3QH3A

The crystal structure of tcr a6
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
194
structure length
194
Chain Sequence
KEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMSIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVTTDSWGKLQFGAGTQVVVTPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords A6 alpha chain
publication title Disparate degrees of hypervariable loop flexibility control T-cell receptor cross-reactivity, specificity, and binding mechanism.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 194
sequence length 194
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qh3A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3qh3A02
1KEMH 3HCVA 4QHUA 1LHZA 3CSYB 5IFAL 1CZ8H 4Y5VC 2R9HD 4UUJA 3UJJL 2C4FU 2Y06H 2NW2A 3OR7A 5FM5O 2EXYD 3RVVC 5I16A 4LPTA 5FDYA 3WUWB 3VXSD 1GIGL 4NGHH 3O3BA 2YBRB 2GCYB 4NKIH 5CJQH 1B0RB 5CINH 5LGJA 4AIXA 3LKSB 2VLKA 3MNZB 5GGUA 2VZUA 4CU6A 1QRNB 3O6FC 3VFNA 3VD3A 1XF4A 1BP3B 3KGRA 3L95B 5I71B 3PNWA 1U9KA 4MA7H 3K4DA 5ERWB 4NWUL 3TVMA 1Z5LA 2EXWD 3LQZB 3Q5OA 3P0YL 4HWBH 5B39G 3CDCA 4NJ9H 3JWDH 3QUYA 4KRLB 4QY8B 1A6WH 4IOFC 4WY7L 4R4BA 4PLKD 4X6FB 1IGML 2DI7A 3RHWK 3MRLA 2WAHA 1RI8A 4O2FB 2WWMD 1NAKL 4MDIA 2AXHA 5C0AE 3LN9A 4ZNEE 1JIBA 1PQZA 3MLZL 3BDXA 4X8JA 2GTWB 2G5BB 4Y7MA 2X4OB 4CUCA 4U0RC 5F1IA 4GH7B 4DGVH 3O11A 3MUGB 3OAYK 4U1HB 1U58A 4NZRH 2XRAL 1MIEL 3IDNA 1L9NA 4JVPA 2GJJA 1WAAF 5DRXB 3TO4C 3ARQA 1CQYA 1P7QB 3RKPA 1NCTA 1R3IL 3PWUB 1I7RB 4ZG1A 4QXUL 3C08H 5I1DA 3P4NA 1MFCL 4WFHE 4J2XA 2MQCA 4OKVB 4U6VH 3V2AR 3WHE0 1LEGA 1DQTA 2E3VA 4I18A 3I6GA 4KAQH 4HT1L 3NIFF 3S5LB 3TT3H 5I75B 1JRHL 4FQQB 2Z4QA 4MMXC 1G7JA 1I8KA 1UVQA 3KPRE 3PP4H 2C9AA 2YSSA 2Y72A 3ETBF 4DZ8A 2YS4A 2X4NA 1YEJL 4ODTL 2I5YL 3DNKA 4P3CL 5HHNA 3QJFA 3U83A 1OGTA 5KSBB 1RUKL 3C9NA 3UTSD 2VDOL 3ARFD 4NC2B 4OLXH 4G6FB 5BO1L 1IKFH 1JHLH 2XPGB 1S7SA 3U4BH 3DO7B 3P9LB 1PDKA 1JV5A 1X4ZA 2W60A 3BW9B 4Y16C 3O9WA 1CFSB 3C60D 5C8JA 5FIEA 2ILLA 1X6NA 4LPVA 1I9JH 3HUJA 5J6HA 4ISVA 2X7LB 5J3HC 4L1DA 1KB5H 1NC4A 2VB5A 3LN5B 1DQQA 4J8RB 4DGIL 1E6JH 12E8H 1ZA3A 3BX7C 4K7PY 4LSRH 5BZDA 1F6FB 3EYVA 2LFGA 3BWUC 4YLQT 5DMKB 1FNGB 1NLBH 2DQIH 1II4E 4E42A 4JFFE 2EZ0D 4LCCC 4M6ML 1D5BB 1S7XA 5DUBB 3O6LH 3UTTD 4B50A 3GK8H 1P7KA 4H88L 2HVKA 2W92A 1YNTA 2QL1A 4QHLA 3U6RA 5BJTA 1SBSL 4HIJB 4LLWA 3SE9H 5JW4M 1IEAB 1G9NH 3MA7A 5FGBA 3S7GA 2K9UA 1DANT 5JW3L 3LRSB 3C5ZB 3NH7L 1BVLA 1G9MC 3VXUA 1RPQA 1AI1L 1I4FB 3FQWB 3ZL4H 1NCCL 2Y07H 4JKPL 1UM5H 2VDLL 5HPOA 4EDXA 2JCCE 3PHOB 3QUZC 4PLNC 5BVPH 4L8SB 1AIFB 2B0SH 2PCPA 4OD2B 4HQQH 5EC1A 3E6FB 4U4BA 5HD8C 3FO1B 4F7PA 3CFBB 4G9FD 5E7FA 5GJTL 3CSYA 3SDAB 1X5FA 3KNBB 3C8HA 3FB7B 3PWLA 5AZ2H 5A2FA 3AU1B 1ND0A 3CXHK 5T3XD 4XVUD 5E08L 1UG9A 3MV9B 3WUWA 2IFGA 3WLBA 1UEYA 1LP9E 2YBRA 2AJVH 5I15H 3JWOC 3OMZA 4OLUH 1H8OA 1JWSB 3VXSE 1FCCA 1KOAA 2Y36H 3LKSA 3MNZA 3QHZH 4U1MB 2I07A 1QRNA 3L95A 1INEL 4BZ1L 2ZSVB 3OG4B 4ZO6A 3SGEI 4RQQB 2DYPD 4JFDB 5ISZB 4JFOB 3S35H 3LQZA 1E6OH 1BHGA 3BD3A 5ADPH 5TGBA 2VDKL 3KJ6L 4O2CA 4QY8A 2APFA 4EIZC 5DUML 2ESVD 1ZTXL 5DEGB 1Q72H 5J9PB 4X6FA 4ZSOE 5GJSL 4AEIH 2ITDB 4R0LC 4U7MA 1AQKL 3L5WB 4YHZL 1MCPL 4O2FA 1AD9B 1T83A 4KY1H 4OZFG 3VG0H 4LCUB 1XIWD 1RZIA 3MROA 5DDHB 5ITFB 4WHTB 2CR3A 5F96L 3WFCL 4DUVA 4X99B 3MOAH 1EX0A 1R3KB 2X4OA 4KK6D 5HI5C 4HFUL 1D3CA 3OB8A 3MUGA 4FQIH 4PJXA 4POUB 2ZPKH 4AEHH 1A3QA 1MUJB 2Q3ZA 3B83A 4EI5B 4LCWD 2CRZA 4FQ1H 1R24A 3TZVC 3LEVL 5DRXA 3V5DB 1EO5A 4KQ3H 1EJ6A 2R0LL 3X12A 3HZKA 3PWUA 4NQED 1MFDH 15C8H 4RFNC 5ILTL 1RK0A 5CILL 3SHSA 3UTZA 3KYKL 1PZ5B 1EIBA 2Q86A 4S0SD 2BNQA 2CLVB 3S5LA 1WWBX 4IRSD 5FYLD 1QBLL 3ULVF 4QTHA 4PJCE 3AM8C 3HG1A 4KVCL 3W9DB 4KTEL 2QR0B 4YXKL 4W70A 4QTIL 3LKQA 4M5YH 1RUPL 4O4YL 5HVHB 1T2JA 1MCKA 5IHZB 1CXIA 3K46A 5KSBA 1VA9A 2UY7A 3OKLB 3EZJB 4JHAH 2L0DA 5E0QA 1U8OB 1RJYA 2XPGA 3MCKB 3OKEB 5EIIB 3RA7L 3UTSE 3VDAA 1ZOXA 4AH2B 5J57B 1ZLVK 1AGEA 1CFSA 3KR3L 1GGIH 1HXYB 2SEBB 9CGTA 3TYGL 2X7LA 1C16B 4Y2OA 3EZ8A 1KTKE 4YGVB 3WNOA 2YXFA 4JRYA 4J8RA 1N6VA 1UYWL 1U92B 3MRMB 3S97C 3VD5A 3BIKA 1YN6A 1FO0B 5SWZE 5DMKA 4Q0XH 1FNGA 1HHKA 1CGXA 3LPWA 4WTXA 1EJOH 3W0WD 1OAKH 1XF3A 2A9NH 3EYUL 5E2UL 1Q1JH 4FG6C 5JW4Q 3WS6C 4YH6A 2NXZD 4FXKB 1JMZA 1JGVL 3ARTA 2XG4A 5JOFB 2WP3T 2WLZA 3CFDB 2AEIT 1KIRA 2M1KA 3ULUH 4JCLA 3RUGE 5IWLA 1BFOB 3BP7B 3AY4A 3QFDB 3C5ZA 5F6IB 1QQDB 1JJUA 1YUHA 4ZUTB 3HC0B 1J10A 4M43H 2ZKHH 1BFVL 4GOSA 4JRXD 4Y4FA 3N1GC 2NYYC 3PHOA 3MRDB 3LEXA 5T1MA 1AIFA 1U3YA 1LO2H 3U7AA 4KROD 5E4EB 1IM9A 1BREA 2A83A 4XC3H 4QXGH 5F7KC 1GC1L 1KB5A 1MAMH 1RZ7H 3KNBA 3H9HB 2DLFH 3FB7A 4KI5F 2NX5D 1XGRA 2EXYC 4Y8AA 5I1HL 4G9FE 3D18B 3F12B 4NNXA 1PJ9A 5T3ZH 2HT3D 4Z0BL 5FO9B 3BAEH 5TE7L 5T3XE 1UM4L 3MCLH 3W2DH 1I9IL 1MQ8A 2RQ8A 3MLVL 3RJQB 5FOBB 1I3GH 1VFUA 4JQVA 4M7ZB 4MXVF 5JNYB 2PYFA 1O0VA 2ZSVA 4RQQA 1XGPB 4QRSA 4WDIA 4JFDA 5ISZA 1JTTA 2ZUUA 2BCKB 1INQB 2HFTA 4ZYKA 1W0YT 3QI9B 5D6DA 3SKNA 3UZQA 5DEGA 3PGFL 1RU9H 4JHZA 1LO0L 2VXSL 5JHDB 2ITDA 3CFKB 2R0KH 4Z7VA 3L5WA 5IK3B 5C2BL 4YWGH 1AD9A 3M17A 4LLUA 1CICD 2J8UB 2W9DL 2AQ3A 4N9OB 4XMKL 5CEYA 5DDHA 1YYML 4CU8A 3VRJB 3UDWC 3UPAA 4X99A 1R3KA 2FX9H 4KPHL 3TV3L 2NY4B 4KGLA 4WCYL 2VXUL 4WU7B 2DICA 2DS4A 3N1PC 4Z7WA 4X7SL 1CLYL 1IQWH 4OGAC 3NFSL 4CVUA 4LSPH 1JNHA 1GHFL 1A4JA 4LCWE 5CP7A 5JR1H 1J87A 3GKWL 5B3JE 4AK1A 3RGVD 3CUPB 1NCDL 4LU5L 3SO3B 3R8QA 2EDTA 3DSFL 1NMCB 2EDDA 2WLYA 4NQEE 5AUMA 3FO2B 1IBGL 1PZ5A 3MZTA 3AREA 2P8PB 3FCTA 1FVDA 1DBBL 3ELAT 2CLVA 2A38A 4MB4A 3JUZA 3DPBA 5C86A 1MPAL 3IAPA 3MTRA 3W9DA 4EVNB 2QR0A 5FYLE 4APQA 5I1GL 4JM2F 1T6VN 1CS6A 3DXAD 3H3PL 3B2VL 5IHZA 2UWEF 1A3RL 4X6EA 1UEMA 3U2SB 3MNWB 1T03H 1JK8A 4GS7B 4CW1B 3OKLA 2PN5A 2NY6B 5TE4H 4S1SL 4ENED 5EIIA 4AH2A 2CKNA 1WZLA 1ZLWH 3C60C 1T04A 1HXYA 3W11D 2NLJB 3HNSL 1CFTB 1QVOB 4M1CD 4URTB 4F33B 3ZTJH 4GRWB 3QG7H 4WI6A 4JG1H 4KUZH 5B38G 1NFDF 1FNLA 1U92A 2ARWA 3KYMB 1BM3L 1HDMB 1KLUA 2EC9U 3HA0A 4FP8H 5D1QB 4QLRA 1NGPH 4HKJA 1IZJA 5KANG 4ODVL 4OSUL 3ARZA 2GT9A 4CU7A 2C3XA 2EZ0C 1PG7L 2Z35B 1A22B 1QLEH 4DWHA 4RFEB 2HJFB 1QSED 3K8KA 4FXKA 3W0WE 2VLJE 4MZ3A 4GKNB 3MBEB 2BX5A 3AAZA 3CFDA 4PR5A 4DAGL 5ITBL 2XQYG 2Y5TB 1BFOA 3CFJB 3RL2B 3BP7A 1OP5H 5IEKB 3ARGD 5I1JH 3ZKSD 1QSFB 3QFDA 1UXSA 2B5IB 2VDQH 1QQDA 3IU4L 2MQ3A 3HC0A 3U0PB 3GJFH 4OQ1A 3C87A 1D9KB 1KEML 3MO1A 1WFTA 1C7TA 2EDHA 2J7LA 4N5EC 2JJTC 1CZ8L 1J88A 4OUUB 4YK4C 2Y06L 5FUCC 1MJJB 3O4OC 1H9VA 4EN3C 4JRXE 1A64A 2FHBA 3D85B 2DTML 4NGHL 1KV3A 1DFBH 3BP4B 4N8VB 2MKWA 3PWPD 3H9HA 4NKIL 5CJQL 5CINL 5SX5H 4KTYA 3D18A 3F12A 5EORH 2OI9C 1GGTA 3BZEA 1QEWA 1MOEA 2NX5E 4PJGE 1KXTB 2C3VB 1LDSA 4Y89A 3MCG1 3MRNB 4MA7L 3WHXB 1SYVB 3GZKA 4HWBL 3QDHA 2FBJH 3GM8A 5JNYA 4RRPA 5IW1B 1A6WL 4HKXB 2AJYH 5MEPA 3QNYB 4XH2A 4F7MA 4U6HB 5DQDH 2VL5B 2V2TB 3QI9A 4YQXH 5C09D 3W82A 3MUY1 3BKJH 5KJRH 1A6VL 1L0YA 3S96B 1CIDA 2J3SA 2EECA 1YN7B 2B4CH 3KAAA 4WV1B 1OCWH 5JHDA 5JOEA 3CFKA 3RX7A 1OTTC 1ROWA 4P2OA 3IDJB 2EDFA 4DGVL 1JGEB 2J8UA 3FO0H 3LD8C 4PJIA 1S9KC 2A2QT 4YNYA 3VXPA 1YMMD 1G7HA 3KVQA 3PG2A 2UYLB 2J8OA 4WI3A 4Y5YB 2LQRA 4QF1B 5E6YA 4C56A 3S36H 3C08L 3TFKC 5E8EB 5I1AA 3C6LC 4U6VL 4ZNCD 4UV7H 4XCEA 1J0HA 4NO5B 3S9DB 3D2UD 4IRJD 4KAQL 5GGSA 3CUPA 3TT3L 1MFBH 2HJLA 2PO6D 4MNHB 3PP4L 4TUOA 4OFYA 2XNAB 3FO2A 4P2RB 2P1YA 3JWNC 2P8PA 4JGJA 1OOAA 3TM6A 3IDGA 2QQLH 1K8DB 1PG7W 4HKBB 5F7EL 4EVNA 4OLXL 3MLXH 1CDBA 1IKFL 1JHLL 2D2OA 3CMOH 3U4BL 1KCRH 3DI2B 5MENB 3KPNB 3U2SA 3MNWA 2EEBA 2YA0A 5ALBH 3DXAE 4CW1A 1I9JL 3DO3A 1EXUB 3P4MA 4NT6B 5BV7B 1JHKH 1WFNA 2FGZA 1BX2B 1E6JL 3DROB 4MX7B 3FB5B 4I9WD 12E8L 4MS8C 2V9QA 3VFGH 4LSRL 4UBDC 3F5WB 3FFCA 3OX8B 4OIIH 5DVNA 1OGAD 1CFTA 1IEHA 1NLBL 1BWMA 2DQIL 3B8YA 1GCFA 5F71A 2BHUA 1I1AA 1V5JA 4LL9A 1KSRA 3WO3B 3MRJA 2DMKA 3O6LL 5SWQB 1YMHB 3GK8L 1HDMA 5D1QA 1OSZB 2ADGB 2IQ9H 2DWDA 3NFNB 2CXGA 3SE9L 1EH9A 4JN1H 3HE7C 1G9NL 4XNYH 5TF1H 3DVFA 2HKHH 5C07B 4M7KH 4Y4HB 4Q2ZA 1ZA6B 3DGCR 3MA9H 4OIBA 4NZJA 1MHPH 3BE1H 3MBEA 4P48A 4MQSB 3ZL4L 2YC1A 1C8PA 4XNXH 1QSEE 1JBJA 2Y07L 2Y5TA 3CFJA 1UM5L 3E6HB 1KJ2B 5EUOA 2IBZY 1QSFA 3HMWL 5BVPL 2NTFA 4PD4J 2B0SL 4BA8A 3VG9B 3TJHC 3JV5A 3U0PA 5JDSA 4BH7B 4TTGA 1YEGH 4HQQL 1D9KA 3MC0A 4L3ED 4NKMB 3NCYS 3ARBB 4UT9H 5E8NB 4OUUA 2CJUL 4Y2DD 1MJJA 2K7QA 2K3TA 4OFDA 2FL5A 2DD8H 3D85A 3WNPA 1RJLB 3BP4A 5ALCH 2AJVL 2IC2A 2WUCH 1RUAH 4NFBA 4D9QD 4OLUL 2EH8H 2Y36L 3QUKB 3IXAB 1MH5A 3QHZL 3PWPE 2HT3C 3VFUA 4YX2H 1R0AH 3OQ3B 5IJKC 3QB7C 2C3VA 1FL6B 3L7FA 4JO1H 3RRQA 1SYVA 5C0ND 3S35L 5C0JB 5IVXB 1E6OL 4ODXB 5ADPL 1CCZA 4PLOB 1MAJA 3W81A 2HT4D 5IW1A 1OL0A 1FL3B 1JL8A 3QNYA 1Q72L 3RZCD 5IW3A 1AXSA 4OZIB 3IRPX 4I0PB 4R90H 1S9XB 4AEIL 1F13A 1QHOA 3GBMH 1U8PA 2Z31B 4JEGB 1DBMH 3KYNA 1AH1A 2QADB 4KY1L 3S96A 3VG0L 1YN7A 3O0RH 5C09E 2Z9TA 5H2BA 3RVXD 4YBLC 1ES0B 2BNUB 2Q6WB 3N50A 4LHUA 5EOCH 3SDCD 3IDJA 4OGXH 3MOAL 3G5VB 1HQRB 1JGEA 1PKQB 4YHIB 2ZPKL 2PW2B 3FQRA 3MLTB 4AEHL 2O5XH 4FQ1L 2QEJA 2VSDA 2CO7B 1A6TA 4Y5YA 5FO7A 4YFDB 4ZFOB 3AMKA 4KQ3L 1YMME 3K80A 2UZIH 4OJFH 4QF1A 1IGJA 4YHYB 1X5ZA 3VFOB 4K9EC 1MFDL 2FIKB 15C8L 5AYQA 1UZ6F 4HG4K 3ECBB 1FHGA 2MTPA 3EYFA 3QZWG 4KDTA 3C8KB 1W8OA 1EEQA 2HWZH 3RGVC 1J1PH 5D7IE 1OARH 1A6AB 5L8JB 4LMQE 4HULB 1HWHB 4L9DA 5FHAH 2XNAA 4P57B 2CR6A 1EA9C 4P2RA 5T1LD 2VISB 2WQRA 2WBJD 5DJYB 4M5YL 4YHPB 2C5DC 5TFSH 1TQBB 4XMLH 4U2YA 1NAMB 4RMQA 3HNVH 1J0JA 5ECJE 4KK8D 3S98A 4HKBA 2JIXB 5E56A 4OD3H 1T0PB 4NOFA 1WTLA 5MENA 5CS7A 3IRZA 1J0YA 5EOCJ 2GJ6B 2V5RA 1GGIL 1M7XA 5DK2B 3U4EB 5F7LB 3X13B 1EXUA 3I6KB 2XIDA 1UH2A 4HIXH 4ENEC 3N9GH 3QQ4A 2H6PA 3VWKA 2NY0B 3FB5A 2E7CA 2Z8WC 3SJVB 1W72B 1S7TA 1DQJB 4RWYH 4NN5B 2M8XA 3W11C 4I9WE 5D8JL 4M1CC 4RNRA 4Q0XL 1WEJH 3ZKNC 3RWCB 1B4JL 2WNGA 2XWTB 1OAKL 3H7LA 1TJGH 5FKPB 2A9NL 4P46B 4HUXA 1OGAE 2AXJA 4GJTB 1Q1JL 1MHHA 4FXLA 5SWQA 3TF7C 4K2UH 4DEPB 4Q74A 4P2QB 1OSZA 3B4NA 2ADGA 5DTFB 4L9LA 3NFNA 5DK3A 2X6MA 3ULUL 5D7SH 4HBQA 4KRPD 5DJ6B 3FRPA 5KAQG 4OCSH 1I8IB 4Y4HA 1ZA6A 3RPIA 3ZKMD 2OL3B 5GGTH 4M43L 4HGKC 5CUSH 1BQUA 2ZKHL 4NQCA 5LAXA 2DM7A 3AFLA 3C09B 3QYCA 1LO2L 5CJXC 2R56H 2EO9A 3D39B 3MRFB 2HTLD 4XC3L 5L88H 3S4SB 1MAML 1RZ7L 5F6HJ 4L3EE 3VD9A 1WAAE 4G6AC 5T3ZL 1FDLH 4HK0A 2OJEB 3QQ9D 5D1ZD 1IKNC 4HCRH 1RJLA 3U9PH 4PV9B 2PYEB 5FCUH 1AKJB 3H9SD 3MCLL 1ZKAA 5EIQA 1MREH 2LU4A 2X05A 3W2DL 3I3DA 2XN9B 3I6LE 3ALPA 1MCNA 4KK9D 3IAGC 3I50H 4D9QE 1I3GL 3ULVD 4YDVB 5MEQB 3D25B 4IMKA 3B9DA 2D0FA 1F97A 2R0ZH 5CIPH 3V6OC 3GKZA 1T20B 1U8IA 4X4ME 1IC7L 1WLHA 4MSWB 2F53D 1RU9L 4U1NB 1EUUA 4I0PA 1J8HD 2BVPB 2ZOKA 2R0KL 3NOIA 1U3HD 2Z31A 4YWGL 4GW4B 5D5MF 4G8IA 4D0CB 3GMMB 4NNPH 2BNUA 3DX8B 2Q6WA 2XXCB 2XV6B 5J6GB 4KJYA 4F9PC 4LLDB 2FX9L 5E8PB 5E70A 4Y1AE 1JFQH 5HJ3A 5BCAA 3FHQA 3E2HC 3MLTA 2BHZA 5GRXG 5INDA 3MODH 1IQWL 4GBXD 3BN3B 3V79C 4HLZG 1OAQH 4LSPL 3O3AA 2GSGA 1BJMA 4JY4A 5KSUB 2VN4A 4ODUB 1AE6H 5FF6B 1VFBA 5JR1L 1KXQE 3SGKC 5BZWA 3VFOA 3E3QC 3B9KD 3ECBA 4XBEL 1T0NA 43C9A 2FH6A 4OFVA 1A7PH 3LV3B 1NUFA 2PO6C 1A6AA 1H8NA 3VGHA 5EZLB 3QWOB 4HX1B 4P57A 5IB4B 4ELME 2QQNH 2YRPA 5LG1A 2QJDA 4EEEA 2D7NA 2VISA 5DJYA 2DRUA 1TVHA 5CEXA 5DHXB 5FYKU 5JXED 1BFSA 2Q7YB 1KFAH 1NAMA 1YEHH 1T03L 1ORSA 4L8BB 2R8SH 2JIXA 4LLMA 4KDVA 2BSRA 3SGEH 3MV8D 3K1DA 5IESL 2O5YH 4KI5D 5DO2D 5TE4L 1XFPA 1C7SA 2ICES 5KSAC 1WT5A 4ODWB 1U8HB 4N0YH 3DRTB 2VZ3A 3TESA 1V3KA 3U4EA 4HGWB 1MCQA 3MOBH 3I6KA 1QZ1A 2BVOB 3QG7L 4XGZB 4JG1L 4KUZL 2E5EA 3SJVA 1WZKA 1KLGB 4TUKH 1OB1A 4IIQA 1CQKA 1DQJA 4PJ8A 4DN4H 1FLRH 3RDTB 5I1CH 2ZG2A 4M62L 1NGPL 3BZ4B 2APTA 2H8PB 4YHOH 5FKPA 4FZ8H 4P46A 3CX5J 3SE8H 1B90A 3UPRB 1FN4A 3OF6A 1DTUA 4PTUB 3ZKXC 3QNXB 3JVGC 2BRRL 2HT2D 4V2CB 1VGKB 5DJ6A 1AO7D 2R2BB 1TFHA 4RDQG 2AJXH 5I1JL 4EDWH 2VDQL 2X2YA 5JPNB 5FO8B 4KFZC 1A1OA 1MCFA 1U8JA 2AJZB 2EIBA 1ORQB 4Y4KB 1DN2A 1Q9WB 4Y5VB 2VUYA 4RGNE 5C3TA 4L4VB 5KN5A 4GQPH 1RZFH 1V7MH 4X9GA 5GGRY 1FV1A 2XY1A 3SDDB 3U0WH 5DJ2B 4PFEA 2L4OA 1K5NB 4JJ5B 4GLRI 3MRFA 3BQUD 1DFBL 2CKBB 3S4SA 1Q9LB 3RY6C 4PJFA 5FYJD 2EDJA 4Z7UE 1FJ1B 3JBG7 3OXRA 4Y2DC 5EORL 3O6FB 3RTQA 3QIBC 3HZMA 4XXCC 5J13C 4Q97A 2GJZB 1WC7B 1B88A 4PV9A 5F7WC 1AKJA 2Q76B 4NHUA 3BHBA 1S9WA 1RUQH 5ICYB 2FNBA 2P43B 5KOMC 2XN9A 3QIUC 1R3LA 3ZDZE 2YPLB 2FBJL 4JG0H 4PP1D 5C70A 3BPNC 3H9SE 4YDVA 5MEQA 4UB0H 4HUUB 4J1UB 5C6PB 3H2WA 5TH2B 5ANMB 5HGBB 4RMVA 1F3RB 3ULVE 5DQDL 5F89A 4JM2D 4PJBA 4YQXL 5I9QC 3BKJL 5KJRL 4JDVA 2VR4A 2O61B 3PL6B 4MSWA 5GGTA 2B4CL 1OCWL 4MCYA 2BVPA 4PS4H 4U0RB 2IAMC 2F53E 3RWIB 1FGNH 5KBNC 2XZCH 3DETC 3VWJB 3BSZH 2FBOJ 2ED7A 3OAUH 4D0CA 1NMAH 3GMMA 4MQXD 4UOJA 4N9GA 3DX8A 1H5BC 1G6RH 4X9HA 5J6GA 1BQHB 1X5KA 4WGWB 5C0GB 2N7AA 5CSGA 4LVNB 2HRPH 2HFEB 1P4LA 3GRWH 2OZ4H 4HCRA 3S36L 3KYOB 4DZBB 4FOMA 4ZAKC 3QEQB 5KSUA 4NN6C 1R5WA 2EIZB 3O8XD 4UV7L 4ODUA 5FF6A 3MRQA 1MFBL 1PVHA 4ONHB 5LWYH 1WBYB 2AABH 4WFEE 2UZXB 3ES6B 4HJJH 3WL9B 3ALXA 4XNZB 4OZGB 2QQLL 2YD4A 4NIKB 1NEZB 2V17H 3EOAA 1H3VA 3QCTL 3QWOA 5A43C 4HX1A 5IB4A 5BS0A 4JFHD 5E4IA 8FABB 3ARVA 1V8HA 3MLXL 1S7WB 2OMBA 4Y16B 5JMOC 1KCRL 2QV2A 3UPCA 4NDMB 1NMBH 2DQUH 1NL0H 5K59F 2X41A 1K4DA 4WIQA 4PJ7A 4L8BA 4OLVH 1CXKA 3GSOB 5ALBL 3KLAB 1FNAA 4X80H 5FYLL 3MUZ1 8CGTA 1JHKL 1OM3H 1QKZH 4JPVH 3T4YB 4K71C 1ONQA 5EPMB 3VXOB 5A3ID 4ODWA 3L3IA 3MV8E 1U8HA 3DRTA 3VFGL 4KI5E 2BNRB 4OIIL 4J3WA 2EIDA 3JWOH 5T1DL 4MJ2A 5ABDE 4HV8B 1IJ9A 5L6YH 4LCCB 1WGOA 4L4TD 1KLGA 3DX9A 4FQJH 1TZIB 4ETYA 4BM7A 2QKIA 2UUDH 2A74A 2MKLC 1ZK9A 4MXVE 4JO4H 3NZHH 3TCXA 1JYNA 1JNLH 2H8PA 2IQ9L 4JN1L 1XF5A 1FGVH 4XNYL 3GBLA 1A6ZB 5TF1L 3QFJD 1E4XI 2HKHL 1WIUA 3UPRA 4NQDD 4M7KL 1I7UB 3GIZH 5C9KA 3FT2B 4LRIA 1MHPL 4Q6IC 2VIRB 3BE1L 1MLCB 3SDYH 4K55A 4X4YA 4XNXL 4MHHG 4H20H 3P0VH 4FQXC 2IADB 4K7FB 4QRRA 4OV5A 1DVFD 4ZS6D 5JPNA 5FO8A 3ZKMC 4PRPA 4UIKH 1AO7E 1YEGL 2AJZA 5KAQF 1ORQA 1CI5A 4Y5VA 2KUTA 4UT9L 2BXZA 3TJEH 4ELKB 1KIQA 2I60H 1OPGL 2XACC 2X40A 3KXFB 4S11A 3QIWD 4UT6H 4Y19D 4XP5H 3BMVA 2DD8L 5DJ2A 1K5NA 4JQXC 3V9FA 1H3XA 4X6CA 5ALCL 3QDJD 1I8LA 1Q9LA 3DYMA 4XT1C 4YFLF 1SYSB 2WUCL 1RUAL 4HUKB 4NPYB 1FJ1A 4NO0D 2EH8L 3TWCH 2AXGA 3O6FA 4LVEA 3UTPD 3TH4T 4RSVA 5FYJE 3T8XB 3NMEA 5JO5A 4P99A 2CMRH 3R06B 1R0AL 1KB9K 1WC7A 5TDOA 5C2UB 4U7SA 2DOCA 4HXAH 1BBJB 2EDWA 3DMMD 3C6SB 2Q76A 4JO1L 2IQAB 5ICYA 3MLUH 1FFRA 1BZ9A 4XBGB 2YPLA 5AZEH 1VGEH 1G0XA 3QAZB 2GTZB 1EBPA 2HVJA 4GO6B 2E9BA 1BQLH 5D7JD 5ANMA 3AVEA 3BVNB 4AIZB 4R90L 5F7MC 4A6YB 2DWEB 3GBML 4FXGA 3WYRA 1QR4A 1VFMA 4JFZH 1DBML 1EMTH 4BK4A 3UTQA 3N85H 4JKKA 3WIIH 1L6XA 1ZEAH 4BQ8A 3UYRL 3O0RL 2UWEE 1ED3B 4LF3B 5EOCL 3MV7D 4OGXL 3RWIA 3ZE0F 2OBGA 2IPUG 3EJZC 3O3EA 3NIGE 2ICWI 1CK0H 3TZVB 2O5XL 1BQHA 3TO4A 5C0GA 2W0KA 3V7AG 1N6QH 2UZIL 4OJFL 4YR6B 1NFDE 4RFNB 4H1LH 3KYOA 4DZBA 4J3VA 2MQ0A 4A2MA 2MSPA 1A9EB 3QEQA 1BOGB 2XFXA 2W91A 2GSIA 3KPRB 2EIZA 3D69B 1A1MB 2R2CA 3ZDYE 3MRIB 3GSQA 5JPMB 3HI6H 3G6DH 2IANB 5IJVB 4ERSH 2HWZL 1OARL 3B9KC 4ONHA 2VC2H 4OZHA 3DVIA 4WWKD 1WBYA 3HE6C 3LKOB 1X44A 3MJ7A 2P24A 1M05B 1CE6B 5TFSL 4KKAD 1BBDH 5CCKH 4XMLL 1NEZA 4PRID 1IVLA 5KOVC 1CDIA 5KSVB 3FQXA 2YWYA 1B6DA 2HMIC 4MNGE 1OW0C 8FABA 5J11B 4OD3L 2P44B 1GYAA 5C08E 4Y16A 5JXEC 4JFHE 2DBJA 3LB6D 5FA4B 1EGJH 1UQSA 4HPYH 4PJ5A 3GSOA 4HJ0C 4CMMB 4BKLA 3IFOB 1X9QA 2EDQA 4KI5C 4HIXL 3N9GL 1J0KA 4P4RA 3T4YA 3SE3C 5H37H 3FFDB 3JV0A 3GRWA 4JFFB 4QRPB 5E6ZA 2BNRA 1EEYB 3CK0L 4RWYL 5DD6B 4Z5RA 4I3SH 4TRPH 2OZ4A 1M6OB 4JKMA 3WEXA 4ZFGH 4UDUB 3ARDC 1WEJL 3IF1A 1T2QH 1S9YB 3T65B 1TJGL 1W0VB 2P5EE 4XP9H 2YRZA 4FFZL 4I1NB 3MREB 2ICCA 2YA1A 4P5MB 4K2UL 4L4TE 5E9DB 1QFUH 1Y18B 3L3OB 4MJIB 4NFDA 1AY1H 4R2GB 5D7SL 1A6ZA 5IM7B 5C0CD 4OCSL 4IMLB 1I7UA 3FT2A 3QWRD 1ZV5A 4UIMB 1MLCA 4IOSD 5CUSL 4NQDE 4G8FB 2RR3A 1MI5A 3QUZA 5HVGB 2F5BH 4OCRH 5FUZH 5JHLL 3GGWA 4XPFH 2VQTA 4R7NB 2R56L 4FMKA 4QGYA 3JZ7A 4RDQF 5DT1H 5L88L 4ELKA 3RVUD 2YD5A 2ZUWA 2DTSA 4UOW0 4YPJA 3DX6B 3KXFA 2QHLA 4ETQB 4P4KD 3FONA 3VXSB 2IPTL 3TCLA 1UWGH 1FDLL 2F9BT 4HCRL 4RRPG 2PR4H 3U9PL 5D71H 4J12A 1SYSA 1ZVYA 2WZPD 4P9HC 1NC2D 3S37H 2XA8H 4NPYA 5D7KD 1CF8H 1MREL 5GRZA 2CQVA 4FRWA 2QTEA 4LSTH 3GSUB 2Z8RA 3T8XA 3OGCB 4NOBA 3R06A 1BD2A 4QOKD 2R0ZL 4X83A 1ZHLB 1BBJA 3UTPE 4YDKH 2IQAA 4YHNA 4PJ9D 4Z6AT 1CDUA 1HQ4B 3WXVH 1NUNB 4XBGA 4ZSOB 4TUJB 4MAYD 4LKCA 4Z76B 2GTZA 2YKLH 4QHNB 4P23D 4HEPG 1AHWB 3BVNA 4R0LA 4AIZA 4JM2C 1IILE 2YPKA 3BWAB 2DWEA 2GY5A 5GRJH 5GSVA 1X5IA 4LLQA 2YN3A 4UI2A 3TIDA 4NNPL 4LF3A 4NN7C 3EGSA 3E0GA 4ZPTB 3IXTB 4RCAA 7FABH 4PJXF 2KKQA 5FOJA 1FG2B 4PRNB 3PQYD 4N0CD 3TZVA 2AJUL 4KKCC 4F2MB 3VMOA 1OAQL 2R1WB 4KRNA 1X7QB 4LPCA 3TPUA 2I24N 1AE6L 1EHAA 4GRMB 4YR6A 1ZT4B 1KTDB 1I7TB 2EE9A 3QR2A 1C5CH 1RVFH 4KZDH 1A9EA 4NQUA 1BOGA 2CIKA 4PJCB 3D69A 1A1MA 3O8XC 1HHIB 3MRIA 5JPMA 1KUMA 2IANA 5IJVA 1A7PL 4JFPB 1B0GB 4XVSH 3AM8A 2JF1A 5DRNA 1AFVH 2QQNL 2DKMA 3FHAA 1RMFH 5LVEA 2ED9A 1CE6A 5GS1C 4FTVA 2YD3A 2BY2A 1S5IH 4P49A 5K9KA 3VFVB 3UTSB 2GK2A 1KFAL 1FZMB 1YEHL 2VLRA 5DJCA 2VXQH 4Z95H 1YY9C 5E2VH 4PRIE 5AG8A 3X3FH 3BD4A 4LPXA 2O5YL 1LEIA 1IL1B 2EH7H 4MCZA 5L2KD 3C60B 5FA4A 5TDNB 4N0YL 4I77H 3IDYB 4X5WA 2CPCA 4JFED 4K3DH 1AGFB 1P7HL 4LIQH 3IFOA 3MOBL 3BP5B 4KJQD 2AQ1A 3SO5A 5A3IC 1GGUA 4TUKL 2JJSC 4ZODA 4QRPA 4DN4L 3Q3GB 1FLRL 5DD6A 4H1LA 5I1CL 4UDUA 1S9YA 5CFHA 1ETZB 1A21A 4FZ8L 4PB9L 3UTTB 3SE8L 5IMMB 3BGAA 4M93B 3RUGB 5KS9F 3D3VD 3W5NA 5E9DA 5IVOA 3VGGA 3HLAB 4MJIA 4BSVB 1BAFL 1IC5H 5IM7A 1MWAB 3PP3K 3RI5F 4BH8A 2AJXL 4IMLA 4PJEE 1IAKB 3MJ8A 4EDWL 1GRWA 3BPLC 1LD9A 1S5HA 1YPZA 4UIMA 1F4YH 5C0CE 3R1GH 5EOQH 3VRLF 3VFPB 3I75B 3JV6B 5HYJE 1OF2B 3QXUA 2VE6A 3ZTJG 1DVFC 1RZFL 1V7ML 2WWKT 3U0WL 4G9FB 4K8RD 1OQOA 2R15A 2J88L 4IHOA 4RWHA 3DX6A 3DSNA 2OI9B 4ETQA 3NZ8B 3DUSB 4M9PA 3BRDA 4NO3B 2YEZA 5DHVB 5EWIH 1FVEA 2Q8BH 3VRIA 5E2JA 2JJUA 4C59B 3T77A 1OP9A 3SDAC 1RUQL 2QHRH 1UZ8A 1UZ6E 4K94H 3GSUA 2E9WA 3REVB 3BZFA 3OGCA 4HIEA 4JG0L 5D7KE 1HYSC 3BEWB 4X6BB 2DYPB 1ZANH 4UB0L 5EO1A 1CFNA 1IGTB 3QDGD 1U95A 5F7NC 4LHUG 1I85C 4ZSOA 1XF1A 4WW2B 4PJAB 4BFEA 2ESVB 1AGDB 3KPOB 2BMKB 5GZND 1X5XA 1JHTB 4Z7VF 3AGVA 3OKKB 2D7QA 4LOUC 4PS4L 3S6CA 3BWAA 4XZUB 5DA0B 1T0MB 1FGNL 3LOWA 25C8H 1CDCA 1A6UH 1XIWB 3V6BR 1T1ZB 1VFOA 2XZCL 3BSZL 3WNKA 1NMAL 1EZVY 3UDWA 2BVYA 1G6RL 2NR6D 4DVBA 3B9AA 2HRPL 4X0KA 3C5SA 4Z7WF 2DQEH 1A47A 2C1PB 3GRWL 4LCWB 1BVKA 1KT2A 4PBVC 4UNTA 2OZ4L 3QDME 4JDZA 4F2MA 1I7ZB 5DJZB 2R1WA 3TA3D 4MA3A 3PQYE 1B4RA 3SQOH 4NQEB 3D5OF 1A7RH 1KTDA 5HHOD 4G6MH 3EDFA 4N0UE 4LLVB 1U2HA 4EI5C 2EC8A 3C2SA 5LWYL 1RZGB 2AABL 4E9LA 3RX8A 1IE5A 1HHIA 3INUL 4K7PL 1TTUA 4HJJL 1N0XL 2XZQH 3WCYA 1B0GA 3Q2CA 3ZMRA 2V17L 3G6JB 4WWKC 5DQJB 3O45B 2CRYA 2NZ9D 2A73A 4G8GA 4ZOCA 2EDEA 2PUQT 4I3RH 1NGYA 1NMBL 1NL0L 2QSTA 4QYOB 1FZMA 3IFPA 4OLVL 5D6CB 4M00A 2NNAB 3AUVA 4X80L 4NQSB 2YXMA 1OM3L 1QKZL 4JPVL 5HVHC 5M7QA 1RHHB 1BIHA 3C60A 2ZUXA 4J4PD 5CJ5A 2Q7NA 3L6FB 4G6KH 3T2NH 2CDFB 5L2KE 4YE4H 2X1XR 3BP5A 5L6YL 5EIVA 3TN0C 1B9ZA 3X14B 4DKAA 4FQJL 3WE6B 4F7EA 3W0WB 1ZHKA 4JO4L 3NZHL 5I73C 1JNLL 3IDIA 2CGRH 1ETZA 1FGVL 2NXZB 3UTTA 3GIZL 3QXAA 3LHPH 2CRIA 5I18H 3SDYL 3ZO0A 3HLAA 3LS4H 3MGTB 4H20L 4BSVA 3D3VE 1D5ZA 1F4XH 3P0VL 1DE4B 4RA3A 1J8KA 3REWB 1IAKA 2ADFH 3TBSA 3BO8A 4UIKL 1WZ1H 5HHPA 3EKCA 2GK0B 5D5ME 4XHQA 3BN9C 3LZFH 2JJTA 3I75A 3TJEL 2I60L 4QKXB 5DF0A 4EN3A 4LP5A 3G5ZA 4OLWL 4F37F 4KROB 4UT6L 1ZXQA 2FH8A 5F6IC 1A4KA 5IMLB 2C4XA 2O26U 1DLFH 3RVUC 1DDHB 2NX5B 4PJGB 3RJDA 4N0FA 5JUEH 2A9MH 1WCQA 4HIHB 4P4KC 4S2SB 4Z77A 3RWHB 4P3DB 4NO3A 1KCSH 5DHVA 3O81A 2CMRL 1ERNA 4HXAL 4TVPD 2LVCA 3MLUL 3O2DH 2HTKD 4KDWA 5AZEL 3P4LA 1VGEL 3BEWA 5F97E 3RVWD 4X6BA 4HG4J 3PIQB 3MBXH 3LEYH 3ULUF 4OI9A 1BQLL 1P84K 4JZNA 1P5UA 4PJ9C 5DLMH 3UJTH 4PJAA 3T0AA 1J1OH 2AV7B 2ESVA 4MAYC 1EMTL 3QDGE 3KPOA 4K23H 5H94B 2VZ1A 3N85L 3WIIL 2VSCA 3QUXD 1ZEAL 2EIEA 3VGAB 1JHTA 1F4WH 4FQHA 4XZUA 4AMKH 1CICB 3WHE1 5J06A 1TMCB 4PJIF 1T1ZA 1UA6H 4JQIH 2B39A 1CK0L 1ZHBA 4OM0H 1HI6B 2Y23A 2JCCF 4KXZI 4NBXB 4BSWB 4WHDA 4M4RA 4N68A 2A6IA 4U49A 3WLWD 3R4DA 1N6QL 4HIIB 2C1PA 4LCWA 2GAZB 3G5YB 1CDYA 1HNFA 3C6LA 4N0CC 1I7ZA 2J4WH 5DJZA 5AD0B 3VFTB 4HWZA 4NKOB 1BIIB 2VN7A 4NQEA 1LP9F 3RGVB 2NY4C 3TH3T 3HI6L 3G6DL 5HHMD 3BIBX 3GSNB 4KVNH 4LLVA 4ERSL 3UBXG 1CR9H 3TNNA 2VC2L 4GLRH 5HHOE 3UYOD 3VJ6B 2QSCH 1S9VB 1TETH 3RWFB 1BBDL 5CCKL 4CVZB 2VYRE 5EU7C 1H3TA 5LJYH 1OLZA 3G6JA 1DBAH 3K3QA 4MXWH 1LMKA 1ZWIA 5CBAA 1FFPB 1UB6B 3DXAB 1HEZA 5EU3A 1TZHB 5DQ9A 1NGWA 2VITA 3RWDA 1C08B 1GZQB 1CXLA 4ONOA 4TTDD 2XWJB 1EGJL 4HPYL 5D6CA 1JYXA 4BELD 3SCMD 2NNAA 5SV4A 2PW1A 3SGJA 3VDBA 3OJ2C 2V2XB 4MB5A 4PJHB 3L6FA 4FFVD 1S7RB 4I3SL 2CDFA 3TVMD 4ZFGL 2I9TB 3L3JB 1QD0A 4KJQC 4Q7DA 4NQVB 1JP5A 1A7QH 2NY6C 1J1XL 3DWTA 1IM3B 3STBA 3X14A 4R96A 4UTBH 4J3TA 1QFUL 3HE7A 3GHEH 1AY1L 1QSEB 2DQJH 4P5KB 1C5DB 2G2RB 2VDRH 4RZCA 1JN6A 5IFHH 1T66D 4PYHA 5EUOF 3FAWA 2XQYK 2VABA 3HPLA 4IS6B 1DE4A 4X7FC 2X1WL 2F5BL 4OCRL 3PV7A 2NPLX 4XPFL 2GK0A 2NY5L 1CVRA 4OCLC 5DT1L 4S0TD 2GQHA 5F44A 5C0RH 1S7VB 3FJTA 5ICXA 1SJHA 5FK9B 5IMLA 2D9QB 1UWGL 4Z7OE 3L3KB 5D2NE 3U79A 3PWPB 1WWAX 2PR4L 2XYCA 5D71L 1DDHA 3S37L 2XA8L 3RIFF 3MR9A 1CF8L 3GMRB 5KVFH 4HS6B 4S2SA 4LSTL 1AGCA 3RWHA 3H6JA 4P3DA 3WJJC 3BKMH 1RULH 5IJKA 3ZHLA 5I19H 5ACZA 3EO1A 3I85A 1HYRC 3BPCB 1HHGB 1NFIA 4OKDA 4YDKL 5HYIA 4K8RH 4PRBB 5GRVL 3RNQB 4G8EB 3ZSTA 2FJGA 1BEYH 4K3EH 4NM8H 3WXVL 1NDGB 4XWOD 1WF5A 4TVPE 1FYTE 4NYLB 2FHCA 3PIQA 3FZUC 1GOFA 4JB9H 2YKLL 1GJIA 1F8TH 3UEZA 2PKDA 1B2WH 3O9WD 5GRJL 4WUUE 3BFOA 1Z2KA 4AQOA 3GNML 2DLHA 5K59E 3MJ9H 3QWQB 4Q9QH 7FABL 4DQOH 1WBZB 3E2HB 3PDOB 1EVTC 1E4XH 4I4WB 4QRTB 1YMMB 1HI6A 4WV1C 2ATKA 3VXRD 4BSWA 4D9LH 2AK4D 2B8OT 2EDNA 5DD0H 2NR6C 3NFPB 3ZDXE 1WQVT 4NC1E 1MJ8L 3IVKB 1OTSD 2EYSB 3SOBH 5DEFA 3G5YA 4RFOH 5IOPB 5GGVY 1C5CL 4KZDL 5D7IB 1JI1A 3DYOA 4JZJC 1BIIA 4IRJB 3VXUD 1M4KA 1AJ7H 2F15A 1OLLA 3RGVA 2PO6B 1HHJB 5ESVB 3O6MH 4XVSL 2BSTB 4YJZL 4YBQD 1OHQA 1AFVL 5K9QI 2X1QA 5HHME 4RAUB 3VJ6A 2FECI 1S9VA 1HOCB 1RMFL 1WBXB 3TIEA 5CKGA 3GEWB 4G42B 3RWFA 1S5IL 2YUVA 5HGAB 4CVZA 3U82B 4WO4D 2XT1B 1M71A 5JIKA 2VXQL 2WM0A 4Z95L 5E2VL 5C71A 1G84A 2NZ9C 4UV4H 1UB6A 3IDMB 2DJSA 3X3FL 3X11B 1NBVH 5KSAB 3IAQA 5ESAB 1NBQA 2EH7L 1TZHA 1N0LA 2XWJA 2ZNWA 2LABA 4I77L 4K3DL 5A2JH 3UZVB 4MJ4A 2GHWB 5K93A 1MY5A 1NCUA 1L0QA 2EYRB 1T5XB 4J4PC 2J1KA 4PJHA 5CMAA 1QBAA 3VXTA 1S7RA 2JTDA 2I9TA 2AV1B 5IT2L 4NUGH 5BV7C 4AT6B 2R23B 3H8NA 4X6DF 3QBTB 3LRGA 4MWFB 5MERB 3MRRB 1XH3B 1MRDH 2XTJD 4YUEH 5B3JF 1IC5L 4P5KA 2BFVH 5IBUB 2GEEA 3STZB 4GSDH 5L2JB 2NY2D 1RZJH 1F4YL 3R1GL 3B5HA 5EOQL 3WXWH 5HYQB 1TNMA 4ZMAT 2ZOLA 5CJXA 2DN7A 3OAZK 4HEME 3J8F7 5ID0B 4L3EB 3ZE0E 4F3FB 1JZ3A 2VQ1B 4MJ6A 4XCYB 4X7DC 4UILH 4Y2DB 3O4LA 3ARPA 1S7VA 3TBTB 3QIBB 3T0ED 5L8KB 5J13B 3WDHA 1P2CB 5EUKA 3VG9C 3L3KA 5EWIL 4YPGA 3OGOE 2Q8BL 3ARBC 5CLWA 1GPOH 2BNQD 2QHRL 3IDXH 4K94L 3VE0A 3BPNB 3B43A 5I8KH 4PY7A 4IOIB 3HG1D 4OF5A 3VI4E 2HJKA 1ZANL 3V6OA 5EA0H 2DI8A 3RNQA 5EU5B 1RK1A 4U3HA 4OCNC 3SKMB 2ICWJ 1S7QB 2CXKA 4WW1B 5I9QB 3T1FA 1NDGA 1JZ6A 1KCUH 4PV8A 4X7EC 5TQ2H 1UACH 4EQ3A 4GMSH 3TBWB 1ZGLB 3RZCB 3CNKA 1HXMB 2W38A 3W5MA 2A6DB 1SJEB 1FG9C 3SN6N 5GRUH 5F3BB 4TVPH 3D6GA 4MQ7B 25C8L 1A6UL 1NGXA 5C92A 5HHVH 3U7WL 1NGZB 4JRYD 3SDCB 4I5BB 3MZGB 4D8PB 1GXEA 3HUJE 3OKDA 4ZPVB 1U93B 3IJHA 3OL2A 2EYTB 4MVBD 2H32H 4XNMA 4D94A 1WBZA 2DQEL 1RD6A 4I4WA 1G7MA 4QRTA 4NC1C 1U8KB 4LVOB 3NFPA 3QH3A 3O2WL 3WLWC 2P5WD 2D3VA 3BJLA 3VXRE 3SGKA 2YD8A 1VPOH 2EYSA 4G6ML 1TCRA 3RBSA 2BY0A 4P3WA 1MQKH 3PABB 2B1HH 1CDHA 4WI4A 4HH9B 4NZDA 5CZXD 5MP6L 1HHJA 5ESVA 2XZQL 4Y8DC 5E2WH 4YHYC 3VXUE 4Y4FD 1TVBA 5T1LB 4G3YH 2WBJB 4CJ0A 2BOCA 4J3SA 3GSXB 2D7PA 1IM9D 1U8LB 5H35B 4I3RL 5HGAA 2ZCKH 2GW5A 1CFVH 1OQXA 4JY5H 2D0HA 4GKOA 3MJ9A 4G5ZL 2Z91B 3X11A 5DJ8B 1P4IH 5KSAA 3B3IB 5ESAA 4BZ2H 3R8BB 2DM3A 5D9SB 4TTDC 1TQBC 5EBMA 4G6KL 3T2NL 3SCMC 5EBWB 4YE4L 1XZ0A 1QOKA 3BGMA 4LNRB 5T33H 5F9DC 2EYRA 1T5XA 4NRXA 1QRNE 3WIHA 5KVEH 5ISZD 4FFVC 5HY9B 2V6HA 4QCIB 1JE6A 5EULV 4DN3L 4Q9CA 4E0RA 1UKQA 2WW8A 5C6TH 1E27A 2CGRL 3DV4B 4KI1A 5D7LA 4AT6A 3I02A 2R23A 1CFBA 1KB9J 3QO0B 2BK8A 4Q6IB 1SVCP 1KYOK 5KTEH 4MWFA 3CVHB 3LHPL 3BGFC 3JVGA 5I8EB 5I18L 4NN5C 1CWVA 2NXYD 6CGTA 2ZNXA 1XH3A 3LS4L 4KRPB 3UAJD 2ZUYA 1F4XL 2C1OB 3STZA 2YUWA 2ADFL 4TSAH 1T66C 1WZ1L 2VJXA 3LZFL 4HS3A 3RFZC 3WFZA 5TQ0H 2VERN 3F7YA 1U2CA 4OLZH 5C0EB 4PJXE 4PJFF 4F3FA 5DK0B 3RY6A 4PJDF 5E00B 2VQ1A 3MRCB 4XCYA 1DLFL 3JTTB 5JUEL 2A9ML 3V95A 2ZJSH 2NTSP 3QIBA 4XXCA 5D1ZB 4BQBA 3LKPB 1KCSL 3QEGH 4MJ5B 3ARED 3T0EE 4JRWA 3THMH 5T1KA 4QNPF 3IJYB 5DD5H 5HHXH 3QIUA 1XCQB 3O2DL 5GGRA 1NCNA 2FZ3A 1QA9A 2AJ3B 3DBXB 5F9WC 2BNQE 2PXYA 4JHWH 2R2EA 3MBXL 2ICWA 2P42B 4APQD 5GS0H 3LEYL 2R69H 3HG1E 5JQ6H 5EU5A 5BVJA 4OBRA 2Z92B 1L6ZA 4PJBF 1T7XA 1Z9SA 5DLML 3Q6FA 3UJTL 4WW1A 4XWOC 4HDIA 3IB4A 3HR5B 3U1SH 3TBWA 1ZGLA 1CLOH 1DLHB 2F53B 3K0WA 4PREB 5DRZB 2XTLA 4K23L 4XTRD 1HXMA 4OF7A 2A6DA 4RX4A 1J8HB 5KSBE 1Q0YH 2IAMA 4XAKD 1Q9KB 5C0AD 3Q5YA 1R6VA 1F4WL 4GW1A 1AR2A 2APWA 3O9WC 2B1AH 4WNQB 5F3BA 4AMKL 2OMNA 5IFJA 1M7DB 1LGVA 3RVTC 4M1DH 1UA6L 3OR6B 1T1XA 4JQIL 1H5BA 5I66A 5D93C 4OM0L 4I5BA 2VWEC 3PWJB 4D8PA 3FN9A 3HAEB 2G9HB 3QHTC 1I3UA 1JPGB 2EYTA 4JRYE 3FOMB 4O02H 3QUMB 4P2YA 4GBXB 4ZAKA 5HDQH 1IQDB 5IVZB 1YC7A 2J4WL 3QRGH 5A16B 4OCXH 1F6LL 1TJIH 2OM5A 5FAAA 1OTSC 2X44D 3B9KB 1WICA 4KVNL 3IYLW 1CR9L 3HE6B 2UVEA 4U3XA 1O7VA 4YBHA 2NY3D 3BZDA 2FSEA 2QSCL 2FLBT 5AWNH 4XBPA 5HGDB 5AAMA 1Q9OB 3VFRB 5I1EH 2YA2A 3FO9A 2FEDC 2P4AB 3CZFA 4XPTH 1DBAL 1ZSDB 4MDJA 3QQ3B 2VR5A 3VRLE 3V6FB 5H35A 1YEDB 4JZOB 2WV3A 3FTGB 4PJ7F 3OJDB 4WO4C 2WSKA 4O00A 4OLYH 2E9JA 2BY3A 1KTLA 3MV8B 4NKDB 4H1LG 1AD0A 2MPAH 4NSKA 5DJ8A 1O7SA 4HHAB 3AB0B 1MELA 3OTTA 3STLB 4TPRH 3PUCA 3BEVB 1LWRA 3TLRA 4P9HH 1FPTL 4V1DA 5EBWA 4ZUVB 3CDFA 5F1OB 3F7QA 3L7EA 1MRFH 1A7QL 4R7DB 5FB8B 3WFBL 3PWVA 4X4XB 2D7MA 3T3MF 4UTBL 3ULUD 5EFIA 5F9AC 3SDXF 1FZJB 3GHEL 1HHHB 1U6AL 4JFDE 5ISZE 3DI3B 1W8NA 3HPJB 3RY5A 2DQJL 2IBZX 2C3GA 2D7TH 3BH9B 4HAFA 3CVHA 5B39B 1YY8A 3IETB 2VDRL 3LS5H 4P2OD 4UAOC 5I8EA 3RDTC 5IFHL 3CFCH 4FQXA 3MRGB 1NBYA 4PRDB 1AO7B 2XTJC 2F74B 1VADB 2MNUA 4EUPG 4Z7VE 2F8XC 2NY2C 4R4NC 1IGYA 5H37G 1JUFB 2RHEA 4KUCF 2FHFA 1HH6B 1LK2B 1ZVSA 2A0LD 1DN0A 3LIZH 3SPVB 5T3ZD 4C56D 4LNVA 4JQXA 3QDAA 3B2UC 3CX2A 4X6CF 3BQUB 4Z7WE 5E00A 3MRCA 2FJHA 2HG5B 4Y4KC 5IHLB 4U33A 4XHJD 1NCWH 4M8QA 4JPIA 5KVFL 1FNSL 3KLHC 3N0PB 2HAZA 3T0EC 2HYMA 1RULL 1LNUA 3FQUB 5IB5A 1Y6NR 5I19L 4MJ5A 3BRGC 1HNGA 3SDDC 3ZT6A 4WEMB 4HZAA 4AG4H 3MX0A 3H9ZA 4K8RL 3V7AE 3V4UH 1XCQA 5IV2B 2WUBH 1YYLH 1BEYL 1NKRA 4K3EL 4HS8H 2YPVH 4NM8L 5HI3D 3DBXA 1UCBH 2HKFH 4PLJD 2YMXH 4XPHH 2VAJA 2ERJB 3BDYH 1F8TL 4JM2B 4L3CB 5TDPA 2Z92A 3VD4A 1B2WL 1FVCB 2UWEB 3ARXA 4LEXL 3VFWB 5F6HI 3HR5A 4L8DB 2F53A 4FN0A 4POZD 2Y5EA 3ZTNH 1J8HA 4NN7B 1Q9KA 3TNMB 1KNOB 3MJ9L 2X4UA 5DI8A 4BYHA 2E7LC 4Q9QL 4XVJH 4WNQA 3K8MA 3FFCD 4M6OH 4XAKE 5D2LA 4DQOL 1F02I 1E4XL 3OR6A 1K4CA 3PL6C 4C83B 1KBGH 4DW2H 1NFDB 2A1WH 3PWJA 4JFXB 1I1AD 4D9LL 5DD0L 1HE7A 3HAEA 5SV3A 2G9HA 1YECL 1JPGA 1GGYA 1HH9B 2P8LB 5I17A 4KKBD 1EUTA 4TYUA 3SOBL 4PYGA 2ZG3A 3VWJC 5BRZA 4RFOL 5IVZA 1OAYH 2F54A 3O8XB 1BJ1J 3AS2A 1VERA 1AJ7L 4LVNC 3B9KA 1GGBH 1CFQB 3AS1A 3O6ML 4OZHF 3HE6A 1WTGT 2OJZH 1SY6H 5GS1B 5ENWB 1JI2A 5HGDA 5CZXC 1PX4A 4OAWB 2AVGA 1Q9OA 3VFRA 4JO2H 4JPKL 3KWWA 3FB6B 4J6RH 3FAXA 1OW0A 4D2NA 1ZSDA 2J8HA 4UV4L 3QQ3A 4G43A 5JXEA 1NBVL 3OJDA 5E8DH 4XNZC 4M3KB 1KJMB 4KTDH 1N64H 5HYEA 3TC9A 3VFMB 3E1F1 3SE3A 4CVXB 3MYJB 3EYOB 4E41A 2YRLA 1MNUL 1BGXH 3BEVA 4MLSA 1NCBH 4BFGA 4GG6F 3ARDA 5J8OA 3GMQB 3S34H 3IU3A 4ZUVA 4L4TB 1JWUB 4NUGL 4R7DA 5SWZD 4X4XA 4QHMA 1K6QL 3H0TB 4OI7A 3RI5K 5F7YC 1M7IB 4KXZH 3QFJB 4NQDB 1MRDL 3ULUE 1VSCA 4YUEL 1GVIA 1EAPB 4KK5D 3BPLB 3OXSB 1YZZA 3SEPA 2BFVL 3BH9A 4RIRB 2DIBA 4K07A 4OFPA 4LHUD 4HD9A 1RZJL 3IETA 3T2PA 1ODAA 4KC3B 4AL8H 2NXYC 3MRGA 3ZE1E 3WXWL 1A14H 1VADA 3KPSA 4KKNA 2GFBB 1DVFB 1JZ5A 5HDLA 4JN2A 1DBKH 3PGDB 5EG6C 1KG0A 5JMRA 4ELMF 4S1RH 2J8UE 6FABH 3A67L 1NDMB 4PJIE 3BJ91 1HH6A 1LK2A 4OZFB 3FQNB 4I0CC 4UILL 4NCC2 3QIWB 4Y19B 4YDJB 3HS0B 1U8QB 1KPVA 2QSQA 1D7FA 3QDJB 5T3ZE 1FNHA 4C56E 1F3DH 4UMGA 1AR1D 3EJYD 4RMSA 4YO0B 2HG5A 3SKOB 4NO0B 2FLRT 4P9MH 1C5BH 1GPOL 2X1PA 3Q1SH 4QT5B 4R3SB 2AXFB 3IDXL 5F7DB 1CL7I 5I8KL 4W68A 4U1KB 4OD1H 2QLVB 5LXGH 1H0DB 3DMMB 5JW4R 1FBIH 4OI8A 2RJMA 5I1LB 1TNNA 2AW2A 2GCYA 1B0RA 5IV2A 5EA0L 3OG6B 1A2YB 5KW9H 5EOTB 4G80B 4XC1H 2JKXA 1KCUL 5TQ2L 1UACL 5EBLB 5D7JB 1UJTA 1MHEB 1RURL 4JM2A 4L3CA 2FWOB 5ERWA 1VEMA 1FVCA 5GRUL 1ULVA 2YD6A 3VFWA 4TVPL 1JGLH 3RKDC 1WFUA 4S10A 4ORZC 5HHVL 3QAZC 4XTRC 1YQ2A 3WS3B 3G6AB 3LN4B 3P4OB 1UENA 3MV7B 2HLAB 5JA8B 3P73B 1KNOA 4O2EB 1E28B 3VWKD 3W9EB 1QYGH 2NW3B 2H26B 3NAAL 1F58L 3EOTH 2IPUK 1X5AA 2QQQA 3FFCE 4C83A 1NFDA 2GTWA 2G5BA 4JFXA 4GG8B 1A3LH 4HF5H 1F3DJ 2P8LA 3FRUB 5HDBF 1U3JA 4KJPD 4U1HA 1VPOL 5DVOA 4Z7UF 4LARH 1MQKL 1T2XA 2B1HL 4HWUA 3O8XA 1U8MB 3KPMB 2J5LC 1P7QA 3DARA 1R3HB 43CAB 2FYYB 1I7RA 1CFQA 5E2WL 1GL4B 4NQCD 4WWKB 1FO0H 4G3YL 2APXA 2NY3C 4QXWA 1HILB 4OKVA 3ZDZF 5GS1A 2H9GB 4GQ9H 3WO4B 5EUOE 1QSFE 3OZ9H 4PRIB 3HB3D 4GKSB 2ZCKL 4FQQA 3EFDH 3T2QA 1CFVL 5CJ8A 5DWUH 1MVUB 4JY5L 3HMXA 4NQXB 1LE5B 4RBPH 4JFQB 1I1FB 1P4IL 1MF2H 4BZ2L 3AS0A 2Y25A 2X1OA 5CGMA 4I2XB 5E99H 4CAGA 3RIAF 3DO7A 2EICA 3EYOA 2JJSA 3P9LA 3TN0B 5J11C 5T33L 1WISA 3BW9A 4AEEA 2YUXA 3CPLB 4M5ZH 4F57H 4XRCB 5KVEL 4OF0A 3GMQA 5ID1B 5I73B 2H2SD 1BLNB 1CLCA 2ZCLH 2WWKO 5GIRB 3LN5A 5C6TL 4XCCH 1JWUA 2ZSWB 4OBSA 4I48B 2NCMA 4N8CH 3VH8G 5KTEL 3H0TA 5A2IH 1DR9A 1EHLH 2EDXA 1SY6A 1M7IA 3QFJA 5C0CB 1KELH 2VLJD 4NQDA 2LU7A 3GMPB 1YPZF 1D5BA 5DJAB 5DUBA 3V6ZB 2GI7A 4RIRA 2M2DA 2YZ1A 4TSAL 3ROOB 2V5YA 4F37K 3UROR 4HIJA 1HSBB 1IEAA 3NABL 3EAKA 1DVFA 5TQ0L 1D5XB 4R2GC 5B22A 3LRSA 1N2RB 4OLZL 3CXDH 5KZCD 4NWTH 1I4FA 3FQWA 1NDMA 4OZFA 1IRAY 2YOCA 3FQNA 4CBPA 3MXVH 2NY1D 3RY4A 4YXHH 4Y19A 4P4KB 3HS0A 1U8QA 2DF3A 4L8SA 2ZJSL 1NBZB 3DTXB 1QFHA 2X4RB 1UJ3C 3BKCH 4OD2A 3QDJA 3E6FA 1MCSA 3FO1A 3QEGL 1NC2B 3CFBA 2BJMH 5CJOL 4Z9KB 3SKOA 3THML 3SDAA 4XHJC 2R9HC 4R3SA 5DD5L 5HHXL 1GOGA 2AXFA 5I8OH 4KV5F 3L5JA 3AU1A 1J18A 2EC9T 4QOKB 3MV9A 4U1KA 4JHWL 3MJ6A 4EQ2A 5GS0L 3F58H 2R69L 4PJ9B 1I85A 1A2YA 1JWSA 5JQ6L 3ILQD 4P2RE 5EOTA 5GZOD 1F4AA 4MAYB 4U1MA 3U1SL 4HUWB 1X5HA 4PLJC 1CLOL 2E27H 1JZ4A 1MHEA 5I2IB 2BVQB 2FWOA 1Q0YL 5H8DA 4JFOA 3ZHDA 2EXWC 2EDOA 4MZ2A 2B1AL 1G7IB 4GKZB 1LO3H 2Y1VA 4UT7H 3QPXH 1P5VA 4POZC 4M1DL 4ZTOH 3S88H 2P46B 3LN4A 5J9PA 1UKTA 3F6LA 4PLKC 3P4OA 3MV7A 4O2EA 4PGEB 3W9EA 1AHWC 1CU4H 1CD8A 3GB7B 4PJ8D 2WWMC 2YK1H 4O02L 4LCUA 3PQYB 3P9WB 1QSZA 3HRZB 1A8JH 4WEBH 4WHTA 5ITFA 2CDGB 5HDQL 5TE6H 1EO7A 4P46D 4GG8A 4PG2C 4N0UB 3QRGL 4HMEA 5J56B 3OF6D 1TJIL 4KKBC 2X9WA 5B38B 5FGSA 1MUJA 1T3FB 4EI5A 5DFVD 3ILPB 1BF2A 4X6DE 4GRWH 5TJWK 1N4XH 1U8MA 3KPMA 3UXFA 3V5DA 5AWNL 5E1AB 1R3HA 43CAA 4JREC 2Z93B 2FYYA 5CD3B 4Z18A 5I1EL 5MEOB 4R97B 5F9JB 2OXGA 4WWKA 3ZKQD 1G7QB 4XPTL 5LBSH 2EE2A 4M02A 4WI2A 2HFGH 4LSSH 3MV11 2H9GA 4NQCE 1OP3H 3SE4A 3QISA 1FC2D 4M6AA 4G9DB 5IFAH 4FFWD 3LKRB 1MVUA 4OLYL 4HWEH 4CADB 1Y6KR 1P53A 4NQXA 1LE5A 3VDCA 4JFQA 3RTQD 2MPAL 3LH2H 5L2KB 3DVGB 1WK0A 5IIEB 4F7CB 5T5FL 4TPRL 4JFEB 4UU9B 3ARFC 4I2XA 4P9HL 2BC4B 4NZUH 4NO2B 4HK3J 1U8OA 4G7VH 3NIGF 1EEUA 3MCKA 3OKEA 3TN0A 1EDQA 1MRFL 3N06B 3IGAB 4KU1A 1KC5H 4XRCA 5HDOA 2AEQH 2SEBA 1RAMA 5ID1A 3IDYC 1C16A 4K3HA 4YGVA 4ZUUB 3EO9H 4HLJA 3EOBB 3CJJA 3MRMA 3D3VB 5FKAB 2D7TL 4ODSH 2X10A 4ZFFB 3LS5L 1FO0A 1EEZB 3CFCL 4FZEH 3ZDYF 4B7LA 1UH4A 4NCDA 5E5UB 2D0GA 4OFKA 5D5MB 3GMPA 5DJDB 4KK5C 5DJAA 3V6ZA 3G5XB 5ICZB 4M93C 3CDGB 3AXLB 5JOFA 1ZLWK 4GUPB 1HSBA 5DMGD 1D5XA 3T4AB 4YAQB 1N2RA 4ZUTA 3RIFK 4OZ4B 1X4XA 1FFQA 3PJSB 3M07A 1R3IH 4ZS7H 2RFXB 1I8MB 5LGHH 2VZTA 1HK6A 2XWBB 4P4KA 2O5ZH 1NCWL 2MHAB 3MRDA 4X7CC 2X4RA 5BXFB 1OD9A 2FJFB 4WI5A 3AC0A 1NC2A 2XKNB 1URLA 3B9VA 4AENB 3A0OA 5KG9B 4AG4L 2DAVA 3EDEA 3V4UL 5F1KC 1PGRB 2WUBL 1PZUB 1YYLL 1OP5K 4XVUC 4HS8L 2YPVL 3SGDI 4QOKA 5FO9A 1UCBL 5INCB 1S78D 2HKFL 5BS0D 1Z0MA 2IMMA 2YMXL 4U1SB 3VCLB 4XPHL 1OAXH 1CG9B 1LO5B 3GJFK 4M61B 3BDYL 4PJ9A 2DMBA 1G7LB 4MAYA 2B4CC 5FOBA 4JKLA 4NJ9L 3JWDL 5GGVH 3F8UB 1MFEH 1XGPA 5DJXB 2BVQA 2VH5H 3KPPB 3ZTNL 5I2IA 4FQCH 2BCKA 1INQA 1PBYA 2ZUVA 2DB8A 4XVJL 3DX7B 1G7IA 4GKZA 3X17A 4M6OL 5SX5K 2PTTB 2DLIA 4WW2C 4JDTH 3B9EA 3WFEH 3BKYH 1KBGL 4JFYB 4DW2L 2A1WL 3V4VH 4GW5B 5IB2B 3HNTH 3GB7A 1FFOB 5IK3A 1RZKC 3SJVE 4U1LB 1XIWC 2C26A 1Z0NA 3HRZA 4NZRL 4RISH 3TA3B 3VRJA 4JZJB 1OAYL 5BV7H 4KK6C 4GRLD 4H88H 1GOHA 3HI1B 1SBSH 5HHOB 2EE3A 4KJPC 4WU7A 1SMOA 1UB5B 1GGBL 1NQBA 1P6AB 1T5WB 1T3FA 35C8H 3ILPA 3NH7H 2ATPB 2OJZL 4QRRD 2IMNA 1SY6L 3FB8B 3V5HB 4NFCA 4PRPD 5C3LD 1NCCH 2Z93A 1XGQB 1ZS8B 3ZYJA 5EB9A 4CNIB 5CD3A 3FT3B 4JO2L 3CH1B 3O3DB 3KPLB 4J6RL 4KUCD 3NACH 4O58H 4ZDHB 1IT9H 1RZ8B 5D70H 4G9DA 2WK2A 4IRSC 5E8DL 1ADQA 3NTCH 4KTDL 1N64L 4JGUA 3CC5B 5E08H 1KJ2H 3MRKB 4PJFE 4PJDE 1KULA 1LE9B 3G9VA 3RWGB 5C0DB 1BGXL 2OR7A 4JFEA 2XQBH 1NCBL 2BC4A 3S34L 1KB5L 2D03H 4PRAB 1ZLUH 3FL7A 1H3PH 5DA4A 3IGAA 4QNPE 3HFMH 1CD0A 2R1YB 1ACYH 2NLJA 2H2SC 4F33A 1QVOA 5KVDH 5IQ7H 2JELH 4PD4K 3EOBA 1I1YB 5C1MB 3HZVB 3KYMA 4LGSB 4PJBE 5F88B 1EPFA 4NHCH 4YXLH 4ZFFA 3SY0B 3MLPA 3FT4B 4AL8L 5FGCB 1ZT1B 1A14L 5EU4B 1UWXH 5DJDA 1B3JA 2Z35A 5B8CB 4RFEA 2HJFA 1DBKL 1WVZA 2NXZC 5F96H 4DKDC 5ICZA 1W2KT 3AXLA 3VXQB 4GKNA 5F1SA 4HFUH 4S1RL 3TO4D 6FABL 2K7PA 2N4IA 5BMFH 1NH6A 3JSSA 3RL2A 5HYSB 5SX4I 5IEKA 5D2NB 3JV4B 2GIYA 4YAQA 1REIA 3OHXB 3R0NA 4OZ4A 5I8CB 1PG7X 4LAJH 5E94B 2RFXA 1I8MA 3QO1B 1CXFA 2XWBA 1C5BL 4P9ML 3Q1SL 1XR9B 4XCNB 4HW6A 5AZ2L 5BXFA 4KROC 1DUYB 3GMLB 2FJFA 3BIAX 1UT9A 4OD1L 5LXGL 1FBIL 3I6LD 4N8VA 4AENA 3BYYA 2I9LB 5I15L 1QBLH 5GS3A 4XMPH 5KW9L 2EDYA 3QZWB 4XC1L 4OQTH 4N1HB 3SKJH 2IEPA 3VCLA 4U1SA 1A7NH 4X7TB 1LO5A 4M61A 3H7BB 2J6EH 3MRNA 3UC0H 4C54A 4Y16D 3WHXA 4EBQH 5BS0E 1OVZA 1G7PB 5GZOC 1ZVHA 1JGLL 1J05B 4PJ5D 4QWWD 3QUXB 1CGSH 4HKXA 4X98B 2ZUQC 3KPPA 4PJ7E 5IMKB 4U6HA 4P5TD 2VL5A 2V2TA 2YD2A 1JF1B 4PJEF 1QYGL 1LEKB 1PEWA 2AS5M 1NAMH 4CGTA 4WV1A 3KPTA 3ARUA 5FDWB 5HYSG 2JB6B 4ODBD 4Y1AD 3VGAC 4GW5A 4IIQC 1WITA 5DD1H 1A3LL 1FFOA 5ELIA 3EYQD 4HF5L 1CICC 4U1LA 1UFUA 4FQIL 3QNZB 4MNQB 4JAMB 1JWMB 4JZJA 3T3ME 4LARL 5D96B 2WBWB 4GAJH 2UYLA 3VFSB 2ICEB 5IMOB 3HI1A 5HHMB 5HHOA 3WN5B 3SDXE 1N59B 1W72H 1UB5A 3WFHB 1T5WA 3MGAA 1X5JA 1MI5D 4ZQKB 3QUZD 1XEDA 5E8EA 1FO0L 1T7WA 4GT7A 2ATPA 4HJGB 5C9JB 2NQCA 3FB8A 3NCYP 4OTXH 5HD8D 4GQ9L 1KYOJ 3HCVB 4NO5A 4PRHB 1XGQA 1ZS8A 4QRRE 3OZ9L 3FT3A 3CH1A 5IVNA 3KPLA 3EFDL 4PRPE 1CDGA 5DWUL 2NW2B 4MNHA 5I16B 3PWNB 1OT2A 3KXFD 1RZ8A 3U7YH 1K8DA 1MF2L 2KH2B 4FFWC 2EEAA 2OL3H 5LGJB 4JO3H 4UDTB 3SCMB 4H8WH 3CC5A 5J0BA 5E99L 5HBBA 3MRKA 4X6CE 4ZO8A 4JHAL 3L5XH 1XF4B 4NZTH 4WI9A 5FUOH 3RP1A 1B0WA 1BD2D 1C1EH 3PNWB 4J4PA 1UM4H 5C0DA 1BJ8A 1QO3B 3KPNA 1MCHA 3TVMB 3MLVH 4M5ZL 4F57L 3VGFA 3OPZH 4NT6A 1P69B 4PRAA 4XCCL 1BX2A 3L3GB 3DROA 4MX7A 5FGRA 1FH5H 4L3AA 1QP1A 2OCFD 4PP2B 5IGXH 2YPLE 3F5WA 3BGFB 4N8CL 3OX8A 3MRLB 1CXEA 4DCQB 4QEGA 3BPOC 4MDIB 1EHLL 4IJ3C 5ANME 1EJOL 3WMSA 1EBAA 2VXVH 5BOZG 1RUMH 3QP3A 5F88A 1YMHA 5HI5D 2C3WA 2HH0H 3SY0A 3O11B 5EU4A 1LO4H 1U58B 4U1IB 1QBMH 3IDNB 5C07A 3HRPA 2IH3B 4WI8A 4HSQA 1VCAA 3CXDL 4RGND 3VXQA 1YEEH 3WD5H 1L9MA 4AJ0A 3E6HA 1KJ2A 3MXVL 3ARGC 3B5GA 4YXHL 3ME0A 3VGEA 1IGIH 3P4NB 2FECL 4OUOA 1UGNA 3K1KC 3QXDB 3BKCL 4BH7A 4R26H 5I8CA 1LEGB 2E7BA 5E94A 4I18B 1VESA 4NKMA 3ARBA 5E8NA 2BJML 4QXGL 5FYKE 5EU6D 4YFEA 1XR9A 2AAVA 1Q0XH 2DLFL 3QEQE 4D9RD 5I8OL 1G7JB 1I8KB 1UVQB 3VW3H 3A6CH 5F9WB 2FRGP 1DUYA 3GMLA 1SMAA 1FC1A 2X4NB 3BAEL 1DBBH 1QLRB 4BFIB 3UP1A 2I9LA 2YR3A 3F58L 4FTVD 4OZHE 4F7TB 3QUKA 3BMWA 4N90D 3IXAA 4W6YB 2VLRD 4F80A 1S78C 2W0PA 1Q94B 1S7SB 2E27L 3M8OH 1JZ7A 1FL6A 3H7BA 3MFGB 3O9WB 5C0JA 4WU5B 5C8JB 5IVXA 4ODXA 1KIUA 3HUJB 4ISVB 3HKFA 1LO3L 4UT7L 1FL3A 3LPFA 3QPXL 5D93B 3ZYZA 4X98A 4ZTOL 3S88L 2D4FA 2VNCA 3CD4A 3CIQA 5IMKA 4OZIA 4PJ5E 1JF1A 1S9XA 5BZDB 4MA8H 1MCJA 1LEKA 1CU4L 3GO1H 4M9OA 1FAIH 2YK1L 3LDBB 4E42B 3S35X 3VXRB 2AK4B 4WEBL 1ES0A 4FG6D 1S7XB 5TE6L 2BHYA 1MAKA 1MCOH 1P7KB 3G5VA 4GG6E 1HQRA 4XCFH 4Z7NE 4RMRA 1MCWW 5DD3H 3QXVA 1PKQA 4YHIA 3QNZA 4MNQA 1GH7A 2PW2A 4JAMA 4LQFH 4UZGA 2A6JB 4OCMC 5DHYB 3VXUB 1A7BA 4GRLC 3VFSA 3HR6A 2ICEA 5IMOA 4ZFOA 4DAGH 1N59A 3GI9H 4OQTA 2NYYD 2FIKA 4WFED 4EDXB 1ACZA 1QUNA 2J6EA 5E2TH 5LBSL 1T7VA 3ALWA 3DRQB 2HFGL 4LSSL 1MI5E 4PRHA 4F7PB 3C8KA 4IRJC 4WO4B 5EH1A 2I27N 3PWLB 1CL7H 3T0DA 1ND0B 4HWEL 3PWNA 2DTMH 3WLBB 3LH2L 4YHPA 3KPQB 4F58H 3KXFE 2VDPH 2VOTA 1I8LC 4UDTA 3UCRA 3SCMA 4V2BA 3VXMD 2I07B 4NZUL 3CX5K 1WWCA 3V8OA 2KDGA 1EFXD 4G7VL 5DC9B 2VQUA 1CGWA 1QO3A 1YEIH 2GJ6A 1KC5L 1MY7A 3OAYH 2AEQL 5DK2A 5TGBB 3X13A 2CKBH 5ACMA 1BD2E 4R6UA 2P7TB 4O2CB 1FCGA 2LAGB 3L3GA 3EO9L 5DMJB 4PP2A 4DFHA 1W72A 2VZSA 4ODSL 4UAOB 2X9YA 5CEZH 4DCQA 4PGCB 4FP8L 5C0BB 1A6VH 2XTJB 4FZEL 1IFHH 3RWCA 2RCSH 3MLSH 2XWTA 2R0WH 3PXHA 1RZIB 1JPFB 2R2HB 3MROB 4WJ5B 2NY2B 1QLEL 1RQ5A 2OP4H 3Q48A 2IALB 2DDQH 4P2QA 5F8RC 5DTFA 2DQFB 2JB5H 3KHOA 4PJXB 4U1IA 5CGTA 4HMDA 1I8IA 1NCAH 1R24B 2IH3A 4OGAD 2OL3A 2APBA 3NCBB 3WUWG 3X12B 3IS1X 4ZS7L 4DUWA 3HZKB 5LGHL 2O5ZL 3T0EB 1TTGA 3VU2A 3QXDA 1RK0B 3UTZB 3O3UN 1EHXA 3D39A 5HDBE 2Q86B 2BNQB 5I74B 3D0LB 3EUUA 3ZHKA 2KZWA 2MFNA 1FNFA 4C4KO 4QTHB 2FGWH 3HG1B 2R29H 2XY2A 5EU6E 4BFIA 1QLRA 2IANE 2OJEA 3LKQB 4YZFE 4D9RE 5FYKH 2PYEA 4G8GD 2OS7A 1OAXL 2BSED 4DVRH 4F7TA 1IC1A 3BRFA 2X5PA 3QXTA 5F7EH 2X9XA 4ESKA 4FTVE 3D25A 5GGVL 1RJYB 1Q94A 2XKSA 3F7VB 1TCMA 4N90E 2AJYL 2VLRE 1MFEL 1VKXB 2VH5L 1AGEB 1T20A 4FQCL 3UYPA 4WU5A 5C0NC 1VDGA 3WSQH 2HT4C 4QWWC 4XX1G 2DKUA 4JRYB 1YC8A 3EOYG 4U3CA 4JDTL 4Y0GA 3RZCC 4U1NA 3WFEL 3BKYL 4P5TC 3I2CH 3V4VL 3VI3F 3BIKB 3HNTL 2VUOA 1YN6B 4HAGA 4WHYH 2Q20A 4GW4A 2H2PD 1HHKB 3FO0L 1FIEA 3VXRA 1XF3B 2AK4A 4QRPE 4HPOH 3RVXC 4RISL 1ITBB 3SDCC 2P5WB 2PNDA 4LLDA 5BV7L 5E8PA 1KJVB 1HN1A 3EYQC 4CN6A 5KS9B 4Z7OF 1KIRB 5SWSB 3S5LG 1IAIM 1A0QH 35C8L 1NUDA 2A6JA 5DHYA 5E9DE 1YUHB 2DIJA 4LVOC 4J3XA 4MJIE 4Y4FB 4N5ED 1TLKA 4TVSa 1YPZE 3LEXB 3BH8B 3HMWH 3NACL 5T1MB 1CN4A 5JIIA 4O58L 4EN3D 2W0FB 3DRQA 3OJVC 1IM9B 2A83B 1G9MH 4M8VA 1IT9L 4WO4A 4RMWA 1KJ3H 5D70L 3LV3A 1KB5B 2CJUH 1PYWB 4XPBH 5EZLA 1JCKA 3NTCL 4U0QB 1XGRB 5C08D 4NNXB 2BVTA 1DUZB 3FN3A 3P30H 4K3JH 1KJ2L 2DQGH 2WBJC 3KPQA 3NPSB 2ITCB 3CMOL 2Q7YA 2OR9H 1ZGLM 2NY7H 4HC1H 2XQBL 5E03A 4LMQI 4KK8C 5GISH 2F8VA 2PYFB 2D03L 4N8PA 4RGMC 1H3PL 4QRSB 4WDIB 3VXME 2HP4A 2N56A 3HFML 4KV5E 4ZYKB 3ZDXF 5A2LH 1ACYL 4RAHA 3VA2C 4HGWA 2X89A 2P7TA 2P5ED 5KVDL 2BVOA 3SKNB 3CXHJ 5IQ7L 4XGZA 4ORGB 2CLZB 2JELL 2WIMA 1RY7B 1OTTD 4HWNA 4Z7VB 3RDTA 4NHCL 4PGCA 4YXLL 2NXYB 5C0BA 1Y6MR 3M17B 1SJVA 3BZ4A 4LLUB 4ZXBD 5CEYB 1JPFA 2R2HA 1EO8H 4DKEH 4WJ5A 2D7OA 3MA9L 1ZT7B 4PTUA 2XI9A 1TJHH 2IALA 3QPQD 5BMFL 3QNXA 2DQFA 2C7UB 1WCBB 1VGKA 4Z7WB 4KRPC 2R2BA 4A6YH 1YJDC 3TFKD 4LK4A 3C6LD 3CAFA 4RGNC 1JNHB 1A4JB 2B2XH 4DTGH 3LVEA 4Y4KA 5CP7B 2YN5A 1Q9WA 4AZ8A 1RIUH 2UUDK 1IAOB 3T0EA 1WFOA 5IG7B 4L4VA 4U6YB 2ID5A 4LHQB 5GRWA 2JJVA 5AUMB 1MLBB 3SDDA 4NCC1 5DXWA 3AREB 3FCTB 4MAUH 4JJ5A 1J12A 1FVDB 1ZLVH 4HWBA 4LPYA 2HTLC 2CKBA 2LAAA 5BW7C 2Q8AH 3D0LA 1T1WB 2HRLA 3BP6B 1AP2B 4XMPL 4ZFOL 5GS2H 3N1QC 4EZMA 2VLMD 1QNZH 1SQ2N 4OQTL 4APQB 5D1ZC 3QQ9C 4YX2L 3SKJL 3OV6A 2GJZA 1A7NL 3UC0L 2J6EL 1DANU 3VA6A 4X6EB 4EBQL 1JK8B 4G8GE 4KK9C 1IAII 2IG2H 5J4MA 3ULVC 1CGSL 3F7VA 4HUUA 4J1UA 4PY8I 5C0AB 5TH2A 2ENYA 3RQ3A 1VKXA 4MS8D 5HGBA 4KH2A 2E7LA 4UBDD 4R8WH 1T04B 2AK1H 5D2LF 5J12B 3F6IA 3QXWA 4I13B 3EBAA 2O61A 1LILA 3PL6A 1NAML 5EO0B 2C3HA 3MXWH 5ESQB 5FA3B 4RGOH 5DD1L 1KLUB 1U3HC 5D8JH 4W4NA 1Z3GH 1AC0A 4HKJB 3VWJA 4LAQH 1B4JH 4WTZA 3HE7D 2GT9B 4YC2C 3GI8H 4CMHC 2P5WA 2EDKA 4GAJL 2J5LB 1KJVA 5F7HA 3AAZB 5KS9A 2HFEA 3X3GH 4PR5B 4LDLB 3TT1H 3UTTE 1W72L 5SWSA 1QBBA 5F8QC 4ONFH 4GBXC 2NY3B 1UXSB 3TJHD 4OTXL 4EXKA 3VI4F 1ITCA 3WJLC 3MO1B 2AGJH 1J1PL 3BH8A 2W0FA 5FHAL 1H3WM 3P9MB 3ES6A 3S36X 2IH1B 5FUCE 3WL9A 5CZKA 4OZGA 4X5XB 3U7YL 3RIAK 1PYWA 2OL3L 3SGDH 4B53A 3HNVL 4JO3L 4H8WL 2AP2A 1DUZA 3BZEB 1QEWB 4LIQE 3L5XL 3NGBC 3Q0HA 2HFFB 2VDMH 1S7WA 2ITCA 4NZTL 5FUOL 1EFQA 1ZLSH 4KZEH 1P9MC 4NDMA 1C1EL 1V3LA 1X3DA 3HUJF 2GUOB 3LKNB 3LAFA 3KLAA 5IB3B 3MUHL 4BQ9A 4MQTB 5DR5H 3OPZL 1F00I 3IKCB 5DO2C 4CL7A 1MIMH 1X5GA 5EPMA 3JXAA 5MEPB 4XH2B 1FH5L 3VXOA 4F7MB 3ORJA 1R5VB 2R4RH 5IGXL 3AB0C 4XP6H 4EIGB 2FO1A 3G08B 1IC7H 2VZVA 4HV8A 1S3KH 5E1HB 4NQTA 4ORGA 2CLZA 2GY7B 4B41A 4LCCA 4TULH 3ESVF 1MCCA 2VXVL 2VMFA 1RUML 3ZE2F 1TZIA 4P2OB 4PJAE 3AMLA 2ESVE 2HH0L 3T0XA 1WSST 1IAMA 2XZAH 2W07A 3C8DA 4JR9H 4PJIB 1LO4L 2HLFD 1QBML 4YNYB 4BZYA 5F7FA 4ZFZB 3T08A 3VXPB 2NY5C 1G7HB 1ZT7A 2JCCB 1DSFH 2VIRA 4U05A 5HYJD 5GGTL 3VGBA 1YEEL 3WD5L 5I6XB 2C7UA 2HT2C 2W65B 1WCBA 2KZ1B 2AI0H 2IADA 4C56B 4K7FA 5HPMB 3CZJA 4BUHA 1IGIL 1UJ3B 5I1AB 1T21B 3MSPA 4R26L 4HC1A 4OF3A 5DZOA 3GIVB 5JA9A 4XCEB 3I9GH 4L8CB 4NRZB 2CH8A 4J3OC 1FNEB 5GGSB 1LP9B 1IAOA 2HJLB 5L8LB 1SEQH