2A77L

Anti-cocaine antibody 7.5.21, crystal form ii
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
216
structure length
214
Chain Sequence
DVLMTQSPLSLPVSLGDQASISCRCSQSIVKSNGHTYLEWYLQKPGKSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLRISRVEAEDLGVYYCFQGSHIPWTFGGGTKLESKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Flexibility of Packing: Four Crystal Forms of an Anti-Cocaine Antibody 7.5.21
rcsb
molecule tags Immune system
molecule keywords Immunoglobulin Light Chain
total genus 49
structure length 214
sequence length 216
ec nomenclature
pdb deposition date 2005-07-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a77L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a77L01
1EEYB 4POZC 1IMHC 5EDXA 1G84A 3JWDL 3V4VL 1QLFB 1MCHA 4XC1H 4KC3B 5DXWA 4NQEB 4K94C 4HF5H 1YY9D 2BVYA 3WHXA 4YDKL 1FDLL 3TYFA 4RGMB 1CF8H 2X4RA 4MDIB 3HB3D 3MGTA 1EO8L 4IMLA 5C0AA 3TBSA 2DLFH 1U3ZA 1CS6A 1IT9L 3MMEA 1Q38A 5GGTH 5GXBB 4EI5D 1T1YA 5DMGD 2YPLD 4RMWA 2Q3ZA 2DIJA 4G6FB 4PJBB 3SCMD 4PGBA 3P30H 4KHTH 1DUYA 4L1HA 3CD4A 3MRLB 3L6FB 1I8LA 1XEDA 5FCUH 4KFZC 3SGKA 2HG5B 3GJFA 3JTSA 5E95B 3LZFL 4MMXC 4XI5C 4RMRA 3QQ4A 1I9JH 4UMGA 3UJTH 5FHAH 4G8GB 3DXAA 2R4RH 3G04B 4WDIB 3QUKB 3ROOA 1SJVA 3UBXI 1EAPB 1U8HA 3EO9H 1QFUH 3GZKA 3FB8A 4NBZB 1LEGA 2VDKL 3VXPB 1ZHLA 5DJZB 4OV6F 3HHRB 1QVOB 3F7QA 4HWZB 4U3XA 1F00I 1EHLH 4EN3C 2IGFL 1JWMA 2IAMB 2YEZA 4LKCA 5I71B 5TE4H 3FQTA 5DHXB 3VXNB 4TUKL 3N85L 3SKOB 2DMBA 1JHLH 2AEQL 5EBMA 4U1SB 1ZEAL 4U1HB 5F7KC 2DOCA 3DUSA 1MREL 4FRWA 1YMMB 2JJTC 5DQ9A 4HSQA 1G1CA 1I8KA 3T0BA 5IJVB 2GK2A 5JXEC 3QIUA 3BI9X 2LTQB 3C6LA 4PJBF 2BNUB 1UQSA 3MNWB 3DXAD 3MZTA 3EJYC 4HX1A 3FZUD 4L9DA 1NAKL 2N7BA 1XMWA 4RZCA 2N1KA 4TUOB 5TQ0H 4OZFA 5E94A 4MS8C 2YC1B 4PRDB 4OZHA 4QTIL 3TA3D 4UIMA 5IKCA 3LSOB 4RX4D 3SPVB 4OGYH 4ODXA 4CUCA 4C4KO 1A6AB 4JFFA 2Z91B 5FYJH 4RNRB 4XP9L 1XZ0B 5IROA 4YQXL 4JM4L 2B1AH 2PKDA 5DHVH 4DKEH 3CFEA 4I3SH 3VXNA 1MCPH 4EI5A 1WF5A 1VGEH 3GMPB 4LSVL 3UTZB 2X4RB 5HVHC 3VFUA 3KYMB 2XY1A 3T09A 3IFPB 4L4JA 3P77A 4HUXA 1S5IL 5DLML 3BP6B 5CHNB 3U1SH 4AL8H 1SQ2N 1M05A 3K8KA 3TBSB 5KSBA 1FFOB 5EZIL 3HC4H 1E4WH 1PLGH 1Q94B 1G7JB 4KK8D 4NQCD 4PJHB 4QOKA 1J05B 2X9YA 3DHMA 1PQZA 4NQSA 3JV4A 3O8XD 1JRHL 1NQBA 4L8SC 4Z7NF 4UT7L 4YXKL 4NDMA 3SBWC 1JV5B 1NBZA 4PGZA 4Y5YA 1RHHA 4ACPA 3D2UB 4JQXA 4XNMA 3UO1L 3ROLA 4O2FA 2PCPB 5HYJA 3MRFA 2IADB 3QDMD 3RVWD 3UYRH 2BNQE 2ERJC 5JOFB 1KLUA 4P4KD 3QDHA 3AS0A 3SKNA 1O7SA 4LVOC 1P53A 4RGNC 4YIQA 5F97E 3OR7B 4APQD 4HUWB 4QHNB 1LDSA 4C57C 3MFGB 4WY7H 3TYFB 1KENH 5IB3B 2QTEA 4BH7B 1N4XL 4OI9A 5ECJE 3HE6D 5C70A 3I6KB 1A5FL 4LHUG 3PV7A 5BJTB 1KYOK 2ZCHL 4FFZL 2DIAA 3BT2H 4NQUA 5MP6H 1B6UA 2WIIB 3QXDB 3U0PA 2HJFA 1ONQB 3WN5C 4ZUWA 2DQEH 5T1MB 4P2OA 3CX5K 4WO4A 3MLPA 3QEQE 4WJ5B 3WE6A 1OHQA 1J8KA 4ODTL 4XNMB 3BESR 2JK5B 5F93C 2NMSA 4J4PD 5SWZD 4JFED 3PWNA 4JHBA 1P7QB 4MXQC 4WV1A 3PGFH 1T03H 1A6ZA 1X5AA 4ZUSB 1BFOA 1MF2L 3IJHB 2OR9H 5I16B 1YQVL 2GUOA 4UUJB 1M6OB 4P9HL 2BVOB 4HJJL 3ZKMD 4L8CB 4C56E 3D0LA 3NCYP 1RK1A 3QAZC 4YHIB 3MUHL 3OJDB 1TPXB 3VI4E 3S96A 5TDPB 2LE9A 3FONA 4BM7A 4NPYB 2NPLX 4PJDB 3WJLA 1R5VB 3CFEB 4I2XB 1JGEA 4MHHG 5IV2A 3F7YA 3T0EA 3MXVH 3U4EB 2ZNXA 5F1SA 3EOBA 1MJ7L 4HFWA 2Z92A 1MREH 1HXMA 4JN2A 4OZHB 1LGVA 4Y4KA 3VGDA 5T3ZD 2KZ1B 1Z3GL 1FN4B 2ICEB 1IGFL 1E4XL 5JPMA 2FX7L 2PXYA 3VXUD 1QFPA 2W07A 3LRSA 1K5NA 2PUQT 1P1ZA 3OAUL 5KVDH 1YNLH 5EZLB 1H9VA 2EXWD 4FQXC 1KIQB 4X80H 1GGIL 5DR5L 2WBKA 1GYAA 3BWUC 2CDFA 1LHZA 3OKNA 2Z31D 3DMMD 5IMKA 2B5IB 3GMRB 2VR4A 1G9MC 2YPKA 3MA7B 4KQ4L 3GRWH 1RZ8A 2JB5H 3ZDZF 5C0BE 5DK0B 4NKOB 1KPVB 1U2CA 2BFVL 2R9HC 4XVSL 3VXMB 3V7MA 3FN9A 5F7MC 2BRRH 5DD3L 3HCVB 1CR9H 3T4AB 1WAAE 1MY7A 4X6EA 2HFEA 4N0UB 2DM4A 5E99L 3O9WB 1YEJH 2J8UA 5CLWA 4K3EL 5AYQA 1PD6A 2AXHA 1V7ML 2HLAB 1OLLA 4MD4B 2SEBA 3VA2C 4AM0B 1SVCP 5BRZA 2OR7A 2ZUTA 5I18L 4JPVL 2EH7H 4AG4L 5KSVA 4NRZB 4U6XB 1CZ8L 1RV6X 4M6MH 4PJEE 4Q7DA 1I3RB 3IFOA 4PP2B 1FNEB 2P5EA 4OLVL 4JJ5A 1A1NB 4ONGH 4CL7A 3L3DB 3RZCC 1KN4H 1UZ6F 4H20H 5B38A 1CFQA 5CBEA 3NIGE 3RGVD 5DTFB 3KPNB 1F58H 3RHWK 4EDXB 1CVRA 1YECL 4ZXBC 3C2AL 5K59F 1S9WB 2F5AL 4GG8B 2D7PA 3HPJB 4LCIH 4R26L 4BH8B 1KJ3H 4JJHA 4P2RA 3WIHH 5EA0L 2DLTA 5ACLA 3MFFB 4KXZH 4M5ZH 3MRDB 4MDJA 4AH2B 2VZOA 2Q87A 4QRUA 2APTA 3RBGA 3D6GA 3BQUC 1J9CT 2CUMA 3QUXB 4X4XA 2F5BL 4CU7A 2RFXA 4QOKE 2YD6A 1KIPB 1MCSA 2FX8H 4LDOB 4LLVB 1T0MB 3UP1A 3MRCA 1Y6MR 4GBXA 3O2DL 3PL6A 4MNGE 3ARXA 1CGUA 1NMBL 3BKJH 3BEWB 4DVBB 3VE0A 5T1LA 4JPWL 4TQEL 5F6IC 2JJTA 4WNQB 3NTCL 3FO9B 5D7LD 1MH5B 3WL9B 4HZLA 4CW1B 1CDIA 3KS0J 4PFEA 2K7PA 4BZ2L 3BIBX 3S35L 2P42B 1X4XA 1YNTA 1MCJA 1T0NB 3NFSH 4CNIA 3LKNB 1MCEA 2HP4A 3NA4A 1X5KA 4KQ3L 4XNQB 3T65A 4YR6B 1CVSC 4HKBA 3DUUB 3PP4H 4JM2A 3MTRA 1TCMA 1VFBA 1Z5LB 3DWTA 1VDGA 3I85A 5EU4B 3VXQA 2VZ1A 1FO0H 3L9RA 1NL0H 1GCFA 1QEWB 1WBYA 4GMSL 2A2QT 1EEYA 5CZXD 5GS2D 2KUTA 1P4LA 2P8LB 2NY7L 1AQDB 4MNHB 1J87A 4LLVA 3VFGH 2EDJA 3KLSA 3GNML 1FVCB 1BBJA 3INUL 5J1AA 3TBTB 2ICWI 3KVQA 5MEOA 2YK1L 4LPYA 4YE4L 3HG1B 4J3OC 5DO2C 2J8UE 5B3JE 3FTGB 3CAFA 2M2DA 1N0LA 3O81A 5KSAC 5GS0C 4JLRA 3WYRA 1R3IH 2HFGH 3TP4A 1MIML 1YMMA 2CO6B 4KK5C 3B2VH 1GZPA 3MBED 4KKNA 1GSMA 4LP4A 4HUMB 2PXYD 4ZMAT 4PV8B 3B6SA 3GDBA 3GBMH 1OWRM 5D1QA 1K2DA 5L2KD 4CDGC 4WUUB 4G8EA 3V6OC 2R4SH 4CU8A 4W68A 5F1OB 1FH5L 5DWUH 2KL6A 4JHZA 3WLBB 3UXFA 1N6QH 3VGAC 3HUJF 4LLDB 3L1OH 3NZHL 4XNZC 2EIZB 5K9QI 2BRRL 3PL6C 5DD3H 5MHSD 3D0VA 3U0WH 2QQLH 1QSVA 1QA9B 1X5ZA 4BELD 1F4WH 3WIFB 1FE8H 4DGIH 3JZ7A 5DUBB 1C08A 4HK3N 4PJFB 5INDB 3I02A 2XZAH 3VGEA 4M3JA 4YBQD 3JXAA 1JWUA 25C8L 2ZOKA 3W0WE 4Y5XB 4XT1C 4OQTL 4PRPB 5DZNA 1NC2B 3TN0A 3EOAB 4XHJD 5E5UB 5B3JF 5CJXA 3PGDB 4PP1D 1MAMH 2DI9A 3CJJA 4TSBH 1L4IA 3EDDA 2QQQA 4KY1L 2NY2B 4BFGA 1T22A 3SJVE 2ZNWA 2H2PC 2IPUK 4NQXA 5L7XL 5ADPH 2DWEA 3LHPH 1NGZB 5I6XB 2BNRD 5FF6A 1FL5B 3QQ3B 5DVLA 1PG7L 5I75C 3UTSA 3QXTA 4XX1G 1BIIA 4G9FB 4HS8L 3RGVA 4PYGA 4ZG1A 15C8H 5HYSB 5D71L 1A7QH 4PRHA 3ULUL 5K9JL 5DJ0B 4PJXB 3Q1SH 4R2GC 2WAHA 1CL7L 3TBYB 3PP3K 1U8HB 4O4YL 2XOTA 3B43A 4M1GL 2WNGA 5I2IB 1WVZA 2P8LA 5HHNA 1WC7A 3MBXL 3U7YL 1EFXB 3VXRA 4D94A 2Y7QA 3GMPA 3QDMB 1XGTB 2OMBA 3C5ZC 1F6AA 1LO0H 4I2XA 3H9ZA 4AK1A 3H8NA 3PABA 2XTJD 3CVHH 1AXIB 1VFBB 3O3EB 1UACH 2H9GB 1MPAH 2LABA 3CX5J 1G9EA 3NTCH 4JY4A 4CKVX 1AHWB 4P5TA 4W4OA 3T1FB 1EHXA 1NBVH 1P4IH 5EUOB 3QXVA 1HE7A 2EDRA 2VLME 3D48R 4JFFB 4YUEH 2D0FA 3JTTB 4JDVA 1YC7A 3HNTH 3IDNA 3ZDXE 2ZCKL 1JGDB 3MRKA 4ZFOB 3IDNB 1WUNT 1FLRL 5D70L 1JFQL 1XGQB 4F33A 2FJGA 3OAZH 1JNNH 4HGKC 5IB5B 4OZIB 1BOYA 5AD0A 4ODSH 2H2SD 1DANU 4LSDA 5DJ0A 4PRBB 2G75A 1A6ZB 1D9KA 1KG0B 3PE9A 1KLUB 1MJUH 5JZ7D 3GSXA 5BS0E 2AS5M 3IDYB 4DFHA 3WNLA 1PX4A 1OF2B 1ITCA 2Y5TA 4WO4B 5IVXE 4NO5B 5E8OB 1OT2A 1FCCA 1NBZB 4YDJB 4M7LL 4PUBH 2GJ6B 3EFFB 4ZPVB 3ELAT 3T2NH 1SBBA 4ZPTA 3MLWH 3L7EA 4MA3A 3PHQB 5IHLB 5BJTA 3V0WL 1T0PB 3T0DA 3ET9F 3WD5L 1U92A 5HI5C 2WP3T 3CVIH 4WI2A 4N8VG 3NH7H 1RZJH 3H0TA 3F6IA 3FT2A 4HPYH 4OSUH 5HDLA 1WQVT 3RWJA 1B4JH 4FMFA 4JG0H 1H5BA 4PPTA 3H9SA 4Q2ZB 4GRLA 4M00A 4OIBA 3IDYC 1RIVL 2E7MA 3WIFA 2ITDB 2ENSA 1FGNL 4KK6C 4HEME 5IHUH 1RUPH 1K6QH 2Y07H 1DUYB 5FM8A 2FBJL 1R6VA 1R5WA 1G7LB 2CRYA 3F7RA 2CR6A 4OUUA 4BKLA 3GIZL 3HLAB 2KKQA 5SX4I 2X4UB 3OHXB 4NO0D 4JRYD 4N0UE 3IDMA 5IVZB 3MLZH 2P24B 5H8DA 3VXMA 2FB4H 3ULVC 1DN0A 4Z8FL 1KBGH 4H88L 4XTRC 5FA3A 4UDUA 3DX6A 1TJHL 1NGPL 1FSKC 5EWIL 3R1GL 5HYSA 3CXHJ 3GSVB 3MLUH 2OZ4A 4RFEB 3I6LE 5KN5B 3KDMA 1T22B 1KB9K 1MY5A 5EBWA 2C7UB 2UV3A 1CE1H 2UZXB 3TJHC 4W6XB 5JHDB 3SDCA 4BA8A 3PHOB 1ORSA 2HFFA 1UKQA 4O00A 5CZVH 1AE6L 1QRNE 4JEGB 4NC0B 3O3BA 3ULUC 1IEHA 3MGOB 1FN4A 2XI9A 1RZGA 4YK4C 4OFVA 3CXDL 4BQ8A 1A4KA 4KKLD 1IGIH 4DKFH 4G5ZH 1XGUB 1PFCA 3LDBB 3U4AA 3ZO0A 1LEIB 2A83B 3QUYC 4LFHG 5F9JA 1RK0A 3DV4A 2HRPL 5JA9A 4R4BB 3O6ML 5D72L 1KXQE 1VFAB 4GRLC 4P2CG 2VLKE 4WUKH 3O9WC 1MRCH 3LKPA 4ESKA 1NCBL 1U8NA 5FM5O 3IU3A 3MV7E 5IFHH 5ENWB 2EZ0D 1CFTA 2ATPB 2P8PB 5C09D 3U30B 2DMKA 3T4YB 5ALBH 1U8KA 2D7MA 5FDWB 3WBDA 4UQ3B 1BD2A 4F7TA 5HHME 3PNWA 1F4HA 4J23A 3LH2H 3UTSE 2O5XL 2ZUQB 3S4SA 4TOYL 5DT1L 3ZE1E 4NNPH 5BS0D 4LVOB 4NT6A 3SDAA 5IHZA 1ZVSB 4F7EA 4LKXA 3QT2A 4XPBL 4NQEE 1C5DA 1E4KC 3GJEA 3W2DH 3QHTC 4XPAL 1KTRL 4Y2DB 5FO7B 2BSRA 3O3DB 5DUMH 4RQQB 2F54D 5E70A 2C4FU 2YPLA 3H3BC 5C0CE 4WTWA 4PGCA 4XP5H 3T04D 3WJJA 3L9RB 4P46D 5DD0H 3EDKA 3TC9A 2BSTB 4D0BA 1NJ9A 4HC1A 3TZVC 5IW1B 3BN9D 3EFDL 3L3HA 3VJ6B 5T1KA 2R1YA 3U9PH 1HHIA 2JCCB 1G7HB 1MHHB 1QYGH 3O4LE 3U6RB 2BSSB 4UOW0 1NLDL 1QFOA 2WBJC 1FAIL 5ICZA 4KJQC 3IDXH 5C2BH 5LWYH 2XV6B 3P0YH 2VKXA 3MZGB 3W39B 4PR5A 2FGWH 1OOAA 2AJZA 5DZOA 4BSWB 4HZLB 2EDBA 3G6DH 4F2MB 4LEOA 4TSAL 4WUUE 4RFNB 1VESA 3SDCB 4TTDC 3KLHC 2ICES 4LEOB 2GCYB 5I1JH 2R23A 4RMSA 1KN2H 3HI1A 3X11A 3S88L 4KRPC 4FHBD 2JIXD 5T1MA 2DQCL 3QQ9D 5KAQF 3U82B 3T3PE 2DBJA 4TRPH 1TZGH 3RIFK 1EHAA 3SDXE 1JI1A 1J0IA 2NTFA 3VI3E 2B2XH 3FL7A 1TTUA 4PJFE 1DUZA 3BUYA 5DHVA 1RMFH 2BXZA 5FYKE 1TZIA 5JPNA 5KVFH 3EOTL 3L3IA 1ES0A 1INQB 2AEWA 2EH8L 2WWMD 2I07B 4ZSOE 3CFIC 3GMRA 1QTYT 4KI5F 1TITA 1BJ1J 1ZE3C 2GI7A 4KJYB 2JCCE 3RWDB 4M9PA 4BK4A 3HZMB 4OF0A 1TNNA 4J3XA 1I8IB 3MRJB 4ZYKA 3I9GL 2R2HB 3L5WA 4NN7C 5GRVK 2Z4QA 3WS3B 1K5NB 1KPUB 3P4LA 3CK0L 3QIUC 1HH9B 3AUVA 4PBVC 5F6IB 1AR2A 1K9TA 4L5FH 1J1OH 3MUY1 3MV9E 3GSOA 5ANMA 2ATPA 2CLRB 2P8PA 1HWGB 4I4WA 4MD0B 1DUZB 4POZD 2BOCB 4ODHH 3V6ZA 3VXTB 3LRGA 3I6GB 2DRUA 4XP1L 1MRDH 3GSRB 4GW1A 2FX9L 3TT3H 2YPKB 2L7JA 4OZGB 5DURD 1MIMH 3MV8B 5D7LE 2IEPA 4H5SB 2R0KH 1G6RL 5F7EL 2V5RA 5FUZH 1WITA 1NUNB 5EBLB 1ZVHA 2NY3C 1QR1B 5ICZB 4UT9L 4HT1L 3P73A 1FL3B 1R3KB 4P3DB 4R7NA 3MRGB 2VXUL 2FEDD 4QXTA 4Z77B 1S9XB 2DKSA 1FFNA 1AH1A 2CIKB 2YD7A 4RGMC 1E4KA 2FL5A 1LE5A 2DQDH 4MGXA 4ELMB 5E6IA 4HH8A 4L1DA 4L8BA 4P2OB 4AEFA 5MEPA 2Q8AL 3GM0A 1N7ML 4PTTB 8CGTA 2ORBH 4N1HB 2XTJB 2Z35B 4RAVB 4UB0H 1NGQH 2EEAA 2X4NB 2KBGA 2YXFA 4M02A 2NZIA 4CMHC 1P4BH 4OLZH 3WFHB 4IMLB 5LCVL 2UZIL 4PJCB 5BO1L 2O5ZH 3E0GA 1WIUA 5ISZB 5FYJU 4HKXA 3SCMA 3S8WA 3RVXD 3MRIB 5HI3D 4WFHE 1U3YA 4L4TA 5JW3H 5IMLA 3CC5B 5DEFB 4G8GD 4WRLA 2YD2A 1RK1B 1DQMH 1LO4L 4NQDA 1KCSH 4DN3L 4KY1H 1KTKE 3F58H 3KLDA 4HH9B 1S9VB 3V5HB 1FL3A 1R3KA 4P3DA 1B9ZA 1YQVH 3VWKC 1AXSA 3QFJD 1HIML 3P0VL 2EDWA 4G6MH 1D5XA 4MAUL 4S1QH 3LV3A 3RTQA 4NQCA 4QOKD 5EIIA 3I84A 4M61B 2V7HB 3G9AB 5IMMA 3ARWA 3DGGA 2X89A 5E6IB 4JO3L 1P6AB 4JFOA 4XNUH 1WLHA 1OAUH 1LP9E 2OJZH 2R29L 4BFIA 4UOJA 2IANE 3ZSSA 4K7PH 5CS7A 3ZTNH 5TF0A 2CK0H 4I18A 1T7YA 1X7QB 2Y5TB 1MI5A 2PYEB 5MEND 4TPRH 1NGZA 1T7ZA 2WLZA 5EO9A 3LIZL 4AIOA 4LBEB 2VXSL 4F9LA 5GS0H 4PJXF 1OL0A 4UDTB 3K81A 4CJ1A 1D9KB 4GRMB 4FXLA 4O51B 5DD5H 3S97C 1MFBL 4LIQE 5E7FA 4HIEA 4JHAL 5KG9B 4ZXBA 1W72A 3O11B 3EJZC 4R4NC 3V8CA 2PXYB 1F4AA 5C0EA 3BWAA 4HJGA 4X99B 1HK6A 1WT5A 5B39B 3MRJA 5E2JA 2IH1A 5LGJB 4I0PA 4FQLH 4QWWD 2P5WB 4H5SA 3RUGE 5ERWA 3RWHB 5EUOF 3GMLA 4UIMB 4FTVA 5C3TA 3WCYA 5B8CA 1A14H 1E27A 3HUJE 2LU4A 3GSXB 1JN6B 4FQQA 2DD8H 4MJIE 3ULUE 4F3FA 1T21B 3GHBL 4Q6IB 3RAJH 3LEVL 4U0RC 4HULB 2BVOA 4L3EA 1S9YA 3QIBA 3U4BH 4X6DF 3E3QC 3ZT7A 1JRHH 1AHWC 2MMXA 3EGSA 5F1KC 1AI1L 1ZANL 2IAMA 2HN7B 4QHKI 3ZHLA 1PEZA 5DJ6B 3NIDF 4LLUA 4ALAH 5IFJB 4XPGL 1FBIL 2APBA 2HKHH 2UUDK 6FABH 3OGCA 2CGRL 2QSCL 1XF3A 3TZVA 5DJ8B 2XRAH 2APFA 2GT9B 2WSKA 3B3IB 2JJVA 5C0BB 2Q1EA 3IDGB 2HJKB 4K07A 5EU7E 1P2CB 3N50A 4U1GB 4Z95H 3CFCL 4JFZL 4NRXB 1T7VA 1XCTB 4K7FA 1DSFH 2E8YA 3TA3A 3FMGL 4S0TD 4Y1AE 5GGVY 4NM4L 4H26A 2VN4A 4FXKB 4PJEB 1U95B 5F7EH 5HHQB 1GGTA 4W4OC 5FKPB 2ZUXA 4MX7B 1DE4B 2UYLB 1QFWI 5E6IC 4OFPA 5I6XC 3VW3H 3WS6A 4G6JL 1YEGL 1NFKA 4JO1L 4M62L 4KV5E 3QEUA 2C3VA 3RNQA 5T5NF 5DFVC 1NSNL 1QHPA 5BVPH 5IVNA 5HHMB 3RWJB 3WFEH 3I02B 2I9LB 2XG5A 1UM4L 4U1GC 1IGCH 3TZVB 3P4OA 3OAYH 1A7PL 5C3LD 3CNKA 3QSKB 2C3XA 2W0FB 1KTDA 3FZUC 1LEKB 4XNXL 5JQHC 3FOLA 5EFIB 3VFSB 4I0PD 1X3DA 5IESL 3CZJA 1GAFL 1BVKB 3SDDC 4HWBA 3TBVA 1XGYL 1U3HC 1YJDL 4FFYL 2AJYH 4PJ8A 3ZKMC 5J6GB 1UH4A 4NQVB 4MNQA 4OLWH 4YHYB 2FGZA 2VQUA 4Y4HA 5IMMB 3TGXA 4LOUD 5MI0C 4XCNB 2QADC 3BGMA 3ECBB 5HY9B 3TFKD 3ULUF 2H3NA 5HVHB 2X6MA 3SGEH 4NJAL 3P4MB 2ZUQC 4PGEA 1MCIA 3R1GH 2IQ9H 1Y0LB 3WFCL 3SGDI 3QI9C 1C12A 5D6DA 4OF6A 3MRRB 1FFRA 4MA7H 4QYOB 5M94B 1RJLA 3K4DA 3EHBD 3RIAF 2B1HH 4JGJA 5F88B 4PREA 4TUJB 4UV7L 4CMMA 1MQKL 5IHZB 5F8RC 5B4MD 1EK3A 1L7IL 4YX2L 4ZUVB 2F9BT 4TYUA 1A3QA 2VDRL 5D1XA 4HIEB 4QNPF 5C7XL 4P3CL 5F9AC 4HBCH 4YHPA 1M71A 2YPLB 1G7IA 5DLMH 3WNOA 1NDMB 3J7HA 1R3JA 3K7UA 3C5JB 5C08A 1EBAA 3DLQR 1R3JB 2WV3A 4U0QB 2Z31C 3DMMC 3PABB 4FMKA 4PV8A 3ZMRA 5JMOC 4NT6B 4IRJA 3GSNA 2L0DA 2BNQD 2Z8WC 5E8DL 2YUVA 1N2RA 1C5CH 1C5DB 3OF6D 1A3RL 1KB5B 2VL5A 5DRXB 1L7TL 4RGOH 3BQUB 4HWBL 4JQVA 4KKBD 4WO4C 4YDKH 1JI2A 5L6YH 1JWSA 4OFDA 2GSGB 3OKKA 3MCKA 1XGUA 4QYOA 1BD2B 4JGUA 5F71A 5GGRY 4K7FB 2P43B 5ESAA 1F3RB 5DR5H 2L7UA 4BZ1H 1WEJH 3SE3A 5A2IH 1SYSB 2NYYD 2BHZA 5HHOB 4QHMA 1JBJA 5C0BA 3QXUA 5EOCL 3UCRA 4XMKH 5DZLA 2E7LA 1DBJH 2DQJH 3VCLA 3RWCA 3IVKB 4IIQC 3DV6A 1ZGLA 5I30H 1L0YA 2QHRL 2X4TB 2VE6B 2OK0H 1OGAA 4JRYB 5HDQH 2AKRA 4J6RL 4D0DB 2HN7A 5IVZA 3DXAB 5I8KL 5DUML 3VFVA 1TENA 2YSSA 2BERA 4ZAKA 5L2KA 4DVRH 1ORQA 1CFVL 2XIDA 3QWRD 1JHKL 1AJ7H 5AYUH 4XCFH 3PF2A 2HMID 1RUML 1RZKH 3X3GH 3ARBC 5E5MA 3HZYA 3HG1A 1V7NL 2NZ9D 4CGTA 4UIKL 4PJ7E 5FM4A 5DQDL 3WKMH 3EZJB 3U9UA 3MACH 3KG5A 3K3QA 3KDMB 1MFCH 2HA1A 4LLWB 3W9DA 2H1PH 3E6FA 2DQHH 3QCUL 5D2LE 3NPSB 3E6FB 2I5YL 1PZUB 3ME0A 2CRZA 4XP6L 1F11B 2YPLE 4D9RE 2LAGB 3GO1L 5CD5D 2AV1B 1I3RA 3ZE0E 4H1LB 4AQ1B 5C9KA 1M1SA 4Z5RB 4I1NB 3UTQB 5J0BA 3LN4B 5E08L 2P24A 2EDLA 2FWOA 2R1XB 3IRPX 3LN4A 1A9EB 4XNQA 1CXHA 1SEBB 3VFVB 5FYJE 1TLKA 4U6TA 4OJFL 2ZSVA 1S5HB 4UAOC 1OP9A 3UTTD 2PF6A 3EYVB 2AEQH 1KBGL 1T7WA 3AY4C 4H88H 2GK0A 3UAJC 3WNPA 3HS0B 4J1UA 2DBLH 2X9XA 2QBWA 5C0JA 1U3HB 1IC5L 1W8OA 4Q58C 4QY8B 5D7LB 3H9HA 1WBXB 5HJ3A 2KDGA 4JREC 2IC2A 1EJOH 3QEHB 4J12A 3O41A 3V7AE 4A6YA 1NMAL 1MIEL 5SV3A 5BV7B 3GK8H 3L5XL 3QUZC 3PWJA 3IJYA 4KHXL 4PJ8D 3MCLL 4APQB 1MWAH 4O2CA 4WI7A 4WWKC 1YNTB 1K4DA 4EUPG 2CKBA 1KTLB 5KSUB 3RNKB 2P47B 5E2VL 4F58L 1QFWM 3OKLB 4WWID 5C0EB 5JO5A 3K4AA 3LQMA 1LP9F 3DUUA 1ZS8B 2VAJA 3G6AA 3HE7A 5C0IB 1MCPL 3LKNA 3NGBC 4KK9C 4P3CH 5GRXG 1IGYA 5GRYA 5DVNA 4FXGB 5JHLL 3UO1H 5HYJE 3QB7C 2PXYC 3MJ9A 5K9OB 1JIBA 3V6FB 4OZIE 5DD6A 2YPVL 5ESAB 3D85A 3QPQC 3B9KB 3T2NL 3R8QA 4EQ2A 4I9WE 2ARJA 4WGVB 4UINL 3RPIB 2BJML 4PTTA 4NOFA 4M7KL 1MAKA 1SMAA 4EKXA 2WQ8A 2VIRB 5HYEA 4ENEC 4LCWE 3SBWA 3NZ8B 5I1IL 1U41A 3VWJA 2M26A 3VGGA 3OXRB 1T1ZA 4Y4KC 1OWWA 1H3GA 5FUCC 1JGLH 3SDCD 1N5YL 2YUZA 5SWSA 2B0SL 3PIQB 4WHDA 1FPTH 5FXCH 5F9DC 4PJIB 5E99H 5FGCB 2FHCA 3QUYA 5GGQL 1OM3L 5CJ5A 2A6IA 1DL7H 4C59B 4JDTL 3GFUA 2DKMA 4EDWH 4JDZA 4OZIF 4PJGF 4Z7WB 1NUGA 3RUGB 2VLRB 3SCMB 1CG9A 3LSOA 1ADQH 4OLZL 5IR1B 2Q8BL 1MVUA 5CIPB 3DETD 4KVCL 2OP4H 3SQOL 5IB1B 2N7AA 2FB4L 2AK4D 1OP3H 3UJTL 5C0DA 4WUUD 5E0QA 2OSLA 1BQUA 4NM8L 1KACB 2KZWA 1NUFA 5HDBE 3GSUA 4D9QD 1XIWA 4D9QE 3OKDA 5DC0A 1MCBA 3MBEA 5CGYC 2FD6L 5C09A 3QO1B 3BFOA 2C5DC 1GZQB 2DQHL 2VDML 2DMCA 3C60B 5KOMC 1MF2H 2ATKA 3HZVA 3P4NB 4XP4H 4Q9QL 1M05B 4OCRL 1A6PA 1EUUA 1Z3GH 3QXWA 4TNWK 2A9NH 4ERSH 3V4PL 4Z5RA 1NKRA 3LN5B 4QCIA 4X8XA 1G1YA 4XH2B 3G6AB 1QQDA 1XF3B 3O6FC 5CFHA 1AC6A 4LARL 2CLRA 1JPST 4MJ6A 5FGRA 1CDCA 3WUZA 4XVTL 5MEQB 3BPCA 4M1GH 1IAOB 4NIKB 3VXRD 4GUPA 5KAQG 1WCBA 4OLXH 2A77H 4DKAA 4P5MB 3Q5YA 5KSBF 1E6JH 4JCLA 3JWDH 3IAPA 1N64H 3NCCB 5IV2B 3MV8D 1A6WL 2FO1A 1R3HA 2VR9A 3KYKH 4F7PA 2DAVA 3MV01 5JHDA 4RFOH 1MUJB 2X1OA 4JANA 4PJFF 2C1PB 3TO2A 4AEIH 4LRIC 2FX8L 5ERWB 2R2HA 5FOJA 5A40E 1FGVL 3CMOL 1J0JA 4F7CB 1T5XA 1WZ1L 3TBTA 3HZMA 1PAMA 1MAJA 1BQHG 3I3BA 4KRMB 4I3GA 2IAMC 4RIRA 2VLKB 1AQKL 3IF1A 5IKCB 4DN4H 1I1YA 1SJHA 4K94L 3BP6A 5CHNA 3PWPE 4CVWA 2SEBB 3BPNC 1RZFL 4RWHA 3T2OA 2CJUH 3HR5B 4U4BA 1I3GL 3UDWC 4NKIL 3LN5A 1RJZB 4QTHB 3SDAD 3EW3B 2Z9TA 1JUFB 1UXSB 4NQEA 4OCYH 3RTQC 1T2XA 4EI5B 1F4YL 3O6LH 4NJ9L 3ARDD 5EBGA 2MSPA 3X14A 3VWKA 3M1BA 4I0KA 4EQ3A 1OAXL 4G6FD 4OCXL 3UJIL 4ZD3L 4XGZA 1A2YB 1T3FB 2PCPA 3G6JE 2XZAL 1IC4H 5LXGH 1BD2E 4YC2C 1T20B 5D7KE 4NC1E 4AENA 2C9AA 1WTGT 4LVNB 3ZE2F 3MR9B 3UYRL 3SKMA 5CEXA 1KJVB 3SOBH 1WBZA 2BK8A 2IPKA 1YEEL 5GRJL 3V79C 4N0FB 1SJHB 1E6OL 5SWZB 1JGUH 5T1KB 1A7RH 3BSZL 4R97C 3HG1E 4JFXB 2OI9C 1OSZB 4PB9L 3T4YA 1LO5B 2GEEA 4HD9A 4BFBD 4U2ZA 1ZOXA 1CLCA 1NDMA 2P7TA 4PJIA 4XNYH 2J6EH 4K7PX 5HHPB 4ZAKD 1FRGH 2A6KA 4G9FE 2CRIA 1C8PA 4NPYA 1T1YB 4PJDA 5D96B 4MB3A 1TXKA 2BCKA 4OGYL 3QO0B 2FLRT 3QCTL 3V5HA 3MRQB 4AMKH 4RZCB 5FCSH 1KIUA 3LMJL 3BP5B 2VZSA 4S1QL 4PJ5E 1LO3L 4M5YL 1JWSB 3QRGH 3QDGB 5IUSA 4PRNB 1NFIB 2OTUB 4O02L 5JIPA 3EAKA 1TDQA 4GW4A 3HTLX 4AY0A 1DBMH 5JORB 1I1FB 5DJDA 3EO9L 5J13B 3WJLC 5C0JB 2HVJB 5JR1L 3RVUD 1TVBB 3W5NA 3G5ZB 1UJ3A 3DX9A 5D1XB 3JVGC 1FVEA 4G80B 1GJIA 2YUXA 4N9GB 2Z31A 3DMMA 4OGAC 3L5IA 2CLZA 3U46B 3X12A 1XZ0A 2UY6A 1L9NA 4H0HB 4FQJH 5C08E 4CVZA 1X5FA 4HJ0D 3G08B 1OAUL 4EN3A 1C1EH 2DQTL 1QKZH 4NN5C 2KQMA 2VAAB 1ORSB 1HHJA 4ISVA 4JCMA 5F96L 4CADB 1HXMB 1REIA 2DQIH 4IRZL 4HUUB 1ZKAA 4U49A 4ZOEA 5ITBH 2VXSH 2H26A 4FQCL 1NCDH 5KANI 4O4YH 1CICD 2NY4C 4QRRA 3ULVE 4JM2C 1R0AH 1R3HB 4F80A 3NFPA 4WY7L 1Q9OA 2Y25A 2YD8A 5DJ2A 1D5ZB 3Q3GB 4KZDH 4Y4HC 1YN7A 4NFDA 3WSQL 5T3ZL 3SKJL 4YDIH 4HBQA 5JUEH 5CWSA 5IFJA 4IIQB 1K3ZA 1T04B 1I7RB 1OT1A 3FRPG 4L3EB 1DDHB 3ZTJG 1A9EA 2CJUL 1OPGL 2XWTB 4OIIH 4YDVA 1LMKA 4OCLC 3AXLA 1G7QA 5EOQL 3GHBH 4XBPA 4ZFFA 5I18H 1TQBC 1FDLH 4P2QA 1ONQA 4QRRD 4LQFH 3RIFF 5GZNC 1OVZA 2NY5C 5DTFA 1KJ2B 3V0WH 2O5ZL 1JYXA 2V2XB 3FB5A 3S37X 4OI8A 3QIWA 5B21A 4TVPD 5FAAA 5I76A 3S37H 2VLLB 2NR6D 3JBG7 4Q9CA 4G6AC 2HVKA 1S8DA 1AGDA 1RUKL 3V2AR 1TQCB 1RIVH 2MQCA 4HS8H 3MACL 4L9LB 3OPZH 1S3KL 5T1DH 4DGYH 4N0FA 1E28B 2FRGP 2VQ1A 2YSSB 4UUJA 1S7XB 1J12A 1HKLH 1G7HA 1MHHA 4MCZB 5ESVB 2YD9A 5F7DB 2PYEA 5FHBL 4ZNCD 1M7DA 5I16A 5J4MA 2R1YB 4ODVL 1T66C 3C09C 4HS3A 5DDHB 2IG2H 4LSRL 3HA0A 5LQBL 4YZFF 4URTB 1XGTA 3QDMA 2R2CA 5TE7H 3H9YA 4BQCA 3O3UN 5EZJA 1GOGA 3D3VA 5GZOC 1INDH 2UUDH 5DEGA 4YHOH 3UAJD 4M1CD 2BNQB 5CJQL 1AQDA 3EYUL 5F21B 1QVOA 3GBLA 4L3EE 3G5VA 3BQUD 1PYWA 2DLIA 5GRWA 2XA8L 3WNNA 4PY8I 4Y4FB 4CMHB 1OARL 1OP5K 4MA7L 2DICA 1MRCL 3NFSL 4PJXA 4ZDHB 5LBSH 1AC0A 3HRPA 3MLUL 2KPNA 5CD3A 3M07A 1DVFC 1XR9A 3ARGA 3MRMA 1P1ZB 2ADIB 4LRNH 1ZAGA 4PJCE 2COQA 2KQNA 2UVFA 3OXRA 5KVFL 4NZRH 3SY0A 4Z8FH 4MXWH 1G7IB 1ZTXH 3Q3GA 3KGRA 5FGCE 3DVIA 4P9HC 4HWEL 1IM3B 4MLSA 4LEXH 1B2WH 4NZUH 1C5BL 4LBEA 2DJUA 5JIKA 3UPAA 2VIRA 4K71B 3FRUB 1NGPH 5HHNB 2Z93B 1D3CA 3W9EB 3QG6A 1PX3A 5EUOA 3VH8A 4M61A 1GC1L 1NEUA 4L29B 5ID1B 3RPKA 3GSQA 4OV5B 3VI4F 2NW3B 4XPAH 5EBLA 3BDYL 4ETQB 4MCYB 3QZWA 1MFEH 3LKOB 4LU5H 4DZ8A 2EIDA 4CU6A 5EC2A 4DJMA 2VDQL 1UM5H 4MD4A 1MI5E 2WBJB 2XZCH 2O26U 4UQ3A 4XAKD 2NX5E 4V2CB 4YNYA 1CTNA 1ZA3B 1GPOH 5DQJA 1BFVH 2BVPA 2VLJA 3BH8B 5FUZL 3UBXA 3Q6GH 3HE6A 3IKCB 3IS1X 3QQ3A 1VSCA 5ETUB 1II4E 4JFHD 1XGPB 3HE7B 2W0PA 4WCYL 1SY6L 1CLOH 3I3DA 5JLZA 4PGJA 5HYIA 1IQWH 3VXTA 4JKKA 4RAUB 5IHUL 3BZ4B 4I4WB 3QDJE 4MD0A 1T1WA 5KSAD 5EC1A 3BE1L 1RZJL 3O0RH 5FO8B 3GSRA 3NIDE 2R0LH 4QKXB 4DCQB 3L1OL 3NZHH 1NCNA 1QLRB 3P4OB 1I7ZB 1OGTB 1KCRH 5KVDL 2WQRA 7FABL 1VERA 1AFVH 1KJ2H 1JPSH 4F7CA 3DO3A 4G3YH 5CCKH 5IM7A 2WIMA 3TN0B 4U3HA 4OD1L 1H8NA 1ZHLB 5L2JA 2C4XA 1L6ZA 1U3HA 3ESVF 1FFNB 3U7WH 1I8LC 4P5MA 5DVMA 1QSFD 4PRIA 2IBBA 3F58L 1AY1L 2XN9E 1MHCB 4JANB 3DRQA 3ZTJH 3D9AL 1J7VR 5C6TL 4M8VA 1KFAL 1ZWIA 2ESVA 5CP7A 3KHOA 3BPLC 1FYHB 1VHPA 4G8GE 2WUBL 4Z7NE 5I1HL 2PW2B 4ZUUA 1RU9L 3QEQB 5GJTL 3QFJB 1F58L 1DP0A 1PKQB 1VA9A 4PJHA 4QOKB 5DC9B 4MNGA 1YMHB 2FO4B 3OB0H 3CLFL 2IPUG 3EYFB 3U9PL 1YMHA 4OUOA 2BDNL 3GMNB 3QDJB 1DBBH 1FNAA 3PQYD 2W38A 4XCYB 2YK1H 3N9GH 3NCYS 1J1PH 3CGTA 1J0ZA 4FABH 3TBVB 4MNQD 3MV9A 2AAVA 3PGCA 1S7RA 1YYLL 1TTGA 2D7OA 2EYSB 4CVUA 3RWHA 4N5EC 4WW2A 4LARH 3QISA 2A6DB 4P2RE 4U7SA 1OSZA 1AP2B 3B2UC 3QR2A 1UWGH 1WICA 2OZ4H 5I8CB 3GNMH 4ODXB 2RFXB 1BQLH 3TJEL 5TGBB 3OB8A 1NCAL 3DI3B 1PW3A 3AMKA 4X6CF 3TA3C 3D1MC 2APXA 1FG9C 5ESQA 4Y4FA 3AS2A 35C8L 5IEKB 1A6VH 4RMTA 4O51A 2DD8L 2E7HA 4PD4K 3GKZA 4NQDD 3O2WH 4UDTA 1MH5A 1AGBA 3S36X 4G42B 2XTJC 1A8JH 4HKBB 5HYQA 4WU5A 3LS5L 1AD0A 2X41A 2XQYG 3DUHA 3MRPA 3BKCH 2X4TA 3BHBA 1GGIH 5CBAA 1KJVA 4XXCA 3BKJL 1HXYA 1ZLWK 1YEJL 2VUOA 3VRLF 3VWKB 3MLYL 4WW2F 5F88A 1G0DA 3UPCA 1WAAA 1N6UA 2NNAB 4XHJC 1CFNB 2VLRD 2XWJB 3CFJA 4ZUVA 3EFDH 2Y36L 4YXHH 3DYOA 2Q6WA 3STLB 3HB3C 5FYKH 4R7NB 3OMZA 1JK8A 4ZD3H 4PIRF 5GISH 2C1OB 4Q6YA 5CJXC 4ALAL 4DKEL 3PNWB 2EDYA 4KJWD 3X17A 4NKOA 4YHNB 4XCFL 1K4CA 4NO0B 5D93C 3ZL4L 2LTQC 4CDHA 3PXHA 2YPVH 3ZT5A 1YECH 5IB2B 5D1XD 4KI5D 4KHTL 4PJAA 1RURH 1NFDB 4RQQA 2MWCA 1QYGL 3SGJA 1RZGB 3P0VH 4EXKA 4RGND 2PR4L 2DQCH 1UXWA 1AKJB 1OTTC 1QLRA 2VH5L 1LEIA 2NY3B 5HY9A 1N7MH 3FHQA 4I0PC 5ADOH 5AZEH 1UADC 7FABH 1FNEA 1WGOA 3PHOA 2J88L 4TSAH 3FB6B 5ELIA 2B0SH 2I9TA 3WO4B 3RZCB 3LOWA 4PLKC 4QGTA 5CIPA 5BRZD 3C5ZA 3WXWL 3MGOA 4YUEL 1FIEA 3DJ9A 1UM4H 4D8PB 5DK0A 4C56B 5TDPA 5ITFA 4Z7UF 1FLRH 2BVEA 2VABB 5GGVH 1OAYH 5D7IE 2GK0B 3NAAL 1KSRA 1KUMA 3OKDB 3SE4C 1DANT 3GEWB 1N4XH 2NXYD 3MA9L 4RRPA 2CPCA 3HR6A 5IW6B 3S96B 1UACL 3C60A 5JOPD 1KTDB 2WUBH 1ZLUK 3REVB 1MIEH 4U1MB 2V5MA 3O6FB 5DF0A 4XVJL 3WHE1 2FR4B 4OB5H 3DX7B 5IVXB 4HBCL 4ZNEE 3C9NA 3HR5A 2ZSVB 2OQJB 3MJ9H 5CEZH 2Y06H 2R2EB 3ULVL 1NH6A 4OFKA 2ICEA 2CK0L 3F5WA 2DS4A 4PJ9C 4OI7A 1HINL 1CLZL 4JR9L 3Q1SL 1XGRA 4TUKH 3AAZB 1ND0A 2YN5A 1FVCA 2YA1A 1EZVX 2RAMA 1MUJA 2CGRH 4PJBA 1IGFH 3OKOB 43C9A 1EPFA 4FZ8H 3LPFA 4JZJA 4KMTL 4LF3A 1EA9C 2E9IA 4OLEA 1QRNA 2GJZA 3MNVA 5HGHA 3EYVA 4AJ0A 1QLEH 3L3OA 5FKAB 2NXZB 3CH1A 1JJUA 1F90H 2QQNH 5KZCB 3I2CH 3EFFA 1FJ1B 1KEGH 5ALCH 1MCOH 4P2YA 1MQ8A 5C6WH 1JZ2A 1RZFH 2WWKO 3FT2B 4U7KA 5J57B 1HDMA 3T1WA 4HKJA 3RVTD 5DJ8A 1A6WH 1IM9A 2X4SB 2BVQA 1FYTB 2EDOA 4KH2A 4OCSH 4R3SA 1JNJA 3QHFH 3BGMB 3ECBA 4M7LT 5E6ID 1X5YA 2VDPL 3CZFB 4HKZB 4P4RA 4J3SA 3ZKNC 1ZT1A 4OZGA 4JFDB 4P4RB 3VXME 1FE8L 1J05A 5EU6A 2Y4SA 2VQ1B 2DLFL 7CGTA 3ULSA 5IBUB 4JY6A 4PGBB 4QHMB 4Y2DD 1QSZA 5IQ9B 3MXWH 5C0AD 4K3EH 2AABL 3MJ8A 1M7DB 2EXYD 1VACA 4W6WB 1CT8B 3MJ8B 2J2ZA 4JM2B 3P30L 3WHE0 1YEHH 4KVCH 5FKAA 1P4BL 1W0VA 4HUNB 3HI5L 3PXJA 4IS6B 3GI9L 3BSZH 3VXUB 1IL1B 3KJ6L 3FMGH 5JNYB 1ZVYA 3HPJA 4D0BB 3Q0HA 4JFOB 5D1QD 3OX8A 1FQ9C 5L8LB 5ICYB 4YIQB 1FNGA 5IBLD 5I1LA 5SWSE 1PY4A 4LPCA 4TVPL 2XQYK 1F6FB 4L3CB 1FVEB 3ZHDA 3N1GC 2DB8A 1GGCH 5EU6E 2J1KA 4P9MH 4MJIB 3NZ8A 1W72L 2X4NA 1NLBL 4FOMA 5F7NC 1YPZB 2X7LB 3RI5K 4M9OA 3AREC 1F2QA 5FHAL 4R8WH 1DQDL 2VZ3A 4X7FC 5GGTA 1MCCA 3SDXA 4N1CA 5GS2H 2A6JA 1G7MA 2HFFB 3MRIA 4P57A 3IGAA 1G6RB 1CXEA 5FO8A 5H37H 1EGJA 5D5MF 5F1IB 4V1DE 5ESVA 3HAEA 3EYFA 1ND0B 3HMWL 4OKDA 5H94A 3JV0A 1A1MB 4KRLB 3WXVH 2H26B 1CK0H 5ALBL 5IMOB 2EH8H 4EUPH 4M5ZL 4Z7WF 5ITFB 5ICYA 2HJLB 3JWDC 3KXFA 4UQ2A 4K3DH 3ZYJA 2O5XH 3CSPA 2DQGH 5EWIH 4QRPD 5AG9A 3N1PC 3QNZA 5SV4A 3C2SA 3F12A 5C8JA 2IQAA 4HQQH 3PQYA 4MMZC 1A1OA 3QQNA 5DJCA 3BZEB 1EO7A 1IAKA 1YJDC 3O4LA 4BJLA 3EDJA 4KI1A 3G9VA 1NAKH 1FIGH 2CRMA 5DK3A 1C1EL 2DQTH 4I2XE 4N8VA 3B5GA 3VG9B 1JYWA 2E6PA 3O3BB 5IJVA 3QUZB 3V4UL 2DLGA 4F9LC 2VDOL 4X9HA 4DZBB 1BZ7A 3TZVD 3SDDA 5CGMA 5HD8C 1NGXA 4XPTL 3S35H 4GW1B 1JFQH 3V6BR 2VC2L 2QHRH 1IAIH 4HX1B 5IG7B 3LEVH 5EU7C 1IAIM 4NBXB 2A9MH 1MCKA 3SKMB 2DWEB 2VXTH 5BXFB 1S7SB 4LVEA 4LCYB 4P46B 1SYSA 1CE1L 3DROA 4LLYB 1A3RH 4H26B 2IMNA 3ARBB 3BD4A 3EO1B 2J7LA 3IDXL 4OLVH 4ONGL 5J12C 3WLBA 5C2BL 4FS0A 5LWYL 4XZUA 5D7JC 3OKNB 1IZKA 3DVFA 4XGZB 1MFDL 3G6JA 4LASH 4M4PA 4OZFH 2NY0B 1MFNA 2GSIA 4RMVA 2E6JA 1HHHA 3V5KB 2X4OA 3S5LB 2QQNL 5HDBF 3JVGA 3PWPD 4LGRB 4RA0C 3QEUB 5SWQA 1A6UL 2QKIB 5INDA 4QTHA 2UZYB 1SJEB 1EMTH 5EG6C 3O4LB 3EIFA 1EVTC 2C1OA 4PYHA 3BIAX 5GQBA 3MV7A 3LS4L 4NKQB 1ZHNA 5I1LB 5DMGC 5FOBB 5EOQH 4XB7A 2X1PA 4K71C 4NN7B 1Y6KR 2BHUA 1C08B 1R5IB 2FNBA 2VLKA 3S36H 1ZHKA 4OZ4A 5GRVL 3FFCA 5ISZA 4WUKL 1KG0A 1G6RH 3U4EA 3VG9C 5C0CB 2ICWB 3B2VL 3MMEB 5FUCE 3L5JA 3GMQA 2UWEE 2CKBL 4NKMB 3MLSH 1OM3H 1CR9L 3VFNB 1I1CA 3PQYE 3U2SA 2R8SH 1FNGB 3G5YB 4E9LA 2PYED 4MJ4A 1C12B 2BNRE 2V9TA 3DX8A 3IJHA 1D6VH 5J12B 2EICA 3TH3T 5FECB 5IK3A 1I4FB 1P7QA 4CMMB 1QQDB 1YPZA 1FO0B 2X7LA 5DRNA 2H2PD 1I1AA 3W2DL 4KROB 5T5FL 1G6VK 5E00B 4ODWA 2K9UA 3P0YL 5KN5A 5HGDA 4V1DA 4PR5B 3K46A 1YMME 3VWJD 5E8PB 2XNAB 2VXVL 2FIRT 1GZQA 2ZUWA 4XVTH 3CU1A 4KMLB 3IAGC 1YA5A 1N5AA 4RSVA 3TIDA 5EFIA 2W60A 1P2CA 3ARGD 5GS0L 5I66A 2XG4A 4WI8A 4JO2H 1BVLA 3PUCA 4MS8D 12E8H 1JHLL 4GAJH 2X4UA 3OF6A 3M8OH 5CEYA 2FECI 1TETH 4NUGL 4F57L 5F8QC 4AEIL 4X7TA 5DGRA 2A6KB 1Q9OB 3IS0X 2X70A 3SGEI 1WZ1H 2GY5A 4GRWE 1U95A 4M4RA 3D5OF 3SGDH 3C60D 3OZ9H 4X4YB 4WHCA 3ROLB 3QNXB 3IXAA 4PJGA 2A74B 4QRQA 4HUUA 1RZIA 1XAUA 4HIIB 3LD8C 5DJYB 3SEPA 3QFDA 2D7TH 1A14L 3DO7A 1HSAB 3RU8L 4EN3D 4KK5D 3UPRB 3RAJL 3TIEB 2A83A 3T4AA 1KCUL 3QUMA 1IAKB 4LCWB 2GKIA 3MV7B 2MQ0A 1YNLL 4HC1H 4P2OD 5D2NE 2XXCB 3HCVA 4HK3J 4YPGB 1MFAL 1KLFA 2MCG1 4I9WD 3IDGA 4OFIA 5FK9B 4I5BA 2APVA 2QSCH 2J8UB 5B8CC 5GGTL 2FBOJ 1IM9B 4NQVA 1E4JA 1HHHB 3V5KA 5IVXA 2OL3L 3FJTA 4ZOAA 3ZE0F 1U8KB 2NXYB 4HS6B 4F58H 4LK4A 4OM0L 4LCCB 4HS6A 1A1NA 1RI8A 1T1WB 2MOVA 3Q5TA 1H3PH 3VFTB 4E0RB 1WT5C 3B6SB 3RZWA 1Q1JH 4XP6H 4XTRD 2GTWB 2FJHB 1ZMYA 4PRBA 3KPPB 3WD5H 3AU1B 4DEPC 3VFWA 2CO7B 3O8XA 4L8SB 1I7ZA 4R0LC 3BPOB 4BYHA 3GBNH 4KUZH 2CDEB 1BPVA 4HUKB 1IILE 2R0KL 3TN0C 4WI5A 3C9NB 1KYOJ 1TJIH 1IKNA 4G43B 3RWFB 4G6JH 1KCVL 15C8L 1SM3L 1RZ7H 4X98B 1T5WA 4PRID 2YMXL 4L3ED 2G5BA 3BP7B 3EYSH 5EU6D 4FXKA 4PJEA 4XRCA 3JV6A 4K7PY 4X83A 5DRZB 2OBGA 4YGVA 3UTPD 5JOEA 5LQBH 4ODUB 1T83A 4EDWL 1S7RB 2R0LL 2F19L 43CAB 5BZDB 1A6TB 4JHAH 3EJZD 4Z18A 1MCNA 5EOTB 1Q0XH 4O9HH 4J4PC 1N6QL 1UYWH 4ZFZA 2HVJA 4E42A 1SBSH 2DJ4A 2PNDA 4FP8L 5D1ZB 2OP4L 4PJ7B 3LKQA 4U05A 3WFHA 4QWWC 3GKWH 4R2GD 1UT9A 1HHGB 4FQLL 2Z35A 4RAVA 1QBBA 5CSGA 5IF0B 3EOTH 3C8DA 5C86A 1CXKA 5T1KD 1QSEE 4Y5VA 1KULA 4LDLB 5JR1H 1K6QL 5AWNH 2GJ6D 1TZIB 4XCCL 2NXYC 3TNNB 5JPNB 3K2UL 3RL1B 2ARWA 4XC3L 3BH9B 1OW0C 4Z7UB 1TZGL 4F9PA 4GG6E 2BY1A 1PYWB 5JDSB 1LO3H 3BP5A 1TVDA 4LSTH 1A47A 3HNSL 5CBAB 3KPSA 5E9DB 1MRFL 5KS9B 2EC9U 3WE6B 4APQC 2EDDA 4IOFC 2O93L 1C5BH 1TVHB 4WV1C 5BZWB 3FQUB 3C6LD 1RQ5A 4PJ9D 4JQIL 3OX8B 1C7TA 4XXDB 4ZS6C 3V5DA 3S3SA 2Y72A 4IRZH 2HT2C 1JNHB 2BXYA 1EX0A 4X4YA 4PUBL 1FV1A 5FGBA 3STZB 1F4XH 1LE9A 3OXSB 4FZEH 4JKPL 5C0BD 4O2CB 2F15A 1A6VL 4HUVB 3BMVA 1W0VB 4IS6A 1KTLA 1BFVL 1NCCH 4C54A 3CVIL 1IEAA 3VFRA 3LY6A 4O2EB 3U0TB 1DBKH 1T0NA 4JB9L 5EUKB 4NO3B 2VOTA 5D6CA 3IJYB 3WUWG 1QLEL 4YC2B 3Q6FA 5SWSB 3ZKQD 3QI9A 2ZOLA 2ADGB 1IC1A 3WDIA 5KTEL 5ETUA 3OKYA 4GMTL 1OPGH 5KSBB 3NBNA 1UJ3C 1NC4D 1GH7A 5E8DH 3TT3L 1LDPL 1ZT1B 2KH2B 4LLQA 5A2FA 4XPFL 3X3FL 2D31A 4UV4L 2NLJA 1KCRL 3HAEG 2HFGL 3GRWL 2D3VA 4AH2A 1BX2B 3IFNH 2YRPA 5CWSB 5F3BB 1OD9A 4UZGA 4PTUB 3B9KA 1IKNC 4PY8J 5DMKA 5TF1L 4N8CH 3TVMB 4ZO9A 5SX5K 3P9LB 2AK4A 3U36A 3CFBA 3VXRB 2R4SL 4E42B 1EEZA 3FOMB 3PWLB 1U6AL 4XMKL 3QI9D 4UTAH 3LQAH 5FYLE 3GUTA 1F4YH 3O6LL 2FEEL 5DQDH 4DGVH 2F53E 1IKFH 3IXTB 2I26N 4D9LH 3JV6B 2ZP0T 4CADA 1VADB 3THMH 1ZVSA 5E1AA 5SWZE 3IRZA 5ICXA 3IETA 2X1QA 4GKOA 3ARFD 3BT2L 5C0NC 5MP6L 1EEUA 3RVUC 2EYTA 5D1ZC 4WFFD 1P5UA 3RKPA 4YFLI 3G5VB 2ADJB 2R2EA 5C07D 1BF8A 3A6CL 5E5RB 2EYRB 4NFCA 4XPHH 5ILTL 2FSEB 5KW9L 4UU9B 3TBYA 3P40A 4OGAD 2VLJD 1KCSL 4KTDL 4GKSA 5TDOA 3FO9A 4KDVA 5F9OL 1HKLL 1OGAD 3O4OB 4MSWA 4MNGB 4QY8A 5D7LA 2NTFB 1C16B 2A77L 3RQ3A 3S88H 1FHGA 4Y5XA 5I74C 5KSBE 5EOTA 3KYKL 3PWUA 5HDOA 1G9NH 3CUPB 4Z7QE 4N8VB 2BHYA 1EJOL 4L4TD 2V17L 2NXZD 4G8GA 1U8IB 5ITBL 5LJYH 5IFHL 1VFUA 2E6QA 4OB5L 1RFDL 3QA3A 2FECL 4JREB 1LEGB 5FYLH 3Q48A 1Z6JT 2ARJB 1Q72H 4JPWH 4TQEH 1B2WL 3GMMB 3QIUB 3BZFA 1NGYB 5HI4D 3FN0H 3MRLA 4Q97A 4I13B 4WJ5A 3TWCH 1T2JA 2DLEA 4JG1H 4XVUC 3NGBB 1TJHH 3OKEB 4YDIL 3WDHA 4NP4H 4ZOCA 5IMOA 1OAXH 3FCTB 2F53A 3SJVB 1JYNA 5F7LB 2E27L 4GAGH 4HPOH 4P59L 1QPXA 5HYQB 4LLDA 3HNVL 2G60L 3BVNA 5DQ9B 5KVMC 1GPOL 2RB8A 2ADIA 4FQPA 2VDRH 3RWCB 3IVKA 5I17A 3D0LB 5CZVL 2YS4A 1LD9A 4WTZA 1IAIL 2VYRE 2I07A 2J5LC 4YR6A 1X6LA 5MEOB 4MA3B 1J11A 1M7IB 1I7RA 5MENE 2I27N 2Z8VC 2VE6A 3B3IA 3N0PB 3RWGA 4KROD 4DKFL 4XPBH 3MLVH 4AQOA 1WFTA 1O7VA 5DEGB 3B9KC 4DVRL 5M7QA 1QLFA 3D85B 4OKVA 2IANB 2GQHA 32C2A 5F6HI 1QKZL 3AB0B 3EGSB 1JNLH 1FFPA 2YD5A 1KB5A 2VL5B 5DRXA 4RRPG 4LDEB 5B39G 2Y6SC 4K3GA 2EIBA 1PVHA 2L4OA 1YMMD 5EOCJ 3CZFA 5DGQA 1NEZG 2J6EL 1FPTL 3KPRA 4L4VA 5KSAA 4HIXH 5B8CB 3FO1A 1TFHA 4PJAF 2ZUUA 2WBJD 4LSRH 4NZJA 4KJQD 1C5CL 3WFEL 2DQUH 2FHBA 3MRPB 3U7WL 5CEXB 1IGCL 4RA3A 2PW2A 2EDHA 3OTTA 1JTOA 5LAXB 2ICCA 3SKJH 1TTFA 1IL1A 1X5JA 1S7XA 2LVEA 1JTPA 1U3JA 4X98A 4ZS7H 3VU2A 2X40A 5IFAL 3FFDA 4Z0BH 1NAML 1BLNA 2HLFD 4KRPD 2DQEL 3MCLH 3S3PA 1WBXA 3MRFB 5GHWH 5HJ3B 3GSVA 5CSBA 1BAFH 3KPSE 3DVGB 1I3UA 4XCNA 4EOWH 1AY1H 1VEMA 3S9DB 4YHIA 5F44A 2DDQL 1ADQL 5EIQA 3GIZH 3PL6B 3LKSB 5EN2A 4LSSL 3RY4A 1I3VA 1CD0A 3D25B 1JUFA 1UXSA 3TESA 4Y5YC 4S1SH 1XF2B 1NDGB 4NZRL 1CWVA 1FAIH 3P77B 2FATL 2ADFH 2DTMH 4ZUUB 1HNGA 4U1MA 1I7UB 1SMOA 1BQSA 1FCGA 1I1YB 2OMNA 4XMLH 4PRHB 1J18A 3IDUA 4MNQB 1HQRA 4BZ2H 4X0KA 3QEQA 4H0IA 3G6DL 2VRAA 5D5MA 4RDQG 5HGHB 4LL9A 3PWPA 2WINB 4QRRB 5D6DC 3MV9D 1I8MA 1JPTL 1T2QL 2NY2D 3DECA 1HZHL 2ZJSL 2QR0B 4FTVB 1X5GA 3CPLA 1WV7T 1YUHA 4YGVB 4EIZC 3GO1H 3ARDA 4R4BA 3NCJL 3VMOA 1YY9C 4U3CA 2R0WL 3JWOC 4R9HA 5JUEL 2IALB 5ISZD 1INDL 1QRKA 4JPIA 1BQHA 3U83A 1RPQA 6CGTA 4FQ2L 3PQYB 4G80A 2XZQL 1F6LL 1MI5B 5GGQH 3LIZH 3KXFE 1Y6NR 2QLVB 1XGQA 4F33B 4EI5C 4HMDA 3ILPB 4NWUH 3T0AA 1I7TB 4CW1A 4JRXA 2MJWA 4NKIH 1DN2A 4CVZB 1T3FA 1MEXH 2IBGA 3QIBC 3TH4T 5FV2A 5FYKD 4FFWC 5BCAA 1CD9B 3DROB 3NCMA 1FGVH 4JY4B 1U58A 2EC9T 3HNVH 2A6IB 3SQOH 1T1ZB 5EORL 2WK2A 1ZGLB 2QHLA 5CCKL 5C0GA 4RCAA 3CSYA 3JSSA 3MA7A 4NBYB 4U7MA 4X5WA 3RY5A 3T77A 3L5HA 1FBIH 3LRSB 1MJUL 5HHXH 5IT2H 3RRQA 1CG9B 4LLQB 4G8EB 3BW9B 3SE3C 4V1DD 5EZOL 5DJXA 4J7RA 5DJXB 4F8TA 4P23A 4X7SH 4Z7OF 5I30L 1J0HA 2Z92B 1BJ1H 5GIRA 4PP1C 1O0VA 4K2UL 1FO0A 5DRNB 4ZTPH 5DD6B 4R4FL 2NY1B 4XMPL 1PY9A 2W0LA 5LXGL 4U1NA 1OTSD 4OUUB 4BKLB 3V4PH 4XPGH 2DYPD 4KXZI 2FZ3A 2RBLA 2XICA 2UWEB 5JW5A 3VWJB 4RISH 1D5IH 4JKWA 2ITDA 4L8BB 4TNVF 4ORZC 1KCVH 3AMLA 4F7MA 2H2SC 1A3LH 4PJAB 3VFNA 1FZKA 1AFVL 4P9ML 5B4MC 2OCFD 2VXQH 1MLBB 2P5WE 1X6NA 5CUSL 1MOEA 3HAEB 2DQUL 5JIHA 3E2HC 2K1MA 1FVDB 1EIBA 3ETBF 5DA4A 3RL2B 2W9DL 5JW4M 1OARH 3FT4B 3WJJC 1NMCC 5SWSD 4Y5VB 2X42A 4U1KB 1MHEA 4JY6B 2QQKH 3F7VA 4ZUSA 3CFJB 5C71A 3BPLB 4NNXB 5EU3B 5IOPA 2EEBA 1S7VB 1NC4B 4Y16C 1CFSB 3QWQB 3N1MC 1OSPL 3DYMA 1U8PB 5I1HH 2PTTA 1RZIB 3VDCA 1CGSL 4QRTB 3VXMD 35C8H 5BS0A 5CKGA 2V7HA 1VCAA 1XH3B 5CEZE 1S5HA 1EDQA 1U8QB 3H2WA 4G8FA 1KV3A 1AR1C 3DIFA 1MLBA 4LRNL 3MV7D 1A4JB 4YBHA 5TGBA 2WLYA 1T5XB 4OLUH 5BMFL 3L3OB 2N56A 4LPVA 2H32B 3MODL 3UMTA 5ESQB 4BSJA 2NY6C 4EDXA 2HKHL 6FABL 1V3JA 1XCQA 2FH8A 2W92A 3PHSA 3PV6A 5DMIL 3OV6A 4I48B 4YAQB 4WCYH 2OJEB 3BD3A 1PJ9A 4DFIA 5EBWB 1CLZH 3A67L 3K8LA 5BQ7A 1YC8A 3VFTA 3BPCB 2UY7A 4OF7A 4JFYB 5C0AE 4HEPG 3VDBA 1NKOA 3INUH 4KKAC 1TVHA 3QULA 2AVGA 5F3BA 3BE1H 4ZNEA 5D5ME 2P44B 1BMGA 3RFZC 1L7TH 1DEDA 2HRLA 4HG4J 3K4ZA 4IMKA 1WC7B 4LMQE 5M95B 4E5XB 2WUCL 3P11L 2VZTA 1WCBB 2X2YA 3CFKA 4Y0GA 4OZFB 2XWBA 3FB7B 4OLYL 2V5SA 2HTKC 1ITBB 1RIUH 5C08D 4QRPB 4AYFA 1QACA 2ITCA 1GGYA 1FL6B 3L95B 2VISB 4ZAKC 5HXMA 1FFOA 1GHFH 1LNUB 3I50L 4IRJD 1DQJB 3IU4L 4M6NL 3QUML 4JQXC 4BSVB 4F7TB 4I3RH 5DRWA 1DLHA 2QADD 3TFKC 5E03A 5JTWA 5F7FA 4F2MA 3X3FH 3NFNA 3GJFH 4CN6A 3HZYB 4TSCL 2BRQA 4YHML 5IGXH 2R23B 1PEWA 1EZVY 1KCUH 4KTEH 1JGVH 3FAWA 1Q1JL 4HGWA 3BAEH 3U4BL 3FFCB 3OKKB 5T3XH 2EDFA 5E5MB 1BZ7B 5D1QC 3M17A 2AGJL 5DS8A 1AQKH 3MRBA 5F9WC 2AW2A 3FQXA 4GS7B 5DFVD 1J8HB 1MVUB 1A9BA 2W1NA 4DGIL 1ZLVK 2P8MA 4GAYA 3HMXH 1QA9A 5IEHA 5EC1B 4DGVL 2Z8SA 5DD0L 3CLFH 2YN3A 3QUYB 4OBSA 3GHEH 1GGCL 3BN3B 2EXWC 5T3XD 1IGMH 3SDDD 4ZPTB 1YEKL 1AO7D 2V9RA 4XWOC 5E56A 1L7IH 3TVMC 1TVBA 4M6OL 5MERA 4BQBA 3FB8B 3RUGF 5L7XH 2D4DA 3MOBL 2JB6A 3A6OA 4M7ZB 3QUKA 3HG1D 4TVPH 1CQYA 4X5XB 4NN6C 1XR8A 4NNXA 2X9WA 3O2VH 5EN2B 1BP3B 3DX6B 3WFDH 4WV1B 3IDIA 3JWOL 3MBEB 1I4FA 2BSED 3QG6B 2RJMA 2I25N 4OD2A 5HPMB 1MJ7H 4G6ML 2HT4C 3FT4A 5IR1A 3ZDYF 4XAWL 1P5VA 1UCBH 5FM5M 5GJSL 1CD1B 3QZWB 4LAJH 3AM8A 3FRPA 4OT1H 4AEHL 2B4CH 2BCKB 5I17B 4HH9A 2R29H 5C0IA 3BHBB 3TIEA 4RMQA 2AJXH 4M1DL 1ADQA 1NCTA 3FQRB 5I8OL 4QO1A 2I24N 1UEMA 1SHMA 2Z93A 1A0QL 5T33L 4RGNE 5I1CL 3QRFM 3SDXF 2DBLL 1N64L 2YC1A 4PRDA 4LNVA 2VDPH 1WZMA 3DV4B 3KPLA 5DI8A 3SE4A 1XF5A 3HC3L 3UDWA 1QHOA 3OXSA 2CK2A 2J8HA 4WW2C 2OK0L 2XTJE 3P0GB 3D3VD 1W0WB 1KPRA 3QHZL 2W9EH 5E4EB 4E0RA 2Y9RT 1OGTA 1JPFA 4PD4J 4GXUN 3V4UH 5EIVA 2AABH 5CJBA 3PWVA 4S10A 1UWXK 1ZHNB 3MV8E 4HCRL 1BM3L 3WFBH 3A67H 4Y4FC 3GSNH 1ZGLM 3MRGA 1XCTA 1IAOA 1MCLA 2H41A 1V7NH 3HZKA 3RIAK 4NJ9H 3VFPA 4TOYH 3TA3B 1AGCA 3UZVB 3HE7D 1IQWL 2EDKA 1DFBL 1Q94A 4OQTA 3B9DA 1CIUA 1RHHB 2XZCL 3HE6B 2NQCA 4ONFH 3V6OE 3MLRL 4OCSL 3S37L 4A2LA 1HH6A 1ETZA 2XKSA 3ARBA 5E2TL 4P2RD 3R06A 4OSUL 1T89C 4IRSA 5CJ8A 1ZGLP 4MCZA 3QQ4B 4JM2F 4KRNA 1HILB 3WKML 5DJ6A 4TTDD 3VRJA 3KLHD 1H3WM 1MCRA 3ARED 2OX5A 1J0KA 5CJQH 1K3IA 5I1EH 3RVXC 2WINA 3C08H 4W70A 4XPFH 3AXLB 1RUPL 5FO9B 2P5EE 1N59A 2AJZB 3CXHK 4NM4H 5D7SL 5CBEB 5I73B 5KS9F 4B0MM 4MAYC 4M8QA 3O8XB 3KYNA 4GFTB 4AIZA 3GIVB 5IM7B 2ICWA 4X9BA 5IWLA 2HFTA 2HLFC 1AXTH 4EVNB 4KZEL 1X5LA 4XBGA 3W81A 4NO5A 4XPHL 5ILTH 3TV3H 4A6YL 3B2UD 1ETZB 1F5WA 1BEYL 4QHKJ 4WGWB 5TQ2H 1IKFL 3FQUA 1LK3H 2ARJQ 2IAMD 2O5YL 3O2DA 3L7EB 3SJVD 3S5LA 3UZEA 3PDDA 3WS6C 4GKSB 1XF4A 2AV7B 3QDJD 4M48L 4Y1AB 4FG6C 5E8NB 1S7VA 3B9EA 1DQLL 1KNOA 4P5KA 4X6DB 1HIMH 4MAUH 5D2NB 2BOBA 1AGFB 2P5ED 4V1DB 2VERN 1YEDB 4CN1A 5I75B 5JHLH 3MJ9L 5E24E 1QEWA 4WWKD 1EHLL 2XN9D 2VR5A 2X89D 5EUKA 1JWMB 3UROR 1HXYB 2AQ2A 5E7BA 5EO0A 4GMSH 3V52H 3CIQA 3WFCH 4X6CE 1QSFA 5J11C 2W91A 2DQIL 1J1OL 1N2RB 2MNUA 3ARSA 2IPTH 1GOHA 1IVLA 3LV3B 3QUMB 3QO0A 5GSRB 2NW3A 1ZT7A 4HLZH 3FO2A 3GRWA 4OCRH 5ENWA 4G42A 3STZA 4YBQC 1J86A 4PJ7A 4JN2B 3IJSB 2WBJA 1R3LA 3DOSA 4ERSL 3U2SB 2EDQA 3O45A 4HHAA 2AEPL 5I9QB 4WIQA 3CDGB 2NW2B 4H1LG 1S7UB 4G9DA 1RK0B 1WSST 1I1AD 1LK2A 1A0QH 3R8BB 1JV5A 4XAKE 5ALCL 1XR9B 3ARGB 1PDKA 4NWUL 4FQCH 3G5ZA 3TEUA 2XKNA 3MUZ1 5GS1A 1M71B 2C26A 4JAMA 2W0KA 4LLAA 3D69A 2OL3B 1LP9A 1ODAA 1SYVA 3NA9H 4DAGL 2ZPKH 3RTQD 1JHTB 4XP9H 3CX2A 1U93A 3IKKA 4JFHE 2AJVL 3I75B 4YXHL 5KVGH 3QDGA 3D3VE 5HTSA 1ACZA 4MCYA 4HWNA 4N90E 4FA8A 1E0OB 1MFAH 4YXLH 4S2SA 1OTTD 1RD6A 2NX5D 2WP3O 3E6HB 4IJ3B 5B3NA 1T83C 4PS4H 3VMPA 5MENA 3EYQD 4HCRH 1WK0A 4X7CC 1MFDH 3GBNL 3IFPA 2V2WB 1S5IH 1NANI 5H37G 4AIXA 1HDMB 4HW6A 2DQDL 3NIGF 3OJVC 4UTBL 4GLRI 3RVVD 1D7FA 5CP7B 3W11C 2YD4A 4PJIF 2Q8BH 1BZ9B 1MFCL 3LB6C 4UT7H 4PLJD 3PGDA 3TO4C 3FT3A 3HI6L 3N9GL 5I73C 1CDBA 4NCDA 4UOW1 1ZV5A 2NTSP 4QGYA 4PV9A 1DQDH 3MX0A 4H1LA 1QG3A 3WFZA 4PRHD 3MJ7A 3PWUB 4PRPD 4WI4A 2C3VB 1FZMA 1UFUA 3NPZB 3D2UD 4K7PL 1LO4H 4DN3H 1CDUA 1JPSL 2CMRL 4HJ0C 1ZHBB 3DRTB 4X6BA 1N6VA 5TDOB 3WV0A 5ID0A 3V8OA 1PKOA 2YUWA 5HHQA 3MYJB 5BVPL 1DLHB 3ARDB 3MUGA 1UB5B 1Q0XL 4O9HL 3NAAH 1KJ2A 2VWEE 4QRSB 3O6FA 2NY0D 3OBAA 4AMKL 1X4ZA 3QXAA 4S1SL 2XWBB 3FB7A 3OZ9L 5T5FH 4MQXD 3WUWA 2J12B 4WFFE 1U91B 4XI5D 3O4LD 4GQ9H 1F13A 5C92A 1MJJA 5ANME 4NM8H 3IXTA 5GJTH 4MLIA 3S98A 4QRRE 2F8OA 1PG7X 2P46B 3WS3A 4JO4L 3TT1H 1AR1D 1UA6L 5CINH 3EYOA 4LNRA 1CGTA 1YDPB 5BW7A 3KAAA 2GCYA 2DN7A 3P3YA 3LPWA 1B4RA 4I0PB 4RBPH 2MHAB 5FYLD 1AD9A 4PG2A 3CPLB 3UYOD 3QNXA 5GRZA 1AD9B 2G2RB 2I60L 4HZAA 2BVTA 3NFPB 3LKRA 4YHKH 1K8IA 1IC4L 3VXUE 3L3JB 3MLYH 4H25B 4JKLA 1JP5A 1WBYB 4KI5C 4NZUL 3MRKB 3CFDB 1A4JA 4ZFOA 4ZAKB 4LCUA 2YOCA 4ZSOA 1RULL 3GSNB 5JXED 5LGKA 1HQ4A 1GC1H 5GSRA 3X11B 1FV1B 3MRHA 4NQTA 5I0DA 4LFHD 1TMCB 5EO9B 3A0OA 5A1AA 5JDJA 2Z31B 3DMMB 3KPRB 4L4VB 1VB9A 3T0ED 4HXAL 2Q86A 1F02I 3QH3A 4JLRB 3RJDA 5FGSA 2VH5H 4YHNA 2R0WH 1S9KC 4G8IB 1G7PA 2E5EA 9CGTA 5J9PB 5CLTA 1BZ9A 4OKVB 5D1QB 1GHFL 4F7EB 3U79A 4RFNC 2ADGA 5K93A 1Q9KB 4EBQH 1P69B 1H3XA 3X14B 3BH8A 1QSED 1YEEH 4ZUTB 4FQHB 4NZTL 1DQQA 3QAZB 4LSPL 4E41E 3NA9L 3WIHA 3MJ7B 3ZE1F 4TN9A 2QSTA 1MLCB 2XKUA 1QO3B 4Q9RH 3VJ6A 1H3PL 3B9VA 4FQXD 4PGDB 5EUOE 3FT3B 3VXOB 4YHYC 3U30C 3F65A 1NGQL 1U8MB 4U2YA 2UWEA 4K23L 3L6FA 5EPMA 4B41A 3OWEA 2DI7A 1KIRA 3OSKA 3ALXA 1RU9H 2ZCLL 2EC8A 3K2UH 1JHKH 3KPMB 5FGBC 1Q9WB 1N59B 1A7NH 5JLZB 4KTDH 4NUJA 4PJCA 3RDTD 5JHDD 4U6XA 1YEHL 3BEWA 4QXTB 4DVBA 4Z77A 5T1DL 4DGYL 3ZDZE 3EHBC 2FR4A 5JW4R 1JZ4A 3D39D 4XMPH 4UAOB 1HYSC 3ZYIA 3BKYL 1T66D 2VLJB 1XR8B 2A73A 3UTPE 3TNNA 1G9NL 4P0DA 4PGEB 1CGYA 3DVNA 5J3HD 3S35X 3GMMA 3ISWA 1RIHH 4GW5B 4Y4HB 5GGUB 3WIIH 5I1DB 3STBA 4AT6A 5E08H 3KPQA 4D0CA 3RGVB 1NPUA 5IK3B 5KANG 4MVBC 1W72H 1IJ9A 3ABZA 1IM3A 1WTLA 5DEFA 4TULH 4YFLF 1J10A 5IBTH 4P23D 1R0AL 2VQTA 3VD7A 4J3UA 1DN0B 1INEL 3C6SB 1ZS8A 4ZTOL 2ESVB 1IC7H 4UT6L 4JFEA 2FWOB 2J8OA 2R1XA 4R90L 2ZKHH 1D5BA 1I85A 1CFBA 5EO0B 3CMGA 4DKDC 4RIRB 2N4IA 5DEZA 5D8JL 5TQ0L 3QA3B 3ARFA 3D18B 1VADA 1MNUL 3GM8A 4PG2C 1RSFA 4F15C 5CD5C 1U8IA 1AP2A 4PB0L 4KDTA 4LSUH 1XIWC 5AEAA 2OL3H 3SKNB 3F7PC 2EYTB 3LQAC 4LHUB 3E8UH 2E9WA 1OB1A 2RIKA 4FQXA 4YHLH 5FO9A 3PDOB 4MXVE 5MEQA 4NNPL 3KYNB 4N8CL 2HJKA 1J5OH 3I6GA 5HDQL 5C0RL 4XVJH 4M93B 1QFHA 4ZXBB 3DHJA 5EZOH 1JNLL 1YYML 4UBDC 2AXJA 3LQAL 4GXVL 5E8EB 1RUKH 3H3PH 5INCB 3L3GB 3HE7C 2MPAL 4LLUB 3GJFK 1N0XL 1DFBH 3QUMH 4QRPA 4OM1H 1IE5A 4M8QB 3VCLB 4GMTH 2ITCB 3L95A 3CH8A 3ARUA 1MCOL 3KR3L 2BJMH 5SX4H 4QXWA 3BDYH 5TE6L 2VDQH 1H8OA 1KELL 5EB9A 2V5YA 2H32H 2WUCH 2R0ZH 1WFNA 4K9EH 1T21A 3OJ2C 3QPXH 1SBSL 3O4OC 1ORQB 3H0TB 2CIIA 4M7JH 4PJ9B 3DRQB 2CDGA 3U9UB 5CEYB 4DQOL 4MQSB 2GSGA 4HAFA 1I9IL 1X4YA 2OSLB 4JFFE 1A6UH 4PJGE 5KTEH 3H42L 4XNYL 3F7YB 4YHZL 2WWKT 3VWJC 1Q9WA 2AP2A 4J3WA 1MLCA 1V3LA 5IMLB 1FZJA 3VFWB 4WI3A 1NFDF 1CF8L 1CL7I 3HUJB 5BV7L 4N9OB 1KLGA 3G6JF 4JZOB 5A2KH 1H0DB 1R5VA 3WXVL 3FO0H 5GSVA 5BVJB 4KJPC 2GTZB 2AI0L 4I8DA 5BOPA 2EYSA 3BKMH 4YLQT 1PSKL 4LSQH 3DGGB 4X7DC 4YWGL 4LEXL 5CKAA 2JIXB 2VXVH 3WO3B 4YJZL 5FK9A 4X4XB 2PTTB 3BRFA 1T03L 3LEXA 4PJ5A 4NP4L 3W39A 4Y89A 5IF0A 3QXDA 3U0PB 4HWZA 4OLUL 2MTPA 5BMFH 4JR9H 3D3VB 3LMJH 3HNSH 1F3DH 2NX5B 3GI9H 3P4MA 4L3CA 3OAZK 4EN3B 3EO0A 5E2WH 3UPRA 1YPZE 3C09B 2XQBH 3B83A 3MOBH 4Q0XL 1CU4L 2H6PB 5AAMA 3TNMA 5JW4Q 4K55A 3M8OL 1DBKL 3PJSA 5HPMA 3KYMA 2BC4B 4G9FA 3WNMA 4HWEH 3AGVA 1JPGA 1I7TA 3VDAA 2A74A 2V17H 4Z7UE 2DYPA 2J4WL 4PJBE 3OKOA 1FC1A 3ESUF 4XBEH 1I9EA 5CILL 5LG1A 3PL6D 5HYJD 4TUOA 1MCDA 3TO4B 4GG8A 1HINH 5K33A 1X5IA 3GGWB 4JFFD 2CD0A 5I1CH 2OR8A 4W6YB 3HC0A 3MYZA 1AGDB 1UH2A 1Y0LA 4S1RH 4GAJL 3SY0B 1DBAH 3L3JA 4JG1L 4JJ5B 1MEXL 5A3ID 1OLZA 3WN5A 3JUYA 4ORGA 3OL2A 3T2QA 2HLAA 2IFFL 4DUXA 4PREB 4TUJA 5DJCB 3BZEA 2W9EL 3KWWA 1VEPA 5TF1H 3HMWH 4TNVK 3SDCC 2ZG1A 4LCWD 3QNZB 2C7UA 1OGAB 2DKUA 5HYFA 3KNBB 1U8OB 4ONOA 2VL4A 1WFUA 3RWEB 4TSCH 3T0XA 1Z2KA 4JRXB 1JF6A 1YY8A 4YO0A 2FJHA 4U1LA 3QUZA 2RR3A 1S7SA 1HNFA 2GJJA 4XX1E 5CJOH 2OM5A 3IB4A 4OF8A 1IT9H 5IG7A 4J6RH 1K2DB 5IJKC 3GSOB 3JTSB 1N8ZA 3LD8B 4C83A 4LGSB 3KS0H 1NBQA 3VD9A 2C3GA 1YEFH 3ZL4H 5DO2D 3HLAA 3SQBA 1MCQA 3SDYL 3A6CH 5ID0B 1YUHB 5AUMB 3TPKA 1TQBB 1OP5H 4WWKA 5EZIH 3RY6C 3V0VB 2MCPL 3MRNA 4BQ6A 3D39E 4MXVF 1RZ7L 5ACMA 3ZKSD 4K8RH 3AU1A 2VDMH 3UTQA 1CLOL 4LCUB 4UIKH 4WEBL 5JHDE 3C08L 4LQFL 2LU7A 2X05A 3O8XC 4N0YH 2MHAA 3MGTB 3OJMB 2BOBB 4J2XA 1A7RL 2IG2L 3C8KA 1XF1A 1TETL 2AK4B 4P48A 4XBPB 3U36B 3ARYA 3LKRB 1ZLVH 5L2JB 5JW5B 1RUQH 1DQJA 1EAJA 1UYWL 1MJJB 4KJYA 4J1UB 3MLXL 4FQ1H 4LCIL 3T2PA 1OGAE 3EJJX 3W0WB 1S3KH 2NY2C 1GZPB 1HKFA 3C6LB 4KAQH 1DEEA 3BPOC 2R8SL 3UTTE 5K9QG 4YPJA 4MQ7A 1FL5A 3BEVB 4XXCC 2BY3A 3KJ4B 1MELA 5GGVL 4GKNA 1A02N 2QQKL 3IDMB 4IM8A 4LCCC 3ILQD 1SEQH 4HQQL 1I1AB 5IB4B 3BKCL 5E00A 2OZ4L 2Y5EA 5IOPB 5DJ2B 1NAMH 4KK8C 5C6TH 1YEIL 4D9RD 3MUGB 3F7VB 3MRHB 1K85A 3QUXA 3T65B 5E8PA 4DOHB 2OL3A 1KIPA 5D1XC 2PTVA 4HXBH 4CVXB 4LP5A 3RU8H 1Z9LA 3BZDA 3LPGA 4HUVA 2VUYA 4RGNB 1GC1C 4DZ8B 3VXUA 2Y36H 4YQXH 4QXGL 5CSZA 4LPXA 2IJ0C 5T1LB 5IJKA 1DBBL 3QBTB 3WDJA 4NRYB 1DQLH 5GS3A 5BZWA 1HWHB 1QOKA 2FLBT 1AIFB 4OCXH 4QNPE 2YBRB 3MOAL 5EU5B 2EKSB 1FFPB 1BOGA 2VLKD 2YRZA 1UG9A 3WFBL 4OLYH 3H9SE 4GKZB 3DI2B 4WHYH 1VGKB 2DWDB 2HH0H 4N9GA 4UNTA 2VC2H 4NNYB 5I8EA 5LKNA 5J7CC 4NRZA 3T0EC 2OS7A 2YWYA 2DQFA 3TPUA 1T2QH 4Z95L 2PO6A 1G7QB 4HK0B 5H35A 3IGAB 5AUMA 1CICA 1IAMA 3I75A 1JZ7A 1HI6B 4KTYA 4N8PA 4WHYG 3S36L 3LQZA 4LASL 5FF6B 4B5EA 1HYRC 3DTXB 3QG7L 5JQ6L 2YXMA 3MV11 1Q9LB 1TZHB 4XZUB 3LS5H 1KC5H 1D6EA 3J8F7 1KPVA 1U36A 4R97B 2ESVE 2C4FT 5F72S 5FDWA 3QIWD 2VN7A 1WAAF 3DRTA 4X6BB 3SOBL 1JGLL 5BZDA 1KJMB 5DHYB 1ACYH 4X4MA 4JFPA 3ZKXB 1YY8B 1LO5A 4OIIL 1CTOA 43CAA 3GHEL 3PIQA 4KTEL 3MJ6A 1UM6H 4LLYA 4NWTL 5F7DA 5J1SC 1MJ8H 5L88L 4B53A 5FOBA 1EEQA 2IH3B 1EERB 4C83B 2A0LC 4GH7B 1QUNA 4M5YH 3W5MA 1GIGH 4HGWB 3A6BL 5DA0B 3SDDB 1UZ8A 2IWGA 2DM3A 5L0QC 3NACH 5BRZE 2CDEA 4S1DD 4LHUD 4JFEE 4AENB 3KPPA 4GRLD 4GS7C 3RPIA 3CLEH 1JVKA 5D7IB 1HYSD 1UWEL 1KJ3L 3GMNA 3BKYH