2A77L

Anti-cocaine antibody 7.5.21, crystal form ii
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
216
structure length
214
Chain Sequence
DVLMTQSPLSLPVSLGDQASISCRCSQSIVKSNGHTYLEWYLQKPGKSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLRISRVEAEDLGVYYCFQGSHIPWTFGGGTKLESKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin Light Chain
publication title Flexibility of Packing: Four Crystal Forms of an Anti-Cocaine Antibody 7.5.21
rcsb
molecule tags Immune system
total genus 49
structure length 214
sequence length 216
ec nomenclature
pdb deposition date 2005-07-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a77L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a77L01
3V8CA 2XWTA 2QQLL 2V9TA 4JO1L 4KXZH 5F96L 1JTPA 5E1HB 4B0MM 1OWWA 4XGZA 4QT5B 3VE0A 3OX8A 4U6HA 1DDHB 4MQXD 4E5XB 4NJAH 2D7QA 5BQ7A 1TIUA 5F7DA 12E8H 2R1WA 4YHLH 3DX9A 2VZTA 3OPZL 3H42H 5F9OL 2UYLA 3MNVB 5HHQB 1JWUB 3BKMH 1I7TB 1NEUA 5D7IE 2FECL 4NKDA 1ZOXA 3RWJB 4YQXL 1MCPH 1G7IB 1OCWL 3U0WH 3N85H 4N8VB 4LU5L 3BO8A 3QIUD 2NW2B 1I85C 3GB7B 3JV4B 1H3PH 2J8UA 1G9EA 1EO8H 5DSCB 4GXUN 4YHYC 5C09B 2AJUL 3K80A 2HT2C 3O4OB 5BV7C 2CIKB 1KT2A 3F6IA 1GAFH 3REWA 4UILL 5T33H 4M5YL 3I2CH 1JN6B 3F7VB 1XF3A 1MCEA 4OZFH 2O5XL 3SKJH 1Q38A 2VLRB 4NKMB 2DTMH 1WZ1H 1KF9B 2BY1A 4PJGF 2FATH 4U1MB 4FMKA 3EDDA 2N4IA 1FL3B 1S3KH 1IAMA 2HFTA 3NAAH 5E8OB 4PYGA 4HS6A 5IFJA 2VXVH 2R2EA 1DR9A 4X9BA 1Q9WA 4ZQKA 1IQDA 5CSZB 3WHE1 4UBDC 2OJEA 5HHNB 1VFMA 3S6CA 1TMCB 4PJ9C 1UWGH 3ILQC 4N1CA 2YBRB 5L2JA 1AXSB 2F15A 2IH1A 3ZHKA 4UQ3B 3TBYB 2X1WL 4PJFA 1J1OL 3J8F7 1W8OA 4QRSA 1BLNB 5C3TA 5MERB 5EC1B 5C09D 5HYSG 1SYVA 5BZDB 2B4CH 1HINL 1YPZF 4AEIH 3KPRD 1H8NA 5CGYD 3G9VA 1BQLL 3QXDB 3T3MF 2JB6B 4PY8I 3TJHD 3CVIH 1U3HB 4EDXA 5EUKA 5IVXE 1QO3A 2VLRD 4E0RB 1EBAA 3NGBB 1JHTB 1XGYL 1NQBA 7CGTA 1HHKA 3OB0H 2YS4A 5FUCC 1NBYB 1S8DB 4AT6B 5D2NB 3PIQB 4I0CC 4OZFG 4PJBA 2HRPH 3QXVA 4ZDHA 4G42A 4L4TA 1VERA 2IPKB 1FFNB 3LKSA 4CL7A 4Z78A 1GOGA 3MLPA 4XVUD 4PRIA 5I8OL 1UVQB 3ULVF 3PWJB 2A74A 3RU8H 3A6CL 2I5YH 1MRFL 4FQ2H 4QY8A 4F2MA 4WEBH 3W0WE 5I8EB 4OZGB 3KLSA 5F6HJ 3BRFA 3OF6A 4DGIH 4NN7B 1FZOA 4EOWL 5B3JE 5FDYA 5DMGD 3CUPB 4QHUB 1U3HD 4GW1A 4LCIL 1UH3A 3ALWA 4WJ5B 3HLAB 3T4AB 1UYWH 5EOTB 1BQHG 3L7FA 4MSWA 1OP3K 3SO3B 3W2DL 1N2RB 2VC2H 1NCBL 4HKBA 4JPKL 3T0BA 5DEGA 4XI5D 3FB8A 1AP2A 2YEZB 1AGBB 1DEEA 1T66D 2ADJA 1RJZA 2WINA 3QCVL 3EFFA 5GGUA 1FVCA 1WLHA 2R1YA 5I1LB 4LVNB 2AXGA 3V0WH 3CLFH 3L3JB 3GMPA 5GIRB 1MJ7H 4Z7NF 3HMWH 5CAYB 5IB2B 1GGYA 4PJ9A 1J10A 1YC7A 4MA7H 3LN4B 3K81A 1FYTE 3INUL 2COQA 4DAGL 4OFDA 5J06A 4GKSA 2FECI 4IDJH 4X7FC 3GMNA 4I5BB 2AGJL 3OXRA 1T5XA 1RU9L 2H32A 2J8UF 2UZYB 3ZT7A 5FUZH 4MWFA 3TPUB 4QYOB 2EDJA 4OF7A 1YEJH 1D5ZA 4PP1C 3C2AL 4PBVC 1IZJA 5KSBA 1T1XB 2FGWH 2EDFA 3PL6D 5E5UB 5TQ2L 1QFUH 1MCWM 4X5LA 2CR6A 3BIAX 4ALAL 3ARFB 5I1IH 3ESUF 4XMKH 5DO2D 1I7RB 5TE7L 2H41A 3VFSA 1SVCP 1ZT1A 2EH7H 5IESL 2D31A 2IFFL 4JHBA 3LCYA 4KUZH 4WFHE 2XA3A 2VERN 3HI1B 4R2GB 2ZUXA 4QRPB 1R3HA 3GGWB 3GSWB 2CKNA 4PJ5A 3GKWL 3RIFK 4PJFF 3WO4C 3LOWA 3QB7C 1CFTB 3KYNB 4K9EH 3IKCA 4W6WB 3MLSH 1OSZA 3KYMB 4HF5H 4LDEB 1X5ZA 1KTLA 2FD6H 4RFEA 4FTVB 5EU3B 1T89C 4LSQL 4H0GA 3TA3A 4OLUH 1A7OL 4XCNA 5D2LA 1T5WA 1A7BA 1L7IH 4X9IA 1ZT7B 3N1PC 3HMXL 3OKMA 1CDIA 3BP6B 4FNLL 4FMFA 2BMKA 2APXA 5H94B 1DFBH 4I2XB 2EDRA 4Y4KB 3LV3B 4RQQA 4EI6A 1R3LA 1E4KC 3DHMA 1BD2A 4PJBF 1CGUA 4CAGA 4JDTL 3O6FB 4FFWD 2MCPH 4ZAKC 1J1PL 5GGSB 1MH5B 3RPIA 5J4MA 1BVZA 4Z7QE 1F42A 4POZC 4HGWA 1D5MA 4WDIB 3OKEA 4DKEL 1EXUB 2CK0H 1JYXA 1A6ZA 1H15B 3IFNL 5HI3C 4ZTPL 4PLKC 1GIGL 3WFBH 4CW1A 2YRLA 4HD9A 1S9XA 4LLMA 4CMHB 3QO0A 3MGAA 4FP8H 1WITA 2G9HA 5I16A 4Y4KD 35C8L 4Y8DC 2R9HD 4AY0A 4FXKB 4GAJH 2AJSH 5IB1B 3P4OB 3O6FD 3O8XC 2DI9A 3P4LA 1NMCB 1DUZA 2VDKH 3SE3C 3QHFL 5L8JB 3ZDYE 5IK3A 3BESR 1T20A 1BEYH 1F13A 2AP2A 4UV4H 1YJDC 3T2PA 4GAGH 1EHLL 1QPPA 4NZTH 3CDGB 2YD1A 5IT2H 4H26A 1DBBH 3DO3A 4YR6B 2JIXA 4J4PD 2RFXB 4JR9L 1ZLVK 2FBOJ 3I75A 1TVDA 4L3EB 5L88L 2OR7A 3O81A 4X6DA 2C3WA 1IEAB 4I9WD 4P99A 4KHXL 5FGSA 1CTNA 1JUFA 4XMLL 4P0DA 5H8DA 4Q0XH 3KGRA 1UB5A 1F45A 5EUOE 4J3TA 5LGJB 1M7IB 4HS8L 5ITFA 3VMNA 4JHAH 4X4XB 2UUDH 1S7VB 4C55A 4EQ2A 3SE8L 1K4DB 5GZND 2PCPA 1CGWA 4WU7A 1F4XH 1KCSH 3CFJB 1K8DB 1CYGA 2G5BA 4FXLA 1AHWB 4I8DA 4NHCL 1JWSA 5BS0B 4L3ED 3X13B 1TFHA 1AGCB 4OCSH 3BGMA 5A3ID 1K4CA 5A40E 1AGDB 4KROC 4Y19B 3RQ3A 2MKWA 2E9JA 2X05A 4J1UB 5I1DB 3RAJL 3QZWA 1IGIL 5DRXA 1HSBA 1E4XL 1E6JH 4QRRB 5JXED 4X6FB 3QDJB 3PWVB 3GMLA 1MVFA 3P77B 5FGCB 1MFAH 4DEPC 2XWJB 4YDVB 1U8IA 2ZKHH 2M2DA 3I6GB 3PE9A 3D6GA 1QBLL 1HHIB 1WIPA 4ZNEA 5HGDB 1NDGB 2R69H 5IGXH 5HYJB 1TTUA 5BS0D 2ATPA 1JIBA 4NC1C 2FLRT 4OD1L 5GS0C 2DQUL 3OJMB 4HBCL 4Y19D 1C5CH 4LBEA 5DWUH 2D2OA 3OAZH 3FB6B 4OCRH 4F3FA 1QSFB 5A2JH 4K23L 4YXHL 1GGIL 4JKPL 3QDJD 4MCZB 4QHLA 1NCCH 4GRWH 1YNTA 1QYGH 4NO2A 2VAAB 1LE9A 3VXMD 1JF5A 2AKRA 2HVJA 4RRPA 1HEZA 5C09E 4ZSOE 3TZVA 3W9EB 5AAMA 2Z91B 3BHBA 1KCUL 1ONQA 2DDQL 2KH2B 3RUGB 3FOMA 4OUOA 3OHXA 3RFZC 4Z7VB 5HYJD 4L4JA 2RIKA 1FYHB 4IRJA 1ZGLM 2VLRE 3UTQB 1ZE3C 5KVEH 1J86A 1RUQL 3IXAA 4LMQE 1CFQA 4U1NA 1EJOH 4U6YA 3JWNC 4OLWH 5ADPH 3WEXA 4XP9L 2A38A 2M1KA 4TOYH 1QSFD 2VLKA 2FIKA 3QQ4B 3KLHD 3ZSSA 1TPXB 4FQCL 1IEBA 2X10A 4JPIA 1I1YB 5EU6A 4YJZL 4LOUC 5LQBL 3D2UA 4Z7WB 2ZUQB 2B5IC 4A6YA 3FMGL 1DE4A 4RBPH 2DQEL 3T3PF 3IFPA 5HDQL 2JCCB 3G6AA 3PHQA 3NFPB 2MPAH 3CLEH 2F19L 1KCKA 1UENA 5DK0A 1EAJA 5JQ6H 3ALPA 2VXSH 4OI8A 1LE5B 3CVHB 2IBBA 2BNUA 2EIDA 1KB5B 1CLCA 3SDXE 3V8OA 4GFTB 4W4OA 4PJAB 4M93C 1WBXA 5D2NE 2VYRE 1ZLSL 5ACZB 4NQTA 4HAGA 4R4NC 3F5WA 3FQWB 4P5TA 1AR1C 2XTJB 4HUUA 5GRJH 1KJ2B 4JM2B 4JDZB 1NCNA 4XNZB 2BVPB 3SDDB 4BSWB 2OZ4A 4TQEL 3VG0H 5JR1H 3FONA 1M6OB 5IVNA 4PJ8A 3M17B 4ODXA 2X4QA 4G6KL 4JQXA 4QKXB 3LSOB 1AGFB 2NPLX 1PKQA 3JV6B 4UINH 5E6YA 5IB3A 1FDLL 1R24B 2FJFA 5HYQB 2HJLA 3HR5B 4ETQA 1KUMA 1CCZA 5E2UH 1ZS8B 1AQKH 1RK1B 2O5ZL 5KTEH 4TTDD 5F6IB 1MHCB 4RCAA 4ZO8A 1F6AB 2BHYA 3RZCA 4NQCB 2GCYA 3O3DB 2ICWB 5SWZB 1A6TA 2RJMA 4EVNA 2LQRA 5D7JC 1VA9A 2OP4L 5HBBA 2YN3A 1A4JB 1UADC 1MHEA 1WT5A 2FZ3A 3DURA 5K33A 1MUJB 2H2SC 2OXHA 3UPRA 3JV0A 1ZHNB 3JVGA 3O41B 1MWAA 5H35A 4P2OA 5F7LB 5DD3L 1MFBH 2AJ3A 3MQIA 1HIML 3JWDH 4JM2D 3OZ9H 1KYOJ 3SDDD 1YYMH 3G6DL 3N1QC 1JYNA 3MCLL 5I18L 5C0AB 5EOCH 4Z0BH 1GH7A 2CUIA 2A73B 4RAHA 2ZP0T 2RAMA 2VZOA 3T04D 2B20A 4IRSC 1P4IL 3CFEA 3HZVB 1J87A 4WV1C 4X6BA 4MAYB 2YHGA 2OR8A 3EIFA 2D3VA 4ONGL 3MRCA 2BC4B 4ODUB 5D1QB 5FKAA 1OTUD 4IOIA 2DM2A 4NQCD 4DQOH 2UVFA 2ZOLB 5EPMA 3F62A 5SWZD 5GJTL 2G2RA 1BGXH 3OKLB 4GW5A 3C9NA 4PGJA 4KTEH 5IWLA 5K93A 1FVEB 5FV1L 5D6DA 4TUKL 1TETL 5TGBA 3VH8G 4X4YA 5D7SL 1CXEA 2GTZA 2I9LB 2M8XA 4P4KC 5F9WC 3VWKA 4KWUA 1Q0XL 3KNBB 5DDHB 1Q9LA 5D93B 5BJTA 5IM7A 3WNOA 2ZSWB 3BVNA 4NDMB 5C0AD 4CGTA 3AM8A 1AXTH 1U8JB 1GZPB 4LLDA 2DICA 3TO4C 4Q9QL 5EC2B 2J12B 4MAYD 5DEZA 5I1JH 4G6JH 1EEQA 1WEJH 5D1QD 1G6RB 1M4KA 5T1MA 4XPHH 5CMAB 1CN4A 3LQZA 3QPQC 2VDQL 1I8KA 3I50H 2VAJA 3F58H 4LFHG 3C5ZA 5DFTA 2GUOB 1J0YA 3L5HA 4RISL 3GJFB 4KAQL 3WXWL 1Q72L 1NLDH 6FABH 3MCKA 1RUPH 2NY3B 4QRPE 4K71C 3UP1A 4I3RL 2HTLD 3QXAA 1H3GA 3NVQA 3WL9B 2IQ9L 4BQ8A 4G9FB 1A9BA 1M7DB 3HNVH 1FRGH 1X9QA 4FTVE 5HYSA 3CSYB 1IKFL 2QR0A 5CILL 2UZIH 2YPVH 4DKFL 3UYRL 3GSUB 1QSEA 4UIMA 5CKGA 1JTTA 5CKAA 4X80L 4YC2B 3IDYC 5GSRB 3ARQA 5TPWH 2XRAH 1RZ7H 2BDNH 5FO9A 4P2RB 5KZCB 1ZHKB 1TQBB 4HUXB 4OF8A 5T1DL 1ZSDB 3BZFB 1I3GH 1U8KA 3K7UA 2BJML 1CXHA 4OZFA 1FPTH 4ODSL 2NY3D 4WGWB 3TLRA 3BGFC 3DGGB 3RTQA 3SKNA 3QIBD 1Z9OA 2Q6WA 3NIGF 1RAMA 1QPXA 3LD8B 2EDXA 4MDIA 3HC0A 4A2LA 1G1YA 2ORBL 2VL5B 4OCMC 1ZHLB 4JPWL 3I6KA 4G9FD 1NUDA 3WN5B 3UMTA 4M3JA 4R4FL 1QTYT 3OV6A 4G5ZH 1DVFC 1PKOA 2W65B 1D5XA 4PJXA 2YD5A 4XVTH 4O2EB 4P2YA 2ZUTA 4JQVC 4YXKL 4KRPD 2FEDC 1CZ8H 5DD1H 3OAYK 4Y5XC 4L8CB 1MHPH 4F9LA 5SWQA 1H5BA 1X5HA 4HV8B 4PR5A 1X44A 5HHVH 3C8KA 3H9HB 3VRLF 3IB4A 4P2RD 4Q6YA 5KZCD 2Z8RA 4KZEH 4Y5YC 1BQHA 2CGRL 2E7LA 3TESA 5I17B 2AK4B 1YECL 3UBXB 4GW4A 1MCLA 3AAZB 5FKPB 2B8OT 4V2BA 1UWEH 2PTTB 4YNYB 1P7QA 4XCCH 3WHE0 3I6LD 3EYFB 3T0VA 5KVDL 1BZ9B 2NZIA 4LLWA 1P6FA 4CVXB 5JOPD 4PJCE 5I1AB 1YMMA 3DOSA 4FQJL 1CLOH 3EOAB 5CEXB 1MLCB 4G8EB 3KYOB 4UU9B 3BH9A 3VWJB 5LXGH 4Y2DB 4PRBA 4OBRA 1MLBA 2UWEA 4RGMC 2GY7B 4L3EE 2LABA 4R4BB 2NY0B 1XCTA 5TFSH 1OF2A 2CRIA 2DIAA 4F7TA 5DJYA 1LP9A 3MFFA 3WJJA 1BJ8A 4H88L 5CWSB 4JM4H 5FCUL 1MFNA 4ZOCA 2AK4D 1A0QL 3UTSA 5FOJA 2IMMA 4KQ3L 1P4BH 1IC4L 1J9CT 1JPFB 2OCFD 5GISL 3GM8A 5BW7A 3MJ8A 1JMZA 4W6XB 3TBTB 4MXVF 4W6YB 4C59B 1UJ3C 2WANA 3IDNB 3FQNA 5IB4B 4O02L 1OOAA 2DQHH 4I48A 1V7ML 2VDOL 3VWJD 5GGSY 3PHSA 4Y2DD 3R8BB 5BS0E 3RVUC 2DLTA 4Y5VA 3V5KA 4YFEA 1FNAA 1A2YA 2NY0D 5DJCB 2P42B 3P4MA 1RIUH 2R8SH 4RNRA 5D1XD 5IBUG 1J0JA 4U2ZA 2BXZA 4J3OC 4ZS6C 2X70A 2W0PA 2OTWA 3QHTC 4KHTH 2Q7YA 2HH0L 4XBEL 1ZLWK 4PJHA 3RL1B 3CCHB 4QRRE 2EH8H 3FAWA 5I6XB 3QDJE 5C0CA 1DANT 4E9LA 2J3SA 4L8DB 5FGCE 5ADOH 3VXQA 2X1PA 3AGVA 3V5DA 4LEOA 1JF1B 1TXKA 4NO0B 4I13B 4CKVX 5IQ9B 3SCMC 4WEMB 2E8ZA 4ELMA 1QVOA 4F9PA 5EORL 4TUJA 3L1OH 8FABB 5IHLB 1QUNA 4HKJB 2MOVA 2W9EL 1U8MB 5HYJE 3ZE2F 4NFCA 4TVPD 1NCDH 1NGQL 1MFCL 3D9AL 1Z3GH 3E3QC 1GSMA 5HVHB 3LN5A 4EJ1C 1NSNL 1V3KA 5D7IA 2C3VB 1OARH 1F4YL 5C1MB 2IPUK 4C4KO 5E4EB 4Y16B 5E00A 5J3HC 2GI7A 3P9LB 5C9JA 2X4RB 3PV6B 4LPVA 4U4BA 5MEPA 2YZ1A 2CMRH 5EO9A 5HY9A 2Z31C 3RX5A 2MNUA 3HPLB 5DD0L 3K0WA 3TBVB 4P57A 3HE7C 5FYJD 5I2IA 4JFHD 1J0KA 3FKUS 3IFOB 4QWWC 1RUAH 2P1YA 3L95A 3NCJH 1ZWIB 4U0RC 3BE1L 5E5MB 2NXYD 5EDXA 4ZFGL 4ONFL 4B5EA 5E8NB 3HZYB 4AMKL 1G7MA 4PS4H 4H1LG 4HBQA 2Q3AA 4LSSH 5INDA 5HYFA 3KPQA 4KK9D 5B8CC 4Y16D 1TZIA 1FJ1B 3AS2A 3QSKB 3BZDA 4N5EC 2PNDA 3Q5YA 1CICB 1J0IA 4YHNA 3AC0A 1BWWA 5LVEA 3WHXA 4MDJB 3ZL4H 1N5AB 1WBZB 4WHTB 1NBVH 3OKNA 1BPVA 1NGPL 4NNPL 2OLDA 3GBNL 3GMQA 2UWEF 4E42A 4RWYH 3QIWC 1T1ZB 2PYEE 4R26H 3V4UH 3QNYA 3KPOA 3BIKB 3C08H 4FFZH 3OG6B 4KI5D 1LP9F 1FG2A 1CE6A 1S5HB 2D7PA 5I75C 5IHUH 4JAMB 4X9FA 2DN7A 3OGCA 4P5KA 2P7TA 5FDWB 4M1DL 1U6AL 2WAHA 3SQOL 3MRLB 3X12B 4JY6B 4ZUWB 2VLJE 2I27N 4Z8FH 4LARL 4NM8H 1BVLB 4L9LC 3JUYA 1FL6A 2XTJE 3H9SD 4YDKL 4A6YL 1UH4A 2RGSA 3UTOA 5HI5C 1VKXB 1WVZA 3DMMC 4XBGA 4ZO7A 3WNMA 3BT2H 2BSTA 1JGDB 1CICD 43C9B 1UXWB 5C0DB 4YWGL 2EEBA 3W0WA 4FZEL 1QNZL 3MRPB 3R8QA 4CJ1A 2ADGA 1IM9B 4ONHA 5GGTH 4D9QD 5ICYB 4NQEB 5K59F 4JFXA 4XCFH 1UKTA 2BCKA 4MNQB 2AEPH 4WTWA 4YHZL 3U6RB 3F7YB 3ARYA 1KLUB 4L1HA 4WTXA 4XPGH 3VGGA 1BREA 4OUUB 2ZCKH 4YDIL 5KOMC 1NC4A 3S34L 4OV5B 1P5VA 1D5IL 1NFDB 3BP7A 4P5MB 3LN9A 2AJXL 4Q97A 4LPTA 2QL1A 2V5YA 1KPVB 3FO1A 4LPWA 4TTGA 4KKLD 25C8H 3TN0B 2OZ4L 3NCCB 4I0PA 5JW5B 3OB8A 4ELMF 4M7JH 1ETZB 4R3SB 5C0AE 1UXSB 4I3SL 5J8OA 1NJ9A 2XZCH 4M5ZL 4LNVA 4EN3A 1FBIL 1NUFA 1FGNL 3GZKA 4WI6A 1KFAL 2VL4A 3B8SA 4WTZG 4NQED 1BJ1J 4WY7L 4LCUB 1JWMB 1Q94A 4R0LC 3LQAL 2VZSA 5FA3A 4L3AA 1FYTA 3VFPA 1F2XK 2KZWA 1A22B 4TUOB 4BZ2L 4NOBA 3EJJX 1I3UA 3RA7H 3TIDB 1PBYA 2JELL 4Q6IA 1MWAL 4KTDH 4QLRA 4YGVA 3S37X 3KJ4C 3MLTB 2R4SH 4PYHA 1AI1L 3PF2A 4MD4B 2QADC 3O4LE 1AR2A 2CJUH 2H6PB 2DS4A 4OT1L 3TN0D 1E28B 2HFFA 3MRNB 4HFUL 4NKOA 3MV7B 2J4WL 1S78C 3GBML 1KYOK 5T3XL 4BQ9A 5D71L 3V9FA 4JZOB 1OGTA 3MRFA 3BQUC 5FB8A 4YBQD 4H0HB 3PJSB 4PJEB 2GITB 4UTAL 2IH3A 3A67L 1X7QB 1U93B 3G6JE 5EBLA 3MMEA 4H20H 2R56L 1RFDL 1T4KA 5E99H 5FECB 1KBGL 5CD5D 3ILPA 1T0PB 4U31A 4GAFB 2IGFH 1X5KA 1RHHB 1UM5H 4OGAD 2EDDA 4QRUA 4UOW1 3LZFL 4M62H 5EO0A 2CLRA 4K3JL 3SE4C 2A6IA 3HRZB 3QNXA 4F58H 4MJ5B 3NFNA 3G5XA 3AU1B 1JV5A 4XHJD 3NTCL 1FNHA 1KNOA 2RCSH 1C12B 3CFKB 2PO6B 2EE6A 2Z92A 1NPUA 1KC5L 4NJ9H 4QF1A 5DQJA 3ZKXB 3QJHA 4G9FE 4WUUE 5LAXA 1FSKB 2BVYA 1HXYA 4GG6F 5FA4A 3RVTD 2HFEB 2OS7A 1UH2A 3QHZH 3QRGH 3NABL 4HJ0C 3BP5A 1D9KC 4Z77B 1HN1A 1P7KB 4FQHB 2CLVA 4JZNB 4HW6A 4Y4FD 4EI5A 2H2PD 4HKZB 4AM0A 4HLJA 3ISWA 3GNMH 4NJAL 4TN9A 1B90A 2HJKB 3B9KB 2AS5M 5D70H 12E8L 1BM3H 3JWDC 5TH2A 3LH2H 3H42L 2V2TB 3MTRA 3I6LE 1ZKAA 3BKML 4Q2ZA 2PO6D 1JL8A 5EULV 4HUMB 1MCPL 3GIVB 1CGSH 3QWRD 3N85L 2D7MA 3CVHH 5GJSH 5C3LD 1H3PL 1KB5H 5KSAC 5B3JF 1EO8L 4P23A 5FF6B 3VXTB 1OM3H 5FM4A 3QIUC 1FORH 1UZ6F 2KL6A 5A1AA 3VI3E 5F7UA 1XT5A 5HSFA 1LDSA 1GAFL 1KJ2H 4LLVA 5T33L 5JORB 2Y6SC 3GMOB 3I2CL 5CINH 1MCIA 1F3DH 1YEEH 4JFOB 3B9KD 5DQDH 3SKJL 2AK4E 1XR9A 3QFJB 3DUSA 4X4ZA 1WZ1L 4KRMB 4MQ7B 1EAPA 2FATL 3SDCC 2C26A 4MVBD 4IJ3B 4W70A 2XQYG 1S3KL 3WCYA 4ELKA 4U1GC 5DJZB 1A4KB 4UQ2B 5HVWA 5FYKD 4FQLH 1EEZB 2HFGH 3BIBX 1C5DA 1UWGL 4F8QA 1PYWB 3MZGB 4J23A 1S7RB 3U7AA 1JK8A 4GBXB 5E94B 1OQOA 4DW2H 2APVA 4O00A 3DV6A 3VFNB 3ZKSD 2B4CL 4L29A 4NGHH 4U6XA 4AEIL 3CXHJ 3ZO0A 3P73B 4ZO6A 4ZPTA 1XF2A 3PWUB 3O4OC 3CVIL 4KUCF 2Q8AL 2W60B 5CGYC 3QDGB 4ZODA 5B22A 5EUOA 3QFJD 3UDWA 3VH8A 3RJDA 3HA0A 5C0ND 4CN6A 4QNPF 3S4SB 3TJHC 4LAQH 3P9WB 1HI6A 3EDJA 1Y18A 1NUGA 2GKIA 2GSGA 4K3DH 5ERWB 5SX5H 5DK2A 2DQIH 2DBJA 1A14H 5E8EA 2WBJC 4HJJH 5IF0B 3LMJH 1PZ5B 1XGQB 2ICES 5F21B 3HZKA 3IJSA 1C08A 1EIBA 1NCWH 2V7HA 3W5NA 4GBXD 1IL1A 4NKQB 4HCRH 3MLWH 3RU8L 3RL2B 3S3JA 2WIIA 4KKCD 4FQ2L 2IC2A 1K85A 3OR7B 4NRYB 4TVPE 4D0DA 4WEBL 5DT1H 1RZKC 4ZUSB 5FK9A 2HVKB 5DFVC 1NCAL 3BEWA 1BOYA 1BZ7A 3V6OC 4DGIL 3TYGL 4OIAA 2P8LB 4ODBD 4WW2A 1IAIH 5TF0A 4J7RA 5DS8B 3S37H 3QDGD 3NPSC 3R0MA 2F53B 4KKBC 1UYWL 4N0FA 1OT1A 5BMFH 2LU7A 4GMSL 3EW3B 1CD1A 4JY5H 2VC2L 4PG9A 3L3IB 1G6RH 4PV9A 2L4OA 2OM5A 4GRWF 4RGOH 2WUBL 1LDPH 4BA8A 5D7KE 1HDMB 4E5XA 3GJFH 4KXZI 4OGXH 4EBQH 5I30H 3DO7A 2XXMB 3V0WL 3WD5L 1X5YA 3L9RB 5CIPB 1MJ7L 3N06B 4QXWA 3MNVA 5HHQA 1JWUA 3HMWL 2FCBA 4LRIC 5TE4H 1I7TA 1KELH 4DWHA 3RWJA 4MA7L 4NN7C 3E8UH 3S88H 1XF4B 2F53D 5EU7E 4N8VA 3C6LB 1J11A 2NW2A 2XFXB 3GB7A 1KLGB 3JV4A 1CXIA 2MTPA 4IDJL 5BZWB 3RP1A 1HZHH 1HCVA 2GK2A 4TSAL 3ZSTA 5C09A 2GEEA 4ZSOA 3SO3C 2EXWC 4Y88A 2CIKA 3P2TA 4EZMA 3ARRA 1AQDB 1YEJL 1JN6A 3O9WB 4AH2B 1FFPB 4XAWH 2YD9A 1JE6A 3F7VA 2FGWL 3BPLB 1J1XH 2VLRA 1QFUL 4NKMA 3VRJA 5EZIH 1GHFL 3ULVD 5JMOC 3T2OA 4U1MA 3PL6C 3ETBF 1FL3A 4HGKC 3HNTL 5I1IL 4XMKL 3KXFE 4YPJA 3MV11 1UG9A 3RHWF 3ROOB 2EH7L 2P5WB 5CSZA 5HHNA 4KUZL 1MF2L 2YBRA 1AXSA 2OMNA 2J88H 2VSCA 1FNEB 4UQ3A 5HD8C 1A3LH 1BLNA 2QQQA 2R23B 2WBKA 5EC1A 5BZDA 5C0RH 3CH1B 1PJ9A 1LEKB 3QDMB 4K9EL 4F7MB 3TP4A 3MLSL 4HF5L 3QXDA 3D69B 1I7ZB 3O9WD 2JB6A 1EVTC 3M1BB 3DVNB 1U3HA 4MD0B 4OLUL 1SMAA 1JHTA 1L7IL 2DL2A 4LSDA 3SDXA 5J12C 1NBYA 1S8DA 3MREB 4LVOB 5D2NA 4F33B 1DFBL 3KLDA 3PIQA 2BOCA 1VADB 2P5WD 2IPKA 3VFVB 1FFNA 3AMLA 2YD4A 4JB9L 5DZNA 2GJ6D 3EO0B 3B2UC 4QRQB 5FGBC 2MCPL 4YBLC 1UVQA 1FO0B 3PWJA 3DYMA 3WNPA 4ZUTB 1JZ4A 4GAYB 4YK4B 2VQUA 3BJ91 2Z35B 5I8EA 1BFTA 5J11B 3QDMD 5C08E 2CK0L 1GXEA 2JJVA 3WKMH 4X8JB 4MNQE 5KSUB 4N0RA 3CUPA 4QHUA 1HHHB 2E7CA 3BP4B 1UA6H 3HLAA 4LCYB 3T4AA 4OIBA 2DL9A 4FP8L 1HKLH 4NNYB 4ENED 1YEKH 3C87A 4N9GA 2XKNB 3MR9A 1N2RA 1NFDE 2EIBA 1LHZA 1YUHA 4GKZB 4GOSA 4PRHB 2XG5A 2AJSL 3LRSA 1XIWD 3VGAB 1H8OA 4I1NB 1RZGB 2R9HC 1AGBA 4QOKD 4TVPH 1K5NB 2VDKL 4YE4H 3O6FC 3EYOB 2K1MA 5I1LA 3MA9H 4UV4L 3L3JA 4GAGL 1JPSH 4NZTL 5GIRA 3L6FB 4N90D 3FTGB 2PETA 5IT2L 2WV3A 1DBBL 1JPTH 4QHMB 3LN4A 2OL3B 5IKCB 1OTTD 1FCGA 1RULH 2Y7QA 3NIFE 5IHZB 3TVMC 4MGXA 5I8CB 4I18C 2DWEB 5ANME 4I5BA 2JJTC 1B6UA 3IJYB 4N9OB 4QXTB 2P49B 3PP3H 1FAKT 4PRHD 3TPUA 5FYJH 4QYOA 4YHYB 4XMPH 5KSVB 3MV7E 4P9HH 3CFBB 1IM3B 1XF5B 5BV7B 4PREB 1XGTA 4K55A 4NUGH 5JUEH 1IGJB 3ELAT 3ZDXF 3ECBB 3ARFA 3GSNB 1SJHB 5D5MF 3IDXL 5GS2D 5DVKA 4Z18A 1I7RA 1F4XL 3QULB 4QGTA 4YO0A 3ARWA 3BN3B 4JFDB 2JJSC 4OFVA 4H1LA 3EUUA 2D9CA 1NH6A 4OCSL 3HI1A 3FFDB 4QRPA 3BH8B 1EUUA 2VLLB 5CJ5A 3GGWA 3B4NA 4IMLB 4JFPB 3KPSB 1DSFH 1CFTA 3KYNA 2YPLB 3I02A 1RSFA 3KYMA 2HT2D 4FTVA 5EU3A 5IMMA 4PG2C 2ED9A 5JXEC 4RMTA 1MFAL 1B88A 3IFLH 1FZKB 3SQBA 3KDMB 1ZT7A 1U0QA 2EC9U 1TCMA 4F57H 5MP6H 4LKXB 5H94A 1JHLH 5I76B 5EWIH 4Y4KA 3LV3A 3P0VH 2DWDB 4X7TA 5K9JH 4XPTH 4JFDD 2R69L 1XGRB 4HIHB 5IGXL 3U0TB 4A2MA 4NUJB 2HG5B 4JKMA 5CSGA 1G7QB 4OD3H 4UBDD 1KB9J 3ARDD 1TITA 5LKNA 3ILQD 5GGSA 1MH5A 1K9TA 1C5CL 3NA4A 5DWUL 3ARZA 4OCRL 5C7XH 1YQVH 2EDOA 1PEWA 2J8HA 3KPSD 5FHBH 2F54D 4WDIA 2YPLD 2DYPB 4I3GA 4RIRB 4OZGF 2C3HA 1AO7B 1TCRA 4QHKI 1NCCL 5FYKE 1G9MH 2FX8H 3F6LA 3O11B 3RVWC 1QYGL 4J4PA 1MHHB 5D72H 3V5HB 1Z9SA 4TULH 3H9ZA 3T08A 4AL8H 2H1PH 1D3CA 1N8ZB 4U6VH 5IMKB 5HVGB 3CFDB 2Q87A 2R1XB 1P2CB 1EHAA 1WISA 2B0SH 2D7TH 4U1SA 4FQIH 3P4OA 2XZAH 2F58H 3EYSH 3QFJE 5KVEL 4Y8AA 1QLRB 1AJ7H 1IVLA 4XPFH 2FR4A 1EJOL 5ADPL 4S2SB 4TOYL 3U4EB 4X6CB 1A5FL 2DJUA 3QUXC 2EDTA 1NFIB 2DYPD 5DC4B 1A8JH 1AO7D 3KPPB 4Z7UB 4YR6A 2Z8SA 2V9QA 4OLVH 2RFXA 4WTZA 4EQ3A 1X4YA 3SKMA 5E2VH 2OJZH 2MPAL 4L3EA 4YZFE 3CLEL 4LAJH 1K8IB 4BSVB 1IEAA 5JQ6L 1F6LL 3DLQR 5GGTA 4ZFZA 3MRJB 3SBWA 2VXSL 3CDYA 3GUTB 1DQQB 3ULUD 1YEGL 5DR5H 3RY6A 2DI8A 4RMWA 5LGJA 1M7IA 5TF1H 1OP3H 4X4XA 1FFRA 1OW0C 1S7VA 4DKAA 4JN2B 2JB5H 1IE5A 5CGTA 1PX4A 4KY1H 3CFJA 2XYCA 3D18B 4OCXH 1K8DA 3L3OB 2I07B 3VG0L 5JR1L 1AHWA 5BS0A 3O2WH 4OGYH 3IDMB 4ZFOB 4UINL 3X13A 1AGCA 4N68A 3NZHH 3SGDH 4EDWH 1AGDA 4Y19A 4BKLB 5E2UL 1FNLA 1OWRM 2GK0B 4JFQB 1AQKL 3CXHK 1OSPH 4J1UA 5I1DA 5TDNB 1T3FB 1RZIB 4QRRA 2GAZB 4U49A 4X6FA 3QDJA 3T3ME 5F93C 3SOBH 3PWVA 4TTDC 2EIEA 3WO4B 3HS0B 3P77A 4WWKC 1N3NB 2EE9A 4XH2B 4PP1D 2XWJA 4HX1B 1FV1B 3I85A 4YDVA 1XR8B 3MBEC 5FEBA 3I6GA 4XP5H 1HHIA 1MFBL 3W11C 3JWDL 3VXSB 3OZ9L 1NDGA 1YYML 4G8GE 3PWNB 3Q6FB 5EOCL 3IT8D 4Z0BL 5HYJA 3SDDC 2JE8A 4CNIA 2GJZB 4YHPB 3BZ4B 3SGEH 4DK6A 4L4VB 1RV6X 3ULVE 1HK6A 3EFDH 4YLQT 1VGEH 1JRHL 1ZLUH 1ZVHA 4ZAKB 4M6MH 4FG6C 3MBXL 1T7VA 1QSFA 4DQOL 4XB8A 4AEEA 1BGXL 4WFFE 2LFGA 4KTEL 2ZZUT 3OKKA 4IM8A 2VAAA 4PGDB 2A0LD 1DZBA 1NL0H 1A7NH 1MCFA 3NOIA 3TT3H 4J2XA 4PD4J 4J3UA 2EICA 3VXSD 3N1GC 2YUWA 1YN7B 4MJID 4AYFA 3RUGA 3LEYH 3T4YB 1I8MB 4Z7VA 1G9NH 4X6EB 4GXVH 4L4VD 4LSUH 5IMLA 3OKOB 3U46B 3O8XB 4Z0XB 4KJPD 4G6JL 5I1JL 4ZAKD 1RIVH 1WEJL 5C0JB 3Q5TA 5DMKB 4XPHL 5FYKH 4ODWB 2F5BH 4UOW0 4Z7NE 4O9HH 2VH5L 1CDHA 2P5WE 3MXWH 4POZD 5GRVL 3I50L 3F58L 1I1YA 1NEZG 2XKSA 5IFAH 4Z7WA 5DUPH 3C60C 2ARJB 2Y06H 1NLDL 6FABL 1JYWA 1RUPL 3MROB 2JCCA 2Q76B 5C2UB 4O51B 1CTOA 4U3XA 4QTHB 3QDME 2J8UE 4HWBH 5M95B 1CD8A 2HTLC 3LPFA 3TBWB 3HNVL 1FRGL 2YZ8A 3BWAB 4D9RE 1X5XA 2NX5B 1OB1B 1CG9A 1LE5A 1HHJB 3CVHA 1NDMA 2UZIL 2YPVL 1C16A 5JA8B 3O8XD 4M6OH 4NFBA 4PJAA 5TPWL 2XRAL 3STLB 5ACZA 2VLJA 1RZ7L 5GGRB 4WO4B 3FQWA 2BDNL 2QEJA 4BZYA 4XT1C 3PDDA 5IW3A 4JM2A 4JDZA 5E8PB 4R90H 2BVPA 4BSWA 1TJIH 3B2VH 1I3GL 1IGYB 4OKDA 3K1KC 3L5IA 1FPTL 3M17A 1H3WM 5T5FH 3QG6A 3LSOA 1AGFA 3JV6A 5ESVA 4U1IB 1R24A 5HYQA 3HR5A 2NY3C 1ZS8A 3PGFH 3LEVH 3VGEA 3QIBC 1RK1A 4N90E 3QUZA 4PJFE 4G5ZL 1F6AA 4LHUG 2NX5D 2FO1A 3O3DA 4XVTL 5T3ZD 2ICWA 5SWZA 1S9YB 4PGEB 1QQDB 5DD1L 1MHPL 1A4JA 4R9HA 1KIQB 1CI5A 1MUJA 5HHVL 1ZHNA 3O41A 4KRPC 3I9GH 4WO4D 4PRHE 4DEPB 3VXNB 4KZEL 1KGCD 1Y6NR 3HAEB 1JGUH 5C0AA 1UWEL 2AJYH 2A73A 1VCAA 4MA8H 4PJBE 1FC2D 3HZVA 4NQDB 4LKCB 3GM0A 4MAYA 4WFGD 1RZ8B 1MAKA 2CH8A 5I73C 2SEBB 4ODUA 5D1QA 4TPRH 1CLOL 2ZOLA 3IS0X 2GSIB 1TENA 3OKLA 5LXGL 2CRMA 4WFED 1BJMA 3LKOA 1FVEA 1O7SA 5TFSL 1AD9B 2I9LA 2A9MH 4JM4L 1I4FB 3BMVA 4G8IB 3KNBA 2DQJH 4PRDB 1BBDH 2ZSWA 4X83A 3NACH 2JTDA 4I0KA 3SGJA 1P4BL 3BGAA 3ULVH 1U8JA 2WLYA 4R7NB 3RUGF 5CIPH 2YA1A 4NQDD 2Y5TB 1ED3B 4Z7VF 3RX8A 4OCNC 2P48B 1F4WH 3F12B 2EKJA 1MJUH 2X6MA 1FVDB 4LHJB 1T2JA 1G6RA 5CMAA 3RNQB 2ZCLH 2YK1H 2Y72A 1I3VA 1OGAB 5DMYA 4JRYB 1L6ZA 1WICA 2DQHL 5DRZB 3ZKMC 3FQTB 3IU4L 5J9PB 2ESVB 2R0ZH 4RAVB 5E08H 2GUOA 2EXYD 3D39B 4UNTA 2AABH 3DX7B 5EBWB 3VWJC 5CJQH 4Y2DC 2IQAB 1RIUL 2DQFB 5FV2A 1MEXL 4Z7WF 1TLKA 2R8SL 2B5IB 4S1DC 4IMKA 2WWMC 5C70A 4GH7B 2JCCF 3KPSE 2E9BA 4KHTL 1YNKH 2YPLE 5D1XC 5B4MD 3DVGB 3LS5H 4G9FA 4WUUA 2EH8L 1KPRA 3DROB 5CJXA 1S7SB 2HLAB 4X4ME 4K2UH 3CSYA 1CDBA 1MNUH 4XX1E 3MRDB 2CQVA 4K94H 3GSUA 3VD7A 2WBWB 1FCCA 5GSRA 4ESKA 5FUCE 3L1OL 1OGAD 4JRYD 4PJAF 4M93B 3DECA 4P2RA 3DXAB 1ZHKA 3IXTB 3FN0H 4HUXA 1I9JL 1PGRB 1GC1H 4D3CL 1ZSDA 3BZFA 3D39D 3MV01 2PUQT 3GI9L 2NW3A 1U91A 1NCDL 4R96A 4JM2F 1TTGA 1Z3GL 1SEBB 3DGGA 3L7EB 2XNAB 1OARL 5EBMB 2ZNXA 5HDLA 3TEUA 2VL5A 4R97B 1ZHLA 4MNHB 3WN5A 1L0XA 1AO7E 1AH1A 1M05B 1KTDB 1WV7T 2Z8VC 1KN4H 2W65A 4DZBB 3Q0HA 4O2EA 3V7AE 5I6XC 1T22B 3D5OF 2C3GA 4L8CA 1INDH 5IIEB 2CMRL 4HV8A 2RQ8A 2DKUA 1KJMB 3U83A 4OFIA 1WZKA 3UC0H 5D7JB 1L9MA 5B39B 3H9HA 4W4NA 2IAMB 2CPCA 1WF5A 1I9IH 3DXAD 4G80A 2LV4A 2R2CA 3SGKA 4ORGB 4ZYKB 1N7ML 1S9WB 3P0YH 4R4ND 1FO0H 1RUAL 5I17A 2AK4A 3NCJL 1BIHA 1AR1D 3J7HA 3MNWB 4GKNB 4L8BB 4N8CH 5FKPA 3AAZA 2PTTA 1D6VH 4YNYA 5AYQA 1KB9K 4IOSD 3SY0B 4PS4L 2NXYC 1TQCC 1BD2E 3EYFA 4LIQE 2EO9A 1BZ9A 1F90H 2PR4H 4JRXB 4IRSB 2ZG3A 3TO2B 4CVXA 5BXFB 5HVHC 1IC1A 4WV1B 4Z7UE 2G5RA 5A43C 5I1AA 5ETUB 3S3PA 1VESA 3EOAA 3P4NB 5CEXA 1MLCA 4G8EA 3KYOA 4UU9A 5DJ0A 1FH5H 1DJSA 2NCMA 4Y2DA 1RUKH 2HYMA 4ZOEA 2F74B 1NBVL 4R4BA 3BKCH 5D7JD 4MLSA 2IAMD 5HDBE 4RWYL 2HLFC 5CWSA 1CGTA 3V4UL 3C08L 4FFZL 4KK5C 4P4KB 5F9WB 5IHUL 5JIKA 4KI5C 4PGCB 5KJRH 3LKNB 1JPFA 3AY4A 5CZVL 1XCQB 3GSVB 5GS2H 4JRXD 4IRSD 4CBPA 3TBTA 4Z8FL 4NM8L 1PD6A 3GO1H 2OL3H 1AIFB 3IDNA 5IB4A 3U30C 1KEGH 3D25B 3BPCB 1T21B 3BT2L 3EYQC 1MFDH 3ULSB 1IGFH 3AREC 4Y89A 5E7BA 4M03A 2K3TA 1CICC 4S0TD 1F2QA 1FZMB 5DJCA 5GGTL 5FUOH 3SO5A 3T3PE 4HK0B 5J1SC 1GL4B 2VXUH 2AEPL 1MAJA 2BY3A 3V52H 4PV8B 1S7QB 4XPGL 5BV7H 1FHGA 4K71B 2ATKB 3CCHA 3RGVD 4PJDB 2ZCKL 4KKNA 1UC6A 4GT7A 3FT2B 5IBLC 3V6FB 4L8DA 3TV3H 4WIQA 3BD4A 3GSNH 4JANB 3Q1SL 3TCXA 1JF1A 4NO0A 1KXTB 1IGTB 5IQ9A 2LTQC 3EZJB 1E27B 25C8L 1IAOB 4FQXC 3VGDA 4KK8C 4WNQB 4JJ5B 1XGUA 3T8XB 3VXSE 5IW6B 8FABA 5SWSB 3IDYB 4M7JL 1INQB 4HKJA 4KKLC 4OSUH 4V2CB 1X5FA 4NO3B 1U8MA 2L7JA 2XZCL 3H7LA 5F89B 3PWPB 3L3DB 5BVJB 5HHPA 2EDHA 1JZ6A 4NQUA 1MCCA 3S5LB 2P24B 4LCWB 1KIPB 4OLZH 2C3VA 5GPRA 3BGFB 1MAMH 3QEQB 4Y16A 2XXCB 1H3UA 1HH9B 3P9LA 1G7PB 3HC3H 2X4RA 1FFQA 3DRTB 3PV6A 2X4OB 4XXCC 2XWBB 3G5ZB 3RA7L 1I1RA 4KTDL 3HE6C 2BSSB 5HYEA 3O3BB 4HG4K 3D3VD 5D8JH 4LRNH 2CJUL 3S7GA 5JPNB 3HPLA 3EHBC 4Y5XB 5DRWB 5SWSD 5GGVH 3WUZA 2GFBB 3TN0C 3IFOA 5JDSA 4NQXB 5D6CB 1NGZB 3PWPD 1ZWIA 5E5MA 2FL5A 5E8NA 4Y5YB 1CT8B 2P43B 3HZYA 1MRDH 3PWLB 4LCWD 4YBQC 4CVZB 4ETYA 3S8WA 5E99L 1XGPA 2PXYA 3KXFA 1HXMB 3WLWC 3P40A 5B38B 1RHFA 3KVQA 3Q3GB 3VFGH 3DETD 2NTSP 3QEQD 4PTUA 4JLRB 2OK0L 2IGFL 2XZQH 5CD5C 1MSPA 1UM5L 4GXUM 3MGOB 2DQCL 2WM0A 5DLMH 1WFUA 5IQ7H 2J1KA 2BRRH 2J7LA 5CFHA 1V05A 4ZUUB 4OGAC 4S1SL 3E1F1 3SDAD 3K8LA 4F58L 2VN7A 3C5SB 1AY1L 4MDJA 1N5AA 1WBZA 4WHTA 2RCSL 4LSTH 3DBXB 4XX1G 2LVCA 2FEDD 1T7WA 4JFZH 4NJ9L 4PD4K 5HHOB 4XHJC 3ULUH 1Q9KB 3JBG7 1EEYB 3V7MA 3BIKA 5C0IB 3THMH 5DD6B 5DHVB 2NX5E 4LCCC 1S5HA 32C2B 3IVKB 4LIQH 2AW2A 4JAMA 5FDWA 5ISZE 1F3RB 3MRLA 3X12A 4JY6A 1N6QH 4ZUWA 4M48H 1SM3H 2P8PB 5T5NF 1NFKA 4NQSB 3OB0K 4X7SL 4GLRH 3GNML 1PZUB 1VKXA 1L0YA 3UPCA 4Y4FC 1ACYH 5D70L 5K9OB 1RK0B 2BNQB 1JGDA 5ILTH 1UJ3B 1O7VA 3LH2L 4C83B 4HEME 4GS7C 43C9A 1UXWA 5EOCJ 4KPHH 1IM9A 3V7AG 1HWGB 1FGVH 3FQXB 4NQEA 5HHOD 4YAQA 5IJKA 1C8PA 4MNQA 1CGSL 4WFGE 4S1RH 1UCBH 3U6RA 3CVHL 3PNWB 2PO6C 3F7YA 4MZ3A 4P9MH 2ZCHH 5KVFL 4OUUA 4AIZB 2B1AH 1N5YH 4XWOC 1FSKC 3AMKA 1KJVB 1FORL 4OV5A 4HPOH 4WFEE 4OF0A 1NFDA 2CRYA 4P5MA 4PFEA 1WTLA 4JE4B 2OI9B 1L4IA 3ARGC 1KPVA 1B0RB 1NCTA 6CGTA 1JPGB 4CU8A 1G0DA 3TN0A 5HPOA 1YEEL 5HHMB 4F37K 2IG2L 2BNQD 1FIEA 4ZXBC 5JW5A 3SCMB 1ETZA 2DQTH 5MEQB 2WQ8A 4JGUA 5CEZD 3B9KC 5CEYB 4PGZA 3CMOH 3RWHB 3WUWB 4V1DB 3BAEH 2IANB 1G9NC 4NQDE 1JGEB 3QQ9D 4MVBC 5DGQA 3VFTB 3S36X 4NC1E 4D0BA 4LCUA 4FQLL 2WW8A 1BF2A 1JWMA 2HFGL 4MCYB 4S1QH 1MCQA 1IJ9A 4ORZC 3WS3B 5DD5H 3DARA 4ZS6D 4DW2L 3WS6C 2R39A 4TUOA 5ALCH 1P7HL 1MVUB 3TIDA 4I4WB 1AFVH 4NGHL 5ANMA 2IJ0C 4AEHH 3X3FL 4DTGH 3CC5B 3MLTA 3MRQB 4MD4A 3WFDH 1Y6KR 4JCMA 2H6PA 1TVBB 1E28A 3QA3B 5HHMD 3MRNA 4JO2H 4O2CA 5EFIB 3MV7A 2HT3D 5IMOB 2Z31B 4Y4HA 3VRLE 4LAQL 2QBWA 4KVCL 1YYLL 1IT9H 3AROA 2HKFH 4C57C 3PJSA 1G84A 2GITA 4K3DL 3QUKB 4YX2H 4V1DD 1I8IB 2IAND 3OJ2C 1A14L 1X7QA 4HJJL 3FO9A 4KI5F 4WI5A 3RX7A 1U93A 4U0RB 5L6YH 4LLAA 3Q2CA 1JGVH 1KCRH 5FECA 4G7YH 3QUYC 1NCWL 1F58H 3V6ZB 4P4RB 4XP6H 1G7LA 1CGXA 1RUMH 4RMVA 4HCRL 3ZYJA 2XWTB 3MLWL 4XAKE 2ESVE 1RHHA 3TYFB 5B8CB 4HWZB 4UT7H 4Z95H 1LO5A 4GBXC 1I1AA 1WIUA 2D0GA 5JIPA 5DT1L 5J3HD 1A21A 3MYJA 2R2HB 4KKCC 3HRZA 5FHAH 1WK0A 4MJ5A 1PEZA 3AU1A 1NEZA 1P84J 1DBMH 1IAIL 3CFKA 2PO6A 4OCYH 3S37L 4ZG1A 2Z31D 4LGSB 3QWRA 5BMFL 4OV6F 4HMCA 5I66B 3QIWB 4JY5L 3ZTNH 2HFEA 4QWWD 1G6RL 5J13C 5DJ6B 2AXJA 1QR1B 1P7KA 5LCVH 4RGOL 5I75B 5I19H 5JW4N 2PKDA 4FQHA 4JZNA 1R5IB 1YJDH 1LDPL 5E5RB 4HKZA 5FO8B 4KFZC 2HJKA 3B9KA 4OGXL 4EBQL 3FT3B 1KT2B 4L9LB 3REWB 5I30L 2DKMA 1QRNB 2V2TA 2ENYA 4EKXA 3IRZA 1U8QB 4BELD 5TE4L 2VISB 1KELL 2HJFB 3QAZB 4K3HA 5JQHC 4MMZC 1SJVA 3E8UL 3GIVA 3S88L 5GSVB 3LS4L 5T3ZH 4KJYA 2NNAB 3QIWD 2BFVH 3V4PH 1DQMH 2Q20A 5FF6A 1HZHL 2R2EB 3VGFA 1CDJA 1IQDB 2OJEB 2ZOKB 1LO4H 1RZJC 5L2JB 4DK3A 4LHUA 4P3CH 5BRZB 5DHXB 3QI9C 4HWNA 5JORA 3GMOA 4XAWL 1D7FA 4JFOA 1YEIH 1QSEE 1J1XL 1YDPB 1NUNB 3QFJA 1QRND 5HI5D 4MQ7A 4GUPB 4M02A 3ZE2E 1IZKA 5DJZA 1A4KA 1ES0B 1BVKA 4UQ2A 5IOPB 1CS6A 1DP0A 1Z5LB 1OTSC 4JRXE 3FN3A 1HHKB 1EEZA 3W5MA 1PYWA 4KGLA 2IEPA 1S7RA 1GGCH 2ADIB 1EBPA 1QA9B 4GBXA 3N1MC 5E94A 4NZRH 2E9WA 2J88L 4BH8B 1I8LC 5CUSH 1A3LL 3GSRA 4R0LB 4Z78B 2ICWI 1HILB 1PLGH 5HGAB 5BRZD 4APQC 4NZUH 4RRPG 5L2KE 1WIOA 1U3ZA 3HAEH 3P73A 1BIIA 5ICXB 4ZS7H 4G6MH 2DMBA 3KJ4B 4HWUA 2W60A 2QADB 2VITB 3QDGA 4Y1AB 5DJ8B 4Z76B 3S4SA 1K3ZA 1FZOB 1GOFA 1VFAB 2ITCB 3EOBB 4GW1B 5ERWA 5GS0H 5IB5B 3RWGA 4PBWD 3BQUB 4PJEF 4YXLH 1PZ5A 2XQBH 5E7FA 4JRWA 4MSWB 1OLZA 1MCKA 2YUXA 2X4NB 4OM0H 4HFWB 4KDTA 2UUDK 5JTWA 3A6BH 3S36H 2QQLH 5DEGB 3FB8B 2OMBA 3PQYB 1BQUA 4ZUSA 2IWGA 4PRID 2HVKA 2ADJB 3WKML 1JNHB 5I15H 3ARBC 2E7BA 3UZVB 2P8LA 1G7HB 2EIZA 3VFWB 4NT6B 5DS8A 2QADD 3GMPB 2VE6B 2F53A 1UA6L 4HDIA 3W39B 1HKLL 2ZUYA 3HAEG 1LP9E 1YEKL 2DLGA 2P8MB 1IAII 1B2WH 4JREB 5EO1B 3BOVA 3L3IA 4LU5H 2NQCA 1INEL 3BQUD 2F8VA 4ENEC 1GGTA 4LVOC 2AQ3A 2DQDH 1KOAA 4GKSB 4P59H 5HHXH 1U41A 3C5JB 1D9KB 2OBGA 5DEFA 3LRGA 1LQSR 4EUPB 1WQVT 4WHCA 4TVPL 1P5UA 3U82B 4MWFB 4LP4A 2ZUSA 1XIWC 4YE4L 1QBMH 3RIFF 3CU7A 1UB6B 3WDHA 3MA9L 4M5YH 1JPSL 3LHPL 3L9RA 5CIPA 3ZYZA 4LCWE 1EH9A 2O5XH 3OSKA 1V7NH 5J11C 1JPTL 5C71A 5IHBA 2YD8A 1P9MC 3BDBA 1JNJA 3VJ6B 1XF4A 3U48A 2P5EB 5K59E 5LWYH 1KN2H 4BM7A 4MXQC 3C6LA 3OAZK 2P47B 2XFXA 1LMKA 1KLGA 1JTOA 1J7VR 3VFSB 3TH4T 5BZWA 1ZT1B 3E6HB 4M1CC 2B2XH 4PLJC 5KSAB 1OAQH 5DJ2B 4X5WB 5FYJL 5DVOA 5C0CE 4FS0A 1D9KD 1DTUA 3L5JA 4XMPL 1J1OH 1AQDA 1BZQK 4P9HL 1BBJB 3O9WA 4AH2A 1FFPA 1Z6JT 4NUGL 5JUEL 3IKCB 4ELME 3ZDZF 4NHUB 2ARJQ 3DHJA 1DQLH 1OQXA 4M6NH 4ODTH 3SDCB 4QEGA 1S7WB 3ROOA 4CMMA 2P5WA 2P5ED 3OKMB 4U1GB 4WHYH 1JZ5A 5H37H 4DVRH 4EI6B 1FNEA 2X1OA 4JGJA 1KENH 5F7HA 1S5IH 5KSAD 2R23A 2NY5C 3RWDA 3CH1A 2CD0A 3MJ7B 1ZVSB 1DSFL 3QDMA 4YZFF 1LEKA 4F7MA 2FGZA 4RBPK 5HHOE 3D69A 3SKUD 1I7ZA 3DVNA 5F8RC 4MD0A 3PG2A 2Y6SD 4GRLC 3RVVC 3IFLL 4EOWH 5ACMA 2CLZA 3KPRB 1NBZB 3MREA 3UBXI 4F57L 5MP6L 3KPNB 4LCIH 3TA3D 4F33A 1JHLL 4CW1B 3SDCD 5EWIL 3P0VL 1VADA 5K9JL 4XPTL 5D5MB 3VFVA 4UDUB 2WBJB 3EO0A 2NY1D 4OD3L 2DJ4A 1FO0A 1KIRB 3OTTA 3LPGA 1EZVX 2R29L 4ZUTA 2E6JA 5CEZE 4GAYA 3HTLX 4FOMA 4HPYH 1B0GB 2Z35A 5C7XL 3ARDC 2XY1A 4G3YL 4YUEH 5FHBL 3VFOB 1MQ8A 3QCVH 5KVMC 5H37G 2B1HH 4IS6B 4X8JA 1KULA 4JKKA 1G9ML 1EMTL 2FX8L 3TH3T 2FX9H 1HHHA 3NN8B 5B39G 1MI5B 3BP4A 3HNSH 4LCYA 5D72L 4N1HB 4HXBH 3TIEB 4H26B 4NNYA 3NPSB 4GG6E 1C1EH 2XKNA 4AL8L 2H1PL 4U6VL 1FNGB 4GKZA 1JGLH 4PRHA 2B0SL 2D7TL 1ZEAH 2WBJD 2IADA 4FQIL 2K7QA 3O2DA 1KACB 4YHMH 1RZGA 2XZAL 1F97A 4X6DB 2F58L 1A1OB 2AV7B 1K5NA 3QXUA 1AJ7L 4DUWA 4NFDA 3GJEB 4LLUB 2ITDB 1UB5B 1JNNH 3L6FA 3P9MB 4XTRC 3FTGA 1ZA3B 3K2MC 3X11B 1NLBH 5DFVD 1EPFA 2VABB 3VCLB 3E3QE 4KGJA 4QHMA 1MI5D 2OL3A 4OLVL 1WCQA 4PUBH 5IKCA 2LVEA 3MUJA 5IHZA 1KJ3H 3BPOC 5E2VL 4Z5RB 5I8CA 2DWEA 5IVOA 2JIXD 3H3PH 4KKBD 2IFFH 1B9ZA 1I85A 4QXTA 2E8YA 5GS1C 1UZ6E 3MLYL 3LY6A 5DC9B 1SY6H 5JHDB 2HMIC 1I3RB 5DR5L 5KSVA 3L3HB 3CFBA 1XF5A 2X9XA 3VI4F 2J6EA 5TF1L 4PREA 3ULUC 3QZWB 2ZUUA 1IGJA 4WCYH 4YFLF 3ECBA 5F9DC 1Q1JH 1YEDB 4PLNC 2JB5L 3GSNA 1SJHA 1P53A 1A7OH 3QULA 4OIIH 4KY1L 4OCXL 3PL6B 2WWKO 2LU3A 5F70A 3GHEH 3NFSH 2VDLL 4LVHC 1NAMB 1CFVH 2DLEA 1WCBB 3O2WL 3FFCB 3ZZ1A 1J0ZA 1A1NB 4OGYL 3NBNA 1J8HE 3K3QA 2H9GB 2NZ9C 3NZHL 4EDWL 3FFDA 1MCSA 5GRVK 3EGSB 2VLLA 1OSPL 1U2CA 4IMLA 5JHDD 4JFPA 3KPSA 1J1PH 1EZVY 2YPLA 4O58H 2FIRT 4LBEB 3VMPA 2EXWD 2VQTA 4X4MA 1OPGH 3EOTL 3LKPB 4DKEH 4QNPE 1X4ZA 2KZ1B 3KDMA 4QHLB 1OLLA 1XH3B 4ZTPH 2D0HA 4LKXA 5IROC 5I76A 5J12B 1RJLB 1WSST 2DWDA 1EFXB 5HYIA 3S5LG 5ID1B 3U0TA 3FHAA 2HG5A 3EKCA 3FFCD 3RWCB 1G7QA 3UTPE 1ONQB 3GI8H 1F3DJ 3EFDL 3FOMB 1VGEL 3OHXB 3T1FA 1A64A 4PJIB 4YBLB 4M6ML 1GPOH 5HD8D 1VGKB 4U33A 4XXDB 2R2BA 1PW3A 1P84K 2DYPA 3B6SA 4LSRH 5DHVH 1AO7A 3ZMRA 1WAAE 1E6OH 2MQ3A 3O11A 5E9DB 3DVFA 1CFSB 1MHHA 2IPTH 1S7XB 2FIKB 3V5HA 1W0WB 2ICWJ 5DMIH 1IEBB 4WI3A 3S96B 2ZJSH 3HKFA 1A7NL 1N8ZA 4K7FB 5IMKA 3TT3L 3D2UB 5BRZE 2A0LC 3ZLQC 3MOAL 4NRXA 2R1XA 1EFXD 1P2CA 3G6AB 1T1YB 3LEYL 4GRWE 3QCTH 3SDYH 3FZUD 3O3UN 5B38G 2QTEA 5CEZH 4P48A 2ZPKL 4GXVL 4JPVL 4FFYH 4LSUL 4XMLH 1QLRA 1X5GA 4HK3J 4FQ1H 5E1AB 3B2UD 15C8L 4GKOA 1RIVL 4HC1A 4JZJC 4IRJD 3PDGA 3OR6A 4S2SA 5FYKL 3U4EA 4X6CA 2F5BL 2D7OA 4KJPC 3ES6B 1IAIM 4Z7UA 3KPPA 4NWTH 4WI4A 4U3CA 5IFAL 4MQTB 1WBXB 4JDVB 5E9DD 5DUPL 2VLKD 3VXRB 2ARWA 5J1TC 4U0QB 1K8IA 3D2UD 2BXYA 4BSVA 3TVMB 4I18B 3MRJA 2OR9H 2W9LA 3GUTA 3JWOC 2W91A 1DQQA 2X09A 4ETQB 5BOZG 1UM6H 4Y1AE 4K7PX 4MA3B 4S0SD 2FNBA 1AE6H 1U8HB 4M6OL 5L0QC 4JVWA 4TSCH 1E4XH 5D1ZC 5T1KB 3BD5A 1QSZA 2Q8BH 5K9KB 5I74C 4JN2A 5HPMB 2X4TB 3B9AA 3MJGX 2FZ3B 3D18A 1L7TH 5E70A 3DURB 1UJTA 2AEQL 3L3OA 3UPRB 1TJIL 3B2VL 1DN0B 4KKAD 1EHNA 2I07A 1ZTXH 3GRWH 4KVNH 3VXRD 1U58B 4NIKB 3OMZA 3IDMA 4ZFOA 4H0IA 4JO3H 3PQYE 4P2CG 1QACA 4BKLA 3TVMD 3UAJC 3PGFL 4JFQA 3SEPA 4PRNB 3VXOB 5TDNA 1G0XA 1T3FA 5ESAB 1VEMA 4X6BB 3SGDI 3B9DA 4OJFH 3E0GA 1JZ7A 4TNWK 1ROWA 3PABB 3HFMH 4X98A 1URLA 5C07E 4XH2A 3T0XA 5T1KD 3QEUB 4HX1A 4K23H 5JXAL 1FV1A 5EPMB 3GK8H 1T89A 1GGIH 1XR8A 3I9GL 3O45B 1T2QH 3WUWG 4OKVA 1FE8H 3VXSA 4WO4C 4RX4D 3RRQA 3PHOA 3PWNA 2FWOB 3Q6FA 5CHNA 2E7MA 3C09B 2AJYL 4Y2OA 2V2WB 4HUNB 4MA8L 2EDYA 2A6KB 1E4KA 1Q9LB 2GJZA 2YMXH 4YHPA 2DI7A 4L4VA 2DIJA 1KG0A 3QQ3B 1S9KC 4ZAKA 4AIXA 1BJ1H 5IBTH 1P69B 3V4VH 4TPRL 2CK2A 5ALBH 3SGEI 1NAKH 4YIQB 1ADQH 2P5EE 1FAIH 4TNVK 1N0XH 2XG4A 1LWRA 1KSRA 1DQTA 4PBXA 4UB0H 1VFBB 1AD0A 4WU5B 4PGDA 2DQJL 1JHKH 2DQEH 4ZUVB 1YN7A 1BBDL 2YD3A 5DUMH 4G43A 3NACL 1JYVA 3T4YA 1I8MA 4JQIH 3VXMB 3VXPB 1HCFX 5BO1H 4JY4B 3ULVL 5ITBH 2YUZA 4OQ1A 4X6EA 2VNCA 1JZ2A 1T03H 3WJLC 4HH9B 3OKOA 1F4WL 3O8XA 4Z0XA 3U46A 3ULUF 1MJUL 4F7EB 5AEAA 1QSVA 3SE3A 2H26A 4ODWA 4K7PY 2ZCLL 4RMUA 2YK1L 2CKBB 2HTKC 4TYUA 2DM7A 3UCRA 1N4XH 1SQ2N 4X6CF 4B53A 2R0ZL 4U1JB 5JNYB 3QUXB 5E08L 4Z7UF 3T1WA 2XOTA 4D94A 3BRGC 3DTXB 2AABL 2ARJA 1WJ3A 3OJDA 5FO9B 2AXFB 3LEXB 3MACH 3IRPX 5CJQL 3MROA 2Q76A 2EXYC 3RVWD 4O51A 3UYPA 1U8KB 4QTHA 1YNKL 5FO7B 4QXGH 4BSJA 3LS5L 4U3HA 3TBWA 5DJAB 1JZ8A 1QLFB 2BVEA 3MOBH 5HDBF 2Q6WB 3BWAA 5A2KH 2NX5A 4K2UL 5B4MC 3QFDB 5AG9A 3MUY1 4Z7OF 1HHJA 2QLVB 1MNUL 4PTTB 5EU4B 3RPKA 4K94L 4PY8J 3KPRE 3RKPA 5ISZA 4DUVA 3IU3B 5E2TH 2BK8A 3STLA 5KS9B 5FOBB 5GGRA 3ZDXE 2O61B 1PVHA 1NMAH 5F1OB 4RDQF 3AS0A 5D5ME 3FN0L 1ZV5A 1H5BB 4PR5B 1GC1L 1WTGT 3QUXD 2ZG1A 5E8PA 1IGYA 3T0EC 3HR6A 2WWKT 4BQ6A 2YPKB 1T0MB 4Y0GA 3O2VH 2MCG1 1MCHA 3NCMA 4U1IA 1ZANL 4GW4B 5I18H 4J8RA 3HI5H 2F8OA 3CK0H 3UO1H 3P30H 3OBAA 3KS0J 3EO1B 1KN4L 4DZ8A 3CZFB 1MI5E 5ELIA 1BFVH 1MY5A 1YMMB 3DUUA 1QQDA 3B8YA 4OI9A 3U0PB 43CAB 4PGEA 5BVPL 1KIQA 5CP3H 3UC0L 1XMWA 5GJTH 4WWKB 4K7PH 1I9IL 2R0WH 5F3BB 3VXNA 2QSVA 5F1IB 5JW4Q 3HAEA 1FO0L 3MBEB 5D7SH 2OSLB 4N8CL 3RI5K 4M9OA 5J6GB 1D6VL 4Z6AT 3ZTJH 4QCIB 4NQDA 2ERJC 2PR4L 3QXTA 1BWMA 1RZ8A 3ZE1E 2SEBA 3GSOA 3GSQB 4JFEB 5HTSA 3SN6N 4B41A 4R97C 5FM8A 3ARPA 3ALXA 4OZGE 5JOFB 3GHBH 4M43H 1FH5L 2E9IA 4OF3A 4WRLA 1YMMD 1RUKL 2X42A 3UJJH 3FQNB 5CJ8A 1MJJB 2VDQH 1VACB 3BKCL 3VXUB 4OB5L 2B39A 4WWKD 1YZZA 3O2DL 1SBBA 3TFKC 4IIQC 1I4FA 4EUPH 2Z4QB 3OJVC 4G8IA 3QEGH 5JHDE 4PRDA 3MBED 2IAMC 1A2YB 3QP3A 3P4MB 1FIGH 3WXVH 3W11D 1W2KT 2P44B 3FQRB 2PW2B 5JIHA 3NPZB 3TT1H 5KJRL 4R7NA 4O5LH 1QRKA 2Y5TA 1ED3A 2IQ9H 3HC4H 3N50A 3F12A 2X41A 2CDFB 1MJ8H 4JFED 2OL3L 3OXSB 4L8SC 1OGAA 1KEGL 3ZTJG 1MFDL 4FG6D 3FQTA 1ORSB 2CR3A 4X80H 2ESVA 1T83C 1IGFL 4MD5B 4RAVA 1YN6B 3KPLB 4AJ0A 5J9PA 5F7FA 3D39A 1ITBB 3FFCE 1TZGH 3DX7A 3VXUD 5FUOL 2IQAA 2DQFA 2V7NB 3GMRB 3MUHL 3U9PH 3C60B 2OQJA 3FJTA 1P1ZA 1EVUA 1D6EB 3V52L 3BKJH 3WFEL 5BV7L 2J6EL 3DVGA 1QHOA 3U2SB 5ENWB 2BHZA 3DROA 1S7SA 2HLAA 3WIHH 5EOQH 4WGVB 1YEFH 4NN6B 3RGVC 3GSNL 1WC7B 4EUPG 2D03H 4YFLI 3UJIH 1HH6B 5GQBA 3F7PC 1V3MA 3K4AA 5L9DH 1F11A 3IDJA 3IAPA 2N7BA 4Z9KB 4OZIF 1U92B 1PFCA 3E2HC 5JPMA 3SHSA 1UWXH 3IXTA 3U7YH 4P46C 3S97C 2XACC 2CO6B 2XQYK 5CBAA 5GGQH 1SEBA 3L7EA 2XPGB 3C60D 2CO7B 1CR9H 3TNMB 4PJIE 4OLZL 2XNAA 5EBMA 4HT1H 4MNHA 1C5BH 1MAML 3DUHA 4ZD3H 1G7MB 3G9AB 1A7PH 1M05A 1KTDA 4DZBA 2WLZA 3QIBB 5E9DE 3WKNA 1T22A 2VXTH 4X99A 5D8JL 5IIEA 4LRNL 4BFEA 4FXGB 5D7JA 5B39A 4BUHA 4NOFA 1CU4H 3DWTA 3L3GB 2K7PA 3WFHB 5GGVL 2WNGA 4L1DA 4ORGA 1UCTA 4KRPB 1S9WA 1TZHB 3MNWA 3MODL 4GKNA 4L8BA 4I2XE 4H88H 4PB0H 5FCUH 1MRDL 5J89A 1MCNA 1GJIA 5FCSH 3SY0A 1H0DB 4DGVH 5IR1B 5IVXB 1RZKH 4AEFA 3WYRA 4JRXA 4IRSA 3TO2A 5BXFA 3VFGL 2W59A 1LO0H 4WV1A 1LK2B 5ETUA 4N8VG 3P4NA 5DLML 3DETC 5I73B 5IQ7L 5F97E 3LDBC 2BRRL 4UT9H 1JBJA 3BYTA 3VXRE 2X4PB 3MRRB 5T1LA 5ID0A 1U8NB 5L2KA 4LSTL 3BDYH 1V7MH 2AV1B 4JFZL 3SDAC 4HIIB 3B5HA 3JSSA 3W0WB 4P4KA 4NP4H 3THML 2ADGB 3U9UB 1A7QH 4HC1L 4LIQL 4I9WE 4PGCA 3LKNA 2CDEB 2X4UB 2Q86B 3F8UB 1XCQA 3GSVA 1N6QL 4M48L 1SM3L 2AERT 3TO4A 1RI8A 1AIFA 5SX5K 2CDGB 2FBJH 1ACYL 3D25A 2YSSB 3BPCA 4PY7B 1T21A 4NZDA 2QJDA 5ILTL 3ULSA 5JZ7D 4AG4H 2VMFA 1NCUA 3GSXB 1N64H 1FZMA 4KPHL 1FGVL 4HK0A 3CNKA 1MOEA 4L3CA 4EN3B 4S1RL 5M7QA 1UCBL 3W0WD 4PV8A 1S7QA 5I1CH 4P9ML 2ATKA 1MFCH 5KANI 1YA5A 1T6VN 2B1AL 4XPBH 5KOVC 1N5YL 5EH1A 5F6HI 3FT2A 4HUKB 5D1XB 4HPOL 2C4FU 4F80A 3V6FA 1YY9C 4D8PB 4JANA 3O0RL 4HMDA 1IGTA 1J05B 1IAOA 5ECJE 4WNQA 4JJ5A 5IW6A 1NAMH 2Y5EA 1H3XA 4L5FH 1SY6A 5SWSA 3VG9C 4F15C 5MENB 1INQA 2DQTL 4ZFOL 4NO3A 1G7JB 5F89A 3CMOL 4HZLA 3PWPA 3L3DA 4I0PD 3ZKMD 2GW5A 3BAEL 2VQ1B 5CP7B 2X9YA 2EC9T 3S5LA 5JO5B 2P24A 4LCWA 4EN3D 2G60H 3TNNB 1KIPA 4ZFGH 4HKXB 4YHIB 5GRXG 3QQ9C 3IKKA 4S1DD 3QEQA 5DD5L 1WFOA 2WWMD 4M00A 5KAQF 4Y19E 1HH9A 5ALCL 1G7PA 5DZLA 2FHCA 2XWBA 3G5ZA 2A6JB 2V17H 4AEHL 2BSSA 2A77H 4DTGL 1DVFA 1HKFA 4BH7A 3O3BA 1IKNC 1MIMH 3S3SA 4GJTB 3WFDL 5JPNA 4JQVA 1FLRH 4L9DA 2OI9C 4JO2L 4Y5XA 3GMMA 1F3JB 5E8DH 5MEND 2GFBA 2VO5A 5CZKA 1FZJB 3H3BC 4KU1A 1JV5B 3VXME 4NQXA 5D6CA 2HT3C 1IT9L 1NGZA 2HKFL 4OFKA 4YX2L 4WW1B 3B5TA 4Y5YA 1CT8A 3QJHB 4XP1H 1K3IA 4UUJB 3I3BA 4CVZA 5L6YL 1HXYB 1Y0LB 5E6IC 2CUMA 3TJEH 1JGVL 1HXMA 1KCRL 4G7YL 2ENSA 3DSFH 5B38A 2NXYB 4XP6L 1TQCB 3BDXA 1RUML 1IARB 4JLRA 5AD0B 3MGOA 4Z95L 4AM0B 4CJ0A 4P49A 4ZUUA 1QSFE 4YDKH 3NCEB 5FHAL 3C5SA 2EDBA 2YA2A 3IDGB 3DBXA 3LKQB 4OCYL 5HHOA 3W82A 2XTLA 1EEYA 4FZEH 1CLYH 1QNZH 5LG1A 2H3NB 2J8OA 5DHVA 2JJUA 5LBSH 3G5YB 3ZTNL 32C2A 4KQ4H 3IVKA 3QDHA 2I9TB 1IMHC 1RVFH 1HOCB 5F7YC 5GHWL 5LCVL 2L7UA 3RUGE 4Z7VE 1CE1H 5KS9E 1YJDL 2V5RA 4N1EA 5KG9B 4NQSA 5LGHH 4J6RH 3BWUC 2KUTA 5K9OA 2BNQA 5GZOC 1W72B 1UJ3A 1AGEB 4C83A 1TJGH 3U30B 4GLRI 4ZOBA 3DX6B 2HWZH 3H9SB 1B3JA 1XR9B 3AREB 3FQXA 1T1WB 4Z7WE 3IDUA 5AZEH 4J3XA 3PNWA 2JCCE 3UX9B 2BFVL 2HLFD 3V4PL 1GCFA 4AIZA 1E4WH 5TDPB 5I71B 1H9VA 1KJVA 4KK5D 1LO4L 4M7LT 4GG6A 1C5DB 3FO0L 4PJDF 2X4SB 4P3CL 4CU6A 1R5VB 1J5OH 5IG7B 3FRPG 1KV3A 4ODVL 1B0RA 4JN1H 1JPGA 4R7DA 2FX7H 1QFWH 1R3JB 1YEIL 3U7WL 3V2AR 4PJAE 2LTQB 3SCMA 5MEQA 4FQXB 4OT1H 5CEYA 3BMWA 1PSKH 3EYQD 3RWHA 3WUWA 4F8TA 4V1DA 5IVZB 3ARED 5C0GB 4UAOC 1JGEA 2WQRA 5MHSD 3VFTA 1KPUB 1HI6B 4MCYA 3QAZC 1GGCL 2X44D 3WS3A 5E8EB 1BFOB 4LEXH 4NZRL 4OLXH 5CUSL 4HIXH 5INCB 3HZKB 1MVUA 3GRWA 3V0VA 1PLGL 1R5WB 1LGVA 4NZUL 3B83A 1IL1B 4U1LB 3CC5A 1CXFA 5IBLD 2N1KA 3MRQA 4NQCE 2QSTA 3D48R 4ZS7L 3WNLA 5TQ0H 4PJ7F 3HE6B 1HHGB 1TVBA 4G6ML 3PXJA 5SWZE 4CADB 4D0DB 4G6FB 4LPXA 5EFIA 2R4RL 5FK9B 5IMOA 2Z31A 2ICEA 3BEWB 5SV4A 1XZ0B 1N26A 4FQXD 4KK8D 1DBJH 3HE7A 2XKUA 4G7VH 3BEVB 3QUKA 1I8IA 5GS0L 4WWID 1A7RH 2MWCA 1C7SA 3F65A 3QG7H 4YXLL 2XQBL 3Q5OA 1CD1B 5FM5O 2FB4H 5DRNB 3V6ZA 4OM0L 4PG9B 3A6BL 1WUNT 3S36L 3VGHA 4OF6A 3TYFA 5B8CA 4AQOA 4HWZA 1J8HA 1WWCA 3FRUB 2QSCH 2R2HA 1SEQH 1IGMH 5I15L 3MXVH 3HE6D 1UZ8B 3M8OH 4G6FD 5C0EB 5IJVA 3DO7B 4OZHF 2V5SA 2N56A 5E56A 4WEUD 3EHBD 4LFHD 5D96C 3VFMB 1ADQA 5I66A 3QIWA 3BSZH 1B2WL 1ZK9A 5DJ6A 4DCQB 2VR9A 4LCCB 1QR1A 2VJXA 2DQDL 2CKBH 4P59L 5HHXL 1U95B 1RURH 5IV2A 1R5IA 4ZTOH 2FSEB 2W0KA 2UY7A 2VDNL 3WLWD 5HGBB 5EN2B 4ZSOB 5FO8A 1QBML 3TBSA 3S98A 2DRUA 3FT3A 3JTTB 4NCC2 4L9LA 3NA9H 4DFHA 1QRNA 1I9RH 2MQ0A 3DMMA 3IETB 4Y4FB 2ADFL 1U8QA 2VISA 1V7NL 2HJFA 4GS7B 3VRJB 5I1GH 5LWYL 1KN2L 5GSVA 4EEEA 1WAAA 1V3JA 2NNAA 3QJFA 5A2IH 3MRMB 5H2BA 4BZ1H 1V5JA 2ZOKA 2B2XL 3IGAB 4YGAB 5FM5M 4JREC 1OAQL 2KQNA 5BRZA 3KHQA 3EOYG 1DL7H 4LGPB 4OCWH 4YDJA 4IRZH 3FAXA 3PDOB 4WI7A 1KCSL 3ARGB 1EHXA 4YHOH 3KWWB 1KXVC 2H8PB 3ARUA 4XCEB 4XB7A 1YDPA 4RMRA 4GUPA 4ZXBB 2Q8AH 1L9NA 1DQLL 4P2RE 1JI2A 4M6NL 1ES0A 5FYLD 3CSBA 4ODTL 5IOPA 3GKZA 1Z5LA 2I60H 3SDXB 4UI2A 2AI0H 1U8OB 4YHLL 3BPNC 2Y1VA 3RIAK 2ADIA 1A6UH 1QA9A 4DVRL 2BOCB 4BH8A 2NR6D 1KENL 2BY2A 4R0LA 1S5IL 3U0WL 3UTZB 2YD7A 1HILA 4XWOD 5HGAA 5F9JB 5JOPE 1CXKA 1EDQA 2BSRB 5ICXA 4OGZA 3MFGB 4CU7A 1PG7W 2R0LH 3ARVA 3ARGD 1JFQH 4LLQB 4NPYB 5C2BH 5IEKB 3K1DA 2VITA 5EZLA 1L0QA 2HKHH 3WMSA 4Y1AA 1NCAH 5DJ8A 4Z76A 2DAVA 3TYGH 1OP5K 5F1NB 2VWEC 1VFAA 1QKZH 2ITCA 3EOBA 4ZXBD 1MCWW 1A3QA 3MZTA 2NY6C 3HUJB 5IB5A 5CZXC 3BQUA 1CDGA 1OAZH 1HWHB 1HNFA 5IBUB 4GMSH 5CP3A 2DTML 2MHAB 4KJWD 3TA3C 4N9GB 4AZ8A 3MR9B 1QEWA 2X4NA 4JFYB 4HFWA 2F5AH 4X9HA 1YUHB 3HN3A 5J6HB 3NAAL 1KIUA 1MCDA 4D9LH 3QUYB 1UACH 4U7KA 2NY1C 2BVQB 2UZXB 2VXVL 3LRSB 2WUBH 3PQYA 4HPYL 3QXWA 4YUEL 1JNHA 2B1HL 3BUTA 1X4XA 2D7NA 4D2NA 5I1HH 1G7HA 1VEOA 3OWEA 3VFWA 2FX9L 1NGXB 4NT6A 3SE4A 3WD5H 4UIKH 2VE6A 4JFFB 3HNSL 3W39A 4HXBL 4XNXH 5C07A 5EO1A 2P8MA 1U8LB 1C1EL 1H3TA 5SX4H 2Y07H 1CBVH 4ODHH 1JGLL 2Y7QB 5IUSA 4XC3H 2BVOB 1A1MB 1ZEAL 3U79A 3C5JA 5J13B 1D9KA 4YHML 3TCLB 4U1HB 4EUPA 3FT4B 2IALB 2VB5A 4TSAH 4QGYA 5MENE 3QUYD 2HRPL 1UB6A 3IF1B 4O2FB 3U4BH 5C6TH 4YHKH 5F3HB 4OTXH 1JNNL 4GQ9H 5HI4C 2VN4A 1Q9OB 1I7UB 1XGTB 4KK6C 1NLBL 3KPMB 2DB8A 2I5YL 3MRBA 1GHFH 5EIVA 3VJ6A 2P5EA 4JFFD 4PUBL 3HCVB 3FB7B 1ZLUK 4U7SA 3HNTH 1A6WH 1KJ3L 4FQQB 4YO0B 1WAAF 3H3PL 2BHUA 3E6HA 1DQJB 5DJDA 5KSAA 5DFWH 1Z0MA 1MF2H 4X0KB 5DJ2A 4H1LB 4LPCA 3VGBA 4X5WA 1IC5H 1SY6L 3QIUA 4XHQA 2N7AA 1BBJA 3QI9B 2CXGA 1K4DA 3E6FA 3I02B 4XRCB 3WIHA 5HVFB 1A6PA 4WCYL 2EYTB 3C8HA 3NIDE 4QT5A 4XBPB 1Q1JL 2VXQH 4NHUA 2UV3A 5FYJE 1DDHA 1IC7H 5IMMB 1FC1A 2BY0A 4JFHE 4OIIL 3SDCA 2YC1B 1S7WA 4HIJB 4PGBB 2BNRB 3GHEL 5IFHH 3ARFD 3CLFL 3NFSL 4NRZB 3WLBB 4G6AD 1CFVL 3BX7C 4X7TB 1T0NB 4RFNC 4N0UB 1G7IA 4JB9H 4DKDC 2X1QA 3OKDB 4JG1H 5A16B 3MJ7A 2GHWB 1ZVSA 4R2GD 1JCKA 4O58L 4QRPD 5DSCA 4APQB 4BK4A 1U42A 3QI9D 1OPGL 2BVTA 5FUZL 4RA3A 1ND0B 3U1SH 2A83B 4LF3B 1HSAB 5E0QA 4BJLA 1TCRB 3KPRA 3MLZH 1NBZA 4FTVD 5GRUH 4K8RD 5DF0A 3KPNA 5DA0B 4KI5E 2BNRD 4QRTB 2W1NA 5CJBA 5D5MA 5CCKH 2JKXA 4UDUA 2WBJA 3D0LB 3K4ZA 1OTSD 1CDYA 2A9NH 3VU2A 4QHNB 5E8OA 1CL7H 3GI8L 1KIRA 2E27H 2RBLA 1I1CA 1IRAY 4U1SB 4U05A 1B0GA 1GPOL 2QKIB 3H9SE 2GJ6B 3VFOA 5MHSE 4IS6A 4LSRL 2DF3A 4APQD 3AXLB 3WNKA 3TBYA 1X5IA 4NBYB 2FR4B 1E6OL 4UT6H 5DUBB 5MERA 3NN8A 2HP4A 3V6OA 3ARBB 1MI5A 2IPTL 3R4DA 4PJCB 4D9QE 5DMIL 5F71A 3TIEA 4LSPH 2ZJSL 3MRGB 5DI8B 2FD6L 2EDQA 4KV5F 1B4JH 1FNGA 2FHBA 4E0RA 3SKMB 1GZQB 4OD2B 4M9PA 3QCTL 3MA7B 4AT6A 3SDYL 1CIDA 5CEZL 1A1OA 2AV7A 4FFYL 3TZVC 3UPAA 4ZFZB 4FQ1L 1ODAA 3FZUC 3GJEA 4LLUA 2ITDA 3AFLA 1CQYA 4H5SB 3RY5A 1XIWB 4ISVB 1XFPA 3P9MA 3N9GH 4O4YH 2GIYA 1ZA3A 2JF1A 4QOKB 3X11A 4NWTL 4IRJC 1GYAA 3G04B 3Q6GH 2VABA 3FO2B 3UXFA 3VCLA 3VRIB 5KSBF 3ARBD 3LIZH 4LRIA 4OZGA 3IDXH 4NQEE 4Z5RA 2KDGA 5IW1B 4WJ5A 3WFBL 2FJHB 2OR9L 5EZJB 5JHDA 5E2JA 5EOTA 1I3RA 2OX5A 3CX5K 4RAUB 2AQ1A 3L3HA 1UM6L 3UBXG 3M07A 1AE6L 3T77B 1YY8B 3H7BB 4XCYB 3BUYB 4TSCL 4GAJL 2V2XB 5K9QG 2WZPD 4K3GA 1XEDA 2Q8BL 1BF8A 4JEGB 1KTKE 4NKIH 2YEZA 5TE6H 1YEDA 4HS3B 1DEDA 2APWA 4NN5B 1L7TL 3PL6A 5D7LB 1WWWX 3MLRH 1BEYL 3UYOD 1ZTXL 5I9QC 4W4OC 5D2LF 3GRWL 4KVNL 1UM4H 1CK0H 1NAMA 1WCBA 3FFCA 1A1NA 4KKAC 3QWOB 4JO3L 5IB2A 4HUVB 2H9GA 4MXQD 4P5TC 4J3WA 5EU5B 2A1WH 3EGSA 2HT4D 1IQWH 4NCC1 5DQ9B 1A47A 5F72S 1QR4A 1T7YA 4CNIB 2JK5B 4M1CD 4PLJD 4ZOAA 1OAUH 2YXFA 4PJ8C 4OJFL 4JQXC 4P3DB 4DN3H 4OAWB 3LKPA 3HFML 3T65B 3EYUH 3WDJA 3OKYA 5T5NG 1UQSB 5DHYB 4Q0XL 4QRRD 3GK8L 1XH3A 1Z9LA 4H25B 4GRLB 1UKQA 3RZCC 2X9WA 1T2QL 3OKKB 1T1XA 4ZPVB 1FE8L 2O26U 1RJLA 3LQAC 5D7LD 4ZNCD 1EFXA 2EDKA 2YXMA 4PJEE 4JHAL 5ID1A 1WT5C 1I9EA