2DQEL 2XWTA 3JUZA 3VE0A 4LNVA 4ZAKD 3CFIC 1Q9OA 3L4CA 3UTSA 4AOFA 3AJ7A 5IQ7L 3B9AA 1G94A 4RAVA 1HEJC 2BOLA 4LVOB 5D9SA 4K7FA 3RZCA 1LQBC 3EOAA 3EZJB 3GMOA 2EE9A 3ZE2F 2BXYA 3ZHNA 5I19L 3VD7A 1J0HA 2EVFA 2E59A 3ATDA 2B1HH 3JTSA 4NM8H 4NNXB 1Z3RA 2JJTA 5KSAD 5DFAA 1BXAA 3NFSH 1LWJA 1VENA 4AT6A 4G9DB 4LPCA 4D9QE 3BDYH 2YPKB 2RCSL 3CIAA 3MSPA 4MHHG 3M46A 3E9TA 1HHGB 2F8VA 4WUUD 1P4LB 2OW7A 5D5MB 5F7LB 2X05A 4APXA 5KS9A 5D1ZI 2N3JA 2WQXA 2QR0A 2ROXA 1YMHB 4QYAA 2QHRH 1G5GA 2DQGH 1TO5A 2OMUA 4NSKB 2HPOA 2Y6SD 4GXVH 4U6VL 4YDMA 3KEDA 5F3BA 12E8L 2HRGA 3GYRA 5CP7B 5C7ZA 4QJ3B 2A99A 2CDFB 2MCAA 2F5AH 2UY7A 3UJTH 4JFED 1OAZL 4XI5C 2QTVA 3V4PH 1AQMA 4N2HA 5I5IA 4P5KB 2DIEA 2Q86A 2RQEA 4ODUB 1OT1A 2WIIB 4FHJA 4LAJH 5MEOA 1C8PA 3ELAT 1MCRA 5IMLB 1EPFA 4LE8A 4PJ5D 5AW0B 4A7UA 1J1PH 4W4OC 1RZPA 2VLKD 1Q4NX 2E76C 1FIEA 2CR3A 3J2PA 3MAWA 3TYFA 5I17B 3QORB 1WCQA 2OS7A 1XGZA 3LH2L 4JBSA 4CVXB 3DVIA 5I73C 3U7YL 3FFCA 4AUJA 1OAXL 1OD7A 4D0DA 1MN4A 3QJSB 1KBVA 1LEKA 3S34H 2BWIA 2FEEL 1H8OA 1N12A 2AXWA 2ICEC 3MBEB 4UT9H 1SHXA 1WZKA 2FO8A 4OCYL 4XBEH 4AL8C 4IJ3B 5TGBA 3G6AA 2DN7A 1OB0A 5CCJA 4JPVL 2B59A 1BHGA 1NIDA 4DW2H 2ITCA 4PB0H 1WC7B 3NEOA 1DSWA 5L6YH 3TC9A 1JZ6A 2WVVB 2WXJA 3MLTB 5CKAA 2R0ZH 1QBMH 4R9HA 4PGDA 3ATFA 3GGWA 5DF0A 2E7CA 4C4KT 2ITDB 3QWQB 2YRBA 5CIPB 2CH8A 5I1EL 3BUYB 3O3DB 1U3ZA 5KSVB 4HPOL 1PQZA 4HH8A 4PJHF 3CXDL 4BD4A 4GI9A 5DCCA 5IY5B 4AGQA 5EZPA 1RK0B 3QR2A 4JZJA 3GZQA 3MJ7A 4L0ZA 4AUYA 3BVTA 4Y88A 3CZSA 1ONQB 2D7TH 3O4LB 4LEOA 4X6BB 1PGRB 2WXOA 1X7SA 4JFWA 3S8WA 1A0QL 4GRLC 2QPFA 1E6JH 3C9NB 4EUPB 2EC9T 2VQ4A 4M29A 2HTKD 1FYTA 3HG1D 4PJGF 3EO9L 3HFFA 4OCWL 4G43B 2BVOA 5FM5M 1QFOA 3EYFB 2E9IA 4KOCA 3V0VB 5CZXD 4I48B 3TPKA 5FK9B 2W5PA 3LYRA 1QFUH 3H9SE 1DZBA 4LKCA 3FU3A 5I15L 4HFUL 3HAEA 5E6YA 3UZVB 4HWBL 5IMMB 2VE6B 5EC2B 1MIEL 5AZEL 4Y89A 3T5WA 2CZNA 1TPXB 4ORGB 1KIPB 4LVOC 1S9VA 1TTGA 3V4VB 1AZVA 1IV8A 2CKNA 4RSYA 4AVJA 4WGVB 4PLKD 1BIIA 3WL9B 2B8OT 1RIUH 1IM3D 2CQVA 2XXMB 2OJ1A 3CCHB 3CDFA 3W39A 3S36X 2CJSA 3IB4A 2VZOA 3Q5YA 2YEZB 1ETB1 4BSVB 3DDFA 1H3VA 2VLLA 1XTMA 3K6SB 1AYOA 2NY6B 4MNQA 1WQVT 3TA3A 4CU6A 2R7EA 4WWNA 1LEIB 1A1MB 2PCPA 4UM8A 2CCLA 1KGWA 1GC1C 4P46C 2Q8BL 3C2SA 2X6CA 4LL9A 5I1KH 3HMXA 1JAEA 3VDCA 3QIBD 3GMPB 43C9B 2Q10A 1KNOB 3KWWA 3S5YA 1F3DH 4N2IA 4TLTA 3IRZA 2R4RL 4HUMB 4NQCD 1XH3B 1OY3B 5EOTB 4UILL 1RVFH 3CUPB 4N0YL 4OZGF 3MRIB 3NK3A 1CURA 4ONFL 4CVZB 1IU1A 2W8CA 3LNDA 3HNSL 3D69A 3VI3B 4PJIE 1GS8A 5CZRA 3DTXA 3MNVB 4UM9D 1VJSA 5GRJH 5DGQA 4XC3H 4P07A 4KPHL 3TT1L 4JO2H 2J8UB 3QDGE 4MSWB 1KCKA 3LKOB 3HUJB 1OPOA 3F7YB 1GXEA 4LDEB 3EYOA 2DS4A 4NT6B 3VRLF 1W72A 5JNYB 2CO1A 2JK5B 3V95A 4HMCA 4IDJH 5FOJA 3F6IA 4WI3A 4L4TE 1HE8A 2TSBA 3CH8A 4QIRA 5ICZA 3L3IA 2HJFB 3DUUB 5E23A 4ZMWA 2BCKA 1FQ9C 3PJSA 2EKJA 4XCCH 4Z23A 4WHYG 3U2SA 4WCYH 1D5RA 1RULL 5D71H 5FA3A 1H3GA 5C0AA 3GSRB 3QUYA 2ADFH 3S97C 1MREL 4P4KA 2G3XA 4JFUA 4PGZA 1SXZA 3AROA 1JV2B 1FO0B 1KIRA 4Z7UB 2RHEA 5IKCA 3S2AA 3VFUA 3KYMB 3MROB 3Q8EA 3A0OA 3VTTA 3MODH 3O2DH 3WN5C 1GA2A 4G8IA 4BQ8A 2OA9A 3HZ3A 1A1OB 1AI1H 4BBWA 1FZOB 2FHBA 4NERA 5DSCB 4LCWB 2FTAA 2RH0A 3ESVF 3IDGA 4KQ4H 4CDGC 4FYRA 2YD9A 2RD0A 1J1XL 3CN1A 1GZQB 3KGRA 3VX0A 1BFVL 3HN5A 2QZ5A 3Q6FA 2IMMA 4AC2A 3O6KL 4HOWA 1XR9B 1J8RA 2QT6A 2R23A 1A14L 3MOAH 1JF1B 4POYA 1YNLL 1JL8A 4HLJA 5ISZD 5BV7H 2VC2B 3BXNB 1LK3L 1IAOA 3QIWA 3RFRA 1TQWA 5BJTA 3FTGB 3IFOB 4GKLA 1R47A 1KXQA 2LAGB 1CLYH 1X5JA 2QFRA 5LWYL 2D03L 2F1BA 4N8VA 4YPGA 5LAXB 3U6RB 4R4ND 4NPKA 1ECZA 1DE4A 1JWUA 1TPXC 3BT2L 1W0WB 3UGXA 5IEKA 1ZT4B 4LRIA 3GSOB 1EGJA 1ZE3C 3SPIA 4YLQT 3TFBA 3P9MA 4NO5A 3FU5A 2CG9X 4ZUSB 3VWJD 1CDIA 2FLMA 2DAVA 2HJKB 4FXLA 5AW9B 3JWNH 1WAAF 1HHJB 1V3LA 4YDLB 1L3NA 4R4BB 1CPUA 2YPLA 2RQ8A 2I5YH 4IMKA 4EN3B 4NCC2 1PKQE 3ZSTA 4UTAA 1TFHA 3QJVB 2IMNA 1UEMA 1N18A 2XWZA 5FYLD 3T3MF 3ZE1E 2HMIC 3TN0B 5DWUL 1X5KA 2OZNA 4P2CG 5J6HA 1O7VA 2PR4H 3NRQA 2D7OA 5KJRH 4Z3FA 3QUMB 4JRXA 5FLVA 1EEUA 4WI6A 4OJAA 4D0BB 2IGLA 4O58H 3TO2A 3FO2A 5JW3L 4OUOA 2Y2YA 1DHKA 2EUVA 4XHQA 3ARZA 2UXFA 3RUGE 1S3RA 3D9AH 4IU3B 1DBML 5FW6A 4AQAB 4HZAA 2P4AB 3UPRA 2XWRA 3HBQA 4CVUA 1AKJA 5B1BB 1VFOA 3KYNB 2XDHA 1BJ1H 4TQEH 2ATAA 4KOBA 3ZZLA 2YKLL 5FXCH 5LNDA 1DSFL 3SO3B 3QEHB 1XZ0A 1P7BA 1NSNH 3FOLA 3LHPH 3ISYA 3BKML 2NY1B 3MNWB 3PP4H 3QXAB 2ZOKA 3DVFA 4JFOA 1GY1A 3FQXA 4K71B 5JMOC 1ZGLB 1MY5A 4N6QA 3GM8A 3BPNB 1FVDB 3MLVH 2EIEA 3U25A 4UWQB 3DNKA 2ENQA 1KJ2L 4URTB 3DIFB 1P4IH 1KTDB 2B1HL 2WLYA 3ARED 4NM8L 1SOXA 4ENED 3MVSA 4OGXL 5E00B 3CLEL 4RAHA 2AI0H 4W9DC 2CGRH 2V5TA 1DQQB 2A6KB 2QKIC 2C9UA 2I7SA 3MRNB 2PYFB 2IANE 1J7VR 1MCIA 3P0YH 3QUZD 4LSVH 4FNQA 3F58L 4M5ZH 3AG1B 4U3CA 2NTFA 5CU9A 3WFBL 4JDZA 4P2RE 3PWVA 4KNUA 5T1LD 5T1DH 5B39A 4R7NA 1KN2H 1I7TB 3KDMA 5HI4C 4XAWL 1KACB 4GG6E 1DEEA 4K73A 3CVHA 2F5AL 1FL6A 4GJTB 5EDSA 1AO7E 4LLDA 5ESAB 2R2EB 3V4PL 3KVQA 3DTDA 3VNZA 4UTBA 4NHCH 5HHME 2BC4A 5DUBA 4ZW7A 5ILTL 1T1YA 3OHXC 3VFTB 1X5YA 3UH8A 3HBPA 4KVPA 4ODVH 1TVBA 4C83A 1J1PL 3FPXA 1LE9A 2OTWA 4LDCA 4BHUI 2EXYD 1NLBH 3VXSA 4M6OH 5EU5A 3SPCA 4YHLH 4G1EB 5F3BB 4FNLL 1Y6MR 4FNPA 1SJEB 1IJ9A 2UY7B 5KANI 5DDHA 3WIIL 4NBXB 5E8EA 3WEXB 1QHOA 3VSVA 5J1SC 4KC3B 3ZDZF 1U58B 2OMWB 2WXPA 4H8UA 5HJBA 3LS5H 4WKZA 4WFHE 5I2IA 1YUKB 2AZAA 3NIGE 1I7ZA 4XBEL 3T2NL 4JMNA 4GAGL 5HD8C 4QHMB 5I76A 4QRPD 1UUSA 2D3JA 4Q6KA 4DW2L 4PB0L 2MKWA 3FTSA 5L6YL 1I8MB 3ZZSA 4K23L 1J18A 5LNEA 1BD2D 3L2LA 3TV3L 1P7QB 3H9SB 1PG7X 2FJFB 3MRGB 4LF3B 1SXCA 5KYWA 3EGDA 4RETB 2YD5A 2WGNB 3MGOB 2PTVA 4G80B 2YJQA 4YNYA 3DUSB 1LEKB 1CGVA 3NJIA 4FHBD 1WFTA 3X17A 3SGJA 5HBBA 4BSWA 1M1XB 4BIKA 4HGKC 3GTVA 2Q8AH 1TO4A 1OE1A 4XP9H 2H2SC 1RU9L 4M9OA 3HG4A 3DSFH 5FUCC 4X8GA 1AP2A 5KVGL 2WYZA 1F3JA 2HX9A 1AXTH 4LL1A 1PCXA 4OFYD 3V4LA 2HN7A 4PVMA 1WA1X 3GSXB 4FQPA 2BSSA 1MZYA 1REIA 2YAOA 1T0MB 4D8PA 3ULVF 2EZ0D 4GP4B 2HFFB 3L9BA 5LBVA 1EFQA 1S5HA 2F7PA 1E6OL 3FCSA 3QS3A 5T1KA 4HDIB 3EO1A 5IVOA 1BLIA 2IOIA 4V1DA 1HSAA 1QFUL 2DLGA 3QARA 4FLSA 4FAAB 5IHBA 3MJ7B 1XO8A 1MRCH 3F7QA 3EUUA 4A39A 1TCMA 3DK0A 2P47B 2WP3O 3VXMA 4X6FB 5J6GB 4U6HA 1UOWA 2BHUA 2Y72A 4XPFH 2NY1C 4JVPA 2AJYH 1Q0YH 5ITFB 1TZOA 3KYKL 4GXUN 2XQBH 4PJIB 2VDML 5IK3B 3TBTA 2H9GA 4PU2A 4XWOC 3BPNC 4UT9A 2GC7C 4X6EB 1SYSB 3GXMA 4PJAB 1WS8A 4FD0A 1OARH 1ODAA 1M71B 3WKML 3O8XD 2BLFA 2E5EA 4KKNA 1S9KC 3L9RA 2F53E 2BVYA 3MLRL 1YYLL 3AXLB 5EUOE 4OF7A 4P2OD 5HY9B 2H3XC 4XVJL 1Q72H 1U2CA 1ADQH 1XSIA 3HPLB 1X5GA 5HJ3B 1CK0H 4PGCA 1NKRA 3SDXA 3BSHA 3QG7L 4NQED 4OKVB 2YSSA 5I1KL 1D5ZA 1UYWH 2NOYA 4MCZA 5F0MB 4E9XA 3S8FB 4PJ7F 2BNQA 3BRDA 5D4HA 2L7UA 5ALBL 2OFQA 4PRIE 5KTEL 3U7WH 3QXDB 1XGRB 1RVFL 2ZX5A 1AS7A 1XGTB 2DLTA 3ZTEA 4ZYKA 43CAA 3ZYIA 4M7LT 1CE6B 2JJTC 5IBUB 1K6QH 1IAII 3EBHA 5GRJL 4AYFB 1OSPH 1ORSB 1S7UA 4KHXH 2X40A 4PCKA 3FB6A 3BN3B 3EGXA 5DMGD 4PJ6A 5DVMA 1MNNA 5HDQH 4JO2L 2R7EB 2GUOA 4OBRA 4X5WA 2BW4A 2YMXH 4S2SB 3DPBA 2C34A 3MCKA 1WFNA 2R8SL 2DM3A 5CWSB 1OB1A 5DUJA 3D39A 3MJ9L 4LLYA 3DHUA 2VM4A 3L5JA 4M56A 5CGYD 4IDJL 1E2WA 1AGEB 3FQTB 5ID0A 4YHMH 5ERWB 3HRZA 1LE5A 4JFXA 5DEFA 1H6EA 2YGVA 3DVNB 3QQXA 4FJZA 5KJ7E 1ZJAA 2CSPA 2B5IC 3P0VH 4R8WH 4WWKA 3TEUA 3EYQD 1J48A 5F1SA 1NCUA 1WZAA 3V9CA 1XCWA 4YHZL 1TZIA 4WCYL 3WFHB 3UADA 1CFSA 3QPQC 1AZNA 2YD3A 2HKHH 3ZDXB 2H1LM 4V11A 1QSEA 4XP6H 1DVFD 2I07A 5J12C 1M05A 3ULVH 3QPXH 2F54D 3B9EA 4PVNA 1A4JB 5J6SA 5E94B 2BIPA 1UT9A 2EINB 3WIHH 1B90A 3LKSA 1CIDA 4APQA 5FGBC 2X2IA 3AMLA 2PXYA 1AI1L 2SODB 4TVPL 3PWPA 3MV7D 2NYYD 3R1GL 3SKNB 3GUTA 1YSOA 2YC1B 5B1KA 3H0TB 4HK0B 4KQ4L 1F41A 2I24N 3ILDA 4WI7A 1QTSA 3ROOB 1KY6A 4NQSB 3MTRA 1ETJA 4PG2A 3GHPA 4GAJH 5JHMA 4KTDL 3KS0H 4YE0A 4EKXA 1OP5H 3FB8A 5JMRA 3QCUL 1S78D 4UUJA 1PKQB 3MOAL 1ZS8A 4WSKA 4BFRA 2ARJQ 3PCYA 2NNFA 3ZE1B 2VLJE 3HHRB 4UF7C 5DJXA 5BS0E 1AGFA 5C8JB 4AGLA 3L1GA 3VFPA 4OR1A 3N85H 1S8DA 2B1AL 2E6QA 4UT7L 1DBKH 4AV0A 5KVMC 1KF9B 4PJHA 2BSTB 4X4ZA 2O5YL 3Q06A 5HYQB 5KBPA 3QEQE 2R27A 3MRMB 2VDNH 5HHVL 4KO6A 4XZUA 3O9WD 1ZEAH 1U9KA 2J8OA 1IAKB 4W9ZA 1EA9C 4LSUH 5C0ND 4ZJ9A 4PJGA 1DQIA 1JFHA 2CGZA 4FYSA 1CLOH 4P4RB 5L2KE 4OZHE 4KY2A 1F6FB 1NIFA 4XOBA 1YDPB 3DRTA 3IE9A 3VGGA 4YMPA 2VQ1A 2XN0A 1G9NH 4J3OC 1JK8A 1T1XB 3O2DA 4MD4A 1XGUB 2IV9A 1ZWIB 3ZL4H 5IBLD 3SJVD 2FWSA 4KXZI 3WLWC 1A7QH 4AIOA 2XWJB 3L5XH 2WJ5A 3P9MB 4FF9A 4NO5B 4WDIA 2E7LC 2OMZA 4ODXA 4JAMB 4B0MM 3L17A 3MN8A 1PBYA 1RUML 4LP5A 3RGVD 3G5XB 5TF0A 1OP5K 3LZFH 3ZTJH 1RPKA 3KJ4B 1MWAL 1ZT7A 2A9NL 4LPVA 4PTUB 2X0UA 4BELD 4U1SA 4BJLA 4CAGA 5DHYA 3BSZA 3GBDA 5I8EB 3TA3C 3VH8G 4P2RB 4KWUA 3FSAA 1KTCA 4NN5C 4JFQB 2OL3L 4TQEL 4AYGA 1IKNC 1XGYH 4HJIA 3QUXB 5H8DA 3D2UA 1CU4H 2J6EH 3RJDA 3RWGB 5BNXD 1U8NB 3T0EE 4JFHE 2H26A 3LKRB 3PYCA 4MJIE 3WFEH 1BVKA 1FH2A 4IBLT 4DFHA 5FHBL 4WTWA 3F7LA 4OU3A 5E9DD 3N3EA 1MCKA 3MLVL 3NZ8B 2GSGA 2NT0A 1C5BH 2FJGB 1OIOA 4M7JH 4WI0B 1HEZB 1NGPH 1ET8A 5EZLA 1IGJB 2VQTA 3MGAA 1P4IL 3VWKB 5EBMA 1AKJB 5KVFL 1RJLB 4OZGA 1NBCA 4XCFH 2SEBA 1F18A 3SPVA 1ORQB 6FABH 1FH5H 1EDYA 4I87A 3DETD 4XTRC 4LSVL 2Y69B 4GBXB 2Z91A 3FOLB 5C0IB 1A5FL 5LBSL 2DQHL 2FX9H 4XB7A 4F5CA 5CCGE 1J11A 4XNQA 4L3CA 4NC2B 5D7LD 3AM8A 5T1DL 5IGXL 1K5WA 3BD4A 1KIUA 1HIMH 2OX5A 4KXBA 3WNIA 2XA3A 2DLIA 4HWNA 4DOHE 2MCPL 4ODWB 5A6IA 5ANME 4BZYA 4UQ3A 2A9AA 2DQMA 2GJ6E 3QWNA 3KPRE 1VACB 3QUYC 3HG3A 1MFVA 5ADPH 3KHOA 4J27A 2FL5B 4P4KC 1KY7A 3S2CA 1DLHB 3V5HA 1H6FA 1ZVHA 4M6OL 1YECH 2LABA 5JUEH 3MA9H 4G8GE 4MCMA 3LN9A 4KVNL 4M6AA 5E6ID 4G11A 5E70A 1FL6B 2YGNA 2NY2C 4GKZB 1KBBA 3JTBA 2OMTA 4KZDH 3MRJA 3OZLA 4R2GB 1A6ZA 1RZKH 4HBCH 1E65A 1BSIA 1K72A 3MV8B 3DYMA 4Q14A 4ZX4A 1OP9A 2F1AA 1QLFB 1GC1L 3FSZA 1E5YA 1TVBB 4OZFG 5KBMA 4C83B 1IGMH 3F01A 3ILQC 4HIEA 4LKXB 2Z0UA 1QFWI 2DI8A 1OGSA 4IBYA 3QO0B 1CDUA 2O6EA 3SYAA 2IFFL 3EBAA 3QWRA 4MDIA 1RLBA 4TS6A 1N7ML 1N26A 4TL4A 5HYSB 2B1OA 2VWEC 3VDAA 2HRHA 3BJLA 5CP3H 5I2IB 4LHUG 4NFDA 2Q8AL 2J5LC 4PS8A 2JV6A 4LSQL 1G1YA 2H41A 1B88A 3ZUNC 1NQBA 4LRIC 3TYGL 4NRXA 1CF8H 2DYPA 3EDKA 4ALAC 4DVRH 2DM2A 4DTGL 3MKKA 1KJMB 5GZNC 5BQ7A 4FQHA 1LO0H 3LPOA 1OTTC 4X9FA 4HKBB 2HTLC 3S36H 2FQEA 1B0IA 3AU0A 1TOXA 2OXGA 3X1NA 4Z7QE 2A83A 5EIIB 5I6MA 2VZ3A 4Z7IA 3DJZA 4X5PA 2K4AA 4O5LL 3FSOA 4TNWF 1QSFA 3FQ4A 5KSUA 1IIIA 1WAAA 4XI5D 3GKWH 3QEUB 2XVKA 2O5XH 4LFHG 1BJ8A 3FRUA 1GOGA 4HXAH 4M1DL 5EO1A 5D4JA 3IRCA 2WK2A 4XPFL 3WNOA 4DEWA 4U05A 1GZPB 2OTUB 4V2CB 4PP1D 5J7CC 2FH8A 1GZHA 4EZKA 2IAAC 4BQ6A 4YHNB 5C3TA 3OKLA 2G5RA 1A1NA 5INDA 3CSGA 4DKEH 1OARL 3IJYB 3CX5J 4NO0B 1FGVL 1FVCA 4OUUA 5AW7B 4X83A 2X10A 1M7IB 2XY1A 3E3QC 1PX3A 3W5NA 1L0YA 1XVSA 1A6AB 4WFFD 1A9VA 2ZOLB 1Q72L 1NC2D 1ADQL 4YAQB 4YDKH 5MEQB 3MUZ1 2CRZA 5E24E 2C3GA 1INQA 1W8OA 2BZCA 4RCAA 4YLBA 4DKAA 3AFLA 3WHE1 2COQA 4DHLA 4PG9A 2X89A 2ZCKH 3N41F 4R0LB 4XNMB 1UC6A 4K94L 5BRZA 3HBZA 1NGWB 4LVHB 5EZJB 1JYVA 3VMPA 2BY3A 2JKIS 4RMSA 4UDTB 3U7WL 3LZPA 5DRWB 1P1ZB 1N0XH 4JFYA 1RUAH 2CO7A 4P5TB 1K6QL 1IAIM 3D18A 1J5DA 4PRHB 2ZCLL 2HKFL 1EZSA 4PY7B 2OR7A 3QRBA 4DN3L 5HDQL 2DD8H 2XETA 2X7LA 5D6CA 3LQAL 2YMXL 3BEVA 3CBKB 1XCTA 5A2LH 2YWZA 1RUQH 2GT9A 4KXDA 2EVHA 3MLZH 1BPLB 1JN6A 2BNQB 1F8TH 4GRLD 3BKJL 2XQYA 1KTBA 3ARGD 3L4TA 2RACA 2I27N 2FB4H 2OJZH 4V2BA 2MRYA 5E08L 1W8NA 1M56B 2JELL 1PD1A 3PGFL 3EOTH 3P0VL 4TOYL 2CUHA 4TUJB 3RUGF 5EF2A 5DD5L 2ZP0T 3C8DA 4CGTA 1RP8A 2VLJB 2HKHL 5DJAB 1T7ZA 5MENB 1MPAL 1NUNB 2GW5A 4XP6L 1DQTA 5K59E 4E42A 1ADQA 4XCNB 4LBEA 3EFDL 3KLDA 1LE5B 2IPTL 1OCWH 3UYPA 3KGTA 3WKPA 5KUMA 3OKDA 2CHXA 2X3AA 4CJ0A 5GZOC 4Z77B 3H53A 2Y2WA 2VDPH 1AIZA 3B8SA 3PWNB 2L7EA 3ARSA 2R9HC 5IB3B 4KTGA 5I1CH 1SMOA 3SKMB 5F9DC 3UFIA 1MSPA 2HT3C 1F00I 2VW4A 1U8KB 1TZIB 2BS9A 3CLFL 1NEPA 3K81A 3LZRA 3IU3B 1MH5A 2FZ3B 4HMDA 1AHWB 3M07A 4JN2B 1QSEB 1WTLA 2I07B 1JWSA 4G8EB 5E7BA 3ZPDA 4MYPA 1JD7A 4NZTH 1QTYT 2I9LA 4WUKH 3CSBA 4E68A 2IAMA 4G83A 3AG4B 3HAEG 2OXHA 2DJUA 1A65A 1EEYB 3FOMB 2X2HA 3DOSB 1PZDA 4AK2A 1JPFA 1SEQH 3N85L 4J3OG 1A3RH 4QGYA 4C47A 2X4TB 4GG6F 1DBKL 3IEAA 4OCLC 4P04A 4ZX6A 1IM9D 5GGQL 1H3XA 1YEHH 2GFBA 3GSWA 4Q2ZA 2AKRB 3I6KB 2QBWA 4I0PB 4U3SB 2UZIH 2EEDA 2C1OA 1MW3A 1U6AH 2BFVL 4X5LA 3L1FA 3NCYS 2EEFA 4Q6YA 5E5UB 3VUAA 1CLZL 3O0RH 4XC1L 2XN9A 5DMYA 2Z31B 2FR4B 3MNDA 1VAHA 4TNWK 3DI3B 3VFPB 4G8FA 1PLGL 4MJIB 3VAEA 5FGCE 1E3XA 5LB1A 5I1HH 3QPKA 4HH9A 2UXTA 4XNDA 2EJ1A 4PJHB 4JG1H 2CUMA 3B7SA 4L1DA 3ZL4L 4R4FH 3L4VA 4R0LC 4MZ2A 3WIHA 3TPUA 1A7QL 5CF3A 1SUHA 2ZXEB 3L5XL 3P77B 4MJ5B 3DO3A 3NIGF 4JHWH 1F4XH 3BFQG 4YDVA 4U1NA 4N2CA 4JFDE 1U95B 4P59H 2VLRE 4PRAA 5A2JH 3WN6A 1J86A 2LU3A 3PQYE 1SVCP 2EYSA 4YWGL 5I18H 3DV4A 2WTRA 2FO4A 3B9KB 4JPIA 3P11H 3UJIL 3NA9L 4A7TA 3KPMA 1SBSH 2DQFB 5CINL 4KNQA 1I75A 4M8QA 2X9XA 1OK0A 5F44A 3OKNA 3AY2A 1FN4A 1XGYL 1RERA 2GQHA 2WYIA 1CU4L 2J6EL 3O4LD 4RH4A 4YN3A 2H47C 3D85B 5JQ6H 2OR9L 2E27L 3D25A 2I9TB 3TH2T 5ANMB 1M7DA 2GJ6B 1PY0A 4WAFA 2IADA 2Z93B 3FQUB 3KPRB 5DHXB 5KYNA 1C5BL 4OLYL 1YG9A 1NGPL 4OD3H 4PJ7A 3MRRA 1ZLVK 2DEWX 1BBJB 5E1AB 2IWKA 4G9FE 3QISA 4UQDA 2AXFB 5B1JA 3V6FA 1A4KB 3VFMA 1SDDB 5ICXA 1UT1A 3H42L 4YS4A 3MI6A 3US0A 1WA2X 3QUML 4G8GB 4XCFL 3AS0A 2YQGA 1CICB 6FABL 2BSED 4Y2DA 2YFOA 5IM7B 1RIHL 3PV6B 4B9YA 4NC1E 3TURA 1VF5C 1BVKB 1QWUA 3FFDB 4GT0A 3TIDA 3QGVA 4E0RB 1KPUA 2NW3B 4I4WB 1AC6A 1UM5H 1J10A 4I9WD 3GMQA 2JLLA 1IKFH 1V3MA 4TSBH 4B27A 4JHUA 3REWA 5BVPH 2WINA 3P9LB 3QJOA 1D2PA 1R6VA 4RZKA 1P5UB 2A6IA 4WHTB 4U1JA 4U6YB 4LLUB 1KBGL 3MOBH 5D96B 5L88H 1AHWC 1MCJA 1PG7H 2V2TA 2D4DA 3VFWB 2HMID 1YECL 3ZR6A 4AM0A 5JUEL 3MA9L 4MS6A 4DUWA 3T3PF 1MXGA 3VXRE 1T5KA 4AUUA 1CVRA 4N8VG 5EU6E 2ICCA 3K1KC 4TKWA 2J5WA 2PWGA 2PXYC 2BZ7A 3IT8D 3K74B 4YLCA 4TTDD 1RZKL 4M61B 4ONGL 1V05A 3AW5A 3WENA 4ABQA 1G0XA 2CO2A 4JCWA 2YBGA 1BVLB 3D48R 3B56A 3EH3B 3NABH 4ZOBA 5AZ2H 4LSSL 3D0AA 3H3PL 2P8PB 2DIAA 1NC4A 3HFMH 2IBZX 4PD4J 1OAKH 2Y24A 4PG2C 1VFUA 1HZLA 2D9CA 2X4QB 1HKLH 4ILDA 3GBNL 5D70H 1HX0A 4M4RA 1MFCH 4DO5A 5SWZB 1MI5E 2JH2A 4WU7A 2EDMA 4OJDH 4XCEB 2N0MA 1JF6A 3EGSB 3SYCA 3U1QA 4AGMA 5GGRB 1DVYA 4DGVH 4HIQA 3MZTA 1FUNA 3OKOB 1CG9A 2BNRE 4ORZC 1TJHL 4YEFA 2Q76A 5BUGA 3MUGA 3GEWB 2ZSVA 1HINH 1YHPA 2P5EE 1S7WB 2RMNA 3L3OA 5H35B 2FBJH 1ZLWK 3RA7H 4EIZC 3JV4A 4A2DA 2NQDA 3GMRB 4M02A 4U1KB 1CF8L 1LM8V 1NJ9B 2N1TE 4XMTA 2EXTA 1DJXA 1IILE 4NQXB 1QUPA 4W1TA 2XWXA 3GXNA 3IFNH 4X6DF 3WUWA 5J11B 1TJIL 1ZIAA 4EI6A 2FUTA 3LKNA 3BP7B 4JM2F 3ZX1A 4JZOA 3B9KC 4P3CH 4XXCA 5JA9A 5EEYA 2H0PA 3I6LE 1XAKA 5HI4D 1FNSH 2YR3A 2Z3FA 3QZBA 4UNTA 3N40P 4HC1H 3FBKA 4IOSA 2GK0B 3WGVB 3ZTNH 2A77H 2GJJA 3GKWL 5IW6B 1EAJA 2CLZB 2RIKA 2O5XL 2Q3XA 2X4SB 1CI3M 4MBOA 1A66A 4HXAL 2G75B 4XNYH 4N28A 1JVLA 4EXKA 2AQ2A 5ACLA 2ITFA 1YEDA 1SBBA 3ARFA 1ZLDA 5GISH 5JR1H 2CIIA 4PFEA 4U3HA 32C2A 1FJ1A 4WFGE 4FCHA 5DEJA 3L7FA 2VISB 4ANWA 1L5GA 3QNZB 1UM4H 5A7EA 1CBJA 1IGTB 4N0UB 3HE6B 4JCMA 4HUKB 3BWZA 3MPCA 1CICC 2BWQA 2ED6A 5I6NA 5TQ2H 3ZJAA 5FYJD 4J3SA 4KZEH 4KBPA 4JJHA 5B39G 2OJEA 1I4FA 4W9FC 1NCCH 5HD8D 1KLGA 2IC2A 4JY6A 5CP3A 3PWJA 2PW2A 4H88H 4NAQA 3IETB 4RIRB 5BUAA 8PAZA 3BH4A 3V5KB 3OKLB 1B0WA 4OD1L 4PJEF 3WV0A 4S1QH 3M45A 1IAIL 5IIEA 1FVCB 3T8MA 3O6ML 3QFDA 3FAWA 5IROA 4GSRA 3B3BA 4ECNA 4EN3D 4XRCA 5C9KA 4S1RH 3QNYB 5JW4Q 3JWNC 1E7UA 2KH2B 3Q1SL 4GS7B 4LMQE 5AOMA 1OTUD 1RUQL 1I85A 3G5ZA 4OZHF 3GJFH 3GMNA 5AAMC 4BSJA 1FNLA 1YN7A 4HIPA 1X7TA 5E99L 1PCSA 2IQAA 2HFGH 3HB3B 5JQHC 1BFOA 3SQOL 2ZWSA 4MD0A 4KKCC 1MVUA 1WBXA 1T4KB 4DZBB 2VN3A 1B2YA 4JFFD 4Z7WE 3FTVA 1ZLEA 1GS6X 4N25A 3Q5TA 2W65A 1E8WA 4ADIA 2ERJB 3NFNA 1O6VA 3VFRB 5K9OB 1ZTXH 5HGAA 3BZ4B 2ZZUT 4PY8J 5IJBC 1YEJL 3GTNA 4JVWA 4WKXA 3C6LA 3PE9A 3KAAA 5DXWA 1A21A 2MKLC 4NUQA 4ZW6A 4BGLA 4QLRA 1RPUA 2JQAA 1T1ZA 2WQRA 5IEHA 2ITEA 2NY1D 1A25A 2FJSA 3VFVA 2AV1A 1BWMA 4XWOD 4Y7MA 2YARA 3RI5F 1YVLA 2XZQH 5ABDE 5IOPB 1NCAL 3ULUC 2L4OA 2VDRH 4W9CC 4WHCA 3ROLA 2R69H 1KFAH 4N5EC 2VZTA 3NZUA 1CR9L 4PMFA 4YSAA 2DLEA 3GZKA 3QSKB 1NCDH 5G5DA 3NAAH 5I0ZA 1X7QA 4HJTA 4UU9B 5CSZB 4ODTH 4P9HH 3JWDH 4MQTB 3ZRSA 4DGIH 2VUYA 2JKNA 3UTSD 1RSYA 1WWBX 1MFAH 2YMTA 3GJFK 4G2AA 4QRSB 3X11A 4P9MH 1R3LB 1A47A 2W0FA 3OG6B 1XGQB 1MCPH 5SWQA 3GBLA 3RWJA 2YA1A 3UBXA 5AB2A 4XE5B 4MYWB 4KI5E 3CZNA 4GUOA 3CFTA 3QDGA 1XEDA 5AB1A 4I2XE 3O11B 5E9NA 2ZOTA 2IH9A 2V2WB 3AWEA 4Z78A 3DWTA 1EAQA 5E51A 4KQ0A 1KYAA 3I50L 4JFDB 3ZDZB 4JMXA 4U31A 2NUPA 3PQYB 2NW2A 5EFIB 1J5CA 3F05A 1MHCB 2AQNA 2ORBH 3EBGA 4FG4A 1UA3A 2D3VA 4L4TA 5CEYB 1HNFA 2R0WH 3IAQA 3DURB 3GS4A 1NGQL 2FHCA 4RX4D 1ET5A 1WISA 2UZIL 5T3ZD 2XKNB 1U6AL 3BH9B 3MA7B 3CMGA 2FSEA 1YPZE 2F9BT 4YHPB 2GSMB 1BREA 4UV7L 3OGOE 1NMCC 3E8UH 4JRYE 5HVFB 1JUFA 1EQWA 4E36A 3TOPA 1AIFB 4RZCA 3CSYB 2NXZC 3GDBA 2FLBT 2XWEA 3GTTA 5I1HL 5J8OA 5JO5A 1RZJH 4JG1L 1CC3A 1OWWA 4ONHB 3RWDB 3FT0A 1GZHC 1G7PA 4AZ8A 4GW5A 1RSFA 4J23A 3TEXA 3KLKA 3H2WA 3QPQD 4JHWL 5DJZA 3HN8A 4O2EB 3ZL1A 3ISRA 3FFCD 1R9FA 3G6JB 5I18L 3PHSA 1LWHA 2PP7A 5JYMA 2PO6A 3R19A 4LIQE 4N2LA 5CJOH 4UOW0 3P11L 1JNHB 1AS6A 5MHSE 4UOQA 3FB7A 1RUPH 1ZK9A 1DJWA 4AY0A 2BDNH 3RL2A 3V7MA 1KENL 5ABAA 1R19A 2V5SA 4IOIA 3VMNA 3QJQB 3HB3C 3EDJA 5KSBB 1BWWA 4UNIA 2A6JA 4KH2A 1R5IA 1Z5LA 4Q6IB 1HH6A 4ENZA 4WK2B 4G1MA 2XV0A 2G4GA 2XZCL 3UO1L 2QQLH 1MAMH 5JIIA 3MMEB 3BZEA 2KZ1B 4LAQL 3VGAC 1BYPA 2DKSA 1T80A 2BVQB 4LT7A 1GGCL 3BHBB 3ZU8A 3BAKA 1EVUA 4HWZA 4ELMF 3TIEA 1WBZA 2ZF9A 2K9UA 3DX3A 1MHPL 1NIEA 5IQ9B 5DJ6B 4O51B 2D31A 5EU6B 3G04A 3B7RL 5GS2H 3WI9A 1I8IB 1KDIA 3OJDA 3D3VA 2LGNA 3CC1A 3KR3L 1RK1B 5D4QA 2ZTBA 4FFYH 1IEAB 1UM5L 2JCWA 4M5SA 1OSZB 1OGTA 3PABB 1UD3A 2JB5H 5IVXE 3IDMA 4A63A 1O7SA 5BVPL 1N5YH 1FFOB 5IVZA 3L48A 1MI5B 4Z5RA 2MPAH 5HGBA 1URIA 1LJMA 5EU3B 1HXYB 3KJ6L 3UZQB 5A43C 1G6VK 1CFQB 4J3OD 4JKMA 4P3DB 1KYDA 1B3JA 1XF4A 3IDYB 4AQEA 1I8KA 1HE7A 4A2FA 4X9GA 3RUGA 4NO3A 3WLWD 3TEYA 5TDPB 3VG0H 4Z18A 1KJ3H 1U8JB 5MEPA 2P5EB 3QDJA 4TQ8A 4A2HA 2WZPD 3RI5K 4OFIA 4RISL 1NCTA 1PDKA 1N6QH 4Y16A 2PPFA 5C07E 3IGKA 1SHWA 4L3EE 5A2IH 2NNXA 4Z76A 5D72L 3NJJA 4G6AC 5BVJB 2DPKA 1J9SA 4MNQD 2D7QA 2WVUA 4PP2A 3FCUB 2K1MA 3BIKB 4N22A 3SO5A 1OAKL 4L9DA 2VL4A 4H25B 2P7TB 2FIKB 5KEZA 2ATPA 4MXVE 1MRFL 3GK8H 2UXGA 2FQFA 1E42A 5DLMH 2IAMC 5EBWA 5K1NA 4RMUA 3EUDA 1QI3A 1B6DA 4DGVL 4RMBA 1EXUA 4CA4A 1JPGA 5FYJU 3ILPA 2IANA 3UTQB 1YNKH 1HINL 2Y06L 4XNXH 1IFRA 5GRVL 3UTOA 3EJZC 5CN2A 5EOQL 4N87A 1WT5A 2V9RA 1NGZB 2DBLL 3TP4A 5KG9B 2XC8A 5HPMB 4GG6A 2AAAA 5DK2B 3WY1A 4NN7C 1U92B 4XTRD 4W68A 1AO7A 3RIAK 25C8H 4DEPC 3FQRB 3WJMA 4GLRH 3HVDA 4NKDA 3J7HA 4NZUH 3R0NA 3HZKA 4HIHB 4K55A 1SVZA 3K3QA 3ULVC 3CFDA 2R83A 3MUGB 4UI2A 1ZCRA 4AIZB 1X5AA 3Q5OA 2YMOA 3ZQXA 4X7TA 1W15A 2A77L 3PAZA 3IWVA 2ICWJ 2ADYA 5C0AD 1T6BX 3QUYD 4DERA 2VDQB 4PJFE 3QAZB 2C7UA 4P4KD 5G4NA 2WUBH 3IMSA 2BK8A 3N40F 3GQFA 3RHWK 1PY9A 4OM0H 2WBWB 3BWUC 4EI6B 1AOZA 3BZ5A 2ZUQB 1P9MC 1BXXA 4P5SA 5BRPA 1QASA 4PJ9A 4J4PC 4QHNA 3RU8H 1I1FB 2GK2A 3NACH 3EJQA 1UM4L 4FOMA 4WNJA 1SDYA 5H4ZA 4NKOB 5EZOH 2ZOOA 4U1MB 2NY2D 4HFWA 1SLXA 5CFHA 4E5XA 4TYUA 4F7PA 2XTJE 2BRQA 1QUNB 2CHNA 4MB3A 2WXNA 1N68A 2P43B 4U7SA 3FQNB 3DSNA 1NCCL 2Z4QB 1YYML 3ILQD 3ARFB 3CVIL 3L1OH 4UCFA 3OPZH 3KGUA 4K5NA 1I8LA 3P30H 3BZDA 1UT2A 4S1QL 3L5HA 1MFNA 4O4YH 5B1JC 1TQVA 3IXTB 5B3JE 5TF1H 2X4UA 2Y6TE 2ETWA 2NY4B 3ZMNA 4Y2DC 4XMXA 1IBDA 2Y1AA 1R0AH 5AVYB 2JI3A 2MPVA 3IDYC 5C0FB 1CGYA 3Q2CA 1SM3H 1KLGB 3EJTA 5DJ2A 3U9UA 5F0PB 4HC1A 2GUYA 4EIBA 1G9NC 1OF0A 3E7JA 5B8CA 1FIGH 1F1GA 2HG0A 2IXQA 2XBZA 3OAWA 4X4XB 2HFGL 3ZYZA 4BQ9A 5J57B 3IXAB 1NCWH 4M4PA 3IFLH 5GZND 4L9LB 1IGIH 4LMQI 4ABWA 4OB5H 2WB1A 4Q7DA 1OTTD 3SD2A 1TYEB 4S11A 3V6ZA 5DJCB 3SB3A 3D0LA 4XN8A 4NPJA 3UTPE 2OCCB 3UPCA 5ENWB 4OZIF 3BAEH 3M1BA 4KHTH 4L37B 2X1WL 1L4IA 2C1PB 2DQTL 4OLWH 3UABA 5CMAB 2BP5M 2KLSA 2GEQA 5IESL 5KN5A 3VGHA 4CBZA 4F7EA 4MCYB 5IHLB 3G6DH 4EDXB 1Y07A 4HJGA 4PJBE 3GIVA 2K7QA 3UTTB 2CXKA 2F53A 4BE5A 3GIZH 3WTWA 5EUOA 4WJ5B 1A4BA 1GKOA 1ZA6A 2FQGA 4CMHB 2Q6WB 1CD9B 2P8MB 3VQLA 3VD1A 3ORJA 2GC4C 1RD6A 1G7HA 3CBRA 1AKJD 4TUUA 2Z92B 3R0MA 4YVNA 4RGOL 2OPCA 1RZGB 3NAAL 5HGAB 5BZXA 4P9HL 3GMMA 3JWDL 4PRIA 1F90H 4DGIL 1RZIB 2CO3A 1MFAL 3MRPA 4JRYB 2GBTA 5JPMA 3QC6X 4YGVA 3C8HA 1MF2H 3BVNA 3ECWA 4P9ML 1ZHNB 4NWUH 5CEZD 2YUXA 3IDUA 3CZLA 1I1RA 1VRSA 2A6DA 2AK4B 5LKNA 2LTQB 4YHIA 2R59A 1FG2A 1BOGB 1QO3A 3TU6A 1ZJBA 5AW5B 4AMKL 1YNTB 5IB2B 3GJFA 1OVZA 3QB7C 4HKJB 4JKNA 3GB7B 3L3OC 3PHQA 2Y7NA 1IQWH 3CFUA 4TSAH 2UUDH 4RFOH 2NUTB 3FO1B 2BP8B 1G1KA 2BVUA 1I3VA 4MNGE 3CZFA 4XPGL 4Z0XB 1SOSA 3PWLB 3B6SA 3U9PH 4IRJA 5FO2A 5AL8A 3TJEH 4OFQA 1T03H 1NPJA 1QBAA 2WTOA 3HZMB 4H5SA 4Y4FB 2G9HB 4ZBJA 2EKSB 2VSCA 3SKJL 4XXCC 2VB5A 3EFOA 4EF3A 2CBQA 4NFBA 2W0FB 1MLBB 4ZDHB 3KYOA 4B9FA 4IMLA 3DX6B 3V0IA 4X6DA 4DK3A 1K8IB 1LO2H 3E8UL 3KHQA 1P7KB 3JT2A 4ZSOB 4R2GD 1D7CA 4JM2A 4PWKA 4N90E 3V52H 3MV8D 2MEJB 1A6WH 4GSUA 2E9BA 1DR9A 4U6XB 1FNEA 5ICYB 3MBWB 1KCRH 1RZJL 3FZUD 4U7KA 3BZFB 4KMLB 1VERA 4FQXA 4WW1A 3ARFC 3UX9B 2R69A 3TZVA 1I3RA 5JZ7C 1PZCA 1DQJB 4MQ7A 4KX8A 3D87B 3U46A 5C3IA 1NUFA 4PMEA 1ZVSB 2ZIDA 4KKBC 2VXVL 4HS6B 1G1CA 3ME0A 1HHKA 4JQVA 1ZK5A 1YYCA 1JGEB 3ZTDC 1YJDH 5CJOL 3KM1A 2DM7A 3C75A 2EYTA 5IFHH 4TTGA 2CR6A 2NY4C 4DAGH 2B15A 1HT6A 4ZMXA 1YY9C 2RJMA 4F92B 4J6RL 4PJ8B 3ABGA 5GZOD 5JO5B 4MDJA 3MV9B 2EDOA 4XN9A 2UUDK 1RUPL 2PLTA 2R9HD 2X4RA 2LE9A 4QDGA 1KWGA 4F7KA 4KFZC 2HT3D 2LW3A 1J12A 2QL1A 1WITA 5LLIC 4CJ1A 2DYRB 5BS0A 3BKCH 1PYWB 2WXLA 4HZ1A 1T21A 2QQLL 3NFPA 5DA0B 5D1XB 4KVCL 4PWIA 1NFIB 4PJEA 3MX0A 3M6DA 4YXLH 3UJJH 2G9KA 2W60B 1M3IA 5J1AA 1NFDE 1OTSC 2H32A 2PCXA 3MDJA 3RWHA 3ARDB 1U2HA 3F7VB 4FI6A 1I85C 1ZV5A 2GITA 4N2FA 5L8LB 4X6CE 3O2VH 1AD9B 1RFDH 3FU7B 1WEJH 3Q13A 4OLUL 1X9LA 2JSFA 3D4YA 4PM1A 3RJOA 1FCGA 2YLKA 4HS3A 4PQXA 3HG5A 4FFYL 2CK0L 5E8OB 5L2KA 4OZHA 4KRPB 4MMYA 3BZEB 4P3WA 2CUIA 4NO0D 3IFPB 4ES9A 4L8SB 4KZCA 3FS9A 4V1DD 3FH5A 1EJOH 1JHLH 1L7IL 1A9BB 2MPAL 5DD0L 3TVMA 5KAQG 1E0OB 3C6LC 1HWWA 1ZXKA 3B7UX 3DV6A 5I6XC 2KPWA 3VXMD 1KPRA 4XP4H 3QZWB 4CRPA 3DGGA 3KBHE 1CN4A 3D3VB 2N7SA 3FONB 3VG0L 1M6OA 3WNLA 1XBRA 3WE1A 5HP5A 1R46A 2CDEB 2WNXA 2BIMA 3WELA 5I1JH 1XIWB 5KYXA 4NKMB 1QVOB 5T5NF 3GJEA 2BSRA 1HCZA 1ND0B 5FIEA 1KBKA 5IVZB 3V4UL 4QYOA 3I9PA 4PRHD 4WUUE 3T0EA 2QKSA 3UTZB 4PSPA 2CO6B 5C0GA 3D51A 3T65B 5EOCJ 5JORB 3S3SA 3LKQB 2AEQL 3EJPA 5F7BA 4XH2B 2DQUH 2HB0A 4NUMA 3GK8L 5EF3A 5EA0H 4NQVB 2BNQD 1JGLH 5LGJB 4JFEE 4OFPA 1UZGA 1HWHB 5C0EB 1VEOA 4TPRH 4X4YB 4CNIB 5IHHA 3N0PB 1HI6A 5DS2A 3BMWA 2B16A 2CWRA 5FKAB 2Y1VA 4PJ5E 4PJFB 4U1IA 2BS71 5HVHB 2VLKE 3GO1H 4E9RA 5CNHA 3ZDYE 4GQPH 4XNXL 4OD2B 4TNFA 4HUUB 1LDPH 2WNGA 4GKSB 4Z7WF 4HJEA 1R3IH 3GPSA 1E27B 1U21A 4HXBH 2ADIB 2ATPB 3DA0A 2VLJD 4JPQA 5MEND 4GRWE 1AR1B 2ZONA 5GS0H 5IHZA 4L5FE 2A9DA 5JLZB 4Y19A 4NZUL 1LK2A 1XZWA 2ZSWA 1Y1UA 3VXQA 2NR6A 4LDOB 1RJZA 4PJ8C 1OAJA 5MI0C 2I69A 3CQFA 4MX7A 4KMTH 4CC0A 3BCFA 2OSWA 2GJZB 5EZIL 5BZDA 1JZ8A 1R3JB 5D6DC 1T66C 5LAPA 2R29A 2JTYA 3UL4A 3QNXB 4WEUD 5E03A 3VRIB 1QSED 2OMYA 2AQPA 1NMBH 4MZ3A 3GZPA 4OM0L 4NKDB 4BH7A 3K4ZA 1BZ7A 2CM6A 4DGWC 2AJUH 3NSYA 2P8LB 1ROCA 3RU8L 3NACL 2B4CL 2DDQL 4HCRL 4B50A 5LGYA 3GNMH 4EE2A 3OGCB 4Z7OE 5AW1B 4LB8A 3BGMA 5E56A 5CM1A 1WZLA 3HG0A 4I3RH 5BQDA 5IHUL 4LASL 4IYKA 4UAOB 3APMA 2BHYA 4N6RA 5FOBA 4C59B 1MLCA 3HG1E 3TT3H 1MCHA 4H1LH 2GIMA 3F7KA 3KL0A 2AC0A 1BV8A 1MELA 5JW4R 3MJ8A 3L1OL 3DK2A 2PPDA 3QEGL 4O2FB 3HZYA 1KTLA 1PLCA 1U8QB 1GGUA 3AVEA 1AACA 3M17A 4L8SC 4YR6A 3ZTJG 1CGXA 4GINA 5FDWA 1R1CA 5E8NA 1XX9C 4PJBB 2ENYA 2M26A 4E5XB 2J43A 2YFNA 3FT4A 3HLAB 1EXGA 2BY0A 4Q58C 3EYVA 2Y7QA 1ZDSA 1WZ1H 4L1HA 4WV1A 1JFQL 5T3XH 3FT1A 4ELMA 1SM3L 1KB9K 3BX7C 2OK0H 4P2QB 5D7JB 3VXOA 2P52A 2F74B 1A8ZA 5BO1H 1QPKA 3LRGA 4P5MB 2PTTB 3KNBA 5E2TH 1NCWL 2DI7A 5HHQB 3W38A 1IGIL 4ZUVA 4YHOH 5DZVA 1R5VA 3VRJA 3WHXA 5IFJB 5CLYA 4L4VB 3RNKB 3B9KD 4LCUA 4AEIH 1NGXA 2XVBA 1A7OH 3A4AA 5F7KC 4IRZL 4L8CA 1NANH 2OP4H 1S7RA 4FXGA 3BESR 3BAEL 3DX2A 4KHTL 5HDLA 1U8MA 2CLRA 3TNNB 2X6BA 5F1IB 1T0OA 5LGHL 1UG9A 4XXDA 2GHWB 3FQ2A 4HX1B 3A67H 5ESVB 2ADGA 4JQIL 4NQCE 3CPLA 1RJYA 4X99A 3NIDF 1FLRL 4OIIL 3TEZA 2A74A 4E41A 4MNGB 5D7IE 3HW7A 4DETA 1FWXA 4IW4C 3V0WL 1KJVB 5ITBH 3INUL 1CFVH 3UBGA 5EMYA 4DP7X 5F6IB 2M1KA 3I9GL 1NCBH 2DOCA 4N86A 5I0VA 2ZYSA 1FZKB 1CICD 1WJ3A 4IIQA 3WUWG 5FCSH 3IMWA 1AR1C 1UOKA 4JFSA 3JWOH 1UFGA 4MS8C 5DJ0B 3F8UB 4Z3GA 1K4CA 3C8KB 1VFAA 1YEEH 3WFDH 3JV6B 1JPTH 2E7DA 3C2AH 3C5SB 5C2BH 2H1PL 5GS1B 4ZUTB 4X98A 4TSAL 5C0JA 5D7EA 3D7PA 4RDQF 1FFPA 2HFEB 4KXAA 1YMMB 3I6GB 4Q9QH 3SODB 4W9IC 5IVXF 3PXHA 3BAYA 1WHOA 1NCNA 1U42A 3EFFA 3ML9A 4KRLB 2EUWA 1EAPA 3VGDA 4S1SH 1AFVH 1NAMB 2B9BA 5JXEA 3TJEL 1RKRA 4XPTH 3SBRA 2DI9A 1YY8A 4NP4H 1DUZB 5DHVH 3IAPA 1GIGL 5HHXH 5IJKA 2VDKB 2XPGA 4K5LA 2NLJA 3QCTL 1FORH 1K5NB 3L3GA 7TAAA 1J8HA 3F85A 1FZMA 1KT2A 5B38B 3WTTA 4KKCD 4IIZA 1ZA3A 1SEBB 4HUNB 3QG6B 1F13A 1HHIA 1F5WA 2HXAA 4XPHH 3ARBB 3M7FB 4Q9BA 1PLBA 3U6XA 5DC0A 5ISZE 2MQGA 2ZF8A 3E0GA 1TZHA 1N4XL 5SWZD 2FT8A 4PJ9C 4M43H 5A2KH 3NN8B 3PL6A 4X6DB 5FUZH 1LP9E 4X6CB 1DVTA 5EBLA 4K8RL 1F1AA 4NN6B 4JPWL 4DAGL 3AB0C 2PP8A 3ULUD 2EDDA 2UYLB 1AQ8A 1WPCA 4LIQH 4HKZB 2YIHA 3KPQA 4N5ED 4Q9RL 5GGSB 3TCLB 2JVUA 3D50A 3GLEA 3IMTA 3GBMH 1HDMB 4LCCB 3PREA 3QZNA 1ILUA 4LLWA 3U36B 2OAAA 1OGPA 4YO0A 4QNPE 3RFZA 3SKUD 4L0PB 2CHDA 1I8LC 2B20A 1A9EB 3B4NA 4O9HH 4JLRB 4W9GC 5AVSB 3DHJA 3GUFA 3QT2A 4ZPVA 1MZZA 3QH3A 5DMIH 3TBYA 6TAAA 4HJ1A 2X41A 3EG9B 3EXJA 4Y4KA 4RRPA 1R3KB 1N5AA 5LUMA 4JGMA 2AJVH 2BRRH 4OCNC 1GW6A 2B14A 3U79A 2JXMA 3GF8A 4OQ1A 2ARJB 5FYLE 1CMOA 4YXLL 1INEH 1B9ZA 1NDGA 2RFXB 4ZFOB 3UJJL 3GSNB 5F3HA 5TH2A 3II2A 1HH9B 2QDVA 3Q3GA 2H6PA 3M8OL 2Y36H 1QQDB 1TR7A 1O5DT 3OKKB 4OBSA 4KITB 3O2VL 3GINA 5CCHE 1YC7A 5B8CC 2E9GA 5TQ0L 3UCRA 4CL7A 3G5VB 3KPSA 4KKAD 4OI8A 4AENB 2DEYX 1TU2A 4E9TA 1NPUA 4YX2L 1GJIA 2A2QT 1T21B 1WIOA 5IQLA 5B3SB 1JZIA 5DJYB 1SOQA 1XH0A 4NQDA 2O6FA 3U30C 2WMPA 4JHZA 1P69B 4AW4A 4BKLA 1SQ2N 3DHMA 4H26B 4HLZH 3I02A 4OQTH 3TO4B 1EJOL 1QSFD 5TJWK 2FWOB 1JHLL 2VAAB 4GUCA 5DQ9B 1J05B 4R96B 3HC3L 2Y5EA 4JFEB 5TDOB 3CNKA 4G7SB 2NXZD 4FYQA 5F88A 2VLRA 2NY0B 3FN0H 4JY4B 3V6OE 2BWDA 4OZIA 3QAQA 5EO9B 3UBXG 5DI8B 3MO1A 2P1YA 1GRWA 1R5WA 3ETBF 4H8WC 4DPCX 4ZD3H 3FPYA 2R2BB 1UB5A 3D2TA 2H0JA 3ZDYB 5F9AC 4EQ2A 5TE7H 4GSDH 4H44C 3N1PC 5HDRA 4Y5YA 3TWCH 4AGNA 2BVPA 2K6ZA 1BOYA 3HI6H 2WLJA 4HUXA 4GRWB 4KUZH 3T1WA 1Z32X 1IE4A 2FIRT 1DBAH 3O6LH 4A2LA 4X8JB 4NAMA 1SXBA 4Y7OC 1S7SA 5C0BB 2P80A 4IRSA 2DQUL 3ZMEA 2BJMH 1DVXA 4PTTA 3CBJB 5BRZD 2CALA 3T4AB 5F7WC 1JGLL 2VR3A 1KN4H 4G9FA 3B5HA 3HB3D 2ISDA 2XG5B 3VM7A 3L5WB 3A4EA 2XT1B 3V79C 3OJMB 4ZMLA 2MQCA 2VZUA 5HHNA 3KCPB 3LD8B 4N9GB 4QYOB 4DWHA 3AT9A 3GT6A 2WCSA 5FV2A 3GO1L 3BYYA 4LSTL 1MNUH 3ARBC 3ALWA 5HI5C 3NK4A 1XD1A 1FL5A 4J8RA 2CPUA 4IRJC 1X6NA 2XBDA 1XSOA 3OB0H 1HXKA 5FHAL 1E9OB 3ZQ9A 3BUQA 5KVDE 4LVEA 4GYBA 5GS0L 1JCVA 4ZW3A 4WW2F 1HI6B 4HF5H 2A4EA 3P73B 4JM2C 4AJVA 3HG1B 2QQNH 5FX3A 3L3HA 3QHFH 1D6EB 2J1XA 4R90H 5FKPB 4QRPE 5SWSA 3GSQB 2E7BA 5DD6A 3WMSA 2JQZA 2QSQA 1BD2E 3D30A 4LCCC 5AVTB 5D2LE 4F27A 1GMIA 4HAFA 3WSQL 3J07A 1L6PA 2YK1H 5FO8B 5KZCD 4UAHA 5KYYB 4DCQA 1FNGA 1NMBL 5JHLA 3NOIA 1VGKA 3ZKQD 3Q43A 1B4LA 5HHPA 4Z7NF 4QHPA 1VCAA 2EICA 1MRDL 3MRQA 3S5LA 4DFIA 1AHMA 3CU7A 4KKRA 3ARTA 4JFPB 2LQRA 4OVUA 4FXKB 3FUIA 4Z1PA 4RMVA 5HDWA 5I1DB 3DXAA 2ZCHL 2BS8A 5E2WH 2QHLA 4G6AD 3SDDB 5I24A 4YK4C 3MFFB 3L3KB 3RNQB 3M1CA 3VXNB 2FBRA 3TT3L 4QEGA 2AJXH 2Y4SA 4QXUH 3OB0K 3MYJA 3ZT7A 4H8HA 1FPTH 2BNRA 3IPEA 1NLDH 2K8QA 4OCSH 3SQBA 4KQ3L 1V8HA 2Q7YB 2IAMD 4DQAA 3QIBB 5DS8B 5IBTH 4FLHA 5IMOA 3FRPB 3HI1B 2HPTA 4A55A 1FG9C