4ZUWB

Crystal structure of equine mhc i(eqca-n*00601) in complexed with equine infectious anaemia virus (eiav) derived peptide gag-gw12
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Classical MHC class I antigen
publication title Structural Illumination of Equine MHC Class I Molecules Highlights Unconventional Epitope Presentation Manner That Is Evolved in Equine Leukocyte Antigen Alleles
pubmed doi rcsb
source organism Equus caballus
molecule tags Immune system
total genus 14
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zuwB00
3FFDA 1P1ZA 4BKLA 4ENED 1U6AL 1OARH 4YHLL 2ZG1A 5E6ID 5MI0C 4Q9QH 4JZOB 1DBJL 4M7KH 5DR5H 3MOAL 2Q8AL 1AI1L 1NLBH 3RNQB 5GGRB 2AJ3A 1IKFL 5CD3B 2ZUTA 2AAVA 1LDSA 2P5WB 2EDWA 4PJ9B 2WUCH 3NIFF 4JLRB 4OZIE 4M62H 4XX1E 1OF2B 4WI4A 4DKDC 5SX5H 3O2DL 4QWWC 1JV5A 3O4LE 1OB1B 1JUFA 2X41A 3GSVA 3HAEH 3D0VA 5E7BA 1RULL 4U4BA 3PWUB 4EKXA 3GSOB 1I9JL 1QLFB 4MNQB 1IL1B 5SWQA 3HE6C 4D94A 1I85A 4YHIB 2GTZB 5E94B 5BQ7A 1GGIH 3PP3H 3QPQD 1ZT7B 4Y16B 4ERSL 2X1WL 3OKEA 2I60H 4LP4A 1X4XA 1A1NB 4NQXB 4XT1C 5DJ2A 4JDVA 4HW6A 2VZSA 2Z31B 1IBGL 4AENA 3C2AL 2Y6SD 3E6FA 4F9PC 3ZDXE 3SPVB 2ICEB 3PHOA 3QI9B 3VFPA 3HCVA 5CP3A 3QEQE 1UWXK 1U8IA 3BGFC 1TVBB 3UJJH 5IW1A 4HS8L 4MAYC 3LMJL 2AEQL 5F70A 3LQAH 3QNZA 4NHCL 4XP6L 3AS2A 5IB1B 4FTVD 1BECA 1BIIB 1Z3GL 3KPOB 3S97C 3GBMH 3S88L 4MNGB 1OCWL 4CU6A 2LTQB 1MLBB 3VI3F 2A83A 5CINH 4OCXL 5ELIA 1D5BB 1AHWA 3K1DA 2D0FA 2Q86B 2HWZL 5IT2H 2Z31C 4Y4FD 4M9PA 5DFWH 1FIGL 1J0KA 3HNSH 4DVBA 5GRVL 4YO0B 4NQDE 3QI9C 3LS5H 4JGJA 4R4BA 5ETUA 3T0VA 1MAML 3DUSB 5DMGD 1KPUA 3FO9B 4JGUA 1X4YA 4WI5A 3LKPA 4ZMAT 3CPLA 3VXSA 2A1WL 1UB6A 2YR3A 4PP2B 5CAYB 1I7UA 5HHVH 5K9QI 5J4MA 4ALAL 4OZFG 2BSSA 1TTFA 4NNYB 1U8HB 5E8NB 2CGRH 3BESR 5CKAA 4FP8L 3GJFA 2BRRH 3S8WA 2Q8BH 3LHPH 3BP6A 1IC4L 2COQA 2NYYC 3GMLA 5GPRA 3V6FB 2CLZB 3SDDA 2E8YA 2MFNA 5C0RL 2JJTA 4F7EB 4WI9A 5IVOA 4X6DF 3SDXB 2IG2L 3QCTL 4Z95H 4EXPX 5J56B 3KS0J 4APQD 3PWPA 2J3SA 4J4PC 1L6ZA 1BF2A 1BOGB 1UWXH 1NGQH 3DYPA 5LBSH 3U4EA 2VZOA 1GH7A 1AR2A 5I16B 5I19H 5IHBA 1CYGA 4F37K 1QRNB 1BVLA 1BPVA 3KPPB 3RX8A 2HRPL 3TPUA 1MPAH 5GZOD 3QO0B 2R0KH 4QT5B 3NCYP 4HPOH 4QYOA 1J5OH 3TBYA 4AG4H 5CD3A 5IHZA 3ZKMD 3VFVB 1CF8H 2VR4A 5JW4Q 4PJ9A 3RBGA 4YK4B 5KS9F 4HC1A 2ZUYA 4N8CL 5E2JA 3SGDH 3ZDYF 4BH8B 4JFYB 3MNZB 2GCYA 3ARDB 5AEAA 4QRPB 3P3YA 2EYSA 2XTLA 2E9JA 4AK1A 1LEKB 5BV7H 1BFSA 1A6PA 3CZFA 4WUUD 3KPSB 4NQEA 1AE6L 1UVQA 1QFWM 5FYLL 3CU1A 2HVKB 4QEGA 4POYA 1ZLWK 2J8UF 1VERA 3PWUA 1JF5A 1YNLL 4X5XA 4MNQA 3QWRA 1NGZB 3FQNB 3WKML 1AD0B 5E94A 4TSAH 1EZVX 4CN6A 1MUJA 4QO1A 1HNGA 4NC2B 3I3EA 1ZT7A 4F2MB 4BFIA 4JFOA 1G84A 4LVHC 4NYLB 5FM8A 3FN9A 3K2UL 1A1NA 4NQXA 5E03A 5I1EL 2FO4B 4LLDB 4PP1D 3VA6A 1NGYB 4IDJL 2VTFA 3P4NB 2Y07H 4UTAL 3QCUL 4FS0A 3BN3B 3PJSB 4UT6L 4K71B 1QD0A 3QBTB 4HJ0C 2A77L 4NQTA 5C09E 3WO3B 1OOAA 1L7IH 3NPZB 4PREA 1K85A 5D1QA 1FCCA 1MCSA 3M8OL 2BVOB 1KN4L 4XCCH 1K4CA 3U7WH 3BDXA 3GO1H 1FDLH 1HWHB 4AH2B 5J9PB 4OZIB 1F2XK 3QUZD 1BIIA 2VDKH 1X3DA 3SE9H 4MNGA 3O4LB 1W0VB 4DWHA 1MLBA 4LDEB 1I75A 4M7ZB 5E5RB 2Z9TA 3H7BB 4MNHB 5JW3H 1PKQE 1T4KA 1N7MH 3MLYH 5DD5L 3RWEA 3JBG7 3UROR 2X6MA 1BMGA 1LK2B 5FYLE 4LCYB 1R0AL 4YO0A 2XI9A 2PO6B 4ISVA 4K71C 2DQUH 3U0WH 3LH2L 2F8XC 2C3WA 1JZ8A 1RSFA 3FO9A 3DETD 3JVGA 4Y4HA 1NEZB 1HH6B 2BK8A 4LLUA 3ZE0E 5D71H 4PP2A 3TN0A 1IAIH 3QEQB 4NJ9H 3AREA 4LLMB 1Z9OA 3QQ9C 4HJGA 5E8NA 5D70L 1OQXA 4X80H 4ZO7A 5D72H 5E2UL 1NFKA 2XKNB 3VFNB 4M7ZC 3P9LB 4H25A 5DMKB 3V6FA 1IT9L 4HH8A 2VXQL 2CLZA 4U0RC 3U48A 1YQVL 2YPLE 4F7EA 2D03H 1S78C 4X7SH 1DVFD 5INCB 5ITBH 4P5TD 3SDXA 1P6FA 4I13B 1FV1B 1GC1C 5KVEL 4YEFA 4YH6A 3ARRA 1BOGA 1QKZL 3G08A 3OKDB 3EFFA 5JDSB 5ESAB 4FFWC 4FFYH 4MS8C 2VLRD 2Z91B 2DWDA 2IWGA 4NSKB 3SCMD 5I16A 1QFUH 1FFOB 2K3TA 4M93C 5LCVL 5IB3A 5BVPH 3T77B 1QRNA 3O0RH 3KPPA 3QO0A 5LVEA 3ZLQC 4U6VH 5JA9A 1MRFH 4U1MA 4MSWB 3VFVA 2QHLA 1MFEH 3VRIB 4Q9RH 2ARJB 4JFYA 1E4KA 2FD6H 3K0WA 3ARDA 4J12A 1F45A 1JTPA 1MJ8H 4MD5A 2FEDC 1VFMA 3JUYA 1AD9B 5F1KC 5IF0B 1M6OB 3KPSA 4I3SH 3RTQB 1FZOB 5DJAB 5HDOA 1CFVL 4M9OA 1NCDH 5KW9L 2ZCHH 4UAOC 3FQNA 3I85A 4ZUTB 2IPTL 4RSVA 2V2TB 1ADQH 1XR8B 4H88L 2Y1VA 4F2MA 5FGBC 4NYLA 4PD4K 3P77B 2YRPA 3H9SE 2R4RH 4F57H 4V2CB 1JHLL 4LLDA 1NGYA 3P4NA 5ERWA 2VR9A 2VH5L 2VDRL 3PGDB 1D7FA 4LCWD 1MCRA 1X4ZA 4WGVB 5J13B 3OQ3B 3NCJH 1TVDA 3UTPD 4D3CH 4RNRB 1MHCA 4OIAA 1S7WA 1FZMB 3UYPA 2LAAA 4X0KA 4XXDA 3WIIH 4OZIA 4AH2A 1RVFL 1ONQA 2VITA 3DXAE 4OFKA 3CX5K 4AIZA 4YZFF 1AR1C 3O4LA 4XVSL 3VDBA 3ARSA 5FUZH 5ANMA 2W91A 1U93B 1JGUH 3QIBD 2ITCB 3SN6N 3VCLB 4HCRA 3H7BA 1TZIA 1G9MC 5GS0L 4JHZA 4PJEE 4XB8A 2QR0A 1NUGA 4FRWA 3ARBD 3O41B 1Q9WB 1LK2A 2M8XA 1OAQL 1XF4A 4JFED 3S96B 2PO6A 1U91B 1A9EA 5ADOL 2MSPA 5EU6D 4EI6B 5I8OH 1HH6A 3QZWA 3V0AC 3ARGC 4OIIH 3WXWH 1SYVB 2DKSA 3QQ4A 4V2BA 3QEQA 3RVXC 1A7QL 2ZCKH 5C09B 4ZUSB 4XC3H 2O5XH 1BHGA 4XVTH 1CLOH 2HJFA 5D1ZD 4LSUH 5EBMB 2XKNA 4FQXA 3DO7A 1ORSA 3VFNA 3VMPA 4DTGL 5EZIL 1BOYA 5DMKA 5A2IH 3NN8B 5SX4I 1ZLVK 3RJQB 1LK3L 1NGWA 4DVRL 4M5ZH 3EJYC 5DEFB 1A9BB 1MCIA 2NW3B 1IQWL 2V5RA 4UV7L 2BJML 1CFNB 3ARTA 1JMXA 5INCA 4B5EA 2OMBA 5CS7A 1R3HA 4OF6A 1PKQB 1YJDL 3O2DA 3PWJA 5J12B 3JV4B 2DQIL 3THMH 2AJYL 1G7JB 3OKDA 4TUOA 5JDSA 4O00A 3E8UL 2ZOLB 1RK0B 3HPJB 4R3SA 4IS6A 2F58H 3VXPB 1A7OH 1NMAH 3T77A 2GITB 4QXWA 1P9MA 3LS4H 1SY6A 2MQ0A 5EO9B 1T80A 5F3BB 5GS1B 1I3RB 1K8DA 1A0QH 4YUEL 4Y5YB 3STZB 3GNML 4KK9D 4BJLA 4X5LA 2ARJA 3KYOB 4YBLB 4PGEA 5TE6H 5GGQH 1RHHB 1EDQA 4QHNB 4UILH 4UOW1 2YPLB 5J12C 2HMIC 5AUMA 3CNKA 5IF0A 1M6OA 2VDOH 3CVIL 3RTQA 1FZOA 1T2QH 2HT4D 1IC5L 3QRFM 5CEZL 4KRNA 1ERNA 2DQFB 1KTKE 1CR9H 4R6UA 4F8QA 4NGHL 3QXDA 4ZUTA 5FYKD 1XR8A 1MREL 2DIJA 4R4FL 3GBLA 3OG4B 3QUYC 2EO9A 1W8OA 3O9WB 2EEBA 1JNJA 3MC0A 1ZLVH 3C6SB 1T7ZA 2Y06L 5E4EB 4YBLC 3PGDA 2EH8L 3NVQA 5HGHA 1EV2E 4PG2C 4RNRA 4W4OA 2SEBB 3O6MH 3RKDD 4XP9H 3BVNA 4QRRA 2VDQH 1FRGH 3BP4A 3RUGE 3FQWB 5CJOL 5LWYH 3FN0L 1F4AA 1B2WL 2HJKB 3T3MF 3JWNC 4M7JH 1RUAH 2Z8VC 2YRLA 2NXYD 1G7IB 2X4OB 3WFHB 3REWB 4CKVX 3B5TA 3OV6A 3ZKNC 1MFBH 4D9LL 4XRCB 4FQ1H 1OT2A 3MYZA 2YD2A 3O41A 1E27B 1Q9WA 3OKKA 3Q0HA 4PRDA 4FXLA 4OD3H 3KPTA 3S96A 3GJFK 4DFHA 3VXSD 5E4EC 5CEZE 3T2NH 5BZDB 5F7EL 3H9SB 5FUOH 5IHUH 1W2KT 2ICWI 4RAVB 1K2DB 5EUKB 2LE9A 1P5UA 1PD6A 3VGBA 4P23B 2EDQA 3O3EA 2Z35B 3HA0A 4QTIL 4WW2B 4YXHL 2JKXA 2OM5A 5FYKH 3T2PA 1W0WB 3QIWA 4L29A 5C09A 2JB6A 1TIUA 1PVHA 4JM2A 4TRPL 3RWDA 3SDDD 3QQNA 4NM8H 1J87A 3T0EE 5EBMA 3BRGC 2X42A 3QCVL 1Q9LA 5L6YL 1XR9B 3DXAB 3BEVA 1JTOA 1C7TA 3FOLB 5DEFA 1A9BA 3PWPD 3FB7A 4KHTL 2QADB 4CDGC 2XWBB 4Q0XH 4LARL 1J05B 2CDFA 2EC9T 4HV8B 4TVPD 1F6FB 3WUWB 1JRHH 4PJEB 4G8EB 3TESA 4XVJL 3JV4A 4DK6A 5C1MB 4LQFH 1FFQA 2JE8A 4XMKL 1G7JA 4EN3A 3B43A 3TO4B 1QLEL 2ZOLA 4KDVA 5L7XL 3HPJA 3BZDA 3RZCA 1QQDA 5I1CH 3ILPB 3VXPA 1JGLL 1QOKA 4OZGF 4GRWE 4POZD 2AJSL 2W1NA 4XMLH 4XPBH 2GITA 4Q6YA 5H94B 3SQOH 3NTCL 2Z4QB 4PJ9D 3WFBL 3DMMB 1S7QB 1AFVH 5GS1A 5JXEC 1I3RA 1ZVSB 4DKFH 3UJTL 4FQHB 3B8YA 4Y5YA 3STZA 4ZFGH 1UKTA 1WLHA 1XZ0B 1F58L 3KYOA 5CLWA 2GJJA 1S9XA 1A3LH 2DBLL 1RHHA 4OLUH 4QHNA 3DURB 1EHLL 1NBVL 2YPLA 3GJFH 2AI0H 1FLRH 4MNQD 3QWRD 5EOCJ 2BZDA 1BQHA 4XPGH 3VA2C 1KLUA 4Y16D 4L3CB 4U1GC 3CSYB 2DQFA 2BVQA 3ULVL 2NY7H 2IPKA 5DUML 1J0HA 3CIQA 3KJ6H 2FIKB 2EKSB 2E7CA 3DMMC 4TSBL 3BQUB 3ROLB 1TJGH 3SO3C 3O9WA 3ILQD 1A6WH 5IW6B 4R90H 4KVCH 2F19H 5D1QD 1RUPL 3MRPB 4TTDD 3PQYB 4O2EA 4LSVH 3Q6GL 3FQWA 1I3UA 1GYAA 5DK3A 1H15B 2VDMH 4JFHE 1F6LL 4BZ1L 2AEPH 5T3ZL 1YDPB 1H3TA 1F2QA 1G7IA 4D0BB 3WFHA 2CJUH 5GS0C 4UNTA 4NFCA 3WFDL 1BVKB 3HC4L 5FUCE 1F11B 1RIVL 5DVOA 1ZT4A 2FX7L 4U1SB 3G9VA 3IJHB 4XZUB 5FIEA 2R1YA 4MVBC 5BW7A 3K3QA 1E4WH 4G6JL 5C0AE 4Y4HD 2YN3A 3MRHB 4AQOA 1EIBA 3IRZA 1RZKL 3UPCA 4I3RL 2UY6A 5BZDA 3QRGL 3SDYL 1DUYA 3TN0D 3H9SA 3R8QA 3ULVE 1CS6A 1T6VN 1L7TL 4Y5VB 2JJUA 4RAVA 1YEDB 1D5MA 5EUKA 4EI5C 4CJ0A 5D5ME 4P23A 1F4WL 3B3IB 4CGTA 5F9AC 4HG4K 2Z35A 5T1DL 4WW2A 1MIEL 4NNPH 1I8LC 1J1PH 1W0WA 1OP3K 4PG9B 3LB6D 4OTXL 5K93A 3HNTH 3RU8L 1MCFA 3RUGB 3DXAA 4B7IA 5I17B 3RFZC 5GGVL 3TJHD 2YZ8A 3TBWB 3FOLA 4WWID 3TH2T 2VQ1B 2GYSA 1IC7L 4UNVA 1M05A 1MVUB 1J1OL 1MELA 1MY5A 4IBLT 1UFUA 1ZV5A 1YJDC 2PR4L 3QG6A 2QSVA 3SO5A 4A2LA 4X6CE 4PJEA 2MMXA 4KKLC 2R0LL 4G8EA 2PYEE 1G6RL 1PEWA 3EHBC 1QRND 3VFRA 1QLRA 1X5HA 4G7VL 4X9GA 5D7IF 4MQXC 4S1RH 3VXOA 1X5XA 3OR7B 3ILPA 3MCLL 4KHXH 3WHXB 4J3XA 1VESA 2ADGB 1D3CA 1SJHB 1OD7A 3K4AA 1ES0A 1S7QA 3MLWL 4M6OL 1XIWB 1OTTD 5CD5C 4QHUB 3ARXA 2WBWB 4N5ED 4FQHA 3ARDD 5FF6A 3NA9H 3T0EB 1HQ4B 1VPOL 3V4UL 1IAOB 1ZHKA 4YX2H 1WZ1L 5C0CE 4L8SC 2MQ3A 1T21B 3KPSD 1I8MA 2VN7A 2PW2B 4RRPG 3DURA 3P30H 1IGFL 4LRNH 2R9HC 1FQ9C 3GZKA 4V1DA 3GI9H 3MLTA 3IFNH 3MRLA 5D7JC 1EO8H 1CIDA 3QEHB 5E2VH 2VLJA 1ACYH 4OCYH 1JPFB 4FOMA 3D48R 3EO9L 4MQSB 2V5TA 2MWCA 1F5WA 3OZ9H 4K23L 5HHXL 5KANG 2VXSH 1OP3H 4Z7VA 3PWNA 1F42A 2Q20A 3O6FB 4LSDA 1IEBB 3BQUA 4GRWB 4MJ5B 5HHPB 4K7PY 3BKCL 3T0EC 4OQTL 4I0CC 1B88A 2EYRB 5FYKU 5IJVA 3VXTB 1RUQH 3RWIA 1HQRB 4BSVB 5F9OL 4LCIL 5TDPA 3QQ9D 4JQXA 4XPTH 4LSPH 3O4LD 5F6IB 3RPIB 3PQYA 4WENB 1ZVYA 4U1NB 4NP4L 1NH6A 4IRJC 3RVVC 1IM3B 4UDUA 1FJ1A 3GSNL 2BVTA 4ZSOA 5M95B 1YNKH 3TO2B 4GW4A 4NNXA 3V52L 1BAFL 3MUGA 1BVKA 1F11A 1DFBL 2DD8H 3EOAB 1JZ3A 4XXCA 2PO6D 2CR6A 4U33A 4U1SA 4B0MM 3IJHA 4NO0B 5GJTH 4XZUA 1MCNA 2HJLB 2XFXB 3VH8B 1ETZA 3L7FB 2ADFL 3FOMB 3MRHA 5ACMA 5EOQH 5JPMB 1EEZB 3RGHA 2XN9E 2EH7H 5D7SL 3S34L 4Y7MA 3QEQD 4Y5VA 4L8BA 1YEDA 3J7HA 2PKDA 2CO7B 1KJVA 2L7UA 3MV7A 3LRHA 2ADJB 1S5IH 5F6IC 4KZEL 4YFDB 5DRWB 3G04B 3MODL 1IAIM 4FQXD 2EYTB 3H3PL 5E2TH 4PG9A 3FHAA 2IBBA 3IKKA 4M1CC 2UYLA 1BX2B 4HHAA 5DI8A 4CMMA 2DQDL 3RUGA 3HMXH 1FE8H 1CFTB 4ZOAA 5F71A 2VQ1A 5KSBE 4LLWB 1U3HB 1UH4A 4P9HH 1GIGH 3I9GH 1UYWH 3UYRL 3A0OA 5DO2C 4OCLC 1A6TB 2NNAB 4HCRH 5C0AB 4M5YL 1Q72H 3DX8A 1KNOB 1NMBL 3AGVA 3L5WB 4OAWA 5D6DA 5I1GL 3OR7A 2ID5A 1AGEB 1IZKA 4HT1L 3GMPA 4X9FA 1MCQA 4DFIA 3KLHC 5D5MB 4I2XE 4JRWA 4FQCH 4OCSL 2ADGA 1OVZA 4UQ2B 1T1YB 3TCXA 3FRPG 1UH3A 1GC1H 5GQBA 4ZS6C 1XIWA 4Z77B 2QKIA 2NY5L 3NH7L 2Y5TB 1ZT1A 1NDMA 3H0TB 1HQ4A 4Z8FH 1U3HC 2GK0A 1IAOA 5HYSG 3ZTJG 2WNGA 4GLRI 2HT3C 1T21A 2A6IB 5FUCC 3RTQD 4YHLH 3L3GA 4P46A 4PGJA 5C3LD 1DBJH 3MOAH 1CICC 1YC8A 4XMPL 1AI1H 2Q8AH 2UZIL 3S35X 1U8PB 1IKFH 1RIHL 5CHNB 5GRVK 5M94B 4X6CB 1C16B 4M6NL 4BSJA 5EBWA 3PDGA 3BMWA 3P4OB 3ARWA 3KAAA 4EOWL 3ULVC 2BNUA 4QOKA 2PYEB 3ROOB 5ISZE 5I9QB 1NFDE 4FZ8L 3CMGA 3O2DH 1WWWX 4N0RA 3RRQA 1HXMA 1P4LB 3O6FA 4PJIE 1IEBA 4RFNB 3P73A 4HD9A 3MRBA 1B0RA 3RHWK 4MJ5A 5HHPA 5IJKC 1TENA 2EECA 4OSUH 2HH0L 5DJ6A 1F4YL 5HGAB 2EYRA 4N8VG 4XPAL 4QRRD 3VXTA 4Y2DC 4GUPA 1HQRA 3CXHK 3P0YH 2XY1A 4OUUB 4ZG1A 4ERSH 1WWAX 3LSOA 4KKBD 5CJQL 3RPIA 4F33A 5DLML 5C0CB 1CTOA 4JANB 1QFWI 1UC6A 1IBGH 1IM3A 1P4BH 3C2AH 3QULB 5IBUG 3DOSA 5I9QC 3PV7A 1YEJH 5K9OB 2ZSVA 1DEDA 5E8OA 5C2BL 4HS8H 4CN1A 3LMJH 3C8HA 2AEQH 2BSRB 5I0ZA 3EOAA 4RFNC 4QRTA 4NHCH 4XP6H 3VWKC 1R3JB 5FK9B 4KTDL 2HJLA 2XFXA 1Z3GH 1K8IA 3L7FA 5KOMC 3QNYA 1OCWH 4MWFB 3FOMA 4JO4H 3CCHB 4S1QL 1B4JL 1EEZA 3CFJB 1IM9A 2EC9U 1G6RB 4F3FB 2YD6A 5C09D 4OCXH 4WEMB 4JM2D 3AS0A 2BDNL 1S7RA 3G04A 4K94L 2EYTA 4Z0BH 1U8NA 4JR9L 4Y4KB 5EO1A 4ZUVA 1DE4A 1IAKB 1B6DA 3OB8A 4NZRL 4P2YA 1WISA 4IOFC 2O5YL 5DRNA 4U1IB 1MAMH 1MNUH 1BX2A 5CZVL 5I6XB 4J8RB 4DCQB 2PXYC 1NGXB 2XWJA 1NGPH 3IF1B 5C2UB 1CFTA 5MEQB 1H8OA 4BYHA 2YN5A 4OGXL 4LLWA 4UB0L 2IH1B 4ZXBA 2ED9A 3QT2A 4NQUA 5FYLD 4FP8H 4EN3D 4TNVK 4TQEH 3WJJA 1IC4H 4FQIL 5MEPB 2NNAA 1ED3A 1JBJA 4CVXB 2YUXA 3S3PA 3ULSA 3LVEA 3IDNA 2HLAA 2XN9B 3JWDC 4TSCL 4X4ME 1KTDB 1IKNC 1AGEA 3HB3C 5C6WH 4XPFH 4F9LC 2IG2H 4OFDA 2CIKB 3TBSB 3MRKA 1UCBL 1Z6JT 3CC5B 4UQ2A 1J12A 1BF8A 3WNLA 5ICZA 2KUTA 1YPZF 5JZ7C 4Z77A 2EO1A 2Y5TA 3V0WL 2YPLD 3AM8A 3H0TA 3HUJA 3VI4E 4FQLL 4ACPA 2R2HA 2EDKA 1QRKA 2QJDA 2NX5A 2R29H 5IWLA 3TM6A 5J1AA 3VFOA 4KU1A 2FBJL 3MZTA 5KSBB 2HRPH 4MMXC 1G7MA 1U36A 4ELMF 1CE6B 1U8PA 5GISL 5CHNA 1NLDL 1R6VA 3GSNB 5D2NC 4Z6AT 2FRGP 4PLOB 2EDJA 1BFOB 3AREC 4N8CH 4HLZH 4PJAF 4F7CB 2EDEA 1E4XL 3O9WD 1C08A 1P4LA 3F12B 1A7PL 5GJSL 1H8NA 3PV6A 2OJEB 1Q38A 1AE6H 4Y88A 2D4DA 1XT5A 5FYLH 4JVWA 2G2RA 1SBBA 4I2XB 3BT2L 1W72L 2YUWA 5A2LH 4JFZL 4KK5D 3TNMB 3MLRL 4HFWB 4J6RL 1I1AA 1TTUA 2DQEH 4AEIH 3WKMH 4U1LB 5F6HJ 2V7NB 2XT1B 4L4JA 4RGNE 3T4YB 4JHWL 1WVZA 4PJGE 2CXKA 1HXYB 2APFA 4RGMB 3K2UH 5F8QC 1A02N 3U46A 5C0CA 5C0DA 5D2LF 2KBGA 3MUJA 1N0XL 1LWRA 2X89D 5DRZB 4UTAH 3QCUH 2YC1A 1A22B 2XOTA 4N0FA 5FKAB 3GDBA 1TQCB 3O8XB 3QDJA 5I2IB 1JVKA 2A77H 3B4NA 4ODXB 3FKUS 4MQ7A 2VZUA 3BRFA 3O6LL 1JPTL 4PRBB 5HHMD 4NOFA 1KN4H 3U36B 2B4CL 3H9SD 5ISZB 1NFDB 2DL9A 4S1SH 5FM5M 3RY6C 2KQMA 4J3UA 4BSWA 4P23D 1NCBH 3PNWB 2YBRB 4PJIB 4KROB 4GG6F 3CFJA 2V2WA 1YYML 3FO0L 2EXWD 2JELL 1MFCL 3CSBA 5JNYB 5KAQG 4RGMC 4O02L 5DD5H 1HEZB 5T1LA 4L4VA 4DN3L 3DXAD 1YMME 4Y4KA 1WBYB 4DEPB 5D6CB 1AIFA 1R0AH 1IAKA 2VLKA 4HIEB 3G5YB 1E4JA 3LH2H 4U1IA 2WK2A 2QADD 1BQSA 2QHRL 1NGXA 3V4PL 2X9XA 2IADA 4WIQA 1GOHA 4K7FA 4O5LL 3VRLE 1KLGB 3MV9E 1FL6B 2DI9A 5D70H 1CGUA 3SKUD 2V7HA 2NR6C 3TO4D 2P8PB 3LN5B 4QY8B 4X6BB 2OQJB 1RUKL 1OSPH 4BFBD 4K2UL 4QXUH 4EBQL 1UXSB 4QLRA 1IT9H 2VXQH 4CVXA 1YQVH 1BFTA 12E8L 5GGTL 5IV2B 4XTRC 4YHYB 4MCYA 4PB0L 5DQJB 4OD2B 1KTDA 3DMMD 1OL0A 4HX1B 4DEPC 5LQBL 5H37G 4ODHL 3T1WA 4R2GB 5DEGA 3TBSA 4L1HA 2AJZB 3CC5A 2BVEA 3VFWB 5KVEH 3ZE0F 1LE5B 5DFTA 5A2FA 2YXFA 2HFGL 1I7RB 4TNVF 1QKZH 2NY5C 3S3JA 3SBWA 5FO9B 3WFCL 3G6JA 4XBGA 4OQTA 3U83A 4RZCB 4UTBL 1BGXH 2NLJB 5J7CC 1RZGB 2PCPB 3E6HB 1VGEL 4V1DD 4QF1B 4N1HB 3EOBA 3CFKB 2VLJD 4MA3B 2EXYD 5GGSB 2KZ1B 4P9ML 3MRGB 1CE6A 1TCRA 3JV6B 4BZ2L 1NCAL 4X99B 4YHYC 3WHE1 1LO0L 3QPXL 5CGTA 5F96L 1YY9C 2IC2A 2DI8A 2WIIA 2I9TB 2IGFH 4M00A 4R2GC 1NAKH 4F7CA 3BQUD 3CSGA 4MVBD 4XGZB 4P3WA 4Z18A 1MRCL 3L3HB 4CDHA 2BY3A 2OJEA 1F6AB 3OB0K 1CXLA 2FH8A 1MCEA 3H9ZA 3TFKC 3H2WA 1V3LA 6FABL 1KPRA 3PQYD 3LKQA 1SEQL 3MACL 2V7NA 3N50A 1S8DB 4H88H 1BJ1H 2P5EA 2A74B 4PJ7E 3T4YA 3KR3L 3BO8B 1HXYA 4KRMB 3O3BB 4O2CB 3WEXB 4YHKL 1JHLH 1I1FA 3IDXH 5JMRA 4OZHE 2VH5H 2VDRH 2R1XA 5FKAA 1AGCB 1ZS8B 5I1DA 1TJIL 4XBEL 2MCPL 1ZAGA 3QDME 5T1MB 2W0KA 4RA0C 5A1AA 5HTSA 3U36A 5ISZA 1RVFH 1A2YB 5MERB 3VMOA 3IDYB 1T1XA 3MROB 4XVSH 4LQ1A 4WUKL 4N0CC 3PNWA 3LRSA 3MV7D 1A6AB 4Y8DC 4KRLB 1UM6L 4OGYL 3GEWB 4Q6IB 4KXZI 3O2WH 3OTTA 2H45A 1U92B 3TA3C 5IMLB 4GRLB 3RWJA 2R23A 4K94C 3LKNA 1HEZA 5DS8B 5JOFB 5FO7B 3ZKXB 4WFFE 2Y72A 2H2PD 5D6CA 2A6KA 4RGNB 2NMSA 4U49A 4HIEA 4PJGB 3G5YA 1LMKA 1DQLL 5KSAB 2VKXA 4CAGA 4G9FA 5TQ2L 2VO5A 2DTSA 3Q1SH 4G80A 4OBRA 3MLVH 1N5YH 3IDIA 1KLGA 1B4RA 2FHCA 1A7QH 5BJTA 3UTOA 4X4YB 4OM1L 3MBXL 3ARUA 4HWBA 4BK4A 1U3JA 5DHXB 2P8PA 5CEZD 3LN5A 2ZUXA 4X6BA 2OQJA 3DBXA 4Q6IC 4XNZC 4DTGH 1VEPA 3K81A 5EZIH 2NW2A 1UXSA 4GRLC 4DVRH 3B5HA 3HRPA 4IRZL 5IV2A 4UV7H 2BJMH 1CQKA 4XX1G 3MBEB 4OF8A 5DQJA 4OD2A 3ZKXC 5GGUB 4HX1A 1XIWD 2GJ6E 4RGNC 2P8LB 4JPIA 3KNBB 5FM4A 3AU1B 5ID0B 3DVGB 1KCVL 3MUZ1 1LE5A 2DQIH 2AXGA 1OT1A 1I7RA 1PJ9A 1YEEL 1YMMB 2AJYH 2J5LB 1W72B 5AAWA 1XFPA 2GW5A 3E8UH 3B5GA 4G6KH 4RZCA 4YHOL 3WJLC 2NLJA 4S0TD 5HHQB 2PCPA 3EO1A 1EMTH 1R24B 2LVCA 5F1OB 3ZHKA 1V7ML 1L9MA 3CFBB 4GKSB 4JFDE 4Z7WE 1RUMH 2A2QT 4OJFL 1JJUA 3UC0L 3UDWC 1HKFA 5KJRL 1KXVC 1NBYB 5GGSA 3QUXB 3MV9B 5F97E 1U58A 1HSAB 4QOKD 2OZ4L 3QZWG 3MRGA 2H26B 4ZYKB 2FECL 4YUEH 1Q9OB 4NRXA 4KMTL 4L9LB 3GNMH 3G6DL 3H9YA 1FZJB 3O6FD 5HVGB 2I9TA 3ZKQD 1LDPL 4R7DB 2AK4E 3CLEL 3BN9C 2FH6A 1SQ2N 3NOIA 2A0LD 4M4PA 4X4MA 3L3HA 3CVIH 2J5LC 4M03A 3Q3GA 4ZFFB 2Z93A 1FO0L 1IC5H 4XP5L 3BPLB 4PV8A 1LE9A 4LSTH 1CLYL 5CEZH 4EIGB 1MHEA 3S5LB 5KG9B 2HVJB 4IMLA 1IGTB 1S8DA 5HHOA 5HYQB 1FNSL 2A74A 4R4FH 3BO8A 5B21A 3QAZC 4O2CA 1YZZA 3QDGE 5SX4H 3AAZA 3IGAA 5IMKB 3VJ6A 3IS0X 1XH3B 4LNRB 2A9NH 2Y06H 1PX3A 4J3TA 2EH8H 1AGCA 1ZS8A 1CXKA 3RAJL 4F58L 3BUYA 5HI4D 1OW0A 5JOPE 1ZTXL 5EN2B 3SKOB 1NFIB 5T1MA 2B4CC 2WMPA 4PB9L 1LD9B 3MOBH 5CJOH 5MERA 4AMKL 4JO3L 2V9RA 1B2WH 1EEQA 4ZQKB 5J11B 1A6AA 3EYQD 3NBNA 3MUY1 2F15A 5ADPL 3GRWL 2FYYB 1YY8B 1UQSB 2W60A 1U92A 3NIFE 1QA9B 1TNNA 4QNPF 4D9LH 5IMLA 4NN5B 5L0QB 3KLHD 1QPXA 1RU9H 2HAZA 4CVWA 5DS8A 1FAIL 5JOFA 4GRWH 2CR3A 4NCC2 1G1YA 4M48L 5F7YC 4ZS6D 2RAMA 3QQ3B 4PJ7B 2XZAL 3MRDA 4JFHD 1T2JA 3JWOL 5KSAA 2NZ9C 1DJSA 3BYYA 1U3HD 3CD4A 3EJJX 1DLFL 3FCTA 4ZXBD 4N9GB 4OZHB 1SEBB 1BZ9B 4WI2A 4QTIH 1BBJB 4JKWA 4AJ0A 2UWEF 4Q7DA 4RX4D 4U1HA 4LKCB 4X4YA 4XP4H 3QDMB 2ZG2A 4QCIA 1S9YB 3QCVH 5L6YH 3D3VE 3IRPX 2F5BL 1UWGH 1DN0B 3MUHL 3PDOB 4HS6B 4L3EE 4KHTH 1H3GA 3UO1L 3DX9A 4A6YA 1P84K 2X4QB 4LARH 5GGUA 2E9BA 5I8CA 2DS4A 2P8LA 4FXGB 3DVGA 3UBXB 2ITDB 3OJVC 3SY0B 1YMMA 2BOCB 3U9UB 4I9WE 3S3SA 4AT6B 1QLEH 3MLZL 5L7XH 4JFQB 5DC9B 5HHQA 1JGLH 3CFBA 4KH2A 4M61B 3RL2B 3AC0A 2AJSH 2IAMA 5CBAB 5JHLL 2YPVL 3CZJA 3B9KC 3NTCH 3MRIB 1BLNB 3REVA 1NBYA 1XGTB 3QUXA 3WFBH 4HZLB 3S35L 2ZSWA 1XF3B 3OGCA 3UJTH 2IFFL 4KPHH 5I1JL 4L9LA 2DQGL 5DFVC 3D2UB 2QV2A 5AYUH 4RFOL 1ZA3B 1UJ3C 4R7DA 1NCNA 4LPVA 1MCLA 2DBLH 2WBKA 4KKNA 4ZOBA 1AQKL 5FGRA 1NBVH 3D39E 1EHLH 5F9WC 4U1JA 5C08E 1MY7A 4M7LL 1I1AD 2VABB 1QSFA 2G5BB 5HI5D 3HS0A 3V95A 2GJ6B 4ZFFA 4GG8B 2EDYA 3KPMB 4HLZG 2C9AA 3SGDI 3ULVH 5DUMH 5C0CD 1S7XB 3DGCR 4X6DE 2R39A 4PFEA 1P53A 3I50H 4RWYL 1WIOA 4Z7WB 3WKNA 4JFDB 4W68A 3QDJD 1JZ6A 1F8TH 5BS0E 3TJEH 4MMZC 4XHJD 1XH3A 4JPWH 4LNRA 1FNHA 3BAEL 1HHHA 1T20B 3SGJA 4FZEH 5FO8B 1J1XL 5I66B 1OTUC 4MA8H 5EN2A 4EVNA 2Z8WC 4RWHA 3SKOA 3TIDB 5K9KB 1NFIA 4MDJA 5CUSL 1Z9MA 2WBJB 3Q6GH 3TCLB 1NKRA 2AK4B 1LD9A 4AM0A 5HVWA 2HTLD 3CDGB 3RI5F 1HINL 4PGZA 4BZ1H 4G9DA 1A3RH 4HGWB 4YQXL 5KS9E 3ZDYE 3CH1B 5E5UB 1N5AB 1YY8A 2FB4L 2FYYA 4XWOD 3WFDH 1QA9A 4Y4KD 3HC4H 2Q76A 4MA7L 1CT8B 1A3QA 2BVPB 4TPRL 3BPCB 2FX7H 5DA4A 1BQHG 4WO4A 1RZ8A 4G6JH 3QQ3A 3PL6B 1NDGB 1RZKH 4PJ7A 4XHQA 4I3RH 4OZ4B 3FFCE 2J8UE 2ZNXA 3SDYH 5ICXB 1HDMB 3ECBA 3KLAB 3QDGB 4OCMC 2ESVA 1L7TH 1N8ZB 1RZJL 2ENSA 3L3OB 1F4WH 3R0MA 5T1DH 1MIEH 5DZNA 1WWBX 5I8EB 4U05A 3RDTA 1G9NL 1J8KA 2NY3B 2AS5M 4LKCA 3V5DA 5DQDL 1JCKA 3V6OC 4NT6B 3RU8H 5F7KC 4FFVC 3O6KL 5GGVH 4M43L 1SM3L 5T5NG 1JHKL 5KVDL 2IPUG 1IAII 4RMRA 1HYSD 1VACB 1J1OH 3F6LA 3MNWB 3PL6C 3ULVF 3VFMB 1TZHB 2XICA 4LF3B 3UBXA 2R0LH 3B6SB 2ITDA 5D5MF 5JA8B 2WQRA 1FO0B 1XF2B 2BOCA 3U9UA 4AT6A 4XXCC 5DGRA 2V5SA 5DSCB 2DMBA 3IAPA 2NY3C 4GMTL 3QNXB 3RL2A 4DN4H 5EWIL 3HR5A 4EDXA 3F7VA 1G0YR 3MRIA 1DL7L 2D7MA 1MEXH 1XGTA 2XQYK 4YXKL 3EZJB 4WWKC 4M6OH 3SDAB 3RVTC 2DLFH 3FMGL 5JHDE 4U2ZA 4KK6C 4KI1A 3LIZL 3P4LA 3V4UH 4OF5A 2XWTB 4X7TB 1HHJA 3D3VB 1WZ1H 5B8CB 1ZA3A 3BH8B 4LSSL 3Q2CA 2DDQL 5I15L 4L3EB 3GSQB 1IGFH 4PJ5E 3CVHA 1T3FA 2VABA 3QDHA 4I18C 4K3HA 2BHZA 3L9RA 3F6IA 4H26A 1KENL 4Y5XA 2LU3A 5JPNB 1AXTH 4YDVB 3HMWL 3WDJA 4MA1C 5HHXH 5E4IA 1E6JL 2HT2D 3OAZK 1S7XA 4X9BA 1WIUA 4CMHC 2BVYA 4UT7L 1MFNA 3MRNA 3SDAC 4Z7UA 1EXUB 4JFDA 3KLSA 1A1MB 4HQQL 3O8XD 2PW1B 1KC5L 3BKCH 4RA3A 3MLSL 4OQTH 3LZFL 5D6DC 2KKQA 5L8KB 1DDHB 1T20A 5F9OH 4LCIH 1I8KB 5ISZD 4PBWD 1OY3B 5FO8A 5I66A 3PWLA 3IAGC 2J8OA 3NFSL 4MCZA 4NKOB 3WS3B 4KROD 3NFNA 4NP4H 3TCLA 1RD6A 2AK4A 5I74B 4HH9B 3D39B 1U8MB 3GSNH 4KMLB 4HPYL 5C08B 4URTB 4UMGA 2I5YL 3AFLA 2YEZB 3BIKA 3OKNB 4DZ8B 1OTSC 1PSKL 4BH7A 3CH1A 1N5AA 2EIBA 1D9KC 3V52H 1BAFH 1DFBH 1U2HA 1OAZH 1NSNL 1DBKL 4GBXB 3GHEL 3HKFA 3LN4A 4G9FD 1KEGL 2YK1H 4DGYL 4X6DB 4HJJL 1RFDL 2EZ0D 3U7AA 5D7SH 3S34H 3QDGA 5HJ3B 1N8ZA 3IETB 3JTTB 5JUEL 3TBVA 4XVUC 5BS0B 2ZOKB 4KZEH 4YFLF 5DHYA 1EAPB 3MODH 3D69A 3DYOA 4WNQB 3H3PH 5I74C 1KIPB 1ZLSL 1KN2L 3CUPA 3DNKA 5TH2A 4JG1L 3K8KA 5KZCB 5DJXB 3QA3A 5D9SB 4MD4B 3EW3B 2KDGA 4N1CA 1IGJA 3OAZH 2HYMA 1KXTB 1JGVH 3VFTA 4GBXC 3V6ZB 3WE6B 1ZWIB 5F8RC 3IVKB 1VACA 4K7PX 5KS9B 2H32B 5DD6A 5FOJA 4PV9B 3MNWA 4WI3A 3VFMA 1LVEA 1TZHA 4OD1L 5C3TA 3UYRH 3WIHA 4YZFE 4F7TB 4G7YL 4LF3A 1KCUL 5IBLC 1INEL 5H35B 3DV4A 3WN5C 3FQRB 4M5YH 1JNNL 3FFCB 2J8UB 1NMBH 5I1GH 1MWAL 3WLBB 3LEYL 5IESH 4HT1H 3QNXA 4RQQB 4NJAL 2RBLA 4NQVA 2HLFD 5IK3B 3BH9B 1S7SA 2NPLX 4ZTOL 4LVOC 3TV3H 4S11A 5JLZB 4KUCF 1FC1A 3NH7H 3OWEA 1CVRA 1U95A 3O3DB 4HKBA 4PYGA 5DD3H 2XWTA 2NY4D 1BD2E 5FOBA 5B8CA 5D93C 1JK8A 3BH8A 1Q94B 2HFFB 4HWBH 2YD3A 4WDIA 3VW3L 4HIXL 4XMPH 2UZIH 5B3JF 1RIHH 1MQKL 4TUJB 2G9HB 4M6NH 5HHOD 3ZE2E 5JPNA 3VDAA 5TDOB 2XQBH 4YDVA 4ZUUB 2GT9A 5CZXD 4FZ8H 1LO2L 3INUH 4HKJA 2D7NA 1ZGLB 1EUUA 3L5XL 2H8PB 1YEKL 4W6WB 2DB8A 4FQQB 5HSFA 4WJ5B 1CXIA 4JRXE 2PW1A 4JN2A 3GBNL 4DKEL 2HH0H 3QIUB 1F4YH 4E41E 4I4WA 4XPAH 2IQAB 4PJFE 4TYUA 5GRJL 2VR5A 3LPGA 5DHVB 4DGIL 5JHDB 3X13B 4PLKC 3VWJB 3K80A 4LL9A 3R1GH 1KTRL 4NKOA 3LKSB 4JHAL 1KCSL 5CJQH 4PLNC 3HE7A 2FGWL 5C7XL 5E95B 4HH9A 2HTKD 2PYFB 1K9TA 2APWA 3D39A 1V05A 4LBEB 3SE4C 2A38A 4PJ5B 3RX7A 1YN6A 2CIIA 3X3GH 5IWLC 4PJIF 1LQSR 2GAZB 5C2BH 2H2SD 4YC2B 4YDIH 4YWGL 4KKCC 1R3KB 5KSAD 4X6DA 4MAUH 3QIUC 2CO6B 3OKLB 5DYOA 5HVHB 4U2YA 3GJEA 4S1QH 4KJQC 1B4JH 1EFQA 1HILB 3QR2A 4YGVB 3W0WE 1RZJC 4GLRH 4X98B 1MIML 1X5ZA 3HNVL 3FT2B 5BS0A 1QEWB 2ZOKA 1S9VA 3RL1A 3RWHB 1EAPA 1G9NC 4K94H 5I76B 5IVNA 4KZDL 1FZKB 3C5SB 4WNQA 5EPMB 3W9EB 4BM7A 1KIPA 3T0WA 3GGWB 4JR9H 4NZRH 2O5YH 2OL3L 3ES6B 4KDTC 1NAML 2DIAA 3MBED 4MLIA 2DBJA 4OCNC 3D0LB 2WWKT 3BN9D 4L4TE 3TZVB 5C86A 4FQPA 4TOYL 4UB0H 3V6ZA 1ZWIA 3IVKA 3UTSE 5KS9A 4RISL 3UX9B 1CG9A 2DQJL 2H32A 2OTWA 3BDYL 1WC7B 1YMMD 5H8DA 5IHLB 4LLVB 3T3ME 5E70A 3M07A 5H35A 4F7PB 2R8SH 1BWWA 4B7LA 3FQRA 1UKQA 1T6WA 2IAMD 1M7IA 1C12B 3FFCA 2J8UA 3L3JB 1EUTA 4PTTB 3QUXD 3I02B 5AZEL 1DBML 2ZNWA 3X12B 1JRHI 4G8GE 1UCBH 1K6QL 3BGMB 4RFEA 1S5HB 4X5WB 1WT5A 1FFPA 1G7PA 2Y25A 4WFHD 4L3AA 1KB9J 5HI3C 1QHPA 3O3DA 3TBTB 3V0WH 4ORGB 4FQLH 2GY7B 5KSVB 1XEDA 4O2FA 3P2TA 1QSFD 3S36L 3B2UC 4JDTL 5DVLA 1Q94A 2APBA 2HFFA 2F54A 2RIKA 3OKMB 2FBJH 3SKNA 1M71B 5JO5B 1D5ZB 2AK1H 5ESVB 4JREB 2XZZA 5GISH 1AJ7L 4TUJA 1NLDH 2X2YA 3BZ4B 5L2KA 3S4SA 2J6EA 2BY0A 4A6YH 3C5ZB 1E4XH 4U1KB 3SHSA 2E5EA 4JO2H 5GJSH 1A7PH 3GIVB 1UACL 3I2CL 2ICES 4WJ5A 5DC4B 3VI4F 5E7FA 3GI8L 4JFZH 1A7NL 3A6BL 4Q74A 3Q6FB 4J6RH 5E56A 2IQAA 1HZHL 2Z92A 4O9HL 4P2OC 5DHVA 5JHDA 3X13A 2AEIT 3OX8B 2XRAL 4OZGE 2R4SL 3VWJA 4ZDHB 4JHWH 4OLYL 1QR4A 4LCUB 3OXSB 4LSRL 1SMOA 1AC0A 3LKSA 1BD2B 2CMRL 3SBWC 1DEEB 1AGDA 1L9NA 1SVCP 1P7KB 4K9EC 1N0XH 5ICYB 2MNUA 2B20A 1I1YB 1INDL 1JYWA 4LLQA 4PJ5A 3MLXH 2LABA 5IEHA 2DIBA 1IEAB 1JHTB 3MX0A 4WO4D 2AJUL 3SE3C 4AEHH 3BKML 4JCLA 3BPOB 2GAZA 3Q5OA 1KOAA 1FSKB 5HGDA 3O6LH 1JPTH 3BEWB 2LQRA 5L88L 2B4CH 1R3KA 4C59B 1H5BA 4UU9B 4TTGA 2ESVD 2VUOA 3ESUF 3X11B 2VC2H 1A4KA 1FNEB 4YEEA 4J2XA 1HILA 4UQ3A 2YA2A 4JRXB 3FO0H 4PJGF 3FT2A 2B1AH 4DZBB 1MFCH 1MJ7L 5EIVA 5C0NC 2WAHA 3RWHA 4E41B 4O02H 1MWAB 4PJFB 1FZKA 1ZHLB 3C5SA 5EPMA 3W9EA 3V0VB 4APQA 3A6CL 4HIHA 5I1AA 4Y0GA 3VG9B 2CRIA 2ZP0T 2D7TL 2XZQL 2HP4A 1PG7H 3FZUD 4UOW0 4AEFA 3RVUD 3CX2A 4OGZA 2QHRH 3V4PH 4MXWL 5IGXL 3VD3A 4JY5L 3TZVA 4O5LH 4FG6D 1YC7A 1IGML 5ITFA 3UPRA 4HLJA 1WZMA 3GMQB 3DX6B 3BDBA 3NAAL 1SJEA 5IG7B 3SKJL 3TLRA 4C4KO 4KKAC 4LLVA 1RUKH 4K2UH 4FA8A 3LPFA 2CLRB 3ALXA 12E8H 5GGTH 2DLEA 3QXTA 1C12A 3W0WB 2WUBL 3RVWD 1PQZA 3I02A 3ZHLA 5LQBH 2G60L 2IALB 3ZHDA 4EQ3A 4ODHH 1JN6B 1KIQB 1RY7B 2CLVB 5C8JB 3BGMA 5IB2B 1E28B 1WAAF 3IDGB 1JNHA 1S5HA 2HFGH 4MJIE 3HG1E 1F00I 2I25N 1MCWM 1IJ9A 2L4OA 5E00B 4UTBH 5HY9B 3X14A 2VQTA 4G5ZH 4JKMA 3ORJA 4D9RE 4KI5D 1J0YA 1MAKA 1S7UB 2DRUA 5T3XL 4L4TB 1NC2A 3OKMA 1NCUA 3HHRB 1M71A 2IMNA 3KPLB 3UTSB 5JO5A 4KAQL 4P9MH 3TF7C 1D5ZA 4YIQA 1FFNB 4Q58C 4BZ2H 2X1PA 4HMEA 1NCAH 4UBDD 1LO0H 3BZ4A 3MXVL 3T04D 3B83A 4GS7C 5HGGS 1Q8MA 3C5ZA 4JFDD 2NY1C 3FQUB 1N6QL 3QUKB 5I1LA 2BHYA 1EVUA 1MRCH 4OI7A 3CU7A 4QRQB 4HIIA 3BWUC 3GIVA 5EOCL 4G8GB 2EE9A 4H1LB 4NZUL 2ZUWA 2WP3T 2UVFA 2C7UB 3Q6FA 3EJZD 2VZ1A 3L3KB 4NUJB 6FABH 1PZ5B 1SEQH 3MACH 4Y1AE 5JOEA 2WBJD 3I6KA 4QRSA 2AK4D 2XZCH 3RIFF 1BQUA 2QBWA 4I0KA 3MSPA 1ZHNB 4OLZL 4YHKH 1G9EA 3RZWA 2WLYA 2EIDA 1P7KA 5J3HD 2FJFB 1XCTB 1I1YA 3DTXB 2OL3B 1U8QB 2WIMA 1NAMB 1IEAA 3OR6B 3GKWH 2GI7A 3MNVB 4NZJA 1TJIH 3G9AB 1NBZB 4XBEH 4XNQB 5T3XE 1WCQA 4Q9BA 2GUOA 3CH8A 1A6VH 3B2VL 3BEWA 2FLBT 1OAUL 3D1MC 3QDGD 2AJVL 3KHOA 3X11A 3IFLL 3L1OL 1ZXQA 3IFPA 2DAVA 4LPYA 1FNEA 4OCWL 3QUML 1UM6H 4OGYH 15C8H 4XWGL 5EZJB 3ZDZF 5TFSH 4JRXA 25C8L 4KGJA 3HC0B 4KTEL 1DVFA 5JOPD 3MCKA 2XQYG 3BKJH 3NABL 4HXAL 3L7EB 1MWAA 3MRFA 4U7MA 1ZHLA 4OZHF 1IRAY 1X5AA 3D87B 3MJ8B 3BOVA 4OZGB 2YKLH 2OCFD 5CJ5A 3NGBB 4LCCC 4UIKL 5HDBF 4HAGA 1DQLH 3QEUB 4JN1H 2D7QA 5TQ2H 1QFOA 1PAMA 1JYNA 4P2QE 5B3NA 2EDTA 1ZLUK 1RZIA 3KYKL 1ZKAA 5JW5A 2QQLL 3OHXB 2JJSA 3ARFB 5E8DL 1NL0L 4KQ4L 2DQCL 1FG2A 3ARQA 3GMQA 3TIEB 3U82B 1S9KC 3DX6A 4OM1H 2AV1B 3C8KA 1AP2B 1XGQA 1LILA 1WQVT 2CKBL 4NRYB 5TE7L 1TQBB 4YDKL 3P4MB 4HWEL 2N1KA 1CFQB 4R0LC 5EFIA 3GSUB 1GZQB 2CLRA 4RAUA 5FDWA 4M02A 2PTTB 4ODTL 2IALA 3SDAD 1QBML 1JN6A 3NGBC 1KIQA 2FEEL 3F62A 3VD9A 1KCVH 5IB2A 4OIBA 1E28A 5DK0B 1YEEH 5HBBA 4M8VA 4ODUB 1R3IL 1HOCB 1U8LB 1J18A 5E00A 5HY9A 3VXRA 3ARFC 3UTQB 2AQ1A 2NXZC 4OJFH 5CILL 4F7MB 3UC0H 1S7UA 4L4TA 5FECB 3E1F1 3TH3T 2FBOJ 4KXZH 2OZ4H 4WTZA 4DW2L 1FFNA 5FEBA 4QGYA 3MV8E 3WIFB 4I9WD 2UZYB 4NRZA 3CMOH 1Q9KB 4S2SB 4OZFB 4PRNB 5DQ9B 1LDPH 3QEGL 4UOJA 4YE4L 1QPPA 3FQUA 3QUKA 1TVHB 3D6GA 3AY4A 3WIHH 4PIRF 5HYJB 4QRQA 1T1WB 1KIRB 4HUUA 5GS2D 5IUSA 1A64A 4M6AA 4G8GA 2AP2A 2QSTA 2W38A 1G7HB 4H1LA 1CLYH 5L2JB 4Z0XB 3R0NA 5C9JB 1KJ2L 2C4FT 1ZLUH 2C7UA 3L3KA 4NUJA 1PZ5A 3HG1B 3KXFE 4MJIB 2VNCA 1AGFB 1HN1A 3NCBB 1GAFL 4IIQB 3SGKA 1UEMA 3DUUB 2NY6B 1FNSH 3ARBA 3D39D 4HFUH 4R7NB 4HDIB 4UT9L 1NC4B 5C08D 2FJHB 4IRSA 1ZHNA 4KK8D 1VKXB 1B90A 1YEGL 2FJFA 1XCTA 5EU6A 5F44A 5FHBL 4YHPA 2OL3A 4OKDA 1U8QA 5HD8D 1NAMA 2IBGA 5C9KA 5L9DL 3AS1A 3MLUH 3OR6A 1MCWW 3MNVA 1JI2A 4F58H 1NBZA 5FGSA 4XNQA 3C6LC 1QZ1A 1C5DB 4PB9H 3BGAA 4XAKD 3NIDF 1KPVB 1U8JB 2X70A 3F7YB 4JO3H 4AMKH 1KCRL 5BS0D 4HXBL 1CCZA 5DJCB 3DRQB 3OPZL 5ESQA 3LKRB 2UZXB 3MFGB 4JY4A 5ADPH 5EZJA 4ZNCD 3BZFB 4IIQC 2OLDA 4HF5L 2NY6C 3DO3A 3HC0A 3C87A 3OG6B 3L7EA 1FIEA 1FAIH 4Y1AB 5KZCD 3MMEA 4IEFB 4H8WH 2NY0D 2GJZB 4OZGA 3H6JA 2XZAH 1IILE 4XCEA 3HE6B 3JWOH 1T7VA 1U42A 2XG5A 2QSCL 1KBGL 5GS2H 1X5KA 1VA9A 5I18L 4P4KB 3MA7B 3WLWC 5TGBA 3WNOA 5ALBL 4I77H 2A9ML 1WEJL 4S1DC 4K7PL 4QHMB 3HI1A 4GQPH 2D9QB 3QG7H 3FT4B 2HFEB 7FABL 5EIIB 2AV1A 3FFCD 3EYUL 2DL2A 3P0VL 4NRYA 4OLXL 2VLME 2K7PA 2P48B 3BGFB 3ET9F 3P4MA 1ORQB 3MRRB 4FNLL 1ROWA 3WS6C 2CXGA 1VB9A 2UV3A 4MAYB 1RZFL 3EYFB 5IVZB 1GZQA 2ICWJ 2GSGA 4M7KL 5DR5L 3TVMA 1B9ZA 3O3UN 1NLBL 1OSZB 4LU5L 3UO1H 4N5UA 1F13A 1WZLA 2RGSA 5GSRA 3BW9B 5T5FL 4M62L 1PY9A 3O45A 1P4IL 4P4KC 2GY5A 2N4IA 4ODUA 2AGJL 3BPNB 5C0GB 4HUVA 3F5WB 3MLZH 2ATKB 2F54D 3Q5YA 1Y6MR 4JGMA 4P2QB 3TWCH 1LO5A 4BELD 4OBSA 4F7MA 5DMIH 5AWNL 2YPVH 3BD3A 5FECA 2QQNH 1AC6A 1V8HA 5L2KD 3VGFA 3HZKB 1GGIL 4C54A 2B1HL 1GZPA 1YUHB 5DRXB 2IFFH 5INDB 1XF5B 3WIFA 5AD0A 2UUDK 5I1JH 2DQGH 4DGVL 1KIUA 3MYJA 1T7WA 1XGPB 4JM4H 3RDTC 1FNGA 4S2SA 4RFOH 2H32H 1KGCE 2EE3A 1WZKA 2X9YA 1AQKH 1H0DB 3NZHH 5TF1L 5HYJA 1T1WA 3UJJL 1A47A 3BPNC 4O4YL 1KIRA 3KYMB 5FA4B 1G9ML 5JHDD 4AL8L 1WICA 5L2JA 5C9JA 3VWJD 4OLEA 4GAFB 3QUMB 3QFJE 3V2AR 3IXAB 1KYOJ 1RI8A 3PIQA 4MJIA 2YZ1A 1PLGL 3DUUA 3EYOA 3BYTA 2OX5A 4HDIA 4RWYH 5CINL 4PJ5D 3TGXA 3W39A 2XA3A 1YNTB 1YPZE 4FMFA 3ULUF 1O7SA 2CUMA 4CJ1A 5BVJB 3BZEB 1EGJA 2R2BB 4KFZC 3MV8B 1J1XH 4M6ML 4ZAKB 5ECJE 4NQCE 5E99H 4GFTB 2I9LB 2GSIB 2RR3A 2EDNA 1L6XA 5CUSH 1TLKA 1JF1A 4H5SB 4ELME 1GL4B 5I8KH 4I8DA 1HINH 2J6EH 3GK8L 3LKRA 4NHUB 2CKBB 4YQXH 5D7LE 1JZ4A 3BUTA 1XCQA 2FB4H 3U2SB 4PJAE 5GHWH 1OWRM 5DDHB 1V7NH 4MA7H 4NPYB 4TPRH 4FMKA 5D7IA 3KXFB 4Y1AA 4JEGB 4YNYB 5I1KL 3S98A 4GRMA 2GJZA 1CI5A 2HKFH 3HZYA 3HE6A 3TZVD 1RZJH 5DHVH 4ZAKC 4IMKC 3MA7A 2E7LC 1NMCB 1PKOA 2E6JA 4JZOA 4LVHB 1IMHC 5EO0B 1EX0A 3RNQA 5GGRA 4JVPA 5LBSL 2O5ZL 2GHWB 5D2LE 4EQ2A 2P5WA 3R8BB 1UH2A 5K9JL 4F9PA 4Y19E 5DQDH 1T04B 1F3DH 1ZSDB 4JLRA 3UCRA 1OF2A 4MDIB 3O6KH 3MRRA 2ZJSL 3W11C 4BQCA 4R4ND 4M43H 1SM3H 4MAYA 1OB1A 3EYFA 1JHKH 1HYRC 1YYLL 4HPOL 5DTFB 1ZHBB 5FHAL 3GSOA 1QLFA 3QH3B 4QTHB 1IL1A 4CW1B 2E7MA 1BZQK 1GOGA 1H3PL 4YHIA 2GTZA 3BW9A 2L7JA 3QJFB 1A4JB 1VFOA 4PUBL 3C60B 4Y16A 4GG6E 1NMCC 4YR6B 4PRHE 5C0GA 5BV7L 1CXHA 4PJ8B 1KJ2B 2YD9A 1NC2D 4KY1L 5A3ID 1A7RL 2Z31A 3HPLB 1F3RB 1LEIB 2AXJA 5J1TC 4P2QA 1UB5B 5EWIH 4LVNB 4HEME 3SPVA 2ICEA 3JSSA 3QI9A 3KS0H 1DL7H 4TSAL 3HZKA 4N0YH 1YUHA 1TVBA 3WL9B 1I1CA 3FMGH 3H3KA 1MVFA 1BBDH 3EGSB 3T08A 3C5ZD 1QR1B 2D3VA 5INDA 5IMMB 1AGBB 5IB1A 1XGPA 3HLAB 3KPOA 3PXJA 4LSSH 2DDQH 5I15H 1H0DA 5EU5B 4WV1B 4UZGA 4HKXB 2MKWA 3C60C 5BXFB 2X4UB 2X4PB 3KYMA 4U0RB 1D5BA 5HYFA 3MJ6A 1KENH 2A6DB 4PJ8C 1T03L 2Q86A 4BFEA 1QP1A 3IXAA 3S37H 4LVNC 1E6JH 1MCCA 3VXQB 3FHQA 5ENWB 1OLZA 3QO1B 4ZTPL 3UBXG 3CFCL 5GIRB 4J4PA 3DUSA 4HUMB 1CTNA 2MPAL 1LP9F 1YNTA 1DP0A 5E0QA 5JW3L 1KC5H 1CZ8L 3MLSH 3ME0A 3SDCC 2C3VB 5BVJA 3BZEA 4NNYA 1U8HA 4M93B 3IU4L 2R2BA 3EBAA 1ZLWH 2AVGA 3MV8A 3U0WL 4WV1C 7CGTA 3NFSH 2BSED 3DECA 5D1XB 2GSIA 4NCDA 3C5JB 4U31A 4XAWL 3RGVC 1G7QB 4KKAD 5DD1L 3BHBB 4JRXD 1L4IA 4H5SA 1G0XA 3UYOD 3EDDA 4HPYH 1URLA 3FO2B 4NJ9L 3VRJB 4QXGH 4NHUA 1PSKH 2CKBA 1F97A 1TITA 5F7FA 4QXTB 2BNRE 2OMNA 5B4MD 4YAQB 3K4DA 3RQ3A 2H9GB 3O3AB 1HHIB 2JJWA 3QFJB 2OTPA 1NSNH 4WU5B 1DBKH 3GHEH 1X7QB 3KXFA 1KEGH 4DGYH 4NQDB 2D03L 1EVTC 2BXYA 4PPTA 1XGYH 4UAOB 1FGNL 3C8DA 1U8KB 5I1HL 4PJHF 1YPZB 2Y5EA 3TPKA 1IAMA 2FX9L 1Q0XH 5D1XC 5EO0A 3UZEA 2HKHL 1GGCL 4QT5A 1FNLA 1FLTX 3UTTE 3W5NA 1ZLSH 2VB5A 2BSTB 4NQCB 1BVZA 1FVDB 1FH5H 4IM8A 4GJTB 4ETQB 1T04A 4BH8A 2VZ3A 4JG1H 2H6PB 1ZSDA 4WCYL 4OUOA 5BVPL 3MNZA 4LASL 1BFVH 2ZKHH 4MLSA 4QRPA 3STBA 4ELMB 4DK3A 1EHXA 3QDAA 1VENA 1LEKA 5E9DE 4WUUE 5J6GB 3G5ZB 4R8WH 4PGDB 5D7LB 2HVKA 4U6VL 1EEYB 4PJAB 1Z5LB 1IFHL 1ZHBA 4LSQH 5DTFA 5ID1B 3QH3A 4QTHA 4OD1H 4R96B 4UDTB 1NGZA 4Q9RL 4G7YH 3VD7A 1AD0A 1KCUH 3VXRD 1INEH 2R0WL 3QJFA 1T89C 2H3NB 1C5CL 4KJWD 3HZMB 4L4TD 1KJ2A 1I3GL 4FQ2L 1MWAH 3LEYH 3HPLA 2FO4A 1WBXB 3UTSD 2VZVA 1UB5A 4NJAH 5E08H 3WBDA 1NCDL 2C4FU 3PJSA 2ZCHL 4JPVH 3MR9B 4PTUB 2P43B 3HMXA 4ZTOH 4ZO6A 1T66C 1NQBA 1ADQL 3WL9A 3V5KB 5D2LB 1Z2KA 4CNIB 4Z78B 1QR1A 4XNYL 3ARGB 4Y19B 4KJPC 2BVOA 4F57L 3G6JF 5J9PA 1MF2L 8CGTA 1DANT 1CDUA 1RJLB 1W0VA 1BM3H 4MYWB 4G8GD 5EU5A 3VW3H 4HIXH 4HKXA 4JZJB 4WFGD 4D3CL 5BXFA 2X4UA 4MNHA 5I75C 3LQAC 2W92A 5DK2B 3QXAB 4MXQD 4OF3A 4ENEC 3QFDB 5E6IC 4GG6B 4IRSD 4LCYA 5KVMC 3VXQA 1LO2H 4PRHB 5FUZL 5ENWA 2D31B 5CGMA 2OP4H 3MOQA 3KPRE 1EK3A 3L5XH 5IEKB 1VEMA 1KCLA 1MJUH 1NEZA 5TJWK 2J4WL 3GBNH 4HUNB 1NJ9B 1JNLL 4KJYB 5JQ6L 2JJVA 4LLMA 3BIBX 2V9QA 5GRJH 4XCNB 2GKIA 3W2DL 4Z7NE 4JZJC 4JHAH 1KCSH 5FA3B 1WT5C 3P9LA 5I8OL 2FGWH 3ZE2F 1TZGL 2ZG3A 3BHBA 5MENE 2APXA 4G6AD 5IB5B 4OIIL 3TT3H 1N3NB 4KUZH 2DQTH 3QPQC 3RNKB 4LHUB 5CWSB 2OR7A 4IOIB 1NUFA 3CJJA 5DF0A 4QXTA 4XVTL 1FV1A 4XI5D 3KPQB 4LSUL 4YAQA 4Y4FB 4YWGH 1VGKB 3QFJA 2Y6SC 5D8JL 4WU5A 1X5IA 2APTA 1X7QA 2E6QA 1U9KA 5ESAA 2VLRE 4NQDA 4ONHB 3UP1A 2IEPA 3GMOB 1JFQL 4H1LH 2ZUVA 4KRPD 4PJFF 5E24E 2Z91A 4NSKA 1FFOA 4XCFL 1MIMH 3WDIA 3ARFD 1WV7T 3HNVH 4JFXB 4CVZB 2WLZA 1YPZA 5FGBA 3IXTB 5A16B 3G6AB 4MB3A 4U3CA 3AMLA 3GFUA 3QUYB 2PNDA 3E0GA 4MSWA 5F7HA 4NQCA 1I9RL 1FVDA 4LEXH 3CFDB 1O5DT 3TVMD 2OL3H 4JG0L 3VRIA 1NAMH 2H6PA 2Z0BA 1NMAL 4FHBD 4ELKB 2FCBA 4Y4FC 1AD9A 1S3KL 1I4FB 2C26A 3VFSB 4K3JH 5J6GA 2E7BA 4TOYH 5CGYD 2I07B 4RISH 5DJAA 2DQJH 1EEYA 3FRUB 4PJAA 1Z5LA 2BNRB 3BDYH 3D9AH 5ID1A 5DMGC 4E42B 4R96A 3UAJD 4UDTA 4YJZL 2GTWB 5J89A 1BJMA 1A21A 2IJ0C 3SE8L 2V2TA 1S9WB 5JORB 4Z7QE 2H3NA 5BV7C 3UMTA 4PBVC 1MH5B 3PHSA 3FB8B 3HZMA 3HAEG 4QNPE 3P77A 2P4AB 1RJYB 5AZEH 1DBMH 1JZ2A 2O61B 5GZND 1BP3B 1WBXA 2B0SL 5L8LB 3N9GL 3MPCA 4LCWE 1K6QH 2E3VA 1CR9L 3F7PC 3MR9A 4X8JB 5KVGL 3DVFA 2BFVH 3UTPE 5TDNB 3UTTB 3DV6B 3RWGB 2AEWA 4RGOL 4G8IB 3V5KA 1UJTA 1FZMA 4CNIA 4Z78A 3ARGA 2Q7YB 1PG7W 3JV0A 2AQ2A 4APQC 2BCKB 5HYJD 3PABB 5C70A 5IOPB 3S36H 2PTUA 1RJLA 2VERN 4JDTH 2UWEE 1DR9A 1DUZB 4TN9A 1DBBL 2MKLC 2X7LB 1U93A 4WUUB 5E9DB 2ITCA 3MJGX 3VCLA 2WWMD 4JO1H 3O6ML 4MJID 1AJ7H 1CGYA 1V3KA 1G1CA 4ZOCA 5EUOF 2R0ZL 1FRGL 1YEIL 3QFDA 1CDGA 5DZLA 4GG6A 4D9RD 3MREB 3U1SH 2R1WB 4LRIC 1XMWA 4PRHA 5GZOC 4WY7L 4P59L 1WFTA 2D31A 1U91A 4EI6A 3ZKMC 1RIUH 3I2CH 1UACH 3CDYA 2R56L 3GI8H 1NJ9A 1A7NH 1SYVA 3A6BH 3WLWD 4RAHA 1OGAE 3EDEA 4LMQE 4ZUSA 4O9HH 4OD3L 4EDWL 3H9HB 3IJSB 4PJCE 1JE6A 2R4SH 1ZGLP 4OLYH 1FYTE 4LSRH 5IHUL 2VKWA 3QUZB 4R26H 3WYRA 3VD5A 2CMRH 3NN8A 3A6OA 5IB5A 2NW3A 3EAKA 1INDH 1YN7B 4QWWD 1CFNA 4NO2B 2V5MA 3I6LE 4LHUA 5CWSA 1N4XL 4OZFH 4IOIA 3VXME 3SKMB 2K9UA 1RJZB 1PKQA 4Y1AD 2AJUH 2JCCE 4NM8L 2YPKB 3KPQA 4M3JA 2D0GA 4PP1C 1VGKA 5LGHH 3HE6D 1BREA 4ONHA 1CK0L 3S4SG 3M17B 1RK0A 3DRTB 4U1GB 3KPRB 3GMNB 2N7AA 5DJZB 5IROC 4U7SA 4JFXA 4CVZA 5D96C 5FKPB 4I0PB 1MJ7H 3EFDL 4R97C 5EO9A 3T8XB 2P5WD 3IXTA 1CFSB 3QUZC 5T3XD 5F3BA 1BJ8A 3QUYA 5EOTB 3SO3B 3A6CH 2VE6B 3OSKA 2D7TH 4WFEE 4MAYD 3P9WB 2XZQH 5AG8A 2X4RB 4TUKH 1EGJH 4YPGB 5KTEL 3A67H 5MENB 4ELKA 4PG2A 1EBAA 1WFUA 4JY5H 4P5TB 5IR1B 4NWUL 1DBAL 3VFSA 4DKFL 2VSDA 5HXMA 5F9JB 2I07A 1IGMH 1M4KA 3V4VL 3FRUA 2BNRA 3VGGA 3DETC 4BQ9A 1M7XA 3PF2A 3SKJH 3GB7B 2GTWA 5DJDB 4ZODA 1D6VL 2Z31D 2VLRB 4I0PC 4P2QD 5CP7B 5JORA 3SCMB 2EE2A 1WTGT 5J57B 3QI9D 4OFVA 4XPGL 2G60H 2O61A 5F1IB 5IVXF 1UENA 1CD1B 1J8HE 3C6SA 1YMHB 2XTJE 1WBZB 3UTTA 1HI6B 3RWGA 4BQBA 4EI5B 2SEBA 1DVFC 2BNQE 4OLVH 4P5TC 4TVPL 3EDKA 2BCKA 3BKYH 3P11L 2NYYD 1O0VA 5DZOA 2W9LA 4K3DL 2HJKA 5T3XH 1DSFL 4R90L 5IFAH 2X7LA 2F19L 1DQML 2X4OA 1R5VB 3REWA 3DI2B 4ODWB 2X89A 4KAQH 2IQ9H 4XH2B 3SCMC 4XRCA 3MXVH 4H0GA 5CJ8A 2QQKL 4J4PD 1E27A 1P2CB 4XNMB 4ZFOL 3MREA 3VXSE 1N6QH 2VDML 2AEPL 4HC1L 5TQ0L 4HEPG 1A8JH 1K2DA 2X1OA 2YUVA 2XACC 5EOCH 3MGTB 4LGPB 3RIAK 3UJIL 3EOTL 4B50A 1TMCB 4NZUH 4LCWB 3MV8D 1NCWL 3IDJB 4K55A 1X6NA 5B22A 4PJBF 4F15B 1RZ7L 5BCAA 4MJ2A 3IJSA 1KT2B 3WNKA 2GQHA 1H3WM 2ZPKL 1XR9A 5JXEA 4OLZH 2UWEB 4HS3B 1MRDL 1JTTA 2XWBA 3BWAB 4TVPE 1J05A 1E6OL 4HV8A 4L8SB 3KXFD 1RJZA 3WUWA 2V17L 4YXLL 2YPKA 1ZGLM 4RRPA 4XP1H 5T3ZE 2BX5A 3B2VH 5D7JB 1OAUH 2DMKA 1C8PA 2AJVH 3TO4A 3IFLH 2RFXB 3L1OH 4JQVC 5DT1L 5EC2B 3WSQL 4NKIL 1NUNB 3KPRA 4OCWH 3JWDL 3QUMH 3GMNA 1QFHA 2JLLA 4XWGH 2NTFB 3T65B 4F15C 1KLFA 25C8H 2CDEB 3WFEL 5H94A 4L1DA 5C0JB 4KTEH 4U6HB 3T8XA 1OGAB 2P45B 1HKLH 1CFSA 2Z4QA 3NCCB 3DMMA 3TH4T 2V5YA 3NABH 1ZVSA 4HXAH 3KLDA 2FNBA 5CIPB 4YLQT 1GGUA 3L5JA 3QIBC 5D1ZB 4HJ0D 4QRPD 4PJCB 5LGKA 1XZ0A 1FYTB 4S1RL 4X8XA 1J0JA 2NCMA 4NQEE 4N8VB 1FPTH 3FQTB 1SJXA 4YPGA 2QTEA 5MENA 3K8MA 5LAXB 3ARBC 4YDJB 3FQXB 4EUPB 1MFAL 5JIIA 2F74B 2QQLH 5E8DH 1NL0H 3VXMB 1MSPA 1KFAL 4IRJB 4KQ4H 5F9JA 3F65A 2NY2B 2JCCB 4RMWA 3C60D 5CJXC 2BC4B 4TNWF 4L3CA 3MRCB 1T83A 3CSYA 4NC0B 3ZYIA 2CKBH 1P1ZB 1HWGB 1DANU 5TE7H 4BKLB 4YDKH 2FIKA 3P30L 2EKSA 5CP7A 1N64L 2VWEC 4GXVL 5HPMB 3GI9L 4PJDF 3ROLA 4ZOEA 5D1ZC 5F1IA 2X4SB 4ODSL 5CEXB 1CD1A 2R2EB 5IW6A 2N7BA 5DEZA 2Q3AA 4OB5L 1HI6A 2VLMD 2ZUUA 4JKLA 5EA0L 1NCCL 1JV5B 1R3IH 4EI5A 3ZTNL 3MRPA 3KYNB 4D9QE 1JUFB 1MCKA 2OXHA 1GGBH 2MHAB 3VFUB 4KQ3H 2E6PA 3D0VB 4FXKB 2NY2C 1I8LA 4JVUA 5CILH 1H15A 5CLTA 3L5HA 1YDPA 1F4HA 4K3EH 5BQ7B 1S78D 4D0BA 4ODWA 3KJ4B 4GAYB 4XH2A 4LSPL 1WFNA 3ABZA 2B8OT 5DJ2B 4BK5A 3I6GB 3ESVF 1CL7L 1P2CA 3QEGH 4AENB 1M1SA 5DD0L 4PRPE 1NEUA 4YE4H 3G5XB 5D2NE 3VFPB 4FFWD 4MS8D 4J1UB 1EFXB 4JPKL 1U8IB 1FHGA 3MGTA 4KK9C 1J8HB 5F1SA 3B3IA 1TXKA 3MFFB 2DD8L 3IDJA 3BSZL 1KJ2H 2XTJB 3CXDL 5DJYB 4FABL 2PETA 3L6FB 8FABB 2BY2A 1KGCD 2BNQB 3DARA 5EOQL 1I85C 1EH9A 1ULVA 4UT9H 2EH7L 4X9HA 4W4NA 3SDXE 5I17A 3KJ4C 5F21B 2H1PH 2A6JB 4MZ2A 3RX5A 1F90H 5GRUL 3TBWA 1CGTA 2UWEA 1AHWB 1YEGH 2EDRA 4Z7UF 1J10A 2YA0A 5FHBH 1YEHL 2FEDD 1MVUA 3RIAF 3F58L 4H0IA 4TULL 3BWAA 3QFJD 4L8SA 4DVBB 1H8SA 1FVCB 4NBXB 4BFGA 4NQDD 3FO1B 4LPTA 1Q1JL 5C0IB 4R4BB 5ETUB 3IDUA 4X7FC 2JF1A 5IQ7L 4WTZG 1KPUB 1CICB 5D7JA 1RHFA 4OM0L 2CKNA 3RY4A 3VXSB 1UB6B 4Z7OF 4XC1L 5B3JE 4HGKC 1I7UB 2RFXA 1KCRH 4HXBH 3AB0C 3GSXB 2XTJC 5EC2A 1N26A 1WFOA 2BSSB 3OPZH 1AH1A 3WHXA 4P9HL 3RKDC 2NTFA 3T65A 2VAAB 3I9GL 3E3QE 3D5OF 1SJHA 5EDXA 4NQCD 1OGAA 3K8LA 3GMLB 1F4XL 4HCRL 4QHUA 5CIPA 4H1LG 1UZ6F 3VU2A 1AHWC 3T0EA 1OQOA 4MQTB 1FYTA 4GT7A 2MOVA 2QSCH 4Y2DB 3FQTA 4KJPD 1U6AH 3WNMA 5D7LD 2PW2A 5I18H 1CE1L 3LKOB 1QG3A 2RCSL 5ALBH 1AR1D 4EUPA 1H3VA 5JIHA 2OK0L 2F74A 4K7PH 3PWVB 3VXMA 4IRJA 5SV3A 3TC9A 3QEHA 3U4EB 4W6YB 3WO4C 7FABH 1JPFA 2EEDA 3MZGB 5IIEB 3MRCA 2YD1A 3BP5B 3EYUH 1IVLA 3P0VH 4OLXH 2IF7A 3GSRB 1FORL 3ZYOA 1BVLB 4FNLH 2I26N 4WEBL 1RZFH 4L8DB 3TPUB 5HPMA 4LU5H 4QYOB 3VWKB 3SDDC 1ACZA 1RULH 3TBYB 2DLHA 2RB8A 4ZFOB 1EEUA 2JJTC 4WTWA 4AIXA 3WXVL 5IHZB 2X4SA 5CEXA 1I9JH 2R2EA 3IU3B 1RAMA 3ARGD 4Y19D 5T5FH 4BSVA 1CDCA 1P4IH 2GCYB 5T33L 1F02I 3RVXD 1WJ3A 2EYSB 2AGJH 2Y4SA 3KYNA 5ANME 3ZL4L 3CZFB 4NQEB 4U1NA 2MHAA 1UVQB 3VFUA 4FXKA 4P3CL 4UNUA 5GRZA 5JIKA 4LFHD 4OSUL 4X5XB 5AWNH 3OXRB 1XGUB 1P5VA 3EJYD 4GH7B 3TO2A 1MUJB 1QO3B 3P0YL 2B1HH 3AXLB 2PXYB 4JKKA 1UM4L 4P48A 4GAYA 1Z9LA 4BFIB 4JFOB 1SY6L 4PRHD 4DGVH 3EO0B 4NO0A 2DM7A 3I6GA 4POZC 3S88H 3VH8A 3ALWA 1P4BL 1KB5L 4PJ9C 1WF5A 3G5XA 2X4NB 4RMVA 5JPMA 5DUPL 4J1UA 1EFXA 5TF1H 1YEJL 4CADB 2IBZX 2P8MB 3NFPB 4O4YH 3B9DA 1J8HA 1G9MH 1JPSL 2ADJA 4PREB 4AL8H 3MFFA 5D1QB 5DRWA 2HWZH 1ZANL 1K4CB 4IDLA 1FIGH 5DJYA 2IMMA 1E4XI 3L6FA 8FABA 2BNQA 1PLGH 4JO4L 4J3VA 3WMSA 2W0LA 2ZCLL 1A6ZB 2C1PB 4Y16C 4LHUD 2I27N 2A6JA 1I7TB 2A1WH 1T4KB 5JW4N 3OMZA 2VYRE 2VDNL 3RWEB 1U3HA 4ALAH 3B8SA 3S7GA 2PF6A 4Z0BL 2HMID 4LAQL 1FVCA 4M6MH 3NCYS 4ISVB 3FO1A 5C0IA 1F3DJ 5I1IL 2KQNA 1MNUL 1A6TA 1U41A 3ILQC 1CICA 1J0IA 4RX4A 4Y4HB 4LLUB 4HWUA 3DX7B 4PRPB 5C0AA 5C0RH 1NGPL 5D1QC 3J8F7 5D2NB 1KNOA 2VISB 3TN0B 4JFFE 3GSXA 5DWUL 3L5WA 3AREB 3GK8H 2F8OA 4HJGB 3QCTH 4TTDC 5D5MA 3QUYD 2VAAA 2OR9L 2LTQC 2ED8A 1T1YA 4TQEL 2VXVL 4H25B 4K07A 3F7RA 5IJKA 5I1KH 4I5BB 2H41A 4NUGL 1IGCL 1OLLA 5JW4M 1JWUB 4XPFL 4Y2DA 2A6IA 1QSVA 2X10A 5SWSE 3LKOA 3LPWA 2BNRD 5B38B 4GKOA 4JFPB 3JVGC 4Y4HC 2DTML 3G5VB 3G08B 3PWVA 2O5ZH 3EFFB 4Y2OA 1OAKL 4Z76B 4HMDA 4X6CA 1C16A 3TN0C 4PY8I 2AABL 3P4OA 5K9JH 3ZKND 2DWDB 5IIEA 5CCKL 2PYEA 2LVEA 2HA1A 3AVEA 1G7LB 3BP5A 3ROOA 5IB3B 4P4RB 2FIRT 1BQLL 2R29L 3GSRA 3LRGA 2ZJSH 2YMXL 2BHUA 1JWMB 4L8DA 1YYLH 3LB6C 3JTSB 3VWKA 2HFTA 5ACZB 4DJMA 5ALCL 4ZFOA 3UTTD 4U1MB 5FHAH 1YNLH 5HGAA 1OPGL 4QRRE 3IU3A 1DZBA 4LGRB 4P99A 3TJHC 1H3PH 3F7QA 3IS1X 1UWEL 4OUUA 4PUBH 3ZZ1A 4MD5B 5IKCB 4KY1H 5E9DD 1X5GA 4GQ9L 1A7RH 4JANA 5I1EH 1VFAB 1YA5A 4IDJH 4OF0A 3TYFB 3QULA 4LNVA 3OXRA 1XGUA 4UT6H 2DQEL 4AEIL 2FLRT 3CDCA 5K9OA 1QO3A 4G6ML 3AXLA 5FCUL 4D8PB 4E5XB 2PXYA 6CGTA 2BSRA 3M8OH 1IGIL 3EO0A 3HI5L 1R3JA 5FK9A 4ODVL 1KCKA 1IE5A 3E3QC 9CGTA 3MRJB 1NUDA 4MWFA 5ERWB 3CCHA 2EKJA 2X4NA 4YK4C 3UPAA 3QHFL 1OTTC 1R5WB 1BIHA 5TE4L 1E4KC 4N5EC 1RMFL 1G6RA 3ARDC 4DUVA 4CADA 2P8MA 3NFPA 4F3FA 1MHCB 3T4AB 1S7WB 1T03H 2KZWA 4X0KB 4XXDB 4LPCA 5C07E 3NACL 1MOEA 1ONQB 2VITB 4AIZB 3MA9L 1IKNA 4WGWB 4F9LA 5JXED 4S1SL 4LLAA 1PY4A 1NCBL 5ANMB 4ZTPH 3LEVL 3CFCH 3UBXI 1CGWA 4J8RA 1T0MB 2MPAH 1A6ZA 2C1PA 4DCQA 1TZIB 1WAAE 1QHOA 1I7TA 1KELL 3IF1A 4HWZB 1CZ8H 5MEQA 2QR0B 4ZPVB 4G42B 3U30B 3VGEA 2IH1A 4KGLA 1XAUA 3IU4H 1XF4B 5E2UH 1EJ6A 3KDMB 5DVNA 1A9EB 4W70A 3X3FL 5CMAB 5MEPA 3KPRD 4RDQG 1KJ3L 4XAWH 5DD1H 3QZWB 3DX7A 4PRPA 1XGRB 5D2NA 3AUVA 2VISA 2YRZA 3QQ4B 4I0PD 5CBEB 2XN9A 4P9HC 4WW1B 2CIKA 4BUGA 3DWTA 4NBYB 2HJFB 3TT1L 4FQXB 2FDBP 3DO7B 1ORSB 1OSPL 1JIBA 4QXUL 1T22B 1QYGL 1NGWB 4FFZL 2CD0A 4I5BA 5MEND 3U30C 3U4AA 1FGNH 5LCVH 1JWUA 1ZOXA 1R3HB 2PO6C 2RJMA 5I1HH 4F80A 2ENYA 4G3YL 1I9IL 2FX9H 1OD9A 3PWJB 3R4DA 5B38A 5KSBA 4JFPA 2HKHH 1GGCH 4GW1B 1DQQB 3G5VA 2V2XB 5CKGA 4TUOB 4Z76A 5JR1L 2EDLA 2UVEA 3GSNA 5GS0D 1BGXL 4R3SB 4IS6B 5M7QA 3WCYA 1BFOA 2FR4B 1Y0LB 1BEYL 4WCYH 1G7LA 4P4RA 4LASH 3FJTA 4JFFB 4FQXC 1JWMA 3U9PL 3F12A 3PUCA 1JMZA 1K8DB 4WHTB 3JTSA 3EOYG 3K1KC 4I2XA 5ACZA 1KB5B 3W5MA 1IFHH 4QHKI 1CFVH 3TNMA 3RY6A 4EI5D 4HFWA 5KW9H 1EO5A 1MCDA 2UY7A 4PGEB 1GOFA 3IYLW 2IGFL 2IPTH 1NAKL 1I3VA 4KVNL 4U1LA 2R0WH 3TA3B 2W0PA 1C5CH 3ZDZE 5IKCA 5F7WC 2E7HA 5AUMB 4F37F 3QWQB 1I3GH 2M2DA 4FQ2H 1VFUA 4LAJH 4HMCA 1VFAA 3H3BC 5SWSB 5DRZA 3TYFA 2AW2A 1JGEB 4NWTL 2G5RA 2CK0L 3O8XA 3QXDB 5I2IA 5KVFL 5LGJB 5HDBE 1P9MC 4D8PA 4E5XA 2DLGA 4ODXA 4XNYH 4K8RL 1NANH 5HHME 4PRBA 5E6ZA 4B53A 2RHEA 4KKLD 4EJ1C 5AG9A 1NFDA 4IHOB 3U0PB 1MF2H 3LEXB 3IDXL 3MRJA 3EHBD 4PD4J 2YBRA 1HK6A 4PJIA 4GSDL 1IGYB 1R5WA 1FBIL 2HG5B 4MQXD 4XNZB 5HGHB 5GS0H 1AO7E 3T4AA 2FECI 5JNYA 3BVNB 4QRRB 3BP4B 2LU4A 3RTQC 3OKOB 1OAQH 1WBYA 3QWOB 5CD5D 4KDWA 1J9CT 4PRIE 5E6YA 5ADOH 4M1DL 3CX5J 1T0MA 3O2WL 4Y89A 3M45A 2J4WH 4GAJL 4HWZA 1JNLH 3BIAX 5JQ6H 5DC0A 4ZPVA 2R9HD 4G42A 3OKKB 1FL6A 4PRDB 4L8CB 1L0YA 1P69B 4I48B 5D7JD 1UG9A 5HVFB 4NN7B 3OB0H 3VE0B 3KDMA 5EZLB 4GAGL 3W2DH 3ZT6A 4QY8A 5J13C 1Z0MA 1J7VR 1YECL 5CMAA 3Q1SL 4W4OC 1LK3H 1TZGH 3O3EB 3RA7L 1N6VA 1XGRA 1IQWH 4XB7A