1TFPA

Transthyretin (formerly known as prealbumin)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
CPLMVKVLDAVRGSPAANVAVKVFKKAADGTWQDFATGKTTEFGEIHELTTEEQFVEGVYRVEFDTSSYWKGLGLSPFHEYADVVFTANDSGHRHYTIAALLSPFSYSTTAVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSTHYRETIN
publication title The crystal structure of transthyretin from chicken.
pubmed doi rcsb
molecule tags Transport (thyroxine)
total genus 21
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 1tfpA00
5EN3A 2F7IA 3DO4A 3IWVA 3Q1EA 4Y9EA 1BZEA 4PWHA 5DEJA 2TRYA 2G3XA 3FC8A 4IK7A 1ICTA 3CXFA 1DVUA 5AKVA 1E3FA 5AYTA 5L4IA 3DGDA 3P3UA 1DVXA 4PWKA 2B77A 4TLUA 4TQHA 5FO2A 2GABA 4YDMA 3KGUA 3QVAA 3IMUA 4ABUA 1E4HA 4IKLA 1TFPA 3GPSA 4TKWA 4WNSA 4QYAA 3GLZA 1BZDA 4ABWA 2ROYA 2G2NA 2TRHA 3HJ0A 3DIDA 4PVNA 1TTAA 4FI7A 1X7SA 3A4EA 3NEEA 4PM1A 3CFTA 2QGBA 1KGJA 2G4EA 4TL4A 1SN0A 1THCA 4HJTA 4L1TA 5FW7A 1ETB1 3M1OA 4PWGA 1SOKA 4TNFA 1U21A 4DEUA 3W3BA 1FHNA 1E5AA 1QABA 2QGCA 4TLTA 4ANKA 5CM1A 4MASA 4TQIA 1TTBA 2H1XA 4N85A 5CLXA 4I87A 2H6UA 3CFQA 3FCBA 4Y9CA 4ABVA 2B14A 1TSHA 1BMZA 2FLMA 5CN3A 2GPZA 4IKKA 1TZ8A 3BSZA 4HJUA 4Q14A 1F86A 4PVMA 4L1SA 1SOQA 3IMVA 3TFBA 1IJNA 2B16A 4DEWA 5BOJA 4TNGA 5HJGA 3P3TA 4DESA 3OZKA 3NG5A 4PWJA 1BZ8A 1ETA1 3KGTA 5JIMA 3IMSA 1QWHA 1Y1DA 3ESNA 4HISA 2F8IA 2IGLA 5L4JA 4TL5A 5TTRA 2B9AA 3U2JA 5L4MA 1TTCA 3KGSA 3CN3A 4IKIA 4IKJA 3CN2A 3GS0A 1TLMA 3A4DA 5CLZA 4WO0A 4YDNA 4PWIA 2G5UA 3CN4A 3U2IA 1X7TA 1ZCRA 1IIIA 3CBRA 3DK0A 4TLSA 5E23A 2G4GA 3SSGA 3IMTA 1FH2A 1KGIA 5CLYA 1G1OA 4PMEA 4N87A 3GRGA 4TLKA 5AL0A 4DETA 2WQAA 1IE4A 3ESOA 5CNHA 2H4EA 2G3ZA 1DVZA 3A4FA 3CN1A 3NESA 4PMFA 4HJSA 5L4FA 1DVQA 2QGEA 3DJZA 4HIQA 2FBRA 5FW6A 2H0JA 4FI8A 4FI6A 1SN2A 3GRBA 3IWUA 3CFMA 3D2TA 4TQPA 5CR1A 5A6IA 3NEXA 4I89A 4DERA 2ROXA 1F41A 2B15A 2QPFA 3ESPA 4IK6A 4WNJA 5AL8A 4TQ8A 3P3SA 2QELA 5E4AA 4ABQA 3B56A 3DJSA 3IMRA 1THAA 3DJTA 4ACTA 2H0FA 5AKSA 4D7BA 4AC2A 4Y9BA 3TCTA 1OO2A 4QRFA 5DWPA 3GS4A 5FW8A 5JIQA 3BT0A 1IIKA 2G2PA 2QGDA 4I85A 1DVYA 1TTRA 4Y9FA 5IHHA 1BM7A 4IIZA 1TT6A 4MRCA 1RLBA 3DK2A 5JIDA 3I9IA 1DVSA 1GKOA 3P3RA 3IPEA 1GKEA 3I9AA 3I9PA 4KY2A 4N86A 2G9KA 4MRBA 4PWEA 1Z7JA 1ZD6A 5K1JA 1TYRA 3D7PA 1DVTA 3DJRA 3CN0A 4PVLA 4PWFA 4AC4A 3OZLA 2PABA 4QXVA 4Y9GA 5AKTA 5E4OA 3GS7A 3CFNA 3NEOA 3IMWA 5EZPA 3IPBA 2NOYA 4TM9A 2H0EA 4TNEA 1SN5A 5K1NA
chains in the Genus database with same CATH superfamily
4MD0A 5T5FL 4HHWA 3CH1B 2AXFB 3K81A 4Q2ZB 3ME0A 3MRIA 2WBJC 1PEWA 3ROLA 3GPSA 4WW2C 4AJ0A 3GLZA 5E5UB 3BLPX 2IFFL 2KUTA 1DVFD 4HFWA 5EEUA 4MGXA 2EE6A 3BPNC 4JFEB 4WWKB 2K1MA 4L37A 3DXAE 1ETB1 1M56B 3EF7A 2YGQA 5A3ID 3B1UA 4XCFH 4U0QB 2BWIA 2MCG1 4ZSOB 4EQ2A 4IRZL 1Y0LB 3D69B 3FSZA 1PZAA 4QHLA 1V3JA 2KZBA 1P5UB 4NLHA 3S5LB 4WUUA 4XMKH 4MLSA 2NTSP 3A4AA 1J1XL 1G0DA 4HEMA 4M56A 1FG9C 1QLEB 5JW5B 2YOAA 1FNEA 2ENQA 2EXWC 4JY6A 2F53E 3ILQD 4ELMB 2IH8A 1HN1A 3LTVA 4MCZB 1I9JH 2ZPKL 2R4SH 3KPPA 3PF2A 1WD9A 2FIKA 3VWKA 1QSFB 5IVZB 4PJ9A 3ZR5A 1HCVA 3FRUA 5L4MA 2Z34A 1AVAA 3O6MH 3MX0B 1AFVH 2VM4A 3HBQA 3SKNB 4BE6A 3RX9A 3UTQB 3SOBH 3W0WB 5FGBA 4U1SB 3GSOA 5C0JA 1VKXA 4FQPA 4PQXA 4UT6L 4FQIH 1X5HA 1MVUA 1TTFA 2LHAA 2VERA 4AVIA 3NZHL 3SBWA 3MV8D 4H8WL 2R15A 3DRTA 1SN2A 3AWFA 4LHJB 3RWJA 2VKXA 5SWSB 1OQOA 2CLZB 2GY5A 2X4QA 1G7MA 3FB7B 4N8PA 4UDTA 3C87A 5ECJE 3TOPA 2AJUL 1B9KA 4P23D 4QI3A 3K5SA 4JFVA 1BIIB 3BWUC 4IS6B 3IU4L 3E3QE 4JE4B 3ZHFA 4K7PX 1VGEL 4NAMA 2W91A 5GGRA 3V4PH 1T1XB 1S9WB 2VW6A 4I85A 1T3FA 2EO9A 1PX3A 2R2EB 1F6AA 3WJLA 3S4SB 4DN3H 1UB5A 1BQRA 2ADFL 2OJZL 4U1MB 1JZJA 1SDYA 2L7EA 5LJYH 4JFTA 5IQ7H 4IIQC 5INCB 2GYSA 4PRIE 3VA2C 3O4LD 3FB6A 3MYZA 1E4XH 5ADOH 2J2ZB 4PGCB 3KYKL 3AMLA 4BFIB 3CZJA 3EHBC 2FTAA 3GK8L 4M8QA 3ZTJG 1QFWM 3EFOA 1L4IA 4N20A 4OLWH 4PRPB 2IPTH 3D5OF 4ATTA 3D39D 1HESA 4ZO8A 3WN5B 3JWOH 1K2DA 3IJYB 1PLGH 1USQA 2RGSA 2Z0UA 2FJFA 4P2AA 4GG6B 2NY6D 1OZUA 4DUVA 3MNDA 5FO2A 4XNQA 2ARJB 4PB0H 4PAZA 4KY1L 2F61A 4JGJA 4JKMA 1JPGB 2AANA 4QNPE 4ZFOL 4CNIA 2CO7A 3ZDXB 4F37F 2H5UA 3DTUB 3VXNB 1MCOL 2F9BT 2FJUB 1D3CA 1ZGLA 5JQIB 3VXRB 4OZGF 3GMPA 2BS9A 4PYHA 2OMZA 5DD6A 5FF6A 4ZUTA 4FGMA 4D0DA 3RVVC 4DNLA 4PBVC 4P99A 1OSZB 5CILL 3KYNB 3EDEA 4TS6A 3K5RA 5HGGS 1WA0X 1IJNA 3LZLA 2DKMA 1ITCA 1JRHI 4AUUA 5HI5D 4U6VH 1SUJA 5CFAA 1WVZA 2HFFB 2IGLA 3V0VA 1X6LA 2DLHA 2FJHA 3QFJA 2OKMA 5JYMA 4NJAH 2VXQA 3FHAA 3DGGB 5IFJB 4EN3C 1S3KH 1LE9B 3APFA 1DLHA 2FLBT 2DN7A 1JL8A 1XCTA 3D85D 4NZUH 5GS3A 4WSGA 2ILLA 3ETBF 3V0EA 3A6CL 1KYOJ 1RMFL 2BP5M 2I25N 4D9LH 1A7OH 2CKBH 3MV9A 1JHLH 3VQMA 2H41A 2LV4A 5AVXB 4BH8B 2CRYA 4LQ1A 1KT2A 5L4FA 2QGEA 2X4TB 4LVHB 4X6DA 1KFGA 3LS4H 3KPSB 1VENA 3WN6A 4MXWH 3SE9L 4HJ1A 4JM2A 1A0QL 2IAMB 5E9NA 2N3JA 3AG4B 4F5CE 1IM3D 3JQOB 3NJGA 5MERA 2G5RA 2YBRB 5EEVA 4GP5B 3DIFB 5SX4H 3FT2A 4JPWL 4N0UB 3IKCA 5MEPA 2WTRA 1QSEA 5EF1A 1NCHA 4F1ZA 2IOOA 1JZ3A 3GS4A 4X6BA 4BK8A 1ZSDA 2Y2TA 2YFOA 3L81A 3U7WH 2WSKA 5CGMA 1T4KA 3NGBC 5ETUA 1JPSL 4S2SB 1U8IA 3FAWA 4CU7A 1HSAA 3M88A 3OR6A 4GY4A 3JTTB 3PE9A 4OKDA 4Y5YB 5I1EL 3IETB 4HYTB 4V2BA 4ZPVB 4RFNC 2YXMA 2I07A 4RGNE 1RZJL 1SFDA 5IMLA 4M29A 4FJYA 3QUXD 4GBXB 5A7EA 5KBMA 4WGKA 1ZLVK 3VWJB 1SYSB 1SN5A 3D0LB 4OZHA 2NLJB 5CD5C 3FQXB 3SGKA 1ZT4A 2DIJA 4O2FA 4BXVA 4I1RA 4X4XA 1KJ3L 4HC1A 4KHXH 4M8UA 1BG9A 3I74A 3KBEA 1HAUA 2ROYA 3BN3B 5F8RC 1SJMA 1RUPH 4RGMB 2NXYC 3HG1E 1THCA 1G9NC 3E7JA 2NXZC 3O9WD 4P5MB 2VDOB 3V9EA 1NIBA 3D0VA 4UQAA 2B4CC 4JFZL 1LO4H 5CD3B 1AGBB 2Z91A 5EO0B 2OYLA 5FYJH 3E0GA 5J11B 4H8UA 2UWEB 1L6XA 3QULA 3UDWA 2IPKB 4KMLB 2WXMA 3RUGB 2EINB 2F74B 3BH4A 4IQHA 2XQ0A 4UZSA 4EI6A 2HT2C 3QCVL 4Q6IB 4KV5F 4WW2F 4Y4FC 3CX5J 1X9RA 2PPEA 2VN6A 5DYOB 3V4UH 4KH2A 1CFNA 1MAKA 3GMLA 4P3DA 3QO0A 5BOPA 2NY4B 4TV3A 2HKFL 1E7VA 5HGDB 4EKJA 1HJCA 1BHGA 4MVBC 3QQ3A 5HYQB 4ODSL 3A67L 3CFEA 5KSBB 3MLWH 2EDEA 4C59B 2X0WA 4LSRL 1A14L 2AK1H 2CIKB 1LQBC 1NOLA 3VD1A 4HIXL 3VYOA 2NY7L 2GG1A 1EJ6A 5D1XB 3SODB 1J9TA 4ZPTB 1UZ6E 3S2CA 4W9FC 3AY4A 3KLAB 1KIPB 4DEPC 4AENB 4UT9H 4AZ8B 3IJ7A 5DRNA 4FQXB 1EXUB 2PETA 5B3SB 2P7TB 4OH2A 1B90A 5FA3B 4NUPA 3T65B 4PTUB 4NO5B 3OKEB 4FKEA 1A6UL 2X09A 2YAFA 1I4FB 1IT9L 2W8CA 2Z0BA 3GUFA 1YMHA 3HG4A 1I7ZA 1QWNA 2P24B 3TTYA 1AD0B 2E5EA 43CAA 3CQPA 3D0AA 5D2NA 4MCNA 1S7RA 2D3JA 3VXOB 2QQQA 5LBGA 3TZVD 2H45A 4B0MM 1OCRB 1XEDA 3BN9D 1KB9K 1UKSA 2OR9L 1HQ4A 2DAVA 1I8IB 4R83A 4E41B 1F4XH 2ZE0A 3DJRA 4E9SA 1A6AA 4MNHA 3KPRD 5KW9H 5D71L 3SDXA 1FIEA 4IKNA 1FDLH 3BJLA 2BNRD 3ECVA 3CVHB 3LKPB 3LZPA 12E8L 1GTNA 3I84A 4KK5D 4Z7NE 3HR5A 4CW1A 5DJ6B 3ZE1B 4Y2OA 1YNKH 1LNUA 3L5JA 5DC9B 3RLSA 5L8LB 4KK9C 2H7WA 4JFOB 2X6AA 5AD0B 4JCLA 1LXMA 5AVSB 1XH0A 2NT1A 3D3VE 3NPSB 2DPKA 2Q3ZA 1AHWC 2Y9RT 1JGLH 2XKUA 4HLZH 3BAEL 4HGWA 4I88A 2DYPD 3IFOB 5AW8B 3S48A 4DP2X 2V7NB 1NBVL 4M7LT 3F58H 3O6FB 3Q48A 5DD1H 5H37H 3WV0A 4HWBA 5IGXL 4ZFZA 3TBVB 3SDAB 2H1XA 1AY1L 4N85A 2DY2A 2JQZA 5ERWB 1KXTA 3PWPA 3QJTB 4AEIH 1VEPA 3TA3A 4DKTA 3B7TA 2N0KA 2VL5B 4MQ7A 3RNQA 2VE6A 1CFTB 3LQAL 3R4DA 4HWUA 4J4PC 3E1F1 3KGTA 2XWZA 1CXHA 1CZ8L 2Z93A 4HH9B 4LRNL 4GAGH 5E4IA 2ZXGA 3CVDA 3NACL 1EANA 3RL2B 5B8CA 3GI8H 3BKCH 3RPBA 1L0XA 5EBWA 3FQ2A 3MA9H 3IM1A 3U2IA 3B2MA 2VTFA 3ATBA 4OVUA 3VDBA 4PGBB 2RHEA 1BJMA 2AMUA 1DO6A 1KGCD 3Q2LA 5DUBB 1H0DB 3RAJL 1G7PA 4IU2A 4MB5A 4KKAD 4Y7OC 4U3SB 3DJZA 2GUYA 2NR6C 3BMWA 2AJ3A 2ALAA 4KI5D 4F9LC 1JRHH 5AVTB 4KQ0A 3V0WL 2EEBA 3S96B 3PP4L 3LX9A 3ABGA 4P9HL 4Q0XL 2JJWA 5HDBF 4GKLA 3MV11 1JYVA 5D7LD 5DLLA 3VD3A 4D7PA 4OJYA 4R2GB 4FC3E 4GUPA 4PY7B 1UWEL 2FT6A 2G3MA 3IFPB 1MG3C 1JWMB 2HXAA 2YXFA 2MMXA 3BWAB 4GO8A 4JR9L 3QI9D 4DGIH 2D2OA 2EEDA 5F0MB 5TF1L 5EOCL 5BV7L 3SE4A 3B4NA 3QZBA 4R8WH 2L4OA 2FT7A 1JZ6A 1NGZB 5FUCE 3DOIA 2CK2A 3UJIH 4GS7B 3QEGH 5BZZA 2FR4A 5JXEA 5J12C 3AQXA 2FD6L 3GSWB 3SQBA 2VMJA 3LZNA 3P77A 3O6KH 4U6HB 1CR9H 1Q94A 4WI6A 4RFOL 3UZQA 3SJVA 3MUY1 3SO3C 1BMGA 1BZEA 5EBLA 4XOCA 4AL8C 2ZX8A 1IC5L 3BE1L 3SZ6A 2D3NA 2Z31C 3OG4B 3NRFA 4DOHB 2E9IA 1I9IH 1GPOL 3KGUA 4XO8A 3CU1A 4OI8A 1YUKB 4GLRI 2X9YA 2ODHA 3MJGX 4P5TC 3JZYA 1GC1H 3CFIC 4I48B 1D6VL 1SM3H 2WVVB 3HC0B 2RQ8A 3QDMD 1B0GB 2VLKE 1KLGB 2A6JA 4OZFH 5TGBB 2W0KA 3ULUC 5E08H 2ZCLH 1RULL 1W91A 4Q9QL 3QORA 4LCWB 1LO5A 4M3HA 3OHXA 2XN2A 3GNML 1WZ1H 5F88A 3P9MB 4Y9CA 1Y0LA 4KAQL 4OFYD 2C9VA 2HPOA 1NFDF 1P5UA 5BNXD 1RURH 2FX9H 3IF1A 4DEWA 1P9MA 1YY8B 2CBMA 2DS4A 2PR9A 5J13B 1KXVA 4M93B 3DV6B 4U6YA 2NDGA 3L9EA 3OZKA 1OOAA 3AXIA 4BHUI 4NNXB 4JCWA 1X9UA 3SYOA 5JW5A 1Q9OB 4Y7MA 5K69A 1OP4A 3KPNB 1AOZA 3DVGB 5IESH 2UY6B 3LEXA 2IAAC 1KC5H 4IRJB 4NUQA 1A8ZA 3BFOA 5LWYL 4YS4A 1QSFA 5FYKU 1H3GA 2EIZB 1G7JB 3VXUD 2AJXH 1KGXA 2EE0A 4XPTL 3UC2A 1FLTX 5D72L 3UTQA 3S8FB 4IMKA 1QO3B 1YMMB 3MV8E 3W0WA 3OMNB 2WXQA 3S37L 4HJSA 5EO1B 1QLEL 4UTAA 5SWZB 1BQHG 3GUTB 3NIDB 1YY9D 4KXZH 5EH1A 5GHWH 3F7KA 4OSUH 5JHMA 2P28B 3V6BR 3A5VA 1IX2A 3L7FA 5G4NA 2HG5A 5CSBA 1Y18B 2HFEB 3FB7A 4DJMA 4PJ7E 2DM3A 3VFMB 1BFOA 1BIIA 2HKHH 3GBEA 3SKMB 4PB9L 4PREB 2PPAA 2Q6WB 5J6HA 5B3NA 4GH7B 1TVHB 1YCSA 2VH5H 4KI1A 2DI8A 4MZ2A 1L9TA 4YDVB 3W57A 1S9WA 1HYSC 3P4MB 4NBXB 4ZMXA 2UZYA 5K9QI 4ZW3A 4C56E 4I2XB 1A7RH 4LRIC 3JV6A 4U1MA 1LEGA 4Z95H 5TH2B 5ACZB 2DLIA 1U42A 4G2AA 3T6QC 4KNQA 4DP6X 5FPIA 2HX7A 4B41A 3UL4A 5EZPA 3S6CA 1G9MH 2QZ5A 1F42A 3EOTH 3F6JA 4QRRD 4BFIA 5GS1B 4MHHI 5EA0H 3S3DB 6PAZA 2WLNA 1UWGL 3ALPA 1AGEB 4NNPL 4NO2B 4K94C 5AWNH 2Y7NA 5B22A 2WZ6A 1SY6H 3IJYA 3IJSA 1L7TL 4NGHH 1B4RA 1DQJB 3RE0A 2UZXB 5JUEL 5KS9B 2YKLH 2ZKHL 1PKQB 2CJUH 3JWDL 2ARJA 4KK8C 3CSYB 4YUEL 5BW7A 3MRHA 1MFBH 4LSUL 2HX9A 3RFZC 4K2UH 5CS7A 4BCZA 2BP0B 3PPEA 1QTYT 1FF5A 5DR5L 3K8MA 2VXVH 3WY2A 5CP3A 2CLVB 1X9LA 2QHRH 2GTWB 1UYWH 4AYSA 1SMAA 3INOA 2ZSWB 3VXRA 1WDAA 1HL8A 2J4WH 1UA6H 4HVBA 1BBJB 3CJJA 5DJXA 4AYDC 4R7DB 1PD1A 1OSZA 1RUAH 4EAEA 3V2AR 2VRQA 2X70B 3WKNA 2C1PB 2C1OB 4EN3D 1OGTB 1J9CT 3UTTD 2N1TE 3VYNA 4Q6KA 1CFMA 1QYGL 5L2KE 4OGXL 4PP1D 2VC2B 3TV3H 1W72L 1O7VA 4K3HA 1BW8A 1PGRB 4ZDHB 4OZIF 5IFJA 1LE9A 1RK0A 2P5EA 2F7OA 3QGVA 4FERA 4HFUL 3DHMA 4NZRH 4H2CA 4BK5C 3CE1A 2CHZA 1NUFA 4F92B 4CAGA 3B2DC 1W8EA 1NLBL 4BBWA 4EI5D 3MFFB 2VIRB 3KHQA 3VXPB 2A9BA 2VWEC 1TJXA 2X4TA 4B27A 1A5FH 5IBTL 1I9RL 1RIHL 2KS0A 3QDGD 1FAIL 5E9AA 4MS8C 4JFDB 2OM5A 2IAMA 5T1LD 2F8OA 2ZAGA 4JFYB 4RMTA 4YN3A 3C6LC 5IBUG 2FHCA 1U8KA 1BAFL 1KFAH 3BD5A 3G6DL 3T2QA 3KBHE 1SHWA 4NP9A 4P2RB 3CZLA 1E9PB 3GMRB 3KBFA 3QUZC 4LL4A 5HY9B 2VXUH 4ODTH 5EUOE 4JKPL 4JUSA 1HKLH 3GFUA 1AIFB 1SRDA 4Z18A 3UZVB 1T20B 2DQCH 3K46A 3VXSA 2XOTA 3WLBB 3LN5B 3JTTA 4WTZA 2ED9A 3LDBB 4Y5YA 1NGQL 2O6DA 1AJ7H 2PR4L 1F56A 3MGTB 4HWZB 3OQ3B 4WDIB 3DO4A 1GYCA 3GHEH 1MW2A 2ED6A 3DTDA 4GBXA 4XBPB 5ICUA 3PUCA 1SYSA 5IM7B 1LGVA 2ZP8A 1RIUL 2NLJA 1W16A 5AG9A 3FQXA 3QVAA 1CLCA 4OFQA 2ED7A 2NXYD 4PS8A 1V7NH 3H7LA 4MJ6A 1BBDH 2NXZD 4UUJB 4QT5B 3TT1H 4OQ1A 1U9KA 4IYKA 1AGDB 3PHSA 1MJUH 4P4KB 4HW6A 4L48A 1J05A 3ZE2F 5D7IF 1UCBL 2E47A 2KZ1B 3L5XH 3U48A 2Y5EA 2ZWKA 4ZTPH 2L8AA 4JDVB 4ZW7A 2IGTA 3TBWB 2X4PB 4PJDE 3BKYH 3Q8CA 4P5MA 1NMAL 3N0PB 4LHUB 5CD3A 3VWKC 1J0KA 1AGBA 4PJ9C 5EO0A 1ITBB 3OM3B 3FKUS 2UWEA 3NH7L 4FQLL 2B9BA 2IPKA 2WQXA 4N1CA 5F9OH 2DV6A 1AKJA 3RUGA 2F74A 3P2DA 4MVBD 1ZWIA 1E4KA 1CUOA 1RUML 5L7XL 4M61B 5DUPL 1AQMA 1FG2A 4U3XA 1A1MB 4YHLL 5IFHH 4RSYA 1UD2A 3BVXA 5IB5B 3ULUF 2XA8L 2VDOL 3SBWC 1EEYB 3TF7C 5CR8A 1M1SA 3ZTNH 3L4VA 5KSBA 2CBOA 4E9TA 4Z7QB 2OMXA 1N8OE 1YEFL 3BVDB 2ESVB 1CF8H 2GJ6B 1UXSB 1ZV2A 4HOWA 5D1XA 2FWUA 2M26A 5I0DA 2AMGA 3QB7C 3QUMH 2A9NH 4ZPTA 1AYOA 3WO4C 4P9MH 2NNFA 1JWSB 1SJEB 1H3TA 3O3DB 5LGHH 1XFPA 1KCWA 1AD9B 3UBGA 5F93C 3GXIA 3CSTA 3KCPA 4FQXA 1EXUA 2XI9A 4UV4H 1YPZB 3MV7A 1OGAE 2HP4A 3I9GH 1YECL 5FA3A 3WJLC 2NDFA 3GM8A 4LEEA 3OKEA 4OLUL 4Y9BA 1MWAB 2EEAA 4ZXBA 1FPTH 1NFKA 4H26A 3ULSA 1GGBH 3MA7B 1DVYA 5TPWH 1P4UA 3AM8A 2P24A 1C08A 3QQNA 4KQ3L 4MAZA 1NKRA 5D93C 1AD0A 1QNZH 4RMSA 3ZQXA 4D3CH 2QZQA 3OXRA 3TU6A 1EUUA 1SEQL 3KPRE 1HH6A 1IU1A 2QKIB 3GQFA 1PZ5B 4PVLA 3CN0A 2XZQL 1QACA 5TDOB 5TDPB 4L29B 1G0XA 5LCVA 4EDXB 2QTEA 2BNRE 4LAQL 5CCJA 1E5CA 3WFEH 1DBMH 5I2IB 3D6GA 4JO1L 2DW5A 2ZP9A 3VGGA 1GGIH 4PJBE 4TQHA 1PNCA 5B39A 4G6AC 1GSKA 1MFAL 5MP6H 2C3VB 3PWVB 5H2BA 3KL0A 3LKPA 1KSRA 4HKJA 1SBSL 4WNSA 3GRWH 1JFQL 4ZMNA 2NY0D 5DJ6A 1C8PA 1KPRB 1TETL 4JFOA 1FE8H 5DQDH 2AVGA 2NT0A 4MKMA 1U21A 2VDRH 1OWWA 4LOFA 4PRNA 3QUHA 2J71A 4K73A 2QBWA 3B2XA 1H9DA 4H5SA 5JMOC 1SUHA 2GC4C 4N8VB 4POUB 5C08E 5CN3A 2GBVA 1TNNA 2YGPA 4TRPL 1CFQB 1H5BB 1UWXH 3JXAA 3MYJA 3TBVA 2VR7A 3FOMB 4UAHA 5TE4H 4UBDD 3UJTH 2OTUB 2ZUWA 4LEBA 3OJVC 4U6TA 2PWHA 3AC0A 2VL5A 4WFFD 4AQAB 4KJPD 1CFTA 4PU2A 3LKQB 4I8DA 4A39A 4NQSB 2XN1A 2A1WH 1KYFA 1MRDL 2PP9A 2DMKA 4AT6B 4KX8A 1PDKA 1WA2X 1AO7D 3MJ9L 3ZHKA 1KCUL 3RL2A 2MSPA 5DJDA 4OIIH 1A6VL 2YAOA 4ISVB 4ALAH 1KGCE 3AABA 4JREC 1A7QH 2NR6D 4HF5H 5IHUH 4PJFE 4JM2C 1MCWW 2CR6A 3VG0L 4PGBA 4P04A 1EZSA 1U8CB 2O6FA 1KIRB 2PW2B 2AQPA 3DRQB 3KD4A 5EU4A 3EYFB 3NFSL 4AW7A 4UM8B 3ARGA 1K4DB 5BQ7B 5D7LE 3MRJB 1JZ2A 2KMWA 1FGNH 1A4AA 3S96A 2ZXDA 4AKQA 1SZNA 3FN0H 2DQEH 3GJFH 3DKHA 1BIHA 5E2VL 4G8GD 4F7CB 1NLDL 2FQDA 2EYRB 2B1HL 3DYPA 4Z7UF 1F4WH 5EF3A 2C7UA 2G2PA 4JO3H 4PY7A 1JWMA 4F15C 2A74A 2BNQA 3EDDA 4LO9A 4DP1X 2J21A 3TNMB 1AXSA 2P8PA 4C57C 2ZXBA 1MDTA 1WAAF 5IEKA 1A3RL 1KTJA 2OXHB 3ESUF 4HXAH 3EGDB 4KPHL 1NGZA 1AXIB 3K6FA 3SGKC 2XWJB 2GUOB 1EDHA 3DARA 1M3JA 1MH5A 2AEQL 4PRHB 1LMIA 3VACA 2BHFA 4CADA 2RFXB 1JGUH 4M3KB 1MIMH 3DVNA 1EEQA 3GB7B 2FJSA 4NQEE 5T1DL 4W9DC 5B7EA 3U4BL 4NN7C 5L4IA 3FTVA 3QIUD 1B4JH 3MRKB 4WGVB 2GY7B 1N7ML 1XGQA 5I5MA 1W8OA 1J1PL 1JF1A 1CGWA 3MKGA 1AZRA 4MA7L 3V5KA 4UQ3B 4JG0L 2IALB 1BAGA 4XWGL 1CVRA 3TCLA 4BKSC 2DF3A 4WK4B 4QJ5B 3FT1A 3WFBL 2VZ3A 3HBGA 3UDWC 2HLFC 5E7FA 3KJ4C 3G5YB 4QOKD 4I48A 1TJGH 2FUTA 2WVVA 3NTCL 4GEIA 5AOKA 3C09C 4XMLL 1KLGA 1JS4A 1U2CA 2FYYB 1KCRL 1UACL 5DA0B 5DD0H 3DGCR 4FQCH 2JI1A 1AQ8A 4JDZA 4XP1H 3F7QA 4NN5C 1VA9A 3QRBA 2OYMA 2P8MA 4PGDB 4PUBH 1PG7W 3RKDC 3TWYA 3P9MA 3PFUA 4LE8A 1M42A 1OAQL 4CJ0A 3QUYD 4NIYE 4AM0B 2R69H 1YY8A 1RIVL 2DKSA 2NZ1A 4LU5L 4RAUB 5F0PB 3DV6A 5GS0L 2X2JA 5DHXB 3LH2L 1QFUL 2K45A 4IKIA 4NNXA 3SCMB 1IVTA 1AYRA 1QG3A 2AJZB 4PPTA 1YQ2A 3HE6B 4HS8L 1NWOA 3KPNA 3DVGA 1M9SA 2YRPA 3AY4C 4ODHH 5E23A 3TS8A 2UV3A 1W6WA 3QWRA 4H4NA 2R7EA 2BOBA 3U7AA 5AOMA 2A7BA 5IB4B 3HI5H 4WRLA 2EIZA 3N85H 1G7JA 1V27A 2JI3A 1SDDA 1WFNA 1YNLH 5FLUA 1V10A 2JKXA 4FDWA 4TQEL 1WWAX 4FXTA 4WEBL 3P4LA 5ID1B 1QO3A 1OPGL 4PI0A 1QLFA 1I8AA 2VMEA 3BH9B 1Q1JH 4U49A 1E8WA 2XQYK 4XPHH 3GUTA 3QIBA 3EOBB 2X4RB 3P3SA 4MQXD 1FNAA 3C2AH 2VDQH 5D2NC 4NP4H 3N2JA 4M1GH 5FM5M 5CJQH 3QA3A 4HS3B 1KGUA 4RGOH 4V1DB 1CD8A 3BT0A 4F8QA 1T7VA 3KHOA 4GSDH 4I3RH 3VFMA 3C5JA 3SKMA 4PREA 1RV6X 1U8HB 3VM7A 3X3FL 4QXGL 2Q6WA 4AL8L 2XY1A 4PV1C 5F1IB 1TVHA 2BC4B 2RD0A 4YDVA 3V95A 4Z7WB 1X44A 4FHKA 2WMPB 4N25A 3V9CA 2D7TL 2NUPA 3MRPA 4U1NB 2VDKH 4ZUWB 2GFBA 4M02A 3DYMA 4JFWA 1MFCH 4JFFA 4I2XA 1BQSA 4ZMAT 3WTUA 2XACC 4R90L 1WEJL 1EDQA 2Q87A 4QRRE 5CCHE 5TH2A 1ZIBA 5AKRA 4N2MA 4E9VA 4N4YB 5JOFB 1TZGH 1JZ5A 4NRZA 4OCSH 2G3XA 2X42A 4NKIL 3ULUL 3DXAB 3C5ZA 2W81C 1MQKH 1XZ0B 1IGFH 1SQ2N 3S36L 2ICWJ 4FCAA 4MJID 1MHEB 3OAUH 4KK8D 4W9CC 3E2HB 2E4TA 4TSAH 1AGEA 4NO2A 1F3DJ 5CN2A 25C8H 5CKAA 3H9HB 3EF4A 2V8MA 1UM5L 5AB1A 2IQ9L 1V8HA 1INEH 2IPUG 3IRPX 4BUHA 3FMGH 3V4VL 3TA3C 2F53B 1HZLA 3CSYA 4IEFA 4O51B 2DD8H 1QABA 2C9UA 2DBLL 2BP0A 1SJHA 5K9KB 1TIUA 1ZIAA 1MLCB 1YNTA 5C71A 2CLVA 3E80A 4DAGH 2GTWA 3LHPL 1T1ZA 2WCSA 3RKPA 5B8CC 1HHKA 2ZSWA 1A64A 3H2QA 2WXPA 1CICB 2F1AA 3QQ4A 4XPAH 1BBJA 4K71B 2X9WA 2MOGA 4OZ4B 5EMYA 2C1OA 2WVTA 3S35H 1KB5B 1TEFA 4M1DL 1MLBA 5A2FA 2FZ3B 1K9TA 2XTJC 1M53A 3BVNA 3UAJA 4ELKB 2HVBA 3BD3A 2WB1A 1BD2B 1JUFB 5J5EA 3QS2A 3CDYA 4G6ML 1UM4H 3KE0A 4ZDHA 4JZJA 2ARJQ 2XJLA 4XNUL 1FYHB 1OAKH 2ZYSA 4NQDE 3KWUA 4Y1AD 3M07A 3H7BB 1U8MA 5IMKA 3D2TA 3M6DA 3AQYA 5ALBL 5F9JB 3FTGA 4F8LA 1ZS2A 3O2DH 3QDGE 3DSFH 4HJJH 4MS8D 1A9BB 4OGAD 5HDQL 1U41A 1J12A 1THAA 2VIRA 4P2QD 3C6LD 5AKSA 3APCA 3SE4C 2J12B 1OCOB 3EFDL 3NA4A 4PRIB 4O00A 4X6DF 2OV0A 4APQB 3O2VH 1MPAL 3ZK0A 3QG6A 1KG0B 5BS0E 3HS9A 1FORH 5IVXE 4KRPC 2CHXA 4K9EH 2ZD0A 4OM1L 5F3BB 5JXEC 4K3EH 3UP6A 4TOYL 1L7IH 5ICYA 3UBXI 3IK2A 3TEWA 1E9PA 3ZDYF 1A7PH 2XFGB 3T3PF 4JJOA 1GTFA 3K0YA 1S9VA 2WY3B 1AIFA 5FO9A 1R3JB 2O5ZL 4Y4KD 3WHE1 1XR8A 3WLBA 3LN5A 2GIMA 2CA3A 4KVCH 3P0VL 3L1OL 3U2SA 1UEMA 5IQ9B 1IRAY 3THML 4NNYA 3ARBB 1EO8H 4M3JA 5FYKL 3T3MF 3QYMA 5DVNA 3GLDA 4HWZA 4NQXB 4UTBL 2ZX9A 3H3PH 1P4LB 2K9FB 2P5WE 5MENB 4WUUD 4XBPA 5F6HI 5LGYA 4EUPB 1JK9A 4N0YL 1CYXA 1TQUA 3QORC 4OZHF 3OHXC 4TVPD 5DSCA 5BRZD 3H6AA 4UUJA 1OT1A 1UXMA 1P5UC 2I24N 3VB9A 3QR2A 1P9MC 4P4KA 3G04A 1CIDA 3VWKD 1KXVC 1X5LA 4G8FB 2J5WA 1UT9A 4H20H 5CCKL 3KM1A 3R1GH 4JDVA 2VJXA 3JUYA 2X4PA 5A43C 2PTTB 3DURA 3MLRH 4G7YH 4JHWL 4MA3A 4J6RL 3D48R 4LHUA 2IH9A 1KIUB 1MCSA 3TONA 3HNTH 4Z7AA 3TASA 3L3JA 4IMKC 3U46B 1DEEB 2W95A 4X0NA 5B39G 2EXSA 4M61A 4N0FB 4TUKL 1A1MA 2RBLA 4KKPA 4L8SB 1M2VB 4GIAA 1H6FA 2AJSH 5IB5A 4XCNB 4M43H 4N28A 3TYFB 1CBJA 2DQIL 4XE0A 1BSIA 2JCCE 4N90D 3FQRB 2PYEB 4YE4L 3OKDB 3EO9L 4HIIA 1G6RL 1GGTA 2V9QA 3MV01 2HMIC 5EU5A 2GJ6A 4FLQA 1EJOH 5K1VA 3KPQA 3DO7B 5GGUA 5DEZA 1JWSA 1SJEA 4GMSH 4S1QH 2E56A 1LE5B 3UBFA 1AD9A 2ZXAA 3AJ7A 3I50H 5EU3B 3VCLA 3BLKA 4J8RB 3FFCB 3RGVD 5EEZA 2CKBA 1D7BA 4JRYB 3U9WA 2BRRL 4PJCE 4RGNB 2V4LA 1FUNA 5ELIA 2MPVA 1LP9E 1RLBA 2ZUQB 4K7FB 4RA3A 4HK3N 2XN9D 5CWSB 3I6LD 1NCAL 5DO2C 2FECI 3K2UL 1FI8C 2EE9A 3SKJH 1ZE3C 1UATA 5IF0A 4R4BB 4GAYB 4DO5A 5C7XL 1G9HA 3L9RB 3DBXB 2YD6A 4FAAB 1XTLA 2OR8A 2FX8H 2X1OA 3HI6L 3T2NL 1J8HE 1NUNB 4MMXB 1CTNA 1PZ5A 3NAAL 5D7JB 4XC1L 3LXCA 1HIML 3S8GB 5EOCJ 3NJLA 5TDOA 4G6AD 5TDPA 4Y9EA 2Q8AH 2KDGA 4EPSA 1MWAL 2Y1ZA 4L29A 4L4VA 3B2VH 3HG1B 5BW7C 3ZL4L 3ZKXB 5I18L 1BG1A 1OP3H 3KR3L 4G7VL 1FV1B 4OCWH 3KPLB 4E36A 2Z7WA 3R0NA 1YEWA 5DD3L 2EZ0D 2YN5A 3CVCA 2C3VA 1RZGB 1VB9A 3GMMA 4R97B 2UUDK 2W80C 2NYYD 4GKSB 1LD9A 3VFSA 4K3DH 1J1OL 1V54B 3G5XA 4LSTL 5C97A 4LEXH 3QRFM 1SFHA 4M7JH 3ETBJ 5CLXA 5EOQL 3I75A 1SMDA 5FHAH 3BJ91 1NAMB 1ZK9A 1RUQL 5FOJA 4PP2B 3FU9A 4HUNB 3GSQB 4DIXA 4Z77B 5DVOA 1ZVNA 2BVUA 2CM5A 35C8L 3FU8A 4YGVA 4CL7A 5BUPA 1JD7A 1HE8A 1XT5A 2DM7A 1H5BA 4XVOA 2EDJA 3ARFB 3IEAA 1V7ML 3WIHL 5C07A 3ZYJA 1W9XA 1MEXH 5I19H 1JGEA 3T1WA 4AQAA 1Q72L 1R75A 3PNWB 4X50A 1X5YA 3CXHK 3OAZK 1U8NB 3LKQA 3TT3H 4NQSA 2WUBH 4EIBA 2K9UA 1MKFA 4AT6A 4JM2D 1MREH 1KCSH 1WH0A 1S9KC 3MLSL 4M03A 3UYRH 2W60B 5L6YH 3CQQA 3C08H 4ISVA 4Z7VF 3ROOA 5HHQB 3G6JE 3LD8C 1WS8A 4R9HA 2V5RA 2IAMC 3CFUA 4R7VA 4YPJA 3TIDA 4JW3A 3JWNE 1U8CA 1KIRA 2G9HB 3ESPA 5DJZB 3DRQA 5CINH 3EYFA 1U2YA 4NPJA 4UM8A 3IMRA 4AUYA 1U95B 4XP4L 1J8SA 1G6VK 2A6IB 1JPFB 1NCWH 1U58B 2YPLA 3V0GA 3BVUA 2YN3A 2YOCA 1L0QA 2EXYD 3LV3A 4HZ1A 4WU5A 3TF4A 3HCVA 1VERA 4IGBB 1AAJA 2EILB 3GEFA 4XPFL 1J11A 2BSTB 5D1QC 4Y5YC 2F2HA 3DX4A 3LOWA 4OTXH 4UT9A 2VQ4A 4UM9B 5DJCB 1FSKB 1TTUA 2PCPB 3X1BA 3TNMA 1T89A 1E6OL 2PABA 3FTSA 4GBXC 4NENB 4Z5RB 5CGBA 3AWEA 3ULVC 4O5LL 2GUOA 3D3VB 4CU8A 2PCXA 4JHZA 4HIHB 4NM8L 4PJAE 1YYLL 1QWUA 2DRUA 1ZTXL 4Y2DA 5HVHC 5HI3C 4RGMC 3RA7L 5C0IA 5K33A 1VFOA 4WTXA 2OA9A 4CVZB 5I24A 5T3XD 2R56H 4KNUA 3CFKA 4QOKE 2NNCA 4JBSA 1AG0A 1Q8MA 3SY0A 4JM4H 3HZVB 5AVWB 3TFKC 1WQVT 4ZFGH 1CTMA 4G11A 4N2NA 4U6XB 1KEGH 4WJKB 2J56A 3MACH 5DEGA 4FQJL 4IBSA 3RKDD 5KVEE 5E8EB 4LF3B 1AQHA 1E4KC 2Q2LA 2ZWLT 5HHNB 3ZPDA 3KXFA 4AMKL 3RPIB 3D18B 4BRVA 5IZ7A 1GHFH 1QMUA 2N7SA 4DKEL 4DVBB 2BVEA 4S11A 2XX0A 1E9QB 5I1IH 2OSWA 4X0KA 2XRAL 3EO1B 1RJLB 4WU7B 1D5ZB 4MNQD 4YK4B 4MBRA 2HVKB 5H37A 2AJZA 4DQOH 4YBQC 3HE6A 4TNVF 2BVTA 2XV3A 5I1DB 5CNHA 2IANB 4PV9B 3R8QA 1UM6L 2ZX5A 1JPEA 2V7HA 3HJEA 2LTQB 4NAQA 3S35X 1INDL 1NEZG 4FQXC 3FAXA 4FI6A 5IB4A 2CK0L 3PJLA 5HPMB 4UV7H 3KVQA 1HI6B 1RUKL 4ELDA 4ZXBC 5D7KD 1SF3A 1SVZA 1I7UB 1WHOA 4AEEA 3BH9A 4UU9B 4NC2B 3GTTA 1OP9A 3AM8C 3A6BL 1FRGL 2Y36H 3EOBA 4EOWH 3L4TA 3QJHB 4U1GB 5KJRL 4HS3A 2JB6B 4TUUA 3HLKA 1PMYA 3HI1A 3QRLA 4XB3A 4LKCB 4W93A 5F6HJ 2DMHA 3MODL 3UACA 2Q76A 4KY2A 1ZV5A 4JL1A 4LP8A 4OLYH 1Z3GH 5IJVB 3W37A 2HN7B 1DBAL 4P57A 4Z0XB 3EW3B 5F1IA 3GJFB 4JAMB 2BC4A 4HX1B 3VD7A 1KJVB 3ZR6A 4X6CE 4YZFE 4N9OB 4DTGL 2WMPA 4QKTA 4ZUWA 4WI4A 4EZLA 1RI8A 4H25B 4X5RA 4K8RC 3BAWA 2RR3A 3ILPB 4G8EB 5C86A 2CO3A 1D5XB 3HFFA 5EIQA 2VLKB 5JOFA 1DBBH 5IQLA 1IEHA 3GSXB 3QCTL 5IVNA 4KTEL 4X80L 1QPXA 4KVNL 3DXAA 4YSCA 2MRYA 1XZ0A 3VFWB 5JR1L 3RU8H 4HKBB 3S9DB 5DJ2B 3MKKA 3OZ9H 2OL3H 1OWRM 1Z9PA 3WNOA 1R0AH 3D25B 4G3YH 2VLJE 2W38A 1N6QH 5D55A 2J43A 2FQFA 1IBFA 3WD5H 3FO0L 4BCXA 2AXGB 4OD2A 1LO3L 1DJZA 1I9EA 1SEBA 5FYLD 4TSBH 1B0RB 3AU1A 2F53A 2AI0L 1VFMA 4H0GA 4O51A 4W9KC 2EDTA 1A4KB 4NBZB 5K9KA 5DZ9A 1GS7A 1MLCA 2ATPA 4X99A 2CDFA 2B7DT 4ODVL 3LMJL 1U92A 3U1SL 5JO5A 1AMYA 3G5VB 3BGAA 2BRQA 1RFDH 2XTJD 3CN3A 1MI5B 4JDEB 4OZFA 1F97A 1FFRA 3B6SB 1BOYA 3BMVA 3L3IB 4OZ4A 4NQQA 2HH0H 2N7BA 4ZFQA 5K59E 5KG9A 1OW0A 1UB6B 4LOVA 1FL5B 2XN0A 2XCMC 3NCYS 1TG8A 1NC4A 1TJHH 3ARGC 4Y1AE 2P80A 4EDWH 2BSDA 4GRMB 4ELKA 2BSEA 5ANHA 3SKUD 3VFRB 1BD2A 1JUFA 1S46A 1QEXA 2F19L 1MY5A 1PU0A 2DBJA 1JNLL 2CNZA 1IZKA 1G87A 2ROXA 2Z92B 2DJSA 1KXQA 3BQUD 3H7BA 1ZANL 3OGOE 2AP2A 2LT9A 2XV0A 3DWTA 4JPKH 4B0MB 1JSYA 3TC9A 1UXLA 3B9AA 4ODXA 4X2UA 4ODWA 4LPXA 5F7KC 2D2CC 1A9BA 2A74C 4HQQH 3OXSB 4C56B 5CJOH 4XMZA 4OV5A 3JYCA 4JPVH 1HVXA 1QI4A 4LBEB 3NK3A 1W6LA 3CLFH 3ZMRA 1IEAB 3VI3B 5F71A 3X17A 4PRIA 5IHZB 4J27A 1FGVL 3GGWB 3SJVD 1KG0A 2RCSL 4YNYA 2DI9A 4G7SB 3QS3A 1V3KA 3VGDA 5DQ9A 5EC1A 5A1AA 1C5BL 5JPNB 3SPHA 4W6YB 2MKLC 1E2ZA 3QZLA 2OYPA 1ZHBB 2FO8A 2VN7A 2X40A 4HSQA 5F7FA 1M1XB 3OKYA 3IDXH 1JD9A 5F1NA 1RQ5A 2VL4A 4OQTH 4L3CB 1U6AL 3UTOA 4YXHH 4JFED 1IM9B 4LMQE 4WWKD 5IQ9A 2Q0ZX 2YJLA 4PBWD 2B20A 4TVPE 5JHLL 5BRZE 4NQXA 3WIIL 3H6JA 3UX9B 1ET7A 2G4EA 5I1JH 3GXNA 3L8QA 4UIKL 4EUPA 2GI0A 3NABH 1SXBA 5T5NG 3ULVF 3WFDL 4PJIF 1A02N 2VXTL 5DFAA 4UMSA 2WQSA 1XGPB 2VLME 3CTTA 2P47B 1QSFD 2FBOJ 5I1KL 2HT4D 2VDPB 3ZLQC 3ARQA 5L2KB 2APXA 4AGQA 1SY6A 1U4EA 5I1GH 4FXGB 1G7QB 1PS3A 5INDB 2PTTA 2WBWB 4UNIA 4XNYH 1A6WH 3W0WD 5GISH 4UDUB 3AS0A 4MD4B 1KIUA 3BIBX 3PP3H 4LARH 2HTLD 3HPJB 1YG9A 1JZ7A 4XTRC 4X7EC 3OB0K 4PN6A 2JVUA 2PWFA 2ZXWB 4HT1L 1NKOA 1E3ZA 1PSKH 3JZ7A 3U46A 1XMEB 4ZZKA 4N90E 5C0AB 3BZ5A 4N0FA 5SWSD 5E70A 1XO8A 4A7GA 4RBPH 3PABA 1E30A 3QIBC 5M95B 3QJZA 5CEXA 4NQCE 4XCNA 3OKNA 3TYFA 2J1YA 2NW2B 1RZFL 1MW1A 1CDIA 3EYOA 2IWGA 3FQRA 1AR2A 2PYEA 4HSCX 3V6ZB 4E5XG 3OKDA 5LQBH 4FADA 1MRFL 5D5MF 4B3VA 3BW9B 5EUOB 4XMPH 1ZXKA 3DO7A 3BKJL 2H2SC 1CFVH 2ZUVA 1LE5A 5KUKA 1IC1A 3MMEB 2XN9E 4XP5L 1LK2B 2X88A 1IGJB 5IK3B 1KB9J 3B5GA 3FONB 5EB9A 4JRYA 4B50A 4R26L 1CFBA 4NZTH 2AEPH 4MRBA 5JOEA 3LPPA 1NIFA 4HCIA 2CHWA 1BREA 4HUKB 4PRPD 3SDYL 2OMTB 3PDGA 3SBRA 3MR9B 4M7LL 3C5ZC 1FNFA 3VXQB 4KUCF 2AQ2A 2AQ3A 4N2AA 4QMEA 3TM6A 3L9RA 2LE9A 2D4FA 4CA4A 2APBA 4BFRA 3MCG1 4MMXA 4AQ1B 4POZD 3FUNA 1R33A 4NHCL 4KMTL 4OD1L 3HG1A 4APXB 4PR5A 1IAII 1YEDA 3VB8A 3VXRD 3LVTA 3GBML 1FV1A 4PM1A 3SYCA 5EBMB 2HG0A 2R0LH 4YFDB 1UD8A 4JLRA 2BMKB 4PFEA 4PJXF 4OF6A 5IMMA 1WPCA 3IB4A 4I77H 3HZMA 4KRNA 4XBGA 4R7LA 4GFTB 4HJ0D 1OE2A 4LSPH 1LK3H 1FNSL 1TZ8A 3BO8A 4K3JL 3MLVL 2GITA 1HXMB 5KYXB 1HOCB 3ZW3A 1WK0A 5CGTA 3JWNH 3IE4A 2LLLA 3N06B 4PP2A 4NKOB 4PW9A 1F11B 1Y1DA 5GGVH 4UF7C 1VADA 3UAJC 3WENA 2WQ8A 3TBBA 5IOPA 2ZXQA 5IW6B 1IFHH 1WAPA 2D03H 5I73C 5CLZA 1UC6A 4LLQA 3AITA 1BJ8A 3AY2A 4JZJC 5KTEL 4WJ5B 3CG8A 3FQWB 4P48A 3QEUA 4HETA 1A1NB 4HD9A 1CPUA 1OK0A 4FMKA 3MRMB 3ZYZA 3KPSD 5HD8C 1QW9A 2CJTA 4PY8I 1NAML 4NXSA 1DUYA 4FOMA 2IAMD 1CXLA 3WFHB 2MPAH 1OGAB 4TMPA 3SBPA 2W60A 1IAKB 4B96A 1HL9A 3HHMA 3OHMB 3R4RA 5GGTH 1MCBA 4OJFH 3QUKB 3FH8A 5I30L 2AS5M 4YPGB 5HYIA 4ZD3H 3KLHC 4FQQB 4EF3A 1F4YL 4OLVH 1S5IH 3L4ZA 1NSNH 1ASOA 4QRAA 5SX5H 3QQDB 4O02B 1ASQA 2Z4TA 3X12B 5AAWC 4LKXB 5IW3A 2A6IA 4TTDD 5A16B 4I18B 3O11B 4P2YA 3TWCL 4EVNA 2C4FU 4HLZG 2R0KH 3QUMA 3Q6GH 3LZQA 5GGVY 4GBXD 1Z2KA 5H37G 4QKXB 3VWJD 2BWQA 5C3IA 1HU8A 2WKOA 4Z78B 4UM9A 5KVEH 5DJCA 2ZF9A 2E8YA 3T09A 1URLA 3NMEA 1JHKH 1P6WA 4MB1A 1K5NB 3UYPB 2K78A 4NENA 4PJHB 1RU9H 4Z5RA 2BVOB 2DDQH 5AOLA 1DVUA 1X4ZA 2HYMA 3D51A 4TLUA 5AUMA 1ZT7B 3D3VA 4LOUD 5HHPB 3NFNA 3VTTA 3SPIA 3WMPA 3ZY7A 3PREA 2R23B 2PN5A 3B2PA 5T3XE 2F68X 4ENEC 5BRPA 2WAQA 1NICA 3AB0B 2EVHA 5C08B 5CF3A 3KLKA 3U25A 3JWOC 5GZOA 3K80A 4ZO7A 4J28A 3UADA 4TSCH 3RHWF 5CEZD 3HNVH 4RX4D 3RY4A 3ARSA 2NY5H 4JO4L 3GXMA 1CD9B 5JA8B 1BX2A 3SPVA 3MRDB 4W4OA 4GXFA 1CBVL 2Z8WC 5I23A 2AABH 4HPHA 4GKOA 4XPGL 2NY4D 4U6XA 1ES0B 2ZOUA 2WGXA 1RCYA 4J7RA 2LU4A 5C70A 1YEIH 3GRWA 3GSNB 4BXSV 2XFXB 3PJSB 4GMTL 4GOSA 2JKJA 5HHNA 3WXVL 5JHBA 1TEGA 4BSJA 4MNQE 3RPIA 5D1XD 1A6TA 2F54B 2H8PB 3D18A 4QO1B 1AMXA 1NCDH 1CK0L 4FNLH 4BZ2L 4DFIA 3TPKA 4YBQD 1JPTH 1EGJH 3W2DH 4AXWB 5L2JA 4Q4EA 1S2EA 2OMYB 4PIBA 5ALCL 3WHXB 4BV1A 3EXJA 1QBML 2EDOA 3BDXA 4WV1B 1RJLA 1D5ZA 1NCGA 5FCUH 2HVKA 4FQXD 5FK9B 4Y88A 4FL4C 4OGYL 1P4BH 3UC0L 1DQQA 3CFBB 1K8IB 2QSCL 3CSPA 1AZUA 4FD0A 2Y6SD 5I1DA 4PV9A 5D7KE 2FIRT 2VCOA 4GAFB 4FEIA 4P3CH 2WOYA 1KELL 5AAMA 1UENA 3LQMA 3MLXH 5HJ3B 5BO1L 2FUQA 2OMUA 1A9EB 3DX0A 1Y1UA 3HRZB 4QHKJ 2LLNA 1BQUA 5A2LH 4ZOCA 5DS8B 3L2NA 4J1UB 2F7PA 2XETA 4M6NL 4N2BA 4YL4A 1ADQL 1I7UA 4M6OH 2WZ0A 1V3LA 2R2CA 3NCBB 2OZ4H 3SN6N 4HMDA 4N24A 3GXPA 1JK8B 4E41D 3EBAA 1AGCB 3QJHA 3GWJA 3FTWA 4NQEB 1S7XA 4OZFG 3PGDA 4MMYA 1E4WL 1OPOA 4PWEA 2O5YH 4RETB 4PWFA 1II4E 1XL6A 2DWEB 1KEML 3S3SA 4BFFA 4K8RD 3N50A 2JKNA 5FB8A 2HN7A 3O4OB 2APTA 4GRWB 2O30A 4JEGB 3GJFA 3J2PA 2XKNB 3NIGF 1DVFA 1FQ9C 1I1YB 2NY2C 4LNRA 5JYLA 4G80B 2RH0A 1OP5K 1QOKA 3HFMH 2DQFB 2R0WH 3I85A 2B3IA 1ZLWH 4RQQB 3AG3B 2H2PC 1LMKA 5DHVH 5ADPL 4G8EA 1MHCA 2X89A 2VLKA 1TQWA 1EFQA 2CPCA 3O6FD 4ZT1A 1X7SA 3GSXA 4YDKH 2ZG2A 4FS0A 4KRMB 4XPBH 2I32A 1NEPA 1U3HB 3GINA 4RRPA 5AVQB 3BGFB 5HI4C 3SDAD 3UTSB 3GI9L 3M1OA 4DFHA 4AIEA 5FYLE 2FQEA 1UUSA 4QLRA 3NDZE 3OX8B 3NBNA 2OP4L 5HYFA 3D25A 4E9XA 2XNAA 2XSKA 2FGWH 2QHLA 2EC9U 4I9WD 3N04A 4WHCA 3RJOA 2AXGA 3II3A 4FG4A 5G55A 5HDLA 1ET8A 2PCYA 3ZT6A 2ADIA 3ENEA 3FF7A 3VDCA 4KO9A 2CUHA 5D2LB 2YUVA 4YHOL 2XTJE 2E0PA 4OZGE 2B9AA 1TEYA 5T3ZL 1WCBB 1YNTF 2X6CA 1CDGA 3VFUB 3KJ6L 3WIFA 1Q9WA 3A47A 3FT9A 1X4XA 3FF8A 1RLWA 3KVPA 4XN2A 4LGRB 7PCYA 3MJ6A 3MV8A 1CDJA 1J0HA 4H88L 1IKOP 4IRZH 2FNWA 4JDEA 2UYLA 1KN2L 3B6SA 4PRBA 2PO6B 2XIBA 2GHWB 1XF5B 3CPLB 4P23A 5FKPA 3NESA 3NP4A 2YD9A 1XSIA 1J1XH 2FWLB 4K7PL 3HG3A 1YEJH 2CZNA 3ZKMC 5DFWH 2BWDA 2DQHL 1IV8A 2R69A 1U91B 1SDAB 2IBBA 4R2GD 4XXDA 5D7HA 3VFRA 2YPVA 2A77L 5AENA 2QELA 1HILB 4B5EA 1VEOA 4S10A 3KWWA 1VFUA 2G60L 4FYQA 3QZWG 1AHKA 3GHBL 4Z9KB 4F9PA 4UT6H 3SJVE 4TVPH 3OXSA 1YN6B 4C56A 4MBOA 1O7DE 1LL1A 1T89C 4A2GA 5FIEA 2RAMA 2X44D 1IEAA 3NZHH 3I9PA 1VRSA 2BY0A 2ED8A 1JWUB 1VCBC 4ICWA 5IHZA 1XQ4A 3GGWA 4LPUA 5DK0B 1HHGB 1C12B 3M46A 4H0IA 4KZDL 2VLRE 2AJUH 4KQ4L 5AW0B 5CKGA 1D2PA 4S1DC 3M7OA 3QZNA 4N0CC 1J5OL 4MNGB 4MJ5B 5D7SH 1MF2L 2E9GA 3SDDB 1TNMA 4Y2LA 4Y2DC 3IU4H 3U79A 5KN5B 1D5BA 4JFEE 5EOTB 1ZHBA 2EYTB 1N10A 4GQPH 2WPGA 5JOPD 4W9HC 4M6ML 4ZSOE 4ZTEA 1ZMYA 5ESVA 2XICA 4ABWA 1R5IA 4QDGA 2ADFH 2AJVL 3OSVA 4L3CA 2COQA 1ZY9A 3PNRB 5ABDE 1JMXA 4LCWD 4X4KA 3ZBMA 2R51A 3TJPA 4HGMA 2NZ9C 4YLQT 2VUOA 2ZOTA 4ZQTA 4LVNB 5I8CB 4ELME 1GIGL 1ND0B 4GFXA 3KYKH 5TQ2L 3GK8H 3ZT5A 1L9OA 2BH0A 2WO4A 4MTMA 4FP8H 5DFTA 2FGZA 2R1WB 4MDIA 4E42B 2F58L 3O6LL 3VFVB 2R59A 4FFZH 5C0RH 1XGPA 2K7PA 4IRJD 4HPOH 1X5JA 1H19A 4JGMA 5DJYB 4KY1H 3WE1A 3OPZL 2XC8A 5L2KA 4XTRD 1ORQB 4LDEB 5DK2B 1G7QA 2YXVA 1TYJA 3HE6C 3U83A 5INDA 5DXWA 1O6SB 4HCGA 2ZOWA 1I8MA 4NQDB 2IH1B 1YMMD 4KZEL 1MCOH 4UDUA 3P0GB 5I75C 1CYGA 3L1FA 5JHDB 2VMCA 4GKZA 5SWSE 5SWZD 3WCYA 1E9OA 2DYSB 2NY3B 2FO4B 3APDA 4TNWK 1HDMB 1XGUA 3SDCB 5CILH 4A55A 2AC0A 4ENZA 4K23H 1IM3A 4OY9A 3B37A 4X9HA 3DECA 4FNPA 1HHIA 4KHTL 3IXTA 5IY5B 2AVFA 2EDMA 5BS0B 2Z4QB 4K5LA 2NW2A 4TQ8A 5IBLC 3X1EA 4DKFL 3N3EA 4KOBA 4G70B 4FULA 4PRDA 3V6ZA 2KZKA 3ZRCC 2P5PA 2Z64C 3QXDB 5H35B 3RWHA 3CLEL 3BW9A 5EUOA 3FB8B 1RMFH 4XNXH 4KJYB 3LKOB 5F9WB 1PD6A 2JXMB 2JIXB 5I5JA 4PRPE 5E99L 3VTAA 3WTWA 5T1JA 3UJJL 2G5BA 4GG6E 3O2DA 5JQHC 2VXQH 2WTOA 1U3JA 1YAZA 1S5HB 3SE9H 2Y06L 1QUNA 3I2CH 2P5WB 5T5NF 1I1FB 2DQ6A 4LVOB 1BJ1J 3E38A 5D8JL 3UIYA 2HCZX 1P6FA 4LPWA 4JPWH 4BKLA 1MWOA 4NAJA 2PNDA 1L9RA 2WZAA 1BGXL 5J9PB 1KN4L 2JSFA 3O9WA 3TEZA 4YQXL 4L3EE 4YGAB 1R19A 3QYCA 4AQ1A 1JPSH 1C5DB 4PVNA 5ISZB 2ITDB 5I1EH 1MCIA 1KBVA 3F05A 5B4MD 1GAFH 5FW7A 4PJDA 1Q1PA 2Q2EB 2VJ0A 3ZUCA 4CRPA 1BLNB 1L9NA 1OCZB 1RZJH 3CAFA 4P2OB 1FO0H 4KKRA 3NJVA 2GTZB 1CI5A 4A04A 2R2BB 4AIZB 2OI9B 3GMQA 4WKZA 4M4RA 3SYQA 2D7OA 1GC1C 3N41B 5KBLA 1P2CB 4K71C 3UAJD 1KJ3H 5GPRA 1MUJB 3QNZA 3PL6B 5EU7E 1EAOA 1R5VA 1HXMA 3T8VA 4PW3A 1KJ2L 1OW0C 3NQIA 3LKNB 1A2YA 1KZQA 4NKOA 3QPQC 1JDCA 4JN2B 1SXNA 4ORGB 4K5MA 5IKCA 4W1TA 3KYMA 3IPFA 4G6FB 2E86A 3KPSE 2ADYA 3CFDB 2ADJA 1RZPA 1JOIA 3QYNA 5DLML 2AXHA 4CILA 2WIMA 5K39B 1A1NA 2PYFA 1PEZA 3E3QC 3ZKNC 5IJBC 2GTQA 4HUXB 3MRMA 3CPUA 4N0UE 1OT2A 4JFDD 1ID5I 3WFHA 3KLHD 1XIWB 3NSCA 1OGAA 4EMZA 1EJFA 3P73B 3ZDZB 2OJ1A 1YLBB 3OMIB 5FYKD 2YQ3A 4JJHA 2HKFH 3H4FA 1BDYA 1CL7L 1SOXA 2WQVA 4P2RD 1N6VA 5D7EA 2Y7QA 1D7FA 3TZVA 4ODSH 2CGRH 5DA4A 4XWOD 3A67H 3QUKA 3RWDB 2VZOA 4YSSA 1AIZA 4LSRH 4OFIA 4CSTA 4ZMWA 4Z3IA 2WQUA 2NY7H 4G6KL 1YJDH 3OSKA 3UTZB 5A2IH 5T3XH 3PDOB 5HXMA 4EO5A 3ISRA 5C0EA 3QQDA 1FBIL 1KPVB 3X12A 3KPRA 4LKXA 1J8HB 1DVSA 1LEIB 2YC1B 2B1AL 4XI5D 1N64L 5HDBE 4PSRA 5A16A 4QCIA 4L0ZA 5T33L 4WGWB 3EOAB 5LLIC 2BNRA 1QNIA 4X5XB 1JGDB 2X5PA 5I74C 1CJYA 2IQAB 1BVKB 2VZ1A 5IP4A 1FN4B 1Z9SB 5AVZB 3EYQC 1M6OB 4MHHG 1P53A 1T7WA 2WOBA 4P2CG 2WJ5A 2WAHA 4Z78A 3MO1B 2H1LM 1JZGA 5DEJA 4BYHA 3IBEA 1L0YA 4KO5A 1VPOH 5F9DC 3UYPA 4P4KD 2DYPA 2BVOA 4YBHA 2Y69B 2YAHA 4XZUB 4GQ9H 1ZT7A 1G9MC 2C3HA 5KSAB 2UWEE 2OXGA 1U33A 1BZ9A 3T2PA 2X9ZA 2MQGA 4B9KC 1NOFA 3D4ZA 4FYSA 4LHUD 3HS0A 1XZWA 4Y8AA 5GGSY 2C4FT 5IB3A 4N2KA 5C08A 1MIEH 5MEQB 1DBKH 1P1ZB 4XMKL 1HHHB 3HIZA 4PGEA 2FWOB 3BPLB 2ZAHA 3HUJF 1BQLL 2GPZA 4PLOB 1ZV9A 2VMDA 4JB9L 4DHLA 2R4SL 4N2FA 4KKZA 5F2FA 4F2MB 1DANU 3RZWA 2D73A 2V2TA 5EWIL 1ES0A 1WFJA 5D1XE 4RAHA 3O6ML 1P5VB 3TN0B 2BIQA 4BDVA 1VLXA 3EJRA 3DX1A 4LEOB 5EIIB 3PWNB 2XFXA 1PY0A 2QSTA 3BAEH 3SOBL 2VKWA 4F33B 3G6JB 2ESVD 1AKPA 2GJ6D 1R3HB 4PTTB 4HCRH 3L3DB 1HNYA 1MNUL 1M6UA 2H8PA 4FQIL 5IGXH 4PMEA 2QJDA 2J57A 4AXWA 5FXCH 1AY1H 2OMYA 2X10A 3BLBA 3D2UB 3PWUB 2JLPA 5F70A 4RRPG 1JMZA 1NBZA 3L3HB 4LSQH 2HJFA 5D7LA 2B5IC 1ID2A 1QR4A 3GSNL 1SHXA 3ZTEA 4HDIA 1AG6A 1CZ8H 3GKZA 4GI9A 3QHTC 3QI9A 4LRNH 4G1MA 5E94A 3KG5A 4JJ5B 3NACH 3KDMB 1FVCB 1YEKH 2LABA 3IN2A 4OBRA 4KKCD 3V4PL 1RJZA 4DZBA 1JZ8A 4UQDA 3FTUA 4RGNC 4E41E 3HRZA 2DJMA 4TNWF 5EFIB 2MFNA 1J48A 3EUUA 3UGEA 4J1UA 2ZUQC 2N1KA 3FQUB 3WY4A 4AWJC 4LASH 4CC0A 1DSFL 3BH8B 3RAJH 3WOVA 1KBBA 2J6EL 4FG0A 1AQKL 5FYLH 3LAFA 2Y22A 4NQEA 1S7VA 3OQRA 1ORSB 4FG6C 4M00A 3V0WH 4MMXC 4Y9GA 4MMZC 3PP4H 4J3OD 5E6IB 1M3IA 3C60B 3G7TA 2DWEA 2WQRA 3ELAT 2X2YA 4N1EA 2H2PD 4WEMB 4MYWB 4UAOB 3ZKXC 1UWEH 3H2WA 4CU6A 4OJCA 3REVB 4PWKA 4JQXA 4JR9H 1CFSB 3L4XA 2NW3B 1EHNA 1PZDA 4G80A 2A9CA 5EOCH 2PWGA 5HI4D 5BV7H 5J3HC 4ZW5A 1UXWB 4RQQA 1CG9A 3FCTB 3U7YH 2KL6A 1RZ8B 4O2EB 1XAUA 1DQLH 5EU6B 5TK2A 1E28B 1I3GL 5DK3A 4OFYA 3G6AB 5I6KA 4NFCA 4DEUA 3VSUA 2FD6H 1EDYA 1U3HA 2VW7A 1WYJA 3QFDB 4I9WE 3UTSA 2YD5A 3CZKA 1IGIL 5DT1L 1OSPL 2HLAA 3LN4B 4YDIH 4RFOH 2DTMH 4I87A 4AYGA 1LQSR 3OAYH 2BY1A 2BERA 2C3WA 3C9NB 3IGAB 4HHGA 4PJGF 1IC5H 3BE1H 2YGOA 2OCJA 4U6VL 3K6DA 1GPOH 1QWHA 2WIIB 2J8OA 3L3GA 4TL5A 4HMEA 1UT1A 1S3KL 1NEUA 1G5GA 1D6VH 2I9TA 1IBHA 5HDWA 5DZLA 1WCBA 2XPYA 1JHLL 1RULH 2ZCKH 3QUGA 4PLJD 4Q9QH 2YA1A 3DOSB 2GK0A 4CMMB 2Y3NA 3GNMH 3ZKMD 2CA4A 3QPXL 5L0QB 4NO0B 2IWKA 2YZ8A 4KAQH 5JW4N 1DJYA 3LS4L 1U30A 1XF5A 3CPLA 5E00B 4MQTB 2CD0A 3WFCL 5AOZA 1NMCB 3K1KC 3PUUA 1B4LA 4OZIE 4RAVB 3V52L 1F8TL 4PHXA 3AUVA 1CLOL 5LWYH 3Q8BA 4XC3L 4NFBA 2BP8A 1L9MA 1HILA 2X4SB 1BVNP 4XPTH 1OO2A 3WBDA 4QRFA 1QRNB 3F62A 5DWPA 4NRXA 1IBBA 1P84J 5D72H 4YIQB 4X6CB 3ZO9A 1ODAA 1U8OB 3I6GA 3CVIL 5MEOB 3FU6A 4OJDH 2BX5A 4DZ8B 1HWWA 3RY5A 3V0JA 4PRHD 1JZFA 1QLEH 3CMGA 4NOFA 5TDNA 4ZMTA 3ARVA 3MNWB 1OCCB 4QRRA 3B9KB 3DA0A 1GYWA 1TFHA 2YA0A 3F7VB 4S1DD 3RG1C 3US1A 4DOHE 2YPKB 4H1LB 1M9WA 3TIEA 3NJFA 2ORBL 3NN8A 1L9PA 3H42H 4OF3A 3QEQB 5ID0A 5IJCC 5JPMB 2BVPB 1HHGA 3UG4A 1C12A 2ZSVB 5IOKA 3ARWA 3CFCL 1AXTH 5CAYB 1T22A 2CRZA 2L0DA 4WNQB 2DZEA 2VLJB 1DBJH 4MB3A 4PB9H 3CHPA 2VZUA 5E6RB 3SDDA 2ITEA 5GZOC 1U8PA 5KN5A 1NGXB 1GY1A 5FWQA 5EOTA 1D7CA 3OMAB 4LCWE 5DVPA 4BA8A 2NZ9D 1RUPL 4XCEB 1TXKA 3D52A 3TYGL 1GA2A 4W4OC 1YUHB 4IU3B 5FKAB 4UWQB 4QNPF 5JDJA 2XHNA 2Z8VC 3WAJA 2Y2YA 3KEDA 4RMQA 2XG4B 4YDJB 1MCKA 1YYCA 4XO3A 2OCCB 2WLLB 3NZUA 1QBAA 3GLAA 1E0OB 5FYJL 5I8CA 3IMBA 2F0CA 5J1AA 3F65A 1XH3A 2BCKB 3WEOA 1HTYA 4RDBA 3SCMD 4XMVA 1UWGH 1F2XK 4NNPH 1BYNA 2R1WA 4MAUL 3K2MC 2VDLL 5DD5L 3V4UL 3SKOB 1S7SB 3HE6D 4OCXL 1L7TH 2X38A 5D7IE 2F8IA 4GIPD 5JUEH 1HEZB 8CGTA 2OL3A 2XVLA 2ZKHH 4I0KA 1YMME 3JWDH 5DYFA 1IC4L 3HMXL 2FBJL 4LSUH 4Y19E 3W9EB 3MAWA 3QR0A 5SWZE 5HDOA 1ORQA 3NIDE 5DK2A 5DR5H 3NIFB 5CXPA 1O6SA 4EI5A 1ZPUA 3W82A 4N2HA 2ZKWA 4NQDA 1T5KA 2CDEB 4DETA 2LTQC 1X5MA 3ASOB 5DEFA 4KNTA 5AAMC 1IQDA 1X7QB 4WLCA 3VTMA 1T0PB 4EJ1C 3QDGA 1FZKB 4N26A 2FO4A 3GXFA 1HDMA 4HZAA 3B3IB 4NUMA 4WAFA 5T1LA 3SDCA 5BMFL 2LAAA 4ALAC 1F5WA 1USZA 1XF4A 1SPDA 1X9QA 2B15A 4H40A 4V1DD 2O5NA 2X7LB 5E03A 1NTDA 1TPXC 4OF5A 2D9QB 4R6UA 4A7GF 3UERA 2G2RA 5BS0A 2D3VA 2OFQA 1QYGH 4HIJB 1JDDA 2OW6A 4U1GC 4ADIA 5E6UB 5C0FA 4C4KT 1ZHLB 4DSYA 1VCAA 1NZRA 3Q1SL 2VZSA 2OMWB 3RDTB 2I5YL 3W39A 1CXEA 3IRCA 4BFOA 5TE6L 3K6OA 4NRYA 1AS7A 1F4XL 1OAZL 3SO5A 3ZGHA 1DVFC 4U7MA 2JIXA 1G7LB 1BFTA 3DPBB 1UFUA 4XCYB 2AKRB 5I6XB 5EORL 4XT1C 3NEOA 3DXAD 3GMNA 5KS9E 1NGWB 3LY6A 5IBTH 4LL1A 1RIHH 1S5HA 4TNEA 5A3IC 1PKQE 4HUWB 2AZAA 2P5WA 3F7YB 4GUQA 3E1ZA 3U0PB 4GT0A 5CP7A 1I1FA 1K4CB 2O1AA 1YNKL 1BAFH 5C7ZA 4X5QA 4GQRA 3V8OA 2WTPA 2VDMB 1QA9B 5DGRA 4F80A 2LU5A 1QW8A 2A9ML 1QTPA 4QYAA 3SBQA 3VXTB 2F53D 3OPUA 4JKPH 3ILQC 4LDLB 5J9PA 1CU4L 1JGLL 4LHQB 2XY2A 3O8XB 4M5ZL 2ZWNA 1DCEA 2DQDH 3BP7B 1ETZB 2ITDA 1JZDC 4QUOA 1NGQH 4LP5A 3WLWD 3DDGA 4G1EB 5HGAB 4NZJA 3MNZB 3U4EB 1CICD 1A3ZA 2YUWA 3TO4B 2X1QA 1BLNA 3DX6B 4AZUA 4ES9A 3ZE0B 4WI0A 4P2OA 4F24A 1JVKA 5KVFE 4OQTA 3O45B 3RZCB 4HUVB 2W9EL 3IDIA 2R2BA 3HC4L 3MRCB 3OBAA 4U3HA 1RIUH 3MLTB 4MS6A 5JLZB 2I9LB 2W0LA 3RWFB 3STZB 3QPQD 2O6CA 1KTRL 2P80D 3IDMB 3BKCL 5IW1B 2BSED 1MUJA 1M7UA 4G9DB 1BD2D 1KENH 4YDNA 4P23C 4NQCB 3CXHJ 2Q3AA 5I0ZA 2BSCA 4X7CC 2I85A 4P5KB 3ISWA 1UCBH 2JCCA 2QQNL 4YO0A 4KBPA 4HUMB 4KTDL 1E27B 3VAEA 1T2QL 3HE7B 1NMAH 1ZGLM 3T1FB 3CFDA 3POCA 2KLTA 5I16A 2VR5A 4JFDE 1NFIB 4IOIB 4UTCA 2N4IA 4ZFOB 3ISYA 1KCVL 1JRHL 5K39A 1UJ3B 2X3BA 1XSKA 3NH7H 1UZ6F 2X6BA 5FYKE 5GS2D 5J6GB 2VAJA 4PRID 5AL8A 4RNRB 4ZJ9A 1J0ZA 4APQD 3R06B 4P2RE 1RUMH 3CC1A 5DUPH 1A21A 3MLZL 3QG7H 4BUGA 4FX5A 1XIWA 5I82A 1MCPL 3FQ4A 3P73A 4PJCA 2K3TA 5E8DH 4AC2A 4ZOEA 2XA8H 2VDOH 3O2WH 1LP9A 4P46B 3TCTA 2W9LA 1B6UA 4DGIL 3IJEB 4NZDA 4EZKA 2DLTA 3ASNB 5IROD 5EO9B 3RWDA 2BY2A 1JF6A 1YEFH 2NY6C 3M8OL 32C2B 3NCXA 3LZRA 2A2QT 3UTZA 3B7YA 4Z23A 2A6KA 3VGAB 5BZDB 2CUMA 3D06A 1J8HA 3EYQD 2PLTA 2YC1A 4QYOB 3S3CB 4DO4A 1LEIA 5DC0A 1JN6B 2CR0A 3ARBD 1LEKB 2JTDA 4MWFB 4X5XA 4KU1A 1XL4A 5IIEA 1Z9SA 3PGFH 4OLUH 1M6OA 2F1EA 2XVBA 3O41B 1H8SA 4XVSL 1RK1B 1NL0L 2A83A 4ZUSA 1WAAE 3D34A 2WKOF 4M5TA 1HL5A 2BCMA 2ATKB 4KQ3H 1Z0NA 2FWSA 1MW3A 4Z7NF 1SM3L 2Q7NA 3QEHB 3PQYB 3CFTA 5BQDA 3C8HA 5I1CL 2FX7L 3KPTA 1A9VA 4YDLB 1SEQH 1FFTB 2UX7A 5C6TH 1KPUB 1TZHB 4M8RA 2XZQH 3VFGH 5KSAA 5T1KB 2F18A 1FIGL 1JF5A 4Y5XB 3WYRA 3GD1C 1WZ1L 2IBGA 3I6SA 4LAQH 4WFGD 3RL1B 3SPGA 5D4QA 5MEQA 2FX9L 1P1ZA 1T7ZA 3ARTA 1HHHA 4K0OA 4PBXA 3VVVA 2ICWB 3AAZB 4NYLB 1HZHL 3RNKA 3GZPA 5IESL 1YQVL 2JK5B 3TJHC 1JFQH 4HWEH 1KC5L 4Z7QE 2ESVE 4AITA 4JY4B 5JW4Q 4JFQB 5LCVH 1MJ7L 2BHYA 3TN0A 2D7PA 2PYED 2J8UB 5C09E 1T5XB 4LEOA 5DC2A 3PWNA 5EIIA 3L95B 3QJSB 4FFVD 1IGYA 1KACB 4F33A 3G6JA 1ML0A 3FO1B 1QLRB 3L3DA 1UEYA 3X1FA 3CHSA 1JCKA 3NP3A 1YPZE 3CVHH 4TRPH 4OSUL 4AH2B 4ZMOA 3S88L 3HC3L 3PWUA 3D2UA 3O3UN 2BW5A 3QWOB 3N5AA 4G6JL 3L3HA 3V0AC 5I15L 3MOAL 3FFCD 1VACA 4GSUA 2FL5B 4G59C 1BFVL 3T4AA 2IBZY 3L1EA 4JRYD 4FFYL 3B7UX 4FN0A 4RGND 2XV6B 5FA4B 1MRDH 1DSYA 4I7ZC 4YFEA 3BQVA 3MJ9H 4JJ5A 1AGFA 3T0WA 2HTKD 4A37A 3KDMA 1FVCA 4FLRA 5DDHA 5HYJE 5I8OL 4G82A 5DUJA 1A6VH 4Z1PA 2OQJB 4H8QA 5DZJA 1UD3A 4HKXB 3WEAA 1FVEA 3LPWA 3L7EB 1JDAA 1JNJA 1GKOA 2VITA 5EFIA 5FO8A 3VM5A 3OKKA 4HLJA 4ECNA 2KI6A 3BH8A 4Z95L 5D7JD 1FVDA 5TK4A 2GJPA 3NFSH 1BCIA 2APFA 4FQHB 3QIUA 4YHNB 3HG1D 5KYWA 1XGRA 1E5UI 2ZICA 1DE4B 1G9ML 4K9EC 3BDYH 3O9WC 3TNNB 4PJAA 2WV3A 3MRNB 4AQ1C 1MRCL 3CFJB 3S34H 3VXMB 3C60A 5BXFA 4JO2L 3P3UA 4GT7A 5J3HD 2B1HH 5LN8A 3QIWB 5J57B 1GZQB 4NGHL 4J6IA 3BXNB 2XU9A 2C8NA 4CVWA 4J3XA 3PV6B 4QOKA 1BFSA 3FCGA 5F1OB 3REVA 2TRHA 1CFSA 2X4OA 3KM2A 3VUAA 4MZ3A 1E42A 3MLUH 4K2UL 2NY1B 5EPMB 4ZODA 5KSVB 2V3DA 3IFLL 4KPHH 4U31A 3FCTA 2K8QA 1XCQA 4O2EA 1RZ8A 4R0LB 1T2XA 2R29L 3FFDB 3UO8B 2AEQH 1NBCA 5CN1A 4IBTA 1FC2D 3CFQA 4X7TB 2J4WL 3IXAB 5B3JE 5T1DH 1CE6A 3ARFD 1TVDA 3QUXB 2Q7YB 1NANH 1NGYA 4AGOA 2CQVA 3LN4A 4AK1A 2HWZL 1N7MH 3P3TA 2E7HA 2IADA 1E4XI 3F04A 2PW1A 2MHAB 4B9ZA 1JZIA 3C9NA 5C0GB 1AZBA 8FABA 1EAPA 4MA7H 5GZNA 2BSRB 3RX5A 2VQUA 4XWGH 4V33A 5FWRA 5ESQB 2WIIA 3QNYA 3SE8L 3TV3L 2I69A 4YZWA 3WFBH 2C3XA 2WCGA 3DI3B 4R7XA 3T77B 1AZNA 3ZGIA 1GMIA 3NTCH 1I1AB 1HNFA 2P48B 3ESMA 1D5MB 4XMLH 1CURA 1UTDA 2AK4E 1AE6L 3WTSA 1C7SA 2AQQA 4FHBD 4H13C 3DOSA 4LLUB 2MNJB 3MOQA 1I7RB 4NO0A 3TZVC 2K7QA 2JKSA 3BN9C 3WTYA 1OAQH 1R17A 1F41A 1O9ZA 1RIVH 5GS0H 1KLUB 1QFUH 1ZTXE 4IGBD 1EGJA 2MTPA 4XH2B 1CGTA 4HS8H 5IFAL 4FF9A 5F7AA 5LKNA 4P0DA 3WNPA 4ANWA 1ZHKA 2K6ZA 4CMHB 4XMXA 2DJ4A 4Q56A 4UM9D 4PJ7F 5E51A 2QQLL 2X4SA 4L3AA 4PRHE 1MJJB 3P3RA 4KK5C 2DQCL 4WEBH 2Y6TE 3FRPB 3FBQA 3FSWA 4RIRB 4X6CA 5MEOA 2Q9OA 2GSIB 3D3VD 5KEZA 1AJ7L 3QO1B 1OAUL 2CO6B 1FL6B 3PWLB 4FFTA 3MNWA 5HTSA 1RSFA 3F7VA 2WD0A 3MRFB 3DI2B 2BFVL 4F57H 1UH4A 4H1LA 1JNHB 5DO8A 2OZ4A 1ZAGA 3HVNA 3QEQA 5AKVA 5E5MA 3GT6A 2BVPA 2JE8A 1HT6A 2ZSVA 3ZDYE 2ZCHH 3Q8FA 1R3KB 2NTFA 3N1MC 1ED3B 3BC9A 3S5ZA 3HS0C 4OVVA 2DIAA 4P05A 3TT1L 2VLJA 3MRLA 4F91B 4D9QE 2Y24A 1MJUL 3X3FH 1KGJA 3V7AE 5KBPA 3MRBB 4HJTA 1MNNA 3L5XL 3D4GA 4XCEA 5F1KC 4ZTPL 4X6EA 3BKYL 3BPOC 4R90H 3BUIA 1YUHA 1WEJH 1MOEA 2Y07L 4OZGB 5LXVA 3IJHB 3IDUA 4IU3A 4UQEA 5FKAA 4AV5A 4GSQA 2XG4A 4YDJA 3HG2A 4NKIH 1MCEA 5BUGA 4G9FE 3S36H 5F9OL 4WZ9A 3L5WA 3C5XA 4KKAC 3OF6D 1XF3A 4J3SA 4RMBA 4L5FL 4U1LB 1S7SA 1JTPA 2EVIA 1UM5H 2IQ9H 4G7RB 1TZIB 1PZ2A 2IAND 2P8LB 3ILEA 4Y1AA 3VJ6A 3ZTNL 3N40F 2GJZA 1G1OA 1RZ7H 2DBLH 1LWHA 1KTDA 2IIJA 1ZLUK 3MNMA 2W07B 2ZJSH 5IB2A 3T2LA 3QI9C 3C5SB 3AGWA 4X7FC 4Q6YA 3LHPH 4PS3A 1OY3B 3V6OE 4D8OA 4V1DE 1X7QA 3MNVB 3Q8AA 1FZKA 4JFPB 2EVFA 3B3IA 3HRZC 2XXCB 3PFQA 3E6FB 5DWUH 1A7NL 1ULVA 3I9GL 3K1DA 2V8LA 2X4UA 1UOVA 2F5AL 4D7BA 1FPTL 4M1DH 4IRZA 3UYOD 5LNEA 4Z7WE 4AV0A 2YWYA 2PCFB 2B0SL 3EJJX 3ZN6A 2RIKA 2Q7AA 3FYIB 4KUZL 3MXWL 5E1IA 2VLRB 3X1GA 4BH7B 1J0JA 4G6MH 3I9IA 4Y4KA 5E1AA 1ZHLA 4XNUH 5LGJB 3RDTA 1I7TA 2GSMB 1WBZB 3DX7B 3TO2A 3QH3B 4CJ1A 4WI5A 1LDSA 1W0VB 4E0RA 3LYRA 2VXSL 5M94B 2XWTB 4OCYH 3L4WA 2YQ2A 4JQXC 2X89D 2VLKD 1I75A 3JBG7 1N19A 1SQMA 2X3CA 1G7LA 3F84A 4QGTA 5KVFH 3DPBA 4XCYA 2AKRA 4MA8L 2P49B 4WF7A 2VC2H 4XVTH 2DM2A 4GXUN 1GGIL 3EFDH 1NGWA 1M7IA 4UT6A 5MP6L 4FKHA 5BRZA 1ZA3B 1MPAH 1H6TA 4HUWA 2EO7A 1TQBB 4GW1B 3F7YA 3U0PA 4OM1H 3OJMB 1MAML 1K4CA 1S7UA 4DP5X 4JPSA 3BGFC 4Y16B 5F89B 1KWKA 1QA9A 1EV2E 5AZ2L 4X8CA 2WBXA 5HSFA 5GJSH 3VXTA 4B97A 2YBGA 2JCWA 1QRKA 2VDRL 4HK3J 4A2FA 1R3IL 2A6DB 5J6SA 1OAJA 5BVPL 5I0XA 1K3ZA 3BP7A 2VLLB 1FZMB 1WICA 2JJVA 5CSGA 4NUGL 3UROR 3FCBA 3P0VH 3L1OH 4FNTA 5HGAA 3N0AA 3B9VA 3MNZA 3THMH 3U4EA 4P07A 5TE4L 5FYKH 4LLYB 4B7IA 4PJDF 1YN7B 1MI5D 3DX6A 2VDML 4UTBH 3FQTB 1FL3B 3IMSA 2WBJB 2XPGB 3TESA 4EIGB 4HUVA 1YO4A 3MRCA 1GMEA 1BD2E 4WW2B 1YY9C 4N0YH 4TUJB 3MLTA 3W56A 3NJNA 4BGLA 3RWFA 3STZA 1KIQB 3BPNB 5AVYB 4AEHH 5AVRB 1KXQE 3IDMA 3WS6A 3E6HB 4D0BB 5IW1A 3HZKB 2X2HA 1A4JA 4C83B 2CMRH 4G9DA 4Z8FH 5CLYA 1I3RA 4NQCA 4AQEB 1A7QL 4MD5A 5IHUL 1U8QB 4QRTB 1LVEA 1KLFB 3BEVB 2EVJA 2G3ZA 4FFZA 4UB0H 4LCCA 2AV7B 4FXKB 3NUKA 4J6RH 4P59L 3HE7A 1S3RA 3RGVA 2GEQA 4C56D 4IOIA 4BK4A 2ZUUA 4ZFOA 2DQUH 1YEGL 2QV2A 1UJ3A 3CXDL 4FZ8L 4FHJA 4MCMA 5EZJA 3VRJA 1DN0B 1RJYB 3HHSB 2EDFA 2YAQA 4ACTA 3BHBA 2EKSA 2DQEL 3FN0L 4RNRA 1DQTA 2XN9A 4YSDA 4GINA 3VE0A 4Z7VE 3U6RB 4TUKH 3BSZL 3SPJA 4JRLA 1WZKA 2QL1A 5F21B 3QP3A 4LLMA 3WDJA 1H3PL 1P7KB 1IKFL 3F7PC 2GI7A 4P46A 3IJEA 4ZO6A 2DQIH 2PMZA 4YE4H 1NIAA 5EO9A 1N70A 3ZTDC 3EO9H 2ZQKA 2HB0A 4OF7A 32C2A 4WK2B 1NC2B 4NEHB 1J18A 1W72B 4GSX