5T1DL

Crystal structure of ebv ghgl/gp42/e1d1 complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
217
structure length
217
Chain Sequence
DIVITQTPLSLPVSLGDQASISCRSSQSLLHSNGNTYLHWYLQRPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLMINRVEAEDLGVYFCSQSIHVPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for Epstein-Barr virus host cell tropism mediated by gp42 and gHgL entry glycoproteins.
pubmed doi rcsb
source organism Epstein-barr virus (strain b95-8)
molecule tags Viral protein
molecule keywords Envelope glycoprotein H
total genus 38
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2016-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t1dL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t1dL01
1E4KC 4YHYB 4F8QA 1XIWC 4G3YH 4M6AA 5L8LB 1G7JA 2D4DA 1LEKB 3TIDA 3R0NA 5DD1L 2X4TB 4FP8L 3KPLA 1SBBA 4JFHD 3MLSL 4Y5VC 3OJDB 1QLEH 1X5LA 5E00B 2CLRA 1QSEE 3INUH 2RCSL 3ARPA 2APVA 5J6HB 4NNXA 1TTFA 3T3ME 4MVBD 3B9KC 3ET9F 3VFSA 3TIEA 4HIEB 5DRWA 5C71A 3OR6B 2OK0L 4U6HA 3CZFA 4L8BA 2NNAA 5EU5A 3ZTJG 1VCAA 4YZFF 3BRFA 5KSAC 1WF5A 3MLZH 5FUZL 3CFDB 4YBHA 1UZ6F 3KG5A 3IDIB 5IKCB 3AFLA 4ODBD 1IGFH 2YEZB 7CGTA 4LCWE 4GS7C 3UROR 2PYFA 4TSCL 1WCBB 5CS7A 2HG5B 3RU8L 5B39G 2NY0C 3Q5OA 4NM8L 4WCYH 3BGFB 1B0GB 1NGZA 2YA0A 4MAYB 4ZSOE 4JFQA 5C09A 3EBAA 3RAJL 1FYTB 2QQKL 1KJ2B 3T2OA 2XNAB 1EZVX 3IDGA 3LEVL 4PG2A 2C4XA 2NY6D 5I1HH 5TPWL 5HPOA 4QT5B 1AQDA 1X5ZA 4AM0B 5T3XH 4Z77A 3F7QA 1XT5A 1S7UA 5IB2B 4LQFL 1FL5A 3AS0A 5DFTA 4YDLC 3BZ4A 2G75A 1MY5A 5DEGA 1FZKB 1U8LB 2VKWA 4P0DA 3DV4A 4HK0A 1DN0A 3G08B 4YXHL 4MJ5B 1MVFA 5DD1H 2FR4A 2I26N 5FO9B 3LQAL 4DZBA 3OAZK 2DM4A 4R26H 4N8PA 5I2IB 3LQZB 1JNLL 3MOBH 4JDZB 1LO0H 4ACPA 5DJXB 4NZRL 2X4QA 1FIGH 5J6HA 1Z6JT 3ARRA 1ZVYA 1WBXB 4LEOB 5ITFB 4M93C 3GMOA 1F4XL 3GB7A 1MH5B 1L0QA 1OLLA 1QZ1A 3QP3A 3VFPB 5I1AA 5IM7B 1ACYH 5KS9B 5GRZA 2AV1B 2CXKA 4NCC1 3L3KA 3MLYL 3C2AH 4GXVL 4C55A 5EOQL 1JI2A 4EVNA 1NCAH 2EC8A 3K7UA 4UUJA 1WZ1L 3X14B 1Y18B 2IANA 3P77A 1X5GA 4JKPH 3STLA 2J8UB 1QR1A 2QSCL 3WEXA 3FTGA 5JHDD 5L7XL 5EU3A 4ZD3H 1FFNB 5CEXA 3WS3B 2VDRH 3ISWA 3TO4B 3QULB 3V52H 2MTPA 1WCQA 5F8QC 3V4PH 1OT1A 3O4LA 3SE9L 4XMLL 4BK4A 5C0RL 1K4CA 1ZVSA 3T65B 1YY8B 1A1NA 2GJ6E 3L3JB 2ARJA 3EO1A 1E4XL 2JB6A 4QRPE 4MSWB 3MRGA 1MCWM 3UDWA 2QADB 4ZUVB 4NWUH 3UAJD 4WFED 1BZ9B 3UTTD 3D3VE 4N8VB 5E8PA 3WO4C 2R0LL 4Z7UB 3EIFA 1DP0A 2BSTA 1NCCH 2KQMA 2Z91B 1NAKH 3KLAB 1KPVA 4MD4A 3RGVD 5CGYD 1P4BL 3IGAB 3RNKB 3QEHA 4LK4A 1XMWA 3VWJA 5F3BB 2EXWD 4JRYE 1DBAL 5LQBH 4LLYB 3MRPB 3N9GH 3U82B 4OQ1A 2R2BB 2HVKB 1INEH 1IKNC 3RIFF 3GSRB 2E6QA 4XPHL 5GHWL 2VNCA 4HUUA 2OZ4A 3RL2A 1P5VA 2D31B 4L4VE 3JV0A 4UT7L 3FHAA 1KNOB 1JF6A 1QEWB 2HVJA 4UQ3A 1RZIA 4L3CA 1WZ1H 3MBXL 4L1HA 2B8OT 4GAYB 1G0DA 3QUMH 5L8KB 2OSLB 4LSSH 4RWYH 1NBQA 5JUEH 3FB7B 4WUKH 5SWSE 3QEQA 2CLZB 4RFNB 1J1PH 5FUCC 3RL2B 1CLZH 5HI5D 1U93A 3ARSA 8FABB 5D1QD 2Q3AA 4CN1A 4HKXB 3JWOL 2VTFA 5CHNB 4Q9CA 4L9DA 1AP2A 3VI4F 3L3HA 2HWZH 1JGUL 2FD6H 4YO0B 1OT2A 5F1IB 4KMQA 5ANMB 1BM3L 1DLFL 1LO0L 2VB5A 2DBLH 1P1ZA 3BEVA 3GBML 4ZAKB 1A6UL 4J3VA 5EZJB 1T1YA 1U8HA 2VERN 3I50H 25C8H 2HMIC 4UDUA 3SQOL 1Q1JL 1CFSB 1NFIA 1UWXK 5DHVB 1YY8A 4NQDA 2ZUWA 1R3KB 3ES6A 1UB5B 3GSOA 5E6IC 4ZMAT 3BGAA 5DLMH 5D7JB 1G1CA 3W0WD 1QQDB 3QZWB 2CKBA 3KLSA 2WZPD 2X1PA 2XT1B 1SY6H 1Z9OA 3CU7A 4YUEL 3AU1A 3MRLA 5HHOB 1YA5A 3RGVB 4MQXC 1JWSA 1S7WB 3AU1B 4EUPA 3V8CA 3BRDA 3RHWF 1SBSH 1B88A 4OZHA 1P2CA 3C8KB 1UB5A 3ESUF 4G80A 1XEDA 3MYJA 4P2RA 4GW1B 1VFAA 4WVRA 4N8VG 3QIUB 3KPRB 1ZMYA 5E24E 1BECA 5FV1L 2VL5B 5HY9B 1V7NL 3OKMB 5DUBA 4D0BB 4M43H 5DVNA 2PW2A 3RL1B 3HI6L 5IP4A 4PJ9B 3L5JA 4CBPA 3VWKB 1RK1B 3GKZA 1HYRC 1IC7H 3QUYC 1YDPB 2YUVA 2ORBH 4CVXB 3PWNB 4G5ZL 3BW9A 3U6RA 1HZHH 1S9YB 4DKAA 5ABDE 1I3VA 2F19L 3FB7A 1QBML 3L6FB 3PDDA 2JK5A 2PKDA 3PL6A 1FCGA 5IGXH 2I07B 2IPTL 3VXUD 2X4RB 4MNHA 43CAB 2EH7L 5C0CD 1ZLVH 5ANME 1KLUA 2DOCA 2GUOA 2J5LC 5GRUH 4PRPD 3U83A 1YYML 5DVLA 2CDGA 5DWUL 4EDWH 4GBXB 4YQXH 4P23B 1C7SA 1QRKA 2CMRH 3UPRA 4GMTL 2A83A 4P5MA 2MJWA 1E4XI 5D8JL 5I8CA 1UXWA 1NKRA 1D5BA 3CAFA 3EO0B 4ZFGH 3D87B 3O2VL 1A6TA 2A6DA 4PJ8A 2VAAA 4HXAL 43CAA 2DQCH 4KUZH 2FGZA 4XAKD 5E99H 2X9YA 1QSVA 3MCKA 1R6VA 4TVPE 1AGFB 1A6PA 2JJSC 5HGHB 4EEEA 1TZGH 4J1UB 4B7IA 5BVJA 3A0OA 1LK2B 4O9HH 4WV1B 3TV3H 4HKXA 4JB9L 3VGGA 2HJFB 2R4RH 4Q9BA 1P69B 1C5BL 1TQBB 1UZ8B 2CIKB 3LN4B 4GRWF 4ORZC 1YQ2A 1X5IA 4PJCF 4MZ2A 4YBQC 5IFJB 3HRPA 1DBKL 4GJTB 5D1XA 2P5WA 4DK3A 2FJHA 3MV9D 3DWTA 1ES0B 4MQTB 2ZPKH 1INQB 1JE6A 1JP5A 3CVHB 5BOZG 1BQHB 2AKRA 4NQSA 3BX7C 4P5KB 4WUUA 4U3HA 5DSCA 2VABA 3N1QC 2D7QA 3Q6FA 4LCWD 1EFXA 3DI2B 1JWMB 3C8HA 2HTKC 1GOGA 4I3RL 4LPWA 2DQUL 3FONA 5DSCB 4LLWA 3VXSE 3V6OA 3S6CA 1CR9H 2M2DA 3ULVC 4DQOL 2IPUG 3FFDA 1TPXB 1S5IL 3WXVH 2A2QT 1OGTB 1W8OA 1Z5LA 4O4YH 4A6YA 1HHHA 1MFDL 5I74C 2DMKA 3MJ9A 1JFQH 3UYPA 5SWZA 4YPGA 1CT8B 3TCXA 3L7FA 2MQ3A 4EDWL 2W9LA 2F5AL 5IM7A 5TDNB 1T2QL 1DVFD 2VQUA 4TSBH 1OTUD 1RZ8A 3UCRA 2A6JA 2ORBL 3DRQA 4LCCA 2VXSH 1NAMB 5GS1B 3CPLA 1PAMA 5L2JA 5J11B 5H94B 1PW3A 1U95A 4XVJH 2VLRA 5IBUG 3TVMB 2CDFB 2WP3O 2X4OA 5DGQA 3FFCD 3FN9A 1J0YA 2LU3A 2NZ9D 5TDNA 3HMWL 1M4KA 1D6VL 2F8OA 5K9JH 1UZ8A 2CIKA 4GUPA 4GKNB 5C07D 4XC1H 2ERJB 1KJ2A 2A9NH 3FFCB 4HPOH 1UYWH 2V17H 4QOKE 4WDIB 1ULVA 5EBLB 1KCSH 3QPQD 2AJZB 3BGMA 1YYMH 4BSVA 4QRPB 3WFDL 1GGUA 4KMTH 5AWNH 2ZSVA 3T3MF 1ZHBA 3GRWA 1FAIL 4EN3C 1U42A 2EKSA 4LHUG 4LPUA 1UEMA 1QLRA 1EFXB 3SKNB 4F7MB 5K93A 5AAWA 4TULL 2BSTB 1G7HB 2R2HB 2X4UB 5CIPA 1B6UA 4Z5RA 5DQJB 3J8F7 3CGTA 4HK3J 3MV11 1XCTA 5E1AB 4J2XA 2E9JA 4TRPL 5KSUA 1UWEL 1MCBA 2NX5D 1S7SB 1U3HB 2O5XL 5I30H 3BZ4B 5E00A 4C58B 5E5MB 3AS1A 5HHPA 4HIHB 1OM3H 1MHHB 5D70L 1F6AB 4NJ9L 1RZ8B 4OAWB 4B5EA 5B8CC 2A74A 2X6MA 2XZQH 3SDDD 1KJMB 4JHAL 1BQSA 4OCNC 3PWUA 4HAGA 3U7AA 5E2UH 3ULUD 2DLFL 4HH8A 4EUPG 3MOAH 4JM4L 5HD8D 5JIIA 2K1MA 4B53A 2R56L 1C08A 4YXLL 1GH7A 2H9GB 2ADIB 4ODTH 5LJYH 1U8PB 4JVPA 5JW4M 3AB0C 4ZPTB 1SYSB 3O3DA 2Z93B 1XGYL 4S1DC 3F7VB 3VXQA 1DFBH 1ZEAL 1GC1L 3QUXB 4N5EC 1H3TA 4TPRH 4U31A 1B90A 4NP4H 2NY0B 4W4NA 1RSFA 6CGTA 3O6LH 4I18B 3PF2A 1QLRB 4U0RB 4WUKL 5TGBB 4PRDA 3DVIA 1WK0A 2ZUVA 3BI9X 2NZ9C 3QH3A 3QXTA 2ED7A 4I77H 4JO2L 4XCEB 5DJZA 2B1HH 3UBXI 5A3ID 2N1KA 1BBJA 3QEHB 4PTTA 2XZAH 3QXWA 3FFCA 3V8OA 5T1LB 3G5XA 5KVFL 5LCVH 5HY9A 1FSKC 5DC0A 2CIIB 5DD3L 1U8NA 4PJGB 1EHNA 3UTSB 3QUXD 4OGXL 3N9GL 2DM7A 2HKFL 1RZKC 3IDGB 5FM4A 1IAKB 1KXVC 3LSOA 2D31A 4YHNA 1QFWM 3SKMB 1PFCA 3HKFA 3HAEA 4ODVH 1K8IA 1ZWIB 3QZWG 3QEGL 1NFDF 4Y1AD 1JYVA 1NC4B 1DBBL 1LO5A 4KJYB 5EFIB 3VGEA 1DE4B 1NPUA 3HZYB 2CGRH 5L9DL 2FX8L 2NW3B 3TT3H 5HHMB 2A6IB 1QSEB 5IFHH 1H3VA 4CNIB 2C1PB 4QEGA 1NDGB 1AP2B 5I30L 5DJDA 4EOWH 2HRLA 3JV4B 4NN6C 4Y1AB 3FTGB 3BHBB 1CBVH 3HC4L 4MCYB 3CLEH 5INDA 1NGYA 5IFAH 4WWID 3KYKL 2Q6WA 4YLQT 4GLRH 3Q6GL 5F89A 1KIUA 1F3RB 1IGFL 2Q86A 4J3OC 4XWOC 3S3PA 5D71H 3FQTA 4HQQH 5D1XC 1OGAA 2IMNA 3OJDA 3S9DB 4HWEH 1T7WA 3CSYB 4IRJC 3VFPA 5I1AB 3ETBF 4NKOB 4WUUE 2HJLA 1N5AA 1PKQE 1JGDA 4JPKH 2IGFH 4YJZL 5HYQB 3RVXC 4AEEA 1EDQA 2P8MA 2ARJQ 5TPWH 4P4KA 3U1SL 4IMKA 3FO1B 5FK9B 3VI3F 2BCKA 4OZGB 3F7PC 5B39B 1NBZA 5HYQA 4LDLB 4P2RB 3C09C 5JMRA 3BWAB 2OL3L 4LEXH 3BEWA 2CK0L 3GKWL 1NCUA 1UG9A 5E2JA 5D7JA 4RA0C 4OI7A 4TSCH 1YNLL 1J1OL 5AD0A 5KTEL 3GSUB 4OCRH 1A6AB 3B5GA 3MLZL 4M61B 5LKNA 4CW1A 2BHZA 4JFHE 4J3UA 4LCUB 2WLZA 1Q94A 1X9QA 4ZNEA 3VMOA 4OB5L 3F8UB 1CGXA 5B38B 5HHME 4I77L 1FRGH 4LAJH 1M71B 3WFBL 4Y4HB 1OTTD 3VXRA 3LS4H 1JGEB 5IOPA 4AMKL 4FFWD 4H88L 3AY4A 4OZHF 3S37X 1DR9A 1DQDH 1JPSL 5I1HL 5HPMB 1BFSA 4PJAE 5D71L 3TWCH 1DL7L 4ZFFB 2QSTA 4PJCB 4GAGH 1D5XB 1ZSDB 1MJ8L 4HC1H 3O3BA 1N0XL 5CGTA 1KIPB 5IV2A 4JGUA 2V2WA 4G8EB 2J8UA 3KR3L 4EXKA 3RU8H 5JR1L 4QRRB 1JHTA 1KFAL 1ZGLB 5FHBL 1KNOA 1ZT7A 5DT1H 4LGSB 2DRUA 4H26A 1QKZL 5FCUL 2DQHH 4G42B 3VFTA 4L3CB 4Y1AA 1J1XH 5F1NA 1I8IA 5C08E 1T66C 2WQRA 4J4PC 4HWZA 1I7ZB 5FDWB 4L5FL 2JLLA 4LL9A 2JCCE 4BZ2L 2X44D 5GS0D 4LCYB 4DKFL 1Q9LA 1R24A 2YMXH 3B5HA 4RSVA 1EPFA 5C3LD 1VB9A 4Z78B 3CDYA 4PJBF 4IDJH 3CFEA 1B3JA 3VFNB 5ESQA 4DKDC 3EOYG 1BWWA 2QV2A 4MA3A 4Y5YC 2H2SD 2CRZA 3Q5TA 4JZNB 5C0GB 2Y72A 5FV2A 2YD5A 3ARYA 4FTVE 3QRGH 1XCQA 4HUVB 1C1EH 2QQNL 2XTJE 4UINL 4HT1L 4HUXB 5H8DA 4N90D 5F9WB 4PJ5B 5D9SB 3PL6D 2IFFL 2XN9E 3RWIB 5JDSB 4PJFA 3V6BR 1YNTB 3CFJA 2UUDH 1E6JL 12E8L 5JOPE 5GSRA 2EE2A 3MQIA 4NWTH 3EJZD 2QQLH 3I02A 3MNZA 3P4LA 1RIUH 4R0LA 1MHEA 4S0TD 4XNQA 4N0RA 3P11H 1JUFA 1YEFH 3DRQB 2JIXD 1BHGA 3AAZB 4XHJD 2BJMH 4DAGL 3U4EA 2JF1A 4XXCC 5LBSH 4CN6A 5I17A 3LMJH 2VKXA 4HUUB 4JRYA 5CJ5A 5D5MF 1IL1A 1U8PA 1FZMB 4Y19E 3WFDH 3BW9B 4GKZB 4UT7H 4L8BB 4DZ8B 5DJAA 1YUHB 1P9MC 4IRJA 3NIGF 2HT3C 3T2QA 5SX4H 2GTZA 4HKJB 3ZTNL 3AREC 3SJVE 5LQBL 1I1AB 3QDJB 3D3VA 4MMZC 4W81A 3E6HB 2O5ZH 5DHVH 3C5ZB 2EDTA 5MENB 3OZ9H 1TJGH 3ULVE 4HXBL 5CILL 1TENA 1CDUA 1WWAX 3M17A 5FYLL 1IEHA 4QRPA 2F53B 1BQUA 2VLLA 2R0LH 2GJ6A 2E6PA 2PN5A 4L8DB 3RVXD 4OLUH 2OR7A 2O93L 3EOTL 4X6CF 1KBGL 2NY4D 3FO0H 2OMNA 3TFKC 1ZHNA 3KYMA 3VFVB 2XWTB 5EBMB 4EIZC 4OLYH 1P7HL 3VD5A 1OP9A 2NX5A 4J3WA 3FCTB 3GJFH 1IQDB 2FDBP 5GGTH 5IG7A 5E1AA 3OKLA 2XTJD 4HJGB 5DVMA 3GGWB 1S7XA 4J3TA 2PTTA 5D1ZC 2FL5B 1MF2H 1U58A 3ZE2E 5KSUB 3E3QE 4JHAH 4LLMB 2XN9B 5EIQA 3NCEB 4HMEA 5EIVA 3WFCL 3KNBB 3TWCL 3CFIC 2QKIA 3MC0A 3T4AA 5D7JC 5IHLB 5IBLC 3FCTA 4WENB 2ZOLA 3V4VL 1GOHA 5DJ6A 5T1KB 5IJKA 2PYEB 2W9EL 3I02B 5IGXL 2P47B 5C08B 1NC4D 1N6QL 1ETZB 5JXED 2EDRA 1NUNB 2OL3A 1V5JA 2AJUL 4XP5H 4OGYH 4KQ4H 1CF8L 5C0ND 1LVEA 1ETZA 5KS9E 3HG1D 4O2EA 4Y5VB 1M6OB 1KTLA 1F13A 1NSNH 1SVCP 1FZMA 1GGCL 1W0WB 2JB5H 3EOAA 2VDNL 4JRXB 4PGDA 4KRMB 4L3AA 2AEQH 2GTZB 3T2NH 3WJJA 3MRHB 4GKNA 2DQIL 3W9EB 3VD4A 4BFIB 2OTUB 4L3EE 2IBZY 5GGRY 4KUZL 1Q9OB 2YZ1A 1ND0A 2Y1VA 1OW0C 4HS3A 4NKOA 2QTEA 2Q76A 4G7YH 5GGRA 5BZWA 1CICA 4WY7L 5E5RB 3B43A 4PJHB 2IJ0C 1UH2A 2H9GA 1BVKB 4Q0XH 5D2LE 3D2UB 2AK4D 4KK8C 5IVOA 2XTLA 4JREC 3ILPA 2UYLA 4Z7NE 1AY1L 1I8MB 2LTQB 1K5NA 2BSSB 2HKFH 4BZ1H 2BXYA 2D03L 1EEYB 1OHQA 3GDBA 4ZNCD 1EBPA 1HDMA 3C5ZA 1SJVA 2VXVL 5E08L 1PG7L 5GRUL 4I3RH 1RHHB 5JOFB 5AD0B 4OIIL 2P8LA 2C1OA 4NJAL 3MRJB 3LHPL 1NDMB 2Y7QB 1MRDH 5E1HB 1BJMA 3FONB 1YEKH 4G6KH 3LB6D 5DJ8A 1TETH 3OGCB 4NO5A 3NCJH 2FLBT 3QUZC 5F70A 4BQ9A 4H1LB 2APXA 4UNVA 1LP9B 5M7QA 2OP4H 4QHLB 2ZG3A 5EORH 3QPXL 3SDXB 1KEGL 5I73B 2R4RL 4P5KA 1WITA 4LSVH 5ESVB 1FIGL 1F4YL 4WU5A 3ZL4H 4U1SA 1QBLL 3EO9H 4X6CB 1OD9A 5CGYC 2YD9A 4PRHD 4LKCA 3IRZA 1N4XH 4M03A 1MFCL 5I19L 2BVYA 3ARUA 1NGQH 3FKUS 1I85C 3U7WH 1RJZB 4TVSa 4NRZA 3WIHH 5IV2B 4FQPA 1PQZA 3WFCH 4YDJB 3BN9C 3W2DH 4NO0D 3EYFA 4LFHD 4OD2B 1MCOL 1QSFE 3OKOA 3DGGB 3VDAA 2OQJB 3SKJH 3MRRB 3BVNB 1A7RL 4LF3A 3VE0B 5GGQL 4P4RB 3MGTA 5IMOA 3KS0H 3FHQA 3IFNL 2YWZA 4PYGA 5DR5L 3ZYOA 2YUZA 3EYQD 3KYOB 3QNZB 4NIKB 3QXDB 3TA3B 3IETA 5JHLL 2L0DA 4NZTH 5DFVD 1BQLH 4YHMH 3HI1B 4I3GA 3EKCA 5HYEA 4MD4B 1INDH 2V5MA 3DHMA 1MCRA 4FZ8L 4XMLH 4LSPH 1QHPA 2CKBB 4MNQD 4Y4FB 1JNNH 1RFDH 3DTXA 1H15B 2NXYB 3JWDL 4M48L 5GGSB 1EHXA 2UVEA 3ROLA 1NC2D 2NXYC 4XVUD 1YZZA 4ZUVA 4APQD 2MNUA 4X9HA 3RA7H 1UWGH 4DGYL 1XF3B 2FB4H 4PJIF 3MRCB 2BNQA 5BO1H 1I85A 2DQJH 1FE8H 4OGZA 2Q87A 4S0SD 3MGOB 1T5WB 3UTTB 4E5XB 5TGBA 2AXJA 2DQGL 3REWB 3AVEA 3SQOH 4HG4J 1FH5H 5JOEA 5ID1A 4DTGL 4NKDB 2R1YA 5BRZD 1V3MA 3MA9H 3R0MA 1T4KB 1IAIM 2VDKH 2VLJA 5ICYA 5FAAA 1CLYL 5E9DA 3MZGB 1ODAA 4ELMB 4PY8J 3T0EE 1T21B 2IWGA 4LHQB 5CBAB 3I9GL 3EZ8A 5BRZB 3ALWA 3TNMB 1KN4H 4WEMB 3S37H 2B5IB 1DN0B 4JFDD 3WS6C 1FZOB 1T03L 5GRXG 5DR5H 4M8QB 1WWBX 1ZWIA 1FNLA 2JJVA 3IDXH 1ZGLP 4FQCL 1F42A 1JTOA 5DUPL 4HFUH 4W4OC 1YEEL 4LNRA 2EDFA 2GEEA 4Q9RH 4NOBA 2A6IA 3BESR 1TNMA 4NRZB 4HIJB 4UNTA 4XAWH 2AJYL 4GLRI 4OGXH 3WJJC 1KG0B 2LV4A 2DQFA 4NNYA 5EWIL 3RI5F 2J6EA 4O2CA 3LKSB 4QTIL 1R3JA 4JLRB 4XX1G 1S9VB 1TVHB 4X7TA 4OCYH 4NQCB 2VLME 2YMXL 2H8PB 4Z0XB 5EO9A 1B0WA 5ENWB 2VDPH 2R56H 3VFGL 4FFZL 4AZ8A 3MUGB 5ISZB 3ZYIA 2GY7B 1NUDA 3D0VA 4MZ3A 4U7KA 2XZQL 3WO3B 2B0SH 5FYKE 5D4QA 4LBEB 3QPXH 2YZ8A 4JFXB 1MCEA 4LLQA 4X80L 4QCIA 4EXPX 1RZFH 4OQTL 3L7FB 5C0DA 3C60C 4G8GE 1CGSH 1M05B 2QQLL 3OKEA 3O6LL 4PLJC 1T1XA 3C9NB 1TCRB 3H6JA 4HHAA 5SX5K 5HYJE 2ARWA 3FQUB 1DANT 4ZOAA 1INDL 1A21A 1DBMH 2JIXA 4NQCD 4YDLB 4XVSL 5C2BH 3BO8A 3IF1A 4MA1B 4XCEA 1I1CA 5JW5B 4W4OA 1KULA 5DMIL 3GBLA 4HFWA 3T0WA 3P3YA 3WNKA 5LGHH 3BP7A 3X11B 3IAGC 5E70A 4JFPB 4JO4H 5GS2D 1AGBB 3C60A 1GL4B 2QQKH 1WVZA 1HH6A 1IAKA 1IAIH 1JF5A 5IBTL 1R0AH 4PP2A 3DGCR 1VEMA 3DXAB 1QFHA 1CD0A 4XI5D 4XZUB 3W0WB 3GMRB 1MAMH 4M7JH 5E4EC 2OJZH 2C4FT 1JNNL 5DZLA 5DURB 2ADJB 3BIKB 2BNRD 5HGAB 5BVJB 1F4XH 4J4PD 3O9WD 3WKML 3MCKB 4UV7L 2YPVL 4CMMA 1CLYH 4PP1D 3P9LB 5DMJB 5AUMA 2F53A 3SGJA 4GXVH 2A6DB 3PL6C 4Y7MA 3NCYS 1YEDA 4L8CA 4ZYKA 1T2QH 2B1AL 3O9WB 1CTOA 2D7NA 3EYSH 5D5MB 3VGFA 4WW2B 1ZT7B 1U2CA 5HDBF 3RWFB 4DGIH 4X8JA 1NFDB 1N6VA 4EQ2A 2HTLD 1VACB 4X0KB 2FEEL 3NPSC 1QACA 2KBGA 2H6PA 3E8UL 4NUJA 3VXTB 4FQ2L 6FABH 3OGCA 4NO5B 5C6WH 3KDMB 2DLGA 4XBGB 2GKIA 4R0LC 1BLNB 4L4TE 3PGDA 1T89C 5T1KA 2DLHA 1Q0YL 2XWJB 5L0QC 1OWRM 2E9BA 4LLMA 2J88H 3W11C 3C08L 4JZOA 4Q9QH 3GBMH 4M1DL 4O9HL 1OLZA 5I1IL 2ZCHL 1RUQL 4BSJA 2XFXB 4TSBL 4FQXB 3M8OL 2F54D 3W5NA 2DM2A 2X1OA 1QO3B 3SDYL 3D9AL 4XB7A 5I1KL 1EIBA 3VD7A 4OLZH 2WK2A 4PJCE 1Q9OA 1FNSL 3F62A 2EDDA 4JO3L 1J10A 5I1DA 1X5YA 2HH0H 3NPZB 3STBA 1LDPH 3OAUH 4LRNL 3KVQA 4PLJD 4CUCA 2I07A 4MXQD 3L5XL 1AY1H 4B0MM 2VDOL 3BUTA 4XGZB 4WW2A 3U4EB 5I17B 1ERNA 4N90E 3TESA 1AE6L 2YPLE 1J0KA 2A1WL 4G8EA 5GRWA 1CG9B 5EPMA 3E8UH 1CVRA 3S8WA 1LP9F 4D9QD 4NZDA 5KVDL 1UENA 4LSUL 5TQ0L 5AUMB 1EO7A 3CSGA 2E5EA 2V2TA 3V9FA 1PD6A 1XF3A 3DARA 5KG9B 3DJ9A 3R4DA 2QKIB 2X4PB 4OZHB 3VXNA 4JDZA 5A2LH 4ODTL 4MA8H 4PB0H 3TA3C 5H35A 1E6OH 4HT1H 4WTWA 1OAYL 4YPJA 3NCCB 3BXNB 4XPGL 1M7DB 3MLVL 1AD0B 4I4WA 4P46A 4ODHH 1FGNL 2ZUQC 3TH4T 3VFNA 1D5IL 3U46A 4MJ6B 4FRWA 4PJ5E 4MHHI 5J06A 5FM8A 1K8IB 3TP4A 1HE7A 1JZ8A 1TVBA 3IS1X 5MERB 1XCQB 4HUVA 1EUTA 4IRSA 2X41A 5CSGA 1T1ZA 1YEFL 1X4YA 4NUGH 4ZXBB 3MV01 2BY2A 2DQJL 4JRXD 4DAGH 5IW6A 1K2DB 2ATPB 1EA9C 3IDJB 3L5WA 3WN5C 5D7LB 4F7PB 3PGFL 1VGEH 1V7MH 3T8XA 3TPKA 4V1DD 5MI0C 2W9DH 5GGTL 2NLJA 1FFPB 2VWEC 4U1LB 1CGYA 3ARVA 3NA9L 3LEYH 1DEDA 2G9HA 2YD1A 3QDGA 1I4FA 3I3EA 4AJ0A 4D3CL 4ETQA 3QDMA 5FO8B 4PJXA 5JORA 4JFEA 3SDCD 2EICA 5T5NF 4WTXA 3GMMB 3ZKMD 1MQ8A 4XNYL 4P46C 3LZFL 3BE1H 3F7VA 5I0DA 4G8FA 1RK0A 4JQXA 4G6JL 3NCBB 2QQNH 4ONHB 3MNVA 1VFMA 4KXZH 3RNKA 3TVMA 1T0MB 1IMHC 3WIIL 1HKLL 4TUJA 4U05A 3REVB 3CXHJ 3G04A 4JO1L 3DURB 3OAUL 5FOBB 4H0IA 4W6XB 3WFHA 5I1LB 4XH2A 2PO6B 4RRPA 1N59B 3OX8B 2KKQA 5CEYB 3P0VH 1VA9A 1D9KA 3HNSL 3FO0L 4YHIB 2FJGA 5ALBL 1TTUA 1CU4H 1NQBA 4U0QB 4ALAL 5EOQH 4XP1H 5GPRA 1PSKH 2QR0B 2HFFB 1U8QA 4G6MH 4Y2DD 4U3CA 1TZHA 1U91B 3ILQD 1PYWB 2DQEL 1HXMB 1AD0A 1E28B 1YPZE 3CDFA 1QD0A 4UB0H 5CEZE 4HMDA 2DTMH 5CSBA 3ZE0F 2Y9RT 4GMSL 1RZIB 3SE9H 3BVNA 1AJ7L 1KJ2H 4KJQD 4OUUA 1D9KC 2CLZA 4M7ZC 4OZGA 4HKZA 1WAAA 2XZZA 1JHTB 3C2AL 3X14A 2I25N 2UV3A 4L29B 4M1GL 1NCNA 4CDHA 1DDHB 3GNMH 2OXHA 3QPQC 1N5YL 3UMTA 3VRIB 3ULUF 5IW6B 2BHUA 5E6YA 3HR5A 2IQ9L 2X9WA 2R0WL 3O8XB 1SYSA 3O3DB 3RX8A 1G6RH 1CQKA 4XBPB 2VLJD 4NO2A 3DSFH 5DRZA 2VE6A 1IT9H 2Z31D 1AGDA 1BJ1J 3MRFB 3AC0A 2VR9A 1NFDE 5EO0B 2ATKA 5IT2H 2ADIA 2Z91A 3TA3A 1N59A 3OAYK 1G9NH 4ZPVA 4YHLL 1DVFC 2ICWA 3LRSA 2VDNH 2Z92B 1FN4B 4GSDL 5HYFA 5JQ6L 4I48A 5GQBA 1KCRL 1UCBH 3S88L 1NH6A 4M61A 5J11C 4QT5A 2BNQD 4H88H 2R1YB 1IGMH 4MCZA 32C2B 5T3ZL 1KJVA 2EO9A 4DN4L 2UVFA 4JN1L 1SEQH 1IGIH 3BYTA 1A2YB 2RIKA 1MELA 5C0IB 4OZIA 2KDGA 5MENE 3MGAA 4TNVF 2B7DT 4RWHA 3RVWC 4PLKC 4U6TA 2QSCH 3VXPB 4YDKL 4HPYL 4JCLA 4TUOB 4JO4L 5LGKA 4MX7A 3S98A 4ELMA 5B3JE 5DHYA 1CLOL 5F7LB 2WNGA 4I8DA 4NHCH 3BRGC 3S4SA 3G5XB 4U7MA 3QQ4A 5D1QB 4G8GD 1T6VN 2ZUTA 3DMMB 4YZFE 2Z35B 1LO3H 1G7PB 2GFBB 2IG2L 1JF1B 3BKYL 5E95B 3RY5A 1CD1A 2V2XB 1TDQA 1KXTB 3VH8B 3WN5B 3T4YB 1NAMH 4ZG1A 3MRBB 3RDTC 1ZHLB 3BN3B 3WD5L 3MRMB 1AIFA 3CVIL 4MGXA 4U1NA 1Q0YH 3ARZA 3FB8B 2LAGB 1TVHA 5E7FA 4U3XA 4H26B 2P5EA 1X3DA 4G6FB 2Q6WB 3N1GC 4KK6D 2Y36L 5FCSH 3V5KA 2V2WB 3BZFB 3QIWA 1KPRA 2C3HA 3QIBA 5IQ9A 4PJ7B 5DD3H 3QJHA 3CZJA 4YDVA 4X99A 3BOVA 2ICES 5CZVL 3M1BA 3VXMD 5IMKA 3NZHH 1XF5B 1WFTA 4TPRL 4TSAL 3DX8B 2FATL 5I8KL 1V3LA 1WWWX 4O58L 4QNPF 3S3JA 4DVRL 5BS0B 2PF6A 2COQA 4AL8L 3TNNA 1IGCL 1MCOH 4YK4B 1Z0NA 2GJZA 3MR9B 5D70H 4CMHB 5SV3A 5IWLC 1BIHA 2YD4A 3QFJB 4JFYA 1EX0A 3HUJF 3BIAX 3OJVC 3U7WL 4R7NB 2MSPA 4D8PA 3VI4E 3FQNA 1HILA 4JFYB 3G6DH 4NFDA 2HT2D 3NN8A 4P4KC 5AZEL 3KS0J 5E2WH 1MOEA 2A6KA 4X6CE 3ZDXE 1VERA 3D39B 4LOUC 4LGRB 4Z7VB 3D85A 3TN0D 2WINB 3NIFF 5I75C 1RIVL 4ZDHA 3BP7B 1AI1H 1NCBL 1JWUB 4KK9D 5JQ6H 2OI9B 4NC2B 4FQHB 1ZEAH 2A0LD 2DD8L 2IC2A 5I18H 3QEGH 3MBED 1UJ3C 3S5LA 1PZ5B 4FFYH 1M05A 1LQSR 5CINL 5F9AC 5HHOD 3KPQB 4PJEA 2XI9A 2AXFA 2QADD 5SWQA 5IEKB 5K9OB 5CEZD 3DLQR 4UOW0 1P84J 1OB1A 5HHQB 4I9WE 1WC7A 1NCTA 4R7DB 3CX5K 1YMMA 1PGRB 3HG1E 3WIFA 4XZUA 1MHEB 1TQCB 3QCVL 3BDYL 5EOTA 2W92A 1S5HB 3QUZD 5L2KA 2XQYG 1OP3K 1KCKA 3D69A 2XWBB 1LGVA 4ZSOB 3P0YH 5IMMB 2VSCA 1SJHA 3DXAD 2EIDA 5F9OH 1HH6B 1F4AA 3L1OH 1RIUL 3PWJB 3H8NA 4WNQA 1YMHB 4S1SH 4Z7WE 5HJ3B 4L9LC 3O6FD 4WV1A 3UPCA 5EZJA 3Q6GH 3WKNA 4WNQB 3MA7A 4JKKA 3FB6A 5KSBF 2BSSA 2ADGA 3C09B 4O51A 5EC1B 2YSSB 5KSAD 3ZYJA 3KYNB 4LHJB 4F2MA 5B4MC 1T80A 3G5YB 1PBYA 4HBCH 1U3HA 1VADB 1BAFH 3B6SB 1EEUA 4PG9A 4NUJB 2D9QB 4PV9A 4A6YB 4U1SB 1ZS8A 1NL0H 3KYAA 4WI3A 3EDDA 3QIBD 4DFIA 2ZOKA 4Z5RB 4C4KT 4Q9RL 3M45A 2P8PA 4I0PA 1I3GH 2MPAL 5IESH 1I8LC 4BFBD 1MWAA 1DVFB 5EO1A 2VL5A 2VUYA 4YFLI 5GGSY 5K9JL 1PYWA 4KI5D 4O2EB 1RK1A 2ZCKH 5DO2D 5J1AA 5CLWA 4RAUB 2OMBA 3L5WB 3T1WA 1OP5K 4HLJA 4XTRD 3D6GA 4GKSB 3P4OB 3QDMD 4NSKB 2YN5A 4OCWL 2F54A 1XZ0A 3MLVH 2WM0A 2AAVA 1AKJB 5D7LD 5J56B 1HQRB 3HZVA 4OQTH 5MEOA 3NGBB 1RZFL 1P84K 2BOCA 3ARGB 4Y16C 2VLKA 5ESAA 3MBEC 3W39B 2ZJSL 4HSQA 3W0WE 1XF4A 1JFQL 1QKZH 5BZWB 4HGMA 3VMPA 1NAMA 5GS1A 3QXDA 3QXAA 1QSZA 3UYOD 4XP4L 1I7ZA 4HWZB 2GJ6D 2YXMA 5JOPD 3MRFA 3IFLL 2BFVH 2DYPD 4WI6A 2VXTL 1UH4A 4LCYA 1J8HB 4LASH 2X4PA 1Q9KB 3G6JB 3O6MH 1RZ7H 2P46B 1VFUA 3GMMA 3WHE1 4OKVA 6FABL 2J4WL 5HGDB 4WHYH 1L0YA 4G9FA 2BVPB 3FOLA 1T0PB 4S1RL 2OXGA 2ADFH 3QDJD 2GK2A 1C16B 5C3TA 3RNQA 4FFYL 3F6IA 4PGCA 4XRCA 4Q6IA 2YA2A 1F3JB 2QHRH 2NXZC 1QSFB 4NKMA 4XXDB 2AEQL 3CX2A 2EECA 5DQJA 4QHNA 2A9MH 1QFUH 5LAXA 2AEPL 3PG2A 1E4JA 4QHLA 4P5TB 2NY4B 3L3OA 2X4UA 5C07B 2X42A 2HFGH 3UP1A 1JZ4A 4MX7B 3RWGB 4K23H 1EEQA 4Q6IB 4WIQA 2XTJB 1G9MC 3K2UL 3BP4A 3T8XB 4H20H 1N4XL 4JZJA 4KTYA 4QHUB 3ZDZE 4MQ7A 2BNRE 5D2NB 4MNGB 1Q1JH 3SO5A 3EFFB 2HLAB 2LE9A 2GJJA 4IDJL 4RZCB 3MZTA 1HHJB 2AK4B 4JKWA 5T1LD 4MQ7B 5JNYB 4YDJA 3SCMA 2YD6A 4KROD 3MGTB 5IMOB 2Y5TB 3JVGA 1HHJA 5TDOB 5D7SH 3GMQB 4U1JA 3U9PH 4CVZB 1FVEB 4LSTH 1FLRL 2ZNWA 1FYTA 3PWLB 4F37K 5EUOA 3O8XD 1AGDB 4I0CC 3AROA 3K8MA 2HRPL 2BOCB 3ARGA 3FMGL 1JZ7A 3N85L 3D9AH 3C08H 4ZODA 1FP5A 1JGDB 3UO1H 4PGZA 4OGAC 5AG9A 3QG6B 1ADQA 3OQ3B 4NPYA 1DUZA 1G6VK 2W9EH 3FOLB 1VFBB 3QDJE 4K9EL 3GJEA 3SKJL 1EH9A 3VD9A 4PJDB 2J1KA 3JUZA 4YWGL 4Y89A 3RUGE 1HNFA 5D72H 4OT1L 1J8HA 2EEDA 4QRUB 4MWFB 3PP3H 4L3ED 4FG6D 5HBBA 5ICXA 5F96L 1BZ9A 2C1PA 4OD3L 2IQAB 3UYRL 3VG0L 5F6IB 4ZO9A 4KJYA 3JTSB 2OYPA 4OCYL 2GITB 1GVIA 2DIBA 4LIQE 1AXIB 2C9AA 2PYEA 3MV9A 1T83A 4N9GA 1JGLL 3HAEB 5C0BD 3VJ6B 4PRHA 5FKPB 1B4JL 2ICWJ 3P30L 1D5ZB 4L4VB 4QXTB 3DV4B 4JVWA 1FC1A 4AT6B 5AEAA 3PGCA 3WV0A 1XIWD 3PQYD 3SKMA 3ARFA 2DI9A 4JQIL 5I9QC 1KYOJ 3DYOA 1NSNL 5EOTB 4HCRA 2A77H 4OCSH 2P49B 2YD7A 3D48R 4NFBA 5IIEB 3UZVB 3CDGA 4KWUA 2Z8SA 4XP5L 4F8TA 1W72H 1YEJH 4IMKC 5E8OB 4EVNB 4YNYB 1U93B 4YDVB 1NKOA 5F7KC 2YBRB 1QR1B 1BD2A 3O3AB 4HQQL 4CGTA 3FT4A 2P5EB 1CDHA 3UC0H 3WSQH 4UBDC 4LU5H 4OCXL 5DS8B 5CJ8A 2VC2L 1A4KA 2FEDD 5D5MA 4KHTH 1OF2A 4TOYH 3R1GH 4HIIA 3D39A 1FO0A 1N8ZA 3HLAA 1FNEA 5MI0B 4PP1C 1YEEH 3OF6D 4U1GB 5HVGB 1LK3H 5DD6B 2JB5L 2W9DL 4UT6H 2QSVA 4OM0L 5D7KE 2FR4B 4FXKB 3MV8A 4IRZL 3ZKSD 5E8PB 1NEUA 5F7EH 3TJEH 3W2DL 5CSZA 4OTXL 4YUEH 3GMRA 4JREB 1T1WB 2ESVE 3U30C 3CFCL 2CIIA 1ZSDA 3EGSA 3V6OC 5TQ2L 4FZEH 5JA8B 4GG8B 5JUEL 5DMIH 4HBQA 4IMLA 1JZ6A 1EEZB 4BZ2H 3SE3C 3W9DB 2DIJA 3G6AB 3DXAA 5E94A 1ZANL 3EO0A 2FJGB 3D3VB 2A9NL 1D6EA 2PETA 4ZOCA 1A14H 4OF8A 1H8OA 4N0UA 1H9VA 2BDNH 3AM8C 3VXMA 2YUWA 2F15A 3U0WL 2R39A 3E2HC 3MJ6A 4TUOA 5FF6B 1A7PL 4P2OC 3IDYC 1IL1B 1YEKL 3S34H 4WHDA 5IK3B 4OI8A 3S4SB 3MOQA 5T5NG 3HR5B 3B9AA 4UINH 4L4TB 1MI5E 3MRIB 3DYPA 5C0AE 2AQ2A 2LU7A 1BEYH 4W70A 4X8XA 4PB9L 4NZTL 1DQDL 2IFFH 3KYNA 1A9EA 1CD1B 2V2XA 1JIBA 4XGZA 5EORL 5CD5C 1A8JH 4X4ME 5IB4A 3JWOH 1BJ1H 1WZMA 1JNJA 4KPHH 3O11A 3KPRE 1MUJA 4OD3H 1E4WL 5GGQH 4FQQB 1BQHA 2AKRB 5FYKL 5ISZA 4BH7B 3EDJA 3V4UL 4G6AC 5ENWA 1A7QH 4DKFH 4FABL 5CFHA 5FHAH 5MEPA 1H8SA 4I48B 2BRRL 4XVTH 3U7YL 2WBJB 2CKNA 3LRGA 2YC1B 4MA3B 2ILLA 2WBJC 4PRBA 4FQXC 1CXLA 1UWGL 1OPGL 2VQ1A 4NO2B 4JN1H 5I1JH 3VMNA 3HZMB 4NQCA 5F93C 5HHOA 4APQA 1AR2A 3EGSB 2VXQH 2HKHL 5C2UB 4MJIA 3KR3H 1CT8A 4P2YA 3F58L 1J0JA 3PV7A 4K07A 1OAUL 3CCHB 3MV7E 4KQ3H 5MERA 2VH5H 3DUUA 4XCYA 3QWRD 4KI5F 4TTGA 3FZUC 1PY4A 2X5PA 4MCZB 4RRPG 2YPLB 3PV6A 1Z5LB 4X9IA 3EOBB 1IC1A 3T3PE 1A6TB 1T1XB 1NLDH 5T3XL 1DQTA 1UXSB 1GGBL 4P2OB 4QHKI 2E7LA 4GKZA 4P23C 4AK1A 5IHZB 3SDAD 5DEFB 3S3SA 4APQC 3VFTB 3PE9A 5KSBA 1UVQA 4TQEL 2XV6B 2XY1A 2GSIA 1P6AB 4CL7A 1U3JA 3G5VB 5EG6C 1T04A 3CSPA 5C0JB 1KIPA 2Y4SA 1D3CA 3VFUB 3QQ4B 4S1DD 1K3IA 2OLDA 1IQWH 1D5XA 4X83A 5I1GL 1MREL 3SDDB 2BVQA 3TZVC 4JM2C 5IVZA 2VIRB 4WCYL 5DWUH 1Y0LA 5C1MB 2EEBA 3GGWA 3LQMA 2X40A 1XGQA 3KXFA 5F7WC 1MCSA 4QXWA 3P9LA 4XI5C 5TH2B 1DQQB 4YHIA 2J4WH 3FT3A 5M95B 3BP5B 5T3ZH 2VAAB 4KV5F 5INCB 3MLRL 3PHOB 2ICWI 5CEZH 1F02I 1J05B 4KQ4L 3LS5H 1AFVL 1EHLL 4PJ7A 4JFFE 5E4EB 3GI9H 1MCCA 1TPXC 2VXQL 1DQMH 5FGCE 3VXUB 1FZJB 4AH2A 1HHGB 2QHRL 3G6JA 1XR8B 4IRSB 5E8EB 2BZDA 1LEGA 2BK8A 4ENED 1G1YA 2H26B 4QRPD 5ECJE 4WI7A 2C3GA 3C2SA 4NQTA 4OZFH 5D1QC 3TV3L 4NT6A 2X05A 4LASL 2UUDK 1NCDH 1JHLH 1JJUA 1RJZA 4NC1C 4PRPA 2G60H 2AXGB 1C5CH 2WBJA 5ACZB 43C9A 1CL7L 2Q1EA 3BD5A 2NY5L 5I8KH 4U1LA 3SE8H 4ZS6C 4L29A 1O7SA 4TVPH 5CJOL 3BH8A 2FCBA 1OSZB 3ZE1F 2VR4A 1DEEA 1Q72H 5BZDB 5K9QG 1XZ0B 4KHXL 4XNYH 5F7FA 2YD3A 1ZLWH 1QVOA 3V0WH 3RUGF 3FFDB 3K46A 1A9BA 3ARGD 5T3XE 1UJ3B 4WJ5A 2VMFA 4RMVA 4MYWB 1FGVL 5JTWA 3N50A 4UDTA 5EIIB 4GQ9H 1X5JA 4WHTA 4RMQA 1S7RB 5E2TH 1YECH 5E8OA 5A2FA 3QDMB 4ODWB 5JXEA 5D7JD 3C60D 1YEHH 1QG3A 3RVVD 1MI5A 4KI1A 2AEWA 5DRNA 2HRPH 1AXTL 3T0EB 4ZPVB 2DQIH 4I18A 2NR6C 1S78D 1VPOH 3AM8A 4CU7A 2EE6A 4DKEL 1UACH 1FAIH 1A1OA 1I8KB 2A73B 4F7TA 3S35X 5DA0B 3VXQB 2VLKB 5DUMH 4HBCL 1AXSB 5F6HI 3DV6B 1RJLB 3GSQA 1A4JA 4OBRA 5F6IC 2CH8A 2R2EB 5MHSD 2VZ3A 5E7BA 4WDIA 4JKPL 2E27H 5EU4B 4ZFOA 3O2DL 3G04B 5C0FA 3GSWA 4J1UA 4Z9KB 3CXDL 1S7UB 5LAXB 3QCVH 1J1XL 5FOBA 2XIDA 1YMHA 3CMOH 4L8DA 1I7UA 4N8CH 3HMWH 2B5IC 5E6IA 2EC9U 1DQQA 3L7EB 1GC1H 2X1QA 2J6EH 1AXSA 3BPNC 1R3LA 1MQKL 2ESVA 2R8SL 2G5BB 5TE4L 1QLFA 2C3WA 5T5FH 4LKCB 1PEWA 3MCG1 4KAQH 2VZSA 1CFVH 2FWOA 3BE1L 3HMXA 4RGOL 4YH6A 5IB5B 5C07A 3E0GA 3NIDE 4GW5A 4Y16B 4LMQE 4KHXH 2BNUA 3KPMA 1CICC 3K4ZA 1S7SA 2FO4B 4JO1H 1AGEB 5TFSH 2VDQL 3PXHA 1UJ3A 4WJ5B 1AO7E 2Z8RA 3HC0A 4X4YA 4QF1B 3QQ9C 1FNGA 5I8OL 5HGBB 4ZQKB 1G9ML 1LNUA 1PKOA 2CO6B 2W07A 3CVHH 4KRNA 4MSWA 5CBEB 1T22A 2LVCA 5IVXE 2DKMA 4AG4L 4QOKD 4CU8A 1G7MB 1I7RA 3VRJA 4C4KO 1JZ5A 2ZUYA 1EGJL 3BUYA 5F6HJ 4X6DB 3OHXA 4Z0BL 1QTYT 2H2PC 4PJHA 2CDFA 1BOGB 4X7TB 4D9RD 1QFWH 1BP3B 4M1DH 2V7HA 1U8KB 3QNYB 4PLOB 5ERWB 1XGYH 1RI8A 3UTSA 5KVGH 3ELAT 5DEGB 3OB0H 4OF3A 1Z9MA 3I75A 4I0PD 3PWPB 3BJLA 2VRAA 5BJTA 5BVPL 2MKLC 2BY1A 5CJXC 4JAMB 4IOSD 1JPGB 3U0PB 5HHQA 5F3BA 3O2DH 5CKAA 4WWKC 1H0DB 2X4QB 4GW4B 3WE6B 2RGSA 4YDKH 5EN2A 3O2WH 4FQHA 2PYED 2GT9A 5J6GA 2F19H 1NCWH 3SDXA 2IALA 2BC4A 3HMXL 3V7AG 2I9LB 2NW2B 1NGXB 1DUYB 1D6EB 1X5AA 1IGML 1NMCB 5DYOB 2NW3A 1ADQH 3UAJC 5T3ZE 4YNYA 2WLYA 2VDML 4DGVL 5I15H 1NAML 3CFBB 4BYHA 4M43L 3OR6A 4CJ0A 3G5ZA 1EEZA 3ORJA 4LSTL 3RWHB 5IW1A 2IG2H 4PP2B 4OFKA 2CDEB 5GS0C 4U1KB 5J4MA 3OKYA 5A2KH 3O2DA 3ESVF 4A2LA 5ETUA 5EU6D 1ZA6B 4YBLC 4OJFL 1EXUB 3LKNA 3KPLB 3NAAH 2X4SB 2JE8A 3U7YH 3HPLA 4AMKH 3RTQA 5CAYB 4OLWL 4OF7A 2IPTH 5A43C 4R96A 3QIUC 4F15B 3OF6A 3EO1B 4XWGL 4UU9A 1UKTA 3OKEB 4MAUL 5JXEC 4TSAH 2FATH 3ARDB 2YRLA 1UZ6E 5T3ZD 4Z7QE 1A6ZB 1JL8A 1ZHKA 2RBLA 3U9UA 1OY3B 3PGDB 4EJ1C 2BNRA 3P9WB 3R8QA 3S35H 1OAUH 5DT1L 1GIGH 3L5HA 4OCRL 5EUKB 3X13A 3QFJD 1VENA 4MWFA 2I27N 4U6VL 3QQ9D 5EUKA 3X13B 3QWRA 15C8H 1H0DA 1J18A 4NBYB 5ACMA 5H2BA 5JDJA 2HKHH 4LGPB 4POYA 5BS0D 1HEZB 3ARBB 5KBNC 1DQLL 1QHOA 5FYJU 4LEXL 2R1WA 5IBTH 3J7HA 4PGBB 3VFWB 1RZGB 1YC7A 3OJ2C 1N6UA 4TNWF 5GISH 1WIUA 4MNQB 4GRWH 4ALAH 5F7DA 1ZXQA 4XC3H 2YPVH 1ORQB 4JKLA 2DS4A 1CICD 4QWWD 2CK0H 2HA1A 4MJ2A 5BZDA 4OF5A 3V0AC 1NLDL 1RUAH 3JSSA 4IS6A 2NY3D 4PJ8C 3MUY1 3X3FL 4P5MB 5KSBB 4YDIH 1O5DT 3HNVH 5EZOL 3U79A 3GI8L 1PSKL 1LO5B 3H7LA 4WUUD 1H5BC 5J13B 1M71A 1CIDA 2B1AH 5GS0L 1NCCL 4U6XA 1G9NL 1NFIB 2GHWB 3SGKC 4UT6L 3RY6C 3UJIH 1CN4A 2VOTA 4PJDE 5E4IA 1F90L 2MCPL 2NY7L 1OAQL 3BZFA 3QIWB 4GRLA 1CFSA 1HIMH 2VLKE 3RX7A 3V5DB 2XRAH 2BCKB 4LNRB 4UV4H 1R24B 2NY3B 4PGJA 1ZE3C 4KKNA 2ZKHL 3GBNL 3NTCH 5I76B 3GO1L 4QHNB 3MJ8B 4OIAA 3ABZA 4ZO6A 5F1IA 3QAZC 4WI5A 4FN0A 4KRPD 4P5TD 4CVUA 2Z4QA 5CMAB 2W91A 5D8JH 4X6DE 5ADOL 3QA3A 3BMVA 5F7UA 1P2CB 3OKDB 2F53D 5BXFB 3D0VB 3I50L 5DJ0B 4U1MB 4NNPL 1YEJL 1W72L 5BXFA 2A6KB 4PRIE 2I24N 4GW1A 3FL7A 4ONFL 3TJEL 4QWWC 4I1NB 5C0BA 3WLBA 3PIQB 5GRVK 5ACZA 1FDLH 2VXUL 4LLYA 5GIRB 3V95A 3BZDA 1JGVL 3GRWL 1B4RA 2HLFD 3OKDA 4D0DB 4MVBC 4JG0L 3RVTD 5KAQG 3VXSB 4F9LC 2IH3A 1L7TL 4GG6B 2YOCA 1UM4L 1EAJA 4PLKD 3MXWH 1FNHA 1MI5D 4CW1B 4OCLC 3B8YA 4TOYL 1LD9A 4C83A 4EUPH 3CC5B 2YPKB 1V7NH 1PDKA 3UTQA 3EFFA 1D5BB 1XF2B 1KPUA 4XCNB 4FA8A 5I1CL 4C83B 1IC4H 2G2RA 4MLIA 1JN6B 3DETD 4HMCA 5C09B 4P3CH 3SN6N 4NSKA 1TCMA 5JIHA 5KW9H 3HZVB 4HH9A 2BVEA 5CILH 5F7EL 1N7ML 1G9NC 2X1WL 3GBNH 3NTCL 2JK5B 1Z3GL 2GTWB 4UI2A 4YHZH 4GH7B 5BV7B 1B2WL 4WHTB 4TUKH 1EGJA 1BVLB 5BMFH 1L4IA 5CJQL 4F15C 5JA9A 4YGAB 1MI5B 1D5IH 4F7CA 1QRNE 3PWPE 4JFOA 3CVIH 2ID5A 3AMKA 1IEBA 3LOWA 4WFGE 3UJIL 2AK1H 5D1XB 1YEDB 3UTTE 1XAUA 3CU1A 1WLHA 3GIVB 1WBZA 5LGJB 3OSKA 3V5DA 4R90L 3K81A 1LEKA 5EPMB 4OV5A 5EZIH 4WFFD 1TMCB 5T1MA 4M6NH 4Z18A 1TZHB 5MP6L 2I9TA 2XG4A 4KDVA 2Y07H 3GB7B 4Z7VA 2ZOKB 4RMUA 1T7XA 2X70B 4RMTA 4BZYA 5ALCH 4YDIL 4ZS6D 5EU7E 5EZLA 4R97C 2XXMB 3WXVL 1LP9E 3PGFH 4P2QB 3RWGA 1MSPA 1TZGL 4NQXB 2EDOA 5DVOA 4ZTPH 3TBTB 4AH2B 3H2WA 5I66B 3AUVA 1NMBH 3JWOC 1DN2A 2VQ1B 1LEGB 5KSAA 3LN5B 4H20L 5IJVB 4AL8H 1U0QA 1KF9B 1C12A 2Y6SD 4K9EH 2DQUH 1A6VH 2BSED 2EDEA 5JDSA 35C8L 2J8HA 4KDTA 5EDXA 3RBGA 4LVOC 2XRAL 5E8NA 1IE5A 1UC6A 1YDPA 4XVJL 4CVXA 4P3DB 4OFIA 4R2GB 5I9QB 2ZCLL 4HS3B 2F5BL 3T0EC 3L95B 2ZWLT 2SEBB 3E6HA 3OXRA 3LHPH 1Z9SA 2XQBL 4LAQL 1F00I 1K2DA 3QI9C 4LOUD 3ZDYE 4UOW1 3FQWB 5MEQB 2P5EE 5FO8A 1XFPA 3N85H 1U6AL 4HPOL 1ZHBB 4JRXA 1MFAH 4KK5D 1YYLL 5GGSA 5EOCH 2VDRL 4F58L 1PG7H 5CZXD 4YHKL 1RVFH 2NY5H 1BFVH 2GTWA 4KC3B 5B8CB 3QR2A 2PR4L 3FRPG 4KKBC 1EFXD 4JRXE 4PYHA 1MCDA 3K2UH 1CGTA 3HAEH 1EAPB 4CDGC 3AS2A 2DTML 3T0VA 1J88A 4YGVA 3ZDYF 1A5FH 5BV7L 1I1FB 4PREA 4NM4H 3X3GH 1MCLA 4DOHE 3KLHC 3WFBH 2UYLB 5HYIA 2AABH 3KNBA 2HWZL 4HX1A 2D03H 3PWVB 1HI6B 2WIIA 2Q8BL 5T3XD 1F6AA 5FKAA 2ICEB 3O41A 3B5TA 1I1FA 4O02H 3OKLB 4XPAH 4EBQL 1NC4A 4HD9A 5IJVA 1RURH 3DVNB 5FUZH 2E7LC 3CLFH 3N1MC 5IBLD 1IGYA 4M5ZL 5C0CE 1HI6A 4JY4B 1J1OH 2H32A 1MJJA 1OWWA 1ZLSL 1X4XA 5DXWA 1W0WA 4GAYA 3V0WL 3V5KB 5FKPA 4JPVL 1KLFA 4LSQH 1IQWL 3WL9B 3SGEH 5A3IC 2F54B 2VXTH 2DYPB 3TBVA 1KCLA 5C0EB 3VRJB 3H7BA 4Z7VE 3C6LC 4ZXBC 4Y5VA 4HIEA 1U3YA 4OZ4A 5CP3H 5J12C 1I8IB 5D1ZD 2ATPA 1NMBL 4I2XB 4K2UL 1BREA 4M4RA 1JGUH 2FD6L 3UTSD 1M7XA 4UU9B 3PDOA 1BBDH 3ZL4L 1CFVL 2AJSH 1UEYA 1HK6A 1WWCA 4K8RL 2MFNA 5HGBA 3SGEI 1YN7B 1ZAGA 3BD3A 1HZHL 5I15L 1VSCA 1QFUL 1RJYB 1XH3B 3MLWL 1HQ4B 2FSEB 2FJFB 4XMKL 3ARWA 1SEBB 3PWPA 1U8IB 3RWJB 3VXRD 2IPKB 4LLQB 4UAOC 2Z31B 4XP1L 5KVEL 4HEME 3GUTA 2J7LA 5K33A 4HJ0D 3ZMRA 3O4LB 4S2SA 3HI1A 3WDHA 4G9FB 2P48B 4F37F 4E41A 3W81A 5DTFA 1IAII 1ZKAA 1SBSL 3S97C 1KT2B 5EB9A 3OGOE 2FHCA 2Z8VC 3NMEA 2AVGA 3VFGH 3BT2L 5IF0A 1KIRB 3I84A 2FO1A 3FQUA 2IQAA 4OFYD 3LMJL 3MV8B 2E9IA 2FH6A 2XOTA 4DW2L 4POZC 4Z7QF 1CGWA 1PY9A 1UKQA 5T33L 1MFBL 1XGPA 5SV4A 1UXWB 2JJUA 4U1NB 1MCHA 4X5WA 3BO8B 1X6LA 5E2TL 5KVFH 4OLYL 1WV7T 4MD0A 4OSUH 1FORL 3VH8A 3WN5A 4V2BA 3TYGH 5JHDB 3AREA 3DOSA 1KSRA 4PGEB 3FRUA 4Y4KB 1WBXA 4LEOA 2F9BT 4TN9A 1CZ8H 4RGMC 5FYJE 1IAOA 1KLUB 2EIEA 4EI5D 1DANU 3CMOL 5J0BA 3KPPB 4HV8B 4Y5XA 1R5VA 4GKOA 5EN2B 3MLYH 1XGTA 1PJ9A 1P7KB 1CI5A 2ADFL 1KB5B 4R3SB 3O81A 4S1RH 4EN3B 4DK6A 4KZDL 3VRLF 3T0AA 2H8PA 1WBYB 1JGVH 1IZJA 3ZTNH 4UT9L 4OZFB 2YRZA 4MD5A 3RWCA 3DECA 5F97E 3NZ8A 3QDGE 1L7TH 1HH9B 3OZ9L 3G6JF 1OGAB 3MJ8A 4PJGF 4BM7A 4Z0XA 1FL3A 4BKLB 1GRWA 4PR5B 1KC5L 4LPTA 5I76A 1G9MH 1MAKA 3LQAH 1CGUA 1KG0A 3FQXB 4NNYB 1F8TL 3RIAF 1DBAH 3FO9B 2Z92A 3T77A 5LWYL 2GAZA 4O5LH 3VA6A 1LE9B 1LWRA 1OARL 2YS4A 4PJAF 3GSOB 2ARJB 3A67L 4G8IA 3W82A 1K4CB 4HFUL 1ZVSB 5I18L 3IFPB 3OHXB 3RRQA 1ACYL 1KTRL 4LVHC 2DQHL 4X4ZA 1Q94B 3MV8D 1HIML 3ARBD 1AHWB 1CS6A 3D25B 3IFPA 3RJQB 1NFKA 2A77L 3TBYB 1N64H 1P7QB 1RMFL 3F5WA 4GG6A 3HRZA 1F2QA 4XAKE 3LKRB 2VLJB 1JPTL 3VG9C 4YAQA 1I9RH 1QRNB 2PXYD 2E7BA 2P1YA 3BDYH 3EFDH 3IJSA 3LRHA 1ZT4B 4U6YA 3TC9A 3FMGH 1MCWW 1AI1L 3I6LD 4IJ3C 1CE1L 4Y5YA 3CH1A 4Y2DB 3D69B 4M7LT 1HSBB 1MIML 5J7CC 4Y4KC 3GSRA 3IU3B 3MRBA 4MAUH 4D0DA 2D7TH 1CK0H 4PJBE 5DMKA 2CXGA 2OM5A 2FGWH 4QRRA 1ZGLA 3HTLX 3QISA 4ZFFA 3MRNB 1IKNA 3TO2B 4MXQC 3IJSB 1LHZA 2WBWB 2YPLA 3PV6B 4N9OB 4BQ8A 1T04B 2X4NB 3OBAA 4A6YH 3GMNA 4GAJH 1SYVB 2DL2A 5D6DA 2OX5A 3VFUA 5TE6L 4FP8H 4M9OA 5DEFA 3SOBL 3GJFA 1T0NB 5IOPB 1R3JB 4JLRA 1DQML 4CADA 3V7AE 4ZXBD 2UZIL 4CN4A 1S7QA 2HFEA 2VZOA 2CSPA 4GRLB 4EI6A 5E6IB 1F97A 2VDMH 2JKXA 1MRDL 4FHBD 3KWWB 4JPIA 2HT3D 4M1CC 3ARED 3EJZC 4WI2A 2WV3A 4WW2F 3V6ZB 1MWAH 3BWUC 1BIIA 5DHVA 5HHMD 3VXUA 3ZT5A 4FQJH 4RDQG 1XR9A 1XGQB 5L88L 5FXCH 4XPFH 3PXJA 3QRGL 4JPIB 2AP2A 2R15A 1CFNB 2B4CC 5I1GH 4K7PH 2P8PB 3WSQL 3ZE2F 2P8MB 1A9EB 3UZEA 2NY1C 3MJ7B 3BZEA 4MJID 1NBZB 1T5XA 1UM6L 4Y4KD 2VZVA 2XZAL 4JFXA 1T5XB 2HVKA 1F4YH 3JVGC 2ZCLH 1ROWA 1EFQA 3C6LA 3ZSSA 3A6BH 4J12A 4WI4A 4N0CD 3DVFA 2FIKB 1T89A 1MFCH 1JN6A 3F5WB 5I19H 5JW3L 2HMID 4J6RL 5EU6E 1FHGA 4ODXB 1KV3A 3RAJH 1KJMA 4MDIB 4R4ND 1BGXH 3ZLQC 2BERA 5GS0H 1ZT4A 4U6YB 3DUSA 4LLUA 5A16A 1HOCB 5C9JB 2D3VA 2BY3A 5IHUL 2PCPB 1LE5B 1I75A 5ID0B 1R3IL 4MJIB 1CD9B 5JNYA 1N0LA 4WFHE 2IBGA 2ED8A 2D7TL 4Y4HC 2WQ8A 3HUJB 1Q38A 3RDTA 1OAXL 3WYRA 3MROB 4HG4K 1RUPH 1CE1H 2YD8A 4AQOA 4G8FB 3EYVB 5FYLH 2OK0H 4B50A 1GXEA 3BKJL 4ODVL 3ULUC 1CF8H 3QIUD 4MA1C 2H45A 3UBXG 7FABL 1I8KA 3DX9A 1U8NB 3PJSB 2VN7A 1I3GL 4GOSA 1SQ2N 4KPHL 4FFVC 3FN3A 4WO4A 4JHWL 1WGOA 3S37L 2OZ4H 3C5SB 4PTUB 4WFHD 4Y16D 4PGCB 1I9RL 4G9DA 5KZCB 2XWTA 2WIIB 1X4ZA 2KPNA 4N5ED 4BSVB 1T0MA 4XPTH 3WUWG 4UIMA 3TH2T 2AS5M 1DLHA 1TJGL 3ZE1E 1IM3B 4HKBB 1DUYA 5T5FL 1JMZA 4QRRD 5GJTL 3RWEB 1IM3A 3MRDB 1ZA3A 1BMGA 3JV4A 1MIEL 1G0YR 2F8VA 3QHZH 1DSFL 1J7VR 1MJJB 4X6EA 3ME0A 2CPCA 1BVZA 2AJUH 2PO6D 4NC0B 4JQVA 3QAZB 2E27L 2FO4A 2CR6A 3U46B 1FIEA 2CLRB 2AJXH 2VR5A 1F45A 5EFIA 5EA0L 4KH2A 1HINH 1IC4L 1M7DA 5F88A 3U0TA 3BDBA 3QWQB 1CFQA 1E4WH 2GCYA 5IEHA 3NFPA 3OKKA 4LNVA 4UTBL 4HWNA 4IRJD 3MSPA 3RIAK 3MODH 3SQBA 1ND0B 3BSZL 3GK8L 1YNTA 3CFJB 4HZAA 2AI0H 5IUSA 3W9EA 1G7MA 4P9HH 2FX7L 4FQXD 5C08D 3CLFL 1LO4L 4KTEL 5EH1A 3PDOB 5B3JF 2EYSB 1MHCA 4TULH 2FJFA 1E4XH 5TE4H 4OM1L 1FG2B 2PCPA 1RJYA 3B9KB 5DK2B 2AJVH 2V7HB 1G7LB 1OTUC 1VGEL 2VN4A 5C8JA 3TYGL 3SCMD 1UM4H 3FT2B 2A73A 4FXLA 1MNUH 4RNRB 1VGKB 3LPFA 4C59B 2G5RA 1MFDH 2X2YA 5KG9A 3RZCB 5TF1L 5DRZB 4LLDA 2Q3ZA 2VDQH 2WW8A 3MYZA 7FABH 4HIIB 3E3QC 1XGRA 4FXGA 3TT1H 1KGCD 1MJ8H 5ICXB 2VLJE 5BVPH 4J7RA 4KK8D 5SX5H 3T09A 1RUPL 3QEQD 4OZIB 4XNZC 3MUZ1 1CG9A 1MHPH 1KCSL 4LSDA 4OLVH 2MQ0A 3GMOB 5CJBA 3VU2A 3DO3A 1KEGH 5E03A 2FH8A 1I3UA 4HF5H 2FWOB 2DQEH 4X5LA 1HKFA 5F9JA 2BNQE 2I5YH 4N0UB 1CDIA 3Q1SH 2UZYB 5ETUB 3DX7B 4M7LL 4IRSD 5JZ7D 2H3NB 2A38A 3NACH 1EO8H 4HIJA 3QHTC 5IVXF 4BELD 5GJTH 1CZ8L 1GAFH 4P5TC 2BNUB 3KPMB 4MJ5A 2DF3A 4KRPC 3LKQA 3O6FA 4Z8FL 4OCXH 3KLHD 3BKCH 2W60B 4N9GB 1S8DA 1AQKL 2XZCL 2PR4H 1S78C 1HWGB 3GSNA 4JRWA 1NGXA 3SE8L 4X99B 3OG6B 4XBPA 4HC1L 1A7NL 3LEXA 4G8GB 1NANH 3LH2H 4H1LG 1XF5A 2AK4A 2R23B 3QRFM 4M9PA 2AERT 4QO1A 3C87A 3F12B 1F3DH 4PJ7E 4QRQB 1C5DB 4RIRA 5TE7L 1KTLB 3MNWA 4D0CA 1HINL 3UTZA 4ZUTB 5CD3B 3B9DA 4L8SC 1WT5C 5FYJD 3U2SB 4P3DA 1VFAB 5DGRA 1N8ZB 4MHHG 1N2RA 4IIQC 4JGJA 1ONQA 2NXYD 4M6NL 5MP6H 3M8OH 3MLXL 3B3IA 4JPWL 3RPIA 2B2XH 4G5ZH 3BPLC 4R9HA 1A4KB 2DICA 2D0HA 4NQEB 1LEIB 4LLAA 4JEGB 1KN2L 4OLZL 2RFXA 4X98A 4OLVL 5KN5A 4L1DA 5C0CA 2J88L 2UZXB 3WKMH 5B39A 4Q9QL 2L7JA 3ARGC 4N8CL 5FYJL 3SDDC 1FGVH 3KPSB 3FQNB 3QIWC 1L9NA 1S9YA 1CLCA 3B3IB 3LD8C 4XX1E 3QWOB 1NJ9A 1BX2B 5SWSB 3SE3A 1O0VA 5KSBE 3ILQC 2WMPA 4POZD 3QFDB 4LCUA 1ED3A 3LQAC 2HP4A 3KJ6L 5DC9B 5JOFA 4NN7B 2H2SC 3LKOA 2ADJA 3BIKA 5DO2C 3JTSA 5GGVH 3MMEB 3ULVH 5EU6B 3QI9B 3MRKA 2QHLA 2A83B 5L88H 5INDB 3MLTB 2RR3A 1CXEA 4ZFGL 4OAWA 4DZBB 1HHKA 4PJ8B 4KRLB 1IFHH 3WCYA 5CHNA 4MJIE 5F3HA 4PB0L 4UTAL 4XP6L 5DMYA 3SKUD 3WJLA 3ECBB 1RURL 3S5LG 4XB8A 4Q7DA 3DGGA 4JO2H 5GS3A 4POUB 5HHOE 3VFRB 1JF1A 1NLBL 1Y6KR 4HZLA 4OF0A 4MXVF 1T4KA 3VRIA 4DZ8A 2PXYB 2DD8H 1OTSC 2FZ3B 2I5YL 3P9MA 2Q8BH 4ISVA 2FX8H 4GBXD 3I3BA 2HTLC 4X6FA 1WBZB 2FHBA 5LGJA 3FO1A 5FK9A 3S36L 4ZTOH 4GO6B 4X9GA 4NQUA 4FMFA 5F1NB 1P7QD 3L3DB 1D7FA 5DJ0A 3CXHK 2WUBL 2XXCB 3BEVB 4NHCL 1ONQB 3KPOB 3EDEA 3STLB 4XNXH 1K4DA 4YO0A 3VGAB 2BRQA 4PJIA 4JFOB 4A6YL 3DROA 3KPRA 3ZKMC 2YBRA 4TTDD 1CFNA 3BKMH 4KFZC 2APWA 4X4MA 1U41A 5DUBB 3MBEB 3BGFC 3DYMA 1YY9D 3QCUH 3TBYA 5CD3A 1JWSB 5HI5C 3CCHA 2AJYH 3V6ZA 5HI4D 5E8DH 1F58H 1WEJH 1A7QL 2CLVB 5CLTA 2Q7YA 1BEYL 2JJWA 2GW5A 2VO5A 3IXAB 1KEML 4DFHA 2JJTA 4PG9B 4K7PX 4XVSH 5DUPH 5EO0A 4KMLB 1S3KL 5C7XH 3DUHA 2HN7B 1NEZB 2FECL 4XCNA 4XP9L 4KZDH 3IXAA 4LPXA 1GGYA 1A7OL 4N8VA 4OUOA 5HHNA 1GSMA 5JW4N 3RWDA 3PL6B 3MRNA 2IADA 4YIQB 4X6BB 1IKFL 3C8DA 3IU3A 2IBBA 1MCKA 3MGOA 3UTTA 1ED3B 1NL0L 5A16B 1AR1C 2PW1B 3H9SB 2WBJD 1R0AL 2C4FU 2DWDA 4AEFA 3EOAB 1QRNA 4M4PA 5L2KB 4K3EH 1LMKA 25C8L 1REIA 3BFOA 4M7JL 3S5LB 2CDEA 1NEZG 5TH2A 1IVLA 5ADPH 4I0PC 5F89B 2OSLA 5ILTL 3RWCB 3BPCA 1I3RB 5C0JA 3SJVA 5LXGH 1NUGA 2JELH 2NY5C 5IR1B 3NFSL 4GRLD 4R7DA 4Y4KA 1ZTXL 2WUCH 2NPLX 2NY1D 4IHOB 4NRXB 1WICA 3HG1B 4Y19A 3GSNH 4Y5XB 4JQIH 1VADA 3IDMB 5F1KC 5I6XB 4KK6C 5D5ME 2P5WB 3H42L 4ORGB 1H3WM 5HGDA 3EFDL 4YBQD 4HWBL 5CWSA 5JMOC 4LHUB 1MFEH 5HVHC 1HILB 2UY6A 4E41D 4G8IB 3ZKNC 4UDUB 3M07A 1X5HA 1BD2E 2Q7YB 1GIGL 1V3KA 3H0TB 3HZKA 1U8OA 5IG7B 4PR5A 4NP4L 3RJDA 5KAQF 4RMRA 1KJ3H 2MPAH 3FB6B 5IESL 1IM9B 4TUKL 4WTZG 4UZGA 1A7RH 5HDQL 3MOAL 5IBUB 1CE6B 2XN9A 4K7FB 2R4SL 3GMPB 3RDTD 5I2IA 5KW9L 5C0BE 2XQYK 2ITDA 1AE6H 2PTTB 1JTPA 3U4BH 1J12A 1AXTH 3NN8B 1G0XA 2ZSWA 1FE8L 3PIQA 2IAMA 4M7KL 2ITDB 4BFIA 4R4FH 4LVEA 1CFQB 2GCYB 4JKMA 1CE6A 3EO9L 4GKSA 3LKQB 3O6FB 4XP9H 4PRHE 2DBLL 4X6EB 4NYLB 4LSVL 3WIFB 2PYEE 3F7YA 3TBWB 2NNAB 1M6OA 2NLJB 3IS0X 4U6HB 2ICCA 1HOCA 1YN7A 2YR3A 2VDKL 5F44A 5TE6H 3TZVB 1MWAB 4U1IA 4PGDB 4HKZB 3VW3H 1XGUA 3QUYB 4NHUA 2YHGA 4RBPK 5IKCA 4MXVE 5L6YL 1AGCB 2E6JA 1J8HE 4W68A 2ZSVB 9CGTA 3IFNH 3RUGA 5CP7A 4BH8A 4XNUH 4MS8D 1A47A 4FNLL 1U3HD 3RKDC 4NM4L 3X3GL 3NIFE 4L4TD 2FRGP 4NNPH 4WO4B 1T3FB 2DMCA 4YHML 1J8KA 4K3EL 3LCYA 5A40E 1F58L 1SY6A 1WEJL 2VJXA 3PJSA 3T65A 4RX4A 1D5MB 1ES0A 1OQXA 1T5WA 2C26A 1SJHB 3L3IB 4PJAA 4LSQL 4N0FB 3JWDH 1BZ7B 1NCAL 1FV1A 3EJJX 3B2VH 3EYUH 4LQFH 2EH8H 3ARTA 1J9CT 5FB8A 4DN3H 4LRNH 3VXRE 1X7QA 1LO2L 1IILE 4UNUA 4M5ZH 5IFHL 2EYTA 3MACL 32C2A 3LDBB 2O26U 4E41B 1R5WB 2NX5B 4LHUA 1YNKH 3BN9D 1U92B 3QO1A 3CK0H 4PJ7F 4HUXA 5E5MA 3HC0B 4X4YB 1D9KD 1PKQB 1ZLUK 1W72B 3PGCB 2K9UA 1H3XA 1LNUB 2E7CA 1RZJH 1VACA 1K8DA 5F9DC 1EK3A 2YKLH 5DJ2B 4OFYA 1ZLWK 3O8XA 4DQOH 2CR3A 2Y25A 5GZND 1HN1A 3UJTH 4CRPA 3HE7A 1U8JB 3T0DA 3I6GA 3QUYA 3QO0A 4NHUB 1IAOB 1EERB 5E2VH 2G9HB 3QDGB 1S9VA 5IHUH 2VL4A 2PUQT 1N5AB 4HZLB 5DD0H 4WHCA 1H3PL 1BOYA 2Z93A 1RHFA 1NMCC 1QFWL 4P49A 3IDJA 2EDQA 4RA3A 3FT4B 1P53A 3CDGB 1KB9J 5DDHA 4RCAA 4JG1H 4ODHL 1VFBA 1WUNT 2D9CA 3SCMB 3I75B 3QNYA 3AMLA 4AG4H 4CVWA 3BUYB 3H9YA 3GMQA 3GSWB 5C09D 1WQVT 2EE9A 2C7UB 3SY0A 3RGVA 5FUOL 3ULSA 3DURA 1PLGL 1KN2H 3DTXB 1FN4A 4NQED 1KLGB 4YXKH 2WWMD 5E5UB 1OW0A 5EULV 4HCRL 3CX5J 3MROA 4Q58C 4IEFB 2IH1B 1FQ9C 2W0FA 3QWOA 5SWZD 1D9KB 1OF2B 5GGVL 3SDXE 5IMLB 4FQ1H 1HCVA 1HDMB 2V5SA 4M6OH 1G7PA 4FQIH 1FO0L 3ARFC 3HS0A 5I1LA 4PRHB 5I1EH 4U0RC 2RFXB 2VITA 2DLEA 2GITA 5DLML 3MRCA 2KH2B 4TUJB 1G84A 2O61A 3V0VA 1UA6L 3WHXB 5AYQA 2J2ZA 3FFCE 2X4TA 2ZUQB 1F4HA 4Q2ZB 4Q0XL 5ITFA 1J86A 3MLUL 4AEIL 3FQTB 4N68A 2XPGA 2ZG2A 4JDVA 1QYGH 3UTSE 3EJYD 3L3OB 2AK1L 1XGTB 1SJEA 2XICA 3ECBA 3O6KL 3L1OL 2XPGB 4JDVB 1T7YA 4P9HL 3UX9B 5ALBH 1TTGA 3R8BB 2Y23A 1RUML 3FRUB 4PRIB 2P44B 4D8PB 1U8QB 1A6ZA 4FS0A 4NO3B 1OAZH 2DQDL 5D96C 3NCFB 5F88B 5DJDB 5FOJA 1KTDB 2EH8L 3B9KD 1U9KA 3CIQA 2NY2B 1PEZA 4PRNB 4M02A 1NGYB 3SDAB 3WUZA 1JNHB 1VKXA 3FQXA 1NGPL 3HFMH 3C6SA 1F4WH 1RMFH 4JRYD 1JNHA 3MNVB 1FL3B 4BKLA 5C6TL 3DBXB 4Z7WA 3C5JB 1BM3H 1DLFH 1HSAB 2RHEA 5GSVB 2Y6SC 2DAVA 1GAFL 1KXQE 3MPCA 1EAPA 3O0RL 4OM1H 2CRIA 4IRZH 3HZMA 2K7QA 3QULA 4MAYD 3RKPA 3UBXA 5ID1B 4YFEA 3JTTA 3W11D 4IIQA 1MRCH 4Z6AT 1DBJL 3BZEB 2L7UA 5J6GB 3D85D 3JTTB 3LPWA 1EMTL 2R29H 4M7ZB 1IBGL 3QXVA 3IFLH 1OCWL 4BQ6A 3RI5K 5CIPH 4KJWC 4CU6A 1YJDL 1EHAA 2B20A 5DA4A 4RAUA 4XXCA 5I1EL 5B22A 5EOCL 2VITB 1I1AC 1YUHA 3ZT6A 3SPVA 2RQ8A 3DI3B 3O3BB 4DVRH 2EC9T 4F3FB 5HDLA 4X5WB 5LVEA 1UACL 4FQXA 3BJ91 4NRYA 2Q86B 3GSNB 1T2XA 3CC5A 4JANA 3NCYP 2J8UF 3LQZA 4NN7C 4P9HC 4NO3A 1LE5A 4UV4L 4X5XB 5F72S 5IF0B 3QSKB 3L3HB 1KTDA 1OAYH 5E9DD 5FUOH 5FUCE 4Z76A 1QYGL 5HDOA 2WANA 1BJ8A 2BJML 4YXHH 4KVNL 2V7NA 3IU4L 4GBXA 3WS3A 1MLBA 3UTOA 3BDXA 4Z76B 4K71C 4BH7A 4P4KB 3KXFB 4KGLA 2K3TA 5KZCD 1JZ2A 1JNLH 2J6EL 1N3NA 2YSSA 3GKWH 2UZIH 1JYNA 3RHWK 1UQSB 4HWBH 1UB6B 2V5TA 3H9HA 4U1HB 3P77B 1FO0H 4JCMA 3HNVL 3WNLA 2QADC 3SDCA 3THML 3RPIB 4CAGA 1UM6H 2HLFC 4QRTB 2FECI 4PJIE 5HI3D 1W0VA 1RIHL 4H5SB 5FB8B 2FIRT 1SHMA 5IROA 1II4E 4ZUWB 5KOVC 3U36B 2YN3A 1UA6H 5GZOD 3P73A 1R3IH 1HEZA 5SWZE 3G6DL 1JI1A 2ENSA 4HWEL 3KLAA 4OB5H 4AENA 1JPFB 3U0TB 2UY7A 1FL6B 3RX5A 4PRPE 4Y8AA 1JMXA 4KQ3L 1DVFA 5EO1B 2KUTA 2FL5A 3V6OE 3KGRA 3QA3B 1FO0B 1I1AD 3HLAB 2R2BA 4NN5C 2BVTA 4R6UA 4XCCH 3RFZC 3QHFL 3OJMB 4Q97A 3IJHA 4NT6B 4IMLB 5CINH 1BBDL 5CZVH 4JE4B 4AENB 4O00A 5IHZA 3P4NB 2YWYA 3G6JE 5IQ7H 4WY7H 1XGPB 2DWDB 2C3XA 3TZVA 4JFFA 5MEOB 3A6BL 2Z0BA 4ZO8A 1T1ZB 4XVTL 3IDYB 1FG2A 4J6RH 2DQTL 2VLRB 3C60B 3A6CL 4P3WA 1C08B 3F58H 1CGVA 2DI7A 2ENYA 5MENA 5DZNA 2AXHA 3KXFE 1BVKA 4HJ0C 1N26A 1MREH 4O5LL 1YN6A 5IB3B 3BH9A 4F80A 2VLLB 2AGJH 4QGYA 1ZGLM 2BMKB 2R1XA 4LCCB 1IM9D 2CKBL 4WI9A 1M7IA 2XKNB 1VEPA 1D5MA 4F7TB 3QIBB 2YEZA 5IQ9B 4EIGB 2M26A 2YK1H 2VH5L 5KSVA 4G3YL 5IW3A 3VRLE 5IMKB 3BKML 1MUJB 1NFDA 1YNKL 2J5LB 4BH8B 1S9XA 1EHLH 1AO7D 4LHUD 3QI9D 3QJFA 1AHWC 1FJ1A 5J9PB 4L8CB 1S7TB 1MJUL 4PTTB 4I5BB 4OV5B 4F2MB 4OLXH 4UV7H 4AIOA 1NCWL 3DSFL 4KKLD 1OP3H 2AK4E 4GRLC 3MV7A 1W0VB 3ZSTA 4FOMA 5JIPA 4L3EB 2RB8A 4S11A 3RP1A 1H3UA 5J3HC 1X7QB 4HHAB 1TCRA 4LQ1A 4AYFA 3FO2A 4YX2L 4GAJL 3BQUC 5CP3A 3DSNA 1T20A 4NQSB 3VGBA 2LAAA 1KC5H 1U58B 2HFFA 1SY6L 1SVZA 1YPZA 4RGNB 3DRTA 3NFPB 4WFGD 3UJJL 1YMMD 1UJTA 2PXYC 2OR9H 4KVNH 5LG1A 3V79C 2NTFB 3FRPA 4OLWH 1BF8A 1WCBA 1GGIL 3X12B 1F5WA 4TNVK 1CK0L 2VDLL 4UB0L 4HS6A 2XTJC 1JPTH 4CVZA 1JZ3A 1U95B 2O5XH 3ZKXB 2R1XB 2FEEI 4NQDE 1RQ5A 3GMNB 2IADB 3NFSH 3OKKB 4PD4J 4NN6B 1I1AA 5SWZB 1PQZB 5AYUH 1CU4L 2KZ1B 1GZQB 4KZEH 5DRWB 2XKSA 3GSNL 3REVA 3BIBX 3TN0B 3TBWA 4ZUUA 1A1OB 4Y4FC 4FZEL 4KK5C 4NPYB 2UWEF 4EI6B 1IC5H 1A3RL 4PREB 4M5YH 3LKPA 4IRJB 2R69H 5TF0A 2BNQB 3QDGD 4N0UE 1OP5H 4KHTL 2BOBB 1G6RL 5ADPL 3MFGB 4H8WC 1NBYB 3HE6B 4DVBB 2MQCA 2D0FA 3A6OA 4G43A 4HLZH 1MIMH 2EDJA 1KJ3L 3OTTA 2IF7A 3V5HB 5EWIH 4JFEE 1LK3L 4PJXE 3QDME 1G7QA 4JFDB 4L4VA 1L7IL 4HK3N 2WSKA 1IM9A 2H1PL 4S1QL 3RNQB 5DHYB 4YHLH 5EBLA 5DEZA 4K7FA 3IGAA 4GRWB 3DX9B 4KXZI 3D1MC 2M1KA 1OTTC 5EU4A 5C0FB 2ESVB 1RU9H 5MEND 2PO6A 3MV8E 5JW4Q 4OZIF 1FZJA 4GT7A 4M7KH 4QXTA 4PBWD 3VWJD 3R1GL 3ULUH 1U8MB 1CIUA 3NACL 2HLAA 5GRJH 2I60H 1MEXL 4D3CH 3CXDH 4EDXB 5C86A 3D39E 5IVXB 5ILTH 2A1WH 3V52L 5ICYB 1FNGB 5E56A 5KSAB 3KYOA 3QNZA 4KMTL 3LEVH 3O4LE 1S5IH 3QDAA 1WTGT 1KIQB 4LLUB 5C9JA 3TO4C 5DVKA 2V5RA 4H1LH 1ORSB 3CFCH 1E0OB 4V2CB 2GYSA 1EMTH 2R29L 1NANI 5CP7B 3OG4B 1H5BA 5EUOB 3QG6A 2IMMA 4PY8I 1AC0A 3NOIA 4ETQB 4XC1L 5CJXA 2IANE 2NYYD 2OTWA 4OGAD 4TVPD 3O6KH 1DDHA 4JPVH 3OPZH 3SDCB 1MF2L 1KJVB 2DQFB 4PJIB 3IAPA 3UTZB 4HIXH 3RPKA 4H8WL 3F6LA 4TYUA 4N0CC 4Y4FA 2NY6B 3MACH 4M8VA 3CMGA 4BQCA 4EUPB 1KUMA 5KTEH 3D18A 5D72L