2A77L

Anti-cocaine antibody 7.5.21, crystal form ii
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
216
structure length
214
Chain Sequence
DVLMTQSPLSLPVSLGDQASISCRCSQSIVKSNGHTYLEWYLQKPGKSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLRISRVEAEDLGVYYCFQGSHIPWTFGGGTKLESKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Immunoglobulin Light Chain
publication title Flexibility of Packing: Four Crystal Forms of an Anti-Cocaine Antibody 7.5.21
rcsb
total genus 49
structure length 214
sequence length 216
ec nomenclature
pdb deposition date 2005-07-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a77L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2a77L01
3EFDL 1T6WA 3MYZA 1CFNA 1YMHB 4PG9B 1YMMD 3O41A 3D69A 4Y5VA 2VDKH 4QRRA 3MLSH 3T8XA 2RQ8A 4GRLA 4LSPH 5TF0A 5HYQB 3IRPX 4RX4A 4TUKH 4S1SL 1WZLA 4XRCB 5F7NC 5F6HI 1Q72H 3CLEL 5CBAB 3MV7E 1P53A 1TJHH 2VDPH 3OHXB 4KTYA 4H20H 4YBLC 1M7DA 3JXAA 2DBLL 4QYOB 4BUHA 2CIIB 1AI1L 3NZHH 5DHVB 1XGRA 1NAML 3D18A 1D6EA 2DI9A 3MBEA 3V5KB 2Z31A 5ICXB 4N0YL 2X05A 3VXUD 2EIZB 1IT9L 3F65A 3H9HB 4Y0GA 5C0EB 2V7HB 3AREA 4JY6A 2E8ZA 1G7PB 4Z7OF 3VD7A 3HAEA 5JOPE 4YDLB 3S37L 5F7FA 4QRQB 5GHWL 3NIFF 4TSCL 4YZFE 1PVHA 3SKUD 4M7LT 2ZUYA 1F4HA 3HG1D 5EOQL 5C6TH 1CFNB 5ACLA 3IFOA 1MREL 3O41B 1QEWA 4OTXH 4Y5VB 4QRRB 3THML 4P9HL 3MV8E 2MPAH 3T8XB 4GRLB 4NCC1 1BZQK 5FM5O 4P4KC 3VXMD 3BI9X 4LK4A 1A7QH 1ITBB 2R69L 4PJHA 4YXHL 4CVWA 3GSRA 5EOCH 4J3VA 1WK0A 1K9TA 1AGCB 1TZHA 2EYTA 4ACPA 4O9HL 3BN9C 1AXIB 3DJ9A 5EUOF 3QUYA 4YDJA 1YDPB 2KKQA 1M7DB 5E2VL 1NC2D 1J8KA 4EN3A 1K2DA 1XGRB 3P30H 3D18B 2HN7A 2LAAA 3U7WL 1RMFH 3MBEB 2W9EH 2Z31B 4DAGL 1YJDC 1XEDA 1JZ3A 2BCKA 2DYPD 5IB2A 2XZCL 3AREB 1NCBL 4I0PD 4JY6B 5CZVH 3HAEB 1L7IH 4WI8A 3QZWA 3WDHA 2KQNA 1NCUA 3QUMH 3ZDZE 1B6DA 1EH9A 3VWJD 5IVXA 5E7FA 3V4PH 5H94A 1F8TH 4MB3A 4H0HB 2J4WL 3G04A 4HKBA 1C7SA 1X5IA 4YC2C 1KPRA 1LO4L 2AQ3A 3IFOB 3MV01 1YC7A 5D6CA 1QEWB 5IFAH 2HFEA 3P73A 3GBML 4R96A 5DVKA 4PJEF 2R4SH 4PJHB 5TPWL 3GSRB 2P5WD 1TZHB 1MNUL 2EYTB 2VXQH 4AIOA 3QUYB 3VXUE 4YDJB 1OD7A 1UWXH 3IDYC 4PJDA 1KJVA 1FO0L 4EN3B 5A3IC 4DGVH 3LEXA 1QA9B 2KPNA 1RIHH 3WHXA 3JWNC 4HS6A 4GG6A 2DLFH 2BCKB 4NNPH 5IB2B 3HG1E 1HYRC 3F12A 1QPXA 1EBPA 4NYLA 4GAJH 1JPGA 4LSSH 3QZWB 4G7VH 1CCZA 3QEGH 2LAGB 1V3LA 4P46C 4JG1L 3VXME 3ROOA 1MAKA 5H94B 1I3GH 3GBNH 1BFOA 1CI5A 4DGIH 2YRLA 4HKBB 3ARFC 5HHOA 1A6TB 2NY2D 1KPRB 5D6CB 5KAQF 4NM4H 2CK2A 2AQ1A 3MRMA 4DEPB 5JQHC 2HFEB 3P73B 3RIAF 4R96B 4P5MA 4QHKJ 1CF8L 5EORL 4K3EL 1DVFA 1NGQL 4DZ8A 1MCOH 2HP4A 4P3CL 1AY1L 1D6VH 2J1KA 1P84J 5GZND 3TBVA 1KCUL 5M7QA 3NPZB 5F72S 4N0UE 1KCKA 4PJDB 1KTLA 1Z5LA 2MFNA 1KJVB 3LN4A 4PG2C 5D2LE 3EHBD 3LEXB 4R0LA 3SKMA 1YEEH 2F8XC 3RFZC 1KOAA 4L8DA 1LDPH 3WHXB 3C2SA 3VXQA 3V95A 5GS0D 1C08A 3GIVA 3OAZK 1QFWL 3INUL 3F12B 1CD8A 5FO9A 3WCYA 4NYLB 2NNAA 2Y5TA 2BNRA 3ULVF 1TTGA 1LO5A 2EDXA 1NC4D 3SDDA 4AYFA 1GAFH 1X5YA 1X5AA 1BFOB 5FGCB 3VFNA 3LRSB 5HHOB 3SKJL 4G6AD 4LEXH 2NY7L 3O6KH 2W9DL 2VXUL 2P5WE 4JO2L 4KXZI 4M43L 3MRMB 2HG5B 3L1OH 4PGJA 4GKOA 2AJUL 4XNMA 2JJWA 1HZHL 4P5MB 5JHLL 5FUOL 1C12A 5FOBA 3HE7C 2DD8H 4DZ8B 5KZCD 4F58L 3MOBH 2A73A 3BPOC 5GS2D 4FQ2L 1WZ1H 4XWOC 1DANU 3TBVB 5E8PB 4LRIC 5D5MF 5DJZA 2J8UF 1KTLB 2Q8BL 3NA4A 2R1XB 1UYWL 3IDNA 3IKCA 4HF5L 4PGCA 1QRKA 3LN4B 1IJ9A 1W72A 4R0LB 3SKMB 4KMTH 1QUNA 2GTZA 1ADQH 4L8DB 4NQVA 4KU1A 4BQBA 2FO1A 4HJGA 4FXKA 3VXQB 3GI9L 1FG2A 3WUWG 3GIVB 4YXLL 1U8QB 1K3ZA 1AHWC 5FO9B 3ZHKA 1YEHH 3PWPA 2NNAB 2Y5TB 4L8SC 4LSVL 4TQEH 5JDJA 4EUPA 1NBVL 2BNRB 1Z3GH 2X4OA 1LO5B 1NSNH 3SDDB 4LF3A 5FM4A 2YN5A 3M8OH 3RVWD 3VFNB 3LHPL 3MUJA 4X0KA 5FYJD 1JF1B 2IAMA 1CK0L 2RIKA 4NC1E 5SX5H 3VWKA 3G6JA 3CSPA 4LPVA 4PGBB 4XMLH 4XNMB 5EZOH 3MRQA 1C12B 4JJ5B 4LGRB 3TVMD 1CIDA 4HPOH 2A73B 3N06B 3QXDA 4OF8A 3WS3B 5DO2D 1ZVYA 1H8SA 2AJSL 1T20A 5E00B 2VLKD 3LAFA 3P3YA 3IKCB 4GO6B 3MRIA 3RNKA 3HI6L 1W72B 4OCRL 2OR8A 2GTZB 3L5XH 4NQVB 2GT9A 5I6XC 4HJGB 4FXKB 3LB6C 1FG2B 5AG9A 4R26H 4JHAL 2F58L 3OXRA 3PWPB 4TSAL 3HRPA 4CDHA 2CRZA 3TH3T 2NX5A 5I71B 3IAGC 2X4OB 3WIHL 3ELAT 4NNXA 3TPKA 5DVLA 4Z7NF 2DWEA 1LDSA 2NLJA 3TJHD 3ARGD 5TE7L 3VWKB 1B4RA 1G9ML 5DJAB 3L5IA 3G6JB 2HKFL 2MQ3A 5L7XL 1I1RA 1F02I 2A77L 3MRQB 4MXWL 1RJZA 4NRZB 3EYOA 2Y07H 4JFEE 5JR1L 2XQYG 2EKJA 3H7BA 3T2NL 1T20B 1E6JH 2IMMA 4I4WA 3BPLB 1LO2H 4HBCL 1NCTA 4MD4A 3BN3B 4OGYL 2DOCA 3MRIB 5DJCA 3T65A 3RNKB 1U8NA 4OLZH 1SBSH 5SX4H 1IGCH 3F6IA 4JQVC 4KRPD 5EC1A 1WGOA 3QUXA 4IJ3C 4MNQA 5F1IB 4JDVA 3TLRA 3UTSD 4XB8A 4YPJA 4U49A 5FYJE 4HFWA 3ZKXC 4KKLD 4FQCL 2UZXB 5CIPH 4FXLA 2CXGA 3RVVD 5I2IA 3N1FC 4NNXB 1G1YA 1ZVSA 2DWEB 3TV3H 3SJVD 3O4OC 4JHZA 2NLJB 4HKZA 1T66D 1KUMA 2VLKE 1A6VH 1EV2E 2BVUA 3QXAB 4U4BA 4PJFA 4OCWH 1RJZB 1RZ7H 2QSQA 1EXUA 1RFDH 4XVTL 2PW2A 1BJ1H 1SY6H 3FB6A 4DVRH 5I17A 2HLAB 5I1CH 3H7BB 4L3ED 4DUVA 4I4WB 2BVTA 1EFXA 3OKMA 3ILQD 1D9KC 1K4CA 4MD4B 4PS4H 4H1LG 3S96A 4KUCF 3T65B 5DJCB 1U8NB 1INEL 1AO7D 1ND0A 4YFLF 3BEWA 3R4DA 5EC1B 3T2PA 4NHCL 5HD8C 5ID0A 3QUXB 3HUJB 2YWYA 4FQXA 1FL5A 2ITDB 3LMJL 4MNQB 1A6UL 4JDVB 4PJ8A 5DHVH 3PWVB 2HT4C 1NGZA 1N5YL 4YHZH 1HXYA 1Z9SA 5I74C 1KN2H 3P9MA 4HFWB 1RIUH 5E8NA 3JZ7A 3WE6A 2OI9C 5C7XH 5IG7A 5I2IB 1SMAA 3QEQD 4HC1A 4TSBL 2EZ0C 1B9ZA 2X9XA 1ZA6A 4JPIB 1DQDH 5KN5A 1EEQA 4LDOB 4PJFB 1AQKH 3U9PH 4MXVE 4PP1C 1MCIA 3SDCD 1EXUB 5T33L 4WUKL 2PW2B 2IPTH 3QIBA 4AT6A 3FB6B 5I17B 2XV6B 2P8PA 43CAA 1U8HA 4Y4FD 4HGWA 1EFXB 1GH7A 2B2XL 3OKMB 3X12A 3LQAC 4IOFD 2BJMH 1K4CB 3UTSE 5KVDH 3S96B 5C0DA 3HZMA 3ILPA 3SCMD 1FE8L 1ND0B 1FNSL 6FABH 1GYAA 3BEWB 4RGNB 2BNQA 4KI5D 3OXSA 3O4LD 3RL2A 1T7ZA 4Q7DA 4P23A 4XGZA 3ZYOA 1FL5B 4PJ8B 4EJ1C 3VGAC 5FYKU 3SJVE 1HXYB 3ULVL 2DQDL 5ALCH 2WUCL 4K71B 5E8NB 3VXSA 5CMAA 1H3PH 5IG7B 2YA1A 3VRIA 1ZOXA 3TT3H 3HAEH 4PGEA 1KYOJ 2YEZA 4Z95L 4ELME 1T80A 3ARSA 4LLDA 4JQIL 2G60L 3H3PL 1ZA6B 4OKDA 4JO4L 5KN5B 5F1KC 4UTAH 1TETH 4JGJA 4B50A 1SJHB 2OZ4L 5I73C 4XPGL 2JK5A 3QIBB 4AT6B 5FYKL 1AO7E 3D25A 1B0WA 2P8PB 43CAB 3QI9C 2NXYD 4HGWB 2IH3B 1EVTC 3X12B 1BOYA 3RZCC 3O45A 4MLIA 1GXEA 1OAKL 5C0DB 3HZMB 2R29L 3ILPB 4JN1H 5HVHC 3AY4C 2H1PL 1KEGL 2GJ6A 4GRMB 5A2LH 3HE6C 2BNQB 3OXSB 3RL2B 4XGZB 4P23B 2VZOA 1OAYH 3QEQE 1MI5A 1J86A 2CUMA 5LCVH 1BBJA 4DJMA 4HULB 1FLTX 4A6YA 1QBAA 5E5RB 1NGWA 2PXYC 3U0PA 3VXSB 3TGXA 1I7ZA 3SE8H 5BVPH 3QNYA 3PGDA 1Q9WA 3FO0L 4NO0D 4N8PA 4PGEB 2YEZB 1C5BL 2UWEF 4UOJA 2CKBA 4LLDB 1CXEA 5F3HA 1ED3A 1MH5B 3PGCA 3CU1A 1A0QL 4IRJD 4E9LA 2ORBL 2JK5B 3BP7A 3D25B 2D03L 2R2BA 1MFAH 4KI5E 25C8H 2PETA 3O4LE 5DMKA 4OLUL 3SO5A 3WNKA 4ODXA 2F53A 2PR4L 3O45B 2QSCH 4YDLC 4TOYL 5E99L 4GXUM 3ZDYE 3GO1H 4ERSL 3WS6C 2LTQB 3FQUA 1FZMA 4LIQH 2C3VA 4WW2A 1ZE3C 5JOFA 4M5YH 4NN7B 4ORGA 3VFTA 5IMOA 3BJLA 4U31A 1WBZA 5EN2A 5DEGA 2ATPA 4AEIH 1BBJB 1Z9LA 2SEBA 3OPZL 5ALBL 1LEGA 4A6YB 4Y5VC 3HMXL 3I9GL 1U8PA 3U0PB 1PBYA 1CFQA 3EO1A 1I7ZB 3QB7C 3QNYB 3HA0A 1NGPL 4ZNCD 3A6CL 3PGDB 4JFZH 4Y19D 3V4VH 1Q9WB 4JFDA 1RAMA 2ZUWA 1YNTA 4R2GD 2CKBB 4CN1A 1XGTA 5F3HB 3D5OF 1ED3B 3H2WA 4UINL 3QPXL 3PGCB 3ZSTA 2OMNA 3TCLA 1U9KA 3V5HA 3BOVA 2A1WH 1QVOA 3QDJA 5ADOH 3HC0A 2R2HA 5TDOA 3MBEC 2XTLA 5LGHL 3BP7B 1TZGH 2J6EA 4Y5YA 2R2BB 4NZRL 4OQTL 3LH2L 5I1KL 4ZXBD 5DMKB 3AREC 4O2FA 4HIHA 4ODXB 2F53B 4UV4L 4HS3A 1I8KA 2VR9A 1AD0A 1FV1A 1PG7H 5EO0A 4F8TA 3FQUB 1FZMB 2C3VB 4WW2B 5JOFB 2YD2A 5ACMA 4ORGB 3ROLA 3VFTB 5IMOB 4ZO9A 1WBZB 5EN2B 5DEGB 5ESAA 2ATPB 3BZDA 2SEBB 2R8SH 1GGYA 3GKWL 3BX7C 4HPYL 3V6BR 1LEGB 2IMNA 4U2YA 1U8PB 1YEFL 5B8CA 1U8MA 2ZCKL 4UDUA 5IFHL 3EO1B 1WEJH 3VGEA 1RZJL 3WSQH 2JCCA 1IC5L 3JWDL 4JFDB 3D39D 5AD0B 1YNTB 1L0QA 3I2CL 3LEYH 3W9EA 1NCAL 1QZ1A 4O00A 2Z93B 4LASH 2WM0A 3T3PE 3KDMA 4YBQD 3TCLB 3V5HB 5F6IB 2J5LC 4IEFB 1BGXL 3L3DA 1QVOB 3QDJB 2F19H 3TN0D 5I1GH 5TDNA 3HC0B 2R2HB 3HCVA 3Q1SH 4YNYA 3CZJA 3CH1A 5TDOB 4C4KO 2MQCA 4U1HB 2RB8A 4Y5YB 4LOUC 1IGIL 2X44D 1TENA 3S5LA 3OZ9L 5IESL 2BHZA 2JELH 3MGAA 4O2FB 4AK1A 5DFTA 3CFCH 4HIHB 5F9WC 4HS3B 4PJ9A 1I8KB 3TBSB 3V0WH 2FB4L 5EO0B 1D5IH 1LGVA 4WWID 5FGSA 4M61A 1ZEAH 3CFEA 4YHOL 3ROLB 5BV7B 1YZZA 3LCYA 4Y19E 3CFBA 4QF1B 5ESAB 2KQMA 4PB0H 4N1EA 4G6KH 1W72H 2VB5A 4DEPC 1GC1H 5ITBL 5B8CB 1DEEA 1U8MB 2WK2A 4UDUB 3RVUC 2HT2C 1RVFL 3JV0A 2X1XR 3UAJD 5CBEA 1ROWA 3OGCA 2JCCB 3CVHL 3BZEA 1DBMH 3RRQA 2Q76A 2QADD 5AG8A 1RUQL 4HUWA 2AJ3A 4C4KT 5AYUH 4GMTH 1XCQA 1AR1D 3W9EB 4OV6F 2NQCA 1JRHH 4LAJH 1MVFA 1TVHA 1I1AC 1T83A 3HI5L 3KDMB 2AJVH 4XP1L 1E4WL 1FLRL 1BOGA 3L3DB 3MJ9H 5TDNB 3HCVB 4YNYB 4S0SD 5MENA 3CH1B 2GSIA 4J6RH 2A9NL 3SE9L 1VSCA 2IEPA 4FOMA 3AB0C 3S5LB 5T1DH 1NQBA 3GM0A 1PG7X 3IXTA 4QY8B 5GRUH 4PJ9B 5CP3H 1GOGA 4FN0A 3RA7L 1UKQA 1FAIL 2MHAA 2Q20A 2YXMA 4J4PC 5CINH 1FNFA 2OK0H 4M61B 3NIGE 3CFEB 5I8KL 1QO3B 3MODL 2OS7A 2BOBA 3CFBB 3V6FA 3D39E 5F88A 1WT5C 4OI9A 4F8QA 1KEML 1KCRH 2VR5A 3ARYA 1DEEB 3MLZH 1OP5K 5A1AA 1MCSA 4PJAE 2YRZA 5CBEB 4N9GA 4UAOC 3OGCB 3BZEB 4UNVA 3PL6A 2Q76B 4I48B 4RRPG 4HUWB 2AJ3B 1OP3K 1MIEH 3VXNA 1XCQB 3T3MF 2H32A 3P9LA 3KLHD 15C8H 2UY7A 4XP6H 4ZPVA 4OF3A 4DQOH 1TVHB 1VFUA 1YECH 4NBYB 1BOGB 2VDNL 4K8RH 5JA8B 4EQ3A 1QNZL 1I85A 1Q9KA 4R0LC 1JNNH 5MENB 2HFGH 2GSIB 4UNTA 4WUUB 1T5WA 1EEYA 2O5YL 1YEJL 3IXTB 4KTDL 2GJZB 4OD3H 4G6JH 5BO1L 4FQLH 4MDIA 2MHAB 1Y0LA 1X6NA 2YN3A 4GQ9L 4Y4HC 1R3IH 3QRFM 2B0SH 3HPLA 2BOBB 4OFVA 3CCHA 4WI5A 4APQA 4N8CL 3V6FB 3EYSL 5F88B 3F7QA 4LNRA 1JN6A 4O5LL 2GEEA 4MNGA 3HAEG 1FJ1A 4LDLB 2XG4A 1LEIA 2DRUA 2ARJQ 4Z7OE 4GKSB 1T6VN 4N9GB 4HIEA 4HWZA 3PL6B 4HMEA 1OTTC 3NIFE 3BEVB 1XF2A 3OV6A 3VXNB 2H32B 3P9LB 4X9BA 4ZPVB 1PX4A 4ZUVA 4YHYC 3M1BA 4K23L 2LVCA 3I50L 5ESQA 5EU6D 1KTKE 2DM4A 4XTRC 4I77L 2C1PA 3LDBB 1GC1C 2NPLX 1BMGA 4OBSA 1MRCL 3IVKA 1YEIL 1I3VA 1T5WB 2MKLC 1EEYB 4QCIA 4KVNH 3RAJL 4MXQD 1FCGA 3Q3GA 5AEAA 1GGIH 5EUOE 3QWRD 4NZTH 3LKSA 4NKIH 4MDIB 1Y0LB 2FX9L 5I71C 3G9AB 5GGSA 3GGWA 1HNFA 4QTIL 3ALWA 3HPLB 3CCHB 1GVIA 4APQB 3FO1A 3QH3B 4OZHF 4LNRB 3VWKC 4MNGB 5SX4I 3G5VB 3WEXA 1FNHA 1FJ1B 3RY6C 1RIVL 1LEIB 4FZEL 2QQNH 2H9GB 4HIEB 4HWZB 1MHPH 5JXAL 4J7RA 4RDQG 1QPPA 3VD4A 5FOJA 1A6ZA 1XF2B 3MJ8A 1I3RA 2NY1C 2IG2L 4D9QD 2DMBA 4RFOL 3BPLC 1FVCA 4ZTPH 1JGVH 2Y06H 4J8RA 4ZUVB 1MAJA 2ZUSA 3M1BB 4D0CA 1JWMA 1YYMH 4JM4H 3ULVD 1NGXA 4HC1H 3HC3L 1QBML 3L5WA 3MRHA 1IL1A 3V4UH 3QXVA 4PJEE 1TXKA 4X80H 4XHJC 1OARH 4XP5L 3IVKB 1Q38A 4QCIB 2IFGA 1CT8A 2A2QT 5CJQL 3HFMH 3LKSB 4IRZH 3JUYA 5ETUA 1A14L 4R4ND 3DBXB 2X1WL 1DE4A 4WNQA 5GGSB 3GGWB 3SDAA 1F4XL 4K8RC 3NOIA 3FO1B 5EA0H 8CGTA 1YNKL 5FYKD 1H3WM 4NKOA 4N0FA 3U1SL 2AK1L 3QAZB 3SHSA 5JIHA 4N5ED 4OCNC 3ULUH 4UI2A 5JLZA 1F3DJ 5A43C 5FF6A 5HHMB 4WY7L 4C59B 5EU6E 3L7EA 1BECA 5T5NF 3UJIL 4AH2B 1A6ZB 1AGEA 1RHFA 3GK8H 1T5XA 3MR9A 5JXEC 3I3BA 1I3RB 3MJ8B 5GZOC 1KFAL 4OGXL 5MEPA 3EJJX 3SDXF 4J8RB 4D0CB 1JWMB 4X83A 1NGXB 1ZSDB 3CK0L 3VCLB 1P84K 3L5WB 5F7KC 1K5NA 1QBLH 4JGUA 4LEOA 4G5ZL 1A3QA 1CT8B 1OAXH 1OSPL 4PY7A 2FECI 3O3DA 4LSRH 1LP9F 4JKMA 1M05A 5ETUB 3WNOA 1UWGL 1DE4B 4CU6A 1ZT7A 2ENSA 5F7HA 3SDAB 2ZUVA 3D2UA 5T1LD 4K55A 3IFNL 2EH8L 1T0NA 3B5TA 1VGEL 4PGDA 1KB9J 3PWJA 4NKOB 2ID5A 1ZTXH 2DQGL 1QFHA 4D9QE 5JLZB 1TCRA 5FF6B 5BRZA 3MA9H 3OWEA 3ULVE 1NUDA 4A6YH 1F97A 1NUFA 2FH8A 3L7EB 3QRGH 4CUCA 1AGEB 4MGXA 3PE9A 5MEPB 3T2QA 5A2FA 4ODHL 5E2TL 5EO1A 2DQUH 5GGTA 3RWCA 3JV4A 4MA1B 1AH1A 1F4YH 1RU9H 2GI7A 3C9NA 3PNWA 3UPAA 4RGNC 1K5NB 1RZFH 2VISA 4ODBD 4LEOB 2I5YH 3IJSA 4IMKA 3PP4H 2HVJA 4PY7B 3DOSA 3O3DB 1BFTA 5F9OL 1M05B 5FYKE 2AP2A 4K71C 3G5YA 5D5ME 2J8UE 1ZT7B 1M7IA 3SBWC 2GCYA 2D2OA 3D85D 4HLZH 2DQJH 3D2UB 4CMHB 3N85H 4ZAKD 1T89A 1T0NB 1RZ8A 3K74B 4PGDB 3PWJB 5EG6C 3W0WD 1TCRB 3GSNA 4NJAH 1QD0A 3JSSA 5IBTL 2N4IA 4N5UA 3QIBC 5D6DA 2Y6SD 1G84A 5EO1B 3G6DL 1J11A 3RWCB 4MNHA 3JV4B 4EBQL 3W39A 2AABL 1CDGA 4GUPA 4EQ2A 3K46A 2FJFA 2VKXA 3PNWB 2Q3AA 2VISB 1YJDL 3BDYL 5LBSH 3ULUC 1NEZA 2CSPA 2R56H 2R0LL 4P23C 3U36B 3IJSB 5I1EL 3MQIA 2HVJB 5D7LA 3RGVA 2CJUL 3BO8A 4YWGH 1MQKL 1IM9A 4HT1H 3N1GC 2B1HL 2V9RA 3G5YB 3ARVA 5IHBA 4DOHB 3PXHA 1M7IB 5KOVC 4YFEA 3M45A 4KUZL 4OZFA 2GCYB 4UBDD 4I3SL 1Y6KR 5DUML 2OP4L 3PQYD 1OAUH 2BVOA 1RZ8B 1PLGL 1INQA 2DQFB 1HN1A 1RPQA 4E42A 3DV4A 5C0JA 3TT1L 4IRSB 5BV7H 1OGAD 2AI0H 4KUCD 4NWTH 1HNGA 1A5FH 4H0IA 4PUBL 1J1XH 3GSNB 4X7CC 1ZLUH 2XXMB 4L9DA 5GJTH 3IRZA 5CEYA 2RJMA 4QRPD 1KNOA 5CILL 5F71A 1QSEA 2LFGA 4Z7NE 3RY4A 2P5EA 5L8JB 3OBAA 2NTSP 3PG2A 2XTJD 4KPHH 1EA9C 4MNHB 1FYTD 5D1QA 3W39B 3MTRA 4GUPB 1QHPA 1PSKH 4KFZC 5F9JA 3STLB 2VDKL 3MLSL 5DD3H 4LSPL 4AEFA 3FAWA 4ETQB 3CDFA 3WN5A 4TUKL 1NEZB 4OLVH 3UBXG 3U82B 5T3ZD 5BS0D 4BQ6A 1JF6A 2FHBA 5SWSB 3E2HB 1Q72L 5D7LB 3RGVB 5JZ7C 1INDH 3BO8B 3QCVH 4KJQC 1TJHL 2VDPL 1IM9B 1J1PH 5GISH 1HILA 5I1LB 4H20L 2R1YA 3U6RA 5DVOA 1C7TA 3T0DA 4OZFB 4XVUD 5B38A 3NZHL 4WI3A 5IFJA 2BVOB 4QOKD 1INQB 4IIQA 4E42B 4JO3H 3DV4B 5C0JB 4D9RD 4XZUB 5ERWA 2CR6A 4OGAD 2E9WA 3PV7A 1ACYL 4NQTA 4CNIA 5CEYB 3NTCH 4X6DF 1KNOB 3JVGC 4K7PY 5ISZD 4CBPA 1QSEB 1CGYA 5C6TL 2P5EB 4JVWA 3DSFH 4PV9A 8FABB 4KK5C 3LPWA 1T3FA 5D1QB 4XNZB 4OTXL 3WIIH 5F9JB 1J8HD 2MPAL 1WAAF 4OCYH 3HMWH 1CGUA 2X4PA 4CN6A 1F2XK 5D2NA 3WN5B 2O5ZH 1A7QL 2Z8SA 4N0CC 3BAEH 5FDWA 5CZXC 5EOCL 2W07A 3PQYE 3KXFD 4WVRA 1SBBA 1MY7A 2X4QA 2P8LA 3ISWA 1CXIA 5HY9A 2R1YB 3U6RB 5A2IH 4JQXC 1OGAE 3C5ZB 5IMLB 5B38B 2WWMC 1P7QA 1UA6H 3P30L 5IFJB 5KSBA 4LSUL 4PPTA 1RMFL 2W9EL 3PP3K 3KPSA 1BAFH 4IIQB 4QRPE 3FHQA 3S3JA 3QUZC 5JW5B 5F6IC 4LSQH 3SKNA 2XTJE 3VDCA 4WWKD 5KG9A 5CZVL 1FYTE 1L7IL 3MLVH 4LLVA 1AXSA 4CNIB 3QUML 1DN0A 4QXWA 3DXAA 3TBTB 3V4PL 4JFYA 1T21A 1I8MB 1F8TL 2XN9D 3WBDA 3VD5A 3ZTJH 4PV9B 5BS0E 1T3FB 1CTOA 1WCQA 4P2QD 4XP9L 3F5WA 4PLKD 2ITCA 2DQIH 5IFAL 1RI8A 2H32H 2WAHA 1X5XA 2X4PB 4OFYD 1MQ8A 1N0LA 2R4SL 4M3JA 3UCRA 2VXQL 1HHGA 4I18A 3TO2A 4Y16D 2NY0D 5J3HC 1BD2A 3WFEH 2X4QB 2APFA 2P8LB 5DD0H 4D9RE 3KAAA 1WSST 5TQ0H 4LHUG 2IBZY 4DGVL 5KSBB 5IBLC 5I8CA 3KPSB 2E27H 5DC9B 3ZYIA 2FL5A 2PUQT 1RIHL 4NO2A 2VH5H 4X4ME 5ISZE 1EAJA 2DLFL 4NNPL 2GYSA 4OFPA 1QLEH 3SKNB 5KG9B 1KYOK 4LLVB 4GAJL 1AXSB 4GW1B 4LSSL 4DFIA 4G7VL 1J8HE 4X9IA 1DN0B 3QEGL 3DXAB 4ONGH 4WI9A 4X5XA 3G5XA 4JFYB 1T21B 1DZBA 1I3GL 3GBNL 4B7IA 3VD9A 4FFWD 4DGIL 3ET9F 4QHNA 3RTQA 1FGNH 1YPZA 2W0KA 2K7PA 2B5IC 1X7QA 4NM4L 3F5WB 3KXFE 3GMRB 2ITCB 4S2SA 3UC0H 4JKKA 5E8OA 3HN3A 4TTGA 1XF4A 5SWZE 5TFSH 2E5EA 1MCOL 4MJ5A 4JZNA 5HYFA 2AW2A 3QXUA 4AIZA 5BXFA 1HHGB 3TO2B 1BD2B 1YYLH 1MJJB 5DUBA 4ZFFA 4LPYA 5BW7A 2VZ3A 1YEEL 5I8CB 1S78C 1IC4H 2FL5B 2PW1A 4UOW0 1LDPL 4NO2B 5IEHA 3UBXI 1M4KA 3TNMA 5IIEB 3IDXH 1OD9A 4P2QE 1L4IA 2V2XB 3STZA 4X5XB 4NCDA 1GAFL 3WO3B 3CJJA 1D7FA 1AGDA 4QHNB 2H2SC 3MRGA 4LEXL 3RTQB 1MLBA 1YPZB 2UWEE 3O6KL 4ZNEA 4JCLA 2FSEA 4OZ4B 5T3XD 4S2SB 4QRUA 4P3DA 3FL7A 3L1OL 5E8OB 4G9FA 2OQJA 2CR3A 1VACA 1EO7A 3FOMA 5D9SB 1XF4B 1ZLVK 5LVEA 5CZKA 5GRVL 2DD8L 4X7DC 4MJ5B 4G8GD 4JZNB 1CXKA 2BFVH 2NXZD 3MOBL 1U58A 4AIZB 2XZAH 1WZ1L 5BXFB 4OF7A 3P77A 3PWLA 3WJLA 2XZQH 1WFTA 4ZFFB 3CC5A 2XQBH 4PJHF 1X4YA 4R4FL 5C0GA 4EOWH 5HJ3A 4KROB 4KMTL 3ARRA 3ETBF 5C0ND 2NY4B 2PW1B 2DQHH 5IEHB 1MWAH 4JG0H 2R9HC 3TNMB 1BP3B 2WWKO 5KS9A 3ZDXF 1YEHL 4TQEL 1Z3GL 1NSNL 1NMAH 1SJVA 4WI4A 3M8OL 1AGDB 2DTSA 3K4ZA 3MRGB 1MCHA 1MLBB 1NCDH 1UH3A 1EEZA 5F1OB 4BYHA 2FSEB 3RHWF 4QRUB 4P3DB 1AD9A 5DK0A 2Y4SA 2CDGA 4G9FB 4S1SH 3GRWH 2OQJB 5DJ8A 1U8LA 4RAUA 1VACB 3FOMB 3QIWC 4XMLL 2ARJA 5EZOL 1HOCA 2JKXA 2J8HA 4RDQF 4CU8A 3B3IA 4KK8C 5JORA 5DR5L 4APQC 3FFDA 4HPOL 1U58B 1O0VA 2DBLH 3P77B 3P9WB 3PWLB 2NZIA 1HWGB 1KIUA 1AI1H 1CICC 1TVDA 3FN3A 3VFVB 4YHKH 4KMLB 4ENEC 1U8KA 1BX2A 1JZ4A 3CC5B 1CFBA 1ZLWH 3HZVA 5C0GB 1PY9A 5HJ3B 1ZA3A 3Q48A 3IFPA 3L5XL 2IC2A 3C09C 3MV7A 3X3GL 1Y6MR 5ECJE 4PJDF 4FP8H 4R26L 5KS9B 4WW1B 5HYJB 1MCCA 3NFNA 4XPAH 5T3XE 4TVPH 2RHEA 5CAYB 3RBSA 2WQRA 5CLTA 2Z35A 1PYWA 3BP5A 2BVEA 2CXKA 4G8GE 1EEZB 4PLNC 1BIHA 4P4KD 4RGOH 1BM3H 5DK0B 1C5DA 2CDGB 4KKAC 3WKNA 5DJ8B 1U8LB 4RAUB 4ZDHA 2ARJB 4JKPH 1HOCB 1GZPA 3CFKA 5GGTH 5JORB 3E6HA 1DQTA 1K85A 3BN9D 4XX1G 3FFDB 3S5LG 2Y07L 4KK9C 3L3GA 5J57B 5GRZA 3QIUC 1FCCA 3QAZC 3BXNA 5GSVA 1E6JL 3S4SG 1LO2L 3OX8A 1U8KB 1BX2B 4KHXH 4RWHA 3RNQA 4DAGH 4U6VH 1J05A 1FNAA 2MCG1 2XY1A 4OLZL 1SBSL 1ZA3B 1IGCL 4K3GA 4CAGA 3C08H 3MV7B 4ETYA 5HDBF 3ZTNH 1HQRA 1T7YA 3AM8C 3GMMA 3VG9B 3AU1A 4Z78A 4B7LA 4ISVB 4WFED 4D9LH 3OKKA 3NFNB 3MBXH 4H26A 1MRDH 2XA8H 5A2KH 4F7MA 1OP9A 3Q2CA 4AJ0A 3EFFA 2Z35B 1PYWB 3BP5B 3TV3L 3EJZC 2VLMD 4NT6A 3JWOH 1LK2A 1YMMA 3QISA 1JZ6A 1X5KA 4RISH 5GIRA 1C5DB 4HD9A 1A9BB 5GJSH 1A6VL 2J8OA 3KS0J 3MCG1 1UACH 4ZDHB 3SDAC 3MLUH 1XGYH 1GZPB 3CFKB 2ZUTA 4JHWH 1JWUB 4OCWL 1RZ7L 1N6VA 3L3GB 2ZOLA 1SY6L 4DVRL 5I1CL 3O2DH 3RU8H 3H8NA 1AGFA 1P9MA 3BXNB 5GSVB 1FO0H 2UZIH 4MYWB 5A3ID 4PS4L 5DURB 3RNQB 5FGBC 3WNNA 4JLRB 3KPMA 2EE3A 5CEZH 4XNUH 2AXHA 2V6HA 1HQRB 4ZODA 2L0DA 4OZFH 3VXUA 4EI6A 3FO9A 2H6PA 3AU1B 4MA1C 4FQHA 3RKDC 4YHZL 5I1AA 3PJSA 4KWUA 4X7SH 2GFBA 1BQUA 3ZTJG 3OKKB 4NWUH 4P46D 1RIUL 4H26B 2YD8A 1IQWH 3OKOB 5DEFA 4Z18A 3LSOA 4UNUA 5C7XL 3T04D 3PWNA 3ARFD 2ED9A 4OFIA 3EFFB 1KT2A 4L4VA 3HG1A 1DQLH 3I85A 1UWEH 2AEPH 4P2OB 4NT6B 4U2ZA 3T3ME 2R1WA 1LK2B 1YMMB 3CSYA 4C83A 1YA5A 5GIRB 1DQDL 1NGQH 1OAZH 3ZE0F 5IHLB 2R4RH 3S6CA 1QHOA 3VXMA 4AEHH 4MZ3A 5DZNA 4CMHC 4NNYA 3B4NA 3O3BB 4QHLA 2F54B 2IPTL 2ZOLB 4DN4H 2LU4A 1REIA 4ZFOA 4XP4H 3G6JF 1WISA 5BZWA 1C16A 2BJML 2V2WA 5KVDL 4EI5C 4WFHE 3VXRD 4DTGH 4WFEE 3KPNA 1RZIB 6FABL 3KPMB 4LPXA 2FWOA 2PYED 4CL7A 3VXUB 4MA3A 4EI6B 3FJTA 3FO9B 2AXFA 4N0UA 2H6PB 3BWAA 2DYPA 4FQHB 3BYTA 1JI2A 5I1AB 3PJSB 2CLZA 2GK0A 1XFPA 4I0PA 1QFPA 4JN2B 5ALCL 1JGEA 5DEFB 1H3PL 4QHUA 3LSOB 5K59F 3PWNB 1BF8A 5C8JA 1BVLA 2CIKA 4LLWA 3VWJA 1KT2B 4L4VB 3TT3L 3DMMD 3HG1B 1S7XA 2R1WB 1BBDH 5JHLH 1N64H 3CSYB 4JRXD 4NQCB 5FUOH 4C83B 3ZHDA 3LN5A 5JIIA 2BY1A 4F9PA 4L4TD 3HE7D 2DS4A 4UTAL 1AKJA 1TETL 4YEEA 1F3RB 3VXMB 5EWIH 4JEGB 3SGDH 3MZTA 2APBA 4NNYB 4XWOD 4NKMA 4QHLB 3S88H 1DQMH 1GJIA 2P5WA 3RL1A 3DVNA 4ZFOB 5FA4A 3OGOE 4IRSC 2E9BA 1C16B 3QCTH 2V2WB 3N1MC 3BRDA 3K2UH 1NLDH 4JN1L 2OJZH 3KPNB 3JWOC 3I75A 4LVEA 3V7AG 2FWOB 3LS5H 4LQFH 2VQ1A 3HZYA 4MA3B 1OWRM 1OAYL 4N0UB 2AXFB 2VIRB 3MRKA 1OY3B 2FRGP 4OZHE 5IEKA 2DYPB 1EEUA 3F62A 2CLZB 1SMOA 2GK0B 1IEHA 4I0PB 1HHIA 1JGEB 4QHUB 3SE8L 5BVPL 3GI8H 2YBRA 3HUJF 5C8JB 1BVLB 2CIKB 3VWJB 3MV11 2R0KH 1S7XB 5CS7A 4ODTH 2Q7YA 3LN5B 1E4XH 3WXWH 1AKJB 2MTPA 4I3RH 1E6OH 3BUYB 3GJFK 2AEQH 3TIDA 1LEKA 3VXRE 5IGXH 3RIAK 4NKMB 5LGJA 4F33A 5IMMA 1E4JA 2P5WB 4G6FD 1BQHB 2YMXH 1MFAL 5FA4B 25C8L 5KSAA 3HRZA 4PJFF 4GRWH 1CU4H 3T0AA 1A7NH 5H35B 1J87A 1CQYA 4UV7L 1WF5A 3I75B 3LB6D 4LIQL 4WENB 3CXDH 1FHGA 3DUSA 4M5YL 5HHPA 2I9TA 3ARZA 1ORQB 2VQ1B 3HZYB 3TESA 4TSAH 4D2NA 3DTXA 4AEIL 5IEKB 5D1QC 2KL6A 4JRXE 1HHIB 3B2UC 1FIEA 3EDDA 2BVQA 3WN5C 4L4TE 2YBRB 1CXHA 4JFZL 3V4VL 4NP4H 1I9RH 4PIRF 1BZ9A 4U6TA 2FJHB 5KTEH 5GGUA 1A4JA 3GSXB 4M6AA 1ULVA 5L7XH 1MY5A 2H3NA 3WO4C 4M93B 5JW4Q 2Q7YB 3SDXE 4NQDD 5HDOA 2HMIC 3C5ZC 2RR3A 2A1WL 3C8DA 5FAAA 5ADOL 3MLWH 3TIDB 1LEKB 3RWHA 1TJGH 5LGJB 4F33B 3REVA 4IIQC 1S3KH 1KIRA 4YQXH 4AENA 2FLBT 3CNKA 5L2JA 3IGAA 5KSAB 2E6JA 3HRZB 1W0WA 1LP9E 3BWUC 4MLSA 1D3CA 3KYKH 1KB9K 5D4QA 1PG7L 1U8IA 1JMZA 3DETC 3AS3A 2I9TB 4X8JA 1UFUA 5AWNH 3DTXB 2R8SL 5IV2A 4KY1H 4BFGA 2Q86A 1WEJL 3ULUF 1JUFA 1BZ9B 1R3HB 1A4JB 5BMFH 3QO1B 3LEYL 2X4UA 4EIZC 2H3NB 3PDDA 4R7NA 4LASL 1AGBA 4YGVA 1AQDA 1UB6A 5CKGA 4JVUA 1RJCA 4MJID 2F19L 1T1ZA 4ZG1A 3Q1SL 1EO5A 3MNWA 5T5FL 3TA3B 1S8DA 3REVB 5KZCB 5C0FA 4ZFGH 1KIRB 4AENB 4NM8H 5L2JB 2ZWLT 3IGAB 1D9KD 1XR9B 1U6AL 2A0LC 3L3IB 2JELL 1F90H 4NRYB 3CFCL 5FO8B 4MB5A 4H88H 1JGDA 1H8OA 4HEPG 4NBZB 5F8QC 3V0WL 5FA3B 1U8IB 4XC1L 3QHFH 2HVKA 1D5IL 5HD8D 2N56A 3MRBA 1UEYA 1ZEAL 4GKZA 1A4KA 3MCLH 4GXVH 2HT4D 4LCWD 1MELA 1SJXA 5I66A 4X8JB 1OPGH 4PB0L 5IV2B 1W72L 4XPFH 3CPLA 1G7JA 1NCCH 1GC1L 1JHTA 2C4FT 1F00I 3MJGX 4DUWA 2Q86B 3U46A 2CMRL 1IEBA 1UXWA 1JUFB 4PD4J 1DBML 2HT3C 4XC3H 2M1KA 1F6FB 5FB8A 4EDWH 5IB1B 2X1OA 2X4UB 5AYUL 1GOHA 3RGHA 3ARGA 4R7NB 1JRHL 1AGBB 4YGVB 3RVTD 1AQDB 2AJVL 1UB6B 5EIVA 4PP1D 3MJ9L 3DGGA 1NEZG 1T1ZB 2I27N 3F58H 1E0OB 3MNWB 1S8DB 4K3DH 4J6RL 4NQUA 5C0FB 3KYNA 2EIEA 2M26A 2R2EA 1CS6A 4KJPC 4X4ZA 5T1DL 3S35H 4YHNA 5GRUL 4OZFG 1NAKL 2O93L 1EMTH 2HVKB 3F7RA 3I6LD 5CINL 5KANG 2E7BA 3MRBB 3RWEB 2OK0L 3WD5H 3LIZH 3H9SA 4GKZB 1A4KB 4JHBA 3UDWC 1GZQA 3RTQC 1J1OH 4ZO8A 3ZKQD 3CPLB 1I3UA 1F42A 1G7JB 1KCRL 3MLZL 3KPLB 1JHTB 4O2EA 3LKNA 2I07A 2QLVB 5CCKH 3EOBA 3U46B 5F7LB 3GSVA 1IEBB 1UXWB 4M7KH 1VEPA 4JQIH 4MJIE 5FB8B 5DMGD 3SJVA 2VLRD 15C8L 3ARGB 3DUUA 4IDLA 4OM1H 4XP6L 3D1MC 2KH2B 1KTDA 4DQOL 1YECL 1XR8A 5H37H 2V5RA 3DGGB 3C5JA 5BW7C 1FL3A 1JNNL 4PRDB 2WBKA 5GGVY 1MFDH 4ELMA 2D4DA 5J12B 1ETZA 5DA4A 1OAKH 2XRAH 3KYNB 5IR1B 3RZCD 4L3EA 2R29H 2R2EB 4LCWE 5CEXA 3SN6N 4Y4KC 4OD3L 5B38G 4G6JL 4FQLL 3U4BH 1GHFH 3HE6D 5HI4C 5GGRA 1R3IL 2VSDA 1RUMH 1L9NA 2B0SL 3H9SB 4KRPB 2WQ8A 2YSSA 5IW6A 3QEHA 1DQJA 1GZQB 3GKZA 2PXYD 2HRLA 4NQEE 4CW1B 4O58L 5F3BA 2A38A 3MO1A 1S9KC 3LKNB 2I07B 3DV6A 3EOBB 3UPCA 1URLA 3DYOA 3KPPA 1IAIH 3QEQA 4X6DE 2ILLA 1NAMA 4HKJA 4P99A 5JW3H 1BQSA 5JIPA 3SJVB 3WJLC 5EU3A 4WRLA 1A1OA 2ZCLH 3GUTA 1KTDB 5L0QB 3ARDC 1AC0A 3AFLA 1AFVH 1XR8B 2JCCF 1NUGA 2D03H 3C5JB 1WAAE 1FL3B 3SKOA 3NFPA 3SDCA 2D7NA 2YPLD 2COQA 4ELMB 5KBNC 3I6LE 3G5ZA 2PR4H 2VDMH 4L29A 1ETZB 4L3EB 4KVNL 1P6FA 5IJKA 2ENYA 4Y4FA 1GGIL 3FFCA 5D7JB 2H26A 4NZTL 1EHAA 3DRTB 2JTDA 4NKIL 2W38A 1P7KA 3LKPA 5KVMC 5GGRB 1OT1A 5K33A 5KVGH 1CQKA 4QHMA 2YSSB 4FQIH 4ALAL 3I9GH 5IW6B 1DQJB 3CX5K 4ZSOE 3LKQA 1YQ2A 4PJCA 1BJ1J 5EULV 4PJ7F 5F3BB 1MCKA 4RX4D 4PRIB 5CJBA 2HTKC 5I30H 5F9AC 3MO1B 1RJYA 2L7UA 5GS3A 3V0VA 3BD4A 2QQNL 1DEDA 3OG4B 3KPPB 3UROR 4TULH 1CDJA 5CFHA 3MRFA 1ZGLM 1ORSA 1QSFA 2NCMA 1S7QA 1KIPA 5EU3B 3L3OA 1DANT 4Z7VB 3MXVH 5AAMA 1A1OB 3GUTB 4ZTPL 1JGVL 1SVZA 2VLJB 2Y06L 1V05A 1YYML 4JM4L 2HAZA 3MBED 1B90A 4HC1L 3MLPA 2B7DT 5HGBB 4YDVA 3SKOB 3JBG7 3NFPB 3Q5TA 2E7HA 3V4UL 1CL7H 3SDCB 4X80L 1OARL 3G5ZB 3ARED 4L29B 4O2CA 5LAXA 2X89A 4Y4FB 3K4AA 3FFCB 3HFML 5IUSA 4IRZL 1IAOA 4XPTL 3FONA 3LEVH 1G9EA 3LKPB 1VPOH 4X6CA 4OIBA 1T1YA 3RDTB 4BH7A 2DM3A 4HGMA 4QHMB 1UKTA 4QO1A 5EA0L 4AZ8A 4LGSB 4BA8A 4PJCB 4F2MA 2J12B 3V0AC 3ULUL 1F45A 1ES0A 3V0VB 2P7TB 2ICWI 3DX6A 3R8BB 4IHOA 4XT1C 5IW3A 2X9WA 1ZHNA 2GTWA 1ORSB 4GH7B 1QSFB 3B9AA 4TUJA 5KANI 3GK8L 1S7QB 1KIPB 3H6JA 4PRPA 5HTSA 2YPLE 3RX5A 3H9ZA 5HBBA 1UZ8B 3T0EA 2A9MH 1KXVC 3OKNA 4YHPA 4YDVB 1MCQA 2GQHA 2G9HA 4LOUD 1QBLL 4I0KA 3QQ4A 5LAXB 1OAXL 2J7LA 2NXYB 3UJTH 2OYPA 4LSRL 5CGYC 4U7KA 4P2CG 1IAOB 5TF1H 1JZ8A 2OR7A 3FONB 4WTWA 4KKCC 5C2BH 3BW9A 1CG9A 4X6CB 3D6GA 5IMKA 1T1YB 4BH7B 4DVBA 5E4EB 1BLNA 2C5DC 4GBXB 4JB9H 4P2OC 4F2MB 3RVUD 1ZTXL 4PJIA 1HH9A 2HT2D 3DYPA 1H8NA 1QFWI 1CGSH 1PG7W 2GSGA 3QQ9C 2ZNWA 3DX6B 3MA9L 2ATKA 2VDLH 4Y19A 1WFOA 1ZHNB 2GTWB 5E9DB 1ZHBA 4TUJB 4A6YL 2YA2A 1G0YR 3QRGL 3ECBB 4LVHB 2WINA 4PRPB 1I1AD 3ZT7A 4OUOA 3SQOH 4M7ZB 4DZBB 4RQQA 4YUEH 3HPJB 2DQUL 4OB5H 1U8OA 3T0EB 1NEUA 3SE9H 5DS8A 1RU9L 5F1NA 4YHPB 1OW0A 1Q9OA 2CKBL 2G9HB 1RZFL 2YUXA 3QQ4B 3X13A 5GPRA 3PP4L 2AS5M 4RNRA 1IC1A 3DYMA 2X10A 2EEBA 3R0NA 3ULSA 5HYIA 4AG4H 4XMPH 2C1OA 4J4PD 4MA8H 2VDQH 3ZYZA 3LKRA 3BW9B 1CG9B 4DKAA 3FAXA 1F2QA 5IMKB 4PJHE 5HHOD 4DVBB 5C71A 4BFEA 2DQJL 3U7AA 1BLNB 3JV5A 3N85L 4LCYA 4RGMB 1JYWA 4PJIB 1HH9B 4EIGB 5DMYA 3ZDXE 2Z4QA 2GSGB 4R97B 1X6LA 2MCPH 4U3HA 3WJJA 4CVXA 4NJAL 5E2WH 4Y19B 1CBVH 1J0KA 1ZHBB 3D39A 3UTOA 2WINB 1W2KT 4R2GB 2F15A 3VFMA 4RQQB 4OLWH 2ZP0T 4LVNB 1U8OB 3ZT5A 3MPCA 2VMFA 3LV3B 1JHLH 3TNNA 3QHZH 5F1NB 1Q9OB 2UUDH 1RZJC 3TN0A 3O2VH 5LBSL 2WZPD 2W65A 1E4XI 3X13B 2R56L 2BP3A 2EDRA 2B1AH 3MOQA 4RNRB 3MACH 2BNRD 4YWGL 1A1NA 2EDQA 2C1OB 5C07D 4HT1L 4Y4HD 1FNLA 3LKRB 5D93C 5GS2H 4J23A 4N8CH 1DSFH 1NJ9A 1HWHB 4XXDA 5IB5B 4L8BA 5J06A 2X1QA 5I1HH 1T2QL 1CIUA 3TFKC 5KJRH 1A21A 4YHMH 1OAUL 4LCYB 4NN5B 3BGFB 3EDEA 4LIQE 4I8DA 4PJDE 2FR4A 5BV7L 2AI0L 4NWTL 2C3WA 2Z4QB 4WO4C 1J1XL 2Q6WA 5GJTL 3U48A 5H37G 3I6GA 2UY6A 1CVRA 3BE1L 5DRWA 2DQEH 2UZYB 5T1KD 4OBRA 4KPHL 3R1GH 4ZOCA 3HTLX 3TNNB 1PSKL 3MRLA 2AGJH 4JPVH 3PABA 5DD3L 3TN0B 1U42A 4KKBC 3WHE1 1D5ZA 2W65B 5FGCE 4OLVL 2Z91A 5HHOE 4O02H 1EJ6A 3B43A 5D7IF 1D5XA 3PWPD 5GRXG 1INDL 1A1NB 1J1PL 5GISL 3OR7A 1OQOA 5TDPA 2NMSA 3E8UH 5C9KA 4CMMA 1A7PH 2Q3ZA 2ZUUA 4XXDB 4L8BB 3U4AA 5JPMA 3RWDA 3VWKD 2D7OA 5HDBE 4JO3L 1GGCH 1PDKA 4M93C 4YIQA 3RPKA 2FR4B 4DKFH 2P24B 3CVIH 1EGJA 1FPTH 2EECA 4IM8A 4WHTA 2Q6WB 4N8VA 1CXFA 1FGVH 2NY1D 1RURL 4HMCA 3NTCL 3I6GB 4QEGA 1QG3A 4JFQA 1ONQA 5DRWB 5DD1H 5KSAC 3DSFL 2JIXA 1G7HA 3HI1B 3WIIL 3MRLB 1EPFA 2BNRE 4WEUD 3PABB 4XHJD 4K9EH 3HMWL 3ZKND 3OQ3B 1D5ZB 2O5ZL 2Z91B 3BAEL 4NSKA 2R2CA 1D5XB 1JL8A 4MSWA 5E94B 3OR7B 5DJ6A 5TDPB 2XXCB 1MCPH 3MCKA 4CMMB 5C6PB 4K8RD 4CDGC 5E03A 3U1SH 4AL8H 1UA6L 5JPMB 1CLZL 3RWDB 2H2PC 3BD5A 2N7BA 1BAFL 2DBJA 5E24E 4YIQB 4JREB 4LSQL 1FDLH 4QWWD 5HYSG 3OKLA 4WHTB 1X9QA 3MLVL 4TNVF 1QQDB 3QYCA 2CUIA 4N8VB 4LNVA 5F7MC 5GZOD 5J9PB 5JXED 1CE6A 3TA3C 1TFHA 2YXFA 2JJSA 3AAZA 4JFQB 5A16B 3SO3B 1ONQB 3PP3H 5K93A 4XAKD 4X7EC 2EXWC 4WI2A 1S7RB 5F44A 2VWEC 4MJ6B 1MJUH 2JIXB 1G7HB 3PWPE 5C2UB 2DQIL 5EU6A 4OCXH 3OR6B 3SE4C 3ZE0E 3ZYJA 3FQWA 1L7TH 4NSKB 5BOPA 3IU3A 1WVZA 3RWGA 5ELIA 3GJFA 4NO3A 4MSWB 5D72H 1HI6A 3G6JE 3FT2A 3WFEL 2Z9TA 5DJ6B 1GGUA 4F7PA 5DD0L 5C09A 1NDGA 3QA3A 1P5VA 5TQ0L 4BKLA 5FM8A 3LS4H 1FVEA 1F6AB 1I4FA 1Q94A 2WBJC 2E27L 4X6BA 2ZUQC 1UVQA 5C0BB 2VH5L 5HDQH 4NKDA 4D0BA 1XCTA 2XQYK 3OKLB 2XI9A 4WV1C 3T1FA 1CD9B 2ESVD 1CE6B 5L2KD 2IBGA 4ONGL 4W4OA 5K59E 3AAZB 1EFXD 4NO5A 2ED7A 1JTOA 5J11C 3HNTH 4POZC 4KGLA 5C1MB 1FGNL 4RGND 4Y8AA 2FLRT 3TZVA 3UC0L 1Z9MA 5EU6B 1CFVL 1OLLA 4G8IB 1RUAH 4NFBA 5IT2H 4BELD 1YNLH 5E0QA 5TFSL 1BQHG 5AZEH 3NN8A 3IU3B 3QPQC 1V3MA 2VZSA 3RWGB 3GJFB 1IGJA 1DBKH 2HRPH 4NO3B 3VRLF 3FT2B 4PYGA 1QSZA 4F7PB 3QUKB 5C09B 1NDGB 1OVZA 3QA3B 4PV8B 1YYLL 4XI5C 3PF2A 4WGWB 4BKLB 4PBXA 1FVEB 5B39A 1I4FB 4A2LA 1Q94B 4FQQB 2R0WH 1FL6A 1IC4L 1UVQB 3KPQA 3ARGC 4NKDB 4D0BB 4R6UA 2J8UA 4XAKE 1MCFA 1XCTB 1PKQA 1HKLH 2NW3B 3T1FB 2HJLA 1TJIL 4UILH 7FABH 5HGHB 3BH8B 3HUJE 4H25B 4NO5B 5J12C 4MNQE 3RBGA 3QDHA 2DDQL 5HGGS 1IAII 4W6WB 4KQ4H 1X5JA 3KWWA 5IF0A 4FZ8H 4CKVX 3TZVB 3ULUD 1FIGH 4LHUD 5HVWA 1LO3H 3IDJB 4KRPC 3MV8D 2E7LA 3NN8B 2QJDA 1AP2A 2BFVL 3C6LA 1VKXA 3VXSD 1M7XA 4Y5XB 1NFDA 2XZAL 1IGJB 5I18H 4FTVD 2XZQL 5HI5D 2X2YA 2APWA 2XQBL 1ZLVH 3RVVC 1MHEA 1BFSA 2D9CA 4EOWL 4WU5B 5T1LA 1FL6B 4FQJH 4I13B 4Y8DC 1UWXK 1C8PA 1GGBH 2EDNA 3KPQB 1MWAL 3NCEB 5JDSA 5L0QC 1PKQB 2GAZA 2HJLB 4RGNE 2VXTH 3MNZA 3QDGD 1NMAL 4WGVB 5F7UA 3A6BH 1TPXC 5EZLA 4YE4L 4BSWA 1NCDL 1S7UA 5D7JC 5HHXH 3KWWB 3I6KA 2ZG3A 5IF0B 3QDMB 3GRWL 1K8IB 1KC5H 2V7NA 5CP7A 1C5CL 1PY4A 3EYUH 2VKWA 1UJ3B 4L5FH 5JZ7D 4KJQD 3DUHA 4F9LA 1AP2B 1X5GA 3C2AH 3C6LB 2APXA 1NFDB 3V2AR 5BQ7B 4Q6IA 1GOFA 1CL7I 4R7DA 5CGTA 4YHKL 2FZ3A 4KK6C 1ERNA 5TH2B 3TBWB 4F80A 5J4MA 3WXVH 5JHDA 4CRPA 3BVNA 3D85A 4GRWF 1MHEB 3L3HA 4LQ1A 4ZAKA 1ACYH 4LKXA 5LQBL 4L9LA 4Z7WA 2E3VA 4OQTA 5JDSB 3W0WA 2D7MA 4FP8L 1KF9B 1U3YA 4ZUWA 2W92A 2GAZB 2QBWA 2O61A 4XPAL 2WIIA 4TVPL 4C56D 3SDCC 3ULUE 3MNZB 4PJBF 2V9TA 2Y72A 4KK5D 3ESUF 5EZLB 3D69B 1VFBA 5ADPH 2C4FU 4ZUUA 1OM3H 4BSWB 1QKZH 4NIKB 1S7UB 1ZGLP 1A6AA 4IOFC 1G7IA 3VXSE 4ORZC 3I6KB 1JZ5A 4RGOL 1BM3L 4FTVE 3GSWA 1AJ7H 4N0CD 5FXCH 3RDTC 1E4KA 4JKPL 2V7NB 1L0XA 2PN5A 2DN7A 5CP7B 5CZXD 3UYPA 4Q6YA 5GGTL 1A8JH 3D87B 4WEBH 5C0RH 4LARH 1I9EA 2AKRA 2IWGA 1NKRA 1R3JA 1VFOA 2PO6C 3QFDA 4Q6IB 4R7DB 4HG4K 4KV5F 5GRVK 4LSUH 3LZFH 4KHXL 1D6EB 1FFOA 3NAAH 3P4OA 5JHDB 2XWBA 4YFLI 1QFUH 2CDFA 4U6VL 3D85B 4HIIA 3B6SA 3L3HB 2CDEA 4ZAKB 3PQYA 3QUZD 3C08L 4K07A 2PCPA 3QDGE 4I0CC 3ZTNL 4LKXB 4L9LB 4Z7WB 1OSZA 2ICEA 4PP2A 3W0WB 4PD4K 4NCC2 1OGAA 4D9LL 3BHBA 4ZUWB 2VC2H 3MZGB 2O61B 4HW6A 1G7QA 3MBXL 1EZVX 4XH2A 1MRDL 2XA8L 3OAUH 5DEZA 3S34H 4QRPA 5HHVH 4XP9H 3GSNL 1VFBB 2NXYC 4ZUUB 1A6AB 3JWOL 1G7IB 2HFFA 4RISL 3GNMH 3NVQA 3GSWB 3OB0K 5GJSL 3HC4H 1PEWA 4YJZL 5DYOA 1UACL 3MLUL 1XGYL 5E4EC 2VTFA 4L4JA 2CH8A 4JHWL 4GBXC 5SX5K 4NRXA 5J3HD 2AKRB 4ODVH 4LU5H 3O2DL 3RU8L 3C8KA 1PZ5A 1R3JB 3QFDB 4WHCA 1A9EA 3C6SA 1K2DB 2UZIL 3AS2A 2HN7B 1UZ6F 1FFOB 5IBLD 1HQ4A 3P4OB 2XWBB 2P49B 2VABA 2CDFB 4MQSB 4HIIB 1NGYA 4NZUH 4S1QH 3B6SB 2CDEB 4M4PA 3U9UA 3PQYB 1A6WH 1BVZA 4C56E 1E27A 3SOBH 3OMZA 3PDOA 4QOKA 1YEDA 2PCPB 4XNUL 5CEZL 4M7ZC 4ZYKA 3QWQB 1OSZB 4QXGH 4PP2B 4LCCA 3T0EC 1J0ZA 1OGAB 5TE4H 1F4WH 5EU5A 3BHBB 5IVXB 4JFFA 4X7SL 4NWUL 5HHQA 1MVUA 4XH2B 1IQWL 2EYSA 3G04B 3N1PC 3J8F7 5DXWA 1ODAA 4QRPB 2EDDA 3ZKSD 3B9KC 4D0DA 1P2CA 2WBWB 5ISZA 2DQCH 2GUOA 5KS9F 1DQLL 4JPWH 1UWEL 2AEPL 2XTJB 1MHHA 1MSPA 4R9HA 1NMBH 4RMRA 2HFFB 2DMKA 2JB5H 4P4RA 5B21A 1J8HA 1OAZL 2R4RL 4IDJH 4JFDE 4JZJA 4AEHL 4AMKL 1P69B 3D0VA 5F89A 4M8VA 5I8OH 3QEUA 4NRXB 5AUMA 4GSDH 4DN4L 3C8KB 1PZ5B 3KXFA 4XP4L 5E5MA 5C3LD 2DLIA 1HQ4B 2VABB 1S78D 3ABZA 1MCBA 1MHCA 4DTGL 5E2JA 2J88H 1NGYB 1T03L 1IE5A 3EGSA 4HS6B 4GG6B 2NW2A 5GS1A 3U9UB 4PBVC 2E6QA 1TLKA 1NBQA 1E27B 4QOKB 3PDOB 3B9VA 1YEDB 4HMDA 4R2GC 4ZYKB 1JPGB 1KENH 1K6QH 3OKEA 5DDHA 4LVNC 4LCCB 4XBGA 3F6LA 3DVIA 5EU5B 4JFFB 4WUUD 3ROOB 4UIKH 4WWKA 5HHQB 1MVUB 2YWZA 3NACH 2G5RA 3HB3C 4K7PH 3U30C 5MERA 2EYSB 4G3YL 2XG5A 5EC2A 5DQ9A 4YLQT 1EGJH 2H2SD 4D0DB 2XN9A 4QNPF 2GUOB 4P0DA 1BBDL 1MHHB 1N64L 4JR9H 1SEQH 1DVFB 4P2QA 4P4RB 4U3CA 5F7YC 2JCCE 4HKXA 1PFCA 5EWIL 1EJOH 2EDHA 3D0VB 4OFYA 2O26U 5F89B 1GIGL 1MLCA 3QJFA 3QEUB 3S88L 1DQML 5AUMB 3BGFC 1Z5LB 3E3QC 3KXFB 4R4FH 4N9OB 5E5MB 4JFED 4LLYA 3QCTL 4FMFA 4M48H 4HAGA 4OM0H 4PLOB 2DAVA 2D7QA 3K2UL 1DLFH 1NLDL 2AEIT 1MHCB 2OJZL 3EGSB 2NW2B 4UT7H 1C08B 1IKNC 2R9HD 1IFHH 2DM7A 4XX1E 3LS5L 4LQFL 1S9WA 3VG0H 1AC6A 4JFHD 1FG9C 4Q9CA 3OKEB 5DDHB 1UM5H 4XBGB 4PJ7E 4XMKH 2XYCA 4WWKB 3DX7A 3CDYA 3IT8D 5DJDA 5MERB 5DQ9B 3GI8L 4HWEH 2OLDA 3ZT6A 3WFHA 4OZIA 2XN9B 2R0KL 4JKWA 3K7UA 4O51A 1N26A 1A3LH 3QIWD 4ODTL 2BY3A 5FOBB 4P2QB 1E4XL 3EO0A 5DR5H 3WXWL 4KK8D 1FSKB 2MNUA 4APQD 4HKXB 4I3RL 1E6OL 1P4LA 2AEQL 5IGXL 3QJFB 4RA0C 1CICD 5DJZB 5TQ2H 4ENED 3O8XA 5D7SH 4OD2A 4XNYH 1HIMH 2YMXL 3IDNB 1RQ5A 3RIFK 4PGCB 4YDKH 5DRXA 2NY6B 3NMEA 4LLYB 2KZWA 5F93C 1CU4L 3WNPA 4HGKC 5MENE 5H8DA 5D8JH 3X3GH 1A7NL 3OJDA 4WUUE 3TO4C 3BKML 4NDMA 3CXDL 3QULA 5CJ8A 4YAQA 2ZKHH 1S9WB 5FV1L 2HJKA 4EUPB 3CXHK 3N9GH 2FBOJ 1LE5A 3FHAA 4K7PX 5I9QB 4ONHA 4FNLH 3RI5F 4LF3B 5D1XC 2K3TA 3DX7B 1JPFA 3IAPA 5DJDB 1SEBA 4ELKA 2N1KA 2VQUA 4X0KB 1DFBH 2IAMB 4KH2A 1F3DH 1I9RL 4NP4L 4KKNA 2QHLA 5KTEL 1VA9A 1WTGT 4JY5L 3WFHB 5HHNA 4OZIB 4WTZA 3NFSH 4O51B 4KKAD 4M8QA 1EFQA 3DVGA 5ENWA 3EO0B 4YGAB 4MQTB 1UKSA 3QXDB 1P4LB 4KK9D 4CJ1A 3MLWL 2FO4A 4UT9H 2ADIA 3QIUD 1TJGL 2CRMA 3A67H 5KVEH 1S3KL 4R8WH 4YQXL 3O8XB 4OD2B 3EJYC 2W9LA 5DRXB 5F7DA 5HHMD 3T0VA 4HH8A 2ZJSH 1YN6A 4JFHE 3WDJA 3KYKL 2GT9B 5ICZA 4NDMB 3SO3C 3OAYK 5BCAA 3QULB 4YAQB 1A3RL 4NN6C 5L9DL 3HNVH 3OXRB 5EB9A 5AWNL 4PLJC 2HJKB 4DCQA 2NX5B 2JJVA 1LE5B 4DKEH 1FC2D 3RUGA 4KY1L 1JE6A 1I75A 4ONHB 3IJHA 2A6DA 3BZFA 3KYOA 3QG7H 1JPFB 1SEBB 2B8OT 3GBLA 4ELKB 1KB5A 2X9YA 4KGJA 4J3UA 3EJZD 1S7TA 3M17A 3O3UN 4U6YA 1I1CA 3CMOH 4M5ZH 5HHNB 5BMFL 4MNGE 4M8QB 3L3JA 1LMKA 1I9JH 4BFIA 1N4XH 3SDAD 1I8LC 1EVUA 5DUPH 2BHUA 2P45B 1DQQA 3EYOB 4QGTA 3MLRH 4H8WH 3RHWK 2NY3B 4WCYH 2HA1A 2FO4B 3DLQR 2ADIB 4Q9RH 3EOYG 5FFLA 4ZFGL 4PJXE 2NXZB 4LCIL 2DB8A 4NM8L 2IBZX 5F7DB 5MI0B 3N1QC 1F90L 1YN6B 4H88L 4FFVD 5T5NG 1YC8A 5TGBA 3QHFL 1EUUA 2G75A 5ICZB 1JWSA 2F5AH 1KLGA 3MCLL 4GXVL 3BQUD 3Q6GH 4G6MH 3RKDD 1OPGL 2VN4A 4DCQB 3KHQA 5E6IA 1FZOA 3RUGB 4P3WA 4XPFL 1TDQA 3IJHB 3KYOB 1NCCL 3VI3F 1G6RA 4I1NB 4ZS6C 2C4XA 1ZVSB 1KB5B 3M17B 1S7TB 4GXUN 4OFKA 4OF0A 4U6YB 4X98A 5FCUH 2FIRT 4XC3L 5IQ7H 3V7AE 4HKZB 4MXQC 4EDWL 4L3CA 4QKXB 3L3JB 4BFIB 4P4KA 1DQQB 5HHME 4TYUA 1UCBH 5IVZA 2R23A 1NBYA 3F58L 2IQ9H 4TVPD 2FCBA 2YOCA 3V6OC 4K3DL 1QP1A 1MJ8H 4U1LA 4JE4B 3WUWA 2FEDC 1ZHKA 1EUTA 1HSBA 4YBLB 4EI5D 4X5LA 1DP0A 1JMXA 2LVEA 1B88A 5F97E 5L88H 3S35L 1EMTL 5ID0B 5TGBB 4G9DA 4FQXB 5FHBH 2DIAA 2G75B 3S8WA 1JWSB 4XVJH 1NGZB 2D9QB 3WD5L 1KLGB 3LIZL 1N7MH 3NCYP 5EZJA 3BMWA 3P9MB 3VRJA 1J1OL 3WE6B 5E6IB 3BMVA 4HUXA 1L9MA 1A7BA 1JGLL 3TZVC 4NHUA 1G6RB 4G8EA 4RIRA 2V5MA 5CCKL 5J1SC 5F7EH 4M7KL 4X98B 4X7FC 4F3FA 4Y5XC 4L3CB 4YDIH 5ABDE 3KR3H 4OM1L 1UM6H 1X5HA 4JDTL 4ZQKA 2MSPA 1IILE 3X11A 5IVZB 1UH4A 1N5AA 1CDBA 4Y2DA 1U8HB 4W68A 3VMPA 1MFDL 4U1LB 4GMSH 4IRSD 4X99A 5CSZA 1QR1A 3WUWB 3AXLA 1ZHKB 2XRAL 1HSBB 5D7IE 4GAGL 2CGRH 2EH7H 4OCSH 2BSRA 3UTQA 3QWOA 4ONFH 3FRUA 5J1AA 1SM3H 3U4BL 1EIBA 1GHFL 4G9DB 1RUML 3BUTA 2WV3A 4CU7A 2IGFH 4YHIA 3WDIA 4JJHA 4H8WC 1Q0XH 3VRJB 5CMAB 1N6QH 1JIBA 4Z0BH 4HUXB 1VGKA 4PRBA 2YD5A 4D94A 5KW9H 1FFPA 4WI6A 4N8VG 4G8EB 5HYEA 3VRIB 4RIRB 4P46A 3PDGA 2VOTA 5SWSD 1QFWM 1UJ3C 3CAFA 2E7LC 5JUEL 1IAIL 2FX7L 3ARFA 4OSUH 4YFDB 3C6LC 4F3FB 4OZHA 2EC9T 4TVPE 5JW3L 1MCWW 4P2RA 5CEZD 3UYRH 4S1DC 2ZCLL 2F9BT 4MAYD 4U6XA 4ZQKB 3X11B 1RY7B 1AFVL 1N5AB 4HJ0C 5EUKA 4Y2DB 4PJ5D 1LNUA 3GZKA 1ZAGA 2RBLA 4HSQA 4X99B 5CSZB 1QR1B 2VDML 1WUNT 3AXLB 3CSGA 2M8XA 1W8NA 4HCRA 4GQPH 3WFCH 4LMQI 2BSRB 3UTQB 3QWOB 4UV7H 4YPGA 3FRUB 1JPSH 2GJ6B 4QTHA 2VN7A 5J1AB 5T3ZH 4PG2A 5J6GA 3NZ8A 4M62H 1MI5B 3UTTD 1U91A 2NY5H 5KVGL 4YHIB 3BPNB 2EICA 5D1QD 4FQIL 1NGWB 3VGDA 4Z7UF 2PYEA 4GRLC 3D3VD 1VGKB 3B2UD 4PRBB 1FFPB 5I30L 4P46B 1PZUB 4UT6H 4FRWA 5I15H 1MF2H 1QLRA 4TULL 4OZHB 2RFXA 3A0OA 3DMMA 4P2RB 3LPFA 3S98A 4Q6IC 4D8PA 2HMID 2ICWJ 3MXVL 3C5ZD 2AVGA 5K9KA 4H1LA 3SGKA 4U6XB 5E08H 3QJHA 2Z31C 4L4TA 4OIIH 2A6JA 5EUKB 1T7XA 4LCUA 1CL7L 1T1XA 4P5KA 5M95B 1RSFA 3V9FA 4LRIA 3S36H 2GJJA 4L9LC 4KZEH 4LPWA 1YQVH 3SDXA 4M1GH 1QYGH 3K4DA 4I3GA 2VDRH 4YPGB 3LQMA 4OLEA 4QTHB 1O7VA 3ZMRA 3DETD 4U1JA 3ARBA 4BZ2H 4PY8J 3ARXA 2XT1B 2KZ1B 3JTSA 3LEVL 3VW3H 5HVGB 1WWCA 5J6GB 3NZ8B 4ZFOL 3BSZH 5MHSD 1U91B 1VPOL 4KRLB 4HEME 1T0MA 5SWSE 4JZOA 4KJWC 2PYEB 5D7LE 3U2SA 1AXTH 1AHWA 1U3HD 1CFQB 2XZZA 4X9GA 1CYGA 5CEZE 2VZ1A 2PTUA 1CDIA 3GMNA 1XGTB 3QUYC 4PJ5E 2RFXB 1E28A 3DMMB 3QXWA 5AYQA 3FMGL 4D8PB 3N50A 4HUMB 1HDMA 2RCSL 4EN3C 1ZHLA 5K9KB 4H1LB 1TIUA 5T5FH 1TVBA 4L4TB 1ZWIA 2A9ML 2A6JB 3KPSD 4C58B 4LCUB 3BPOB 1U6AH 1T1XB 4P5KB 5SV3A 4M7LH 4HAFA 2A0LD 3UTTE 2QHRH 3H3KA 1P1ZA 1AD0B 1FV1B 4JKLA 4XC1H 2Y7QA 3UJTL 3NCCB 2X4TA 2FNBA 3D3VE 4Z77A 3VRLE 3ARBB 3PHOA 5E56A 5TF1L 3JTSB 1OGTA 5C2BL 2A6KA 4LLUA 4K3JH 2OJEA 4S1RH 1T0MB 3MC0A 4HZAA 2MWCA 3U2SB 3OF6D 5HGDA 4JB9L 1FORH 1S5HA 4YH6A 2CMRH 1CGSL 2HT3D 2XA3A 4U1SA 4EUPH 3PHQA 3GMNB 3QP3A 2VDLL 3DSNA 4XWGH 1G9NL 1E28B 3O9WA 1BWMA 3SQOL 1HDMB 5CJOH 2NY5C 1ZHLB 4LVOB 4YUEL 4E41A 2LQRA 4G7YH 4OB5L 4NQDA 1NL0H 1TVBB 1ZWIB 3ORJA 3K2MC 1CR9H 2BNUA 3EDKA 4XVUC 4EDXA 3S36X 2YA0A 1HINH 3BPCA 4U1GB 4WJ5A 3B5HA 3B9DA 1ITCA 5MHSE 4KJPD 4Z7VF 1NAKH 2ARWA 4KAQH 1P1ZB 3GSQA 4UIMA 1KLUA 2X4TB 3K1DA 4J12A 3C8HA 4AG4L 4XMPL 3PHOB 4MA8L 5FKPA 4U1KA 2VDQL 3O6LH 1OGTB 4FQPA 2BSSA 4LLUB 5E2UH 2GKIA 5I6XB 2OJEB 2KUTA 2WANA 3RTQD 3KJ6H 1RUKH 5HSFA 1WV7T 5EU4A 5HGDB 1EBAA 32C2A 1EERB 1QFOA 1JF5A 1S5HB 2APVA 1DVFC 1I9IH 5C0CA 2VRAA 2MCPL 4U1SB 3PHQB 1EHXA 1EDQA 4TTDC 5E2WL 3KPSE 1CBVL 4PJCF 3BKYL 2X7LA 1VADA 3O9WB 1JFQH 1CVSC 3WL9A 3EW3B 1HYSC 1ADQA 5K9OA 4E41B 1JI1A 4OLWL 4PRHD 4NQDB 2VNCA 1M71A 1JHLL 3QHZL 4HHAA 3RQ3A 4EDXB 5FUZH 3O2VL 3BPCB 2EO9A 4WJ5B 3K8MA 3MGOA 3FTGA 3W82A 4Y4KD 2B1AL 3GSQB 2ZSVA 4UIMB 4BSJA 1KLUB 3MACL 5HI4D 3NCFB 2YD3A 3SDDC 5FKPB 4U1KB 3T4YA 3CZFA 4ZUTA 2BSSB 1V7MH 1DSFL 2FX8H 4X6EA 1XMWA 5I1HL 4GRWE 4O58H 5KJRL 4YHML 3PXJA 5EU4B 32C2B 1JPTH 5GGRY 5IB4A 4V1DD 1J0HA 5E4IA 3UTZA 4RFEA 4PLKC 5C0CB 4X6CF 4UUJA 1U92A 1N0XH 1PQZA 5C86A 4Q9QH 3IS1X 3O4OB 2X7LB 1VADB 4PJBE 3EYQC 3WL9B 2VUYA 3ARDD 1KB5H 2DQEL 5K9OB 2NY6C 3DI3B 1UM4H 1CE1H 1Q9KB 3P0YH 3MNVA 3R1GL 4HUUA 12E8H 4HHAB 2AGJL 4JPVL 1UT9A 4X6DA 2MOVA 3GJEA 3MGOB 4O02L 5BJTA 3W9DA 5HYJD 2ZSVB 2DLEA 2OX5A 3UO1H 2LU3A 2Y1VA 5I9QC 2VO5A 4K3HA 4KV5E 3T4YB 3E8UL 4ALAH 3CZFB 5EBGA 4ZUTB 1A7PL 4X6EB 2HLFD 1OTSC 2IAMC 1JN6B 3QZWG 2HTKD 5IB4B 5CD5C 1JTPA 5I74B 1GGCL 3UTZB 4RFEB 1G0XA 2OI9B 4DKFL 3CVIL 4UUJB 1U92B 3UZVB 1FPTL 4PRHE 1PQZB 1DUYA 1R3LA 2O5XH 5EOTA 1FGVL 3IU4H 4UTBH 4ZSOA 1T7WA 1G6RH 3O8XC 4PJIF 4MJ4A 3ALXA 5ESQB 1F58L 2CKNA 5DD1L 3EYFA 1MCLA 2VLRA 4YO0A 3FQNA 3MNVB 2C1PB 2FGWH 1IAIM 3P4MA 3Q0HA 5FEBA 4K9EL 4X6DB 3CSBA 2AERT 2ICES 3Q3GB 4XBPA 5CIPA 3GJEB 2AQ2A 1R24A 5BJTB 3W9DB 3KS0H 4XPTH 3PWUA 3VGFA 5F1SA 1QBBA 3NCMA 3NIDF 1XF1A 5CJXA 2P47B 3AY4A 4FFYH 4PJGA 4V1DE 2X70A 1YUHA 4MMZC 1MCPL 1UZ6E 3HE6A 2KDGA 1P4BH 5CLWA 3P4NA 4AL8L 1MFEH 3VDBA 3VGAB 3WEXB 5JTWA 5E6YA 3O2WH 2PXYA 4FFZH 4BM7A 1Y6NR 1FDLL 5LXGH 2D31A 1IBGH 1WFNA 2DLGA 2NY3C 1CDCA 1DUYB 1R3LB 5EOTB 1EZVY 4KJYA 1FVCB 1II4E 3CFJA 2VZUA 3EYFB 4GS7B 5DURD 2VLRB 5KS9E 3MRHB 1IL1B 1IGFH 5HYJE 1MJUL 1Y18A 4U7MA 3CU7A 3EOAA 3MYJA 4NBXB 1PW3A 5B3NA 3QUXC 5GGVH 3P4MB 3V5KA 2PNDA 4Z5RA 4OCXL 5BOZG 2EIZA 4IOSD 1VHPA 4Y7MA 5C0NC 4XBPB 5CIPB 1L7TL 2YPLA 1R24B 3ZKMC 5CGYD 3PWUB 4U33A 4HH9A 1KN4L 1G7PA 4WNQB 4KKCD 5HVHB 5D72L 1OOAA 1KXTB 4PJGB 5JPNA 2X70B 3MREA 2APTA 1BEYH 4XCYA 1S9YA 3P4NB 3LS4L 4N0FB 4P2OD 5GRJH 2IFFH 4RRPA 2CLVA 2PXYB 2WIMA 2GHWB 5HDQL 3QQ9D 1DJSA 3RKPA 2ZNXA 3KLAA 4KTEH 2D31B 1T5XB 3MR9B 2DM2A 2F54D 1AGCA 4KJYB 4NFCA 3ZZ1A 3CFJB 3MRNA 2X4RA 5IM7A 1YDPA 4U1MA 5DF0A 3HNTL 3T77A 2FHFA 4QNPE 2CKBH 5D1ZA 1BPVA 1YY9C 1Y18B 3SGJA 4HQQH 2I60H 4OFDA 3EOAB 3MYJB 3S3SA 4QXUH 1XT5A 4FQXC 4Z5RB 4PJ8C 1RUAL 1L0YA 5IT2L 1YNLL 3CFDA 5JNYA 2YPLB 3UMTA 4Y2OA 5AZEL 5DSCA 2IPUG 4HH9B 5E6IC 3UPRA 2VL5A 1DBKL 2HRPL 5JPNB 1A1MA 3MREB 4HCRH 2QV2A 4XCYB 4L4VD 3MFFA 1S9YB 2OSLA 1DL7H 3VXOA 2CLVB 4NQCD 1KPVA 2R0WL 1B0RA 4EUPG 3I84A 5HDLA 5I75B 4FA8A 4OV5A 5BRZB 4WDIA 3KLAB 2DKUA 5GRYA 5E95B 1HKLL 3VDAA 4UILL 7FABL 3MRNB 2X4RB 4HX1A 5IM7B 3RJDA 4U1MB 3ARQA 3IB4A 3T77B 2DI7A 5D1ZB 3C9NB 1ZGLA 5I0DA 1GL4B 4KQ4L 5C6WH 3VFUA 4FZ8L 1IC7L 1QA9A 1FIGL 4G8FA 4BSVA 4WFGD 3GMPA 1LO3L 3CFDB 4XAWH 4H1LH 5JNYB 1U2HA 3BIKA 5E1AA 1B0GA 5DSCB 3GSUA 5MEQA 2J6EH 4NQXA 5C9JA 3V52H 3UPRB 1YMME 2VL5B 3B9EA 2WMPA 4KZDH 1LO0L 5I18L 4JM2A 2YUZA 5C70A 1H9VA 5F6HJ 4M1CC 4OD1H 1T2QH 1A1MB 3TFKD 4B5EA 1HK6A 2AXGA 3MFFB 2MQ0A 2OSLB 1A6TA 2F54E 4FABH 3VXOB 2ICCA 4NGHH 1KPVB 1B0RB 4FQJL 5FUCC 4Y88A 1ZT1A 4OV5B 1GGBL 1AKJD 4KDVA 4WO4D 4WDIB 1JTTA 3K0WA 1JNJA 1T2XA 2Y36H 4PR5A 4Y2DC 1Z6JT 3BE1H 3VI4F 4LDEB 2VL4A 2VXTL 1BVKA 4HX1B 4WTZG 3T1WA 3A6BL 2IQAA 1I1AA 1FRGH 1QRND 2FJFB 2J5LB 1ZGLB 2LTQC 2Z8WC 5HHXL 5D71H 1PKOA 3X14A 4NN7C 4KKBD 3VFUB 4U1IA 4G8FB 4BSVB 2ZOKA 3GMPB 1KC5L 5B3JF 3BIKB 3EYUL 4L4VE 1IGMH 3BPNC 4L5FL 5E1AB 1B0GB 1L6XA 3GSUB 5MEQB 3C2AL 4NQXB 4OAWA 5F9WB 5C9JB 1Z2KA 4NQCE 1HCFX 1WCBA 4JM2B 5DD5H 2IH1A 4OJFL 4J4PA 4TPRL 3E6FA 3RZWA 3KPRD 2AXGB 2C3HA 3WXVL 2ZPKL 3LRSA 2JE8A 3L95A 1WT5A 1ZT1B 1H5BA 2HG5A 3ARWA 1IKFH 3CGTA 4MAUH 3M07A 3P40A 1G7LA 3H42H 1F4AA 1RURH 4DK6A 4YEFA 3NABH 4PR5B 4OKVA 5L6YH 3OTTA 1XF5A 4V2CB 1RV6X 1BVKB 5KSAD 2BY2A 5E8PA 4WFGE 4X9HA 2IQAB 1I1AB 5ADPL 4HWBA 2R1XA 1OM3L 1MJ7H 3WV0A 1QKZL 3D0LA 1A22B 3TPUA 4WW2C 3X14B 3A6OA 2NYYC 3K8KA 4U1IB 1AJ7L 2ZOKB 4KRNA 1FYHB 4TRPH 5LG1A 5KVFH 2YZ1A 3AB0B 4P5TA 3P0VH 3P2TA 4E0RA 1U8QA 1HILB 1SYVA 4WEBL 4A2MA 4OAWB 4ZS7H 5C0RL 4LARL 5SWZD 2QQQA 3GM8A 2Q87A 1WCBB 2IH1B 1FFRA 1NBZA 4P49A 5C07A 4Y4HA 3E6FB 1CLZH 3LZFL 4HUNB 3NAAL 4NC2B 2FIKA 1UEMA 1QFUL 2H2PD 4O4YL 5DRZA 5ERWB 1JF1A 5GSRA 3L95B 2DQTH 3DMMC 1WWBX 5MEOA 1H5BB 3X3FH 1XIWD 2LABA 1JYVA 3CX5J 4PGBA 5HPOA 3SGKC 1G7LB 1QRNE 4JJ5A 4UAOB 3V79C 5FM5M 3TA3D 4OKVB 4Y5YC 2VC2L 3TYGH 2AK4D 3UXFA 3VI3E 2DIJA 1XF5B 3WS3A 3OAUL 3S34L 4BQ8A 2EXWD 5E00A 5HHVL 3LQZA 3UZQA 1JP5A 1RZKH 4F37F 1FH5H 3U4EA 5T1KA 3D0LB 5DJXA 3CH8A 3TPUB 3ARBC 5D2NB 1JRHI 3G6AA 3HZKA 5BV7C 3HS0A 3GNML 1KIQA 1T22A 1WC7A 4RCAA 5FDWB 5LWYL 3HC4L 1NDMA 4LAQH 4P5TB 1TQBB 3KPRE 4E0RB 3GIZH 2V5SA 2WUBH 1SYVB 2NTFA 5B8CC 3TP4A 5HY9B 5I8EA 4ODVL 4LU5L 2EIBA 2PYFA 1NBZB 1P7QB 5C07B 4K2UH 4Y4HB 4PTTA 1TNMA 1I7RA 1OT2A 1U3ZA 3OB0H 4JY4A 3QNZA 1G1CA 3FRPA 4KVCH 2FIKB 2BRRL 2WBJD 3VFRA 3NCJL 3MJ9A 2C26A 5DRZB 4NZUL 4S1QL 4TNWF 5GSRB 1NFDF 1I7UA 1A6WL 5MEOB 3SOBL 5DJAA 3CX2A 3RY6A 4LVOC 1ZLWK 4NUGH 4QXGL 2CK0H 4JRYA 2BSTA 3F7PC 4NRZA 5TE4L 1F4WL 2BOCA 5CP3A 4WEMB 4HWUA 4U1GC 4UZGA 4DGYH 4PJ9C 4POZD 3LQZB 5L8KB 2DQCL 5MP6H 1P6AB 3MLXH 3U4EB 4YHYB 1CFVH 5T1KB 5DJXB 4ZPTA 4JPWL 4XCCH 1NMBL 3G6AB 3HZKB 3HS0B 2JB5L 2W59A 1KIQB 1T22B 1WC7B 2EC9U 1NDMB 4FHBD 4IDJL 3QPQD 4I18B 5F1IA 2NTFB 5I8OL 4GSDL 3IF1A 5I8EB 2BY0A 2PYFB 4RMTA 4XI5D 5FYLH 4E5XA 4PTTB 1I7RB 4JY4B 3LD8B 1TITA 5IW1A 3LQAH 3QNZB 4OZGA 1HXMA 3VFRB 2J88L 3HR6A 2AK4E 2Y9RT 4OT1H 1T83C 1CZ8H 1I7UB 3O9WC 5I76A 4JO1H 4MVBC 2VWEE 3HNSH 3QXAA 2CRIA 1KENL 1TJIH 1K6QL 4JRYB 2BSTB 5DFWH 3G5XB 2OTWA 2BOCB 3JV6A 4UIKL 5C0AA 4Z6AT 3NACL 4K7PL 2DDQH 2HLAA 2OM5A 5JXEA 2NY1B 3F7YA 3UBXA 43C9A 3OAZH 4AY0A 1EGJL 4Z7WF 4X7TA 4TNVK 5IWLA 1X7QB 4ZPTB 4BK5A 3G9VA 4KQ3H 5F7WC 4JR9L 1SEQL 5CKAA 5J7CC 3H9SD 4LFHG 2AEWA 3Q5YA 4HUKB 3HUJA 4HLZG 2W0FA 2ITDA 1EJOL 3MRCA 1CN4A 3PWVA 4OI7A