2A77L

Anti-cocaine antibody 7.5.21, crystal form ii
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
216
structure length
214
Chain Sequence
DVLMTQSPLSLPVSLGDQASISCRCSQSIVKSNGHTYLEWYLQKPGKSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLRISRVEAEDLGVYYCFQGSHIPWTFGGGTKLESKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Flexibility of Packing: Four Crystal Forms of an Anti-Cocaine Antibody 7.5.21
rcsb
molecule tags Immune system
molecule keywords Immunoglobulin Light Chain
total genus 49
structure length 214
sequence length 216
ec nomenclature
pdb deposition date 2005-07-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a77L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a77L01
3NAAH 5L9DH 3KPLB 5D7SH 3VFNA 2X10A 1IAKB 3BJ91 3U4EA 2P8MB 2OCFD 3VXME 1EFXA 1FVCA 5J6GB 3QEQB 4TUJA 3UTPE 1MRDL 2AK4B 3QEGH 3MRPB 1YYML 1NFIB 1DVFB 4X6EB 2Q1EA 4L29A 2GFBB 4TYUA 1DQJA 1JN6A 2GJZA 3TA3B 3V6FA 5FB8A 3C5ZB 3QDAA 3G5XA 4RISH 5HYJA 4GLRI 5FUCC 5I18L 3DRQA 4U6YA 3IDMB 5EUOB 1VACB 1IC7H 3H3PH 1RZ8A 4ZO8A 1NGYA 1U8JA 1J11A 5J3HC 2V5SA 3HNTH 1LNUA 2HJKB 3W39A 2CRYA 5BW7C 1IGYB 4OIBA 3H9SB 4M61B 4PJEB 1TENA 3EO0A 4PJ7E 3GI8L 1O0VA 3FQTB 5I19L 1OM3L 5JR1L 4JFXB 5I9QC 3BKCL 2QQNH 5J06A 2K7QA 4JQVC 4QHUB 1IC4H 3MROA 4O2FB 4X7TA 3CVHL 1Q9WB 4ZNEA 4I4WB 3PP4H 4PGBB 4OZHF 2XKNB 4G5ZH 5HDQL 3E2HC 3OKOA 4AEIH 4TSBL 5F6HJ 1IGJA 2LTQB 5E5MA 3QUXD 4LPYA 5FUOH 3HCVA 2AEWA 2DDQH 3VFWB 1AGBA 2D2OA 5ESVA 5AZEL 4MB5A 3ARGB 2ADGA 4XP5H 3EDEA 2ESVA 2EDNA 5D6DA 4X7FC 3DWTA 4K7PX 3QUKB 2A77H 1R0AH 3BKMH 1A5FH 3NPSB 4FXKA 3IFPB 4W81A 4GFTB 5DTFB 4PJAE 3VJ6A 1KEMH 1U3ZA 3QHZL 4KFZC 4XCNB 2NY7H 1IGMH 4NPYB 3QXVA 5I66A 1CDBA 1NL0L 2GHWB 5MERA 3C9NA 1DZBA 4BH7A 4Q58C 1IC4L 1IEBB 1XGTB 4UT6L 1ZSDB 4KY1H 5I76B 4DQOH 5KW9L 1H3GA 2DQUL 1MY5A 4JO2H 2QKIA 3VFRA 1J05B 1GXEA 4G80B 4JO2L 3OKKB 4Q9BA 1TJHH 4JHAL 4DGIL 4JVUA 4JRXE 1U8IA 4Z0XB 1I9RL 1QFUH 1JN6B 2GJZB 3TA3A 4H5SA 2A6KB 3RWJA 3A0OA 1BVZA 3GK8L 1P4BH 5HYSB 1N6VA 3OJDB 3OQ3B 3MRGA 2VB5A 1VFMA 1HILA 5KSAD 4XVSL 3QEQA 4K07A 4LIQH 4L4VE 1KTLA 2UWEB 4GBXA 4RISL 1DQLH 2P8LB 3Q6GL 1PYWA 1FAKT 4WFGE 3VW3H 3QDHA 4J8RB 2VLJA 4Q0XL 3GSQA 4PJ8D 2FL5B 2ZUQC 3GRWA 3B8SA 4MJID 3GMOA 2WAHA 3C5ZD 5ALCH 3RVXD 2CLZA 5EBWB 4Y89A 1JGVH 4UINL 1BZ7A 4JRYA 2DQTH 4UU9B 4KK6C 4ONFH 4JJHA 2DWDB 1ROWA 3NN8A 5C0IA 2QADD 1FL6B 4WFGD 4ZAKB 2YOCA 1Z5LB 5CGYD 4DVBB 4M7ZC 2MPAL 5GRXG 3UTOA 3S3JA 4HFWA 1NBYA 4RIRA 1J5OH 5IM7B 1DBML 4K7FA 3CFCH 1D5ZA 1AY1H 3ZHKA 5I1HL 4QXGL 5KANG 2AS5M 1UH2A 5T5NF 4KDVA 1QSEA 3LKSB 3BUYA 4UT9L 3KWWA 5TQ0H 2FBOJ 4PJ7F 3ZZ1A 4HIJB 4P9ML 3UC0L 3TT3L 3EZ8A 4FFWC 3O11A 4ZPVA 2R56H 3DSFL 4CAGA 1CXLA 3FT4B 2BCKA 4JPIB 2P5ED 3FZUC 4R4BA 2H1PH 2X2YA 4EN3D 1P2CB 5I73C 2OQJB 4XXDA 3G08B 2R1XA 4P2QA 4APQB 2ADJB 3PABB 1JGUL 4L9DA 3SKOA 2CIKB 4Y19E 1B0WA 2FGZA 3HG1E 4IHOA 4KJQD 5GGSA 2LU3A 4Y1AB 1MHHA 3QPXL 5D1ZC 8FABA 4FQJH 2W0LA 2OK0H 1I3RA 2PR4H 5KVGH 2L7UA 4ALAL 4P3DA 1MFDL 4C54A 3REVA 3AS0A 3OGCB 4UILH 1LILA 5IB4A 1FSKC 2A73B 3S37X 3QEQE 1QLFA 4U1SB 1HCVA 4YPGB 3U0PA 1VPOL 3ZYIA 3BO8A 1A9EB 4EBQL 1E28B 4K8RC 5CKGA 3UTTD 3TZVA 4ZNCD 1QSFD 1NGWB 2CJUH 2JJTA 3O4OB 4ZXBB 2A9NL 5F1KC 1KENL 1CT8A 4YO0B 1TETL 5D2LB 4XPGH 1T20A 4OIAA 2R29L 3MOBH 4YH6A 2VDNH 4K8RL 4QRTA 1CE1H 3U4AA 3SBWC 3GJEA 1V7NH 3LRSB 1UB5A 5IBTL 1OARH 4OLXH 2D4DA 5DJ8B 3KPPB 1NDGA 4LVOB 2DM3A 2DBLH 1W2KT 1ZVSA 3T0AA 4PJHE 1BGXL 3BZ4A 3ULUL 3HTLX 2CDFA 5BZDB 3EO1A 4U1IB 3VCLB 3TO4D 5HGHB 3QFDA 4GG8A 4H25A 3UCRA 1NJ9A 4D9RE 4I3SH 5E08H 3SGKC 1HHIA 5B39G 2C9AA 2YKLL 2J8HA 5DR5L 1X5GA 5TE7L 3OBAA 5BVPL 5SV3A 3GRWL 5E8EB 1RJZB 3GNMH 4NSKA 2VKWA 2Z31C 2BJML 1JF6A 4TNVK 2HFGH 4KMTH 3RX5A 1S7WB 1U8KA 5F1NA 3TNNB 4M1CD 3TZVC 3F7QA 1U92B 3BP6B 3V5DA 3V4UH 1RJYA 1ZANH 1DBKL 2HTLC 2FLRT 5SWQA 3H7BB 4LU5H 1V3LA 4ZXBC 4ZUVB 1YEIH 3LPGA 4DKEH 4DUVA 1AHWC 1FDLL 5AUMA 3UTQA 1RZFH 3ZKMD 5KSBA 4R8WL 3HR6A 4YWGH 1KYOK 3HNTL 3SE3A 3FO2A 1TNNA 4WI6A 3NPZB 1FRGH 1KIQA 5J13B 2VN4A 1WWBX 5HBBA 5IMMA 2GUOB 4RWHA 3VFOA 4JO4L 5KOVC 1CR9H 4F8TA 4YX2H 4OB5H 4Z0BH 4I0CC 4K3HA 2APXA 1FZJA 1SQ2N 5F9DC 3BRDA 2CK0H 1JK8A 3WXVH 2ENSA 4EUPG 3WXVL 2E6JA 5CEZD 1MSPA 3IRZA 4QOKE 4NHUA 1MFEL 3CCHB 5CAYB 2HTLD 3QUXA 4JKMA 4MGXA 4P2QD 4F15B 4O2EA 2JB5H 3KXFB 3VG0H 3C60D 3JWDL 1WZ1H 1TETH 1H5BA 2BVQB 5IQ7L 3H9SD 3L5WA 5CKAA 3G5VA 1NCNA 4L3EB 5C09E 1G7IB 1I7UB 1UJTA 3P0VH 4YHPB 2ZZUT 3SE4C 4LEXH 4DGYL 5D96C 3OX8B 3MUGA 4ZUVA 2XQYK 1T0MA 5SWQB 5H94A 3TLRA 4TSAL 4CRPA 4FQ2H 3T4YB 4U0RC 1U92A 1YYLH 4WO4C 4XH2A 1B4JL 3EKCA 4G8IB 3U7YL 1U8OB 3QXWA 3V6ZB 1PJ9A 1HH9A 4X7CC 1WQVT 1U36A 2X1PA 4V2BA 1AKJD 3VGBA 4PS4H 5GXBB 3ILQD 1RJZA 4NSKB 1VGEH 4ZS6C 5IR1A 3MOBL 1S78C 3PWLB 4GQ9H 4WWKD 3SGDI 4O9HH 4G8GB 1UJ3A 3C6LA 3ARBC 1NMCB 1BP3B 5EU6D 5IESL 1RUMH 1JRHH 5CJBA 4MCZA 1AO7B 2ZCKH 4PJHF 3PL6A 1J0YA 2I24N 1HZHH 3VMOA 1LEIB 1IBGL 1JNLL 2A83A 4F37K 1N0LA 3LV3B 1D5IH 3MODH 3N1PC 1IAMA 5I1IL 2FX8L 1T0PB 5B38A 2NX5E 4YIQA 3FOLB 1V7NL 4PJGB 2XWJA 2V9RA 1G9MH 3P30L 5I1CH 4FXGA 3EYUL 4EEEA 3T0WA 1UZ6E 2AEQH 4XNZC 4TSCL 4GW4B 4RDQG 5F6IB 5L7XH 1F90H 2EEDA 4XP6H 3SQOH 2I26N 4ZDHA 4WWKA 4WY7H 4U1MB 5DA4A 3I6LE 4OKVB 4PLJD 1QFHA 1ERNA 3SE8H 3CMOL 3F12A 2OI9C 4P23C 5I75B 1A9EA 4JM4H 2AJVL 1MAML 3IJYA 1WAAA 4RGND 5F7HA 3NOIA 1JHTB 4I13B 5SV4A 4G7VH 3O9WA 2J8UB 5GGVY 4XNXH 2JK5B 1GOFA 3O45A 4MQTB 1CICA 5FKPB 4Y7MA 4YHZH 5DJ6B 4R8WH 1Q0XL 4ZTPH 1FFRA 4IOFD 3I6LD 3QFJA 2W60B 1UZ8A 1NLBH 2P1YA 4JHWL 2AABH 4QT5A 1QRNA 3HZMA 1TJIH 1JUFA 5KSUB 4R2GB 4WW2A 1QBMH 4MAYB 1BBDH 1ZVHA 4XVSH 1BM3H 2HT3D 4ZTOH 1U93A 1BZ9A 3RWIA 3K4ZA 2A74A 5HGAB 3BEVA 1M6OB 3Q3GB 2WUCL 2N7AA 5CSZA 4UB0L 4NBYB 3V0WH 4JPIA 4DEPC 1A3LL 4N0YL 5CZVL 3AFLA 4XCFH 1KPRB 1MUJB 1QSED 4HBQA 5KZCB 1G7HB 1QFPA 3FO0L 2WWKO 5IHZB 3FN0H 1V05A 3VWKA 1FFPB 5IVZA 1CICD 3O6LL 5LXGH 5D1QA 4PRIA 4KRPB 4V1DA 5FK9A 5IHUL 1FYTB 4WUUD 2HH0L 4WUUA 2JJSC 4LASH 5AWNL 1OW0C 5C0BA 2YXFA 3JZ7A 3O41A 5A16A 4LLAA 4K7FB 1JZ3A 3T4AB 3EYQD 2AERT 3U9PL 3QYCA 1FG9C 4P2OD 5FM5M 4OZFA 3O4LB 3ZTJH 1MHEB 1N3NA 1T89C 1EO8L 2DKUA 4PGDA 4NQDA 3T77B 4LFHD 1R3KB 4M1GH 3FRUA 3CK0L 1JNNL 4TNWK 3L3GB 3E6HB 1ZLVK 1JWUB 4DVRH 2GJ6A 2IANB 3BX7C 4NC1C 5I15H 4KROC 5ADPL 3VMPA 3NTCL 3DUUA 5IFJB 4L8SA 8CGTA 4H20H 1S7RB 5EZLA 3U82B 1MFNA 2WBJB 3R8BB 5K9JH 3VE0A 1EHNA 3TNMB 4WWID 2D31B 3KS0H 4ZOBA 4ONHB 3U0TB 4UQ2B 3WS3A 3MJ7A 4QEGA 1CWVA 4AEIL 5FM4A 2GK2A 4EUPB 4DN3L 4YFDB 5FYLL 4N8CH 2DMCA 4Y4KA 2IAMD 2X70B 3PWNA 3CMOH 5IBLD 4IRZL 4QRRE 5JZ7C 5F9WC 3JUZA 2F5BH 3QPQC 2Y5EA 3DHJA 4HKBB 4ALAH 3DGGB 4HIXH 1MCRA 3NGBC 2O5ZH 3QCTH 4PRNB 4G80A 4HC1L 1F6FB 2VDRL 3QEHB 5GIRA 4OD2B 2X4NA 3OKNA 2AQ1A 4HUXB 4HGWB 1G9MC 1VFBB 5F71A 1PX3A 4OM1L 4H1LA 1AR1D 4F7TB 1H15B 1FGNH 1BAFL 1FFNB 2YSSA 4BSJA 3CXDL 4LDEB 4XCNA 5IROC 3OKLA 1KCRL 3IGAB 3A6BL 2XNAB 5T3ZD 3CH1A 1RZKC 3L3JB 3SDDB 3NFPA 3A6CH 4I0PB 4UTBH 4HLJA 2WWMD 3V7AE 1T5WA 2DQEL 4XPAL 5GS0D 3TN0C 3C60A 4TNVF 5GGTH 3I85A 4R6UA 3O3UN 3QUKA 3MRFB 2GAZB 2XZQH 3BGFC 4XNUH 3N06B 3BP7B 4POZD 4MWFB 3IYLW 4RAUA 3RY6C 3DURA 3F7YB 3O3DA 4XBGB 2MQ0A 5E5MB 3ZDYE 1ETZA 3PWPD 1NFDA 1ED3A 5IMKB 4PG2C 2ZSWB 2ZCHH 4K3DL 4OD3H 3OR6B 1RUQL 1X7QA 3I84A 4PREA 3DARA 5DD0H 1XR8B 3V8CA 5GGVH 3MLVH 1CDIA 4XP6L 2I60L 3H8NA 4ZFZA 1B88A 3QT2A 3SOBH 4H88L 3VWJB 3HN3A 1JWSB 5CS7A 3JWDH 4N8PA 3IJHB 2HT4C 4PD4K 1A64A 3MLXH 4L9LB 1AQKL 4CKVX 3WDIA 5I1AA 4M6NH 5DJAA 1B9ZA 4HSQA 1R3IL 1EEZA 1OOAA 3WUWA 1YC8A 1J10A 3PE9A 3ULVC 4POZC 3BRGC 3EJYC 3KPRA 1JHLL 2EDKA 5B8CB 1OGAB 1JNHA 3L3IA 4XPBL 3VGAB 1SYSB 1T0NB 3MLUL 1DQJB 4S0SD 5FB8B 2MTPA 1SBSH 2VUYA 4PPTA 5HHQA 3P4NA 1AIFA 4U3HA 2A2QT 1RZJL 1G6RH 4MCYB 5F93C 4L1HA 2V9TA 2RJMA 4XP1H 1KOAA 4OLYL 3MPCA 3P9WB 4XC3H 4YNYA 4Z95L 5SWZD 4M48L 3RX7A 1U8NA 2YXMA 4M7KL 4MJ5A 1UA6L 3W11D 4Q9QL 1UB6A 1HWGB 3V52L 4ETYA 3MCKB 3BD3A 5FYKH 2CMRH 1A9BA 1MJ8L 1V3KA 5L2KA 4N8VB 4UOJA 4OCWL 3UTTE 1I9EA 1BMGA 4Z7UE 3DGCR 3A6OA 1OWRM 1A9BB 1Z2KA 4LLWB 3C6LD 1KEML 4PJDE 5I1LA 4NQCD 1U58B 4MDIB 4NQED 2ARJA 4L3EE 5C09B 2X9XA 3ZKNC 3LEYH 2P5WA 4JRXD 3VDBA 3KYNA 2KL6A 5E2JA 1ZANL 2JIXB 4YDVA 4XRCB 5IHUH 1INEH 5ICZB 1G6VK 2C4FT 3HNVL 4X6DA 2CUIA 4ZYKA 1T1WA 4U6VH 4KVCH 3WDHA 4P5MB 4TN9A 1OVZA 3SGJC 3H42H 5I16B 2AEPH 4AG4H 3UAJD 1F58L 4G42A 5F7LB 5ESAA 1U42A 3DX6A 1A1OB 3BQUA 1R3LA 5L2KD 3VWJA 4ZFZB 3RY5A 2PN5A 1DLHB 2VLJD 4KKBC 5EOQL 3LKPA 2VSDA 4KU1A 2HJLB 1MELA 4NN6C 1CD9B 1A14L 1BWMA 1NKOA 4JDVA 2BVPA 1N2RB 1NANI 3B2VH 4OCWH 4IS6A 4Y4FB 5FYKU 1P4LB 1BECA 1JPSL 1OW0A 2QBWA 2XZCL 4KKCD 2KDGA 1I7RB 5EUKB 1B3JA 2EH7L 5I8CB 1J88A 4CNIA 4RCAA 3BMWA 1S9VA 2V9QA 3BPOC 3EJZD 3CFIC 4JM2F 4RQQB 1A1OA 3BQUB 5EOTA 3MLTB 2AJVH 3ZO0A 5HHXL 4LVOC 2APTA 4NT6B 4PJ9D 5ANMA 3HS0A 1OAKH 1OAQH 3BP7A 4MJ4A 1LE9B 3RBGA 2C7UB 5T1DH 3MLUH 3MXVL 1U9KA 5C0CD 1AXIB 1T1WB 2LTQC 3C60B 2A6DA 4BQCA 4X6DB 1Y6MR 1CXKA 3ARVA 5F7UA 3HZVA 4X7SL 3RIAK 3V4UL 4OZFG 2JIXA 1FGVL 1WWAX 3RHWK 3CH1B 3U7YH 3ARQA 4IRSB 4PRAB 1YYLL 1A6UL 1U2CA 3QWRD 4GLRH 2Z31B 2I60H 3UTSD 5JXED 3FHAA 1GJIA 4UTAL 5HHNA 5I1LB 4F7TA 4Y4KC 4H1LB 43CAA 2HG5B 2NW2A 2R2BA 3LAFA 4PG9B 4U1JA 4ELME 4J4PC 3DVIA 2OL3B 3BOVA 2VDLH 3NH7H 4JCMA 3FAWA 5D7IE 2BSTB 2J5LB 4YR6B 1JYNA 4OZHA 5L8KB 3NCCB 1E4KC 3RWEB 3OB0K 3TFKC 3WFEL 2XV6B 2R56L 4L4TE 2CDEA 1GOGA 5TGBB 5AD0B 5E0QA 4ODUA 3ZE0E 1H3UA 1MCIA 4Q6IC 4JKPL 5I1GL 1OTUD 1QSFE 4KQ4L 2QL1A 2X09A 5C07A 1HXMB 2NZIA 3L7EA 5EC2B 1OTSD 5T1DL 4KROD 4OV6F 5IROA 4EXPX 3WNMA 1Z9SA 5D7LB 4ZUUA 3D5OF 2ZOKB 3G5ZB 4F2MB 2G60L 3IJHA 2OYPA 5CSBA 4KDTA 4X5LA 1UADC 5IK3A 3AAZB 4F7MA 5SX5H 4S1QL 1WFUA 2GK0A 5ADOL 5JO5B 3UJTH 3LZFL 5T1KB 1UACL 3UTZA 2JF1A 4NP4H 3LSOB 1AE6L 3WHE0 1H3XA 4JO3H 1G1YA 5DD3L 1ZHNB 3O4LA 1WVZA 5CJQL 2YUVA 2VH5H 1MREL 3D25A 5B39B 3BT2L 3J7HA 5I2IB 1ZKAA 3O3DB 3TYFA 5C0BB 3OF6D 3DECA 4BA8A 1KF9B 3TEUA 3MRRB 2IBBA 3TYFB 3OKMA 1CVSC 4FZ8H 1KJ3H 5K93A 4LLMB 5B39A 3ZTNL 4KVCL 5DLML 1EBPA 5EIVA 3OXSB 5CMAA 5KG9B 1T5WB 1I1FB 2BC4A 1UH3A 2ATPB 4ZUTB 2X4TA 3C8DA 1U93B 2NY0B 1F4HA 1AGEA 3OSKA 2VL5B 4PRBA 1BQSA 2FJGB 2E9JA 3QUYD 4FQQA 4YE4H 2F9BT 1DBKH 4K94H 2G5BB 4PRDA 3B9VA 1RMFH 5E5RB 1F02I 2WBJC 4JANB 4P4RB 2YPVH 2VDNL 5EDXA 2J1KA 2Y7QA 5DQ9B 2BNRE 3GSOB 4PLNC 2VITA 4RZCA 4M7JL 3C87A 3GSXB 3G6DH 4JHAH 4HKBA 2ICEB 1TXKA 5TE7H 1UENA 2PUQT 3MA9H 3MLYH 2AJYL 2R4SL 3FQXB 2VAAB 2QTEA 2ICEA 4JPKL 4G8GD 5TPWH 2QQKL 1U91A 3NZHL 5DK2A 4WWKB 3NCEB 1DQDH 4OZHB 3NGBB 4N5ED 1CI5A 4UOW1 1AO7D 1T4KA 4O02L 2EO1A 4O2CA 3RUGE 4GW4A 2H3NB 5JLZB 2EE6A 3QNXA 2M26A 1MAKA 4NKMB 4ELMF 1I1AB 1A3LH 1MPAH 4HS3A 4Y19B 4ZFFA 3ULSB 2MQ3A 4WVRA 1X5LA 1FBIL 3LQZB 5L2JA 1AXTH 2IBZY 1JWUA 3MV9E 4NQUA 2CO6B 3FQRB 3QI9C 4O51B 1URLA 3OJMB 4HULB 2VLKA 4QO1A 3BKCH 4ZUTA 4IRSA 4OCMC 4LASL 3ZE0F 3E0GA 4Y88A 2VLKE 5EUOF 3PL6B 4Y16D 3BI9X 3T3MF 1DBJL 5J9PA 4PJ9A 5D6DC 1VESA 3O6FC 3HZVB 2A6DB 2ZCHL 3BUTA 4WHYH 4G8GA 4ZPTA 2CXGA 5E99H 3AXLA 2C5DC 5H8DA 1HNGA 3OKMB 5CZVH 1BD2E 3GJFH 3QIUC 2BHZA 3KLDA 4JY5L 3V0WL 1NGXA 2VSCA 1RK0A 3RDTC 3BEWA 3P4LA 2AV7B 3TIEA 2R1YB 3GUTA 2H9GA 5I2IA 5MI0C 2LVCA 1V7MH 2E6PA 4DGVL 2FIKB 3R8QA 3WIHL 3M17B 3WS6C 5MEND 5ELIA 4H88H 1I7RA 3MBXL 4S1DC 2YK1L 4GUPA 4NQCB 1KPRA 5K9OA 4HIXL 1NBVL 4IS6B 1HDMA 3OPZL 3X3GH 1QLRB 4KZDH 4PJ8C 1J1XL 2ICWJ 5I1EL 4L3CB 4PGEB 5J56B 2KH2B 1IQDB 3PIQB 4L3EA 2VC2H 1NUFA 1YMME 1A6AB 4AENA 5D2NC 3O3BA 5AYUH 4L9LC 1IILE 1V8HA 4ZUUB 3GHBL 3DX6B 2DQJH 3SDAD 4GRMA 1OD7A 2XTLA 4U0QB 3IDYB 2XY2A 3ARFC 1NDMA 1RK1B 2NY3D 2VDRH 4ODTL 5A40E 4WHTB 1CICB 2OSLB 3QCTL 5FKPA 4E41B 1DJSA 4XWOD 1ZXQA 1NGZA 5EZOL 1J0IA 3OJ2C 1MREH 5IOPA 4OZIA 3P0GB 5C07B 4Z8FH 5CLTA 2RB8A 1NMAH 1HKFA 3QAZC 4IRZH 1NCTA 4XMPH 1DSFH 1FNLA 4LNRB 2OR7A 3QJHA 4X4MA 2AGJH 1TIUA 1N8ZA 2W59A 5E8DL 4CDHA 2ZPKH 5KS9A 1PG7H 5DJ2A 1EPFA 3HB3D 3AROA 4LLVB 4AIOA 4XCYA 1PG7L 4ZD3H 3BXNB 43C9B 1J18A 4IMKA 4U1JB 5ENWB 1GL4B 1CDUA 5SX4H 4HBCH 2XPGB 1JMXA 3ARED 4DQOL 1INQA 4XTRC 2IQAA 1L7IH 4KUZL 4MAUL 1LD9A 2R0KH 3MLRL 4WCYL 5EU5B 3RWGA 4PRAA 3DO3A 2FECL 1U3HC 3MV01 2AXFA 1JGEA 4KQ4H 1A6UH 1M7XA 5DJXA 1PDKA 4CMMA 1T6WA 2IMMA 4G6ML 4YHKL 2FJFA 1UJ3B 3I9GL 4Z77B 2GYSA 5JW4M 5C0RL 3D0LA 3SJVA 1LK2A 2N4IA 1KT2B 4NNPL 3I02B 4M5YL 1YMHB 3ARFA 1FG2A 2MCG1 3TWCH 3WUWB 4FQ1L 3SGEH 3OTTA 5GSVA 2WP3T 1NMBH 3MNVA 1ZT1B 3OJVC 4L3AA 4S10A 4G9DB 1OGTB 3AREA 3FTGA 1RZJC 1S9VB 4AK1A 3HFML 4YHZL 3KXFE 3V6ZA 4G8IA 1XZ0A 4R4FH 4NKDA 3WIHH 2Z35A 4OF5A 3NCJH 3O3EB 5CWSB 1I9IH 1N2RA 4Y4FA 4N1HB 1NDGB 35C8L 2YD3A 2NXZC 4JREC 3GSRB 4G5ZL 1P4IL 5JNYB 4LK4A 1KPUA 2VRAA 4PJFB 5EPMB 3R1GL 3MRNA 1BM3L 3LKPB 3QQNA 3UTSB 4ZTOL 4LVHC 2F5AL 2VLLA 1HHKB 3QXTA 4HHAB 4KTDL 4JG0H 12E8H 3HE7C 1EFXD 1G6RB 2KKQA 5DGQA 1MHPL 3IF1B 4BZYA 1JCKA 3HMXA 1F4YL 1N64H 4X6BB 4OFDA 3P0YL 2IQ9L 4JZNA 3V9FA 2ED9A 2FIRT 3N85L 1BX2B 5E7FA 3ULUC 4HF5H 1AH1A 5BRZA 1IGCH 5B3JF 1H8SA 4MXVF 5HYJD 3L6FB 3SO3C 4QRRD 1LVEA 4LIQE 2NX5A 3EDJA 4KRLB 4FTVE 1TFHA 2ITCB 3QISA 1CDCA 3T0XA 1CK0H 5IFHH 3ULUF 2AK4E 4GRWB 4MJ2A 4I0PA 4I0PD 4M93C 3Q6FA 5KVDL 2XNAA 1FFOB 5DZNA 2J6EH 3KYNB 5IW6A 3RTQD 1AFVL 4EDXB 5DVKA 5DWUL 4QHMA 4PJ8A 3I2CH 4GKNA 4OLEA 1DN0A 1DCLA 1BF8A 1VFBA 5KSBB 2CIKA 4QRPE 2FH6A 5H37H 4XAWL 5K59F 5EBLA 4JFHD 4MXQC 3DUHA 1U8NB 4AG4L 5T1KD 1GGBL 2E27H 4HV8B 5CHNB 1FO0B 1OT1A 3P73A 3VFGL 2VXQL 5H35B 1RHHA 3WIIL 3AMKA 4AQOA 1YNKH 5J12B 1WZMA 5GGRA 3BP5B 1FZMB 1BF2A 1J0KA 1TQCB 1I1YA 1D9KC 3IXAB 3OXRB 4YHOH 4D0BB 2EKSB 1SVZA 1CG9B 3FN9A 1HHIB 1CFTB 4NWTH 3ROOB 1D5ZB 1HYRC 3CMGA 1T2QH 5A2LH 4J3UA 2C3HA 2QHRL 2NY4C 4JFYA 1UT9A 4HPOH 4P3WA 2CDFB 5BZDA 1CF8H 4KGJA 4RMQA 2PR4L 4N9GA 5KVGL 1A6PA 2P5EA 3BE1L 4P46C 1Y0LA 4LLYB 1UB5B 3HZKB 2YBRA 3JTTA 4JAMB 2Z8RA 3OKDA 3ES6A 5GRWA 3L5JA 2EDOA 2EXYC 3IFOB 1HSAA 2DTMH 2PW2A 1VPOH 32C2A 5E9DE 3MREB 1GGUA 5DFVC 2ZP0T 1FYTA 4RAUB 5DVOA 4V1DB 1A7BA 5FK9B 2OR8A 1DANT 2EH7H 3CSGA 2ICWA 3GEWB 4OM0H 5FM8A 3WJJA 2ZUUA 4HKXA 4LHUB 5ADOH 2R39A 1H5BC 5J8OA 3AS1A 3OJDA 4WFFD 3EDFA 3OZ9L 1EGJH 5D6CB 4E5XB 3P40A 4ZOAA 5D2NA 2IPTH 1RUKH 3WN5C 3LPWA 1C7SA 2EZ0C 4OCYL 3K46A 1OAXH 3SY0A 4B50A 5ITBL 1F2QA 2Y5TB 4ZAKC 3BPCA 5FKAB 1YEKH 3EJZC 3FONA 2E7MA 5K33A 1GGCL 1D5XB 1I7ZA 5C70A 4NRZB 4NQCE 4S1SH 2F8VA 4LLQB 4KXZI 1DEEB 3QFJB 1CD1A 5B3JE 1Q94B 4D3CL 1O5DT 4YXHH 1A4JB 4MXVE 1ES0A 3NFNA 4Z76A 1A14H 2BRRH 4XXDB 1QNZH 3O45B 1QSFB 1YNLH 2J8UA 5EIIB 4PBWD 3ULUE 2XFXB 2VR9A 3EFFA 3ZKMC 3MR9A 5I8OL 1QFWL 2BXYA 2JJTC 2QEJA 4JQVA 4PJGE 1MIMH 2X70A 4HT1L 5MHSE 4G8EB 1NC4D 2J6EL 3RZCA 1RURL 1U8LA 2DI9A 1C16A 4NQVA 3WS3B 3HHRB 1Y18B 2AJUH 3LKSA 4I5BB 1FNAA 5EORH 2YUXA 3GBNL 1IGIL 5T1MA 1IQWH 4ZUWA 1OAUH 2FATL 5IGXH 2MCPH 2FD6L 4Z18A 4HPOL 4UAOB 3M8OL 5CEYB 5IM7A 2XTJB 3FB6A 2HMIC 2MMXA 4X5WB 5FYLD 5EU6A 3K8MA 4UIMB 1Q9WA 1A7RH 4HJGB 4FQLL 3KPSD 1JNJA 4QWWD 1ZA3A 3UYRL 3IDGB 4MCZB 3BDXA 3FQTA 1HEZA 1OSPL 4FZEH 1NL0H 5HGGS 2VJXA 4MS8C 5C0RH 3F7VB 5LWYH 5T33H 3PG2A 3PWLA 5GPRA 4KI1A 2J8UF 1HKLH 1S7TA 4JE4B 4MLIA 4UNVA 3IFLH 5F8RC 4PJIB 2XZCH 4J8RA 5CILL 5C0CE 1AD9A 3SKNB 1KTLB 2UWEA 5DD0L 5EU3B 4DOHB 5B4MD 5HPMA 4P2RB 5C8JB 3W82A 5C0AB 1M4KA 2R4SH 4JPVH 5JOFA 4R90L 3TP4A 1OP5K 1M6OA 4TUJB 2YS4A 4KMQA 1MCLA 4CVZA 3HAEA 1OB1A 1I9JH 4MX7A 5I1DB 4H1LG 1ORQA 1Q9KB 2CRIA 2DQIL 2BY1A 1B0RB 1G7IA 2YN3A 4QF1B 4WJ5B 1ZSDA 1J8HE 2BNQB 5ICYB 1NCCL 3P9MB 3KPMB 2W60A 2AXHA 1ZGLB 1WISA 4P4KB 3I6KA 4KK5C 1GH7A 2VL4A 3HPLA 4NKIL 4MD5A 4NHUB 3SO5A 2ITDB 5AZ2H 3IFPA 1CFQB 3L9RA 4I18A 4GG6F 3C6SA 3MRLB 2EIEA 3DOSA 2IMNA 4XNXL 3CLFH 4PRHE 3QZWA 3VI3F 1T83A 4NM8H 3V95A 3QG6A 1MCCA 1SEQL 3VFOB 4M00A 4UDUA 2DLHA 1C5CH 3F6LA 3SE8L 5TQ0L 1KIQB 5ACMA 1IFHL 2OBGA 3HCVB 2DAVA 3G04B 1A6VH 4ACPA 3EDKA 2VKXA 4PTUB 3VMNA 3PWPA 2DI7A 4Y5VB 3MSPA 2EXWD 3WNOA 4FMFA 3UROR 1A21A 1W72H 3U4BH 2X4SB 4HX1A 4K9EL 4Y5XA 3T2OA 4PGBA 3H7BA 5EWIL 4O2FA 1IC5H 3LB6C 2X1WL 4U1HA 1NEUA 1D5MB 3MGAA 3V5DB 4G6FB 4RMVA 4P57B 5IMLB 5TF1H 4N5EC 1IEAA 4TRPL 2FDBP 3JXAA 2WZPD 3QI9B 4PGCB 1RZGA 4OCXH 4RWYH 1JTTA 4OUUB 4WGWB 1LNUB 3N1MC 5GRYA 5D7LD 5IR1B 3QQ3B 5L6YL 1GC1C 3FCTB 5GSRA 4KRPD 3ULVL 1W72A 2Z4QA 3ULVH 1ZGLM 3O6FB 5BVJA 1KPVB 3FQWB 4S2SB 4HUWB 2K1MA 2C3VA 1NCCH 5EO9B 1K8IB 4X6FB 1AI1H 4XAKE 5E6ZA 3FOMB 2UY7A 4N8CL 1K4DB 4P59L 3VXPB 3JWDC 4P3CH 4OI7A 3J8F7 4LRIA 2DQJL 2HLAA 3MC0A 1VHPA 2MPAH 1X5HA 3GKWH 1FVCB 4LSDA 4HG4J 3OX8A 1T6VN 3QDMD 3U4EB 1S7VA 4HAFA 5HYFA 2RHEA 5FF6B 3CJJA 4U1NB 3PDOB 1I7UA 1YPZA 4HIIB 5GRJH 4Z78B 2VABB 1OAZH 3P4MA 4UUJA 5IT2H 4GQ9L 1KG0B 2H41A 4YXKL 1QSEE 1IGML 4N8VG 2RAMA 1MRCH 3ZYOA 5IBUG 5D7JA 4C57C 1L0QA 4ERSH 4BSWB 3BRFA 5GS1C 2XQBH 2R0WH 3U9PH 2AJXH 1ZEAH 3B9KB 4OKDA 3AY4A 4XVTH 1FORH 1RIVH 3MLWL 4PG2A 2D03H 1A7OH 5EOCH 1TCRA 1OAYL 4LCYA 5CJXA 4M8QA 4LVNB 2FHBA 1F3JA 1I3RB 2Q7YA 3EW3B 3CFBB 3FO2B 2IJ0C 3DMMD 4JFED 4F9PA 4U2ZA 3QAZB 4MHHI 1MI5A 1V7ML 1BOGB 3JWOL 4Z7OE 2DD8L 4OV5A 5DJDA 3HMXL 1KLGA 3SKOB 5DLMH 1AGCB 3ARRA 5E2TL 1SVCP 4KUCD 4JQXC 4XC1L 4TULH 1KJ2B 3H7LA 1J0HA 4K94L 3RU8H 1PSKH 3B2VL 4LGSB 3RAJH 4GG6E 4R4BB 5DYOA 4RGNC 2YD7A 1OL0A 5DMIL 1HI6A 3VI3E 1KEGL 2Q8AH 1OQOA 2CKBA 1F90L 4HT1H 4M6ML 2G75A 1ZT4A 3HFMH 3VI4F 3V7MA 4EI5B 1G0XA 1E27B 4FTVB 4BQ6A 4PUBL 1MJ7L 4XZUA 4Z7UB 5IJKC 2CR3A 4OB5L 3MV7A 1F6AB 1QLEL 4Z0BL 4N90D 1X9QA 1B6DA 1KELL 4XMLL 5IEKA 5L0QC 1CBVH 3MLYL 3KJ4C 1AE6H 3QQ4A 3V6OA 5D7JC 3WIHA 5IVXA 1EVUA 4YXHL 3QIWA 1DQMH 1PZ5A 3MRKA 4Y4HC 1NJ9B 1OF2B 4YHKH 3DMMC 3QG7L 1ADQH 1Q0YH 3DIFA 2H2SD 3B9KA 4LF3A 4U1GB 4HUMB 4GKZA 2MKWA 3RI5F 4RNRA 4PGJA 5IWLA 1WCBB 5L7XL 1HN1A 3P9LB 2CLVA 5D1XA 4EUPH 3NCMA 2MHAB 3DLQR 4UU9A 2P4AB 2HFTA 5INCA 3CAFA 3W9DB 3O8XA 3IS0X 3U2SB 4PYHA 1OQXA 2HVJB 4OCXL 4RWYL 2D7TL 4HH9A 4AQ1B 3VWJD 4X6DF 2P8PB 4HH9B 3RVTC 5EFIB 5F1IA 3PDOA 4WHDA 3EYQC 1FQ9C 2DIBA 1PFCA 3W81A 4B5EA 2O61A 2CLVB 5D1XB 1JTPA 5D7IA 2JE8A 5GZOD 2FWOA 4DZBA 5E8OA 1EH9A 4F7EB 1AGDB 4LQFL 4MA3B 3IT8D 3CIQA 1WZLA 3RKDC 1B6UA 3OKKA 4LVEA 1VGEL 3QIWB 5BO1H 2QLVB 1YNLL 1KB5L 5GSRB 3QQ4B 4IJ3C 5C0DA 1ZA6B 2BVEA 3ARXA 1YPZF 3M45A 8FABB 1ZHBA 3ARDD 1ZHLA 4DW2H 3REWB 4PY8J 1BFOA 1PEWA 4K23L 5DHXB 1RZIA 3MV7B 3NA9H 1IAOA 4LSTH 2GY7B 3S3SA 3ZTNH 4N9OB 4MQ7B 1A1MB 3VDCA 3WFCH 4NPYA 2CKBB 3KYMB 5C07D 3BSZH 3K8KA 3C8HA 4U1HB 1X4ZA 3MV11 5DTFA 1OSZA 3GIVA 5F88B 5DRWA 1YEGL 1KLFA 4K23H 1MCPH 5DK0A 3UTTA 1SJVA 1HQ4B 2NY2D 1SEQH 1EO5A 2PO6B 3IDJA 4PB9L 4OLUH 3QNYB 3BUYB 3LN4A 4MNHA 1QFWI 3N9GL 2YA0A 4OLUL 4GRLC 4UBDD 5HJ3B 2A0LC 2DQDL 4JGJA 2WSKA 3DTXA 1EXUA 1MI5D 4FQHA 4LSQH 4F33A 2IF7A 4M9OA 1L4IA 4WTZG 4NN6B 3PP3K 4DVBA 2XXMB 4XCCH 1SJEB 1OAXL 4Y5YA 1Z5LA 5M7QA 2MWCA 3FFCA 2W65A 5J1TC 3I6KB 5CZXC 4OI9A 4FS0A 4JGMA 3S8WA 3VFVA 4F3FB 3KPQA 3UC0H 1DUYA 2HJKA 1G1CA 1CFVL 2J12B 3FO1B 4U1NA 3SDXB 4GKSB 1OB1B 3WE6A 3QUZD 1PYWB 4PJBA 4JHZA 4GBXB 1AHWB 3S36L 1WLHA 4WW2C 3C5ZA 4FHBD 4QY8B 3K1DA 4ZSOA 4FQPA 5GRZA 4J3WA 3D69B 2NY1D 5HGDA 5IB5A 5EO9A 1I4FA 3KYOB 1N7ML 2PTUA 3CFJA 4JZJC 4MD4A 5TE6H 5BVJB 5FHAH 1EFXB 2YKLH 1KN2H 5T33L 1J05A 2A0LD 4N0CD 2CSPA 4YAQB 3ZT5A 4I3SL 5E08L 3CZFA 4GKSA 1JPSH 3MV9B 1CL7I 4XP9L 4DGIH 4KVNH 1ZHKA 1P7HL 3X14B 3QRFM 1EHXA 4HWEH 4QRPD 3THMH 1ZMYA 2M2DA 3R0MA 4M6MH 1BJ8A 4P57A 5IMLA 1WV7T 3UXFA 2YMXH 4XPFL 3GI9H 1NBQA 5I66B 1HH6B 4M8VA 2IAMC 2W65B 5DWUH 1DQTA 5HHME 3U79A 4WO4B 2EH8L 4HQQL 1H3PL 3VJ6B 3WHXA 4ONOA 3LQAL 2R9HD 3CPLB 4JRXB 1G9NC 2OMBA 2FD6H 4FXKB 3T1FA 1H0DA 4PRPE 4G6FD 2Y25A 4KPHH 5HHOB 4F33B 3WXWL 4EOWH 1UA6H 2PNDA 5CCKH 5IMOB 5FA4A 1KJVB 3IKKA 4WFHE 5KN5A 1I9RH 3S4SB 1SM3H 5BOPA 3GJFK 3T0EC 4P2OA 1PX4A 5T1MB 4RAHA 3VWJC 2BVOA 3ECBA 4I5BA 1CDYA 3EYOB 3G5YB 3TM6A 4P2OB 3UEZA 4HFUH 4F58H 2NZ9D 5E00A 1KB5B 4U4BA 5JIHA 5JW5B 4TVPH 1IKNA 1KN4H 1Z0MA 3Q1SH 2G5RA 1JGDB 5MENA 3FRPG 5HHOA 3L5HA 5F88A 3BP4B 4K3EL 4WUKL 1OSZB 4WU5A 3ET9F 1QR4A 4Q9RH 4K3JH 1CS6A 4QHUA 4PRHA 5CP7B 4WO4A 4I0KA 5IBUB 1MLBB 4GW5B 2I5YL 1TNMA 4IDJH 5F44A 2ZUQB 1AXSA 1JTOA 2D7OA 2H45A 4A6YH 3EO0B 1NCUA 1SMOA 3HC3H 3KPRD 3PHOB 5LCVH 2UWEF 4RGNE 4MA1B 4R4FL 4U1LA 1I7ZB 2NMSA 5KVMC 3LKQB 1KTKE 1EERB 4LPUA 4YAQA 4MDJA 1XGYL 4OLWL 4PIRF 3HR5A 1J8HD 3MV7D 4OTXL 3HC0A 1CYGA 2X89D 3CFJB 4NQSA 5EU7E 1I4FB 3F6IA 3KYOA 4HUUB 4MA3A 1DL7L 4ZFOL 5D2NB 5C0AA 3PL6C 3RGVD 3TBWB 1DBAL 4YHNB 1NFIA 1DUZA 5FECB 3GSNH 2P48B 4QY8A 3LCYA 1PLGL 2ILLA 2O61B 5GS2D 1EV2E 2E7HA 2XWBB 3AB0B 4X83A 3FB8A 2O5ZL 5IV2B 2D4FA 5BS0E 4FFVD 1S7XB 2BOCB 5F1IB 1IGFL 1RZ7L 4UDTB 4WTXA 1CLCA 4E0RB 3PXJA 1OTTD 4Z6AT 2YD5A 2AEQL 2BX5A 2G9HB 4OQ1A 1YEFL 4W4OA 2IFGA 3MCG1 4I77L 1YEDB 1QFWM 3QCVL 1A7OL 3BFOA 3C5SA 3UMTA 5KS9E 3SDAC 4ELKB 1FYHB 3DYOA 1ZLVH 2PYEE 4G6AD 4P5KA 5T1LB 3X3FL 4EJ1C 1QFUL 1N5AA 4BYHA 3QUMB 5FYKE 2P5EB 2FEEI 4ERSL 1MFDH 4DZ8B 2OTWB 2NNAA 4X5WA 4WI4A 3NTCH 3DIFB 3FB6B 3L5IA 4G9FD 1T80A 4K8RD 3AM8C 2F8XC 1KIUA 4FABL 1Q9OA 3MJ8B 4QRSA 4A6YA 3D39D 1DDHA 5D71H 3LN5A 2VLME 4LSRL 1LO0L 1JYVA 5I73B 5DMKB 2MKLC 3WIIH 3DV4A 1P53A 1XF3B 1VGKB 1FBIH 2XZZA 2V5YA 1KGCD 3VRLF 5TF1L 2BERA 4Z7UA 3I3EA 5GGRB 1GYAA 1BEYL 4ZD3L 2R69H 3D9AL 2Q76B 4PJBF 4KI5D 1UCBH 1WBXB 4Z7WE 5J6HB 1AR2A 5K9JL 2IG2L 3C09C 3DVGA 4HV8A 3BYTA 2ZKHH 4GS7B 2UVFA 4H8WL 4JZOA 4K94C 4P4KD 1T5XB 2KZWA 1NLDL 2VXUL 5EBLB 4Z8FL 4KQ3H 4GQPH 4L5FH 2ZUXA 4XI5D 1WTGT 4LFHG 4NRZA 4XTRD 4NDMA 2F5BL 1B2WH 5D70L 1UCTA 5IQ7H 5JHDE 1FIGL 4LHJB 3ZE1E 2JJSA 1K5NA 2YD9A 4ODHH 4J3SA 1YQ2A 2R0ZH 3IDNB 1KCRH 4DK3A 2J2ZA 3CC5A 4I2XB 3C2SA 3SY0B 5FGBA 2DLEA 5ACZB 3Q6FB 5INDB 4TUOB 1M71B 3LN9A 3RPIA 1NLDH 2VXUH 4K3GA 2Y23A 2IH3B 3BW9A 4CW1A 5DEZA 3C09B 4P5TB 4E5XA 4M62L 4NO5B 1ZLWK 5SX4I 2AK1H 4YK4C 2UZIH 3QDJD 4J1UA 3N85H 5J1AA 4ZQKA 4JO4H 5DEFA 3VW3L 5FFLA 2P8PA 1MJ8H 2OTUA 4M1CC 3V8OA 2R23B 3S97C 1FAIL 5IHLB 4X99B 5JHLL 5INCB 4FABH 1EHLH 5EPMA 2NW3B 3ZKSD 1UKQA 2PF6A 1EBAA 5B4MC 1J9CT 4MLSA 2F58H 2YPKA 3MLRH 1MRDH 1NLBL 4JHWH 3PHSA 4N9GB 1PEZA 2ZUTA 3TBTB 1RPQA 2FYYA 5TPWL 2BP3A 3KYAA 2BHUA 1AD0A 1IGTB 3BVNB 1A4KB 1XGQB 2C3VB 1XGRA 4HUWA 3PQYA 1KPVA 3KNBA 4HUKB 3LMJL 3MNVB 5TE6L 3H3PL 3B2UD 4ODBD 5MENE 3T04D 2DLTA 2MJWA 4X5XB 4BELD 5BVPH 2W92A 5DS8B 4D0BA 2DJSA 2DLFH 3IXAA 3MRHA 3V2AR 1KT2A 2G60H 2WINA 1P9MA 4NJ9H 4KK5D 3DSNA 4LSUH 5DJXB 3CSBA 3D85A 3SO3B 4CVWA 1J1PL 5EO0A 2QSVA 4W4OC 4EI6B 3BIAX 1CFVH 4F15C 4ODTH 3NIDF 3PWVB 4HBCL 3C60C 4QGYA 3WFBL 3MJ9H 1AGCA 3K2UH 4U1KA 1IKNC 4YHYC 2FX8H 1G7LA 5BS0B 4XX1G 4FQXA 3WDJA 2X4OA 4TSBH 4XCFL 1RJLA 1F42A 4KZEL 5E2UH 1VFAB 1OGAE 4NNYA 4ZFGH 2ZCKL 4FRWA 1VERA 4WEUD 2EDWA 5DJ2B 1R24A 2BOBB 2FO4A 3S5LA 1TCRB 2GCYB 3MACL 1JBJA 4PJBE 3QJHB 4FQCL 2F74A 1Z3GL 2F53D 5JMOC 3OZ9H 4Z7WF 2LE9A 3D0VB 4PRPA 4XPAH 1U3HD 1FNGB 3B2UC 5FA3B 5E8PB 2WIIB 4AEHL 2DIAA 2YHGA 4NYLA 1MWAL 5SWSE 2OS7A 3RVVD 1BX2A 3S88L 5EWIH 1CGUA 3BZFB 4GRWE 2VABA 4JKLA 2A1WL 1A3QA 2JB6A 3IF1A 3JV5A 2AJ3A 4LBEA 3PIQA 3L3OB 4OFYA 4X4XB 4LEXL 4DGYH 1MWAA 1UKTA 4HC1H 4BK4A 1U8QA 3HAEB 3GO1L 3F5WA 2W9LA 2XN9D 3LD8B 4NC1E 3VXSD 5FUZL 4TSCH 2VZVA 2F19H 3HG1B 4WV1B 2AVGA 3GSUB 1XZ0B 2FIKA 4DOHE 2WANA 2FHCA 1DBAH 2B2XL 3WNPA 3IVKA 3TBSA 4PV8B 4KJPD 4P9MH 3VFPA 3UO1H 1ZT1A 5EU3A 3GI9L 3JBG7 3GMNA 5JPMA 2R1YA 5C0JB 3O6ML 4XGZA 1UXSB 4LKXB 1R3HA 1XCTB 3U1SH 1S7TB 3HC4L 3QQ3A 4TSAH 5AZ2L 5ID1B 4Z7NF 5IB3A 1HHGA 5F7MC 1YN7B 4QRUA 1IRAY 5DMGC 4R7DB 4MMZC 3H0TB 4AL8H 2J7LA 4M93B 5GZOC 4QHNA 3O9WD 1OLZA 2WW8A 2Q7NA 4AMKH 5FAAA 1YY9D 2DMBA 5BRZE 3MJ9L 5EBMB 3NA9L 4NUGH 2Z8VC 2FZ3B 2ORBL 3FQNB 5TDPB 4PJIE 2YA2A 2BVYA 4HK3J 4HGKC 4W70A 4Y19A 1C12B 3STLB 3PWUB 2IAND 2H3NA 2I25N 3INUH 5JLZA 2NY0C 3PGCB 3G04A 2ERJC 5E03A 1CLYH 3ZSTA 4XCYB 4UDUB 4LDOB 2YD1A 3GMNB 5KS9B 3QQ9D 4Y8AA 2P46B 5CBEB 5JXAH 4HIEB 2CUHA 3SEPA 4G8EA 4WDIB 3IDXL 1TVDA 5TE4H 2DYPD 3UPCA 4HDIB 1WC7A 2X4RA 3NIDE 1M7IA 2Y6SD 5DC4B 4JM2C 5E9DD 2OSLA 4O5LL 1G9NH 3QUYB 1RZFL 1HOCA 1I7TA 3BWAB 4EKXA 4OZ4A 3S7GA 3P77A 4JRYD 1ZGLA 1HXYB 1RIHH 4X9IA 1R3JA 3VH8A 5HYIA 3ESUF 3DX8A 3S88H 4NKOB 3RVWC 4NQEE 3FONB 2BMKB 4O4YL 2E9IA 3BPCB 1RULL 2VL5A 4OFYD 4PRBB 4QTHA 2I9TB 4KWUA 1AGEB 1JP5A 1VFUA 5E6YA 2EIZA 4ODWA 1VADB 3DBXA 2JCCF 4DK6A 2YPLE 1JYXA 2DMKA 5DVNA 1OAUL 4OCLC 3O2DH 4NNXA 2EIBA 2ZSVB 5DQJB 4QXTA 1JVKA 1DQML 3EOAA 4P2RA 5C8JA 3E2HB 5JIIA 3U7WL 4F8QA 4GAYA 1S9WA 2OZ4A 1UWEL 1A7PH 4PY7A 4PJAB 1AD9B 2ICWB 3SKNA 1N59A 4P49A 1R24B 1UM4H 1B90A 1E4XI 4OSUH 4F7PB 5BCAA 3HC4H 3GB7B 2R0WL 2H1PL 5F3HB 3MRCA 3IFOA 2VDOH 2PCPA 4APQC 5F89A 2JCCB 1YA5A 4JZJB 3BIKA 1JZ2A 3RVWD 1RZKH 3L7FA 3GMQB 2YBRB 3ZYJA 1YJDC 5J9PB 1I1RA 4Y16B 3RVUC 4X0KA 4Z7WA 3BN9C 1P6AB 5ID0A 4Z7VA 4O51A 2VZTA 5CP3A 3CVIH 3W9EA 5I74C 9CGTA 3HE6C 3VXNA 1VEPA 4NUJA 3ARGC 3NVQA 4MNGE 4XP4L 5ALBH 1R5IB 3UAJC 4F2MA 3QNXB 5F9JB 3ROOA 3MMEA 4M3KB 2HT2D 3D85D 3TWCL 3QH3B 3S35H 1Y18A 2D03L 4YGVA 5DUBA 3KPSE 2AXJA 2F5AH 4C83B 5TH2A 3KNBB 2Q8BH 3PDGA 4BFGA 5IFAL 1XGRB 1OCWH 1S7SB 1FPTL 2XI9A 4FQXC 4XVUD 4ODUB 4FQJL 3I6GB 5TGBA 2XTJD 3NCJL 1CDGA 4XC3L 5C9JA 5EIIA 4ODXB 2X40A 3VXSB 4NO0A 2VITB 4D0CA 1XT5A 3GSOA 3DMMB 4JFEB 4PJIF 4UT7L 4LLUA 3KPNB 4YFLI 5C09D 3T2NH 1BLNA 1JFQH 1JL8A 4NHCL 4JY4B 4IEFB 5F70A 2G5BA 4FQ1H 4PRDB 4C56E 1ZOXA 4EBQH 1AKJB 4G8GE 2HG5A 2NW2B 4ZFGL 4MVBD 1BVKB 1S78D 3VXMB 5FKAA 3EOTL 4EDXA 2IBGA 1R5WB 1XAUA 1EEUA 1K8DA 2WM0A 1NAMB 1I85A 4PYGA 1A2YB 4TVPE 3F58H 4P5TA 2PYEB 4IRJA 1FAIH 1P7QA 1M71A 1U8PB 4LLMA 5D7KD 4NJ9L 2HT2C 2YR3A 3V4PH 5ACZA 1MHCB 1TQBC 1MLCA 3MXWL 1I8IA 3VGGA 4G7YH 4RQQA 4G9FE 4TVPD 4X9BA 1QKZL 4HH8A 2YD4A 5DC0A 4HHAA 1CD0A 2J4WL 2JCCE 2HWZL 3IAPA 3G6JA 4P23D 4JDVB 1KTDA 3DXAE 3QA3B 1KLUB 4LSPH 2R1WA 3WSQL 1BD2A 3TVMD 3FO0H 1KEGH 5AAWA 1MJUH 2R8SL 12E8L 5IK3B 4HXBL 2NY7L 2WWMC 1RFDL 3LDBC 4IRJD 4NGHL 4CU7A 3A6BH 3BH8A 1A02N 3VXOB 4OZGB 5HVWA 5D7LA 1CFTA 1G7QB 5F7KC 5D71L 4EVNB 1I9IL 3L95A 2PYFB 1V3JA 1DN2A 1HSBB 3PGDB 3BPNC 3F58L 4D0DA 1IM9B 1V5JA 1LK2B 2VOTA 1RUAL 1FLTX 1E4JA 1UWEH 1XIWB 2K7PA 1YDPA 1K85A 3UPAA 4ONGL 1MJ7H 3MV8D 3UP1A 1JGEB 3V4VL 2CDEB 2DBLL 1XCQA 2NY5H 1MRFL 3NFSH 2CH8A 4FNLH 2AXGB 4X98A 1CGTA 3MOQA 5JIPA 3C5SB 1S5IL 2OR9H 5BW7A 2OL3A 4R26H 4L4TA 5DI8B 4XCEA 3V52H 1OD9A 5GS1A 2FEEL 4LPTA 4OBSA 43CAB 3QIUD 4L8CA 4KKNA 5FO9B 1CLZH 4FFZH 4L4TB 4R7NB 3RIAF 3OWEA 3TO2A 4WU7A 2ED7A 3GI8H 3HMWL 1N4XL 5H37G 2VYRE 3WJLC 3MNWB 5ADPH 4HKZB 3KPTA 5LXGL 1S5IH 2OR9L 3LIZL 3VXRD 1SYVA 3RUGB 3TBWA 1X5JA 1IQWL 2IG2H 2NXYC 3VXMD 5C9KA 5J12C 1ZEAL 4OZHE 4NNPH 4AH2A 1NGZB 4E41A 1I8KB 1F3RB 3U4BL 1T03L 1ZK9A 1T22B 3L95B 1EEYB 4HJJH 4RAVB 4R97C 4HCRL 1QFWH 4JZNB 4L9LA 4YK4B 3MLVL 1OPGH 3BH8B 3FRPA 1LO3L 5C0CA 5CD3B 1FVDA 2AI0L 3D18B 3L1OH 1QYGH 1T04B 3CDGB 2XICA 3KHQA 1ZLSH 2VLLB 2HFFA 4CNIB 1S9XA 5JDSA 4YHLH 2F8OA 3RVTD 3QA3A 3JWNC 4WUKH 3O2VH 1MCWM 3W11C 3MOAH 3SDXE 4M7LH 1LWRA 4WU5B 4E41E 2VDML 1X5FA 1P5VA 4IDLA 3RWFA 1NKRA 4NKDB 1VEOA 4KXZH 4P3CL 1IMHC 6CGTA 5ILTL 2A6IA 2W1NA 1I8MB 3B6SA 1LO2H 2AV7A 3TIEB 1IZJA 5GSVB 4RFEA 2NYYD 5JW3H 2BVOB 1KGCE 3MNZA 2UZYB 4WI5A 2YPLA 1WFTA 3I02A 2DQDH 5EZIL 3X13A 1GC1H 1KJVA 1I9JL 1FL5A 1T2XA 2Z92B 4HWZB 2EECA 3MV8A 3NAAL 2Z9TA 2AXFB 3W0WE 3DX7A 1WIUA 2PXYA 3TA3C 3ULVF 1I3GH 1FGNL 3MUY1 2V2XA 1KCLA 2YMXL 4G9FB 2GTZB 1K8DB 4JKWA 3RNKA 2IQAB 1NAKH 3EUUA 5FO9A 3EFDL 4PV9B 2N56A 1C5DA 5DEGB 4LEOB 4KH2A 5DJCA 4NKMA 1PW3A 3MBXH 3RDTD 1HKLL 5SWSD 4J2XA 4JY4A 3WXWH 3MGOA 4EOWL 4NQEA 3VRJB 4DCQA 1G0DA 3N1GC 1T1XB 5HHVL 1KCSL 3T3PE 4MA7H 2RQ8A 3K80A 2HKHH 4DUWA 4JKPH 1D5IL 1X5ZA 3MODL 3WFHA 5HHQB 4GW1B 2CD0A 3T08A 3TCLA 3L3DB 4R3SA 3ELAT 4ZNEE 3V79C 5TH2B 3GSWA 2APBA 3MACH 1NDMB 2VDLL 3NH7L 2ZG3A 2Y7QB 4L8BB 5T5FL 3WE6B 4YGVB 2PYFA 2CKBH 3MJ9A 5IJVA 1F97A 3W5NA 4EVNA 3FO1A 3SDXA 1CXHA 2J6EA 3V5HB 5C3LD 5C6WH 2VUOA 4HZLB 2IADA 3CDCA 2NY6D 1JHKH 1JWSA 3ZT7A 3KPQB 4MB3A 4F3FA 1S9YB 3ARFD 2ADIB 5CJOL 1Z6JT 5I1KH 1B0GB 4L3CA 4PGEA 1U2HA 4XP4H 4PS4L 4PLOB 3IU3B 4YPJA 2OJZL 1KTDB 3LQAH 2ATPA 1NC4B 5D2NE 4UOW0 4PRID 3L7FB 2WIMA 1PBYA 4BKLA 4PP2A 4PJ5A 5CUSH 4YLQT 4GMTH 3HLAB 4YQXH 3MZGB 3MBEA 3MRCB 5I8EA 4WV1C 2XQYG 4YJZL 5JPNA 1Q0XH 3MA9L 2DDQL 1U95B 4HS6A 4AMKL 1EAPA 4S1SL 3U7AA 3IDJB 3HI5H 4POYA 5IVZB 4K8RH 5CJ8A 1KBGL 4JLRA 3PQYD 4OFPA 3DROB 1ORSA 2WLYA 2WUCH 2UV3A 3C5ZC 1T2JA 1MUJA 3C2AL 5DRWB 1FNFA 5EA0L 5DQJA 5KSAC 1UFUA 4EIGB 2ZSVA 3SDXF 1KC5H 4JFQB 4OCYH 1CGSH 3ZSSA 1XF2A 5AAMA 2EEBA 2JIXD 5T1KA 3UTZB 4WO4D 1DBBH 5EULV 3FFDA 4EDWH 5C2UB 4L8DA 1A6ZB 1H15A 5T3ZL 1QSZA 3LKOB 4QT5B 3TV3H 3D3VA 5IF0B 4Y4HA 1MCJA 4NP4L 1AGFB 1BIHA 2VLRD 4D8PB 4TUKH 5EN2B 3KLHC 5DJ6A 3BDYL 3KPNA 1OHQA 4KI5F 2P5WD 4Y16C 3LEVL 1DBBL 4BSVA 1JZ6A 3L7EB 5DK2B 3DGGA 2ATKB 4RBPK 2ZOLA 3ULVE 1XF1A 3EGSB 1HQRB 3L3HB 5K9QG 5SWSB 2X1XR 5AD0A 1L0YA 3BE1H 3KPOB 4DZBB 5FO8B 1YY9C 1IZKA 3ILPA 4NBXB 4GAFB 5D7IB 1A6TB 1CXEA 1I1AD 4C83A 4YXLL 3QUZB 1U8MA 3TIDB 4I3RL 3VE0B 2VTFA 2DM7A 5F9JA 1UH4A 3T1WA 4TPRL 1KXVC 1GOHA 1WCQA 1FE8L 3GNML 3LKOA 1CLYL 4JFHE 3QUYC 3CGTA 2H8PA 2AKRA 1JGLL 4L5FL 1A7QH 4KUZH 5T3XH 3UJIL 3UYPA 3RL1A 4ZO7A 1XGPB 2WBJD 4GBXC 1BZQK 5IESH 5ID0B 4PJCA 1WF5A 3FKUS 3OR7A 3ZMRA 1P6FA 5C08D 4LF3B 3BIKB 2IAMB 4QRUB 3AC0A 1HHGB 3DHMA 4ORGA 3WFZA 3MRKB 4FQIH 5IVXB 4LKXA 4RSVA 1LO0H 2Z93B 4Q7DA 4LPWA 2EEAA 3GM0A 3DI2B 5EOTB 1FFPA 2WP3O 4GAYB 4URTB 1LO3H 1LP9A 2HP4A 3RGVB 2V2WA 4R0LB 4UTBL 5I8CA 5EUKA 1ITBB 2ZUWA 5CGTA 5F1SA 1OY3B 3GIZL 1D5BA 2BDNH 3FMGH 3BKJH 3MUGB 2QSCL 3T2PA 4PB0L 4Z5RA 4XNQB 4G8FB 3RWHB 2JB5L 3QNZB 2XN9B 1QD0A 3QULB 3DX8B 1QLEH 2D9QB 2B7DT 3O0RL 3S35X 3JV4B 4G42B 7FABH 3WLBB 4MA8H 3KVQA 4NN5B 4L8BA 3CLEH 5E8PA 4XHJD 3ARBD 4NQDE 4QXGH 2FHFA 4XPHH 1TQBB 5ISZE 2XQBL 1W0VB 4ZYKB 4N0UB 2FJHB 1FZJB 2XWTB 4RX4A 4DJMA 4MNGA 4HMEA 3BYYA 1FIGH 2DD8H 4U1MA 5GHWH 3HI5L 5DFWH 1SJHA 3E8UL 5GGSY 4MXWL 4JRYE 5HGBB 3BH9B 2WUBL 3T2QA 1Z3GH 1C7TA 1U58A 3BKML 4YZFF 4FG6D 2NYYC 4LLWA 1KG0A 3VA6A 3PWUA 4WRLA 5D7JD 5LVEA 1BBJB 3I3BA 5ALCL 4YIQB 2EXYD 5TDPA 4D9QD 3V0VB 4M5YH 1RU9L 3SDCA 1MH5A 4M1GL 4YC2C 1T1YB 1NC2A 3QIBD 1EO8H 1LEIA 3B9DA 2PXYB 5DMIH 4ZG1A 3T0DA 4RGNB 4GMSL 1OP9A 4M4RA 1B4RA 2B4CC 3P4OA 4ELMB 15C8L 5J89A 1K8IA 3R4DA 1SYSA 1T0NA 4HZAA 2VZOA 5A3IC 5CFHA 1FNEB 1MQ8A 3MRHB 1D6VL 4PJHB 4XBEL 2EZ0D 1EEZB 4TVSa 1MCEA 5T5FH 1F4XL 4HJJL 1UZ6F 5C0JA 3FO9A 3X11B 3IETA 4X4YB 4PJHA 5J13C 4XNYL 3ULUH 1D6EA 1NMBL 3JWOC 4GG8B 4U2YA 3EOTH 3WKMH 1IGTA 5HI4C 1LDSA 1F4YH 2ZPKL 3O8XD 3WFDL 3T4YA 1UEMA 4M7LT 1P4LA 3MBEC 4GJTB 3KR3L 1TLKA 4CDGC 4H8WC 4IRSD 4M6NL 5F9WB 2IPKB 1NC2B 3F5WB 4ZO9A 2XA3A 2R29H 3EOYG 1FN4A 1AP2B 1MWAB 4XAKD 5EZOH 2HFFB 4DAGL 3L3OA 3QXDA 4LBEB 3MV8E 4R96A 4YDIL 4BFBD 4F9LC 2E7LC 1CICC 3EYFB 3QJFB 4YDIH 5L88L 3B8YA 1BBJA 2R0KL 5FHBH 3C08L 5IUSA 4YO0A 2Q87A 4PTUA 1BFVH 1H5BB 1RZJH 3DURB 4KKAC 4P2YA 2GITA 2H32B 5DEFB 1HYSC 4QXWA 4JPKH 3ARSA 3Q5OA 5E2VH 3VRIA 5D96B 3BH9A 4ZXBA 3QUXB 4Y4FD 1RY7B 4RRPA 5CLWA 3TZVB 3CFDA 4MYWB 2AJUL 1MCBA 3WBDA 1FYTE 2ZG1A 4Y1AE 1NGPL 5IIEA 2XTJE 4WI8A 5LGHL 4HUNB 4YPGA 1FCCA 3ESVF 3F65A 4ONGH 3U0PB 3X3GL 3TZVD 2GY5A 3JSSA 4I2XE 3O8XC 1I75A 3TVMC 1ACYH 2XZQL 1WTLA 2FEDD 4CVXA 2BSSB 1P84K 3S37L 1BJMA 1C5CL 1EIBA 5JUEL 1CD8A 3KPMA 5GGRY 5GGSB 2YD2A 2X4OB 1FCGA 1QVOA 4ODHL 1D3CA 4BM7A 1MQKL 1IVLA 2X4NB 3OKNB 1UB6B 1SY6L 3QEHA 2R1XB 1PG7W 4B0MM 4PY8I 2I07B 4NFDA 2YEZB 4YFLF 1WBXA 1Z9MA 3BP6A 3D85B 2Q76A 3TBYA 1CFSA 1QBBA 4TQEL 1KV3A 1R5VA 3L3KA 3L1OL 1XIWA 4LCUA 4EUPA 1GIGH 4JFPA 2QQNL 1RVFH 2R69L 1EGJL 2Q6WA 1KULA 2Z93A 5DMKA 2I9LA 1QA9B 2VDPH 5TJWK 3IU4H 2WBJA 1JPTH 1G7QA 1YUHB 1Q9OB 4QRSB 1GZPB 3PQYB 1WBYA 1C08B 1LMKA 2C3GA 3QFDB 1A7NL 3SDYL 4DN3H 5GJSL 3P11H 2FYYB 3NACL 2DTML 4AEFA 4DZ8A 5DT1H 1EDQA 1QO3B 1RUPL 1UGNA 5BQ7A 3S6CA 3FRUB 4AEEA 1R3KA 3MLSH 3W2DH 2OX5A 1NBZB 4UIMA 1K2DB 3P0VL 3AY4C 4IOIA 1XGPA 4OGXL 1QR1A 3ZHDA 4MNQD 3I50H 3OR6A 5C1MB 4Y5YC 1AJ7L 4OZFB 2AKRB 3CX5J 1GAFH 1UJ3C 2EDBA 5E6IC 4FMKA 4WFEE 4NN7C 5FYJU 3F7YA 4XBGA 2P7TB 3STZB 2HT3C 4ZUWB 4A2MA 2O93L 4LP4A 5J11C 4WENB 3NZ8B 2XWBA 2BSRA 2FX9H 4PLKD 4PTTB 2DLIA 3U9UA 2ICWI 3B83A 3AUVA 3RZCB 2VISA 3MRGB 2F53A 2GEEA 1I1CA 4LAQL 5DD6A 4KJYA 1VENA 4LQFH 5CGYC 1R0AL 4R90H 4WFED 5DQDL 1HK6A 4ZOCA 5IKCB 3RZCD 1U8IB 4S11A 2WWKT 4PJXE 3U6RB 4O5LH 5D1XD 2Q8BL 5F7EL 3OKLB 4NZRH 3TN0A 4JVPA 1TZIB 2QKIB 4FQIL 5MI0B 4P3DB 2BNRD 4WWKC 2W9EH 1AGFA 1TPXB 3G6DL 4M1DH 1ZS8A 1BWWA 4GMSH 5DC9B 1UZ8B 3QCUL 3ZDYF 3KJ6H 2RIKA 5E4IA 2EDEA 2E8YA 2DYPA 2EDFA 2EYTA 4L8SC 3O9WC 2OLDA 5DMYA 2GI7A 4LLUB 5C0BD 1ADQA 1R6VA 4PRNA 3RGHA 3DMMA 4JFEA 4LCCC 4CGTA 4PRHB 1NFDF 3CLEL 1XF2B 5AG8A 1UC6A 3I6GA 4LARH 4M5ZL 1J86A 5BV7B 2BJMH 3O11B 3U7WH 4UV7H 3ZE2E 4KHTL 1CR9L 5DFVD 2ESVB 1XF3A 3QPQD 4MA7L 3NABL 3E8UH 3MV9D 5BMFH 5HSFA 2QQLH 1IKFH 3TNMA 2FATH 4BQ9A 3ZKXB 4F80A 1J1OH 3WIFB 3S4SA 3RY4A 1UVQB 4BKLB 3TO4B 3W9EB 3L5XL 3QDGB 4F7CA 3F62A 3HZKA 5I19H 1K2DA 3SJVE 3SDDD 4IJ3B 1MOEA 3A67H 3O0RH 2NY4B 3N9GH 5C0IB 3OG4B 4F7CB 2R0LL 3H3BC 3QDGA 3HI1B 3VFUA 3H9HB 2J88H 4OCSH 5DF0A 2CLZB 4NRXA 5FHAL 5C0FA 2JCCA 3RVVC 2UVEA 1NCWH 2G9HA 3WIFA 1IGYA 1QRND 2MSPA 5HYJE 2LABA 3O81A 1XIWC 1T89A 5ITFB 3BAEL 1CG9A 5F8QC 3VFSA 1NGYB 2NY6C 5DZOA 1VACA 2EKSA 3ZTJG 3SE9L 3OXRA 3QDJA 1CGYA 4WY7L 3FT2A 1CL7H 5HI5D 5GJTH 1EJOH 3WFCL 1HH9B 4PJCE 2E7LA 2GFBA 5HDOA 3D69A 1RHHB 3TBYB 5HYSG 2BNUB 4X6EA 1FPTH 1KACB 4MZ3A 4WEBL 1IKFL 3GMLB 3PV7A 3BZDA 2XT1B 5DRXB 4DFIA 2AK4D 4NUGL 4OLVH 1T2QL 1ZTXL 4XAWH 1A6WL 1BZ9B 4PJBB 3T8XB 3VRJA 4QTHB 5BXFA 4YHPA 2EYTB 3KPLA 5BV7H 3SDCD 4LARL 2XA8L 1QVOB 5SWZB 1DUYB 4YBLB 1SEBA 1XFPA 4OQTL 4PV9A 1RV6X 4NM4H 4PJ8B 3VH8B 4MMXC 1MCSA 4HC1A 2ORBH 4G9FA 5E70A 2XACC 4KRPC 4NQXA 4K2UH 5IKCA 5BV7L 4MS8D 3SDAA 2B5IB 2BY2A 3IJYB 3MV8B 3GJFA 4P46D 2CIIB 1NFKA 4NIKB 4KJYB 1XF5A 4H26A 5K9KA 1MNUH 4DTGL 4G3YL 2VISB 3T65A 3ALWA 3DTXB 3X13B 4ZDHB 2XTJC 3ARGA 3MQIA 1WSST 3AB0C 3HMWH 5IMMB 3EYOA 3G5YA 3I2CL 1FFQA 3QNYA 1XR9A 4KKAD 1N6QL 1KENH 2RR3A 1C12A 4FXGB 2NR6D 4QHKI 1MJJB 5ISZA 5DK0B 1IT9L 1INDH 5FA4B 4XXCA 1IM3A 3C2AH 1ADQL 1Q0YL 5B38B 1NFDE 2FZ3A 5HVHB 2XKNA 1KPUB 4JRXA 5EBMA 1F4AA 4BFIB 4I4WA 4RFOH 1NBZA 3WHXB 2DB8A 2EDJA 2Z0BA 4ODSL 5E2WL 4JFFD 5HDBF 2O5YL 3NFSL 1KJMB 4LCCA 3BMVA 3CSYA 1IGCL 2X9YA 4R4ND 4O4YH 5FV2A 1FO0L 4I9WD 1QBLL 3LEXA 3CDGA 2ZCLL 2IFFL 2YK1H 3VFTA 2BNQE 1GZPA 4OD1H 1ZHBB 2CK0L 1L0XA 3MV9A 4HPYH 4WFFE 1FORL 1EEYA 3LKRB 1PSKL 3RAJL 4MQSB 3BZEA 3IDMA 1YMHA 3ARFB 4WIQA 4LPXA 4GXUN 5ECJE 4JFPB 5K9QI 4MD4B 3GZKA 4KHXH 5D7IF 3TESA 5FGSA 1F58H 5IB2B 5KVEL 4CMMB 1RFDH 4NGHH 4ORZC 1B2WL 5D70H 5BMFL 4P2RE 1FHGA 2OL3H 4D9LH 1A22B 1JHKL 2B1HH 5H94B 3MNWA 1MQKH 3S4SG 5EU5A 3RWGB 3CX2A 4KV5E 3SDCB 4I48B 1A3RL 3VFMA 1T1ZB 1DVFD 5CUSL 4R7NA 1ND0B 2VLRE 2FECI 3MRBB 5CIPA 2FSEB 4RDQF 1CT8B 1DE4A 1LO5A 3OB8A 4CVXB 3CDYA 2DICA 2HMID 4GAGH 3OMZA 4X98B 3FFCB 1S8DA 4GKOA 1SJHB 2CLRA 1Q72L 3B9KC 5FA3A 3SKMA 1IARB 3FB7B 4RNRB 2XWTA 5LBSH 2W0KA 4RA3A 1WAAF 4GKZB 2B1AH 4C55A 1AJ7H 4JY6B 4KAQL 4PBVC 1OF2A 1PG7X 4NRYA 1PZ5B 3R06B 3ARGD 4WW1B 2R2EB 5FHBL 1HSBA 2X4PB 3PGDA 1SBSL 3LN4B 4MNHB 1F6LL 5GGQH 5IEKB 3KG5A 2ID5A 3NCBB 4GXUM 1RIUL 1G0YR 2B2XH 3NIFF 3HZYB 4R26L 1G7LB 2P49B 1DLFL 2VR4A 3HPJA 3QDGD 1ZT4B 5HHMD 4LKCB 5DDHA 1WBZA 3LD8C 1JFQL 1HE7A 4X6CF 2AQ2A 2DM2A 2IPKA 3MRDB 5C08E 1RJYB 4ZPVB 1S7WA 2JELL 3P2TA 3S5LG 2CJUL 1OAYH 3HE7B 4YC2B 4OV5B 3QIUB 2NXYD 1MI5B 5AYUL 5D5MF 1RUPH 3BIBX 3KR3H 1D6VH 4NWUH 2EDYA 3BEWB 3BISA 4PRPD 5DS8A 2Q7YB 5CP3H 4EQ3A 3DETC 4FNLL 5C0DB 5C0GA 2WBWB 3MOAL 1SY6H 1XGYH 4OLWH 1ZT7A 4XNYH 2VDKH 5HDQH 1ONQA 2W0FA 2HN7B 3QIBC 4HXAH 5GS0H 3QDMB 5JA9A 3TBTA 2FWOB 5D5MB 1YC7A 4J3VA 1MFCL 1A6VL 1MFBH 3B43A 3VXQA 1J8HA 5JW3L 5D7JB 5GGVL 5FCUL 1PLGH 2DWDA 2ESVE 2NW3A 2ZNWA 1BZ7B 2WQ8A 3TPUA 2VXSH 5D72H 1K4CA 5FYJH 4G43A 3EYVB 3ULSA 4CN4A 3ZT6A 2VDOL 1EGJA 3TPUB 1P5UA 2VO5A 4NZRL 4KTEL 5DVMA 4HEME 4ZQKB 3D48R 3QFJE 4U7SA 1J8HB 4ODXA 4KRNA 5LBSL 4JJ5B 3C08H 4OGYH 3CVHH 4NO5A 2FJHA 1QKZH 3T0EE 2IPUG 5EUOE 1LP9F 1K4DA 3VXPA 5IQ9A 3T3ME 1S7SA 3U30C 5JTWA 4Z0XA 1HHJA 4PJ7A 2AJSH 5INDA 1NAMH 4PJ9C 5C7XH 2Z4QB 4CU8A 3TT1L 3QH3A 1NGPH 5CSGA 1TVHB 5I0DA 1WT5A 1IEBA 1IC5L 1XGTA 1CCZA 2XN9A 3UYRH 1F6AA 1BAFH 2NY5L 3ULUD 3QIUA 3B9EA 1DFBL 3PUCA 4NC2B 2PYED 4P9HC 4HIHB 3FL7A 4IIQA 2Y06H 4TRPH 1JWMA 1FJ1A 4JFFB 5A43C 2KUTA 1WAAE 5DJYA 3QWQB 1I1FA 1TTGA 4O9HL 4QHLA 3HPJB 1X4YA 4JZJA 1FNSH 5I8KH 4NM8L 4XXCC 5IFAH 4HJ0C 3OKYA 3PWPB 1AXTL 4Y5VA 1DL7H 4OLZL 3QEUA 5EU7C 4R2GC 5LAXA 3KWWB 4CVUA 1UM6H 2JLLA 4HS6B 1A7RL 5F1OB 2R2EA 3NIFE 3S98A 5I8EB 5JPNB 1AC6A 1O7VA 3MRQB 1QNZL 4PP2B 1VB9A 2HWZH 2VLMD 4X6CE 2IAMA 3EOAB 4XP9H 3W5MA 2B20A 4I18C 2KPNA 4LHUG 4NNXB 4AIZA 4JM2B 2X4QB 5DRZA 4PJCB 4IDJL 3IU3A 1MCQA 1YEDA 3AAZA 2H8PB 5D5ME 2R9HC 1RURH 3QO1B 5EB9A 5CIPB 3QDME 3GMOB 3QRGH 1CGXA 3G5ZA 4WJ5A 1YPZB 4WGVB 3D3VE 4HPYL 1S7VB 1E6JH 5EUOA 1HOCB 1TITA 6FABL 2P8LA 3KHOA 3DRQB 4Y5XC 4KKBD 1ZLWH 2DQIH 3F7RA 4NCDA 3VU2A 1J12A 2OP4L 4ZTPL 3CXHK 4N0FB 1T7ZA 1DVFA 4Y5VC 2GJ6E 5HI3C 4D9LL 1NMCC 4KI5C 3RPKA 4FP8H 1GVIA 3ME0A 3D3VD 3HR5B 4W68A 4YR6A 5C6PB 1CXFA 5I18H 1T1XA 2EDQA 1FC2D 4M3JA 1KCVL 4DCQB 3FCTA 3MGOB 3T2NL 5I76A 4XNMA 3PGCA 5GZNC 4PG9A 4BH7B 4U1LB 1PKQB 4PGCA 1KIPA 1YY8A 5DEGA 4JHBA 4DAGH 4KTDH 1L6XA 4U6XA 3UPRB 4WUUE 2GTZA 1ZA3B 3SGJA 4PJ5E 4LRIC 4HJGA 5TFSL 1LP9E 5IGXL 3LHPH 5SX5K 5C08A 3BP4A 2XIDA 3BKJL 3OV6A 1IM3B 5ALBL 2OZ4H 4JLRB 3JV6A 4BH8B 1GGIH 2F15A 5J4MA 1LE9A 2ZUYA 4HKJB 3BAEH 4ZODA 1JRHL 3SCMC 1XR9B 4KVNL 1AGBB 1I1AC 5ESVB 2DQCL 5JDJA 2H6PA 5KTEL 1D7FA 3N1QC 3MLTA 4OQTH 3MBEB 3B6SB 3W0WD 1IGJB 1C16B 3T65B 4PV8A 4Z7VE 1WT5C 3K74B 1QRNE 5IMOA 1Q72H 4OQTA 3WEXB 1KSRA 3TFKD 1G9ML 3C6SB 3MRLA 2YRLA 4JQIH 5JIKA 2XFXA 2PXYD 3G6AB 4L4VB 4X7TB 5MEPB 1CE1L 2Z91A 3HPLB 3TO4C 3UJJL 4MAUH 3MRIB 1JGUH 5EO1B 4LSUL 5C0ND 4OAWA 1RUML 2Y1VA 1T04A 1SEBB 3BZFA 5EU4A 1EK3A 2X1QA 2VLRA 3MZTA 5IJVB 4N0UE 5I1DA 1KB9K 1E4XH 4CVZB 3DXAB 1F13A 3TC9A 3ZHLA 1RSFA 3RWDB 3G5XB 3O6KL 5DSCA 1FDLH 4GW1A 4N1EA 1LE5B 5HVGB 1U3HB 25C8H 4WEBH 5FDWB 4YDVB 3SE4A 3CZJA 3UZQA 3QDJB 4Q2ZB 1EJOL 5IEHA 3A6CL 4NQEB 3EFDH 1E4KA 3MREA 4P4KC 5EA0H 5B8CC 1OAKL 2PW2B 2YD8A 5T3ZE 5FYKL 3V6OC 3VXTA 1IAIL 5CCKL 3HE7D 2OMNA 2IWGA 4QLRA 5BZWB 3BDYH 5DD5L 1LK3H 5DI8A 3ES6B 5L8LB 1MVUB 5HHVH 1CFBA 1LK3L 2DQTL 3FZUD 2RGSA 5C0AD 3WNLA 1JGVL 1QOKA 4AEHH 2V2XB 4NN5C 5AG9A 5HHPA 2B0SL 4QRRA 5A2JH 3CSPA 2PTTA 1X6LA 3GMPB 4DUXA 1ZWIA 2YWZA 2NXZB 5EU6B 4DKEL 2Z92A 5D1ZD 1WK0A 5HHOE 3MLWH 3Q6GH 5KAQF 5I74B 4NO2B 3NCFB 4I0PC 4IOFC 2BZDA 4ODVH 4XC1H 4NZJA 5JQ6H 4X5XA 3C5JA 1G7PA 2D0HA 3WL9B 3RTQC 2PO6A 2VNCA 4FFVC 4NQVB 2A6IB 2X89A 1IC1A 1N7MH 1U8LB 4BJLA 4Y19D 3BP5A 4KMLB 1FZKB 2D0GA 5HYEA 5E56A 5J57B 3GIVB 1BD2B 3MR9B 2IALB 5DUMH 1XR8A 3RBSA 3P73B 4MQXD 1DBJH 4RFNB 3JVGA 5JW4N 1YEIL 3O2WH 2R2HB 3G6JB 3EOBA 5E1HB 3RP1A 1QZ1A 4BFEA 1S9XB 5JDSB 5DJZB 2ZUSA 3X12A 5GS2H 1Q1JL 3AREC 3LS5L 3I75B 4UNTA 3SN6N 2X7LA 2PETA 1F3DH 3GSNB 3D18A 4E42B 4MJIA 1FH5L 4KTYA 2OK0L 3BD4A 3HUJA 4KK6D 2VIRA 5FCUH 1MEXH 1T22A 5E1AA 2Y5TA 4MWFA 2CK2A 4S0TD 1I8KA 2VWEE 2D7NA 2A77L 5KSAA 3U6RA 3GO1H 1KCVH 3ZL4H 2DQEH 3BGAA 4GT7A 3RQ3A 4PJAF 1KCUL 2ITCA 3K1KC 4MB4A 3IAGC 1M05A 4LQ1A 4Y2DD 4YFEA 5ERWB 4L3ED 2IQ9H 1YNTB 5KSVA 4FFZL 4PJGF 4LHUA 2A6JA 3U9UB 4MQXC 4HJ0D 3X3FH 3E3QC 3MO1A 2FRGP 3UO1L 4QXUL 1BHGA 2DKSA 2R2CA 4P46A 3RJDA 4YDLC 5EFIA 1X5YA 2GQHA 2YC1B 5E94A 4DN4L 2WBKA 4LCWE 4QGTA 4GRLA 4NDMB 4GRLD 4X6BA 1AKJA 5FYJD 3QHZH 5DHYA 5D9SA 1NAML 3OKDB 3LH2H 3O8XB 4S1RH 5F9AC 1TZGH 3IJSA 3JTTB 2F58L 5D1QC 2R2HA 1XEDA 1NC2D 4U05A 1XCQB 3TJEL 5CD5C 2APVA 5J6HA 2Y6SC 1QO3A 3ARPA 3RNQB 4JR9L 3GHBH 3GSNL 1FZOB 4YEEA 3O4LD 3PWNB 2OJEB 2HKFL 1YDPB 1SMAA 4Y4KB 2YPLD 3HMXH 4G9DA 1C08A 1L7TL 5JXEC 2CUMA 5TDNB 4WNQA 4JM2D 4OTXH 3WD5H 1LEKA 1G7PB 4W6WB 3LRGA 2D31A 1N0XL 3LN5B 2J8UE 5A1AA 3PWPE 1KCUH 4J4PD 3IU4L 3AS2A 2E5EA 4IMLB 3MJ8A 2XKSA 3WLWC 3WO4C 1NCAH 5EOCL 2IANA 3L3KB 1DQLL 1CFSB 4OLZH 3K4AA 3AMLA 1I85C 2P24B 1HI6B 1D9KA 4Z7VB 1KLUA 4EN3A 5ETUB 4X0KB 5GQBA 3LZFH 4P5KB 5T1LA 4YGAB 1FV1B 5FYLE 2HFEB 1UYWL 2X4UA 1OTSC 5HY9B 3OAZK 1MCOH 4Y2OA 4O02H 1CDJA 1BJ1J 4HK0B 4ETQA 5I6XB 2N7BA 3FB5B 1VKXB 5GZND 4B53A 4OM1H 2GJJA 4QOKD 2H2PD 4YUEL 3UZEA 1DFBH 2AV1A 3LKNA 4WI7A 4LOUD 2APWA 2YUZA 5IEHB 5D1QB 1DANU 3EAKA 2AI0H 4AJ0A 1MHCA 2FR4B 4LCYB 2AP2A 3TJHD 3VG9B 2PO6C 5ERWA 2ARJQ 2BFVH 4LSSH 5KZCD 5A3ID 4M43H 5JXEA 4LMQE 1MPAL 5SWZE 2NTSP 4OZIB 2Y36H 1RMFL 1SBBA 4LLDA 1HHHA 4JDZA 1F45A 3DBXB 1RK1A 4LMQI 4MDJB 5BRZB 3JVGC 2I9TA 4C56D 4FQ2L 2GITB 4BUHA 3LKQA 5KSUA 1F11B 1QRNB 2C1PA 3HZMB 4UUJB 2EC9U 3O3BB 5DUML 2FH8A 4XB7A 2Q86B 3DO7B 1MCHA 4AENB 3N1FC 1A6AA 1MVFA 5DMGD 1EA9C 2DQUH 4R96B 3WN5A 4J6RH 3X12B 2V7NB 1YEEL 3GMMB 2D9CA 4JN1H 3UTSA 4DGVH 1J0ZA 1I7TB 3BWAA 4X7DC 3DPBA 1MLBA 4GW5A 3GSRA 2LV4A 3ZDXE 1KN2L 2Z91B 4U49A 5CEZL 3G6AA 1A1NA 3O9WB 4L4VA 2VXTH 2X05A 3IAQA 3TPKA 3Q5TA 3TJHC 5I9QB 1MFBL 2BXZA 2P45B 1P4BL 1C1EL 1MJUL 2R8SH 1TJGL 5CBEA 3BT2H 3FQWA 2N1KA 3X11A 2Y9RT 2CRZA 1BQLH 2V5RA 4QRQA 3WL9A 5JHDB 2Y4SA 1OAQL 4OGYL 1FG2B 3MMEB 2HH0H 5AWNH 3QR2A 3STLA 3M8OH 1CU4H 1TZHB 1FNEA 1A3RH 1IEAB 3TH2T 4QYOB 4ZSOE 3FOLA 3VXNB 3MRJB 3CLFL 3RZCC 4JFZH 5C08B 4ZMAT 4M6AA 3QWOA 2VDQH 4U3XA 3RGVC 4Z7WB 3WUZA 1PAMA 1NGQH 1LD9B 5HD8C 1RJCA 1UXWB 4TOYH