1TFPA

Transthyretin (formerly known as prealbumin)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
114
structure length
114
Chain Sequence
CPLMVKVLDAVRGSPAANVAVKVFKKAADGTWQDFATGKTTEFGEIHELTTEEQFVEGVYRVEFDTSSYWKGLGLSPFHEYADVVFTANDSGHRHYTIAALLSPFSYSTTAVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of transthyretin from chicken.
pubmed doi rcsb
molecule tags Transport (thyroxine)
molecule keywords TRANSTHYRETIN
total genus 21
structure length 114
sequence length 114
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 1tfpA00
3GRBA 3ESNA 5E4OA 3CFQA 4QXVA 4TLTA 2B16A 3OZLA 5EN3A 3NEOA 4TQ8A 2B14A 3IMWA 1KGIA 2PABA 3CFNA 5TTRA 4ACTA 4PWEA 3P3UA 4FI7A 5DWPA 3U2IA 3BSZA 3P3TA 4TQIA 2IGLA 4ABUA 5AKSA 3BT0A 3GS7A 1TTRA 4PWHA 3DGDA 4IKLA 3NESA 1RLBA 1TZ8A 4PMEA 2QGEA 4TKWA 4Y9FA 1DVTA 1GKEA 4N86A 4YDMA 4DEUA 3A4DA 5CM1A 4HJSA 3CN3A 3P3SA 2QELA 4ANKA 1FH2A 4Y9GA 4MRCA 3KGUA 1DVZA 1BZEA 3I9IA 3SSGA 4DETA 5CLZA 3DJTA 3IMVA 1IE4A 4MASA 4FI6A 2FLMA 2H0EA 1SOKA 3I9AA 4IKIA 1DVUA 1ETB1 5AL8A 1SOQA 3IMRA 5HJGA 3IPEA 4I85A 4L1SA 4ABVA 2G5UA 4TM9A 1BZDA 5IHHA 3NEEA 4IK6A 2H4EA 3GS0A 3FC8A 4PWKA 5E23A 4ABQA 4HIQA 3CXFA 3CFTA 1DVXA 4WO0A 4AC2A 4DEWA 2B15A 2QGBA 4I89A 4TNGA 1DVQA 2G4GA 5EZPA 4QRFA 4HJUA 3A4EA 1FHNA 2GABA 4TNEA 2G9KA 3TFBA 3NG5A 3IPBA 1E5AA 5AL0A 5AYTA 5BOJA 1TTAA 3IMUA 4WNSA 3GRGA 5AKTA 1IIKA 5FO2A 4PWJA 3DO4A 2WQAA 2FBRA 2QGDA 1DVSA 4TQPA 1SN2A 2H0JA 4HISA 4DERA 1THAA 4PWGA 2B9AA 1IJNA 3DJZA 5E4AA 1BM7A 5JIMA 3DK2A 4TLUA 4TL4A 1ICTA 3IWVA 4PMFA 3U2JA 5JIQA 3TCTA 3GPSA 3GLZA 1QABA 2TRHA 4L1TA 2NOYA 4DESA 4AC4A 3GS4A 3IMSA 3IMTA 1QWHA 4MRBA 5A6IA 1IIIA 4Y9EA 1U21A 4YDNA 1GKOA 3NEXA 4IIZA 4PVNA 4TL5A 3CN1A 3B56A 3QVAA 1ZCRA 2QGCA 3CN2A 3M1OA 3OZKA 3DIDA 1SN5A 4KY2A 1ZD6A 3DJRA 3CN0A 3KGTA 1THCA 1Y1DA 1DVYA 4N85A 5L4IA 1BMZA 2QPFA 3ESOA 2G3XA 2G2PA 1G1OA 2G4EA 5L4FA 1KGJA 3ESPA 3IWUA 1SN0A 1F41A 3DK0A 2F8IA 4FI8A 4WNJA 4IK7A 4TLKA 1BZ8A 1TFPA 2G3ZA 3HJ0A 2F7IA 1TTCA 3I9PA 4TLSA 5L4MA 5FW7A 4ABWA 4I87A 5K1NA 1E3FA 1X7SA 4IKJA 4PWIA 5FW8A 4PWFA 1TT6A 1X7TA 1ETA1 1TLMA 4Y9BA 3CN4A 3FCBA 4D7BA 5DEJA 5JIDA 3D2TA 2B77A 5CR1A 4TNFA 3Q1EA 2GPZA 4QYAA 1E4HA 1Z7JA 3A4FA 3CFMA 3W3BA 5CLYA 1TTBA 4HJTA 3CBRA 3P3RA 2H6UA 5CLXA 5K1JA 2H0FA 1OO2A 2ROYA 4IKKA 4PVMA 4Y9CA 5CNHA 2H1XA 5FW6A 3D7PA 4N87A 4PVLA 4PM1A 4TQHA 5CN3A 5L4JA 2ROXA 2TRYA 1F86A 1TYRA 2G2NA 1TSHA 3DJSA 4Q14A 5AKVA 3KGSA
chains in the Genus database with same CATH superfamily
1NM4A 4UQEA 3NCYP 3SPVB 2OQJB 2MPAH 2C7UB 4N2HA 4PJDE 3IMWA 1FSKB 4P5TB 4LLUB 3T0XA 5EU3A 4JCLA 3U2IA 1EJ6A 3KLAA 2D31A 5E9DD 3OKOB 3LNHA 3LZQA 1XF5A 4KJQD 2E6QA 1YNKL 2DKSA 2E46A 1AI1L 2W5PA 4BZ1H 4UM9A 1X5XA 2V9UA 2EDFA 1JZ8A 3TP4A 4NP4H 2Y72A 2XZAH 3EBHA 1KEML 4N86A 1KGCD 1LK2B 4X42A 5CO1A 5C0IB 1BDYA 3OF6D 7PCYA 3GMPA 2FEJA 5F6IB 2IF7A 4U1NB 1UEMA 5JO5A 2ZXWB 4XC1H 4EJ1C 3L4TA 4E9SA 1PZ2A 3KXFA 2A9ML 3TH2T 2WP3T 2VDKB 1RPQA 4DVBA 2H3XC 5J1TC 1UT1A 2OR7A 3WNKA 5D4HA 5BV7B 1MVYA 2YIHA 1EMTL 2I69A 1RIHH 4TVUA 4LVHB 4XNUH 1R3JA 3W57A 3L7EA 2A9CA 2HKAA 4Y2DA 3AS2A 3FTGB 4NRYB 1FYTB 3LVEA 1HYRC 3LTVA 4HISA 2VJ8A 5E0FA 4OGYH 1I7ZA 1UM6H 3W81A 1N8OE 1MJ8H 3N3EA 3OWEA 1SJHA 4PJ7A 3KXFD 3M8OH 4WEUD 1V8HA 43CAA 3T9WA 2Y4SA 4QRRB 1K6QH 4JFDB 4JFFE 2VZOA 3O2VL 3CDZA 4ODTL 4QNPE 3VE0A 4LCUB 4G2AA 4XNUL 1Y6KR 2QSCH 2WKOF 3S35X 2Y6SC 3GMMB 1DVYA 4XNQB 5I2IB 4P3CH 5H35A 2YGOA 3KJ6L 4JJ5A 1XV8A 1CI3M 3EOTL 2HH0L 5FUOL 1RZGB 1SDAB 4FFVD 3KH4A 4TLSA 5EC2B 4PQXA 2OR8A 3WJMB 1CK0H 3V0AC 1M2VA 4TSAL 5LWYL 4JG0L 2V2TB 4GW5B 1CN4A 1YZZA 2RCSH 3CVCA 3KDMA 4NT6A 1TLKA 4AKOA 2XXMB 3DGCR 3GQFA 4F7EB 1Q38A 3H53A 1UGNA 1QP1A 2X05A 3O2DL 2EEXA 2Q3ZA 2YEZB 1HE7A 2FYYB 2VDNL 4MS8D 1ZV2A 2LLGA 3QQ9D 3QWOB 2CH8A 5D5MA 1ZLWH 2UZXA 3TZVC 2OTWB 5L7XL 2H3NB 4I9WE 4WHTA 1CURA 4CMHB 5LNDA 2VLRD 4PV8A 4JJ5B 2P8LA 3FMGH 3QJHA 3D9AL 4JL1A 4NJ9L 3SE8L 4HQQH 3RL1B 3BESR 2AZAA 1UD2A 2NY7H 2IAND 1S5IL 3WXWH 4UQCA 4DKDC 3Q9PA 2R4SH 4H8WH 4MJ2A 4FTDA 4P9HC 1TSRA 5F7FA 2EDOA 4JB9L 4F7PB 4R2GC 4OQ1A 1JWUB 2JKSA 4JFEA 3MA7B 4JFPA 4CVXA 3GRWH 5F96L 1MQKH 4FDWA 2DY2A 5CSZB 2XG5B 4HXAL 1SJVA 4DETA 1X5GA 5C09B 1AKJB 2J55A 1MEXL 4JDEB 4P23D 5AZEL 1SOQA 2QL1A 5DQ9B 3ZOAA 2YSTA 3BWUC 2ZCHL 3NIFF 3SPVA 3BRDA 2YK1L 3VJ6B 4C8XA 1H5BC 3TO2B 5IUCA 2BVTA 2IBBA 1G6RA 1YPZB 2DIBA 1UD5A 3EO1B 3JWNG 2Q10A 4R5VA 2GTWB 4NIYE 2R1XB 5EZPA 3KXFE 2ZTBA 4F9PA 3QWNA 2WNWA 4W9CC 1DJSA 2PPEA 4Q2ZB 3S34H 1NWOA 2WWKO 3RKDD 1S7SA 1WFIA 3HS0C 5JA9A 4JFQB 3QAQA 4JFZL 4X80L 4DP1X 1HHGA 5SWQB 1JXFA 4JKPL 2CO4A 4XPTL 2K8MA 4UOZA 3ECVA 2VXUL 1N10A 4HMDA 2OBGA 3GSOB 4CU7A 5C0ND 4ZO7A 3CX5J 2P42B 1F8TH 5CGYD 4S1SL 4EXKA 3QORB 1FNEB 4KTEL 2XY2A 2V5RA 4GG8A 1KYUA 3U0PA 4YO0A 1T22A 3WIFA 5D1QE 1ONQA 1HEJC 5GGVH 4LLYB 4R7NB 5HGBA 3SJVE 2KDGA 4IBSA 1TZIB 2ENPA 3RVXD 43C9A 4F2MB 3HS0B 2NX5E 5E9DB 5GSVA 1PD0A 2LLLA 2HFEB 1HKLH 3GJFH 1A22B 2YPLA 4QKXB 3ILQC 5L4FA 1IBGL 2ZX7A 4A7GA 1NCGA 3UYPA 3Q05A 1U8KA 4Y19B 5DHXB 1PPIA 1WBZB 3UIZA 4ANXA 3PXHA 3FONA 4OLZH 3QG7H 3MRGA 2PWFA 1T6BX 1YO4A 1GR7A 1ZVNA 1S7WB 1L6PA 3ZBMA 1O7DE 1RULH 4BSWB 5F8RC 3K91A 3U4AA 1KCRL 4NP9A 2WXFA 3P9LA 3W3BA 5BXFA 3FUJA 4RWYL 1XF5B 3P3RA 3C08L 3KLKA 2OXGB 3MRRA 4XVJL 4Y5XA 4WU7B 4BK5C 3OKLB 4FNTA 3O4LA 4O2EA 1MFVA 1BEXA 1YC8A 5HHOE 1TSHA 1WA2X 1FVDB 3ARGB 1W16A 4CVZB 3NBNA 1A0QL 4JRXB 1FZKA 2VDQH 3WFEL 2KMWA 4GIPD 3TNNA 4E0RA 1SUHA 4W4OC 1IGFL 5IQ7L 4X9BA 1MCCA 4UI2A 1FVCA 4RBPK 5ICZB 5I5RA 4V11A 4OV6F 4Y5YA 3C5ZB 1CIDA 5LWYH 4WCYH 1IEBB 4G1EA 3IBEA 4YPGB 3WUWA 2VMCA 3UBXA 3L7FB 2YPLD 3KCPB 5TDPA 4JGJA 3B2XA 2MTPA 2OL3L 5A3IC 4G8FA 2X4QB 5F7WC 3MLWL 1U8QA 1NGWA 4MXWH 4OZHF 4PGBB 5F6HI 5DJ6B 2D7MA 5J6HB 5B7MA 5GSRB 4JDVA 3RZCC 4UYQA 1WZMA 2XSKA 1NCAH 3A6CL 4QHPA 5FUCC 3SD2A 2WWNA 3O3DB 4S1SH 4XCFH 3RWIB 4ZTPL 4HC1A 4UAHA 4ZXBA 4A1RA 4ZMOA 3EJYD 3IJ7A 3CLWA 1WT5C 3JVGA 1PTZA 1XB6A 1U2YA 4NZRH 4MHHG 1AVAA 4KK5C 5AOLA 1NPJA 2VUOA 3N04A 2IO5A 2YD2A 4JRXE 1RJZA 3FQXA 2W91A 4AGNA 4W9KC 3D6GA 4F33A 4GXUN 1XGUB 4GRWH 3GSWB 5A6LA 3HFMH 1ZHLB 3MR9A 3IMSA 5DHYB 3NSXA 5E6ZA 4XWOC 2L7UA 1NCAL 2DWDA 2P5WD 3OKDA 5EFIB 3RB7A 4UNVA 5LAXB 4Z95H 4Z7OB 2F8XC 3BAWA 1RJCA 2XA8H 4I13B 2X4RA 3WIHH 1LHZA 3QNZA 1UFUA 3FRUB 4A04A 3FUEA 4N85A 1AR1D 1ED3A 1FGVL 4K5OA 1MOEA 2B5IC 4P4RA 5EBMA 5T1JA 3BVNA 5CSBA 5CZRA 5AB2A 5FGCE 4YDKL 4ZSOA 4A2LA 4KKLC 4F7KA 2C1OB 3L1OH 4Q4IA 1UC6A 3BAIA 1OHQA 4KHXL 1D6VH 4U4IA 4R2GD 2NY5L 5D1ZI 5FW8A 5GIRB 5GRJL 2ZAGA 3BIKB 4EOWH 3NH7H 4GUOA 2WBJB 5C0BD 2BHFA 3Q1EA 2A6KA 4BZ1A 2XA3A 2WYTA 4NAJA 1OLLA 1SRDA 2UY7B 3HAEH 3DROB 5G4OA 1FAIH 3ZK0A 3PWJA 4HAFA 3RU8L 4UT6H 4FL4B 2QV2A 1QBML 2XQBL 3Q8CA 2BY0A 4YSEA 4NFBA 2NY4C 2QSVA 1X4XA 3ESNA 2B16A 4BH8A 1F1AA 3IB4A 3GRWA 3L4VA 4UV4L 5CINL 3BP5B 1RERA 2NY6C 3FFOA 3QGVA 5HVFB 2WBXA 3V0JA 2NY5H 1CUOA 3PF2A 1FHGA 2FJGB 1P4LA 2OSXA 3LHAA 2GJPA 3CU7A 1ZLVK 4ZQTA 4QTFA 2E3VA 2P45B 3P4LA 3BRFA 4JG1H 1KELL 3MJWA 3OKOA 4Q8BA 4WGVB 1R5VA 3JWNE 1JS4A 1BFVL 4KDWA 3RWFA 3HLKA 4X9HA 2KPWA 4P9ML 4CSTA 5D2NE 2F53D 2HG5B 1B6UA 4X4XA 5AVQB 4MNGB 9CGTA 3GMPB 5T3XH 1BPLB 3ROLB 3GMNA 4NHUB 2WLLB 1S3RA 1QUPA 4B9PA 2CKBA 1PQZA 4LSTH 4Q6IC 3S3BB 4WWNA 4ISVA 1CZ8L 2FCBA 4R7NA 1OP4A 4KFZC 5HGGS 1NGXA 3WUWB 4WFFD 2ZUTA 2AV1B 3LS5L 1S7UB 1SXCA 1ZE3C 2AVFA 5TE7L 3H4FA 3BGMA 1D5IL 2J8OA 4CJ1A 2BRRL 2FQDA 1KGWA 4HIEB 4YAQB 3U6XS 3WMSA 3CZUB 4PLKD 4AG4L 1M9WA 1Z9NA 3ZDZB 3OKMA 3NRPA 3AQYA 4O00A 3GMRB 5EG6C 1W15A 1HXMA 2N56A 5J0BA 4YDLC 1M05B 5BCAA 2QPSA 4DP6X 1T5WA 2IFFH 1I8LC 3OR7A 4FL4C 3O3DA 5KS9B 5LDUA 4S1QH 1BP3B 2D0GA 3I85A 3ZHKA 2X2HA 2PPDA 4J4PC 5DHEA 4BQ9A 3C09B 3L9RB 4G42B 5IF0A 1BFSA 1TCRA 4NO0B 3EXLA 1ASOA 1K85A 1AACA 1KBKA 4G5AA 1WITA 5IVZA 4ZW6A 4ABWA 5IOPB 2XNAB 3RNKB 2GJ6B 3T6XA 4F93B 4KJPC 5HVWA 2R0ZH 3GKWH 4YDLB 4GH7B 3QDJB 5JTWA 3I3DA 2W8CA 4YXLL 4JFTA 3OKDB 3QO1A 1N8ZB 2QQNL 1KXQE 2XUWA 2V4LA 3PWLA 4LLAA 4Y5YB 4DZBA 5C0FA 1RURH 4F58L 5IHLB 3H42L 3I6GB 3TO4B 4F37F 3DRQB 2X0UA 4Q6IA 3WLBB 1W8EA 3RL2A 5MEQB 1JWSB 3K6FA 3P2TA 4GSRA 5KJ7E 2UZXB 3OC5A 5AW5B 1QASA 5DVPA 4EAEA 3SGKA 2AITA 3CFCL 4F8OA 1UYWH 1WWAX 1II4E 2X41A 4IM8A 4TPRH 2V6HA 1AZUA 5BVPL 4H1LA 4HLZG 4PJIF 4D9QD 4PD4J 3GSNA 4GEJA 3HPLA 1XL4A 4IKLA 1ACCA 3T3PF 2LQRA 4OCWL 3EZJB 1PX3A 2G3NA 4DEUA 4V2CB 3WEXA 4XN8A 1U9KA 1JZ4A 1MZZA 4ANKA 2AQ2A 3NK3A 3GHPA 5EORH 2LVEA 5D6CA 2W0PA 1UM4H 3M7FB 4CVWA 3DOIA 4IKIA 3KLHD 4K2UH 4KX8A 4YEFA 3S35L 2UXFA 4HCRA 5TDOA 4LOVA 3UZVA 2ZKHL 1LTXA 3GS0A 4BK5A 5L2JB 4KMTL 5AAWA 2MSPA 3NJXA 1ZT4B 3L5IA 3WBDA 4PGJA 3IDYC 1F4YH 4M62H 3DYPA 3FCTB 4MA7L 5MHSE 3IGKA 3TFKD 1OALA 3FQRB 1Q0YH 5IMOA 4HHAB 4WNSA 3KPNA 3OD3A 3QPQC 4PJ8C 2DQHH 1UASA 2FBRA 1I1AC 4P2QB 2MCPL 3WTWA 3GINA 4QHMB 3RTQC 4I18B 3VXOB 1F2QA 3CC1A 2CLZB 2JIXD 3FO1B 4PLOB 2XVGA 2KC0A 5B3SB 3N42B 1F6AA 1IGIH 1W0WA 2Z8SA 1WHOA 5GS1A 1QRNB 1PS3A 4M7JH 3GSOA 2QV4A 1MFBL 3LKOA 5KVDL 5H37H 2EDWA 3B8SA 3CJJA 5CZXD 3LY6A 1LK3L 4F3FB 1TQVA 1CFSA 5ABDE 1RIHL 2IH3B 3IAGC 5JHDB 2CKBB 1ORQA 2JCCA 1WTLA 3UBGA 5IEKA 3MCLL 3CN0A 3NSDA 5IVXF 4EDWH 4RQQA 1J88A 5F0JB 1XCXA 1EPFA 4YUEH 5FGCB 5FUZH 3F85A 1VADA 3II3A 2VLKB 4X6EB 5CU5A 3ILPB 2GEQA 3P77A 3WKMH 2BNRA 2WXGA 4OJCA 4UMGA 1T7VA 4EI6A 4OM0L 4YQXL 3UTSA 3ZE1B 4WI8A 1L3NA 1C12B 2WNKA 4R0LA 4MDIB 2GC4C 5ADOH 4U3CA 1SDDA 1BF2A 1MFBH 4M00A 3QDMD 1TF4A 3V6BR 3UZEA 3V4UH 3GMRA 1NUGA 3MFFA 4JQXA 2XKNB 3S3CB 3FBQA 3UC2A 3H9HB 4RZCA 3R18A 1M05A 4PIBA 4YXHL 3VRJA 2VO8A 2HUEA 5HYJD 4P46A 1IC1A 2CK0L 3LS4L 4OW6A 1NDTA 4DUWA 2FWSA 4DWHA 2HN7B 2EXWD 2OMNA 1M71B 1KF9B 2CDFA 2FX8L 1AQDB 3CFEA 3LN5A 4FXKA 1CD1A 5C08A 5DGRA 2WSDA 3V0FA 2XRAH 3LD8B 1SF5A 2FWLB 1MFCL 3DGGB 5F93C 1LK2A 1WBZA 1E4XL 3Q5YA 4JE4B 3QXTA 4DQAA 4Z7OE 4FQ2L 4IBTA 4HWUA 4FAAB 1XF4B 3OX8A 3UEZA 4YSUA 3PWPE 2VLJB 4PJEE 2HVJA 1UACL 3IJSB 4DVBB 3L3KA 3QFJE 2ESVA 4UZSA 5IBTL 3V6FA 3NCBB 4FNUA 3SEPA 2HJKA 4Y1AB 2K45A 4DN4L 1R24A 3LEXA 5DD0L 4R7VA 3VD5A 4D7PA 1C9SA 1ADQH 1EDHA 4JFXA 1KXTA 1MFCH 4A63A 2HWZH 3FB5B 4ZNEA 1KMGA 3WIHA 3IXTA 4XNZC 1HH6B 1IAOB 5E6UB 5KBKA 2LE9A 1T1ZB 3WSQH 4J39A 3DUSA 5C07A 3RWHB 3VI4E 1BXUA 1FGNH 1NMBH 1A6AA 3BEVB 1V3MA 5I1HL 2VQUA 3SGDH 1EBPA 2DMHA 4KMQA 1KLUA 3VSVA 3I84A 3RUGB 3QPXL 1P7QA 2VDOB 3BIBX 3P9MA 1H6EA 2CIIA 4DN4H 4GW1B 4IRSB 1S78D 4AJ0A 5ECGA 3BZ4B 3VNZA 1I8KB 3GMMA 1NFIA 3S3PA 3O6FC 3EG9B 1AC6A 1JNJA 4ANUA 3QC6X 4OM0H 1I7UA 1NCHA 3QIBD 2FHBA 4L5FL 3HAEA 5D7IE 4IBYA 4IGBA 4NNYA 2J6WA 1GS6X 5DHYA 3L3GA 1BJ1H 2BSED 1QVOB 3N1GC 1JTTA 1ORSB 3FU0A 4UM8B 2VLJE 1RH8A 3KPSD 4PJEB 5E9DE 4P4RB 2AK4A 4AYEC 5KBMA 4LSQL 1NPUA 1X7SA 2OMYA 2FO4A 3DC0A 4HFUH 2CHWA 3SJVB 1RZIB 3DTDA 5T1MA 4O02B 2X9YA 3O6ML 5H4YA 3GM0A 4FNLH 4AWJC 4NDMB 3D9AH 1XCTA 5F89A 3SO3B 4F58H 4S10A 3T6QC 3VFNA 4NN6C 2AXWA 1SLVA 1TU2A 2EE3A 5MENA 1Q9LA 1XEUA 5T1KB 2BO0A 2LFEA 3QJQB 2IGTA 4M3HA 2L7QA 1URLA 2BCMA 3ML9A 1LP9F 2FLBT 2YJQA 3CH1B 3HE6B 1AOHA 3OR6A 4O5LL 4UILL 3DX9A 5DEFB 4MA8H 4NERA 4UTBA 3MNVB 5KSUA 1M56B 3MRNA 2CR6A 4M4RA 3QBTB 3HZMB 4XI5D 2F68X 4KI5F 3N42F 2AQTA 5CCHE 4F7CA 2ITDB 1UADC 2A73B 2B59B 2W38A 4QXUL 5AVVB 1YCSA 3RVTD 5AB1A 3W9DA 2G0LA 4OQTH 3JV6B 3UPRA 5K39B 3PE9A 5F89B 4WWKC 3ZKMD 3O3EB 2A6KB 4LT7A 5KYUB 5BJTB 1FH2A 3EYFB 3MV8D 3HZYB 1Q1JL 2EDBA 2DF3A 1OAXH 4N90E 4WV1A 2EP6A 4XPBL 4J3OG 3HI6L 4H0LC 5CCJA 5D7LE 4XO3A 3QXAB 25C8H 4ZMTA 1G84A 3SE6A 1R5WA 2FLRT 4JFFA 4YHZL 4HIQA 3UTPD 2VISA 5AW4B 3QPXH 5D7JD 1AAJA 1QUNA 2YGPA 5EEWA 2W59A 2A6IB 3TVMA 4KTEH 4JFZH 4Y89A 2WXRA 2G9KA 2X7LB 1BJ8A 1P4LB 2A4EA 4WFEE 4XPFH 2L7EA 5L8LB 2HRGA 2ZKWA 1O9WA 4CMHC 5EUOF 3PYCA 5HHVH 2NSMA 5DRWA 2JK5A 3I6LE 5IHUL 5E4AA 2AHIA 1ACYH 3S96B 1W6LA 1JYNA 4OCNC 4LDLB 2OX5B 3DX1A 4Y1AA 4LVEA 3K7UA 1E6OL 1G9ML 4NBXB 5GSVB 4AVHA 5H4ZA 3FB7A 2HMID 2E7HA 3WAKA 4LBAA 1MI5B 5AALA 4HOZA 1QFOA 1FYTA 4WWOA 1ZTMA 2KBGA 3HE7A 4K3JL 2YS4A 3Q2WA 3VFSB 4KJWD 3TVMB 3N5AA 1GXEA 3HNSL 4LKXB 1V7MH 3L3IA 4ZBJA 3VWJC 3RZCD 4QCIB 4GXUM 1CFMA 1GOFA 2BJMH 4JM4L 3L3HA 5CJQL 1TFPA 4H0GA 4OB5L 3FQ1A 3MACH 2H45A 5CIPH 3TEZA 1ERNA 1G7PA 5FB8B 3LPWA 5AOIA 4NN5B 4WKZA 4M1CC 4YSPA 1MHEA 1MQ8A 2DICA 1IC0A 2YOCA 4X8JA 5IV2B 1Z9OA 1E28A 2XBDA 1S9VA 4BINA 4MMZB 5JNYA 1R75A 3EO9H 4WW1B 2OJ1A 1T5XB 4HSQA 4AGQA 5I17A 3QG6A 2XCMC 4ZMAT 3G6DL 3OAZK 2F7RA 5C0CA 1LEIA 3VDCA 5FW6A 4NGHH 1MH5A 1FJ1A 4J3OF 2WWMC 3KGSA 1I8AA 3VFOB 3I75A 4RVBA 5ITFB 3LV3A 1MCQA 4KRMB 4ZRGA 4HCRH 4LSDA 3MXWH 4URTB 4G7RB 3NRQA 5C0JA 5I1IH 4JFSA 3C5JA 4U7SA 2JLPA 3P3UA 1CFVL 5I1DA 1BBJB 4QHKI 3ZMNA 4LVHC 1O6TA 3SO5A 5KVDE 3DX7A 3WLWC 5FGBA 1AR1B 4ZQKB 4Z0BH 3HI6H 1UENA 3NESA 4Y5VC 1NCTA 1ZHKB 4X7TA 1PLGH 3QUZB 3SE4A 3R0NA 3HI5L 1YDPA 3ARDB 4LCCC 3VFNB 1N5AA 2C9XA 4PU2A 1R47A 4JAMB 5IVXA 3LEVL 1MLCA 1FN4B 2Z7WA 3BVWA 3BEVA 3QHTC 2B4CH 5DEZA 1BZOA 3FT2A 1PL3A 3L4ZA 5D6CB 1UA7A 2Y2YA 1MJ7H 3FQYA 3TN0B 5A7EA 2YEZA 5EBLA 5SWZE 3WFZA 2FEEL 1QOKA 1CT8A 3VXSA 3ZQ9A 4AITA 3MRKB 3MLZH 4YBHA 5BRZA 5C0NC 1Z2KA 2YBRB 5KAQG 3BXNA 3CAFA 4H1LB 3EDFA 1LDSA 4OSUH 3I6SA 4YGVB 4APQA 1EDQA 3L3JB 1GW6A 3BUPA 4IBZA 2TAAA 2OV0A 4AL8L 2EH7L 3JWNC 3NJFA 4MNQA 2MPVA 4A39A 2ZKYA 2NOYA 4GAGH 2X4PB 1RIVH 3FO1A 2FQEA 1MFAL 2R51A 4PREB 1LP9B 3QK0A 3D33A 2VITA 3RURA 1ET8A 1TO5A 5FGBC 2NY3C 5HHMD 3LKOB 4J27A 1T6WA 5HHOA 5JOPD 1IM9D 5IB3B 4LZKA 4N2AA 4R8WH 4Y16C 3RVWD 3VFTA 1SEQL 4RNRA 4KHXH 4HU8A 5A2JH 4KVCL 4HUXB 2MEJB 2W07B 2P5EB 3MUGA 4O2FB 3ISRA 1I31A 3QXWA 5K9QG 4PB0L 1QBAA 5CEYB 4AK1A 2GG1A 4PWIA 5CBAA 1KJVA 4YWGL 2CLVB 2ERJB 4PJGE 3NIGB 1S7SB 3B9EA 3VGDA 4D3CL 2XN9E 1MLBA 4U3SA 5KSAC 1LEGA 1YUHA 4UV4H 5I0XA 1W9XA 2IAMA 2MPAL 2YKLL 5DT1L 4AZ8B 3X2QB 4XOEA 1HSAA 3LRHA 5L6YL 2ZP8A 3IRCA 2QDWA 5IWLC 3VW3H 1H3GA 1U8NA 4TUJB 1WV7T 4YHIA 1U30A 2J73A 4ALAL 4ELKB 1WJ3A 1OP9A 5LXVA 4XPHH 3HZYA 2YSSA 3ELAT 1K9TA 3Q01A 4OQTA 2EO9A 4BCXA 1WTGT 3CZLA 4ACTA 5C0AB 3PRZA 1R3JB 2ZWYA 3CV5A 3BKCH 5EU5A 5F3FA 2UXGA 3EJZC 5I26A 1I8MB 5I24A 2HXAA 2QKIA 3ARTA 3G04B 4HK0A 3OKLA 3TT3L 3DSFH 1JZ7A 2W81C 3UYRL 4X5XB 1UWYA 4KXBA 5ID1A 2JQMA 2YPKB 4WW1A 1RJLB 3VRLF 1YJDH 5E5MA 1LEGB 1YUHB 5JHAA 4RSYA 1N5YL 4KI5E 1C7TA 2JLLA 5I71C 3OAZH 2GJJA 3G3LA 4QHNA 5KJRH 5KANI 1WE5A 1RZKH 3FQWB 1D5BA 4GMTL 4H26B 4PRIA 4PRHE 1EHLL 4M9PA 1YUKB 3EYQC 3VXUA 4DEWA 1M6UA 3GSXB 4DKAA 5FFOA 3MXWL 3QA3B 2AV1A 3AQDA 4XNQA 1IV8A 5I2IA 1I7RA 4PLNC 5JDSB 4L8BA 3U30C 1TCMA 3ZHDA 5K69A 3RVVD 1PG7W 3SOBL 3D51A 3VXSE 3DVIA 5EZIL 4ILDA 3MOAL 3VRIB 4MMXB 1DBMH 1M2VB 3OKMB 5K59F 5HDBF 4JMXA 4ZFOL 3KMDA 4NS0A 2DKUA 1JPFB 1KB5L 3SDXA 4EIBA 5I23A 5KJRL 1CS6A 1MLCB 4GP8B 5LQBH 1PU0A 5IB2A 4WO4B 1E50A 2VH5L 3RAJH 1GMEA 2VDPL 3OXRB 3G7TA 4O58H 2QADD 4XBEL 4OCXL 3SYAA 4KXDA 1NGPH 5FIEA 2OK0L 1I4FB 2FJFB 3D0VA 5TPWH 3VXNB 3US0A 3G6JA 5JPMA 1KEGH 1D7CA 4XXWA 2YC1B 4GKSA 3QA3A 1U33A 5ESAB 1UCBL 2X0WA 3EJSA 3BGFB 2ATPB 4ANVA 1A4KA 4J4PA 2E59A 2H0PA 2GBAA 4HX1B 4POZC 1EWHA 1I85C 2NYYD 3QJSB 4UTBH 4Y4KD 3VRIA 4EUPA 5IIEA 4FA8A 3TBWB 2KQNA 2ED9A 4K8RD 4J3OH 2IG2L 1FP5A 5LGHL 5CZVH 1CQYA 3N91A 4TNFA 3K6OA 4XMLL 4A2EA 3OJMB 5KOVC 5GZNA 1NSNL 5KBPA 4QLWA 1NIDA 4FXGA 1C5CL 1QR4A 4MDRA 2HA1A 4PVMA 1OB0A 2MCAA 3FT3B 5DC0A 2PTTA 2DQEH 3EOBA 4J4PD 1ASQA 2OXHB 2UZYA 4WZ9A 3WFHA 2NUPB 2ZYIA 4XXDA 3WNLA 4WWPA 2OMZA 5F3BB 4IOSD 4X9YA 1FN4A 3QRBA 5HDQL 4G6KH 2GSMB 1NBVH 3S5LB 4F8NA 2WQXA 3NCFB 1I1FA 2NQCA 3WFDL 5ELIA 1Z5LB 4UMSA 1B2WH 1UH3A 2AGJL 3VYNA 3QI9D 5CCGE 3KHQA 4M5SA 4DCQB 1VKXA 1RZKL 5G4MA 4GMTH 5FO8A 1DVTA 4I48B 4BKSC 4IOFD 1E4XI 5CF3A 3NQIA 4AVKA 3KJ6H 4K7FB 4YSTA 1G9EA 1A4JB 3TF4A 1BQSA 4HUWA 2VJXA 3GUFA 1T7XA 4TUJA 1BZDA 1ZT1A 2Z0BA 3EYFA 4X8GA 3NSYA 3RJDA 1RZPA 5E23A 1JV2B 4TSCH 4QYOB 3QIUD 5KG9A 4OZ4B 5KEZA 3BZFA 2ZSVB 5T5FH 3SYOA 3VXUD 2G9HB 1JZJA 1HQRA 3MKGA 1F8TL 4PRHA 1ROWA 1UZ6F 4G6AD 5IQLA 4DGIH 4A7SA 4GG6A 1TQCC 3VFWB 1VFAB 4GG6F 3MRLB 3L1GA 5EOCL 1GGIL 1I75A 4RNRB 5BZDA 1KCVH 1P5UB 1WHPA 5DHVH 4EIUA 2XBTA 3MRHA 3MRFA 1ZLEA 1OSEA 4DPBX 3ZIMA 3S96A 5BXFB 2WYZA 2PN5A 3CDFA 4NFCA 1D9KB 3MPCA 1JI1A 1N68A 1JE6A 1KCKA 3RG1C 4QRQA 4XODA 1T0OA 3FULA 1I9RH 3KPPB 3NOIA 4KO5A 4ODVH 3HG1B 1JF1B 2IV9A 1GGCH 3UTSB 5CZVL 4Y1SA 3FUHA 1MFUA 3FRPB 2XN2A 1PNCA 1P84J 3IPFA 4UM9B 3DRTA 1T3FB 3S4SA 3IWUA 1C5BH 2BH0A 3HMXH 4NHUA 4GS7C 4AT6A 3US1A 2X5PA 5DA0B 2WQSA 3L1OL 4FLQA 4JKWA 1A6TA 3QJZA 3EYSL 3D09A 2BOLA 3BMWA 1NGXB 2CRIA 4P99A 2AK4E 5C1MB 2FGWL 1UKQA 2YD3A 3NTCL 5FC9A 2PO6B 4LVNB 3EJUA 4JHVA 3V4VL 2MOGA 1BYOA 4XAWH 4MDJB 4MX7B 4OGZA 3V6ZB 1ZSDB 3OKYA 4OGQC 5FYLH 3CPLA 3RGVD 1SYSB 2G75A 1I7TB 3BYYA 2BS9A 2MIZA 3NABL 4BUQA 2Q6WB 5JR1L 2CBMA 5BQDA 5J3HC 2EDMA 3RX9A 2C9VA 1N59A 2QQLH 3OPZH 4HDIA 4P23A 5D1ZD 3SKOA 2BOBA 4UANA 4I1RA 1CR9L 4H8UA 2VDQB 4LOUD 2FL5B 4EEEA 4QRPA 1G7QA 4GB9A 2AJXL 4Z77B 4LDEB 2A83B 5E8OB 3D87B 1OW0C 4L23A 2C9PA 1RLBA 4P2RB 4ZAKA 4D8OA 4ENED 4HIXL 3TL5A 5DD0H 3SY0A 3VXUB 3T3PE 1AJ7H 4P5RA 3NZ8B 1R24B 1JWSA 1E9OB 1IAIH 1TZOA 3RUGF 5DDHA 4EDXB 3V0IA 3B9AA 1KEMH 4AOFA 2NNCA 3KPOA 2EE6A 4NM8L 1MRFH 3OVUB 4L0PB 3H7BA 4KJPD 2IANA 3P0YH 4MNHA 4FP8H 2DQEL 2YGNA 1QNZH 3NK4A 3ATDA 2BM3A 4MXQC 4UOJA 3VDBA 3NFPB 2NX5A 3D85D 4JFYB 3U36B 3A4EA 5D55A 2WCGA 3BZ5A 5AL0A 2D03H 5E1IA 4M8VA 2JKWA 1EMTH 2ZKMX 2ITFA 4NNPL 1ZRUA 1MCDA 4LGPB 3DETC 3FT0A 3UTSE 1QO3B 3VI3F 4QTIL 1BM7A 2IPUK 3H3BC 5GIRA 3WFEH 2AC0A 1AP2B 3SYPA 1J5IA 4NKIH 3QB7C 4GY4A 1CD9B 3MCKB 1U8JA 1SM3H 2R2CA 5DCCA 5MERB 2DJSA 2DYPD 5DVMA 4KTGA 2NZIA 3EDJA 1W0VB 4TL5A 1IAIM 2QPEB 3RX7A 3CWGA 4BZ2A 5FDWA 1ZCRA 1E4KA 2ZSWA 3EJCA 4OFDA 3ET9F 4HETA 5CD3A 3CVHA 1IQDA 5IFJB 2NX5B 3N1FC 2VITB 4JFYA 3GNML 4MCYB 1TXKA 3DV6B 3MNZA 4MA1C 4BELD 4RFEB 1HKFA 3EBIA 4FQLL 4YHNB 3D3VD 4OF0A 1M53A 1O5DT 1V10A 1DQJB 4QDGA 4HVBA 1T89C 5K9OB 1FIGL 4IRJB 1AI1H 5HGDB 3CZFB 4LMQI 2C3HA 2H32A 2VR8A 2OMWA 1EHAA 1TFHA 4FZEH 4HHAA 4UT6L 3R1GH 4JHZA 1XIWA 3QUXC 4PJXB 2ADGB 2PCFA 2VNCA 5C97A 4RGNE 4XCYB 3FUNA 4ZOEA 3PWPA 3QIUB 2D3JA 3F7VA 4ZPTB 1YEIH 4QGTA 3BLPX 1N67A 4FRWA 3EGDA 3UO1H 2J7LA 1XGZA 2A6JB 1L9MA 1CGXA 1TYRA 3Q44A 5B1JA 2IWEA 3JWOL 3K8MA 2LAAA 4HFWB 2OYKA 3MNZB 2FEDC 3UTOA 3MJ8A 2ICEB 4G1MB 4HKXB 4IHOB 4YL4A 2G30A 2QMJA 3JZ7A 4NN5C 5JHDA 2Y5TB 3UPRB 4O4YH 3LQZA 4OZGB 3R8BB 5C0RH 1AQ8A 1VZGA 4RQQB 3TO4C 2YUWA 4JY6A 3F04A 1CDIA 2VLKA 4QYOA 4WWKD 3ZKMC 1KCLA 25C8L 3IGFA 4M48H 4EO5A 2P3YA 4H13C 1OAXL 1MLBB 3HW7A 4LCWD 4U3SB 5SWSE 1FCCA 2HJLA 3BDYL 3BAJA 3JVFC 2VXTL 3QJFB 4MJIE 1DBJH 3FUIA 5F9JB 3RGVC 3UCQA 5GS2D 5BQ7B 4ZMPA 2K4WA 3LN9A 4OUOA 3UYPB 4WIQA 1AHWA 2H5UA 4U7MA 4A37A 4Q9CA 5HTSA 1OAJA 2ZUQC 1T1WB 1BECA 4DP8X 1OVZA 2A0LD 4YFDB 4DPRA 3CZGA 3TV3H 3ARDC 1IVLA 2Z34A 2BNQA 4DPAX 1ZA3B 1JDCA 4TVPH 3QWRD 2XNAA 1ES0B 5FYJU 1Z9SB 1CLYL 5JIMA 3ZKQD 2OJZL 4OD2B 2C5DC 1DCEA 1KNOB 4ZODA 5KVGL 2CO7B 2PXYB 1QI5A 1QTSA 2J4WL 3MNDA 5E2UH 2JKRM 3B83A 5TFSH 1X5LA 3HB3C 3SDYL 2VDNH 3GXUB 3P9WB 5IB1B 4OB5H 3EH3B 4P05A 3DX2A 2VL4A 3O3UN 5MENE 1FIGH 3KDMB 5EIIG 2HRHA 4ICXA 4NQEB 4K8RH 4ZFOA 3HNSH 5T1LA 2DI7A 2ICEC 4JQVA 1PKQB 3LZFH 4B9IA 1RZFH 2EKJA 4Q6IB 2VN7A 1CICB 3FQ2A 4JANA 1FG9C 3UG4A 4Z8FL 4P06A 4OFYA 1RU9L 5ESAA 2EUVA 3IU4L 4QAMB 4B50A 1A7PH 5E4IA 2R39A 1X4ZA 4XNMB 3ILQD 3C9NA 3D3VE 5FHAL 2IPTH 3ATAA 2YA1A 3CXHK 3ZKND 1IC4L 4E42A 5E8PB 4HUKB 1MFAH 3ARQA 2YUXA 5I16B 1EHNA 1ZTXH 2J25A 3CE1A 2BPBA 4M6MH 4RLDA 4IIQA 4LRNH 3PABA 2A83A 4AUUA 4LVOC 4N9GB 5D1XB 3C6EA 2YXFA 4E5XA 1OCZB 4KZ0A 3D07A 4ZAKB 5CD3B 4J1UB 4GI6A 5I6PA 4M1DL 1F2XK 4QRRD 4PY7A 4QHLA 2AEOA 1BZ7B 1DUYB 1OCWL 4LKCA 2WHVA 1FRGH 3KPOB 2JSFA 5E8NA 5IEHB 5EULV 4DK5A 2EIZB 4X2UA 1USZA 4GQZA 1AYRA 2NSXA 5KYWB 3H7LA 4L3FA 1DL7L 1DBJL 4R4ND 4CU8A 5LHDA 4DEPB 2IDUA 3GMLA 1T1XB 2H1LM 4K2UL 5EEVA 4KX7A 2W60A 3P4OA 3W0WE 5I0ZA 1CYXA 1KPVA 4IQHA 1A2YB 4WEEA 2NT0A 3L4WA 3RWGA 4NHCL 4S2SA 5JIHA 1EDYA 3BPOB 4S0SD 1M1XB 2X2YA 1FBIH 1E5ZA 1WCBB 4MJHA 3LH2H 3WDHA 2Z91B 3C6LA 3BWUF 3CXHJ 1NC4B 4ZSOB 2VLRE 5SWSA 1A7OH 1P6WA 3GSVB 4AC2A 1FYTD 1OP3H 4EVNB 4NPYB 4KO6A 5FGRA 4HV8B 1ZWIA 3CFJA 3FN0L 2OL3A 4XVSL 3K5SA 5FO7A 4HJ0C 4OLEA 5EPMB 2WBJA 5BOJA 4ZZFA 4RAVA 1UKSA 2FB4H 5D4JA 1Q72L 2VXQH 4M6AA 3MNVA 3N06B 3RNQA 5CGBA 1BHGA 5EF0A 4N8VA 5CGMA 4L9LC 3QWQB 2NY1D 3EJYC 4TTGA 5L0QC 2BSBA 3SGKC 2VN3A 3F58H 4PMFA 4B5EA 3QEHA 4HUWB 2ARJA 3ETBF 3MFFB 4BWTA 3QZOA 2ENSA 3ALPA 4AIXA 3NJNA 3O3EA 3RWCB 4L9DA 4WTZA 3DX0A 4LXFA 5CEXA 1KTRL 4PB0H 3IJEA 4X6CE 5JZ7C 2JCCF 2GUOB 4KY2A 3ATFA 1VB9A 3BZFB 3DOSB 3QCVH 3ESUF 4H8VA 4WY7H 4YQXH 1I3VA 4I0PD 1G1OA 2G9HA 2VUYA 1YEEL 2GAZA 3U0TA 1YN7B 4NJ9H 2ENYA 1F02I 4ZMWA 1VEOA 2NY6B 3F7YA 1ES0A 5TGBA 2PO6C 1RUQH 3ATBA 4LVNC 1CDGA 4YDKH 1HAUA 2EXYC 2VH5H 4X7FC 5DFWH 1A66A 4PRPD 5BS0B 2HCZX 3OKNB 3FZUD 2VR3A 4DK3A 5DSCA 4LKXA 3N9GL 4XO5A 1BVKB 1RZJH 4NCC2 3C5ZA 2QHRL 2YMOA 4OUUB 4HK3N 1ZVSB 1WWWX 2XACC 1F86A 1A6WH 1TDQA 3K4ZA 3OKKA 1B4RA 2D8KA 1KJMB 2DB8A 3ALXA 1T5KA 1KCRH 2CDEA 1U3ZA 4FN0A 2X6MA 2Y7OA 1VFBB 1Q9KA 3ECQA 3PWUA 1P7BA 5SWZA 4K9EH 3EFOA 4YDZA 3ZPDA 3LH8A 3GS7A 3WMPA 4HPOH 3IU4H 5BRZE 5I1AA 3QEUA 3F7QA 3SDAC 4FG6C 4OCMC 3BDYH 4N1CA 2F8VA 4PJCF 4HULB 3OMIB 2FSEB 2F5AH 3J27A 3VFVB 3WUWG 3FQWA 1NKGA 3HKFA 3TN0D 3IXAA 1TVHA 2FZ3B 4WUUD 4AQ1A 3RVTC 4I5BA 1BD2B 1KELH 4D8PB 1DVUA 1ETB1 3RGHA 2X9XA 4FFYA 4GW4A 2XN9B 1Q1JH 4KJQC 4IK6A 3FQXB 2V7NA 3K6IA 4EBQH 4EN2A 3GI8H 3HZVA 4ABQA 2MNWA 2JTYA 4MZRA 1PF3A 1NBVL 2XWEA 2XC8A 3RDTB 5I1HH 2ZOLA 3WUZA 5L9DH 3RVVC 5EEYA 5CMAB 4TNEA 3CVHH 1E5AA 3ZN6A 4F5CE 1KULA 1J0YA 3IMUA 4FXKC 4O58L 4XBEH 2PTUA 2V5SA 5EDXA 3WTTA 1U8MB 3OXRA 4EOWL 2FO4B 4OF8A 5LQBL 5KN5B 3RX8A 5DZ9A 4WNQA 5CZXC 1FQ9C 2ZCKH 3HG0A 5AAMC 5JMOC 1EEZB 4PP2A 1RULL 2WUCL 5A6IA 5DI8B 3AW5A 2PPFA 3LEYH 3ULSA 1G5GA 1NKRA 4KQ3L 1WDAA 1RZFL 5T5FL 3EO0B 1JBJA 4ZJ9A 3SE3C 3GLDA 4QR7A 1L5GB 1UZGA 2P48B 1A7OL 4YSDA 2C34A 5FUZL 3VACA 3ECBB 1KJ2L 4QNPF 2CMRH 3HPLB 1IARB 1AGBA 4XVOA 3V6OC 5C8JA 4MYPA 4OZIB 1MCWM 2ZYHA 2R2EA 5F7DB 3AITA 2NPLX 4WU5A 3CCHA 2X38A 3UTZA 4DGUA 1NWPA 3UOAB 3DV6A 5F1SA 3ZTEA 1FZOB 3QIWB 3TJPA 2F53B 3U7WH 4LBEB 5GRYA 3EYOA 3ME0B 3VGEA 5K39A 2GPZA 3A4FA 3FOMA 1PCXA 4L5FE 1HHHB 3UJJH 3WSQL 5LGJA 5HDQH 3CVIL 4BK8A 1SLWA 1VERA 3NMEA 3OKEB 3FUKA 4O2FA 1QR1B 4IYKA 1G6RH 1NLBL 3BPNC 1F6LL 1TKWA 1HIMH 1XXDC 2DQJL 2PCPA 4H25A 3KPRB 4PGDB 4ATTA 4JKMA 1FO0L 1JPGA 4KC3B 1BD2D 4K55A 4PW3A 1P6FA 2PABA 3LIUA 3NAAH 3SPCA 3INOA 1NBZA 4LLVA 4NEHB 2AAAA 4FULA 2A6IA 2YUVA 3WEBA 4AKPA 1EZVY 4MKMA 2O5XL 4AZ8A 2JF1A 3U48A 4X0KB 1AIZA 1OV8A 3QJRB 2DJMA 2IMMA 5B1CA 2R83A 2UV3A 4M6NL 4P2OA 1A6VH 3FU5A 2DQFB 2CSPA 2EO7A 2H26B 2ZYRA 3HI5H 4GSDH 3AROA 5INCA 1IE4A 3ULVF 4OCWH 1NCJA 3N85L 4GEIA 4YSSA 3B5HA 3BH4A 1OSZB 1KJMA 4PJIA 2IPKB 4QJ4B 3O2WL 3GXNA 1RJLA 4K9EC 3G6JE 2VLLB 2HT2D 2DJUA 3D2UA 1KIUB 3D4ZA 4LPXA 3P0VH 4L29A 1R19A 3F58L 1CFNA 4M6OL 1F4YL 3HR5A 4PGCA 5DQ9A 1SY6H 3K4DA 4HUUB 5C0AA 1YSOA 5DHVB 5ISZA 4PW4A 3I9GL 5EU5B 3T0EA 4CN4A 4AGMA 5JIQA 3SDCD 5CN1A 5I19H 5M95B 1V27A 3BJ91 3CUPA 1FL3A 4PLKC 4RMBA 5G5DA 5C08B 1EVTC 1JF1A 2JELL 3O2WH 5GZND 2JJSA 4MAYB 3WKYA 2J44A 5FCSH 1GMIA 4OZGE 5KZCB 1THCA 4FG2A 1RK0B 2CKNA 1X4YA 4OJAA 5E2VL 2BOCB 1CLCA 1XX9C 5ITFA 1SJHB 4PJ7B 4B7LA 5IBLD 4LLWA 2MQGA 3GSUB 7FABH 1PZ3A 3GLEA 3N1PC 4NKIL 3CFKA 1JVLA 3FH7A 1I3GL 1OXYA 3B9KC 4OLXH 3VXNA 5CR1A 1AXSB 4KK9C 1P84K 4MX7A 3V6ZA 5D7LB 2H6PB 4CSPA 5JOPE 3KAAA 3VU1A 5D96B 1GYWA 3CBRA 2OMUB 1Z3GL 4R83A 3DHPA 3P1VA 2AJXH 4X4ZA 1LDPH 1WZAA 2BOBB 1AD9A 3GKWL 1EXGA 2YRPA 1TPXB 1IKFH 4N8CL 1J9SA 3JTTA 3RWHA 4ELMA 2NY3B 1WICA 4XE0A 4KV5E 5L7XH 3QEQB 1ZGLP 1MELA 1N9PA 4RSVA 1D3CA 4OR1A 3OHMB 1KYAA 4EZLA 1S6NA 5J11B 1BG1A 1YNTF 1CZ8H 5J57B 1OIOA 2YLKA 2XVBA 4LVOB 2B5IB 3QCUH 3NFNA 3QR2A 1ZY9A 5LUMA 4QY8B 2CIKB 4L48A 3FQRA 3STLB 4X8CA 2V2XA 5F8QC 3UL4A 1YNLL 1LNUA 1W8NA 4RGNC 1U8LA 4U2YA 4UTCA 2VLRB 2A4CA 1QFHA 2BDNL 1DJGA 4MSWA 4Y8DC 3AM8C 2JTDA 1YPZF 1BAGA 3KPRA 7TAAA 2ZZUT 4QOKD 1MW2A 4PY7B 2YARA 3T1FB 1FDLH 2NY1C 4K23H 1M3IA 1M2OA 3L5WA 4MB5A 4TVPE 3WFCL 5J89A 4KWUA 2BSSB 4J8QA 5GGUA 4MD0B 3FJTA 3G6DH 4GT7A 1CFSB 2BMKA 1TJIL 3DDFA 4B7IA 2OMTA 5DJ8A 2EVIA 3Q2NA 1TEFA 4FJYA 4S1RL 4G9FB 5JW4M 1TJGH 3APNA 4APXB 2BWIA 4JDVB 5EIVA 1F1DA 2PXYC 2FECI 4E9VA 1N0XL 4ZFGL 1WEJH 5FO8B 3SDCA 4IOIA 5CU9A 1OTSC 3SN6N 4YXLH 2EIMB 4ZW5A 5INDB 1NCOA 2PYED 5C0CE 2N59A 2ZX5A 3ZDZF 5L4IA 1BMGA 1XR8B 5MEOA 2FX7H 3RVXC 5DMGD 1BOYA 2YXWA 1U93A 4X7EC 1JZ6A 1XQ4A 3VFMB 4A6YA 1G6VK 1UXWA 2F7IA 2YQGA 3GBLA 3CSYA 5DVKA 4DHLA 5KVEE 3ESMA 1CQKA 4P5TC 2H1PH 3OB0H 4APXA 2KZBA 3GK8L 1YC7A 4LQ1A 4Z3FA 3BKML 3EH1A 3PJSA 1LWJA 2UY6A 3TT1H 1CB4A 1R3IH 2DTSA 1FORL 1PKQE 4QXWA 3QJXA 4K8RC 5HHMB 3ZRFC 2VQ1A 1QRKA 5IESH 1OO2A 1PY9A 3VWKB 1ZHBB 5DS8B 4U1HB 4N87A 1D7FA 1P5UC 2DM4A 2IFGA 1KN2H 4Q14A 5C3LD 1C1EL 2DM3A 3GRBA 4MAYC 1ZK9A 2WIIA 2WVUA 4PHXA 1HYSC 1DANT 2WGNB 2W9DH 3P3TA 3QXDA 4RGMB 5FHAH 1BG9A 4WENB 4L8BB 2IGFL 2PF6A 2X70B 3HUJB 4FNQA 3TA3C 1G9MC 1U36A 1J12A 5F88B 2H6PA 1F3JB 1WWBX 2COQA 1XSJA 2Q9OA 3V0DA 3KCWA 1GZQB 2DQIL 1F90L 2LU3A 4AZUA 5B22A 3ENEA 1BVNP 5D93B 3VH8G 4G7VL 1DSFH 5B1KA 1IT9L 4OKVB 4ABVA 5IHHA 4M7LT 1SLXA 2WAHA 5BV7H 3DOHA 3VUAA 5ISZB 4O2CB 3WIAA 2WLZA 2AQ1A 3AY4C 1SY6A 1B3IA 5BZWB 2Q86B 3T4YA 3DX8B 3GC3A 3KPRE 5EO9B 5FO9B 4JREB 5EIIB 3KYNA 3GBEA 3T8XA 5AYTA 5AKRA 3I74A 4X6DB 1JZGA 2MKWA 4BFGA 4OF5A 4XCFL 4Z9KB 3D50A 2CO7A 4K3HA 3EFFB 4YN3A 2K78A 2VW6A 5F0MB 2W92A 3MRGB 4JUTA 5GS0H 3OPUA 1NEZB 2YMXL 4TL4A 3QUMH 3EGSB 2DDQH 4PEEA 5E56A 4LLWB 5KSBB 1QSEB 4NQSA 5ADOL 3FU3A 5I6MA 4GXVL 2XN9A 1UQSB 1E27B 4XVJH 2R56H 3F62A 4K8RL 3RY5A 3HOGA 4LIQE 4OZIE 3BSGA 2KLRA 2FQFA 4J5VA 1SEQH 2BZDA 2BIIA 1E3XA 4CILA 4WSJA 3A5VA 5E2TL 4XP9H 5J6GB 5CCKL 2FK9A 5HDBB 4MNHB 4HS8H 3AT0A 1Z9MA 5JHBA 1AXIB 2ZX8A 3AB0C 1BZ9A 3ZKNC 3LRSA 1R3LB 2B0SH 1H3UA 2HFFB 2JNZA 2RGSA 3F84A 4K7PL 4NWTH 2HPTA 4AV0A 4D7BA 5HYJB 4HKZB 4L9LA 3KPMA 3W0WD 3ARBC 4NUMA 3B1UA 4QF1A 4PBVC 5GZNC 4MA3A 3HNTL 3AU1B 3M07A 4XWOD 4XMVA 1HZHH 3O4LD 1CT8B 3VW3L 4MQ7B 3MOAH 3QEGH 4ODUA 5K9JH 4JGNA 3RWDB 5AAPA 1MJUH 5E5UB 5E8NB 3CZFA 2E9BA 1J1PH 5B8CB 2APSA 2OMXB 3UPAA 3VFUB 4HOMA 5J6GA 2IWGA 3GBNL 4YMPA 3HE7C 3KYKL 1UVQB 4BFBD 1LNUB 3ETTA 1WBYB 4N8PA 4NHCH 1TJMA 3Q8EA 1A1OB 5KBNC 2Z65C 2Q0ZX 3K0WA 1MFEL 3BT0A 4U1GC 4ZPTA 1I8LA 1AIFA 5JW3H 1CYWA 2VISB 3FH5A 1VCAA 3CLEL 4NSKA 4DPCX 3IFLL 1YJDL 3IGUA 4HKJA 2X4PA 5B1JC 5J13B 5AYQA 1ZLVH 5T3XD 2GW5A 3ISWA 2LOEA 1D5ZA 3MJ8B 2F54B 3JSSA 5CBEB 3HFML 4OV5B 1GOGA 4OJFH 4J3BA 3ULVD 3QDJE 4I85A 4NXKA 5DFVD 1HWWA 4WHTB 4JO3L 4Z7WE 5F0PB 3VFUA 4E9XA 3SYCA 3MV9E 4A2DA 5BUAA 4YSQA 2X3AA 2CGZA 5AAWC 3EFDH 5I0DA 3TNMA 5IT2L 4FD0A 2WJ5A 2WD0A 1IKNC 4UNIA 3KHOA 2E86A 3PWPD 4K07A 1FF5A 3HCVA 1PY4A 4GAYA 3UTPE 2WBWB 3QW9A 2YQ2A 3ABKB 1H3PL 2IGFH 4PJFB 3ZE1F 4G8IA 3ZT7A 5JOFB 2Y6SD 1NGYB 4PRAA 4B9FA 5B38A 4ZFGH 2Y6TE 1I8IA 3KLDA 4F15B 2QADC 5A2LH 4XWGH 2BS8A 1BCIA 1TQUA 3CDCA 3Q48A 2YWZA 1IM3A 3LHPH 5CCKH 4NO2A 1X7QA 2UY7A 3ARVA 4I2XA 1J5OL 3UC0L 1GKOA 3RWJA 4F92B 2B1AL 1TZHA 5C6WH 4K71C 3RFZC 1S9VB 2YA2A 2BS71 4OGAD 3HG3A 5CILH 1RZ8B 1ETZB 4JFHD 5E94B 2HKHL 5SV3A 4HJ0D 5ABAA 4B9GA 4BWWA 3F7KA 2IFFL 4JE0A 1OPGH 4Z7UB 3B37A 1MAML 2QHLA 2UXTA 4GMSH 2E9JA 4LEXL 4MMXC 3WELA 5C0DA 3OZ9H 4UIKH 2X6AA 1I8IB 2JKLA 3I75B 4NZTL 4HUUA 5AZ2H 1NEZA 3RVWC 3MJ9H 2XYBA 3D4YA 5D1XD 1OD7A 1A3RH 2AJSH 4LLDA 1ZTXE 1AQMA 3IN0A 4GRMA 3PGDB 3W0WA 5A2BA 2PW1A 1WZKA 1MWAB 1S3KL 3HUJA 3QFJD 5GXBB 2CPCA 1R3HB 4JEGB 1ADQA 3V5DB 2JB6B 4NO0A 2HFGL 2WKLA 5D70L 3UO1L 3DVNA 1HFUA 4JPIB 4OKDA 5DUPH 4R97C 4PBXA 4JJOA 3AU0A 3EO9L 1IM3D 1WYJA 3DBSA 2IBZY 1K8IB 5EUKB 3QORD 3IDIB 1EHXA 2Y0SA 3MJ9L 4GS7B 1EEYB 1JWMB 1B4JH 4HIJA 5PCYA 3VRJB 3P4MA 1EJ8A 4IW4C 5DVLA 1KJ3L 5F9WB 3TEYA 3L4YA 4GLRH 2VDKL 3NSFA 3TN0C 1G7MA 2ATKB 3BDBA 2DYSB 4N2MA 4JFDA 5AW1B 1P5VA 1RUPH 2C3WA 4L3CA 1UB5B 1JL8A 2J88L 3ARPA 1M7IA 2DAVA 1AZBA 3PCYA 4HMEA 4YDIH 5CP7A 1WC7B 2XETA 1J10A 3NEEA 2FX9H 3T65A 3IDNA 4JY5L 1G9MH 4PWKA 4HX1A 1U3YA 3NAAL 2QMKA 4HP5A 3RIAK 5KYXB 2ORBH 4E41A 4MJ5B 5TH2B 2OS7A 2N7SA 3GSQB 3II1A 4LMQE 4DGWC 4JO1L 1AIFB 3H9ZA 4NWUL 1KJ3H 5FHBH 1CFTB 1G4MA 1YNKH 4KK8D 3S3JA 3K6SB 1DVFB 4XP6H 5IFAL 2J2ZA 3MQIA 3AC0A 4ETQB 2R0ZL 1T6VN 3I02B 4LHQB 5DURB 1H6TA 3RNKA 3SOBH 2HRLA 3N1MC 4C4KO 3STLA 2MCPH 4ZFFB 1JFQL 3GS4A 4WSGA 3CFUA 3ECBA 4PV8B 4EN3A 5EPMA 4M43L 2Y9RT 3JTSA 3KYMB 3L8QA 5IMOB 3QVAA 3CGTA 1EIBA 3QG7L 3KPMB 4G8GE 4M56A 4K15A 1PZCA 5HYFA 4GAYB 3KLLA 4PI2A 3H1ZA 2EZ0C 1RIVL 2K8QA 2WQWA 1CG9B 2ADIB 2AJ3A 3HJ0A 1PJ9A 4PJ8D 3ESVF 4WUKL 3T0AA 5EU6E 1NFKA 4N4YB 4XRCB 1ZE3H 4QRPE 2Z7ZA 1SJMA 5JHLA 1MJ8L 3MRJA 2RIKA 5BNXD 1CL7I 3HAEB 5DJYA 3C2AH 1KCSL 3EJQA 2W0FA 3RJQB 1F0LA 3UDWA 4M43H 1P7HL 4PR5A 2AJZA 3HS8A 1WS8A 5I6XC 1G6RL 1NLBH 2OTUB 1PX4A 3KYMA 2W0LA 1EZSA 1BD2E 4NSKB 3GJFA 3ZGHA 3S5LG 2UY6B 3P30H 5HHPA 2XBZA 2QQLL 3OPZL 4FQHA 5LG6A 3O6KH 2UVEA 4M1DH 2Y1ZA 5SWQA 2VZSA 3MRMB 7FABL 4Y4KA 4MA7H 5LBSA 3KL3A 1J8HD 4FQXD 4JREC 5LVEA 1MAMH 4GMSL 1MJJB 4LEXH 5AB0A 5L6YH 1NEPA 4MTMA 3VD3A 3ZYJA 4MXWL 5AZ2L 1AOZA 1DQLH 4D9RD 3V8CA 3FAXA 4WK0B 5DRXB 1A3RL 2AJSL 3B2DC 4L4TD 2LW3A 3IDUA 4GRLB 4F9PC 1RUAH 3CHPA 5TF0A 1UXLA 3SQOL 2MOVA 3LPOA 1GZQA 2H4EA 4WK4B 5EO1B 2HFGH 2F53E 3ZDXE 1ZLWK 5HDLA 3ZR6A 3V2AR 4NQEA 3Q6FB 4EDWL 1S5IH 1EO5A 3F05A 4NXSA 3WXWL 1EEYA 1YEIL 4YHOH 5BJTA 2OM5A 3D85B 1GW0A 3PJLA 4IMLB 5D7KD 1OF0A 5E2JA 4V2BA 4E41E 3EF4A 3SGDI 1KCUL 4FFTA 4J7RA 2AI0L 3FUDA 4RDBA 2QSQA 2FB4L 1ID5I 1UA6L 3MNWA 5E4EC 3DSNB 1J8HA 4X6CB 2CA4A 3VXPB 1WC7A 1OKEA 1U21A 3WFCH 3HPJA 5EUOB 3QI9B 5C07B 4F8QA 3LIZL 1Y1DA 1LLAA 5ICZA 1CXEA 1ULVA 2K6ZA 4IJTA 5FO9A 3L54A 3ZDXF 4PP2B 1RKRA 2VXTH 1XH0A 1Z5HA 5DEGA 1KIPB 3PNWB 3O6LH 4GW1A 4HWZA 2AEWA 2FTAA 2M26A 3ZYIA 3RJOA 3ZT5A 3AMKA 5TPWL 5D72H 3IBOA 3ARGA 1A8ZA 5GHWL 4K94L 2I24N 3HI1B 4BSVA 1U8CB 3FCSB 1VGKB 4N2KA 4K71B 3RFZB 3I6KB 3V9EA 1U91B 1KPVB 3SDXF 1JFQH 4NKOA 4GAJH 5D70H 3L3GB 5ENWB 4AVJA 5FECB 1FVCB 1OCWH 2EYTA 4N20A 3RE0A 2R9HD 3P4MB 2EEDA 1UOVA 4TQHA 4WI0A 4ZS7L 4EN3C 2HAZA 3QDGD 2OI9B 2QADB 3Q8AA 2NLJA 2YN5A 5FF6B 4FMFA 4HJ1A 1YMMD 4PJIE 2DQDL 2VW4A 5DRZA 4LOFA 1T21A 5EN3A 1CBJA 2AXGB 4Q58C 3KS0J 2H41A 3VXMA 1CD0A 3AS0A 4EQ2A 4JRXD 4MVBC 4PWEA 1AS7A 1L5GA 2H3NA 3O8XC 3D25B 4ZT1A 4D9LH 2C1PB 2IGLA 3CXDL 3NJVA 5LGJB 4ZUTA 4WUKH 2CAKA 2CE6A 5MENB 3TGXA 2LGNA 2ADFH 1E90A 3V10A 5KSBF 1IC5L 1W0VA 1ZXKA 4CSSA 3VB9A 1JF5A 1NCBH 1XXFC 2X2IA 2FT8A 4NUPA 5EOTA 1CE6A 1DJHA 1QLFA 1R1CA 3T4AA 4PTUB 3O81A 3G5ZB 3UZQA 3L16A 1S4IA 4HYTB 5LXGL 2VKXA 1KLFB 4JVUA 3CVDA 1IBYA 3NJGA 4ODUB 2XG5A 5FK9A 4GINA 4CN1A 1GC1H 1TNNA 4HJIA 3FB6B 1B0IA 1P5UA 3FO2B 4H0IA 4OCXH 2NY4D 3CFCH 4AYFB 3QFGA 5EN2A 2UUDH 3FBKA 4F91B 4UQIM 3CMOH 2X6CA 2XXCB 4C56E 2F5BH 4S1RH 1AE6H 1CTMA 4UQAA 1GCYA 1O7VA 1OAZH 1JOIA 1YMMA 3JT2A 1UCTA 2AK4B 2V5MA 3D1MC 4XVUC 4IOIB 1S7QA 1CDCA 4IDJH 2EIJB 4FNLL 4LF3A 1MCOH 2W9EH 1EX0A 4WHCA 3MJ9A 1DE4A 1YEGH 3DX6A 5I0VA 4FE9A 1YHPA 1XH1A 4LEBA 3RWEA 5A1AA 3EOTH 2Y7MA 3A6CH 3EJPA 5FUOH 2XFGB 2P5WB 4M62L 4P59L 3WEMA 5A2IH 5IG7A 2ITCA 3FCTA 2G3XA 4J28A 1X5HA 4PUBH 3SPGA 3BT2H 3F00A 4F15C 1TQSA 2OX5A 4HBCH 4MBOA 1E8XA 1FLRH 4HWEL 2YMXH 2WLJA 4M4RB 1KTJA 1YMMB 2A77L 2FHCA 5AYUH 1A9EB 3O6FD 3L3OC 4DVRH 5JIDA 4L29B 4Y19A 1CI5A 4XNZB 4XMZA 2EIEA 3BFQG 1KCBA 1FO0B 2ZOTA 3HHMA 4IBLT 2QVIA 4JO8A 3TPKA 4EIGB 1RD6A 1AHWB 4J23A 5I6XB 1JYVA 4TPRL 4M61B 5DUML 5D5MF 4FQCL 4DAGH 1KYDA 1ZEAL 4QMEA 1TTFA 1M9SA 3QXAA 1HYSD 4Z7VF 2Z31A 5C3IA 3QULA 3RVUD 1KJVB 2NTFA 4MB3A 1G7HB 3QDGE 2DEYX 4P23C 4NC1E 4ZOAA 3BFOA 2WKGA 5DWPA 1E9PB 1F90H 4XNYL 3QC5X 2XQYG 3L7EB 5C0DB 4Y7OC 1ZGLB 1CWVA 4NLHA 4PJDB 1L9QA 2NW3A 4Z5RB 3CHXA 4PS8A 1LO3H 3GXPA 4BH7A 4AEEA 4IU2A 2F08A 4JM2B 5CJ5A 4JPKL 1AQHA 2WLLA 2GSGA 4NN6B 2DN7A 1I1CA 3D8MA 1AGDA 2XU9A 1OSPH 2BHZA 2GC7C 1U8PB 1EGJA 2Z64C 1YA5A 4N2IA 3VXQB 1CK0L 2R9HC 2X1QA 2XX0A 1M71A 4FXKB 5JORA 1XGTB 2GTZA 4MXVF 4Z7NB 1G7LA 2IJ0C 3M7OA 1W6WA 3OWRA 4RMWA 5HY9A 2Z35A 4G42A 5IF0B 1RV6X 3CFTA 4MS8C 3O41A 2BVQA 4NAMA 4J2QA 4PJ9C 2XIBA 1I8UA 1NOAA 2DDQL 2XFXB 5J12C 1WAEA 3ABMB 4M7JL 5KS9F 3HG2A 1GJUA 1ZGLM 5GS0L 2XOTA 3O3AA 4LDOB 4NJAH 3GXIA 1T04B 3HRZA 1QSEA 5IW1A 4PCKA 3MOBH 4PTTB 1LWHA 4WKZB 1SFHA 3S2CA 4WGKA 3R1GL 5I8KH 4PJ5D 1MXGA 4FADA 2XICA 1JXKA 4OSUL 3H3PL 4U6TA 4YXKH 5HJ3A 3VWKC 3TF7C 4TVPL 3RIAF 1KWGA 1YMME 4ZS6C 4BFNA 3WD5L 3CZSA 2BMKB 1F4XH 2FYYA 4DUXA 1GC1C 1Z32X 1OGPA 2I07A 2FECL 4L3EA 3ZZQA 4DN3L 1EZVX 1R5IB 3SBPA 3DIDA 2AEIT 2B0SL 4WWKB 4XCCL 3DJRA 2WLIA 4LSTL 2DWEB 5TH2A 3GEFA 1KC5H 4KNSA 3RTLA 3LRSB 1VCBC 1CVRA 5DQDH 5AB9A 4N0UE 5KVEH 1T04A 3HRZB 4DF9A 1T89A 3V5HB 4S2SB 1QEWB 2YN3A 2WLYA 4PJ8B 2NY0B 2BRRH 2JXMB 4BHUA 1T21B 3V4PA 3ULVL 4KKZA 4N2LA 3EZ8A 4XTRD 3U1SL 1CTOA 5F7AA 4QJ5B 3BCFA 3S34L 3VG9C 3V79C 2D7PA 1Y07A 2EXTA 2VLME 1HDMA 1LILA 2I07B 2VDQL 3T6WA 3UADA 5K9JL 4UTAA 1E4XH 4NZUL 3ZIYA 5IW3A 1GYVA 4Z23A 1UT2A 3QH3B 3MFGB 4ZTOL 4OZFG 4B6ZA 3TBWA 1SJXA 1QVOA 4LLQA 5KVEL 1B4TA 3K5RA 4UWQB 3TIEB 3Q06A 3BT2L 3MV7D 1UOLA 2A99A 2ADIA 2AJ3B 2Y1YA 4GSUA 1JNHA 5IBTH 2HJFB 4ODHH 3VWKA 15C8H 4JZOB 5DS8A 5GGSB 3GRWL 5AYUL 1C08B 5IP4A 3FQNB 3LZNA 1CBVH 3VYPA 2W0FB 4ZNCD 5IT2H 2BVOA 1ZHNA 2PWHA 4UQ3B 5DXWA 1MF2H 2NUPA 4IBVA 3BO8A 3H4HA 4M5YH 1WVZA 3NQKA 4OLZL 2GI7A 3NA9H 4WEBL 4IRSC 4LPYA 4ONOA 4P07A 4UILH 2D2CC 2XN9D 1V55B 4FABL 4YLBA 2AV7B 2AJUH 1O6SA 5IGXL 1F6AB 3QFJB 4J3XA 4IIQC 2B1OA 1MHPH 1SY6L 2JKXA 3MDJA 4A7UA 4BFIA 3NP3A 1ZGLA 4JN1L 1IAMA 1FCGA 4RZKA 2HJFA 1MJJA 1WF5A 2ITDA 4KITB 1IEAB 1EAPA 4Z76A 3ULUC 3RTQD 3MCG1 2R15A 2BWDA 2G5BA 3WV0A 4D9RE 3CZNA 4XMKL 4PYHA 1UG9A 1X5MA 3GT6A 3INUH 1NTDA 3MODH 2LHAA 4HWNA 5CZKA 4F7TB 2EUWA 4H8QA 2NCMA 1T03H 3BH9A 2VZTA 1QABA 5EIQA 1OSPL 3W2DH 2IIJA 1BQHG 4POYA 1CL7L 1QSEE 5ANME 2ZG2A 3SGEH 2XV6B 3ARFD 3NCJL 2E8ZA 3DGGA 4GIAA 2J1ZA 1FSKC 4PP1D 3ULUE 2EDYA 4GSDL 3QEUB 2F6AA 3SDXB 3OZ9L 2ZONA 2WXJA 3LOWA 2BSTB 4FJZA 2WLHA 3KBFA 3PDDA 3REVB 1QW8A 3I9PA 1QPXA 2UX6A 5TK2A 2C3GA 5IW1B 5T8IA 5D1XC 4DQOH 1AO7E 3IJSA 2AXHA 2CDFB 3LN5B 4O4YL 4GUPB 4PG2C 4GO6B 4PY8I 3UBXB 1ZDSA 2O6EA 4FQ2H 4Y5XB 2B9BA 2YC1A 1M7XA 3NFNB 2VAJA 3QUZD 1ADWA 1HTYA 3MRCA 2J21A 3QARA 4WI4A 4A6YL 5GPRA 1ZEAH 1RY7B 3D69A 4H2AA 4JFXB 1ET5A 3KW8A 3F7PC 3K6DA 5GJTH 5CNHA 1HHJA 2X44D 3PAYA 4EF3A 1ZOXA 2V3EA 4AQAB 3J2PA 1EAOA 3QIBC 4IU3B 3WKPA 4AYDC 1KGCE 3N9GH 3AXHA 5DF0A 4NUQA 1EHLH 4C59B 1W72H 4HZLB 3ZO9A 2IH8A 4H26A 4ZFZB 3TYFA 1HOEA 4CJ0A 1U8PA 2K6YA 4P3DA 3SBQA 2YPVH 3HBQA 4E9QA 4PJCB 1BEYL 2B1HL 3MC0A 4ZX6A 3QZNA 4ZPVA 4AK2A 3QQDB 3PV6B 1WUZA 5AOKA 1DN0B 2KI6A 4OZHA 5BW7A 1NFDF 3PNRB 1NQBA 3NP4A 5A7BA 2WW8A 1K4DA 3RPIA 3DO3A 1X3DA 5D1ZC 1FFOA 2D2OA 1FL5A 3Q8BA 4U1MB 1JSYA 2VR4A 1S2EA 5ETUB 5FCUL 2FX9L 2F74A 1GS8A 3T6ZA 3NIGF 4NUJA 4PSPA 5IB2B 4PRID 4LQFL 1IRAY 1CE6B 1QLFB 5D9SB 5KANG 2NSQA 2YAOA 3WHXA 3SDYH 4MA3B 1B90A 3IDJB 3AS1A 4WWID 1IQWH 1JWUA 4JFEB 3RI5K 2N7BA 1DVFA 1IEHA 4TVSa 2VW7A 3WE6A 4Z3HA 4RWHA 1JCKA 4ZPVB 2F54A 1MW3A 2BP8A 4XP6L 5CBEA 2CUHA 1FNFA 4L8DB 5H94B 3SKJH 5T3ZE 1JDDA 3MBED 4U1KA 1N6QL 1KFGA 3EG9A 3DO4A 1XDTT 1T83A 4F1ZA 1QMUA 5L9DL 5I6KA 4CN6A 2NY2B 4Q56A 1XMEB 1ZHLA 2I5YL 1THAA 3MR9B 4ZW8A 2B9AA 4DGIL 4EUPB 5IIEB 2HT3D 2VSMB 2F8OA 4XGZB 3TTYA 5B3JF 2DPKA 2X53A 4N5UA 4Q6KA 3S4SG 1MF2L 2PCPB 4H25B 4PGDA 3TA3A 3KR3H 2BJML 1P1ZA 4IS6B 5FYLE 1XSKA 1A1NB 2IADA 2YGVA 4WSKA 1BLNB 4JRYB 1R46A 1LWRA 1QPKA 3BW9B 1ML0A 5F6HJ 4FNPA 5IW6B 3PHOB 1RZ7L 2EDXA 3CQFA 3PREA 2COVD 3IETA 5I9QB 3GHEL 3GMQB 1L6ZA 1B0GB 3JXAA 1PIGA 1J8KA 1HILA 1I3UA 1NLDL 4PV9B 1YAIA 1EERB 2CG9X 2HLFD 3RL1A 3WXVL 2IQAB 3MCKA 4QOKA 2DD8L 1NCCL 1OOWA 4Q7DA 4APQB 2AGJH 2CMRL 4U1JB 5IQOA 1E3FA 1JERA 1H3WM 2JQAA 4UTAH 1X44A 3EH2A 4JX0A 4L4JA 1MCRA 1E4JA 1V5JA 2BNRB 5AQ0A 3S36H 4EI6B 4ADGA 1KN2L 3KPQB 3HB3B 2GFBB 2H7WA 1P1ZB 3X1EA 1MW1A 3W11D 4IRJC 2PYFA 1WZ1L 4F3FA 3QORC 2LVCA 1QWUA 1A7RL 3G6AA 4UCFA 4X5WA 4EBQL 1R3KB 1INDH 2NY2C 1IFHH 4HKBA 5FYKH 2VE6A 3CVIH 4Z7VE 4DFHA 4KJWC 5H37G 4KRPB 4XI5C 3UBFA 3KPSA 5BO0D 3HE6D 3MUGB 4I0PB 3W11C 3RIFF 4LSQH 1R5VB 1BV8A 5B1BB 3OB0K 1HL9A 3F7VB 2FH6A 2HKFH 5SX5H 1KGUA 4XC1L 5T1DL 1XGQA 5B39A 1HHGB 2ZXAA 2BZCA 1JI2A 3ATEA 3MRCB 3NA9L 4WEBH 1OAUH 4MS6A 3AT8A 2XXFA 1CXFA 2EDDA 1YY8B 1E3ZA 4LLDB 4XZUA 4YZFE 1QX1A 35C8H 2XV0A 5D1ZB 3BPNB 1SGKA 4HZLA 1FNHA 3QQ3A 1CGYA 4LSUL 5DRWB 1ZT7B 4O5LH 1RMFL 3C2SA 1ZDQA 2P52A 3SDAB 1MHHA 3CXDH 2JKJA 1LO4L 1BYNA 2FUTA 2OW7A 2YJLA 3Q7JA 5H35B 2WQVA 3QQDA 4OLYL 4AYMC 5DD5L 5T3ZL 4GPVA 4WW2F 3EO0A 1TJGL 3A4AA 4FQXB 3PAUA 4YFLF 5E03A 1HH6A 1IAOA 5LDSA 2FE0A 3FONB 4HXBH 5KW9H 1FL5B 4NPJA 1DQQB 4ALAC 35C8L 2R2EB 4F2ME 2F74B 5CWSA 4GO8A 4PJ9A 4J2XA 4E36A 5DYOB 5F1KC 1MPAL 3NTCH 2AQQA 5KS9A 1YYML 4QF1B 3NN8B 3EUUA 3GBDA 3KH3A 2Z8VC 4LBEA 2IDTA 4I8DA 1B0WA 5D72L 5D7JC 2ZNWA 4FEMA 2PR4L 1XR9B 2XWRA 1MFDH 1UM4L 3FN9A 5EBGA 1CR9H 1PW3A 5AUMB 1F41A 1XGUA 2IVFC 1NDGB 1CC3A 4IKNA 4LASL 1SOSA 4I87A 1BMWA 1PEZA 3MROB 4Q9RH 1HZKA 3IKCB 5B21A 2XVKA 4AUYA 1CFTA 4JCWA 5FKPB 2O6FA 2CUMA 2PTVA 3ZZSA 2PYEA 5DTFB 1KBGH 3RLSA 1S8DA 1I1AD 3C60A 4I4WB 3L7FA 1TTBA 2C9SA 2J8UA 3SJVA 3WNJA 2OK0H 1HOCB 4NBYB 2Z4QA 4F7MA 5JIPA 1QSFA 1XGPB 5GRVL 2ZP9A 1OW0A 3DVFA 4XBPB 3WTVA 3TIDA 4BCYA 2VLMD 3V0EA 4X9GA 1OPOA 5J6HA 2GJ6D 1FNLA 1Z3GH 1FLRL 1QQDB 1BSIA 2ZYSA 3OQRA 4G9FA 5JW4Q 2DI8A 1W0YT 5CFHA 3K74B 3A23A 4IIQB 3C5SB 4KZDL 1MI5E 4M29A 4LSUH 3PY9A 1OOAA 1BVOA 2EICA 3ZE0B 1TOXA 3C60B 5KVFL 2D0HA 4JO3H 1WSST 2VZVA 3LSOA 4ZUWB 2YAEA 5ILTL 2ZXBA 3IJHA 4IHOA 3O4LE 5CAYB 3G6AB 3ZHNA 1OGAD 4YO0B 4CW1A 1ZHNB 1YVLA 4GT0A 1JD9A 3VD4A 1DQTA 4PJAE 4OVUA 3STZA 4JGMA 1FC2D 5HJBA 2VO5A 1UWEH 5IQ9A 1OD9A 1B2WL 3LMJH 4RAUA 1PMYA 3B2MA 2AV7A 3GHBH 1BLNA 4OFPA 3FU8A 1L9NA 2DZEA 2PCYA 3OSKA 1L0YA 1UGKA 3QNYB 3B7RL 4DOHE 3TESA 3HZKA 4KO9A 4YHKH 3K2IA 3O11A 2E27L 3OJDA 3TV3L 1KLGB 4JKNA 4YFEA 1B2YA 4YWGH 1HILB 4PV9A 2EDJA 5D7SL 4A2GA 2V2WB 3MRQA 2CGRH 1JVKA 4LNRB 3BO8B 5D1ZA 4RISH 1ITCA 1UXSA 2VM9A 5GGTA 3WENA 4R4BA 5CHNA 5LCVL 3ZSSA 2E7LC 5CJ8A 5FO7B 5CKAA 2BLFA 4L4TA 2X6UA 2V8LA 2X1PA 3LMJL 3LB6C 2AQSA 4AM0Q 1EFXD 1NCCH 1UACH 4RAUB 4HBCL 4WDIB 4BFIB 1DBAH 1P4BL 2H8PB 4RETB 5DJ0B 2OPCA 2ZXCA 5JIKA 3TNNB 2EH8L 1VF5C 4YK4B 2L7JA 3V7MA 5EU7C 2EC9T 3ARWA 2VCOA 3BKCL 3OJDB 1JXGA 3PGCB 4Y19D 2VE6B 3H9HA 4RZCB 4YSOA 3UABA 4AL8H 2O5XH 2V9RA 4RESB 1XF4A 4L05A 3UYRH 1ZS8B 2E6JA 3KM2A 5T1LB 4YDVA 1D2OA 2ATKA 5CGTA 1XBRA 3NN8A 1TZAA 1A0QH 4HG4J 4OI8A 2BCKA 5EU4B 1XGYH 5DUMH 1I8MA 5C09E 4LO9A 3NIFB 1AR2A 4ODXA 2PYEE 4BFFA 5C0CD 5EF1A 4QT5A 2G2NA 5C08D 1E9PA 4MNGA 3VQMA 1WAPA 5T33L 5GSRA 5D7HA 3E6HB 3S5YA 1SXSA 5HHNA 1YY8A 1KGIA 3K72B 1P2CA 3FFCA 2H2SC 4YK4C 1X5JA 1T0MA 3VYOA 3CHQA 5E6IA 4P04A 4PJHB 1LMKA 1S7RA 1HCFX 1A6AB 3F64A 1WAAF 3MLTA 4W6XB 2QELA 5DU7A 4Y9GA 5JORB 2AXGA 5JDSA 3RDTD 3RX5A 4NP4L 2VIRA 5E1AA 1LQSR 3IDYB 5AL8A 1R9FA 2DBLL 3H9SA 4NQVB 3RYMA 4ALAH 3CVBA 2Q6WA 1DEEB 3UERA 4QO1A 1NGPL 2UX7A 2G0KA 5I5JA 2WVVA 3HJEA 3LZPA 3MYJA 5ALCL 3WHE1 1Q0XH 1JUFA 1GGIH 3RPKA 5CJBA 4ZFOB 2ZWLT 15C8L 1VZIA 3IRPX 2VMEA 2P5PA 5IVOA 4B9JA 4CKVX 2Y07H 3U4BH 3UP1A 1SVCP 2X4SB 3AXIA 3WE6B 4KPHH 2MJWA 2WMPA 4FS0A 3FUFA 4QGYA 4TN9A 1MCBA 2VDOH 4APQC 1S46A 2F19H 3FN0H 3HUJF 3OL2A 2C9UA 3H3PH 5IOPA 1EJOH 1VAHA 1TJHL 5SWSB 3BKMH 3STBA 3P11H 4A55A 4EUPH 4YHYB 4KNQA 3PIQB 4G6FB 1ILUA 4FP8L 1GYAA 1V7ML 3VFGH 2M8XA 4HMCA 4ATWA 1KC5L 2QQQA 4GKZB 2DMCA 2FR4B 3BZDA 3IAPA 3QYCA 4IS6A 2WO4A 5IFHL 4E2OA 5HGHA 4DIXA 4G59C 5KSAD 1UH2A 1DE4B 5FA4B 4JQIH 5JMRA 4NZTH 5D5MB 1NMCB 3FH8A 1IILE 3AG4B 4XT1C 1DL7H 1XB8A 4XP9L 3QHZL 2NXYB 1NKOA 2VDLH 4H88H 1ZLSL 2JI2A 5DJCA 4Z78A 5DMIH 2P5EA 1G9NH 1CL7H 3T5WA 3NPZB 1T4KA 4G72B 2E9GA 2WTPA 3MBEC 4LHUG 4X6EA 4JDZA 2Y69B 3FQTB 1GCFA 3TNMB 2ZSVA 2H1XA 2JI1A 2ZKXA 4XH2A 1J1XL 3W82A 4DCQA 3E0GA 3QEQD 3MHZA 3ZE2F 2PP9A 1T2QL 5DLLA 1PZDA 1QG3A 2Z6FA 1E9QB 1A6ZB 3NZHH 4I7ZC 2P5WA 1IAIL 4JKLA 5KVFH 2XPGA 4P46B 1I3RB 1M7DB 2QPUA 2Y3NA 5F7MC 1LO5B 1BQLL 3PWNA 4M61A 5ADPL 5D4IA 1T7WA 1WRFA 1JPSL 5A43C 4UDUB 5E4EB 4PS4H 3DUUB 2AK1H 3F7RA 4OIIH 5TE6L 3ILDA 1PD1A 5IVNA 1D6VL 4OM1H 3UAJA 1QRNA 4JPWH 5FYKU 1AYOA 1N0XH 5JPNC 3S48A 1U8NB 2FIRT 1R3KA 3TU6A 1CE1L 1M57B 3D3VB 2RMNA 2GUOA 4N8UA 3H9SE 2OSWA 3MLPA 4OBSA 4C4UA 3GWJA 3FYEB 2EH7H 1S7VB 4JZJC 5EU7E 2A6DB 1MUJB 4GAAA 1XGQB 3F2LA 1I7RB 3PAVA 1J05B 5D1QC 4D94A 1A02N 1OE3A 4MD4A 3HZVB 3BFWA 1ZSDA 4JKPH 2EDEA 5JQHC 5DZPA 2D9CA 2P47B 5LNEA 4U1NA 1N0LB 3ARBD 1KN4H 2AANA 3B5TA 4XB8A 4Y4FA 4AC4A 4DUVA 5CKGA 5JW4N 4OVVA 1AMXA 4WVRA 2R0KL 3O9WA 1R3IL 4OIBA 1G1CA 2I60H 5I5MA 5HPOA 1VDGA 2BC4B 3PXLA 4ORGB 5I1LB 3BAEH 4Z18A 4D9QE 3CC5A 4LP5A 2WVTA 3UZEC 5E7BA 1JYWA 2CK2A 1DBBL 2YRZA 3R06B 4Q0XH 5D96C 2Y2TA 5CIPB 4ZO9A 5HY9B 3ESPA 1RUKH 3Q1SH 2CIIB 3NPSC 4P5SA 4DQOL 1BBJA 1E28B 4FFZL 3WYRA 1NGQH 5JA8B 1U3NA 3D25A 2HKHH 2M2DA 3M86A 3EYQD 4JB9H 2VM3A 1UWXK 2YAQA 3AGWA 1UVQA 1FZKB 2XFXA 3E1F1 2IDQA 2R69H 4L1BA 3REWA 4XO8A 1LD9A 1HHJB 5FYKE 1D6EB 1NJ9B 3CD4A 4PRBA 1FJ1B 5MI0B 2FSEA