4ZUWB

Crystal structure of equine mhc i(eqca-n*00601) in complexed with equine infectious anaemia virus (eiav) derived peptide gag-gw12
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Classical MHC class I antigen
publication title Structural Illumination of Equine MHC Class I Molecules Highlights Unconventional Epitope Presentation Manner That Is Evolved in Equine Leukocyte Antigen Alleles
pubmed doi rcsb
source organism Equus caballus
total genus 14
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zuwB00
2FSEB 5HSFA 1IAOB 1CTNA 3I2CH 4D9LH 5I1JH 3B6SA 3O3DB 4X80L 4WGWB 4XCEB 3P3YA 4PRHA 4ZUWA 4OAWB 5TDOB 4KHXH 1TQBB 3EAKA 4L3AA 4PJDA 4Z7WA 5E8PA 3R1GH 1S7RA 4I1NB 2DDQH 4D9QD 4YHML 1CGXA 1I75A 3PQYD 5CZXC 3RBGA 3SKJL 1MVUB 1UJ3A 1CLOH 4EN3D 3I6GB 4LDLB 1BHGA 4ZOCA 1A7OH 4ISVA 3QUXC 5JW4R 4OZGB 5KVDH 3MGTB 3HI6L 4PJ9D 1I7RB 4Q7DA 3AM8C 1EAJA 1F11B 1AQDA 2RB8A 3U0TB 3F12B 3SQOH 2VB5A 3BP7B 5JORB 1AO7A 5T1KD 2Y5EA 1EEUA 1H15B 4XGZA 1KCKA 4HC1H 4XAWH 3E3QC 4GS7C 1J5OH 4MHHI 1KNOA 1TZGL 3PQYB 5IB5A 1WCBB 5JW3H 3ULVF 4EN3B 1NUNB 3WE6B 1F58H 1R5VA 3PWPD 1KPUA 5J1AB 4OCYL 3T0DA 3F8UB 1UM4L 5DZOA 1GC1L 4PJ9B 1RZFH 4DEPC 2BERA 1FV1B 5F1OB 5A16A 3W11C 2R4RH 1AHWC 4Z76A 4HT1H 4JFFD 3T1WA 1Q9OB 4R0LA 3DUHA 4M3JA 5T1KB 4HUUB 3CFDB 1XMWA 2E7HA 3AXLA 5MERA 1LQSR 4P2OC 4WUKH 4DW2L 3DETC 3HNSL 4P4KA 5DRXB 5ALCL 2FWOB 3Q6GL 1UA6L 2UUDK 2DQEH 1J11A 1QKZH 4YHLL 3MNWA 2B4CH 2QQLL 5DJXA 2HH0L 5CZVH 1OP3H 3ARRA 3N1MC 3PWPB 4YJZL 1FVEA 2WSKA 1DANU 4G9FD 1N2RA 1I3RB 2QQKL 4LHUD 2XZAL 2EDOA 1B6DA 1II4E 5MP6L 3MUGA 3P9WB 4JFFB 3MRHA 4NDMA 2CLZA 1QYGL 1EGJA 3IDNA 2EEDA 5FOBA 3D3VE 3BKJH 5DJZB 1CQKA 3M8OL 1MCPH 5D7LE 1M71A 3EOYG 4MCYA 4XBGB 2R4SH 3P4NA 1KIRB 5C0ND 3GNML 1EHXA 1ZLSH 4Z7UF 3SE4C 3VFVA 4Q0XH 3U4EA 1NGYB 4UB0H 4G9FB 4LHUB 4OI8A 4JKPH 5C0BD 4AIXA 4KRNA 1ZGLA 4HPYL 2R2CA 3QHZL 4HIEB 2PXYA 2QKIB 2GKIA 3ARFA 4HJGA 4Y5XC 4N0CD 3SE9L 4JO2H 3PWLA 1NBZA 1TVHA 2I25N 3DSFH 4K07A 4M7JL 4DTGL 4GAYA 2P8LB 1S7TB 1KB5A 4E41E 1YECL 2EH7H 4LFHD 3REWA 1SYVA 1R3HB 1T2XA 4N8VB 4N8VG 2AABH 4IMLA 4PGEB 1XGUA 1YEJH 3O6KH 3RNQB 5C0BB 2CDEA 3HFMH 3DO3A 1CXFA 4OF3A 3RVXD 4PR5A 3IU3A 3C6SA 4TSBH 1A2YA 2LABA 5E9DA 4QCIB 4LCWD 4CW1B 2E6QA 1NFIB 4PV8B 2FB4L 4U0RB 4EXKA 3R06A 1CFSB 3DIFA 3FRPG 3UZQA 5HBBA 2Y07L 3CPLB 4UTAL 3CXDL 3FAXA 5D7IA 1RAMA 3Q5TA 1KTRL 1OP5H 4NQXB 4CNIA 3RGVA 2OZ4L 2VDPH 4YEFA 3F5WB 3CLFL 3F65A 1WWCA 4FTVA 4QRUB 2QSCL 2EH8L 4X0KA 4X6CA 3DUSB 4HK0A 2VL5A 3T65B 3ZKMC 1BIHA 1EZVY 3GI8H 2P5EE 2RCSH 5DEZA 5EULV 4RZCA 1S7SB 5TF1L 4HF5H 5DI8A 1OWWA 2NNAB 1OSZA 1IEHA 2VDRH 4LCWB 3DVIA 2IGFH 5E6YA 4B7LA 1NCAH 1DQTA 3C2SA 3VXOA 2IPUG 2H9GB 3GDBA 3DX7B 4YHZL 5ADOL 1NCCH 4AH2A 1A6UL 4XCCH 3ULUH 1CFVH 4RA3A 3KPPB 3RY5A 1YMHB 4B50A 4IMKA 4J2XA 4H20L 2V5TA 1J1OL 4XHJD 4WNQB 3UTQB 4XBEH 4HDIA 1NGPH 4K9EC 1FO0H 1AKJD 1NCNA 4L4TA 2BNRA 4NZRH 4ZUVB 3L5IA 2VABA 2DIBA 1NAML 2Y9RT 2FO1A 3LRSB 4CADB 3STZA 4Q9BA 4YQXL 5I18L 5I1LA 5T3ZE 1OWRM 4PJCA 4NFCA 4MB5A 4YXHL 2YXMA 3DURA 3G6JB 1SEBB 3FT4A 3UP1A 2X10A 2DLFH 5T33H 5BOPA 4OM0L 5ETUA 1QRKA 2W0LA 1FG2A 3FZUC 4HLJA 4OLXH 3GO1H 3BAEL 4E41D 3PL6C 3HRZB 1UACL 4HUXB 3EFDH 3ES6A 4JFPA 5IFAH 5JMRA 2VAAA 1JWSA 2N1KA 1AKJB 1BAFH 1MHHA 2ED8A 3C2AH 4O2EB 3QWRD 1NL0H 3V4UL 1XIWA 2QLVB 5GJSH 1DVFA 1UEMA 4ZFOA 3T08A 3IDGA 2KZWA 2EE2A 4GQ9H 4FNLH 3QUZA 4AG4L 4ELMA 4Z0XB 3ARYA 5H37H 1VPOL 4XNUL 4HKXB 3QNYB 1KGCE 4ZSOE 4OD3H 2GFBB 5E2TH 4FQXD 4GRLA 1HYSD 2V5YA 5BV7C 1SM3H 1LO0H 3NH7H 4WTXA 4XB7A 4E41B 3ZMRA 4EI5D 3OPZH 3MGOB 4EJ1C 2OTWA 2PYEA 3N1QC 4NN6C 5IM7A 4XX1G 3X3FH 1HWHB 3V9FA 4NBYB 4ONHA 5AG8A 5B4MC 2PYFB 5EPMB 5F1NA 1HILA 3U6RA 5C6WH 5IV2A 5E4EB 3VG0H 4NWTL 1I1RA 4HS8L 1RZJL 3SKOA 3N50A 3ULSA 3BDYL 4PGCB 3BW9A 4DZBA 2W9DL 4F9PC 5DK3A 1SQ2N 3EYOB 5EUKA 4FRWA 1KT2A 1LMKA 4I3SH 4FQXB 3ZTNL 4MD4B 2VLJE 1NQBA 2R9HC 1OF2A 5KSBE 4NIKB 4EI5B 4GH7B 1FG9C 4NO3A 4Y0GA 4GRMB 4HWBH 1ETZB 2ZCLH 2FZ3B 1CDHA 1IGCH 3S4SA 4F7MB 5T1LA 4J23A 4N5ED 4LCCB 1BZ9B 5ACMA 3UTOA 4R0LC 2X09A 2Q8BL 2V7HB 3VE0B 1G9MH 4PJDF 3P9MB 1PSKH 3CXHJ 1BQHB 1BQHG 3LH2L 3BEVB 4P4KC 4Z7WF 5FECB 1A3QA 4AY0A 4YBQC 1J05A 1U8LA 1BD2A 2F9BT 1ZT4B 1FAIH 4UBDC 5K59F 3X3GH 2Z92B 5T3ZD 3BQUD 1S7WA 5CGYC 2AXJA 2R23B 1A6TB 3NACH 1T03H 43CAA 4HIHB 2YPLD 4GUPA 4NKIH 4PB9L 3CGTA 2Q8AH 3UO1L 1UZ6F 1RK0B 4Q6IB 1CLYL 4ZPTB 1CGSH 1AFVH 1J1PH 5HVHC 5D6CA 4EOWH 4G6JH 2YA0A 1MREH 5MEND 3QEQE 5IHZB 4BKLA 5GGTL 3LS4H 3UAJC 5DJAA 3BEWA 3NIGE 1YQ2A 4EVNA 1QBAA 4PRIA 3EJJX 3BUYA 4LGSB 4HIXL 5EZIL 1H8NA 4U3CA 3TBSA 5ACZA 4NQEA 2J2ZA 3VW3H 1INDH 5JR1H 1U8MA 5HHOD 1CFNB 3FFCA 1AQKH 3BQUB 3MV9E 3RTQD 1QFPA 2O5XH 2DQCL 3GMQA 4F37K 1KB9J 5E5UB 3U48A 3DGGB 5L2KD 1MVFA 5H94A 3CFBB 4WU5B 1DLFH 1KGCD 3ZE1E 4ETQB 5GRVK 2PXYC 2YPLB 3WSQL 3ARFC 2UV3A 3EUUA 1FFPB 4HX1B 3VWJD 2IANA 3H9YA 3KYKL 1JGVL 5HHQB 3NTCL 2G9HB 4TULL 3VXMA 4AEHH 1DUZA 3MA7A 1S8DA 4KRPD 5MENB 3B2UC 5TGBB 5DD3L 1J9CT 3U4BL 3SKUD 3EBAA 1CDIA 2A6KA 1MH5B 5FDWA 4WI9A 4W81A 5D96B 1QUNA 1UCBL 3VGHA 1AGDA 3MRGA 3WNKA 2APVA 5HHOB 3S35H 2Y1VA 5DMJB 5EU6E 3RTQB 1T80A 5L2KB 3I50L 5C0DB 3SGEH 4FQ1H 6CGTA 4MNHA 1I8IB 1QSEB 3VWJB 4AEFA 1HHKA 1R3IL 3FKUS 4XMPL 4CN1A 3FQWA 3LEYH 3TH4T 4YBLB 2IAMA 4KRPB 3MTRA 3EYSH 1P7KA 2DLGA 3S34L 3VI3F 4OLZL 1OTUD 3ZT7A 5F7YC 1X4YA 3CX5K 3H7BA 2XKSA 4Z7NF 1KLGB 1A9EB 1P4IH 2HFEB 1WIPA 3OGOE 3PGDA 3LKPB 5I19L 4AIOA 4RIRA 2CRIA 4P5KA 1K5NA 1RZ7L 2ICCA 4MWFA 4TNWK 3HA0A 2YSSA 1E0OB 1Q0YH 3V0WH 4URTB 3A6BL 3L3KB 3ZL4L 2NY2C 1U8PB 1IILE 2HJKA 3O3BB 4HUMB 4WO4B 3ILPA 4GRWF 4ENED 1AIFA 4AM0A 1DQMH 2NY4C 1N6VA 3CSYB 12E8L 4OFYD 1UXWA 2DTMH 1ND0A 4OZIB 2A77L 3A67L 3QEQD 3B2VH 4M00A 3QCTH 4IMKC 5JXEA 3VD9A 1QLEH 4JFQB 3RWFB 4LVOC 4PJBA 5IB4A 5LVEA 3SEPA 3C9NA 4TOYH 5HD8D 3WO4C 5ILTH 5I9QC 1GXEA 4H88H 3U83A 4U4BA 2JJVA 3WUWA 3JV6B 2EKJA 1XF5A 5DQDL 4X7EC 3L3OA 4M6OH 3SGEI 3CX2A 4P5MA 3Q2CA 4NJAH 1CICA 1A7PL 5DR5L 2QADD 2EDBA 1QRNA 3IFNH 1F6FB 4ZXBD 5EO0B 1REIA 5FEBA 2J7LA 2CLRB 1DZBA 2VMFA 4M6AA 4M7KH 1I9RH 4L8DA 4BFEA 3MLYL 1F4HA 3WHXA 4CL7A 5IVZB 5D7IF 3TT1L 3TBWA 3FQUB 4AMKH 2NR6D 3DVNA 3CMOL 2Q76B 4LMQI 4NRXB 4HMEA 3QEQB 3RVWD 2GITB 4QF1B 1BECA 2HT3D 5C9JA 4OM1H 2VDQL 4X6BA 4APQD 1KJ3H 5ALBL 1NKOA 3ARDA 4XNZC 4A6YB 1S7UA 2IMMA 1F13A 4PBWD 3ZKXC 4HW6A 4WHTA 3VGFA 4JFXB 3CFJA 4ODVH 4WWKD 4EXPX 3HPJA 2IFGA 1I1AC 4P57B 1ONQA 1QO3A 4ZAKA 4Y19E 1DVFC 2QADB 4ZXBB 2HLAA 2X4RB 1HDMA 1NFDB 3TV3L 3QUZC 4XBPB 2FR4A 5C3LD 1DSFL 4N0FB 5KS9A 4ZFGL 2X7LA 4JFOB 2X1PA 4PY7B 5CP7A 4NRZB 2OYPA 3IDIB 1ZEAH 3BVNB 4LNRB 1AXSA 4APQB 3TA3A 3MRDA 3BJLA 2C7UA 2D9CA 3IGAA 5F1IA 1T21A 3E6FB 3MR9B 3BKYL 4PJAE 4Y5YB 5BO1L 2B1HH 4P3DB 4WWKB 3TH2T 1CGVA 4IOFC 4ZODA 3O3EB 4MQ7B 1TZHB 1GZQA 5KG9A 5D71H 3H9ZA 4L29B 4M43H 3T3PE 1RJYA 3L3GB 1I9IL 4PJCF 1ZANL 2EE3A 4RMTA 3V4VH 1MWAB 5ISZA 1DQDH 1F3JA 2AJ3B 3L95B 3SCMD 5D2NC 4WDIB 1G7QA 5GSVB 5HYQB 4HCRH 2AKRA 2IH1B 4FZ8H 4K8RD 5DYOA 4BSWA 5FV2A 1P7QA 2BSRB 5EZJB 4IDJH 3GSXA 1BQLL 4U7SA 4W4OA 3VDCA 3D85B 5B39G 4F57H 4KY1L 4C56D 3PG2A 3GRWL 4ESKA 3LEXB 4K3EL 3RWHA 1FN4B 4OZFH 5K9OA 3T4AA 1UWEH 4H26B 4Y5VA 4M8VA 5AZ2H 4JDTL 5JIIA 4ETYA 1MUJB 4H1LH 5LWYH 4Y4FA 4ELMF 3NBNA 3E6HA 3SCMB 1U95B 2ERJB 2F54E 2EDDA 3D0VA 1TJGL 1BMGA 3LRHA 5EZLB 1H3VA 2WINB 5DC9B 2PUQT 4C58B 3MXVL 4FXGB 1KXVC 5GGRA 1A5FL 1OCWL 1X5FA 1ZS8B 2FEDC 4WUUA 4GW5A 3QQ9C 3ZDXE 4C56B 5ESQA 4WU7B 2UYLB 3MFFB 5EUOA 5CILH 1CFQA 2ARWA 1N7ML 1AE6L 4XVTH 3MNZB 2HVKA 1XGYH 2XTJE 4R7DB 4YWGL 5BRZE 3HNVH 3O0RL 4JN1L 4NZUH 5AG9A 1FLRH 5D72L 3CFCL 1FVDA 1T7YA 4PRPD 5IHLB 2FYYB 5CKAA 1CD1B 3P9LB 3OV6A 5DUMH 1X7QB 3MROA 1UENA 3QCVL 1YY9C 4JRXD 4EDXA 3QWQB 5DRZA 5A2FA 2I07B 3MOBL 4U6HA 1IM9D 1HI6B 4KJQC 5CJBA 4Y8AA 4ZO8A 3UPAA 2Y36L 4M5YL 1LDPH 3I85A 4MD0B 2GQHA 2V2WA 2L0DA 4NM4L 5KJRH 2I27N 3BT2L 4LF3A 1CG9A 1FBIL 2WAHA 2Q7YA 2X4UB 2Y06L 1CR9H 1H0DA 1JPSL 1UKQA 3GJEB 4RFOL 5IMOA 2DQHL 4NUGH 3FCTB 1DLHA 2D2OA 5GQBA 3WNMA 2A6JA 4M1DH 1FL5B 2C1PA 4GW1B 2FDBP 3EKCA 4PRPB 3C8KA 1Z9SA 5IKCA 1W0VA 4TRPL 4NHCL 3QEUA 3S36H 3P4MA 1NCWH 4OCXL 1U8NB 4JRXB 4O2CB 1JWMA 1SVCP 2FX8L 1UWGL 3BHBB 1FO0A 1NDGB 1RURL 2CDGA 1UYWL 1A7RH 4XP1L 5J7CC 1G7JB 4YR6B 1FJ1A 4H25B 1JHLH 4WFHE 3DVGB 1I3GL 3QUMB 5CD3A 2IAMC 3BZ4A 4Q58C 1WAAE 1DUYA 4R4BB 2FGWH 3QUYA 5C3TA 5C8JB 3OB0K 2CJUH 3VRIA 1BBDH 2ADFL 4JN2B 5DMIL 1YDPB 1YNKL 5CCKL 3IS0X 3VGAC 4PJGE 1LK3L 2J8UE 4R8WH 4GMSH 1P6AB 3O9WA 1WT5A 4OI7A 4ZTPH 3C5SB 1HXMB 2B5IB 4PJIE 3QG7H 3BZFA 1T7ZA 1UM6L 2JTDA 5D93C 2LQRA 4JFEE 3KR3L 3O2DH 2CR3A 5F88B 2NYYC 3V6FB 1LE9A 3PWJB 4RFEA 2VNCA 1R5IB 4XRCB 5CD5D 5I30L 3B43A 4S0SD 2X1WL 5EIIA 1MLBA 1ZE3C 3OAYH 4XMLH 1IL1B 3IFLL 1G6RH 1FORL 4NFDA 1DBKH 4J4PD 1AD0B 2OCFD 1U3HD 4XI5D 1Z3GH 5IB1A 4EI6A 5JXEC 4CVZB 4ZUSB 1NEZA 3PWVA 1BFOA 3MV01 1X3DA 1ORQA 3GSOA 2X1OA 3BGAA 5JHLL 1EMTL 4MNQA 4Y8DC 4LEXL 5E00A 1DE4B 4QKXB 3LN4B 2FEEI 2IPTL 5L9DL 2XTLA 2IALA 2NY1D 1I9JL 3WS3B 4LSUH 1U8KB 4LU5L 4MJ4A 3Q1SH 1C5DA 3VFOA 2MPAL 2DBJA 4O4YH 4JVWA 1LO5B 4U49A 2AK4D 1U3HB 3HS0A 1KTDA 1WFTA 5I16B 1J0IA 5EWIH 1L6XA 5JPNB 1ED3A 2H2SC 4NWUL 3TNNB 5HYJA 5LXGL 4KMTL 3V7AG 1JGUL 1J0KA 5F89A 1JPTH 1WEJL 3ARDC 5FIEA 4P59L 4AYFA 1VEPA 1MY7A 4PIRF 2V5RA 1RQ5A 1J0JA 4I4WB 3TO4D 4M7ZC 4NQVA 3P73A 5B38G 4NBXB 4ZAKC 1DBML 4C59B 3MXWH 2NY1B 4NPYB 1P53A 4AL8L 3D87B 1SYSB 1B4JL 1V8HA 1OPGL 1MRDH 1Q9LB 1NGWB 3O3DA 1JFQL 2AK4B 3O3AB 4XCEA 2B4CC 1WLHA 4OAWA 5TDOA 3VD3A 4IBLT 3GK8H 4YZFF 5I8CB 2KH2B 4OLUL 3TA3C 2Z35B 3TJEH 3KPNB 5BVPH 3VXNB 5DD5L 3UJJH 2HG5A 3I6GA 3TO4B 1GIGL 1KCVH 3VFSA 1G7IB 1XF3B 5I15L 4OZGA 1QEWB 4MGXA 5GJTH 2NX5E 2J5LB 2X89A 5C0FB 3HZYB 1L6ZA 1VEMA 1VB9A 3RWCB 2Y6SD 3U0TA 2P47B 4OF5A 2DYPD 3RUGE 2ICWI 3EO9L 5CSZB 1H15A 4MSWA 5D7JD 4ZUTB 1PG7X 3HUJA 5FYJD 4X80H 4RRPA 1JGEA 4W4OC 3MLSL 1WCBA 1L7IL 5C0CE 2DI9A 5D1QC 4EN3A 1GGIL 1U58A 4HBCL 3WE6A 4PJGB 2DJUA 1YN7A 4KPHL 2J8UB 4XVUD 5J1AA 1IE5A 4YHMH 3Q3GA 5J1SC 3F7RA 5I71B 4PJ9A 5DWUL 5KS9F 1A1OB 1Q9OA 3BYYA 2DYPB 3BH9A 4JKKA 2H2PC 1VDGA 3HI6H 4QHKI 2D9QB 3UJTL 4J12A 5D7JB 5DRXA 3KDMA 3FO9B 2HFTA 2BOBB 3G6AB 4GG6F 1FGNL 3P77B 4U6TA 4WFFE 4ONFL 3VCLB 3IAQA 1TZGH 5B8CA 1T1ZB 1Y6MR 3BDBA 2ZKHL 1RZ8B 4JFFA 1SY6L 1W72B 4TUOA 4OCYH 5F6IC 4MJIE 1UM4H 1GC1H 5DT1L 3WIHA 4D2NA 2XWJB 4IRSA 3MJ9L 5DJZA 3LRGA 4XBGA 3CC5B 1KIRA 5EO1A 1XEDA 5FB8B 4DW2H 4BH7A 3HNSH 3FN3A 1K6QL 4XTRC 4X5LA 1WVZA 4P46B 1NGYA 3TBVB 4W6XB 3KLHC 5ALCH 1AR2A 4G9FA 4LHUA 4AT6A 1OGTA 3Q6GH 1UA6H 2JCCA 4YHLH 1BWWA 4HIEA 2QQLH 2ICEA 2HH0H 1T0NB 3WNOA 2QKIA 3OKLB 1TPXB 5K33A 2X05A 5L0QC 3ULUC 3WXWL 4HXAL 4S11A 5ACLA 2QQKH 2MTPA 1PVHA 2XZAH 2H6PB 1N0LA 5FYLD 3QDJE 2P8LA 5MP6H 1LD9B 2MJWA 2ZUQB 3CDYA 1S7TA 3NA4A 3ME0A 1I1CA 2HTLD 5EC2B 3PDDA 3WNLA 3MRBB 1QYGH 4JAMB 4MJ6A 5KVEL 4PJ8A 1R3HA 3V0VA 3M8OH 3ZZ1A 4K8RH 3MRCB 2EO9A 5KVFL 4J1UB 3GKZA 2KL6A 4M6ML 3RNQA 5DS8A 3GNMH 4XPGL 2GJ6E 3M1BB 3NGBB 4E42B 5C0CD 1V7NL 1S9YB 1ZT7B 3LY6A 3PNWA 3QUYC 5F7DB 4CW1A 3T1FB 4PV8A 3MLTA 4HPYH 3QHZH 1CFSA 3FQNA 5LG1A 4LPVA 1MHEA 4EDWL 5E7FA 4L3ED 1RD6A 1Q0XL 1KIUA 3O9WC 1KUMA 3SE9H 4KKAC 4NQXA 4PRNB 2APWA 1WT5C 2EDTA 4OD1L 4KRLB 1QVOA 4M7JH 4DTGH 3PGCB 2F53D 1YECH 2LU4A 3O6LL 3DUSA 2ZOLA 5J13C 5CP3A 5KZCD 1PD6A 1PQZA 1X4ZA 3X13B 1IC1A 2V2XB 3L3DB 4LRNL 5EC1B 5DD0H 4E9LA 2NNAA 3OG4B 4XVSL 3ULUF 3MCG1 1F6AB 2UWEE 3FO1A 5EOQL 2FLRT 4KROC 3LD8B 2G5RA 4L3EB 4QHMB 3BE1L 2E9WA 5L6YL 3V4PL 1MCWW 1QPXA 3BGFC 2OR7A 3OZ9H 2FB4H 4YDLB 3CVIL 5BV7L 5CIPH 1ZT1A 2Y07H 2F53B 4UTAH 3BPOB 3DO7B 3LKSB 4XH2B 3CXDH 3RKDD 5KZCB 5IIEB 5D7KD 1CBVL 1YJDL 4WNQA 4XNYL 2OZ4H 3UTQA 3WIFB 2WV3A 4TNVF 1E27A 1MIEL 1WBYB 5EU3A 3KHOA 4DZ8B 4F8TA 3W81A 3CLFH 1KPVB 2J12B 4OIAA 3C5ZD 3TPUB 4HCRA 4Z7OE 2EH8H 4NOBA 2WIIA 3DJ9A 3LRSA 4XCYB 1QFWM 1C16B 5J6HA 2DKUA 3EHBC 4OLWL 5TF1H 4PLNC 4PYHA 3BYTA 4KXZH 1QHOA 1CDBA 2BY1A 2A83B 1N5YL 4JANA 1VENA 5IWLC 2F19L 2O93L 2ICWJ 4YHZH 5ADOH 2IG2L 4OZFA 3U0WL 3QFJE 5D7LA 5FM5M 1G9MC 3HRZA 1A6UH 3T2QA 4H1LA 1F3DH 2HFFB 1W8NA 1AKJA 5J3HD 3S3PA 4H20H 2J1KA 1J1OH 5F96L 5HHXL 4G8FB 4BZ2L 1NCUA 1FNEA 1TQBC 1XR8A 5D2LE 1CE6A 2EXWD 2IBZX 5HI4D 2H3NB 4BZ1H 4JFHE 1AJ7L 2DQFA 4JZJB 3MLZL 5DK2A 1NAMH 1VFBB 4HKXA 5LGJB 3QNYA 2H1PL 3RX7A 1JUFB 2GFBA 1QLFB 4YQXH 3P4OB 4QHKJ 5I18H 1MCCA 3OQ3B 2ADIB 4YXHH 4E41A 3EJZD 1TITA 1NH6A 3NCFB 3MGOA 3MYJA 4MAYC 4QEGA 1S5HB 2I9LA 3VRJB 3CSGA 3GMNB 4OM0H 3UROR 4C4KT 3QWRA 1D5BB 3BAEH 3C8HA 1UACH 1AP2A 2JELL 1ZHNA 2PYFA 5EPMA 5I1HL 4YXKL 4BK4A 3L5XL 1EAPB 2KPNA 4HEPG 4N0UE 3V4UH 4PGCA 1EBPA 2DTSA 3EYOA 4KXZI 4EN3C 4FQXA 1UXSA 4MD4A 2BNQE 4QT5B 5TH2B 4AG4H 1YNTB 5HDBE 1VPOH 4I0PA 2DAVA 4XNUH 4EI5A 2GSIA 2GY5A 3D18B 1A6AA 4GRMA 1ETZA 3K2MC 1WQVT 4I18A 2XN9E 4Y2OA 1XZ0B 4WRLA 4F7MA 4N90D 4QXUL 2VSCA 4LCCA 4RNRA 2BDNL 3BKCL 4LSSL 2VQ1B 2QSQA 3P9MA 1KB5L 2HAZA 3CLEL 3BEVA 4OD2B 5HYFA 5FECA 2ZSWB 5IFHL 1VGEL 2VLLB 3MNVB 3RVTC 5MEOA 2XQYK 3J8F7 1ZT4A 3A6OA 2DL9A 3KLAB 2UWEB 5F44A 9CGTA 3AU1B 3BMVA 4HS8H 1RZJH 4P23A 4PGJA 3BDYH 4OZGF 1J87A 4LBEB 4R9HA 2BVYA 5B8CC 2W9DH 1TIUA 1UB6B 4F7TB 1D3CA 1A6TA 2HT4D 4LP4A 4EKXA 3Q5OA 3ZTNH 4HIHA 4KKBD 3U30C 2XNAB 2H32H 1B0GA 1J0HA 1TENA 5C86A 5J11B 4IRSC 2CPCA 2NLJA 3HUJF 3MRRB 4WI4A 4YX2L 1ZA3A 1HOCB 1NDMA 4MZ2A 2Q8BH 1Q9KA 2DKSA 3RWIB 1WUNT 3RWJB 1RIVL 3VFPB 3OSKA 2CK2A 3LH2H 4WTZA 1CFNA 1DQJB 5FKPB 5C7XL 3QWOB 3SKMB 2OSLB 4XCFH 1T6VN 2E7LA 3CFBA 4WU5A 4ETQA 3V7MA 2YPLA 3QULA 2BC4B 3ARED 1FFPA 4HX1A 4L4VD 4EIGB 4LGRB 4U1KB 2G9HA 4OSUL 1RJLB 1MFCL 1YEKL 5TGBA 3U1SL 4PB9H 2E3VA 3UO1H 1MH5A 1CLYH 4ODXB 3MCKB 3L6FA 2EIEA 5GGUB 3BRFA 3JTSA 4PJ8C 4G7YL 4JFDD 5HHOA 1T20B 5GGTH 4U1GC 3NOIA 3LS5L 2VIRA 5L2KA 5C0DA 2VERN 2DKMA 5J12C 5EZIH 1CIUA 2H45A 1MCEA 5DQJB 1HNGA 4NP4L 4L4VB 3VWJA 3OKYA 4FFVD 1F6LL 1FGVL 3Q48A 4UTBL 4LOUD 2DD8L 3VGBA 3VD4A 3E0GA 4M5ZL 3WSQH 3CAFA 1TCMA 5JZ7C 3ZHKA 3KYKH 1JGVH 2YRLA 4TULH 4JPWL 3VFNA 1A9EA 4JFDB 4PJHF 5CJ5A 4YHOL 2JB6B 5DD3H 1YA5A 3U4BH 2Z0BA 4M48L 5EO9B 3WL9B 4EBQL 2DQUL 3TJHD 2GY7B 4DN3L 2A9ML 3IFPB 3ZTJG 5MHSE 2JCCF 1UCBH 3L3JB 3FO2A 4JCMA 1KACB 2VLJA 2ZUSA 4X8JA 3L3KA 2NQCA 2Z4QB 4J3XA 4ZFOL 5DHYB 2IWGA 5KSBA 4OV5B 3I50H 4RAUB 3SY0B 5DJCB 5AAMA 3BH8A 1CGYA 3DX9B 5D1ZD 1R3IH 2PW2A 2OLDA 1MRCH 3BOVA 1FNFA 4XMPH 3C09C 4OZHE 1MIML 2HYMA 4RBPK 4KK5D 3QPQC 4OLVL 3VFWB 4OZIA 2AERT 5C0RL 3LPGA 3CZFB 1PKQE 2Y7QB 3S34H 4OLZH 3FMGL 5E8OB 2E9JA 3KXFD 4KQ3L 3RI5K 4BSVB 1BOYA 2YD2A 5L88L 3JV6A 5I19H 3RY6A 4FQLL 4QXGL 1KPRB 4HUVB 1A1NB 5EO0A 5CFHA 1I4FA 1RZ7H 5DVKA 3QJHB 3N85L 3DYOA 5F9WB 5D1ZB 1ZLVK 5IVZA 3A6BH 5DDHB 3GHEL 2YC1A 4F15C 3GM0A 4F7CB 4YC2C 2XZCL 4OFYA 3GBLA 5C1MB 3DGCR 2Q76A 5I75B 4NRXA 4V1DE 1B3JA 3QEQA 2GITA 2CIKB 3EYVB 1CZ8L 1A9BB 12E8H 3KXFB 1I3UA 2JJTA 3ARQA 5E8NB 4QRTB 2A77H 3EYQD 3A67H 4JFXA 3LKQB 3ARXA 4ZFFB 5GRZA 3MRNB 3MV9A 1MFDL 4ZXBA 4YDVB 4PLKD 1NFDA 4XBPA 3UBXI 5JW4Q 5DQDH 4N0FA 4HKJA 1EIBA 5DR5H 2W92A 1A7PH 4JZNA 5KANI 4JFYA 5DHVH 1F3DJ 1N8ZA 1AR1D 4IS6B 4NRZA 1JYWA 3IJSA 4KFZC 1T6WA 3IDIA 3MLYH 1IGML 4FXKB 3BVNA 3MJGX 4K3HA 4K2UH 4LNRA 2XZQL 1A0QL 3GEWB 4AIZB 3TT1H 1DBAL 3MOAL 5GGRY 3BN9D 3B9DA 3KGRA 5DJ2A 3MR9A 4PRHE 2AEQL 1HH6A 1RUKL 4L9LA 3B8SA 4P3DA 3ZYIA 4WWKA 2Q86B 2KQNA 2EICA 2VDQH 1GOFA 4Z7WE 5ALBH 1OP9A 3O3EA 1K8DA 3CMGA 5MHSD 3AROA 2A6DB 4G3YL 3C5JB 1Z9LA 2XICA 5KN5A 1FL3A 4P9HL 4ORGB 5EBLB 4R26L 1SJEB 2AJ3A 3L95A 5D1XC 4E5XB 5A40E 2BFVL 3MBED 5HYQA 4YGVA 4X7TB 3WLWD 4FQXC 3I02B 2C3HA 4O00A 3TV3H 4BYHA 1DSFH 5EZJA 4AJ0A 2CO7B 4I0PC 4ZFGH 4EI5C 2X4OA 4PJ7B 5DEGB 5EFIB 5E24E 1VA9A 2OM5A 2EYTB 3BO8A 3K8MA 2P4AB 1YMMD 4I18C 5GS0L 1JYNA 4QY8B 4J3TA 1P6FA 3LEXA 1FN4A 1CLCA 5I1AB 4H26A 2X9WA 4RGNE 3FTGB 1MUJA 5JHDD 3BKYH 5BO1H 2VZ1A 3VXPB 1U8JA 3QHFL 3QFDB 5JW5B 3DMMD 3SCMA 1U95A 1AGEA 1W2KT 2ID5A 5EZLA 5DO2C 3O11A 2D7NA 4G9DB 2WINA 4PD4K 5ICYB 5IQ7L 3O41A 3D69A 1I9IH 1ZANH 3H6JA 1KJ2L 4P23C 4RCAA 3A6CL 1MOEA 1JZ7A 1N0XL 1WISA 1LEKB 1YQVL 1ZS8A 1YMMB 2AEPL 2IF7A 3H7LA 4KHTL 2OL3B 3T3ME 4C56A 3L7FB 1I85A 5FO8B 4YHKL 3ECBB 4WU7A 2UYLA 3MFFA 4UUJB 3FFDA 1BQLH 4Y4HD 2YD5A 5C0JB 5KTEH 1KXQE 1XFPA 2P42B 3FAWA 5JHDB 4KK6D 3GRWH 1JGDA 2FYYA 3DMMB 2RJMA 2AJXL 4K3EH 4NKMA 2OQJB 1X7QA 4POYA 2G75A 1T22B 3DX6B 4JDTH 2A73B 2I07A 8FABB 3I75B 3CX5J 4KUCD 3D39D 3MZGB 2PW1A 1TJGH 1Z0MA 2E7LC 3IAPA 2E27L 4HK3N 2K7PA 5F9JA 1G0YR 1HEZB 3MXVH 3MV11 2Z31C 3FCTA 4Y4HB 4P2RE 1A5FH 1OCWH 1KEGL 1FL5A 2AAVA 4GW1A 4QHLB 1HSBB 1OB1B 3I84A 3K2UH 4G80B 4DAGL 3QIUD 2VITB 5CAYB 1U92A 1NSNL 1N7MH 1AE6H 4JG0L 4YWGH 2X40A 4Y4KC 5I66B 3VXUE 3O0RH 5CIPA 1U8NA 4JN1H 1QNZL 4JRXA 2ED7A 5T1MA 5D72H 3CFCH 4U33A 1IM9A 3WN5A 4O2CA 2VAJA 3T2OA 2DBLL 4YK4B 2OZ4A 3D39B 3FB8B 1NDGA 2PCPB 1XF2B 4IJ3C 3HB3D 3QCVH 4F33A 4J6RL 5JIKA 5EBWB 3MOBH 4RAVA 5HXMA 1G7JA 4XPTL 3RL2B 1MQKL 2HLFD 2VDNL 2J8HA 4NJ9L 2Y36H 3A0OA 4UIKH 3QUMA 2RAMA 4UV7L 2J3SA 4M5YH 4UU9A 4KRPC 1DANT 4OUOA 1KJMB 4R4BA 3BT2H 4NO0D 3JXAA 4PJAA 3QIUB 2MQ0A 1MCSA 2FATL 1FBIH 4S2SA 2OJEA 2Y06H 3G08A 4BQCA 2VZTA 4RFOH 3DRQA 3UMTA 2DQHH 5IOPB 1YDPA 3QEHB 5DLML 5B3NA 2HN7B 4RGND 2XIDA 5HYSB 5HYSG 1KLFA 1FNGB 3PP3H 3BXNB 4XP6L 4TRPH 5E1AB 4NHCH 1B2WL 4HMDA 3LQZB 4YHIB 5E9DE 4OCXH 1HXMA 4MXQD 1M05A 2B7DT 2XQYG 2EDQA 4JO1H 5AUMB 5FGSA 4DOHE 1EBAA 2FX8H 1UWGH 4HH8A 4I5BA 1RURH 1R5IA 4XRCA 1UYWH 3EO1A 3PGFL 1FRGL 4RX4D 4ZOAA 4NO0B 4TVPE 4XP1H 1NAMA 1PLGH 2B4CL 2PO6D 3GUTB 4NQDE 1I3GH 4X6DB 5FGBA 4TYUA 2R1XA 1WFNA 4X6CE 2HTKD 2OI9B 2WUBL 4RGNB 1JCKA 4CVZA 4ZUSA 4KRMB 5F7EL 1FH5L 4RQQB 1RZKL 1VHPA 2F54A 4GBXC 1TXKA 4IIQB 1CCZA 1X5AA 5DGRA 1YNKH 2M1KA 1NCDL 4ZOEA 1LK3H 3HZKA 4OTXL 1A6ZB 4XZUB 1R5WA 3LN4A 3RY6C 2P24A 3KJ4B 5HI5D 1A14L 1U8KA 4HH9B 5EIVA 1XGRB 1UM6H 2W0PA 1P2CB 2PO6B 3KR3H 3KPMA 1LO5A 1MCHA 4DKDC 2QR0A 4WJ5B 4J4PA 2WMPA 1U3HA 5I30H 3OKKA 3GJFH 5JPNA 4JJHA 3ZO0A 2R29L 3IFLH 1IEAB 5FKAB 4L4TE 4RMRA 2JJTC 4WY7H 2A1WL 1S9VB 3HPLA 1IVLA 1O7SA 5D4QA 1V05A 4Q9QH 4I4WA 1A4KB 5D5MB 2WP3O 2I9TB 3ZYZA 5KSBF 3IXAB 3ZDZE 2AXFB 2HRPH 1EMTH 4LEXH 5JXAL 1SYSA 4JZOA 5DUBB 4NKQB 3VI4E 1O0VA 1NGWA 3DRTA 5LBSL 3MV7E 2AK4A 2IPTH 3O3AA 5L9DH 4GAFB 3T0ED 2AABL 1I9JH 5L8JB 3ARSA 4OCNC 2WBJC 4LU5H 2Z35A 5CGTA 3K7UA 3KPNA 3VXNA 4N8CL 4RAHA 4KJYB 4KQ4L 4L9LC 1KLUB 4TSCL 1S78C 43C9B 3X12B 4HJ0D 4LEOA 2CIIB 2H32A 4WWKC 3TO4A 5J6GB 5LXGH 2CH8A 4KMTH 2NMSA 1JGUH 1D6VL 1GC1C 1NMAL 1G7IA 1P84J 3OHXB 4L3CB 1QEWA 1WEJH 4P59H 1ZLWK 3HZYA 3Q6FA 3RWCA 4Z77B 3JWNC 2BVOA 2WWKO 1QA9B 1K4CB 4OKVB 1MHPH 1DBMH 3T0EB 4XXCA 1TQCB 3FOLB 4AL8H 2VQTA 3UTPE 5CSZA 3HC3H 1CT8A 1B4JH 1OPGH 1WAAA 4WFED 5CJOL 1BF2A 5FYKU 4D0DA 2VSDA 4TVPD 3NIGF 5DTFB 2V9RA 1JFQH 3N06B 2X2YA 3V5DB 5IMKB 1HSAB 4MDIA 3ZHLA 4MJ5A 2VDRL 2IJ0C 4CMHB 2BHZA 2VWEE 4PJGA 1LO4L 2J8UA 3UTZB 3TN0D 4OLUH 5F7KC 4HWNA 1MJ7L 3M17B 5DD5H 4GJTB 1HQRB 2F8XC 3ZE1F 3B5TA 1OLZA 4PJIA 3WBDA 2DWEB 3ULUL 2PR4L 1GIGH 2DWDB 1IAMA 3B9KA 3TCLB 3EFFA 4JFEA 4DOHB 5I15H 2DYPA 3S6CA 3EGSB 3MUY1 1R3JB 1LEGB 5GGTA 4K8RC 3RPIA 3U79A 1W0WB 1KN2L 1C12B 1Q9WB 3RZCD 4KTDL 2BOBA 4NGHL 3NABL 1PFCA 3NFPB 4I48B 2R0WL 4MS8C 3P77A 3EO9H 1NCTA 1YC7A 4U1HB 4DN4L 4P5TA 3VCLA 3TN0B 4QRRD 3DI2B 3MLSH 1T1ZA 3QIWD 4PLOB 1L7IH 2PTVA 1G9EA 5I8KL 1JYVA 1BD2E 1AXIB 4X83A 1GGIH 4HBCH 4PJEE 4KPHH 3GSUA 1HCFX 4R96B 2UZYB 4C83A 3ZE2E 5IJKC 5BS0E 1JRHL 1GGYA 3EFDL 3RZCB 5DWUH 5AYUL 1DDHB 2WWKT 1BAFL 2XFXB 4I2XB 4HWZA 2B8OT 2BHYA 3UJTH 5FB8A 4YAQB 1JZ5A 5GJSL 3P40A 3EO0B 3UBXA 3RL1A 2HKFL 3DXAE 3QNXB 3EOAB 4QRRB 3J7HA 4GQ9L 2NY3D 3BPCB 1FGNH 4QXWA 4ONFH 4OUUB 5I2IB 5IB2B 4Z78B 2Q87A 2E5EA 5E8EB 1D7FA 3GSRB 4HQQL 3W9DB 2H6PA 5KVGL 1LD9A 1FLTX 3WN5C 2ZKHH 1F4XL 1Z2KA 3JUYA 1S9WB 1SY6H 4HS6A 3D25B 2XACC 2IFFL 5DT1H 1G9NL 5F7UA 3MJ9H 1O5DT 1JNNL 1BFVL 3RRQA 4OFDA 1JWUB 5CBAB 3WIIL 5E70A 2D7MA 5I1DA 4J1UA 4M9PA 2NY3B 3TC9A 1DL7L 4YPGB 3M1BA 4YHPB 2AS5M 1S9YA 1ZT7A 3WLBB 1K6QH 1K2DB 3AGVA 3MRMB 3NPSC 1RV6X 4OCSH 4HEME 1T7WA 3T1FA 4HZLB 4WHYG 5DRNA 2VISB 5JNYB 3IKCB 4LPWA 3JTTA 5HGAB 3SDCA 3H9SD 3MPCA 3WXWH 3O6FD 3LKOA 2CLVA 4WEBL 4HXAH 2ESVD 4JGJA 5F70A 2YK1L 4KDTC 4M3KB 4DK3A 4Z5RB 3L3IA 3IKKA 4NZDA 4L8SB 3TVMB 3ARUA 1PSKL 4JREC 2YA2A 5A3ID 1GAFL 1G7HB 3DOSA 5KVEH 5C0CA 4RGOL 2V2XA 1I8LA 4ZS7L 1M4KA 4JHWL 1PG7L 2ZNXA 5DHVA 5I6XB 5KVFH 1PYWB 4M6MH 5FGBC 4X9HA 1LP9B 4XPGH 1IEBA 3UJIL 3H2WA 5SWSB 3ARTA 2DI8A 1V7NH 4HS3B 3H9SB 4L3EA 4QHMA 3O6FB 2ESVB 3O8XD 4LAQL 1SHMA 1P5UA 5K93A 4PG9B 1FZKB 3S35X 5C2BL 4LPUA 1AFVL 5BS0D 2F53A 4QRPD 3RU8L 1MJ8L 4PJXB 4EDWH 3DO7A 2UY6A 1UKTA 1Q0XH 5IIEA 3LS4L 2MNUA 3WIFA 4OD1H 1RULL 1WBYA 4BH8B 1JPFB 3NIDE 3WKNA 1BP3B 1CQYA 4PJAF 4Z7VB 3OXSB 2B0SL 4X4ZA 4JY4B 4J4PC 1P9MA 4XCYA 2XTJC 4XI5C 1C16A 4N9OB 3VMOA 4PJBE 3QEGL 1U3ZA 4LLWA 2VDKL 4AEIL 4HGMA 4GAJL 4P2CG 4LRNH 3T3PF 1JGLL 4XVSH 4YDJB 4FS0A 2NY5L 3O8XB 1U93A 5ERWB 5EOQH 1PEZA 4XNMA 1Y0LB 1QRNE 3FRUA 2RR3A 5BS0B 1CXEA 3UX9B 4QRPB 3GI9L 3INUL 2IPKB 3LKRB 1H3TA 3BE1H 5L6YH 4JLRB 3V4PH 4GMTL 1RSFA 1DQQB 2HFFA 4FQHA 1T1XB 3VWKB 3CVIH 3K1DA 5BV7H 2D4DA 3WS6A 4JGUA 1ITBB 4HG4J 1KFAL 3C5ZA 4DGIL 5TE4L 3S88L 3VD5A 4UT9L 1H5BB 3ARVA 1UWXK 4G8FA 1CBVH 1YJDH 3JSSA 4XNYH 1D5IL 1MIEH 2H3NA 2AQ3A 4X9GA 1Q72L 5C0AD 2G5BB 2A0LC 2CO6B 1C5CL 4JZJA 5BZDB 3JWDL 4NNYA 5LGJA 2IC2A 3G5XB 4P2QD 1QLFA 3T8XA 3P4OA 4OLWH 2LTQC 3TO4C 3L5JA 3MZTA 1M1SA 3FT3B 1J8HD 1TZIB 5FFLA 3PP4L 1N5YH 1S5HA 4X99B 4LCUB 3FQXB 4LASL 1A02N 2F19H 4U3HA 4I13B 3PABA 5E8DL 3QXWA 2IG2H 4RMUA 3U0WH 3P30L 4WI2A 1D5BA 4UQ3A 3UPRA 4XXCC 3WIHL 4QGYA 2A6IB 5LAXB 1NAKH 2VKXA 5C0AB 2UVEA 4NUJA 2ORBL 3SGKA 1EAPA 2V2TB 2J8OA 4KI5E 4PG2C 2LFGA 5F96H 5HHXH 1OGAE 4D8PB 1KIPB 3QRFM 1IQWL 4YEEA 4P2QB 4U6XB 3KVQA 4QT5A 3IDYB 5TH2A 1AJ7H 3S96B 3WO3B 1J8HB 2ZUWA 1QR1B 5A2JH 4G8GE 5IB3A 5I71C 1QHPA 3R8BB 5EOTB 5GS3A 2H1PH 1XZ0A 2A9NH 2Y6SC 4QTHB 2XA3A 1F02I 3B9KC 3PDOB 3TH3T 1VEOA 3LPFA 4J8RB 4EQ2A 5DJDB 1ZHBB 3ALXA 3B2VL 4LPXA 4NYLB 4OFIA 2VQ1A 2HFGL 1QSZA 3ZDYE 1TNMA 3QAZC 3MV8E 4TOYL 3STLA 5IW6A 1WWWX 2VLLA 3MNVA 3X11A 3V0AC 1L9NA 2FIKB 2JELH 3UC0L 2UWEA 2RBLA 1AH1A 4NQUA 5I1HH 4YXKH 3L5XH 3PV6B 4P5TC 4LBEA 2XWTB 1I8KB 5GXBB 2WK2A 4F7TA 3T2NL 4CVUA 4D9RE 1I1FB 5DJ6A 2XNAA 2JB5L 1CDCA 3QP3A 4WV1C 2E6PA 5DZLA 4G6AD 1BZ7A 2EDWA 1YEDA 4GLRH 4JHZA 1AI1L 4BFGA 1X6LA 1WAAF 3MRRA 4QXUH 5F6HI 2GI7A 1QFUL 1QSFD 2D7PA 4QRSB 4WUUE 1HOCA 5TE7L 5EUOE 2BDNH 1IGJB 1Z5LB 3V6ZB 1ZOXA 4LSSH 4WENB 3H9HB 3RWIA 4BFIB 3RWJA 3VFPA 1KB5H 1FFNB 1AD9A 1DP0A 4PJGF 5EU4A 4NN7C 5M7QA 5IFHH 4MQTB 1VGEH 2J8UF 1DQJA 2W91A 5FKPA 5KSUB 4PLJD 3SKMA 2RGSA 2OSLA 4LSQL 3NCMA 4XAKD 1MFEL 4MX7B 3X14B 4DKFL 3AS0A 1EEZB 4PJIF 4EUPB 5FUOL 2BC4A 4EUPG 4XP5L 1ZV5A 3QFJA 2NY0C 1JL8A 2DMCA 1RJLA 1T1YA 3UTSE 2QSTA 1PG7W 1QSFB 1X5GA 5IHUL 4HFWB 4ODXA 3SDDB 5C92A 5GGUA 3LB6D 4Y16D 1HKFA 2P5WB 1ZSDA 4YX2H 4X7SL 4HJJL 4M43L 3VH8B 1HWGB 4TVPH 1KEML 1FYTD 1OGAD 3NGBC 4U2ZA 1IC7L 1RIVH 3MRPA 5IVNA 4XNQB 5DQJA 2CKBB 3AREA 5DF0A 4NO5A 4X6FA 5DA4A 5GS2H 4FZ8L 1ZHKA 3I6LD 3X17A 4PPTA 5C7XH 4P3CL 2V17L 3REVA 3MQIA 3GJFA 1T04B 1C1EL 3OGCA 3SDCC 5H35A 3QZWG 2R39A 2EIBA 3MRFB 3HNTL 3IDJB 1FE8H 4P2YA 4M6NL 4HGWB 2AJZB 3SO5A 5DFWH 2Z91A 1VGKB 2MMXA 2GK0B 1MFCH 2APBA 1FSKB 5IVXE 2UVFA 1NGZB 4Y16B 1WK0A 1YEKH 4JFDA 2W0KA 3U1SH 4U1NB 2F15A 1UWEL 5EDXA 5EO9A 3WL9A 4OZ4B 4G7VL 1FNSL 3BWUC 2APXA 2GCYA 1BVKB 5LWYL 4KK8D 4K71C 3IFPA 4FN0A 1FYTB 1OGAB 3L3JA 4G7YH 1OTTD 5CGMA 2QSVA 3B3IA 5C07B 4ZPVB 1BFSA 1HINL 3LS5H 4YDKL 5GS1A 1R0AH 4OV5A 5FAAA 4RAUA 2NTFA 3SY0A 2MWCA 2VLKE 4K7FA 2AGJL 2EDLA 2XN9A 3QDGD 4XP9L 1IT9L 4NP4H 1OT1A 3OX8B 1J1XL 1FGVH 4YDLC 4UTBH 3VFWA 3NFNA 2DD8H 1EUUA 1CXHA 2OXGA 1KG0B 3CZFA 4M5ZH 2OXHA 2A74A 2VRAA 5E8OA 4F9LA 2YN3A 1WJ3A 4JPWH 1NJ9B 2AXHA 3RJQB 4BSVA 3ULVD 4LARL 4ZDHA 2HMIC 1HXYB 3MJ6A 4YHOH 4M48H 4JM2A 3PHQB 4YBHA 4EBQH 2DQUH 4GKOA 3FN0L 4DN3H 1P9MC 2A9MH 1A1NA 1M7XA 5LGKA 3TBTB 1NUFA 3R0NA 3QJHA 1J10A 3WFZA 3QDGB 1URLA 2X4PA 2NY6B 4KKLC 3HAEB 1FZJB 3HAEG 5DDHA 3GIZL 1OAXL 3LKNB 3RUGF 4B7IA 5BXFA 3UTSD 3BKML 3BZDA 4N0YL 3EYVA 5I1GL 1A9BA 5GRJL 3RKDC 1BPVA 1T66D 2WBWB 4YFEA 1Q94A 3W5NA 1MIMH 5K9QI 2BX5A 4OLVH 1M6OB 5C0RH 4QRTA 3O4LE 3L5WB 3S36L 4LPCA 1QBLL 3C5ZC 4HBQA 4CJ1A 3FMGH 1BZQK 4ZFFA 3SQBA 3ZYOA 4GKZB 3MRNA 5HYJE 3QUXD 2E7BA 4KQ3H 4HAGA 2VE6B 4Z7QE 1Y18B 4YDVA 32C2B 4DVBA 2VLMD 3IF1B 5L88H 2CDFB 3O4OB 1EJOL 1M7IA 3MX0A 4FQLH 3DNKA 4QXGH 4PREA 1NCBL 5INCB 3UTSB 2IQAB 3N85H 2AK1L 4IS6A 1MQ8A 4XC3L 2W9EL 4L1HA 1LNUA 3GHEH 4AIZA 2BK8A 2XZCH 5DVNA 4L8CB 5E95B 2P8MB 5CZKA 1VKXA 4X5XA 2Q86A 2OR9H 1BOGB 5E6ID 3QCUL 1CZ8H 3HCVA 2CR6A 5ESVB 3QUXB 1RFDL 1BM3L 1INQB 1S9XB 3O2VL 2A6DA 3W11D 1FFOB 3C5JA 2BRQA 3SGKC 4ORGA 5EBLA 1SJEA 2YEZB 2FNBA 3VFUB 4G42A 1MFDH 1I7ZA 4OZGE 3BJ91 3I02A 1T5XB 3DETD 2VLKD 5T3ZL 5JOFA 3BIKB 3F6LA 4GS7B 3V52L 4GG8A 3T4YB 5DEGA 5EFIA 5F6HJ 3VFMB 1E4WL 4TN9A 1WBXA 4PRBB 4Z7UB 5IVXB 4U1JA 4BK5A 2EKSB 3HTLX 1IGMH 3BPLC 3HE7A 2XZQH 1A0QH 3MC0A 1DBAH 3MOAH 5I1AA 4D9QE 3VXRD 4DEPB 3PQYE 2AEQH 1RUKH 3FQTA 4G8IB 3VXPA 1AHWB 3QFDA 1SY6A 5JW5A 4KZDL 1OVZA 4TQEL 3MBEA 1ZGLP 3NN8B 4UV4L 3SO3C 5FA3A 4P2OB 1U3JA 5IBTL 4H5SA 1K3ZA 2H26B 2VLKB 4G3YH 3QIBC 5ICYA 5EBGA 4F7EB 4P9HH 5FUCE 4LSUL 4R26H 1A8JH 1NLDL 1S7XA 1Z6JT 2BFVH 3E1F1 1I9EA 4OZHA 2VJXA 3B8YA 4PJ5D 1LEKA 1YMMA 2MHAB 5FO8A 1CK0L 3JVGA 1GGCL 5GGQL 5KAQF 4LSTL 3ORJA 4H0HB 2AI0H 4BELD 5J11C 3VXRB 3PUCA 2XWBA 1SVZA 5C0JA 5GS0H 3V6BR 5JHDA 3DPBA 4JJ5A 4O51B 5MEQB 4B5EA 3DMMA 3HLAA 2P46B 2OS7A 4NKDA 3PWPE 1MCOL 1T22A 1H3UA 3DX6A 5IEKA 2AV1B 1EK3A 2A73A 3CUPB 5EBMB 3MREB 1U2HA 3QXDA 3I75A 3QHFH 1U8OB 4UNTA 3SGJA 3S7GA 4PJ5B 2HT4C 4U3XA 2W9LA 2AJSL 4KKBC 2H8PB 3VFRB 5IQ7H 4V1DA 3BMWA 1CL7L 3N1GC 1KJ2H 5IR1A 1MCRA 2X5PA 4P3WA 1QFWL 2D31A 3OJMB 4ODWB 5KOVC 3F7VB 1A1MB 3A6CH 1KN4L 3PWNB 1N0XH 1YQVH 2AEPH 4KHTH 2LAAA 4QHLA 2WLZA 4Z0BL 1OB1A 3T77B 4G80A 4YHKH 1LE5B 1IM3B 4ONOA 4NC1E 2M8XA 3V5HB 4Y5XB 3UDWA 1RK1B 5GZOD 3HR6A 5I66A 1W0YT 2UWEF 4G9FE 2ZSVB 15C8L 2HJFB 2ZOKB 1OAZL 3IVKB 1HHGB 3GSVB 4JQVC 3EYFB 2AJXH 4NKOB 3FB8A 5IG7B 2PCPA 3H3PL 1XF2A 2ED9A 1DBBH 1T83A 3SDYH 2XZZA 5IBLC 3AREC 4ALAL 1BIIB 3ZKMD 2VO5A 1IJ9A 4L5FL 4QXTA 4L9DA 5IESL 2E27H 1KJMA 1G7LA 3ALPA 1UB5A 3QIUA 1FL6B 1BQUA 3MJ8B 5CMAA 3OR7A 4Z7OF 5JA8B 2FJHB 1WWAX 4D0BA 1EO7A 1KEGH 4KMLB 3LAFA 5C0BE 3KPRD 1JZ4A 4IHOB 4ELKB 5HYSA 2C4XA 4DAGH 3PHOB 4BUHA 2BVUA 1NSNH 3CVHB 4A6YL 1NC2A 4MA8L 4JG0H 3RY4A 2CD0A 3KPLB 3LQZA 4YHIA 1AGBA 1QNZH 5FK9B 5JOPE 5AUMA 1INEL 4LLDB 2DBLH 3QXAA 5GS1C 4FFVC 3VMNA 4X9IA 1I7UB 4J6RH 4NO0A 2J4WL 4XPTH 4CMMB 1MQKH 2VDNH 3I3EA 5F72S 3ILQC 4NJ9H 3QO1A 4JKMA 4UV7H 4X98B 4RDQF 5D2LF 5JDSB 1QPPA 3KPRB 3RIAK 4HKZB 4X7DC 2FATH 3EIFA 3U9PL 4P49A 3WFEL 2COQA 4F9LC 2W60A 3KHQA 4UDTB 4IIQA 4LCWE 5DLMH 4S1QL 4NQSB 5IQ9A 3ROLB 1YY8A 1RZIA 4XZUA 1A6ZA 4JM2C 1WZMA 1F5WA 3LV3B 3H3BC 3PL6D 4OF8A 4UAOC 4XP6H 1B2WH 2R2HB 5F71A 4V2CB 3M45A 2YKLL 5KSAD 1MJUL 1B88A 1XGRA 4RX4A 1MWAL 2FH6A 2PO6A 1A47A 4JY6A 1J8KA 4KC3B 4WJ5A 4KK5C 1VFAA 3PGFH 1K8IB 1FRGH 4LNVA 2ENSA 4ZMAT 1O7VA 3F7YA 4PJFB 4ONGL 1IEAA 1BLNA 1VSCA 2MKWA 2OMNA 3TO2B 5DJ0A 2VH5L 2P1YA 1JTPA 4I3GA 4QRQB 4L8BB 4GKSA 2WUBH 1UADC 3DECA 5HHMD 1A4KA 5D5MA 1IBGL 1JZ2A 5F7EH 5DJYB 1FH5H 1RHFA 5HDBF 1FZMB 5FA4B 4YIQB 3HE6C 3PL6B 1RZKH 2AXFA 1A6WH 1E4JA 5F9AC 5KSAB 1OAKL 3O6ML 4FQIL 3G6JE 4MVBC 1NCDH 5DUBA 5F97E 1FZOB 4OTXH 5E94A 1KF9B 1AO7D 4K8RL 4M4RA 1A14H 1P4BL 4P2RA 3E2HB 4PJDB 3MRQA 2ILLA 4DGYH 2JF1A 3CDCA 2IQ9L 3IU4L 2B1AL 2JIXA 1NMCC 2DI7A 4KJYA 3VXUA 5I1CL 3KPOB 5HHMB 43C9A 5C9KA 2EC9T 5J6GA 2R29H 2R9HD 1X5XA 4JM2F 1SJVA 4L3CA 4ISVB 3OHXA 5D8JH 1RUML 4NFBA 1LGVA 2A1WH 5DGQA 1ES0B 3P0VL 1AQDB 5EU5A 5L8LB 5JOPD 4NN6B 2GTWB 1K4CA 3WD5L 3T0EA 1AO7B 3OJDB 5JUEL 3FOLA 2ADJA 3SDAC 4WW2C 5JXAH 4DQOL 4MNGE 5LBSH 4LSVL 4S1SL 4DUVA 4YBQD 4JRYD 1P7HL 3TIEA 3V5DA 5DD0L 5IB5B 1HSAA 2MFNA 4XX1E 5HHPB 3UTTD 4GW4B 3NIFE 1TVBB 3FHQA 3VGGA 1KPUB 3HE7C 5EORL 1MEXL 4W6WB 4K7PX 1OLLA 3HHRB 4N8CH 2ITCA 4RMVA 5A16B 5F3BB 1HQRA 4KQ4H 5J0BA 4TSCH 4Z76B 1OW0C 3OZ9L 4XWGL 3TCLA 1JK8B 3IETA 1D6VH 4R0LB 1CVRA 1NMAH 3ARGD 3MBEC 3EGSA 4YHYB 4ZNEE 3OKDA 1R3JA 1LEGA 5MERB 3L9RA 4DK6A 4P4KB 5E2UL 3UAJD 1Q9WA 3WYRA 3CH1A 3T04D 4JRYB 3SKNA 2R0ZL 1MCDA 4NQDA 3S3SA 2VLRD 2YBRA 4RISL 3MNWB 4LLYA 3UTTB 5DJXB 4XVJL 3JVGC 4U1HA 4PGBA 1G7PB 5CJOH 4C55A 3QH3A 3TN0A 3QUML 1MHCA 3UPCA 1N2RB 5GHWL 1WICA 4MYWB 3F7QA 1YYLL 3WMSA 2PXYD 3DMMC 4HUKB 3MRHB 2B20A 1LO4H 1G0XA 2DL2A 3ARGB 4JPKL 4OF0A 1MJ7H 5HVHB 4WW2F 1T5WB 2DQJL 4OGZA 5IVOA 1M71B 2PR4H 2VTFA 3RZCA 1ACZA 1DDHA 2AXGA 4MCYB 3SGJC 3OR6A 1VFMA 2FO4B 5F8RC 4ZFZB 2XFXA 2CKNA 4I2XA 2VLRB 1XCQB 4UQ2B 4YAQA 3EO0A 1P5VA 2DM7A 5DEFB 1KN2H 3JBG7 5IMMB 4KTDH 1EDQA 4MCZA 3EOAA 4NGHH 3NABH 1H3WM 3QQ3A 4BZ1L 2R0WH 1FYHB 3BPCA 4LLQA 4K94L 3SJVE 3QIWA 1ZGLB 2OJZL 4S1DC 3CXHK 2PXYB 1MFAL 4QWWC 3ARFB 3RVVD 2XPGA 3MRJA 4HJGB 1HCVA 4DN4H 3HZMA 4OUUA 5IB2A 1KCSL 3UDWC 1KIQB 2MSPA 1NBZB 1OD9A 1TVHB 1HH9B 3FB5A 1GRWA 3W9DA 4GRWB 5I8KH 2WLYA 1TDQA 4GAYB 6FABL 5GRUL 4UILL 4U6YB 4OV6F 4Y88A 3SDXE 1LHZA 1S9WA 2YPLE 3DTXA 3MV7A 4K3GA 4OZHF 1T83C 4MMXC 4F3FA 4U7MA 1JRHH 5CBAA 5DXWA 1RUQL 5MENE 5AYUH 1XGUB 1OSPL 3LDBC 1HHJB 2CDEB 4YHPA 1UC6A 3E8UL 4HLZH 4AEEA 4YE4L 3WLBA 1K2DA 3C6SB 3O45B 2HKFH 3WEXB 5GRVL 5J06A 4ODHL 5HHOE 1OP3K 4UIMA 2NY2D 4HZLA 2VISA 5JNYA 3IKCA 5GRXG 5L2KE 5HGAA 2Z93B 3R06B 4XPFL 3MGAA 4FQQB 1UJ3C 5D7IB 1IZKA 2NY4D 5ITBH 1N6QL 1QSEE 4CNIB 4HQQH 1QFHA 2C3WA 4MB4A 4LCIL 1QFOA 4LLMB 5KVGH 5C0EB 1F4XH 2HLFC 1YJDC 1VACA 4MNGB 4L8SA 4X0KB 5JO5B 4PV9B 4FP8L 4J3VA 5GISL 3TYGH 2EDJA 4XXDB 1G7HA 3K0WA 2IFFH 4HSQA 1G9NH 3IXTB 4Q9RL 1JNNH 1BFVH 2GTZB 3HI1B 1OSZB 3WIIH 3GGWA 2NY2B 1D5MA 1DL7H 3VXOB 4GO6B 4RGNC 3DBXB 2YA1A 1Q38A 4DFHA 4LSDA 4HS3A 1NBVL 1WFOA 2XY1A 4KUCF 4GXVL 3TNMB 2NY4B 3AB0B 2PETA 3O6FA 3VU2A 4HXBL 2DM3A 3TIDB 4FABL 2DLIA 5FM8A 4KJWC 2YN5A 2G2RB 4QHUB 3UXFA 3QA3B 3UEZA 2ZUTA 4IM8A 1RJZA 4LVOB 1FFQA 3KJ4C 4WEBH 3MCLL 4G6ML 1T0MA 1JRHI 2N56A 5GSRA 3WO4B 4HDIB 2YK1H 3FT2A 5I9QB 3U0PA 4JCLA 4BH8A 1JPFA 4FA8A 5GIRA 2YZ8A 4NT6A 2BNRB 5EA0L 4Z7VA 4OZIE 1GVIA 3ZT6A 1I1AD 3OXSA 4JY4A 1GAFH 1EHAA 2HTKC 3SJVD 2ZG3A 1V3MA 4RGOH 1OQXA 1T3FB 5I1IL 5I1LB 4ZS7H 4XCFL 3QUZD 4PJCB 3CNKA 5CWSB 4PJEA 4JHWH 1PG7H 3R8QA 3RX8A 1B90A 1BBJA 3DURB 1G7MB 3VD7A 2VC2L 2EDHA 3UJIH 2YD8A 1Y0LA 2BXZA 2R0LH 5ETUB 2EYRA 3L7EA 5BS0A 4QRPA 4X5WB 4WHDA 3VRLE 3TM6A 1YEGL 4JLRA 4XNZB 1OP5K 3ES6B 4LAQH 4JFPB 4TPRL 1EO8L 1WITA 3L3HA 1E6JL 1T1XA 5C2BH 1MI5D 3ZKXB 3VMPA 5IF0A 4J7RA 3RU8H 1MJ8H 1I1AB 4IOFD 3ABZA 3DXAA 2NXYC 3SJVB 2VXQL 1RULH 3IDGB 1GZPB 5I0ZA 5FYJL 2BJML 3QUZB 4ELMB 2G5BA 5BZDA 2B0SH 4FMKA 2FJGB 2F5AL 3G5XA 2ZG2A 3QEGH 3ZKND 4AEIH 2VDKH 5T3XD 4GAJH 3FT3A 1JGLH 1NUGA 1WZLA 4XPAL 1NFDE 3TEUA 3SDXB 2UZIL 2NY5H 1CU4L 4X99A 1QSED 2OTWB 2PYEB 4LCUA 3FQXA 3VXSD 3OKEA 1JZ3A 1MI5B 3D6GA 3T3MF 3WJLA 1ZVSB 5SX4H 4K23L 3GI9H 3INUH 1W72L 4G8EB 2DB8A 3U36B 4XCNB 3TESA 3ARBD 3QISA 4GMTH 1B4RA 3K81A 3U6RB 1NBYA 3NCBB 1IC5L 5IV2B 3N1FC 5C0AA 1KFAH 3SKOB 4DGIH 4HV8B 5TE4H 3S88H 2X1QA 4UT9H 3DHMA 5D2NB 3BW9B 4D8PA 4DZBB 1KIPA 5LGHL 5IJVB 1D5IH 4IOSD 1KT2B 2WQRA 4U6XA 1KJ2A 4HJ0C 4OQ1A 5D5MF 1Q72H 2CXKA 4TNVK 1C5CH 1YUHA 1QR1A 3JWDH 1VFUA 4NO3B 5I73C 5EOTA 2FEDD 3VXSB 1MRCL 4I9WD 3LSOA 3S4SG 4QTHA 2ZCHL 4J8RA 2B39A 4LVNC 2QQNL 1HZHL 4WO4D 3PP4H 5DJDA 1ZHBA 4NYLA 3ARBB 2CRMA 4LASH 1NLBL 5E8DH 3RGVC 2BHUA 1C08B 3BD3A 3P30H 5ICZB 5J89A 4PRID 2FIKA 3WIHH 1Z9OA 3MRLA 3I9GH 1YY9D 1B0RA 4M1CD 3TBYB 2YMXL 5BVJA 2ORBH 2W1NA 2NCMA 3DV6B 5HJ3A 3R4DA 4NCDA 3U7YL 2XWTA 1OAYL 1IQWH 1K4DB 1I1FA 3W0WD 2K9UA 4J3OC 3O3UN 2YWYA 1R24A 2IAND 3EDKA 2E9BA 4OCWH 5D6CB 5FYLL 5FM5O 3ZHDA 5SX4I 1EA9C 4X7CC 5L8KB 1JF5A 1D5XA 1QACA 4QRSA 5A43C 5L2JB 1GOGA 1EHLL 4C56E 4EVNB 1VERA 4PRIB 1IGJA 3OBAA 4XC1L 5ACZB 1H3PL 1W8OA 3H9HA 2HFGH 3TBSB 4BFIA 1FFNA 1UKSA 1EX0A 1U8MB 3GIVA 4PGDB 1T1WB 2DOCA 3GMQB 4DJMA 5JMOC 2BSSB 3QIWC 2D0GA 4NOFA 3UC0H 3X14A 2ZNWA 4PP1D 1A64A 3W0WB 2FH8A 2YPVL 5GRYA 5DK0B 4OIIL 1A7BA 2IANB 1DR9A 3VJ6B 4POUB 1DUZB 3MA7B 3LZFL 2IAMD 3MUJA 4RMWA 4K2UL 3T2NH 1KCRL 1LK2B 4NNXA 5IW3A 1QSFA 2A6KB 4HFWA 5FDWB 4WI7A 3V5KB 2JB5H 2M26A 4MA3A 3FQRB 5DQ9A 4X6CF 1AGDB 3MRGB 4OQTA 1AI1H 1GH7A 3WV0A 3QG6B 2NZIA 4I77L 1QFUH 4HIIA 4PRPE 5TE7H 3OXRB 3VH8A 2NY3C 1NC4A 2VXSL 1BF8A 5I0DA 1SMOA 1XIWC 1Y6NR 2DQIH 5GGSB 4JRXE 2A2QT 1HHKB 3NFSL 5CP3H 4MHHG 3JV4A 2NYYD 4H8WL 2BCKA 3FQWB 2C3VB 5TPWL 4G43B 1T04A 3B5HA 2I24N 4LSQH 2IAMB 1MFEH 4DKFH 1P7KB 5EN2B 5FUOH 5HVWA 1ZLUH 4XP5H 2EDRA 4HGWA 2AJZA 5FV1L 4GRLC 3H7BB 1VGKA 1I1YA 5FYKE 2ZUVA 3LVEA 1E4XL 3VGAB 5JXED 2NZ9C 3D85D 4YO0A 4TVSa 4HPOL 4BQ9A 1T7XA 5IHUH 4P5KB 1FYTA 5D6DA 2X70B 1OGAA 1K5NB 4MWFB 1PAMA 5D93B 2YSSB 3EYUL 1JHTB 2VWEC 4ZPVA 3IJHB 4HJJH 4X7SH 1G6VK 4YDIL 4N5UA 1KEMH 4G8GA 3ZDZF 1IC7H 1JPGB 1AIFB 4AM0B 2D0FA 3VI4F 1IGFL 1IGYA 3O6FC 4P3CH 2V17H 2EIZB 3BIAX 1C1EH 1U8QA 4XPHL 3MV8A 2H2SD 1F4WL 3HNTH 2DM4A 4M6NH 5KTEL 2D03L 5B39B 2J6EL 5IB4B 3C9NB 5A3IC 3RZWA 4M7LT 1BVZA 1NJ9A 3WUWB 3WUWG 3EDDA 5HHNB 1MFNA 3L3OB 3PHQA 4P5MB 4G7VH 1FNSH 1XF4B 1KJVB 4ZAKD 4BZYA 5EU7E 3DV4A 2NW3A 4BQ6A 4LLAA 3TBTA 4PRDA 4KKCC 1NGQL 3QDGA 3WHXB 1F4YL 3FB6B 4YHNB 1FZJA 2R0KL 4YDKH 1HINH 4ZQKA 4FMFA 4B41A 3LKNA 1I7TB 3AAZA 5SWQA 2AGJH 3QI9A 4XP9H 5SX5K 3WFHA 2YS4A 3GMMA 1IT9H 2OP4L 5C9JB 1IGTA 4RMSA 2BOCB 1KENH 3TA3D 4BA8A 3K2UL 1J1XH 1SEQL 3LMJL 1M6OA 4OFPA 3L5WA 4OLYL 3OKOA 3HPJB 1ONQB 4RGMC 4ZAKB 3V7AE 4LVHC 2HLAB 2VE6A 1HDMB 2P8PA 2Q3AA 4KAQL 1RHHA 4P9HC 4LARH 5BQ7B 2FR4B 2CDFA 5KS9B 5TFSL 5TE6L 5J56B 3C87A 4KJPC 3FN0H 1PEWA 2X7LB 5INCA 3UTSA 4UIKL 2IQAA 3MACL 4MQXD 3KYMB 4RFNC 2XG5A 3GIZH 1AXSB 3TA3B 1OAXH 4R2GC 5GS0C 3CDGB 4GG6B 3MRDB 2C7UB 2O5ZL 5FYKD 2AK4E 5D1QD 2P8MA 3BKMH 5F1IB 5TDPB 4N0YH 5BJTB 5EIQA 5I1GH 2F8VA 1T0PB 5GRJH 2YD7A 1WZ1L 3QUXA 1JVKA 4R97C 5ESVA 4Y2DD 4WFGD 5KG9B 2GSGA 3AM8A 3MLPA 1FFOA 3QUKA 4C57C 4U1IA 1QBLH 4PJEF 5ADPL 2YEZA 5HVGB 1CFTA 2EIDA 3VFUA 1V7ML 2BY3A 1G7QB 2H2PD 4JO1L 2AKRB 4FFWC 4JPVL 5LJYH 3D48R 4O2FA 5DYOB 3ZE2F 4BSWB 4EIZC 2EO1A 5ANME 2HP4A 3PXJA 4QHNB 1EJOH 2BRRL 3VFMA 1CGWA 3GSXB 4UI2A 1PLGL 1NCBH 5D1QB 3EOBB 5IVXA 2AK1H 1CLZL 2EKSA 4XC3H 1JF6A 2W9EH 4F58L 5E6IA 5AZEL 3RWHB 5E2WL 2YWZA 3HN3A 4Y2DB 3T4AB 3U9UA 3WDIA 1N64L 1CIDA 1JNHB 3KYNB 3E6HB 3QCUH 3D0VB 1RFDH 2EXYC 1BM3H 5ID0B 1F00I 4YH6A 3O2VH 2VLKA 2YPKB 4MAUH 1X4XA 3HMXL 2O61A 4XWOC 2HWZL 5ID1B 4DCQA 2MHAA 3GHBL 5IROA 2VDOL 5GZND 5CBEB 1L0YA 5T3ZH 2D3VA 1IAIM 1CFQB 3V52H 3EOTL 4OKDA 3KLHD 4E0RB 2E6JA 4GXUN 5FYJE 1E4WH 1ZWIB 3TP4A 1CS6A 1FVDB 4WY7L 5MEQA 3UYRL 5J57B 3HI5L 2YD3A 4UT6L 5CUSL 4Q9QL 5F6IB 2V6HA 4HFUH 3MROB 4U1SB 2VR9A 4EDXB 3HMWL 5T5NF 2FJFB 3GSQB 2SEBA 5EBMA 5MEPA 3MREA 2R2BA 1F4AA 2HRPL 4KZDH 1U8OA 3MLXL 3NZ8A 3HR5B 4TQEH 1J12A 4PJ5A 4UV4H 2C4FU 2V2WB 5IBTH 1CICC 35C8L 2R2EB 3VFRA 5J8OA 3OKMB 4J3WA 3TPKA 1H0DB 1NLDH 2GAZB 4ODWA 2EZ0C 2MCPL 3F7VA 1A1MA 5IW1B 1ULVA 3GMOB 4HIJA 3LPWA 3RDTD 3MRIA 3T77A 1CK0H 3O4LA 1GGCH 1LE5A 1IM3A 5GGQH 2C1OB 3QUYD 4LSTH 5L0QB 4PS4L 1D5ZB 3QEUB 3P4MB 3TF7C 2HJFA 2ZOKA 3EJYD 4KMQA 4QOKE 5CEZE 4CN6A 3IVKA 1EFQA 3EYFA 2GHWB 3BIBX 4NKOA 5T5FL 1FO0B 1N3NA 3O9WD 2CDGB 4KKAD 5IG7A 5B38B 3WHE1 1MCOH 4A2LA 4ODTL 3F58L 3IDXL 1MHPL 5F7WC 2CXGA 2EDYA 4POZD 3CU7A 2FSEA 1BIIA 4U1MB 4JFZL 1IAOA 3HC3L 1J86A 2V5MA 3VG9B 5IGXL 5CD3B 1ZGLM 2ZCKL 3W2DL 1KYOJ 3RDTB 2AJSH 2UUDH 3NIDF 4ZOBA 1RIHL 3QUYB 1CL7H 1FL6A 1QFWH 4XHQA 5HGHB 1KN4H 2QHRL 1FSKC 5DVMA 4JB9L 4PJBF 4Z0BH 4KROD 2FRGP 1RZKC 1MVUA 1CF8L 2CRZA 3PHOA 4KI5C 3O9WB 3V6OE 4PFEA 1C7TA 15C8H 3BZFB 3ESUF 3MGTA 5FK9A 1OAZH 4HLZG 4LLDA 5FYLE 1I7RA 4LLVB 5ANMB 4IOIB 3C8DA 5J13B 1F11A 3H3PH 1CWVA 3F12A 3W9EB 4NSKB 4XMKL 3BP7A 1GHFL 1WSST 4MZ3A 5H37G 1MLBB 5JORA 2X9YA 5F7FA 3OB8A 4ALAH 3NCYS 4MA1C 3IDUA 1GGTA 4L5FH 1TTFA 4X98A 2X9XA 3EHBD 5I8OL 2XXMB 5JDSA 5IESH 4KROB 3PQYA 5TQ2L 3PWVB 1BFOB 1NEZG 1ORQB 2ZPKL 3MLUL 4KK8C 5F7NC 1RJCA 3BGFB 4MNQB 4F8QA 4UDTA 2K3TA 5D7SL 5GRWA 3ROLA 1CN4A 4K7PY 4MA7L 4KK9C 4M93B 4Y5VC 2X4SB 7FABL 1FV1A 5ENWB 4A6YH 1XR9B 4MA8H 4Y4FC 5CJ8A 2IALB 4L3EE 1XH3B 1KXTB 5T1KA 5F3HB 4HUUA 3CFDA 1INEH 1YEFL 2F53E 2BY0A 2QQQA 2FWOA 4PUBL 4BQBA 3QI9C 3PHSA 1CL7I 1D9KD 1ED3B 2J4WH 1QFWI 4PJFA 4DFIA 2VXVL 3WHE0 4PP2B 4KI5F 4EZMA 1YEIL 4P46D 3PWPA 1C8PA 1I3RA 4QOKD 3BRGC 3P73B 3U9PH 3PXHA 5CEZD 1FZMA 4YIQA 3WFEH 3PL6A 2BSTB 1EEQA 4MAYD 2X89D 1MAML 3I3BA 5KSAA 5DUPL 4S1QH 3O4OC 1FZOA 1RUPL 4WI3A 3HC0B 5DSCB 4UNVA 5D7KE 3ZDYF 2YKLH 1D9KB 1MJUH 2JE8A 1MWAH 3OAYK 1T66C 4GQPH 3RIFK 2OL3L 4U1LB 3G5YB 4OCSL 3KPOA 4KVCL 2N7AA 4UT7L 5HI3C 2HG5B 4QOKB 4JHAL 1JTTA 4TSAL 3VFSB 4ONGH 4UNUA 1NANH 4MAYB 2VH5H 4JM4H 4ORZC 2DMBA 3HG1D 4PRAB 3TT3L 3RVUC 1ES0A 1IBGH 5E1HB 4LPTA 2GTWA 2DQGL 1FIGL 1JZ6A 3OJDA 4W70A 3QDMD 1H8OA 4LDOB 1OTSC 1OAKH 3O6MH 4FQIH 4MSWB 5JIPA 4QNPE 3HUJB 4AK1A 1B6UA 3F6IA 3RVTD 4RRPG 1JGEB 4N8VA 5EUOF 4PGEA 2XI9A 4F9PA 2R1YB 1P4BH 4KDWA 5HHPA 1ODAA 4GW4A 2W07A 1TVBA 4NQCE 1U58B 3BPNC 5C0BA 1YN7B 4X8XA 5E6IC 1PX4A 1GGBL 1LO2L 1UCTA 1TMCB 3Q3GB 2IQ9H 4NCC1 3QPXL 3IU4H 2B1AH 3N9GL 3V95A 1P4LB 1D6EB 4R3SB 1PW3A 5F3BA 2Z8SA 3HG1B 4QCIA 5I1CH 2Y5TB 3WFCL 1NFIA 4Y89A 3THML 1DN0B 5C2UB 2XYCA 1JK8A 4P0DA 1ROWA 3FRPA 3BH9B 1YPZE 1RUMH 3CPLA 5CEYB 2D4FA 3QDMB 1XT5A 1PDKA 3U7WL 3GSNB 4IRSD 4DWHA 5T1DL 3P0VH 3KDMB 3BWAB 4JRYA 3F5WA 3WD5H 4WI6A 5JUEH 2LU3A 4QRUA 3WFDL 5IROC 3T65A 3UTTA 3PWUB 4DQOH 1G7PA 4ZS6D 3QJFB 4GFTB 3PF2A 4LSVH 4S1SH 1GJIA 1F90L 1S7SA 3VGEA 5B8CB 4RWYH 4IDLA 3QT2A 2VN7A 4LCWA 3V79C 3NCJL 4JO3H 3C60D 3U30B 1NANI 4N1CA 5EORH 1MEXH 2H9GA 3U46B 3ARGA 4N9GB 4TUOB 3DX7A 3HC4H 4IRSB 1IC4L 1T5WA 3M07A 4A2MA 3OF6D 1LO3L 1AGCB 4XWGH 1PY9A 2EC9U 2GJJA 4OB5L 3KPPA 4N90E 2EDKA 2FO4A 1A21A 2NXZC 1G9NC 3BESR 4ZFZA 5EO1B 1YMHA 2VLRA 4C4KO 1BVLB 1XCQA 4PJ8D 4UQ2A 5IVXF 4BH7B 4PJHB 1F8TL 4X4MA 4KTEL 5HDLA 5E2UH 5DEFA 3QHTC 5IMMA 3FB7B 4AT6B 2R0ZH 1MPAL 4LHUG 1OGTB 2JCCB 2ZZUT 4RISH 2WNGA 4ZUVA 2ICEB 4XVJH 5FYKH 3C60B 4PTUB 4WW1B 2HRLA 4CADA 1U0QA 3QUMH 1KIQA 5GHWH 1HH9A 2OX5A 3BP4B 3H0TB 1J88A 5FO7B 1YYLH 1UVQB 3G6JA 3RWGB 5DMGC 5MI0C 1SEBA 4U6YA 5AYQA 1NKRA 5JZ7D 2XA8L 1DQLH 4H0GA 4JPKH 2W59A 2N4IA 4MJ6B 2L7UA 2AEWA 4PJ8B 3C6LD 2DQJH 3V0VB 4HUXA 1FVCB 1Y6KR 2W0FB 4NN5B 4U1GB 2FD6L 1T4KB 1NAKL 1HHJA 5DS8B 4OGAD 2PF6A 2C5DC 3OG6B 5J12B 4O2EA 3PNWB 4NQCD 3O45A 4M8QB 1U8HB 4QYOB 2R1WB 3WEXA 5GZOC 4G5ZL 3MLTB 4K94H 4Z0XA 3MBXL 4JE4B 4OF7A 3H42H 2Z93A 3FHAA 3FQNB 2OJZH 1JI1A 1MFAH 4FQQA 1MHEB 1KELL 2CUIA 5DFVD 1JTOA 3PE9A 4FZEL 1KCSH 2A9NL 4LFHG 3CFIC 4TUJB 4L4VE 2R8SL 2F58L 3QPQD 1U2CA 4IEFB 3C6LB 3SE3A 1OARL 1QVOB 5F8QC 2GYSA 4LLMA 6FABH 5GRUH 4UILH 5C0EA 4IRJD 4MNGA 1MJJB 2ZOLB 5JO5A 4PV9A 1PQZB 4XXDA 4M1GL 4GSDL 3MOQA 3IXTA 5I1EL 1OD7A 2GTZA 3TWCL 3KNBB 4NQCB 1RUQH 3HI1A 4JFDE 4LSRL 1OSPH 3IFOB 3FO1B 4Z7QF 2I26N 4PBXA 3DBXA 3E8UH 5HGDB 4YE4H 2NY5C 2YD6A 3BP6B 3DROB 3TNMA 4ODHH 1WC7B 5TQ0L 1F45A 3CD4A 3C09B 3TIDA 4ZNEA 1YPZB 3S37X 4K7PL 3MYZA 2G2RA 4QHUA 3D3VD 4XPFH 3QA3A 1ZT1B 3LQAL 4PJ9C 2BVPB 4IRJB 5D7LD 5FUCC 2ZJSL 5EB9A 2FZ3A 4KUZL 4YLQT 1N6QH 4BM7A 1UGNA 1BZ9A 1E27B 4LCIH 5EU3B 2AEIT 1UM5L 2V7HA 3VE0A 4OBRA 1BQHA 4FP8H 2WIIB 5GISH 5J6HB 5H2BB 1T3FA 4Q9RH 3JWDC 5CWSA 1RZGB 4UOJA 4F15B 3NCCB 5K9JL 4JANB 4YC2B 1G7MA 3GKWL 2Z92A 1OAUL 3D3VB 4XPBH 1UT9A 1NBVH 4X5WA 2R23A 4OZFB 4OZFG 5D7LB 3PV7A 4LGPB 3GM8A 4GXVH 4ZYKB 4JO4L 5HYIA 4HXBH 4H1LB 4H1LG 4FABH 1F3RB 5KSAC 1RK0A 1EO5A 4Q6IA 4GXUM 4ZPTA 3LHPL 1GCFA 4DGVL 1I1AA 5IHZA 2CQVA 3QXUA 1SBBA 3MCLH 1S5IL 1NPUA 1FNEB 1XR8B 4G6MH 5DHXB 1CE6B 3SJVA 3E2HC 3KXFE 1GZPA 2FX9L 4TVPL 4S10A 1HHHB 5EA0H 2DQFB 5I8EB 4NC1C 3RWEB 5DK2B 5D1XD 3VGDA 1V3LA 2FJGA 3TZVD 3BQUA 3CK0L 2JJSA 1I8MB 3DGGA 5I1IH 5C08E 1S3KL 4HGKC 4I0PD 1MLCB 3SDXA 3NAAL 5CINL 3MYJB 2I9LB 1FE8L 2VC2H 5AEAA 4P4RB 1MI5A 5HHQA 4FQJL 1ZVSA 5CKGA 4KZEL 5HDQL 4G8EA 5MENA 1CXLA 3SPVB 1YEGH 3U36A 4XCNA 1K3IA 1WTGT 1AP2B 4AZ8A 1ZHNB 2P5ED 4TPRH 1EO8H 2IADB 1E6JH 2O26U 5M95B 5C0NC 1EVTC 4PJFF 4HV8A 3T0WA 5D1XB 4MXWL 5D2NA 1XGQB 3BN3B 3TZVB 5IJVA 1CVSC 3RTQA 5DO2D 5FCUL 4I0CC 2VXQH 3QXVA 5E2VL 1UXSB 3ZKSD 1R0AL 5FYJH 3ARZA 2BJMH 1JV5B 5KOMC 4NC0B 4I0PB 4P23D 1G1YA 1WBZB 2GSIB 2GK2A 4QO1A 1A6AB 3T0BA 1I8IA 1QSEA 2F5AH 5A2LH 4I18B 3VXSA 5ITFB 1S7VB 4N0CC 2KDGA 4XPAH 3WJJA 4U0RC 2E8YA 1XGPB 4RNRB 4YHYC 2UZIH 3ARBA 1CU4H 1YN6B 2P5EB 4PJ7E 4JDVB 1U8IB 5EOCL 4OFKA 1KLGA 3ISWA 4K23H 3G6DL 1C08A 1W72H 5ICZA 2HFEA 5MEOB 5FGRA 5C6PB 3R0MA 3LKPA 4JEGB 5B3JE 2ENYA 3FL7A 1UH3A 2VKWA 1IC5H 3MLRL 3TBYA 4KGLA 4P23B 2V9QA 3DV6A 4R4FL 3WDJA 3RVXC 1LEIB 5LGHH 3AFLA 3FONB 4CGTA 1K4DA 4V2BA 1U8PA 3O3BA 4WO4A 3ARGC 1B0GB 3P11L 2Z31D 1ADQL 2YD4A 5CEZH 1BGXL 2ZUUA 3CSYA 1NMBL 3RHWF 2NLJB 1YMME 2ZCHH 3IJYB 5L2JA 1ZA3B 2QQNH 1HZHH 1NDMB 2FHCA 1Q9KB 4NHUB 4Y4KD 5HHVL 4JFQA 3RWFA 1NLBH 4WTZG 2RIKA