2A77L

Anti-cocaine antibody 7.5.21, crystal form ii
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
216
structure length
214
Chain Sequence
b'DVLMTQSPLSLPVSLGDQASISCRCSQSIVKSNGHTYLEWYLQKPGKSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLRISRVEAEDLGVYYCFQGSHIPWTFGGGTKLESKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin Light Chain
molecule tags Immune system
publication title Flexibility of Packing: Four Crystal Forms of an Anti-Cocaine Antibody 7.5.21
rcsb
total genus 49
structure length 214
sequence length 216
ec nomenclature
pdb deposition date 2005-07-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a77L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a77L01
1V05A 2HTLC 1A0QH 3H3PL 3DSNA 5D7LA 5H2BA 2Q8BH 3X13B 1NCTA 2Y07L 3V6OA 1JL8A 2YWZA 4EI5D 5C0FA 4RIRA 4WGWB 4Y8AA 4FQPA 4WFHE 3H9SB 3RNKB 3IXTB 2DLFL 5IFHL 2NY0C 2C3VB 4FQ1L 5SWSB 1N64L 2X1OA 3MBXL 3VFGH 5BVJB 1JZ7A 3I3DA 3TF7C 1RZ8B 3RUGA 5T1DL 5CEYB 3CFJB 3CU1A 4HJJL 2ESVE 3UJJL 5ICYA 4KTDL 3Q3GB 4GBXA 2ZOLB 4QCIB 2I60L 1MFBL 4FXGA 5DQ9B 1R5VB 2DQUH 3AUVA 5D1ZD 4NKOA 3GSRA 1S7QB 1A3LL 4N8VG 3B9DA 3MX0A 5GXBB 2JLLA 4OZFH 2VDQL 3GHBL 1K9TA 4Y5VB 3IFLL 5BMFH 4LARH 3BT2L 1XAUA 3X12A 1BIHA 1IKNC 5IW1A 5I1AB 5FUZH 4WDIB 2JB5H 3BQUD 1JGEA 4KDVA 3BDXA 1YMHB 1A4JB 1J1PL 1SQ2N 4P2OD 1F8TH 5GRYA 1DBAH 5LBSH 3GMMA 5BXFB 3KPOB 5ENWA 1EO5A 1INEL 5DJDA 4XNYH 3P4OB 5FK9A 3BP7A 4CVXB 3B9KC 1MFAH 1ED3A 2EXYD 3QWOB 3RWHB 3S35X 4W70A 4JDZB 3DVGB 1YN6B 4OCNC 2V7HA 2QKIB 1E4JA 1ETZB 1QHPA 2VLKE 1II4E 1HHIB 5I15H 3P9MB 5E8PA 3BUYB 4H8WH 1GOFA 3H9SA 2QR0B 5E4EC 4ISVA 2DQTL 5ISZD 4DJMA 3PGFL 4M4PA 5DVNA 4WWKB 2EYRB 2MFNA 3I75B 5GRUL 2E7BA 3SDDD 2NY6D 5TFSL 1M7XA 2A6KB 3LN5A 3P4OA 5FK9B 5DHVH 3RAJL 1GIGL 1NEZG 2DIBA 3DX7A 4KXZI 2H6PA 4MLSA 2VQ1A 4OZHE 3SO5A 1BD2E 2Y06L 4HX1B 4MXVF 5CINH 4ZOBA 4JVPA 5FKPB 2IMNA 5MENE 2NXZD 3D3VB 2KUTA 1TDQA 4UDUB 3LQMA 3SGEH 2Q1EA 4GUPA 5DD0L 1FFPB 2X40A 3WNNA 2DQJH 4IM8A 1PZUB 1KLFA 3KPSE 1KFAL 2L7UA 3L95A 4ZNCD 5EWIL 1WV7T 3C60D 4JRYA 3U6RA 5D6CB 3ULUH 4J4PC 4DFIA 4EDXA 1RIHL 4R2GD 2WUCH 1WBXB 4KY1H 5EU6A 1TPXB 4Y2DC 4JRYE 5F1SA 5D5MA 1UZ6E 3FB7B 5CJXC 1V8HA 5SWSA 4I3GA 4DTGH 1W72A 1BD2B 3QFJE 1WBZA 1AE6H 1MI5E 1WBYB 4JR9H 4NN5C 4M7ZC 3THML 3I6LD 3VFUA 5MEQB 4JKMA 5A1AA 1JF1B 2YK1H 1FVCB 4UV4L 4TSBH 43C9B 4XPBL 4WFGE 1EIBA 1U3HC 3JUZA 4JB9L 4WW2B 5EC1A 3VI3F 4Q6IC 4NFBA 3ARFC 5GRVL 1UKSA 2FRGP 1WAAF 4L5FL 1HKLH 4JKPL 2FH8A 3RFZC 5SX5H 1MEXL 3MFGB 4YHML 4EUPG 3VGEA 4KDTA 1CDIA 2BNQD 4O00A 5I1KL 3I50H 5IW6B 2GKIA 3DVIA 3MLTA 5ERWA 4QT5B 2PW1B 4BYHA 3G6DH 4PD4K 4JKKA 4OD3L 5FYLH 2DAVA 1B3JA 4Z7OE 5DD6A 1KC5H 1WISA 2CQVA 3QCVL 4WCYL 3N9GH 4YHOL 5D1XA 4JQVA 3C6SA 3VG0L 4PRAB 2D3VA 3U0WL 4BK5A 2WINB 2X1QA 1QKZL 1QSED 1NEUA 4RAVA 1QSFD 4P9MH 2BCKA 5B39A 3R1GL 2EDJA 3Q48A 4U6VL 4MNQA 4ENED 3IXAA 3OJDB 4FZEL 4YHLL 1V3MA 4U1NB 5C9JB 1X5GA 5LVEA 1G9MH 4LIQE 5I18H 2J3SA 3AC0A 1A1NB 3BKYL 3GMLB 2EC8A 2GTZB 3HC3L 3FMGL 1XR9B 2C4XA 2ZCKH 5EIQA 3T2NH 1SJHA 5BRZA 2V2XB 2IAMB 5T3ZE 5F1IB 1K4DA 2IC2A 3DURB 4I9WD 1PVHA 2VXUH 1CE6B 3IDXL 4CL7A 3KLHD 4ZFFB 2ZJSL 1S78D 2DTSA 1R3IH 4L8CA 3MJ9A 1J86A 4S1DD 5E8EA 3C8KB 3CXHK 3RWDB 3MREB 3SCMB 4X6CE 4GMTH 1F3RB 4IRSA 4UILH 1G7MA 4PY8I 4Y5YA 2MPAH 4KH2A 4N0FB 4X8XA 3DIFA 1PY9A 5H2BB 1XGPA 1U8MB 5K9KB 1ZLWH 3HLAA 2XKSA 5JOFB 3O3DA 1BGXL 3CFCH 2WV3A 4LCWE 1FL6A 4N1HB 4G5ZH 3EDKA 2FGWH 3D3VD 3OR6A 2BERA 1HCVA 3WIIL 2GJZA 3KPQA 1AD9B 4OZGE 4A6YH 1J0JA 2BVPB 3S35H 2XXMB 3VRJB 3R8QA 3P4MB 4F7CA 3IKCA 4XTRC 2WBWB 1D6EA 4LDEB 4P4RB 2OBGA 3DI3B 3QRGH 3JTSB 1ADQL 2WIIB 4ELMF 2B0SL 1A3QA 2YKLL 4RBPH 3VXMA 1H3TA 1IGTA 3LKPA 3N1GC 3KGRA 4IRSB 2NMSA 5T3XE 2G75B 1GYAA 3BZEA 2NYYC 2XWJB 2D9QB 4JPVH 3NZ8B 4HKXB 4ZO9A 2VJXA 4JZJA 5IK3A 3JTTB 5DRNB 1A8JH 1JZ8A 5ACMA 2AJVH 4BZ1H 4XPFL 3RBSA 4Z76B 4H25B 3LEVH 2Q8BL 3Q6GL 3CDFA 5TGBA 3UO1L 1S5HA 1EERB 3JWOC 1AGEB 3GJFB 4NUGL 1FFNA 5E8NB 1A1MB 4G9FE 4JDTH 5FO9A 4TVPL 1ZVSB 4EN3D 4LVHB 3MTRA 1C5BL 3SDAC 2PUQT 4Z7UF 5D2NE 3PHSA 4MXWH 2ZSWB 3KR3H 4HKJA 4LSRL 4F3FB 3ULUD 3GSNA 1RZKC 4OZHF 3S4SB 3EOAA 3IDYC 3AXLB 4XCYA 4LL9A 1DUZA 2HFGL 1QA9B 1T89C 2E6JA 4M61B 1FL6B 4MXQD 4ZFOA 3ECBA 3UTSB 4U1GC 1T2QL 5JDJA 1WK0A 1JRHH 5CBAB 1KB9K 2J8UB 4GG6A 2BNRB 4MVBC 1KB5B 5EOQL 2CK2A 4LSVH 4P5MA 5CZXD 3JWDC 5F9AC 5EH1A 3WFDH 3D0LA 1CXEA 5FCUH 2EIEA 1ES0B 4HK3N 3DHMA 1KGCE 1GZQB 2FJHA 2FX9H 3SDXE 3T0AA 3CFKA 5IROC 1NFIB 4J12A 2MWCA 5DUBB 3WHXB 1D6VL 3GI8L 3BKML 4G80A 5EIVA 5JIPA 1QBBA 2O61A 2CO6B 3D69B 4PJEE 3VXMD 3HN3A 5EZLB 5FCSH 5E2JA 1L6XA 3VFSA 5GZNC 3HFMH 4Y16A 3QIWB 2GTZA 3FQTA 2P8PB 4D0CA 1P5VA 4RWHA 4G7YH 3MUGB 5ESQB 1ZS8A 2R8SH 3WL9A 1SYSB 3IDJA 3NCYS 5D2LB 5I8EA 3RWDA 1B2WH 2JJUA 1V7ML 2ICES 2C3HA 4OCYL 2KH2B 4ZDHA 5C0AD 2NY7H 4NWUH 4G9DA 4N90D 1FZOB 4OD3H 2J8HA 3PABA 5SX4H 3VXTA 2DWEB 3QXAB 2LE9A 2NNAA 3MMEB 3GIZH 3MV8D 4M6NL 1XR8A 5IMLA 7FABL 1XGRB 1JN6B 1ZLWK 1LO0L 3QEQA 3QUZC 3EYSH 2B4CH 4OSUL 3T0VA 3RY6A 2ZUVA 1TFHA 4A6YA 1HEZA 5D1XC 1YEIH 1UH2A 4QHMB 1B4JH 2R0LH 3NCBB 1F13A 2OP4L 3MRKA 3FQWA 5KANG 3V8OA 1IGIL 2FD6L 5E00A 1XIWB 3D25A 1NC2D 2P4AB 3OG6B 4K23H 1K8IB 4Y7MA 3REVA 1YUHB 4GBXD 2RHEA 4HDIB 1OAZH 4PBXA 2KDGA 4XCCL 4LVEA 5EU3A 4WTZG 2B8OT 2P44B 4HJGA 3T2OA 1VACA 3C6SB 4DQOL 4HFWB 5GHWH 5K93A 1NCBH 3BEVA 4KWUA 4ZXBB 1RZ7L 4UB0H 2VZOA 5AZ2L 3MLSH 1FN4B 4JDVA 3QDJB 5BOPA 2RQ8A 2X4SA 2HKHH 3E3QC 3LKRB 5BZDA 3TZVC 3ECBB 4MJ2A 2JTDA 1NDMA 1T83C 1DE4B 2VNCA 4DGYH 3W0WE 3B3IB 5BV7L 3DO7B 1LDPL 5IESL 1VA9A 1YMMD 2AEQH 2I5YH 3KYKH 3DYMA 4RQQA 1LEIA 5FECA 2PO6B 3RX5A 3O4OB 4LF3B 4LNVA 4YFLI 1A1NA 1N59A 3CLFL 4M7LL 4YH6A 1BF2A 3FB8A 4W6XB 5IROA 5IKCB 3P0VH 1FFNB 2AGJH 3G6DL 2DLIA 4KKCD 5CD3B 1HHHA 2GJ6A 1KTDB 4IJ3B 4OT1H 3FQUB 4PV8A 3W9DB 4IEFB 3PJSB 4K07A 4N0UA 2P45B 4Y5VA 4F58H 3FHQA 4H20H 2VLJD 3T8XB 3JTTA 2MQCA 3HNTH 1A7RH 1I9RH 4HCRL 3MO1A 2GITA 3LQZA 1CI5A 4MCYA 4PRIA 2LTQB 1KPUB 1S7VB 3KHQA 1YYMH 3MYJB 4NQEA 3V4UH 2H2PC 3AVEA 4OLVL 4MQ7A 3QUYD 2KZ1B 3UTZA 1FV1B 3IKCB 5C7XH 1RZJL 2FB4H 5C0GA 3QO1A 4PJCA 3C5JB 3F7PC 4KKAD 3EHBC 3L3KA 3DX6B 4UQ3B 4KVCH 2F8XC 4NN7C 2W9EL 5GGVL 5T5FL 3MBEB 3HZYB 5HYJE 1MQKL 2J6EL 3PDOB 1E4KC 1TZGH 4S1DC 3T0ED 2XRAL 3W9EB 3B6SA 4PJAE 4NZUH 5GS0H 2AK4D 1CFSA 5TE6H 4PJBA 2I25N 3CX5J 4S1SL 4TUKH 3SE3C 5E8OB 4JO3H 2AKRB 2IBZX 5ANMB 4ODTH 3BKCH 3QCTH 3DGGA 3H7LA 4NM8H 2B5IC 4JFDE 4JPWL 2DLHA 1J0IA 5GGSY 5HD8D 1T0MB 1DLFH 1YY8B 4IMKC 1R0AH 1IARB 3NFSH 1F6AA 3R06B 5FYLE 3W5NA 2G5BB 2BSED 5ETUB 4E9LA 4I0KA 4HLZG 4FQXA 5DEFB 1X3DA 3WXVH 1QHOA 1H3UA 2Y06H 1DBMH 3T4YB 5IR1B 2VH5L 2O5ZL 5TFSH 4PJCE 3F12B 5CEZD 5FV1L 1IEAA 1IC5H 4LQFH 2MQ0A 4BQ9A 2BOCB 1TMCB 3GMMB 1E6OH 5BVJA 4YXHH 3G04B 3IETA 4XBPA 5EU7C 1OF2B 1NBZA 3OKNA 4D0BA 1UA6L 4RRPA 5IM7B 3TFKC 5J12B 4EBQL 4M1CC 5C08E 5I1AA 1HHJA 1RZFL 2PW2B 1D5BB 4PJXA 4XWOD 4W6YB 4POZC 5KSBF 3HZKB 4IJ3C 4F37K 2X4TA 1CGYA 3TJHC 4L8DA 5FYJE 4GAGL 4HFWA 4TN9A 4NJAH 3HZMA 1C08A 4LLQA 3AFLA 1FGVH 2HJLA 2QTEA 2FBJL 3FRUB 1NGPL 1FLRL 1FAIH 2FHFA 2J4WL 1KBGL 2OM5A 4ZD3L 1FVDA 2NY2D 1IL1B 4M62H 5JIHA 3WLWD 4P46D 1LO3H 3EO0A 4ZYKB 4YX2H 3QUXC 4FQXC 1YQVH 2QQKH 2BDNL 2ORBH 3CDGA 5L0QB 1I7RA 2Q7NA 4XP9H 3BT2H 3RNKA 1I1FB 4NZJA 4HBCH 3F58L 2IFGA 5FUZL 2FEDC 5HSFA 4JDZA 3LB6C 4KVCL 4M7KH 1X5AA 3KS0H 2VABB 4OFIA 4LLAA 1N6VA 3QEQB 3WLWC 2YBRB 1G6RL 4YPGA 1VPOH 4XCNA 5HVFB 1CXLA 4I0PB 4S10A 3E8UH 2GUOB 2CDEA 3NH7H 4LASH 1RFDH 3ARWA 3QXAA 3BHBA 4ZXBC 4FQJH 1RZJH 4OIAA 3CUPA 3I85A 1NLBL 3QDMA 4P5KA 1A2YA 1EAPA 2XZAH 3IT8D 3IDNB 5AD0A 1AE6L 3QULB 2OJZH 2P48B 2WP3O 1LK2B 4XMPL 1QP1A 3W39A 3FB8B 5C0RH 2VLLA 4XP6L 3SE3A 3EUUA 3ZDZF 4KMLB 5D72L 1YPZE 3RL1A 4KHTH 3K1KC 1XIWC 5FF6B 4JKWA 1N4XL 4P46A 1TQCC 5C0ND 1NC4A 3BKJH 4EN3A 1QSEB 1BHGA 1BQLL 2GY7B 4KK9D 3EO9H 2VH5H 1JPSL 2E9JA 2YEZB 5J1SC 4YNYB 4M6AA 4AIXA 2IQ9L 4DKFL 1JGLH 5IJVB 3QUZB 3QO1B 3D18A 1N5AA 4PJCB 1CF8H 3WFBL 5HDQL 1K85A 1IQDB 4HZLA 5IOPA 5BZDB 3V5DA 1ND0A 1O0VA 2VERN 2LAGB 4ZFGL 3FMGH 3OF6D 3WUWA 4PRBB 1LHZA 5GRUH 5FO8B 4O9HH 3VH8G 1CFSB 1NGZA 3GGWA 2R0LL 3U46A 1GIGH 4U3CA 1A02N 3L3DA 4NO0A 3MA9H 5TH2B 4C83B 4LSDA 3HZYA 4X6DA 2ZUTA 4XVUC 1A1OA 5IB5B 3K81A 1U58A 3QIWC 1BZ9B 1T22B 2FNBA 1WFTA 1QVOA 3HG1E 2XN9E 1RUKH 2VXTH 1CIUA 4J4PA 4FG6C 3G9VA 4ELKB 4JCLA 2H26B 4C56E 5D7JA 3QPQD 1HEZB 3AB0C 4HLJA 5LBSL 4F15B 3VD4A 2QHRH 3K8MA 1TJGH 1BLNB 1XGRA 3SOBH 3FO9B 5F7UA 2BSTA 1OM3L 4DVBB 4J6RL 3T09A 1FDLL 1WITA 2X70A 5EBGA 2AK1L 2R2EB 5F6IB 2P7TB 1A22B 3OSKA 5DRNA 2XN9A 4M9PA 1ZA6A 3CH1A 3HPLA 3UJIH 2ZCHH 5EORL 4EXKA 5INDB 2G2RB 3TA3A 5CGYC 3IDJB 5D2LA 5I8EB 3MCLH 3QDHA 2NZ9D 1NC4D 1ZE3C 1EFXD 4X6DE 4CADA 4P2QA 5ESVB 3LY6A 2A77L 2XIDA 4ODXB 4LOUC 4V2CB 2DL9A 1I9IH 1NCWH 4U1LB 3ULSB 4UBDD 4PJ8C 1CE1L 3F7RA 4HIXL 5IEKB 2DMKA 3FQNA 5JW5A 5IB4B 4WWKD 1OAXH 1UM6H 4N0CC 2V17H 1RJCA 4XP5H 1RZ8A 3RUGB 4YXHL 1EPFA 5E2TL 5H8DA 3FFCA 1I8LC 4HUUB 5H35A 4RMRA 1KJ2B 4P3DB 1RJLB 2GYSA 1XGPB 1ZWIB 3O9WD 1U91B 4KHTL 3QNZA 4GLRI 2Y5TB 4TVPD 3S5LG 2G75A 1BM3L 3HMXL 3RI5F 5EU6D 2ZWLT 4ZXBA 1A7BA 2XT1B 3BEWB 4I4WA 2J8UA 3LKNA 3BZFA 3RU8H 5F88B 2A2QT 4O2FA 5IMLB 1OAUL 2QV2A 2VDRL 5IBLD 2A0LD 1F00I 4Q9QL 2BVQA 2R29H 1HH6B 3OX8A 4Z7WE 1RZIA 4G9FA 3ZDXE 1HNGA 5KVGL 4P2RE 1NAKH 3ES6A 3VD5A 3WD5H 5GPRA 5CJOL 3TNMB 5F7EH 1AC0A 3RWCB 2D7TL 3HA0A 4NKQB 4OM1L 3WUWB 4QNPE 2LU7A 3BDYL 3G6JA 4NZTH 1R3HB 2Q7YB 3SPVA 4YC2C 4WCYH 3EJYD 3INUL 2HKFH 3EDDA 4X7EC 1QBMH 2BVQB 1H9VA 3IF1B 3L3HA 4KKCC 3MA7B 3P4LA 2OX5A 3QXDB 5E6ID 5HXMA 5KSBE 4JQXC 1UM5H 5FA4A 3VFNB 1AGDA 1R3KB 5FHAL 2ITCA 5I6XC 3UTPE 2OTUB 3SE8H 4L5FH 2AJZA 3T77B 5DVKA 4GRLD 4OF5A 5D8JH 3Q1SL 4UOJA 4WY7L 4MA3A 2Z0BA 4P0DA 3MLUL 1F11B 2YZ1A 2Z8RA 1UVQB 2FDBP 2ICWI 2W9DH 1YJDC 3I6KB 5JIIA 3MLXH 4ZFZA 3FQXA 4PRDB 3S5LA 1X4XA 3DV4A 3KPPA 1F02I 2J2ZA 2W0KA 3IDMB 2F9BT 1N7ML 5JW4Q 1CD1B 3EYQC 2E9BA 1RUAL 4X7SL 2HFFA 1I8LA 1HINH 4LRNH 2FX7H 2GK0B 3G5ZA 4PG2C 2GI7A 4D9LL 4WHTB 1G0YR 1ZTXH 3G5YB 5K9OA 4FQIH 1Z5LA 4NDMB 4JHZA 1QQDB 3CK0L 3MRHA 3U4AA 3EYOA 4GRLC 3STBA 4GO6B 5CZVL 4ZS7L 5EG6C 1U9KA 4AY0A 1WBXA 4LLUA 2P8LA 1M05A 4HS8H 4I5BB 4JDTL 3BP5A 1BX2A 3O6FD 4U1LA 3MV9E 3MCKB 3RL1B 3ARPA 1R6VA 3QDJD 5EUOA 5J8OA 1AH1A 5CJ5A 3VRLE 3K2MC 2P5WD 1T0MA 4UDTA 3FB6B 4LAJH 4M48H 4EIZC 2VXVL 5KSAD 3SCMD 5TPWH 4MNQE 5DC0A 5TGBB 1U58B 1MHCA 2BCKB 4LHUG 5LAXB 3V4PL 3MLRH 4FNLH 4NJ9L 4Z7QF 1Z0MA 4NT6A 5D93B 4Y4FB 3UC0L 3CH8A 3KYOA 3FO9A 4B0MM 3DX8A 3ABZA 4DUXA 1XZ0A 2IAMD 4BJLA 4R0LA 3OAUH 1A7OH 4U1HB 4Y5YB 2X4RB 4UV7L 1MCQA 4PRBA 5BS0B 1NBYA 1BOGB 4RMUA 5ALBL 3OJ2C 3GB7A 1A5FL 1T20B 5F71A 4NO5B 4H5SB 4TNWK 2FSEA 4LSPH 4J7RA 1JWSB 1YEFL 1BP3B 3KPQB 4MAYB 3TJEL 3DURA 3QRGL 1TZHB 1KTKE 1J1XL 4K7PX 1NCDL 4WUUB 2DQHH 3RWHA 3GSVB 1FNHA 2ICEA 2IGFL 3LN4A 4UMGA 1UACH 5KS9B 5TF0A 4ONFH 3AB0B 3TO4C 1YNKH 5I1GH 4PJAB 4Z7WA 3C5ZD 4OI7A 1YA5A 3IJHB 1FPTH 5FM4A 2FIKA 2PW2A 1PG7W 1EXUB 1IRAY 4RDQF 1FO0L 4PRNA 3V5DB 2F19L 2W0LA 3E3QE 4Q9QH 3SGKA 1K3IA 2ZCKL 1GPOH 1UEYA 3WNLA 4CMHB 1SY6L 2JK5A 4YNYA 4ELMA 2DL2A 2DYPB 4Y2OA 2ZNXA 1CXHA 3FFCE 3QA3B 2GITB 4PY7A 3BZ4A 1JV5A 4IOIB 3WDHA 1OVZA 2VC2H 4P2QE 2ATPA 4TSCH 3RDTD 3THMH 1U3HD 1LO4H 3NFPB 3WYRA 4CDGC 1RUKL 2OXGA 3KDMA 4PGBA 2B7DT 1E0OB 1KENL 5TE7H 1OLZA 3TCLB 1AQKH 1YQ2A 1NGXA 3GSOB 4P59L 4PRPD 3ZDXF 4ZYKA 2FX8H 3A6BH 3EIFA 3RA7H 2GSIB 4NOBA 1AD0B 4PJEF 4RIRB 2MKLC 4WI8A 2B1HL 4ODVL 1N59B 1SJEA 1TZIB 1DL7L 3WE6B 3TIEA 4PYHA 2Q76B 4R7NA 1X4ZA 4U3HA 2VABA 3HPJA 4PRDA 1JBJA 1MCOH 5CEYA 2DF3A 4K7PL 4FFZH 1YDPA 4PB9L 1KEMH 1ZSDA 2QR0A 1LEGB 2AJXH 4NM8L 4JY4B 3PE9A 4DZ8A 3MRRB 5BS0E 2X4SB 3MRKB 4XPTH 1G7JA 1ZT4B 4WO4C 1LD9B 3VE0B 3LMJH 3RVXC 1S7VA 3HHRB 3S9DB 2B20A 1MLBB 1UXWB 4P2RA 5DMIL 4ONGL 5EOCH 5BV7C 1WCQA 5JHDD 1U36A 1BJ1H 1HE7A 1OTTD 3S88L 2JCCA 4YEEA 2ZUUA 3IAQA 4E5XA 2FO1A 3O11B 2ZUXA 3RIAF 2VLRE 5HGHA 3QEGH 4R3SB 4NP4L 3C6LD 4JFXA 3BISA 3RZCA 2AP2A 4HUVA 1YYML 3V4UL 1ZHNA 3KDMB 1YN7A 3OKKB 1FIGH 5K59F 2I9LB 4LHUA 3RQ3A 1MUJB 2HTLD 3GBNH 2PXYB 4K71C 4JR9L 4U31A 4MNGE 4MJIA 2FLRT 1B4JL 3LN5B 3QFDA 4NQVB 3D39E 1OGAD 4GMTL 4JRWA 4MQTB 4P5TB 1ORQA 3D2UB 2YD3A 5JR1H 3I84A 3O4LD 1I8MA 4F57L 3GKWL 4Y4HA 3ARGB 4OF6A 1XR8B 1FNFA 1CTOA 5F7KC 4KQ3H 3L3KB 2NY0D 3OXRB 4OCXL 4IHOA 2X05A 1UWGL 2UZYB 4KJPD 3TVMA 1VFAA 1H15B 3U82B 4N68A 3ARBB 3UCRA 5HPMA 1VESA 5FGBC 1LEGA 3BZFB 4TVSa 3U9PL 1I1YB 1YEHH 4YHYB 5GGTL 1P5UA 3MUGA 4HKZA 4AM0A 1LO2H 2PXYC 4K71B 4Z0XB 1MWAA 2BRQA 1TITA 4OQTL 3EZJB 3WN5C 1QRKA 4WGVB 5CJBA 2HKHL 4YFDB 4JFQB 3QUYA 1C1EL 3RWIB 2FECL 1CDBA 1QOKA 4WU5A 5C0IA 4NQCE 1U8HA 4AH2B 2AJYL 5DGQA 3VFOB 3BAEL 3GSNB 3T65B 5C3LD 3S4SG 5FYJH 3MCKA 4C56A 3MJ9H 3DVGA 2OTUA 2VKWA 4LBEA 3QEQE 2DQCH 1UZ8A 3MBEC 4N0UE 5ABDE 2W1NA 2OP4H 1N2RA 1JGVL 3CSGA 5DJ2A 1BWMA 3MV7D 3O3EA 3NCYP 4ODSH 3FQUA 3OAYK 1S3KL 2EXWD 3UBXB 1PGRB 4GMSH 4Y89A 4HWZA 3M1BA 2R4RH 3LEXA 3AM8C 2LTQC 5KVMC 3HC4H 3PL6A 5F72S 3LH2L 4TUJA 1AHWA 4HIIA 1N26A 2EDYA 3EO1B 4D9LH 4WFFE 4FQLL 1S9VB 5FECB 3HE7B 4QY8B 3QCUH 4UT7L 4NP4H 1AD9A 1TZHA 1X5KA 3QG7L 4M1DH 2B39A 3B2VL 3JWOH 2Y36H 4R90H 3KPMB 3OGOE 5EC2A 1R5IA 3D0VA 4A6YB 5I19L 1ACZA 3AS0A 3W2DL 1MH5A 2FCBA 5J11C 3H7BA 4JVWA 4ZQKB 5HHMD 3GHEH 3V0VB 1HH9A 4U1KB 1HK6A 3Q5OA 1X5JA 4FNLL 4KK8D 4NJ9H 5B3JF 4KDTC 1A6WH 3HAEH 2ICWJ 3FO1A 2P5EE 3CXHJ 5KSUA 4ZSOB 5LAXA 1QSVA 2FGWL 3NABH 5D7SL 3LOWA 4R2GC 3MGTB 4PJ5B 1CDGA 2AJYH 7CGTA 3RU8L 3QUKA 3IFNH 4XMLH 2X1PA 2R2BA 1NMAH 1WC7A 1UWEH 5F7DB 3K3QA 4R4FH 4XPHL 2CIIB 4NCC2 3GM8A 4LCUA 3RVTD 4G8FB 2HH0H 3ROLB 3FO2B 3KPNB 2YA1A 2FB4L 1JGVH 4GQ9H 5FA3B 1CF8L 3L6FB 1NFIA 5DR5H 2VR9A 4G43B 4LDOB 4HKBA 4FOMA 4Y5YC 5DTFB 1RULH 3MR9A 3WJLA 5D1XB 1HWHB 5CP7B 3DVNA 3SO3C 2HTKD 5HHQB 1BVLB 4Y4FC 5D93C 1B0RA 5TF1L 2F54E 1LILA 4GW1B 4DQOH 2ERJB 1QNZH 3QUMB 1M7IB 3QIWA 3IRZA 5HI3D 4OKDA 3X14A 3ESVF 4LP5A 5FDWA 4OD1H 1LE9A 1E4XH 3RZCD 4K3JH 3T4AA 3P11L 4U1JB 4Y19B 4YQXL 5KG9A 1OM3H 3S4SA 5GGRB 4MJ4A 5GISH 3V0WL 5HVHC 1KCVL 4MX7A 3PWPA 3QUMH 5F88A 3EDFA 5E08L 3Q2CA 3B2VH 3EYQD 3DUSB 3KYNA 3WUZA 3UX9B 3O45A 1I3RB 3ULVL 1BVLA 4UIMA 1J9CT 3FRPG 4YBLB 4NWUL 2XPGA 4AIOA 3BRDA 5MEQA 1FFOA 4LVOC 2BNRA 3GJFA 3VH8A 3VI4E 5C1MB 2AJSL 4Z77B 3IRPX 2BRRL 3HI5L 1KJMA 1S9XA 3IF1A 3VD7A 5F6HI 3RIAK 2D31A 4WFEE 2FJFA 5SV4A 1DDHA 4DVBA 3ARED 1C5DA 2APBA 2R0WH 1JNLL 3EDEA 5EORH 1TCRB 5F89B 3PQYE 3FONA 1TETL 1KCRL 3VXOB 5TE4H 4EJ1C 2IANE 1JUFB 5FO7B 5GRJL 5HHOE 4HHAA 3HFML 2OI9C 3GMQA 3NFNB 4CADB 5JW4N 4U1GB 1SJVA 4L8BB 3EOTH 3UROR 4CU6A 4GS7B 1FNAA 4RX4D 3L3OB 5HHVH 3Q6FB 4MNQB 5D71L 5D7IF 5CCKH 5KOVC 1PKQE 1P1ZB 5C0BE 1XF5B 3GSXA 2A6DB 1X9QA 4FN0A 3LKNB 3SDAB 4EI5A 4W6WB 1AGBB 3HS0A 1SEBB 1U92B 3UYRH 2ED7A 2MSPA 4WWKA 3D85B 4MQXD 4K94H 3MGOB 4X6EA 2DQEL 1IQWH 3CVHL 2RGSA 1VFMA 4XX1E 3I2CL 2IFFH 5C08D 1FV1A 1Q9OA 3VRLF 1EEZA 3MC0A 2HJFA 1JF5A 1UM6L 3LHPL 3RWGA 5IB2B 2W65B 5GGTH 2DLTA 2KKQA 3U2SB 2BHYA 4PRIB 5DFWH 3WIHL 3DXAE 5DFVD 5J4MA 5CKAA 1OQXA 4IRSC 4K9EL 3GBLA 2WBJD 2HJLB 2NR6D 2VDOH 3VRIA 1KCVH 4PJ9A 4DGIH 1DQQB 3MYZA 1SM3H 1FG9C 1CCZA 3BPOB 2P42B 5GRZA 3OKLB 1IZJA 4J6RH 5E94B 4WV1C 1MUJA 3M07A 5TQ0H 3IB4A 1Q38A 2DQFA 1G7LB 2W91A 4PV8B 1AXTH 4DN3L 1FNSL 5IHUH 4PJEB 1J1OL 5DD5L 2IGFH 4M03A 4KAQL 2CRMA 1FVEA 3E6HB 2CXGA 3N85L 3NIFE 3MGAA 4MCZB 3BHBB 5I1HL 3EOBA 3HAEG 3NA4A 4KZDL 3SDXB 1QG3A 1DBKH 1U8LB 4XAKD 1SYVA 2BY0A 4PJ7E 1S7XB 4X9GA 5DEZA 1OOAA 5KSAC 1U93B 1DP0A 4NQVA 4R9HA 2HLFD 1KTLA 4GSDL 1H3PL 4U7MA 1DBBL 5MI0C 1AKJA 1EZVY 4LHUB 3U0TB 2ZKHL 4XXCC 1RIHH 5IB1A 1MHEB 3QPXL 3TYGH 3RVVC 2VDNH 1ZT1B 3BVNA 2IAMC 4YJZL 1DBJH 5D2LE 4GW5A 5DUPL 5JW3H 1N6QL 2AXFA 2EC9T 4KV5F 3SDDB 5BO1H 3MOBL 3LS5L 1UQSB 3NCCB 3LRSA 2HVJA 2R2CA 1CL7I 3ARSA 1QRNE 3BE1L 4NPYB 2Y6SD 4ONFL 4PJAA 1YQVL 4I0CC 4FQQB 4PJXF 4M8VA 4P2YA 1P4IL 2DOCA 4JFHE 4BFEA 1R3IL 3MUY1 4LCCA 4CMMA 4F33B 5EU5A 1S7WA 4C59B 5EBMB 1PD6A 1RQ5A 4M43H 4P4KA 5J6GB 1OF2A 2CLZA 4N8VB 4NRZA 2FX8L 2WBJA 4KQ4L 4JHWL 1FGNL 1QFWL 1YYLL 1EJOL 2D7MA 2OCFD 5GRWA 2WWKO 3TA3C 3GUTA 3SDCA 3HS0B 4KJWD 2A83B 4PY7B 3MO1B 1HHKB 2NX5E 4F8TA 1E6JL 4HC1L 2XRAH 4NKIH 2R1XB 3O2WH 3OKEB 1IBGH 1UA6H 2AV7B 4J2XA 2LQRA 1XIWD 4P49A 2VN4A 5JDSA 4ZOCA 4R7DA 2HP4A 4GW5B 4LHJB 3TWCL 1WZ1L 3TCLA 3N9GL 5HVHB 3GO1L 4HIXH 3STLB 1WBZB 3NTCL 2QQLL 4R3SA 1FHGA 43CAB 4L8BA 1BFVH 4Q6IB 3EYUH 2W9DL 4O02L 1CD0A 4AIZB 5T3ZH 2CDEB 4PYGA 3KPRE 2QADD 1IVLA 1WEJH 3QCVH 3OKMA 5EUKB 2FHBA 1HHKA 3WLBB 4BH8B 2C3WA 1U8NB 3IS0X 1YNTB 4X6CB 4WI4A 5IVXF 1TQBB 4OD2A 4NN5B 2RAMA 1NANH 1DE4A 2R0WL 4J4PD 1I7RB 1FVEB 5DUBA 4HBCL 1T83A 4LRNL 3ULVD 2FO4A 4H5SA 5C6WH 3QJHA 4KK6D 4HC1A 4JFDB 1VEMA 1GGIL 2JCCF 2IQAB 3DHJA 1T66D 2Y7QA 4TNVF 5IVOA 1MCEA 5FOBB 5DQDL 4Y88A 4HEME 3KPRB 5IB3B 2DTML 4TSBL 2AQ1A 2FL5B 1RURL 3MRDB 5CHNA 1DL7H 3I75A 4CVWA 4LU5H 5GZOD 2IQAA 3NN8B 4CUCA 4F7PB 3KYMB 4WTZA 4KI5E 2EEDA 5IFAH 1NGWA 3VFTB 3T0EA 2EKSB 3UZQA 2VXQL 5IMKB 2JJWA 3O3AA 4MSWB 3TM6A 1OSPH 3GMQB 3NFNA 3ZT7A 1XGUA 2E8ZA 2DQDH 1B0RB 3UTSD 3BN9C 1FGNH 5I2IB 3TYFB 4GW4A 5L88H 4YDVB 5DUMH 2GY5A 4BZYA 4Q9RL 4ORZC 4OLXL 2QL1A 4RMWA 1EMTH 4GQPH 3ZKND 1P1ZA 2GK2A 3LQAH 3GI9H 5J3HD 2BOBA 2IPTH 2E7HA 5EUOE 4D9QD 1JNJA 1PKQB 4Y19D 2Q7YA 3SPVB 4X4XB 2P8MB 5DMKA 2EH7L 4ALAL 2IJ0C 5ITBL 1KYOK 5TE4L 1PKOA 1I3RA 4U2YA 5C0RL 1IJ9A 1FIGL 4ZAKB 3VRIB 3UTTD 3DV6B 3P4MA 4Y16C 4WV1A 3MV7B 1A7QH 3ARQA 1T04A 4FXKA 2VR5A 4BSWB 4NRXA 2XQYK 4PRPA 5CCKL 1ZHLB 1OAUH 2VDRH 2EDDA 4Z7VA 4P4KB 3EFFB 4K3DH 5F9DC 1BVKB 5J6GA 1PYWB 2XTJD 4HIJA 1BVZA 5HGBA 4BFIA 3VH8B 2DD8H 5CWSA 1XF4A 3FT3B 1JPTL 2H3NA 4CMMB 2ESVA 5ADOL 2BVTA 1NUFA 3VXPB 1U8OA 3WO4C 3O45B 3S3PA 3RDTA 3DX9B 1CXIA 4BSVB 2O5YL 3SGDH 2YRLA 1I7UB 4GXVH 4PTTA 2LABA 3X3FL 4XZUA 3KPSB 1DVFD 4XP4L 3PV6B 1RHHB 3ME0A 1NMBH 1F2QA 4BFBD 2XQYG 2YPKA 3MOQA 1XIWA 3D25B 4O5LL 4QXWA 5IVZB 4ONOA 2FEEL 2W0FB 4XMKL 1GGYA 2ENYA 2NY5C 3WS6A 4LSVL 2LVEA 3GRWH 3H2WA 3MCLL 5JXAH 4LEOB 1R24A 4G6ML 3SKMB 3RY6C 3QUKB 5FUCC 3ZKQD 4LLUB 4GG8B 2BY1A 1OAQL 3C5SA 2CUIA 3O0RH 4HWZB 4L29B 3OKYA 3CU7A 3QG6A 1S5HB 2KPNA 1URLA 3UJTL 5IMMB 1D5IH 1CD9B 3DMMB 3QO0B 1AGFA 2YPLD 4NGHH 4AENA 4KV5E 3EOYG 1OTUD 5GJSH 3SJVE 1UZ8B 3ISWA 5DSCA 3L5HA 3PWVA 4E0RB 4NNYA 5C07A 4OLYL 4NQDE 5DD6B 1ZGLM 1DSFL 4ZUVA 5LGJA 3ARFA 2H3NB 1CQKA 3MNZA 1HCFX 2NTSP 2OMNA 4QO1A 4CJ1A 4Y5XC 5IVZA 2HJKA 4OZGA 1CWVA 4PRHE 5KG9B 1I4FA 1K4CB 2GCYA 5AUMA 2JIXD 3RZCC 1E4WL 4NKMA 2C4FU 4MMXC 1KXTB 3P4NB 5C08A 4PRHA 4KPHH 5JOFA 2PYFA 2ZPKL 3ELAT 4ZSOE 7FABH 3AS2A 1IGJA 2DWDA 2NX5B 4YXLH 3TBYB 1J05B 4ODXA 3LN9A 4BQ6A 2I60H 1U8PB 1RUQH 5E8NA 3QUZD 5DEGB 3QNZB 4HT1L 3GK8H 5JQ6H 5IJKA 4Q0XL 3VXUB 1DQTA 3H9HA 4PIRF 4FABL 4QXTA 4I3RL 3DRQB 1OT1A 1I7ZA 1O5DT 1MCLA 3GKWH 1HSAA 3CVHA 4GRMA 4Q2ZA 5C6TL 4FXKB 4JFPA 4N8PA 5F6HJ 2VITB 4G8FA 4J8RB 4ZO7A 1NUNB 2B2XL 3VXSB 5IQ7H 2AK4E 5JR1L 1GSMA 2D2OA 4HKJB 3B83A 3QQ3A 1AO7B 2EC9U 3SDCC 1JHTB 3FO0L 4KQ3L 5IVXE 4P3CL 3RNQB 4AYFA 3VXOA 4ZPVB 4J8RA 4LCCC 4JZOA 1AGCA 2QSCH 2VLRB 1HXMB 4WY7H 3LZFH 1P84K 1AIFB 3FJTA 4JFFB 4X6DB 4I18C 4HQQH 3TT3H 3QDGE 4LEXL 3MRPB 1N2RB 1U8MA 3ZKSD 2V5SA 1WWBX 3RVVD 3HRZB 3MQIA 1NGZB 3GGWB 4XNQB 4NRYB 1UFUA 5CEZE 3VXSE 1YECL 4RA3A 1MHHA 3RL2B 3C08L 3L9RB 2AJUL 5D7JB 3TBYA 1LMKA 3NIFF 5I8CB 5GS1C 5HHOA 3ILQC 5F7LB 1NGWB 3BH8A 1HINL 2BXZA 2Q8AL 1QLRB 4U1JA 4Y19A 1DLHB 3V52H 4ZNEA 2YEZA 2XZQL 1MCIA 3WMSA 5CINL 1FZJA 4QF1A 5HHXL 2YR3A 5DO2D 4CKVX 3K80A 1A6ZB 1NLDH 1S7SB 3RDTC 3MV9B 3WO3B 4OCWH 3OPZL 4UINH 3MRMB 3D39A 2MKWA 3SE4C 4P59H 2CLVA 1LK2A 1RUQL 5HDOA 3UPRA 2FHCA 2Q86A 4PPTA 1UGNA 4NZRL 4EKXA 5BS0D 5MEOB 2XNAA 3CDCA 3MROB 1IAMA 1QLEL 4X5XB 4QHKI 3OMZA 5HGHB 3G04A 4JO1H 3S3JA 2F53A 4L4TE 2OL3B 2WINA 3P9LA 4TSAH 2AV7A 3QH3B 5J6HA 2KZWA 3BGMB 2VLJE 3G08B 4QEGA 3QIBD 4QYOA 3NZ8A 1DFBL 4FXGB 1EHLH 2WZPD 4U1SB 5T33L 2X4OB 3VWKA 2Y36L 1NKOA 1J8HE 3VXRB 3QDMD 3REWB 3QFJD 3DXAA 1S9WB 5TQ2L 2VLRD 2K7PA 5AG9A 3E0GA 2A0LC 1ULVA 2B0SH 4JM4H 4HIJB 2BVOB 3IDIA 1HDMB 2UUDK 1MRFH 2A74A 4PG9B 5E70A 1KC5L 2QSCL 1FYTE 1WFNA 1U3YA 1LP9B 1CG9B 4QRQA 5DRXA 3WFEH 1A9BA 5FV2A 5SWZB 5GS0C 4MQXC 4OF7A 1I7UA 5KVFL 1VKXA 4HJ0D 5E5MA 4NYLA 4PP2B 3WE6A 4DGIL 2PXYD 4IMKA 2MJWA 1RSFA 4P3CH 4I0PD 4OI8A 4RFOH 3O2VL 3P40A 3LD8C 4HFUH 5CBEA 5L6YH 2CO7B 3ORJA 2ADIA 3BW9B 2D7NA 4OSUH 4B53A 2DYPD 1IAKA 1UXSA 4N9GA 4N0CD 5TDOB 5JMOC 2HFTA 5E8PB 5D7KE 1TTGA 1KLGA 1ZGLA 4OLVH 4QHNB 5C0CA 1XCQA 4JFDD 2EIZA 3B43A 3QUZA 1FLRH 3MRNA 3CSBA 4XPBH 1XH3B 5IIEB 3ZMRA 4PUBH 2AXGB 1EGJH 4G42A 2A1WL 5E9DB 2BXYA 3MODL 2DI9A 5DWUH 5B22A 4QY8A 1AY1L 4R0LB 4ZTOH 2CDFB 3BP7B 4CVXA 5E5MB 3G08A 1KCUH 1WICA 3DVFA 4WW2F 5D5ME 1WZKA 2IF7A 4OQTA 2EKSA 5IMKA 4HPYH 1CG9A 4KPHL 5DRXB 3IVKA 4LHQB 3V7AG 3KLHC 4WEMB 5HVWA 1A7OL 1KCSH 5E5RB 1CLZH 1CXKA 1JPTH 4PJIE 4PJEA 1PDKA 2DJSA 4JG1L 4JM2C 3S36L 1CFTA 2VZTA 2H6PB 4KQ4H 5AWNH 2JCCB 3WJJC 1YEHL 2W9LA 4QHUA 3OZ9H 3NIDE 3GRWA 3R0MA 4KKBC 1JK8A 5ELIA 5IESH 1A4KB 4YHMH 1UEMA 1MLBA 4WO4A 1K6QL 1JPGA 4X99A 1TETH 1FBIH 4BA8A 2YN3A 3NAAH 1UJTA 4EZMA 5D70H 4Y1AD 1RK0A 1MFEL 4RGOL 1R3LB 4DEPC 3ARVA 1HHIA 4XPAH 4NGHL 5C07E 5BVPL 4M6NH 3RKDD 2X1XR 2AXHA 4OGXH 1NQBA 4QRUB 4CW1B 4U6YA 1S7TA 2EIDA 4RRPG 1HYSC 2R0ZL 3IFNL 4K9EC 4XMLL 5T1DH 3GJEA 5E03A 1QSFE 4PRID 1I1YA 1YMHA 2EZ0C 2WUCL 3QNXB 2V6HA 1A47A 5FYKH 4Z5RA 3VCLB 5EWIH 1J1PH 1Z9MA 2APTA 1DJSA 5FM5O 3AY4A 4NO3A 5KVFH 3H9SD 1TVHA 3HE6A 5BS0A 4XNMB 1OHQA 1CU4H 1R3KA 3ROOA 4NRYA 1NCAL 1NFDE 1RURH 2EDOA 2VDOL 4PB0L 3JWOL 5CIPA 3PABB 2Z31A 3LKQA 1YN7B 3OKKA 3RWEA 4R4BA 1IT9H 1I8KB 1BWWA 1PEWA 2JIXB 1IQWL 3CVHH 5FKPA 5J1AB 1V7NL 1KIRA 4JKLA 3PGFH 15C8L 5GSRB 3QXUA 4NC1C 4UIMB 3KYKL 3A6OA 2HFGH 3BD4A 3CVIH 3C5ZC 1RZKL 1FE8H 2OJEB 4G8EB 1BGXH 3CFCL 2ERJC 3FQTB 3IFOB 3MRQA 2H32B 5L2KB 2DQEH 3FRPA 5D6DA 4XVJL 1A9BB 4XBGA 1T1XA 1LP9E 5SX4I 5D7SH 4H8WL 2WBJB 2P24B 3REVB 1RZ7H 4PR5B 3DI2B 2YPLB 4L3ED 2HT3C 3HC0A 1NMAL 3LVEA 1TPXC 2BNQA 3NACH 1IM3B 3L3GB 5FAAA 1G7IB 1ZXQA 4LPTA 1MELA 1RU9H 4GAYB 4QTHA 4ODHH 5TDPA 1F4WL 4XBEL 5E1HB 3V5KA 2BSRA 4XRCB 4XCFH 3LRSB 4Z0BH 1S9YB 2M26A 3IDGB 5BXFA 4ZODA 1VGEL 4R2GB 4XPGH 4HG4J 1RMFL 1FJ1B 3P0YL 1GZPA 2EDTA 3QQ4B 5MHSE 3WJJA 3DROB 1Q9WA 4LLMA 3STZA 4PGBB 1KULA 3WL9B 3GIZL 3VW3H 3HMWH 2ZOKB 3IFLH 4UV4H 2HG5B 1CFNA 2HVKB 2VUOA 3WNPA 4YHKH 1RAMA 4AK1A 2VIRB 4PBVC 5B21A 5HI3C 2ATKA 4XP1L 4LLMB 5A16B 2VR4A 2R9HD 3TO2A 2IWGA 2MCG1 4GRWB 3WHE0 4G80B 5I1CL 5BV7H 2D31B 5D1QC 2X42A 1X5HA 4OD1L 4X8JB 4NC2B 5I8CA 4HKXA 2VKXA 5HDBE 2X6MA 2X2YA 3GMRB 3H7BB 3HE7C 2W92A 5ESQA 2D7QA 5ADPL 1RI8A 1MCHA 4WI2A 1DLFL 3C2AL 1MJJA 1NCBL 3BKMH 5HGBB 1TVBB 2IG2L 4UNUA 4L3EB 3RJQB 1LK3L 3T1FB 3WIIH 5FOJA 4MZ2A 1CDJA 1TCMA 1YEKH 4RMTA 3OJVC 3I6KA 5KZCD 1QBML 4L4VE 1HH6A 5E00B 4NSKA 5FB8B 4PJBE 3CFKB 4ZUUA 5F1NB 4D0DA 4U0QB 2SEBA 1FE8L 3ARZA 3MRGA 5CIPH 3MRCA 1ZHBA 3O2WL 4DZBA 4QHMA 4ZQKA 4PJDB 4JEGB 2VAAA 4Q9BA 3OF6A 5CP7A 1MFNA 1JNLH 2NY0B 4I0PC 1PX4A 4KVNH 1IAII 4HIHB 3KWWA 1BZQK 1MAMH 3K7UA 4JHAH 4Y1AA 1DBML 4X4MA 5F1OB 5C09A 1HSAB 2EE9A 2VOTA 3PWJB 1E28B 1Q9LB 2VLKA 3QUXA 3MV01 3RKDC 4V1DE 5HBBA 2EYTB 4WJ5B 3VXUA 1FSKB 4WI5A 3QJFA 4HIHA 4KFZC 3C5SB 5L9DL 2OR9H 2ENSA 2JCCE 4BH7B 3TYFA 2H32H 3BKCL 4QRPE 5L2JB 2CXKA 1L0QA 1CT8B 2VXQH 4PJDE 3U7YH 3WIHA 4WIQA 3ZKMD 3O3AB 4Z7UA 3LS5H 3UYRL 3UTQB 1RVFH 4V2BA 4NSKB 5FB8A 3BE1H 5AD0B 2OQJB 1JYWA 1JZ2A 2QSVA 1WTLA 3VA6A 2YUZA 3GJFH 4W4OC 2Q3ZA 1MQKH 4Y4KD 3SE4A 5I1CH 2DMBA 1X5FA 1S9YA 5FHBH 4M7JH 4M93C 4LGPB 3IGAB 3ARGC 5C7XL 3QHFL 2LU3A 3U36B 3BEWA 5D7IE 2ZP0T 5FYLL 3KJ4C 4RFEB 4UTAL 4C58B 4U7KA 4XC3L 4PJDA 1REIA 1G7IA 2B1AH 1FNLA 1ND0B 4AENB 3F7VB 4N5ED 4Q0XH 1QFWM 4Z8FL 4G7VL 1H15A 3WHE1 1BVKA 1G6RH 3P77A 1UT9A 3QEHB 1MCNA 1DQML 4OZHB 1IGYB 3MJ7A 1HQ4A 3RBGA 1FVDB 4OLUH 3TO2B 4LCUB 5FGRA 1BFVL 4U6HA 4Z7UB 2FLBT 4Y8DC 1JE6A 3WFBH 3GO1H 5GS2D 4PJGB 3PNWB 1KJ2H 3GMLA 4MXWL 2R4SL 5DI8B 2NY5L 2FJGA 2V5MA 1U8QB 5D2NB 3T2NL 3CPLB 4MJIE 5H94A 1CICD 2H9GB 3JWDH 3IDNA 4M5ZH 1IGFL 1KT2B 3OL2A 2DM7A 5HY9B 4ONGH 5KSUB 3FOMA 3MFFA 2FYYA 4H1LB 4XZUB 4M6OH 1IEAB 1E4WH 4HAFA 3SKNB 5DWUL 2IH3B 1SMAA 2FEEI 3DTXB 4KZEH 1IKFH 4U7SA 3X3GL 1Q0YH 5LXGH 3EBAA 2AVGA 4PGCA 1OB1B 3O3UN 2VWEE 5CGMA 4WFHD 3C08H 4YHLH 5A2FA 5EC2B 4KRPD 4OAWA 1CYGA 5JXEA 3FCTA 1JTTA 3MRGB 2EIZB 1BFOA 2VDPH 4PP1D 4RAHA 1BJ1J 2BNQB 1R0AL 4U1NA 5C9JA 2VXSL 1AXIB 1EJOH 3TT1L 1ZHLA 2F19H 4AH2A 1IAKB 1UXSB 1U41A 1I1CA 5TDOA 1NGQH 3SDCD 4LPYA 5LQBH 1NC2A 3CX5K 1Z6JT 1SY6H 4NQCB 4XCEB 2QADB 4G6AD 4XRCA 2ARWA 2N4IA 3V95A 4HIIB 1EVTC 2A9MH 1Z2KA 1UJ3B 4XP9L 3HZKA 1VSCA 1A9EA 3KVQA 3MBEA 3OTTA 1D6VH 5EN2A 3TBTA 4TUKL 1W0VA 3PWUA 2CKBL 1MWAH 4H88L 1EUTA 4AEEA 4G6AC 1T7XA 1U42A 1N5AB 2QHRL 3U0TA 2BVYA 5M7QA 1K8DB 4H26B 3VDCA 4LCIL 1S8DA 3QI9B 3M8OL 3RKPA 4DW2H 1JPGB 3NTCH 4UTBH 4L1DA 1FO0B 1QYGL 1ZLUK 5FFLA 3GMNB 2OTPA 2ZUQC 3MRQB 3PWLB 3WS3A 1AHWB 1AR1C 2E6QA 3TV3L 5JW4M 3KPOA 3UPCA 3UTOA 5LJYH 1C7TA 4PG2A 2C26A 5GSRA 1MVFA 4YXLL 1WCBB 4OT1L 1IC5L 5F9OL 3VFUB 1G9NH 3LEXB 4X9HA 4X4XA 4DAGL 1MJUL 3CD4A 3K4AA 4PJIA 5DMIH 3QIBC 2WQRA 4HX1A 2E8YA 2Y1VA 4OFVA 3L7FB 4X6FA 2G60L 5E8OA 1P4LB 4HWEL 1EHLL 1EEUA 2BSTB 5MENA 4ZD3H 3QB7C 3H6JA 3ZHDA 3NZHL 2NTFB 4G6JH 4PJ9B 2X7LB 5HYFA 4QOKD 1OSZB 1Y18B 3GKZA 3ZTJG 2QQQA 2ICEB 2IADA 3Q6GH 3LHPH 4ZUWB 4YPJA 3SGKC 2VL5A 4JZJC 1ORSA 2VE6B 2G5BA 1QLRA 1RIUL 3FAXA 1I3GH 1SY6A 4Z9KB 2CLZB 4N8VA 4X6CF 3CSYA 3SEPA 1C8PA 4HT1H 3HC0B 5DRZB 1TZGL 3GB7B 4S1RL 1CQYA 3S37L 2WWKT 1N4XH 1HNFA 1ZKAA 4H0HB 1ORSB 1KENH 3GFUA 5IG7B 4U49A 1U8NA 5GHWL 3MLRL 4F9PA 4LPCA 1VKXB 3DUUB 4LEXH 4H0IA 2K1MA 1BIIB 5EU3B 4KRMB 4OGYH 4JRXD 5IG7A 4K8RL 2Q6WA 1DBKL 1KIRB 4UQ3A 3DNKA 3W9DA 1K5NA 4UUJB 4HXAL 1QEWA 1J87A 3ARBA 4HFUL 5HPMB 4Z7UE 5L6YL 5ADPH 2W07A 1D5MB 5SX5K 2GSGA 2XWTA 1G7PA 4WO4D 4F7MA 2DI7A 5E8DH 2QJDA 3RGHA 1OGAA 2OR8A 1LO0H 4PGCB 4U1HA 1FL5A 1QO3A 3I02B 4I3SH 2GT9A 5I66A 3T4YA 1DBJL 3MV8A 3P0VL 1VFBA 3DO7A 4OLZH 4Q2ZB 5EU7E 4JFEE 2W59A 3K8KA 3VXQB 1XH3A 1HXYB 3ARDA 3TZVA 1YZZA 2DD8L 2VDQH 5EBMA 4BUGA 1KBGH 4ZDHB 1C7SA 4QRPA 2OYPA 4EUPB 2R8SL 4KTDH 4CN6A 2H8PA 1H0DA 1V7MH 2R1YA 2OTWB 3SDDC 4PJBB 3VMPA 4HF5L 3S36H 2HKFL 3VGAB 3FB5A 3T0EC 5JA8B 3VFSB 4RISH 3MRLB 4GJTB 1UXWA 3FN3A 3ARBD 3OG4B 1NAMA 5CEZL 3HUJE 4WUUA 1ODAA 3VMOA 3CCHB 1UB5B 3HC4L 4IOSD 5MI0B 4XXCA 3PHOB 1KJMB 1S9XB 4ODSL 2HT3D 3QRFM 5F7EL 3F7VA 2F53D 5DURB 4I48A 5A2JH 3HAEA 1DN0B 3PGDA 1ZSDB 1FFOB 2YRPA 2A1WH 1SEBA 1U92A 4P23D 5GGSB 4OLWL 4AL8H 3DTXA 4JJ5A 2R23A 4WW1B 5DJDB 2BP3A 4YWGH 3NFSL 4I9WE 3N1FC 1T4KA 2CIKB 3FOMB 1FL3A 3JXAA 3MFFB 5HDBF 3HUJB 2UZXB 1CFTB 4P4KD 1A4JA 3C2SA 4LMQI 2J12B 4JHBA 1YEJL 2XKUA 5DHXB 2VSCA 1HOCB 4LGRB 2NCMA 1LP9F 3RGVA 1KNOA 1R5WB 3CZFB 4GBXC 3V2AR 3EYSL 4NCDA 5IQ9B 4PGJA 3WKML 2AJSH 4MDJB 1YPZF 3MCG1 2QEJA 4I77H 3WFEL 4NQSB 1A1MA 4HQQL 4G8GB 4MWFA 5BW7C 4FFYL 5I74B 1CTNA 2YPKB 2AK4B 1CE1H 2ITDA 3QI9A 4OLEA 1NC2B 5SV3A 1DLHA 3W0WA 5L8LB 5I16A 4HJJH 5JORB 1NCAH 1A3RH 1OL0A 4MHHI 5FA3A 1NGYA 1ITBB 1EMTL 1WLHA 3WHXA 3HRPA 3GSNH 1MJUH 1FH5H 3UTPD 1TNMA 1TTUA 2J88L 2DJUA 2R2HB 4R96A 3SQOL 2WW8A 2OLDA 2PTUA 3JVGA 4MZ3A 1HYSD 5F9OH 4EEEA 5KSVB 4J3WA 4P57A 4GRWE 3S96B 1PQZA 3BWAA 3LRHA 4FFWD 4I3RH 4F58L 5KS9A 3O2DA 4PJ5A 3D69A 5CILH 4LPUA 5KANI 3OR6B 4JN1L 1K4CA 5AUMB 1I7TA 3S34L 3ZHLA 3EYVA 4JANA 1RJYB 2DI8A 3ZL4H 2H45A 1HH9B 5MEND 5DMGD 4OM1H 2Z8WC 4QRSA 25C8H 2DICA 2VQUA 1W72H 4NZTL 2CRZA 1XF1A 5IGXH 2MPAL 3QI9D 4P2QB 1C5CL 2VLME 4NNYB 4X7TA 1T5WB 4YQXH 5CZVH 3FONB 3GIVB 2XXCB 2CJUH 2R56H 5DTFA 3SGJC 1NFKA 2NXYD 4S1RH 2MOVA 4UT6H 2DIJA 5E2WL 3RGVD 1YEKL 4N0UB 1FBIL 4LCWD 2CRYA 1OARL 5E7FA 1S7RB 2Z93B 1EVUA 4WVRA 2P1YA 2XN9D 1XR9A 4UZGA 4FP8L 2XFXA 2VWEC 4OLWH 4AL8L 5CEXA 2HMIC 5L7XL 5GJSL 4FTVE 2GTWA 1OGTA 4NJAL 3U36A 12E8L 2RCSH 5ID0B 2F5BH 2B1HH 4ODVH 3ZE1F 2Z35B 3EHBD 4BH7A 4L9DA 1F4HA 3ARDC 3DROA 2VSDA 1U3HB 3ZYIA 4YEFA 4JFPB 3TBVA 2X89A 3MRHB 4WU5B 5C0IB 4HS3B 3D87B 3ALWA 4QRRA 1HZHH 3U0WH 1BEYL 1ZEAL 3WIFB 2DQUL 3MUZ1 3HI1B 4H8WC 3U9UA 1ZLSL 4JZJB 3SY0B 2YZ8A 4S11A 5DLMH 5CEXB 4HKZB 4AM0B 1TQCB 2HLAA 1L7IL 4PJ9C 4QTHB 1NLDL 1Q94B 15C8H 3MUHL 4Y2DB 1RIUH 4P2OC 4ZFOL 3HAEB 2MCPL 3LH2H 5F1NA 1S7RA 5J13C 1KSRA 3MRPA 3WJLC 5HHPA 4GAFB 3X17A 1XCTB 5D1XD 4NRXB 4HS3A 4QRRB 5I8OL 5IWLA 2OK0H 5F1IA 1JGDA 4JM2A 4LCYA 2D7OA 3FZUD 2FATL 4MNGB 2ATKB 3B5TA 5HGDA 3F8UB 4OTXH 4QXGL 4RAUB 5JPMB 4K3EL 4TOYH 2PYEA 1S5IH 2XZAL 5DRWB 4K7FB 5MP6H 2ITCB 2NZ9C 3TC9A 1AQDA 4WUUE 3DVNB 5D6DC 1F3DJ 3RGVB 1EJ6A 4DN4L 5ID1B 1IAIL 4ZS6D 3OZ9L 2NY1D 1KELH 4E41E 4A6YL 1PLGL 1KB9J 5T1KD 1IC4L 2XA8L 1Q9LA 2VLKB 3QUXB 5TQ2H 4ZTPH 4NKIL 4E5XB 3H9HB 2IAMA 4Z95L 2I07B 3EJYC 5K9QI 4NO2A 4JY6A 2DBLL 4OGYL 1U8KB 1A5FH 4XPAL 5HYQB 4XVTL 3VXNA 4PTUB 1U8PA 3QISA 3QP3A 4DKDC 3OAZK 3GMRA 4G3YH 1MCBA 3O41B 4X0KB 4L3CA 2PW1A 4WHCA 3RHWK 5C0EA 1KNOB 1R5WA 4YDLC 4EXPX 3JZ7A 1AXTL 4DN3H 1VERA 2EXYC 4FFZL 4NQED 1IGFH 4JFXB 5MERB 1HILB 1BZ9A 4J23A 4OBRA 1VADA 1YY9D 5J12C 4J1UA 3O3DB 3ZKXB 4HMEA 2EE6A 4TVPH 2CLRA 3VFRA 3QT2A 4PRAA 2RJMA 4NBZB 5F97E 4WW1A 1W8NA 4X80L 3HNVH 1HSBB 3QFJB 3I9GL 1KIPA 3NPZB 4GH7B 4Y5VC 4P2RB 3V5KB 3U83A 3RZWA 5HHXH 1MI5B 1OAYH 4YDIH 1FVCA 4HUNB 5T1KA 3E6FB 1Q0XL 3AGVA 1Y0LB 1UKTA 4WU7A 4D8PA 2JIXA 4OZIF 3WBDA 2ZKHH 5L8KB 4RBPK 1PYWA 1FJ1A 3TVMB 3ZYZA 5FEBA 1G6RB 2X70B 4OM0H 5KVGH 4PR5A 2HRPH 3SDAD 3UAJC 4G6FD 5DUPH 1N6QH 1DUZB 1HIML 2E6PA 3U7AA 3WLBA 4B7LA 4D3CL 1Q1JH 4LBEB 4BELD 1U8LA 4YHNB 1F58L 2QHLA 1UENA 5GS3A 5GGQH 4U1IB 4FQ2L 1XF2A 4LCIH 3E6HA 1ZHKB 2NLJA 3NIGE 4F9PC 2VLKD 3QUXD 4DW2L 1R3JA 3HNSL 3EDJA 2B4CC 4NQTA 1A7NL 1FYTB 1C12A 4UNTA 3TZVD 2AJ3B 4GXUN 3MLXL 5HYJB 3BP6B 3GSWA 3Q1SH 5ICZA 4RFOL 1DQMH 4KRPB 1YEDA 3TPUA 1JNHA 2IH1A 1MCOL 3TJEH 3KJ4B 2PTTA 3KAAA 4MHHG 5BQ7A 5T3ZD 3GBMH 1BFSA 2Y7QB 4LSPL 3C8DA 2BHZA 4NO3B 4EUPA 2XA3A 4ISVB 4U6TA 4YO0B 1BD2D 1TLKA 1Q9OB 2VZSA 4OJFH 1XCQB 4RGMB 1D6EB 3TWCH 1QFUL 3RWEB 2Y9RT 3CIQA 3L1OH 4KJYB 5IW6A 2FSEB 4JO4H 3PHOA 4APQC 1T7VA 4KK5C 1WUNT 3BQUB 3EYFB 4UUJA 5BZWA 2XI9A 1NAMB 3CLEH 1V3JA 3PWNB 1IC7H 1ORQB 3D2UA 3NGBC 4KK8C 1QLEH 1YEDB 3T08A 4G3YL 3TPUB 1LDSA 3MODH 4BKLB 2BJML 4XI5C 5KAQF 2I9TB 2X4TB 4YDJB 1HZHL 4XWOC 5GSVA 1F4XL 4TSAL 1QR1B 1U2HA 2DQCL 43CAA 2NY5H 1UWEL 2V5RA 4C4KT 5AZ2H 1WVZA 1I3GL 5F3HB 4EDWH 1MCKA 5TPWL 4PJIB 1NEZB 4M5ZL 1P4IH 4TULL 5CD3A 5I75B 5MEPB 3IU4L 9CGTA 4YAQA 5BV7B 5KN5A 2DQIL 3TZVB 4NHCH 4LLDB 5ECJE 3FN0H 1PZ5B 3CJJA 2QKIA 1WAAA 2YD7A 4U1MA 1CL7L 4LF3A 1UCBL 3V0AC 1A64A 1N6UA 2X4RA 3MV8B 4WO4B 4NUJB 5B3JE 3VFMB 3MJ6A 1Y18A 2BNRE 3D39D 3QA3A 3VXUE 4QRUA 2YD1A 4CW1A 3QIUC 5IBUB 4JRYB 1NCUA 3SDXA 4S2SB 1EBAA 4ODTL 5KOMC 3T0WA 4HK0B 3AMKA 3QSKB 2FJFB 4H26A 1EV2E 2DKSA 3T2QA 1IGML 3CVIL 4HSQA 1RZKH 4OUOA 1ZK9A 4JY5H 3WDJA 1Y6MR 1NEZA 2ADJA 2F8OA 5KW9H 2NXYB 3QHFH 2FJGB 4FFVD 1F6LL 2VL5B 5CBEB 2AQ3A 4URTB 2C4FT 1FNEB 2HN7A 3QR2A 5GSVB 4JN2A 4QHKJ 5CMAA 5C0DB 4HWUA 4FQQA 4ZOAA 2HYMA 3DETD 3QFJA 2GUOA 3ZE0F 1MFCL 2BVUA 4NZDA 1BX2B 5F96L 2NTFA 2X4QB 3I6GB 3PDDA 3MRBA 1KTRL 1MHPH 1IC4H 5KVDH 2N7BA 4ORGB 1SJXA 2HLFC 3O8XB 2GSIA 2N1KA 3DX6A 3BX7C 2VL4A 4LLYB 4TTDD 5GGRY 1NCCL 4EN3C 4XAWL 4UT9H 4D9RD 1F11A 3DOSA 4MA8L 1I1AB 1T6WA 2YD2A 3Q5YA 1W0VB 3UTZB 2J88H 5E6IA 4ACPA 4U05A 3O41A 3CGTA 2MQ3A 1Y0LA 1YN6A 3LDBC 3MLUH 1ZA3A 5BRZE 1A9EB 4Z7OF 3BIBX 1CR9H 3ZYOA 1F4AA 2BSSB 1F90L 3IDMA 4QYOB 3W0WD 4J3SA 1H8SA 3TV3H 3T8XA 1TZIA 5FYKE 1SBBA 5DXWA 1FFQA 5ITFA 1A7QL 3TBWA 4KKBD 3UJJH 3BYYA 4Q97A 1YY8A 4QRQB 1KT2A 4YHKL 1YNLH 1AP2A 4XT1C 5F7YC 1KEGL 4KKLC 5DLML 3T3PE 4O2EB 3MLVH 5T1KB 3RNQA 1XF2B 3FB7A 5C0BA 3AMLA 4KMTH 2F74A 3LSOA 2Q87A 3MV9A 3K8LA 3CFBB 1Y6KR 3TA3D 5F3BB 1MQ8A 4NHUA 4MAYC 1AQKL 1S7XA 3UMTA 5T5FH 4ZMAT 3V4PH 5BOZG 4U3XA 5E9DE 2EDRA 4LSUL 1CFQA 2A9ML 3HG1D 1KB5L 5EBLA 2YD8A 1QQDA 5T1MB 5IIEA 1OP5K 4Y0GA 3U4EB 3C5JA 5I15L 4F2MA 1OP3H 3P73A 2F5AL 4P3WA 4CU8A 1RUMH 2F58H 4UDUA 5I9QB 4F8QA 4QRRD 4GKOA 2IG2H 3KWWB 4NNXB 4OAWB 5F7NC 4X9FA 4YK4C 2X9YA 4F37F 4MLIA 3VXRA 2CGRH 1AGBA 3MLYH 5AAWA 4NC1E 5D96B 1M71B 4EQ3A 1CDHA 4BZ2L 1ACYL 1FRGL 5ISZE 3NCMA 2NY6C 3MRJA 3PDOA 4HF5H 4ZXBD 1GXEA 4W68A 1IGYA 1T1YA 4MNHA 4RGNE 3UJTH 2HJFB 2XNAB 4UAOB 5IMOA 3R1GH 1P7HL 4JZOB 1QFUH 5C92A 1D9KB 2A9NH 4AQ1B 1BF8A 1FG2B 4AJ0A 4PJ5E 1I9JH 1KPVA 1MFBH 1MJJB 1Y6NR 2EDXA 4K3DL 4G9FD 2DQGH 3PV7A 4LFHD 2AEPH 3K4DA 4ZUVB 3GSUA 1G1YA 3QWOA 1KB5A 3HMWL 2JB6A 2P5WB 4R97B 4WFED 4BZ1L 4OLZL 4F57H 3MA7A 2RIKA 5EA0L 5EZIH 4OQ1A 2FYYB 4PJIF 1UACL 1G7QB 1RZGA 1I3UA 4POZD 3PWJA 3IDXH 1X7QB 3TBVB 5GIRA 5EOCJ 1KTDA 3FN9A 5LQBL 3ZT6A 1OD7A 2VDKH 3JSSA 3QAZB 3QDJE 3RWFB 1OP3K 3G5XA 3QIUB 5EU4A 3OBAA 3BZEB 3NIDF 2VIRA 2BY2A 4YHPB 2P8PA 4EDWL 4Y4HC 3TNMA 5FO9B 3H9ZA 4TULH 2GFBB 3SN6N 2FBOJ 2H1PH 5L88L 4UT6L 5E7BA 1ZOXA 3CFJA 5EULV 2IMMA 1BZ7A 1YUHA 1KUMA 1T2QH 1I7ZB 4DEPB 4GOSA 2XTLA 3L7EA 5I6XB 3X14B 3BAEH 1U3ZA 3VXME 5B3NA 4R26L 3HE6C 2BY3A 5TQ0L 5JHDB 5HHNB 3QQ3B 3RL2A 2AGJL 5DZLA 1T1WA 3CC5A 4JFEB 4JQXA 2RCSL 3HI5H 4G6FB 2R0KL 5DC4B 3WIHH 1MIML 3BQUC 1AKJD 4F2MB 3KLDA 5L9DH 5F9WB 4H0GA 3QQ9D 3EO9L 1P7KA 2HA1A 1AJ7H 4RFNC 4M8QB 1G1CA 4XCYB 3GIVA 1VENA 5DJYB 4DCQA 5JW5B 4ZPVA 2GFBA 2X41A 2L4OA 3VD3A 2GTWB 4KRPC 1YMMA 4R0LC 5ESVA 4YDKL 4JREB 4OFYD 5HYSG 4D0DB 1LWRA 3QPXH 3TYGL 4EI6A 5B38A 3MLWL 2P8MA 5DMKB 5IGXL 1MJ8H 3IXAB 4LK4A 4X6BA 3EAKA 3S36X 1IQDA 3QO0A 4M7JL 4OZIB 3S98A 1QNZL 2PNDA 3CFEB 4GG6E 1T3FB 1T4KB 2KBGA 4Y1AB 5E95B 4MD5A 5B39G 3V8CA 3O81A 1NFDA 2P49B 1UWXH 1PQZB 3QDGA 3QEGL 5D7IB 2V2TB 3ARFB 3ROOB 4G8GA 5I1LA 1ZS8B 5I1JH 1KELL 4ETQA 1N3NA 1EUUA 3V6BR 2JF1A 4LVNB 1FNSH 5EBWB 4DGVH 4LGSB 1NCNA 5IQ7L 4ZO6A 1KLUA 1T21B 2ADFL 3CDGB 4AQOA 1IEBA 1T2XA 5GGUA 3N85H 6CGTA 3BJLA 2BC4A 1Q9WB 3O6ML 4NWTH 3P4NA 4M7ZB 2JJSC 5IMMA 5IMOB 1EEQA 4BSWA 1INDH 1XF3A 3GMPA 5AYQA 4K9EH 4C55A 4PJHB 3OX8B 2PYED 5JHLL 4KK9C 4X7DC 1W0YT 1VEOA 4OLXH 3NPSB 4IS6B 4PJ9D 3S7GA 2J5LC 3FRUA 3L5IA 5I0ZA 5L2KE 4ZUTA 3MV9D 5B8CA 5DHVB 5I1EL 5FO8A 2F74B 3LSOB 5DK0B 4PJ8A 2GJ6E 3OKOB 4M1CD 3LPWA 1MVUB 1OTSD 5I1DA 2EECA 3RWFA 2R2HA 4LLVB 3KPMA 1ONQB 4C56D 5EO1A 3M17B 4CAGA 5HYEA 3PP3K 5CS7A 2P7TA 4G43A 2AJVL 2Z31B 4MD4A 4KY1L 4NBYB 4OFDA 3O3EB 4F15C 3U4EA 4YDLB 5I18L 4QRTA 4U6VH 3B9EA 2NR6C 4XBGB 3DBXB 3ZYJA 1OCWL 2FH6A 2UWEE 4NKDA 5HD8C 3SGDI 3PWPD 3I9GH 2FZ3A 1WFUA 1P7QD 2UWEA 2DB8A 3JTSA 4JZNB 4Z7VF 3R06A 4MSWA 2HN7B 4PUBL 4LLDA 5D71H 4HMCA 3LKOA 1UWGH 4HCRA 4JPKL 4RX4A 3QWRD 4WFGD 4HV8A 1CICB 32C2A 2R2EA 2FIKB 4M7KL 1N8ZB 4DKEH 3WUWG 3RI5K 4Z7VE 1FYTD 5KS9E 4NZUL 4S2SA 3L3DB 3JV5A 1NL0H 4FMFA 1WZMA 3VA2C 3I02A 5I66B 5EPMB 3QHZL 1SVZA 2JJTC 5SWSD 5IR1A 4WHDA 3IJYB 4JFYB 3SGEI 1A7NH 2B2XH 1CDCA 5LCVL 5I1JL 5FHAH 3ZE1E 1PSKL 4YUEL 4JN1H 1G7JB 4F7TB 5JPNA 4TVPE 3ZDYE 1ERNA 2CRIA 1JFQH 2IBGA 1EX0A 5C0NC 4MNQD 1IAIH 4LCCB 3CCHA 4IDLA 1BQSA 4WNQA 2VQ1B 2X4NB 1KCKA 3LQZB 4OCMC 1JYVA 3F5WA 3M8OH 4HWBL 1Q1JL 4F9LC 2NX5D 5DD1L 1M6OB 5MENB 5BVPH 2HT2C 5FOBA 5KJRH 5ALBH 1CLYL 4P2RD 3SE9L 4WEUD 2PCPA 4KROC 1N8ZA 1WF5A 5T3XL 1UH3A 4KAQH 3GSOA 4CBPA 1TJIL 1IM9B 5SWZD 3E1F1 3BGAA 8FABA 2FEDD 3NN8A 1FL3B 1KFAH 1CFVH 4U1IA 5FGBA 3O6FB 5IBUG 2K9UA 1BIIA 1H3WM 3KPRA 3PWLA 3WS3B 5IB3A 4O4YL 2IADB 1KACB 4HWEH 2ESVD 3K46A 4FQLH 3BZ4B 4HMDA 4IOIA 3ZLQC 2M1KA 1LEIB 5L0QC 2EIBA 2CKBA 3LV3B 4FQXB 5DEFA 4V1DA 3K2UL 4EBQH 8CGTA 1HN1A 3T3ME 2VLLB 1U6AL 4P9HL 2GSGB 3BGFB 4N9OB 2HMID 1BEYH 1ZEAH 4Y1AE 5T1LD 1DVFA 5HGAA 3ILPB 4G8GE 4KUCD 3DYPA 4GKZA 4F7TA 4M3KB 3D3VA 1U8HB 1M7DA 4N9GB 1K5NB 3G6AB 4OD2B 3JV4A 3IJHA 1MI5A 2NY1B 1BQHA 1DEEA 4BQ8A 4O51A 1SHMA 1DQQA 4FQIL 2NXZB 3BPLB 1ZLUH 3GSRB 3X13A 1XGYL 4YFLF 2R1WA 1PAMA 3UYOD 5SWZA 3SKJH 3GDBA 4P23C 2O5XL 5D1ZC 3VWKD 1N5YL 5C0JB 1LE5B 5TDNA 1UVQA 1KXVC 2ZUYA 3WFCL 2IANB 5HGAB 3C09B 2IBBA 1W8OA 3HB3C 3FQWB 4DN4H 4OFPA 1MIEH 3OXRA 3X3FH 2F54A 4FA8A 4BQBA 3I3EA 4IRZH 1X5LA 4V1DB 3ET9F 1SM3L 1JI1A 4EI5B 1OSZA 5D7IA 2V2TA 4JPVL 4IIQA 2B5IB 4OGAC 4HJ0C 4HJGB 3CLEL 3QIWD 4G6MH 5E2TH 1EFQA 1L0YA 1P4LA 4YGVB 4FFYH 4Y5XA 3ZE0E 1FIEA 1CDUA 3UP1A 4JRXB 2JKXA 1PG7H 1ZT1A 3BVNB 4I2XE 4HV8B 3L5WA 4GG6F 3PWUB 2LV4A 3UZVB 2DQFB 2HT4D 3BDBA 4LAQH 4DVRL 4XBPB 1P6AB 4YGVA 1IE5A 3QXWA 1N64H 3MBXH 3PNWA 1L6ZA 1AO7A 3GK8L 4L1HA 4NN7B 4LPXA 3P0YH 3VXNB 4RGNC 5IV2B 3GMNA 1NKRA 4U1SA 2PF6A 4XP4H 2C7UB 1U8JA 4LKXA 5DJZA 3WS6C 3G5VA 4XCFL 1VEPA 3RWGB 1XF3B 3GMPB 1LD9A 3VE0A 2F54B 1FC1A 2ZZUT 4Y4HD 2ZPKH 2CDGB 2FIRT 4L8SA 5HY9A 3U0PA 4KKNA 2Y72A 2BVOA 5CJOH 1MI5D 3L3JB 5ADOH 5TDNB 2J7LA 4HGWA 4MDIB 5FIEA 4OZGF 4KTYA 1MCPH 4JDVB 2DN7A 1KCSL 1SYSA 1MVUA 1AQDB 3IU4H 1JCKA 1OPGH 3TH3T 4KHXH 1T6VN 5BQ7B 4GKSA 4ZAKC 1G7HB 5KW9L 5T5NF 5EIIB 1INQA 1KIPB 4NO2B 2EXWC 1E6JH 2EICA 4R4ND 1XGYH 5ICZB 4YBHA 2YA0A 2BMKB 1LP9A 5K9QG 1O7VA 2R56L 1P2CA 4KI5C 3RIFF 4GRWF 3O4OC 1X4YA 1GH7A 4I13B 2FR4A 5TE6L 2PO6C 4HH9A 3UPRB 5K59E 5K9JL 2PETA 2Z35A 5GQBA 5E2UH 5EUOB 1GRWA 4NZRH 2UWEB 4QTIL 2XY1A 3O0RL 4ETQB 4XXDB 1F2XK 3NH7L 3LEVL 4YHNA 5I30H 5H37G 2D0GA 3RPIB 4CVZB 3QZWG 4MD5B 1OTSC 2V9TA 2WM0A 3G6JF 3V6ZB 1CLYH 3SE9H 2D4DA 1I8IA 5DURD 2IQ9H 1EHXA 1ZV5A 3V4VL 5CP3H 2BJMH 1QSEE 3MLZH 4ZNEE 3VG9C 2BNUA 3EJZC 2OQJA 2ARJQ 5EN2B 3JV6A 3OGCA 2DDQH 2M2DA 1AY1H 5J9PB 3OKLA 5T3XH 5A2KH 4B41A 5DK0A 2CGRL 1D7FA 1NDGB 2EO9A 4I1NB 4UOW1 4XGZA 1KYOJ 2P8LB 3KNBB 1KN4L 3LIZH 4FQCH 1JYXA 5FCUL 2ILLA 3B3IA 1VADB 1P4BH 1OWRM 4PRHD 4LSQH 3AREC 5D7JD 2R15A 4PJ7A 3CX2A 1HKFA 1KLUB 2F15A 1MH5B 1J8HA 5J9PA 3MA9L 5AYUH 3OKDA 2ESVB 3TJHD 4L8SC 2D9CA 5E1AB 4K3EH 1K6QH 2Y5TA 1IMHC 3NAAL 4XHJC 2FATH 3KJ6L 3S5LB 3WIFA 1MCWM 3F7YB 2VDML 2LVCA 1ADQA 3D3VE 1KIQA 2OXHA 4OIIH 4X6BB 2NW3A 5FDWB 4ZS6C 3ROLA 4FRWA 4XPFH 3SDYH 4XNZB 3TN0D 5DYOB 5FM5M 4N1CA 2A6JB 3W5MA 5JOPD 2AI0L 1HHGB 4R8WL 1DQLH 1YC7A 2G2RA 2WK2A 5E8EB 3TA3B 3WFZA 4NM4L 4L4JA 1EHNA 3QXDA 1HI6A 3O9WA 3QIBB 3DRQA 1I4FB 1G7QA 1RZGB 5DJ2B 5JUEL 3AROA 5C0AA 1RUML 2F58L 3VG9B 3NCJH 1NSNL 2A77H 4D94A 4IRJA 3Q5TA 1EA9C 4HWNA 4LLVA 3C6LC 5FKAA 3MNWA 1KG0B 4JO4L 3VGFA 2ZUQB 1OP9A 1CD8A 3UZEA 4KK6C 4DK3A 5B8CB 1RUPH 2E9IA 2Q8AH 2G60H 1DBAL 4Z78B 3UBXI 1UM4H 1HOCA 1Z3GL 1ZMYA 3RHWF 3HZVA 5GS0L 2UWEF 4OZFG 1T1ZA 2GCYB 2ZNWA 3MV7A 3T1FA 2BC4B 1U8JB 2J6EH 3PQYA 4O2FB 1LEKB 3DRTA 4TTDC 4HW6A 2H32A 5L2KA 5DQJA 5IVXA 3D5OF 1R24B 4PS4L 4XC1H 4JJ5B 2ZSWA 4OF8A 5CSBA 2HVKA 4Z0XA 3TT1H 1H8NA 3HNSH 5IQ9A 2QADC 4X9IA 1GOGA 1GGBH 3JV6B 1EFXA 1MRFL 1HIMH 1GGCL 1I1RA 5CWSB 2VYRE 2F54D 5GIRB 1IM3A 4XMKH 3DMMA 5ILTH 1F58H 5L8JB 5FDYA 3V5HB 3ZTNL 4I8DA 5EZOH 4LQFL 1CLZL 4HUMB 3QIBA 1PEZA 4HGKC 4M5YL 2VLJB 3DLQR 4OZIE 4WV1B 2NY2B 4UV7H 3VXRD 2OS7A 2MTPA 3OKMB 1T5XA 4WW2A 3EO1A 3VXPA 3H0TB 2GJJA 2VN7A 2Y07H 3H42H 3UDWC 1WC7B 5DD0H 1E27A 3I6LE 1FFPA 3PL6D 1UM5L 4RGNB 1OAXL 1EH9A 4IIQC 3QEUA 2F5AH 4Y4KB 1K3ZA 2XN9B 1QVOB 3VDAA 4UIKH 4ERSL 5JHLH 1IFHL 1T1XB 1CZ8H 3KNBA 4GQ9L 3SCMC 4M4RA 2HT4C 3V6OE 5IK3B 1I9EA 4N0FA 4P2OA 3F65A 3VXUD 3MBED 3BH9B 3PGCB 4MAUL 1FNEA 4PJAF 2EDHA 5JHDA 3BMVA 4RCAA 1WIUA 4CJ0A 3T65A 1I1AA 4U4BA 5ACLA 4DAGH 2N7AA 1ZTXL 3VJ6A 3WEXB 1HXYA 2R0ZH 3UTTB 1YNLL 2UY7A 4ZUSA 4XAKE 4Z7QE 5EO0B 1QSEA 2F8VA 3RPIA 1JK8B 4CVZA 5IHZA 4ODWB 3C60B 1EGJL 2OI9B 2X4QA 2Y6SC 1PLGH 4Q7DA 1F97A 3TIEB 3DJ9A 4XWGL 2QSTA 5DK3A 3VFPB 1NDGA 2APXA 4JQIH 1WIPA 5K33A 5EZIL 5IT2L 3L7FA 4FS0A 3VXSD 1S9KC 4JVUA 4Z5RB 1FYTA 4YUEH 3M1BB 1G0XA 2NXZC 1PY4A 5IW1B 5F3HA 1QFHA 4GRLA 4PBWD 4HXBH 1MF2L 2PCPB 4Z8FH 1DN2A 4POYA 2BOCA 5BRZD 2DQHL 1YNTA 4X6CA 2CDFA 1FL5B 1GHFH 5DZOA 2ZOLA 4QCIA 4NUJA 5DA4A 4KJQD 3VFWB 4M48L 1BREA 3SKOA 4MA7L 4AT6A 1QLFA 2J6EA 2P5WE 4JHAL 2IPUK 1FSKC 3WNOA 4YE4H 4JQVC 1FG2A 4G7YL 3M45A 4KUZH 4BZ2H 2FR4B 3HR5B 1B2WL 4TRPH 2W0PA 3LPGA 5JO5A 1T22A 1VFUA 3QYCA 3E6FA 4K94C 4HPOL 3DWTA 4ZUWA 5DJZB 5I71C 1DQLL 2VQTA 5JW4R 1UJ3A 1U6AH 4P9HH 4BKLA 5A2LH 5DT1H 4HUXB 4XCNB 4CDHA 4XPGL 2XV6B 4JFFD 3SO3B 4AIZA 5IHZB 5LWYL 2VZ1A 4NHCL 1RFDL 1B4RA 5CSZA 4QT5A 1N7MH 3SJVA 1WWCA 1DSFH 4YHIB 4QRRE 1VFAB 5I8KL 1OAKH 4X6EB 4U6XA 2OL3L 4N0YL 5J89A 1AO7D 1MCPL 2YC1B 3MV8E 3BSZH 4PJ8D 4BH8A 4KKLD 5GJTH 2Z92A 1A6AB 1QUNA 1U95B 1JN6A 3DX8B 2EDKA 1OGAE 4LRIC 5CUSH 3HZMB 2YWYA 1A14L 5CLTA 3T3PF 3KXFB 5HI4D 3JBG7 4HWBH 3K2UH 3D6GA 4E42B 2MHAA 4NBXB 4KMTL 3O3BB 4PGDA 1D5BA 3MRRA 1WJ3A 2H1PL 4E41B 4HS6B 4JFHD 3LS4L 1XEDA 5H94B 4PLOB 1QSFA 2A6IB 1BOYA 4TUOB 4NOFA 5IM7A 3ULUE 4K3HA 3BUTA 2MNUA 1CICC 4KK5D 4E42A 1JWMB 3DX7B 4WWKC 2EO1A 3ARUA 2FZ3B 3N1MC 4LKCA 1FZKB 2NW2B 1A7PH 1CFVL 1WWAX 4NPYA 2CLRB 1VGEH 3VFRB 2C1PA 4EDXB 2X1WL 1NCCH 5EO0A 1KJVB 5ICYB 5J6HB 4UT9L 5IHUL 3KXFE 4PJFF 4MB4A 1I1FA 3FHAA 2KL6A 3HCVA 1N5YH 4RSVA 3ZT5A 2JE8A 5C0GB 2UZIL 3MROA 1DVFB 4XH2A 3LKRA 2DRUA 1MFDL 5DK2B 1ETZA 4GRWH 4TTGA 1ES0A 1F4WH 1QFWI 4XAWH 4XBEH 4IOFC 1Q94A 5IUSA 5C70A 1YEGL 2DKMA 3D39B 3NACL 4UU9B 4PTUA 2ED9A 1H3VA 2HT2D 2O26U 3IDUA 5EOCL 3ALPA 3HRZA 5DS8B 3OHXA 5IBTL 3KYOB 2HVJB 2EDFA 4JCMA 3NCEB 4JN2B 2F53B 3L5XL 1GC1L 2ZCLH 3CXDH 1AIFA 2AJ3A 5CZXC 1JGUL 3K1DA 2A74B 2ADJB 1U3HA 3H9YA 2RB8A 4Y4KA 3MRIA 1CLOH 3BH8B 2APWA 1CGTA 3NPSC 4HPOH 1MAML 1JZ3A 3IETB 4N0YH 3UBXG 5EO9A 5F93C 1M6OA 4F9LA 3CFDA 4CRPA 5IVNA 4QLRA 5HYQA