5T1DL

Crystal structure of ebv ghgl/gp42/e1d1 complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
217
structure length
217
Chain Sequence
b'DIVITQTPLSLPVSLGDQASISCRSSQSLLHSNGNTYLHWYLQRPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLMINRVEAEDLGVYFCSQSIHVPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein H
publication title Structural basis for Epstein-Barr virus host cell tropism mediated by gp42 and gHgL entry glycoproteins.
pubmed doi rcsb
source organism Epstein-barr virus (strain b95-8)
molecule tags Viral protein
total genus 38
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2016-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t1dL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t1dL01
3H9HA 1N8ZA 5HHPB 1KEGL 4R96A 1MRDL 2ZOLA 1J11A 5D1QD 4NQDA 5F7FA 3FB6B 3WXWL 3VFRB 2DTMH 5D1XD 4F37K 1CE1H 3TN0C 2WBJA 3PNWB 4I18C 1KC5H 1PKQB 3H3BC 4CAGA 4ZTOH 1LO2H 2LAAA 3LPFA 5DZOA 3HE6C 1AR2A 1RU9H 1U9KA 5E2VH 4JFED 3PP4L 5DZLA 5D5ME 5HI4C 5EU6B 3S36X 4AIZA 1XIWA 3QQ4B 2AJYL 4PJDF 2AABL 3GMNA 3CFCL 4YDJB 3O81A 3QEHA 1CR9L 3H9SB 1QRNB 4FQPA 4RWYL 1AXTH 1KGCE 1RIVH 3EDFA 4HUVB 1IEHA 3MNVA 1HYSC 1I7RB 2BY2A 1I8MB 3DUSA 3CAFA 5C0ND 2BCKA 5HDQL 3HI6L 1GGCL 4B5EA 1WZKA 4NO3A 1U8KA 1BIHA 5I30H 3U4AA 4H5SA 1MCFA 4D8PA 3STZA 4LLQB 3CFJB 2QQLL 4IOIA 5FKAA 3IVKB 3QDMB 4POZD 2NY3B 1WV7T 4JLRB 3CU7A 2IH3B 1F3DJ 4JR9L 4DN3H 4ONHA 3RBGA 1FJ1A 2FJFB 1H3GA 1NCBL 2VAAB 1P53A 4NRYB 4APQD 4GMTH 4RGOH 1K6QH 5TDPA 2H6PA 5JA8B 1OAUL 1KGCD 1S7RA 4X6CB 1EO8H 4OCSH 2P7TB 1G0YR 3W82A 4ZFGL 3ARTA 3ZHKA 4PY7B 5HYEA 3N1MC 4I48B 2X1WL 5SX5H 3T2NH 1AO7D 4ISVB 3NBNA 3C5JB 3UP1A 3GSVA 4L4TE 5J1TC 4NT6A 3CFEB 4KPHL 2F53B 2VXSH 4GQ9L 2IMNA 5DJXA 5C8JA 2NY2D 1YN7A 3IDMA 3VD4A 1C7TA 2Y25A 5F7WC 1W0WA 5C09E 2IPTL 5C0AA 3VGEA 1JPTH 4Q2ZA 2HT2C 3BPCB 5L9DH 1QYGL 1T66D 2DM7A 3HZVA 1VERA 1QVOA 4ORZC 5ESVB 3EJJX 2F74A 2V17H 3L5WA 4QGYA 4QOKA 4XPAH 4Z7UB 4UT9H 4GBXB 3P4LA 4XP1L 1AQDA 3O4LA 1CD0A 3BN3B 3DO3A 4S2SB 2V5YA 4Z7OE 2IPKA 4L8SA 4N1HB 5J8OA 1OT1A 4O9HL 4G9FB 3MFFA 2NY3C 2F54A 3LEXA 1LO0H 4Y4FA 1H5BB 3B9KA 1VDGA 4A6YB 1I85C 1G7MB 4HH9B 2I07B 1DQQB 2Z4QB 3E8UL 2DKUA 2HVKA 5DUPL 1IC5L 2AJSL 2NY5H 4X5LA 4XMLL 4G42B 3OKYA 3GO1L 2MJWA 1VENA 5KN5A 5E8NB 5HDBF 2Q76B 3PGFL 4GAGH 1SVZA 2B1AH 2ZUUA 4MCYA 2FR4B 3W81A 4YHNA 5DI8A 3Q3GB 4PJ7E 4A2LA 3E6HA 1K2DA 4GRWH 1QLFB 2A6KA 3JXAA 3RI5F 1CT8A 3FT2A 2DWEB 3UDWC 4OF3A 3SN6N 1S7WB 3BO8B 4YO0A 5IB4B 4D0BA 4LLVA 5JLZA 4S0SD 5DJDB 3OHXA 3WIIH 4MS8D 1OARH 4HUWB 3G5XA 4R3SB 3MRIA 4K3DH 3UJIL 3QIBA 5FA3A 1A8JH 3E3QE 3G5YB 4GBXC 4IOSD 4ZS6C 1MREL 2GAZA 2OM5A 5BW7A 3A6CL 1K4DA 1S7UA 5J4MA 2X4NA 2VLLA 2NTFA 5JW4N 4GKSA 3P4OB 5FYKH 4H1LH 4P2QA 1PG7H 3FTGA 2P8LB 3RX5A 5HYJE 1T03H 4LEXH 2XN9B 4HKJA 1ZLSL 4HPYL 4R4BB 4JFHD 4MA8L 4MXQD 5CMAB 1YY9D 4PTTA 3CUPA 4LSSH 4O00A 1H5BC 3EFDL 4G43B 1BZ7B 2GSGB 3IDJB 5D71L 5F8QC 4LPVA 4JZNA 4RISL 5C0CE 5I8EA 1QSFB 3N85H 1CXLA 5GRVK 1A7PL 1T5WB 2FD6L 3CFKA 4LHUD 5E6YA 3I6GB 1ES0A 5IF0B 2HFTA 3KPRE 5JXAL 3BP5A 4HS3B 3DSFL 3S35X 4UT7H 4M9PA 5JR1L 3PWPE 4I77H 1NMAL 4PJFE 5HYJD 4RSVA 5DT1H 4PRIA 3HUJE 4JDTL 2VDKH 3ORJA 5CWSB 1JF1A 5IB3B 1AGDB 3RWCA 5GGRB 3O8XA 5T1DH 1JP5A 2RR3A 3BYTA 2LU7A 4NQCB 1FC2D 2FH8A 3KPRD 3QH3A 3VU2A 5EZJB 2AV1B 4F2MB 3PWPD 1MJUL 4OF8A 3U0PA 4WDIA 3TN0A 1D6EA 4I18A 1CXIA 1BZQK 2MNUA 3CDYA 1GHFH 1NBZA 3EYOB 4R8WL 4KMTL 3CVHB 5CJXC 3HE6A 1BD2E 1FL5B 1OSZA 2R4SL 4L5FL 1KFAL 5FDYA 4NQEA 4S1RL 4E0RA 4RGMB 3S3PA 1U8OA 4XC1H 4OD1H 4IIQB 2H1PL 3FHQA 4TPRH 3KPSB 3VXOB 1U91A 4Y5VC 5IMOB 3ZKNC 3MV8E 3DMMB 3QSKB 2WINB 3LQZB 4KKBC 3TYFA 1BQUA 4GRMA 2DQJH 3K81A 3RQ3A 2CDFB 4G8GE 1JPGB 4N9OB 5I2IA 4X5WA 2AK4B 35C8H 1P84J 1TJGL 2F19H 4P59H 1P5UA 2DYPD 4MNHB 4PRPA 1BD2D 2GK0A 4LASL 4CVZB 3BUYA 3BZEA 4KVNL 3AB0B 1JMZA 4IRSA 1PG7W 4P9HC 1EGJA 5CHNB 3O0RL 5EH1A 4PJCB 5J06A 5HHPA 3LMJH 3RWFB 4S1SH 4HQQL 5CAYB 3FB6A 5SV4A 4WI8A 4UTAH 1E4KC 4WFGE 4G8GD 4NN6B 1ZHKB 3VFRA 3MOBL 5D7SL 1BWWA 2FCBA 2W60B 4J12A 2FX8L 1YYML 3VI4F 2K1MA 3PNWA 5C1MB 1PKQA 2VDPH 3FQTB 1I9IH 3N1QC 5HHVH 2LVEA 5J12B 2DD8H 5EU6A 4RGMC 1EFQA 4UOJA 2LV4A 1I3GH 3QQ4A 4IIQC 4YDJA 4YXKH 2IBZY 3PWNB 3QBTB 1DCLA 1YEIH 3H9SA 1A3LL 1YEKL 4D3CL 1QRNA 3HCVB 3DMMC 4HUVA 2WUCL 2J8HA 1I7RA 4WFGD 1MHPL 4RMRA 1I8MA 3KLDA 4TN9A 3BE1L 3SE9L 4TTDC 5FA4B 3H8NA 4QT5A 1OP5H 4K9EL 1J18A 1FH5H 3V5HB 4M6OL 5HXMA 4LLQA 3CFJA 4FQ2H 4WWKD 2C3WA 2I60L 3IVKA 4S1DD 3HZMA 5DC4B 3QDMA 2EH8H 4X7CC 2KZWA 2OTPA 4JLRA 4LSUH 4PJ5B 1Q9LB 1SEBB 2IH3A 4YZFF 3U36B 3AB0C 3QISA 4JZOB 5TQ2H 1RZKH 2FJFA 2VAAA 4NRYA 5JO5B 3SQBA 1HINH 1I85A 3S7GA 2W92A 5EUOE 1QBBA 3SKOB 3ILQC 4X6CA 2ZJSL 1IEAA 2P7TA 2Y06H 4KQ4L 3SQOH 1ZANL 4WU7B 5C6TL 1VPOH 1MJ8H 4NN6C 1K8IB 2R0LL 3MBXL 4PY7A 2HH0L 4I48A 1H3UA 3NZ8B 3ARRA 1CFVH 3QCUL 4ISVA 3V95A 4Z0XB 3FKUS 2VB5A 3DNKA 1ZLUH 4Z7NF 1BOYA 1VGEH 1KJ3L 3CFEA 5KSBF 2F53A 1H3PH 5J12C 3PV7A 4ZS7H 3WFCH 3KXFB 2XG4A 3UDWA 3T3MF 3C8KB 5INCB 4IRZH 3RDTB 3BPCA 5I1JH 1P69B 3GIZL 1OAYL 1JZ8A 3M8OL 4PJIE 4H20L 5ESVA 4YFLI 4FQLL 3ARSA 4Z7UA 1CFTB 5AD0B 3MFGB 3IU4H 4GBXA 2VH5L 3SE4C 3VWJB 4BQ8A 4S2SA 1T2QL 4PD4J 4DQOH 1MH5B 1BF2A 3O6LH 2ZG1A 3N1GC 4WUUD 5DRWB 4G9FA 2VN4A 2VZ3A 4UOW1 3U0WH 4JFZL 2X40A 1VEOA 1S7QB 1CS6A 4LCYB 3QXWA 2JJSC 2O26U 3OBAA 2KBGA 5A1AA 1H5BA 2R56H 4FNLL 4A6YA 1M1SA 2YMXH 1KLUB 2HTKC 4XNXH 1T89C 1G7MA 5GS1B 3BN9D 4GRWB 4HH9A 2I07A 4NIKB 4OLUL 1CD9B 1DQQA 2Z4QA 4I4WB 5GS3A 4Y16B 5KVEH 3JWOH 1JGVL 1KLFA 4G42A 3MRBB 3QG7L 1DL7H 3QDGB 1UH4A 4BZ2L 5LGHL 5E8NA 3TT3H 1AI1L 2Q76A 4KK5D 4PJ9D 1BJ1H 1NFDB 1U8HB 3MQIA 2FR4A 4FZ8L 1VADB 3Q3GA 4BFIB 5DVMA 3QDAA 1BQLH 1QLFA 5DRXB 3QPXH 1FNLA 2DWEA 4JANB 5FYLL 4KGLA 3L5XH 1KCVH 4PY8J 3OGOE 2BFVL 1S7WA 3RDTC 3BO8A 2WM0A 3CXHK 5IB4A 4H1LB 4ODTH 2VL5B 4D9LL 5DJDA 1Q1JL 1CCZA 4HUWA 5KANI 1Y6KR 4R3SA 5ILTH 4UNVA 4DUWA 4M43H 3UC0L 3G5YA 3JTTB 1Z9MA 4XP4L 5JPMB 3OMZA 4LRNL 3F6IA 3VWJC 2ATPB 3P4OA 2LAGB 4DFHA 2NY5C 4GMSL 4LDOB 2P8LA 1KPVB 1A7OH 5CJXA 5BS0E 2XN9A 4KMQA 4R4BA 5CMAA 1FL3B 5DEGB 1MCKA 7CGTA 4G43A 1P7HL 4OI9A 1S7VB 3IAQA 1BZ7A 2GSGA 3IDJA 5FDWB 5DMYA 2EDNA 3FFCB 5GS1C 4LBEB 1G9NL 1JNHB 4IMLB 1QSFA 4RRPA 4U4BA 4Y16C 2YWYA 1K8DB 1J1XL 3I6GA 5J6GB 4Q7DA 3ZE1F 4ODVL 5IF0A 4OFKA 2NR6C 3DTXB 4PYGA 4HS3A 4XBEH 4FQ1H 1IVLA 5FK9B 3NCJH 1AR1D 5BS0D 1RULH 1X3DA 1Y18B 5CWSA 2NXZD 3MRCB 5IB3A 1T21B 2AXHA 4YHOH 2XTJB 3FRUB 1AGDA 5AG8A 1G7HA 5C92A 2R69H 5FHBL 3NA4A 5GGRA 1DN0B 2XWBB 1BZ9B 3IJYB 4QWWC 2D3VA 3JV4B 4HXAH 3OX8B 2RHEA 3V0VB 5CZXC 4NQCA 4HIEB 2YS4A 4QXUL 3O3EB 3PQYE 1PBYA 3HNTL 2VXVH 5GRYA 5EZJA 3CSGA 1YYLL 2AV1A 3O2VH 4F2MA 5FUZL 1GZPB 4HFWB 5I8KL 5HD8C 2OBGA 3NCEB 5JMRA 4XH2B 3CVHA 1FL5A 3L5HA 4LSRH 1TJIH 1NC4B 4ETQB 2UWEB 4WO4B 4DZ8B 1S9XB 5DJ8B 2OJEB 4N5UA 4IIQA 1MFNA 1KCSL 4QY8B 1KCRL 3KPSA 5TDNB 3VXOA 1FGNL 5IMOA 3VXQB 2UUDH 3PQYD 4YHYB 2HJFB 3X3FH 3DMMA 3VFPB 3LQZA 5BVPL 1X7QB 4LSTH 4UBDD 4O02H 2CDFA 4OGAD 1JPGA 3VW3H 3EHBC 5GJSH 4XVSL 2AK4A 1I4FB 4MNHA 4MWFB 3HPLB 5KOVC 2VZ1A 4U1SB 3OKDB 4CVZA 1V7MH 4NQTA 4HCRL 3FZUC 4YQXH 4OZGF 4HUXB 4YXHH 4TSBL 5CHNA 4M1GH 2ZCKL 2CD0A 4PJCA 4RQQB 2ADFH 3D5OF 3RWFA 4C56E 3ULUL 1R5VB 4ERSL 1FVDB 4F57L 4OZ4A 4ETYA 3MV7B 1ZHKA 4X9HA 5F7LB 1U41A 4F37F 2W60A 2DL2A 2CSPA 3A6OA 2R1XB 4QHKI 2R0WH 3FQTA 3QFJD 3W39B 3NCYP 1JZ6A 3EOAB 3TYGH 1J5OH 4Z8FL 1UFUA 4WO4C 1IC7L 1T2XA 1A6AB 1ZVYA 3MV9E 4OM0H 3ZZ1A 4ACPA 5KSAB 1U8NB 4NQDE 5HHMB 3PWNA 4GG8B 4MYWB 3CXDL 4K3JL 3WXVL 4Q58C 3ZTNH 3HCVA 4XGZB 4M62L 5BMFL 1E0OB 1OSPH 4XAKE 5I1DA 1CG9B 3X11B 5FA4A 2JCCB 3SE4A 4H1LG 3C5ZD 4XX1E 3V5HA 2HFEB 1AKJB 2NZ9D 1AQKL 1F97A 1AIFB 4E42B 2R0ZH 5JPNB 5KZCB 5JW5B 5TGBB 4DGIH 4CMHB 2EEBA 1I1RA 4PJ5A 1IFHL 1Q9LA 1SEBA 3RBSA 3MV9D 4WFFE 2Z8VC 5EZOL 5F6IB 3U36A 5E00B 2JJSA 4JZOA 5F9DC 4Z5RB 1JPSH 4NQDD 5DJ6B 1XCQB 4XCFH 3BD5A 5JO5A 1F4YL 5DD5H 2FO4B 3ESUF 1T89A 2PW2B 3SKOA 4XNZB 1IBGH 2A9ML 2WBJD 1ZS8B 4OBRA 3ZDYE 4CRPA 5FO8B 1KJ2H 1K8IA 1QFHA 3BYYA 4G6AC 1FFOB 2DM3A 2FH6A 4FQCH 3REVB 4GG6B 4KRNA 4X6FB 5GGVL 2QQKL 3SGEH 4PIRF 3CLFL 4Z0XA 3MLVH 1XIWD 1BVLB 4CDGC 2B5IB 1XGQB 4NC2B 4WFFD 5F7DB 3D0VB 3KXFA 3T0WA 3C8KA 5C0DB 4NUGL 5INCA 3RDTA 4Q74A 3UYRL 1IJ9A 5KSAC 3IXAB 1QR1B 5T5FL 2YPVL 1N59B 5ALBH 5C2UB 1EGJL 2EIEA 1RZKC 1CFTA 5AD0A 3EJYC 3LCYA 1FRGL 1K3ZA 3VWJA 1CLOL 4Z7QE 1Z3GL 2QSCH 1MH5A 3SKJL 4KZDL 3P30L 5DRWA 3BIBX 2FHCA 4CMHC 1S7QA 1FAIH 5KG9B 5F6IC 4LCYA 3S88H 1A9EB 4R4NC 1F6FB 2HKFL 1FLRH 1KLUA 5FHAH 5GS1A 4QOKE 4XNZC 1AD0B 4I4WA 5EZIL 4Y16A 3JBG7 2LVCA 3O4LE 1C5BH 3OF6A 4KJWD 4M3KB 3MRBA 4OSUH 3QDGA 4PJGB 4HWEL 1NJ9A 4OLVH 4U6XB 3TH2T 1U8HA 4CU6A 2CGRL 2F54E 3G5VB 3SE8H 4BFIA 5C0AD 4XAWH 4ZFOB 4EXPX 2B5IC 1QPXA 3NTCH 4K23L 1NEUA 5DRXA 1FYTB 2E3VA 1G0XA 4JANA 4DJMA 2OSLB 2GJ6E 2QADB 3UXFA 3CSBA 3TLRA 2YUXA 2DLFH 3NA9L 1OAQH 3KYAA 4H1LA 1L7IH 2VL5A 3PHOB 4WI9A 4QOKD 4L4JA 2ZNXA 3O4LD 4M61B 5IFHH 1YNLH 3IU3B 1WLHA 4R26L 1MIEL 1MSPA 1GGUA 4D0CB 4D0DB 3JTTA 4NHUB 4ZTPH 5JPMA 1GL4B 3BAEH 1B3JA 5EA0L 2ATPA 2F54D 3KPLB 2IBZX 4JO4H 2VLJE 3BFOA 3L9RB 3P11L 4Y4FD 1XAUA 2G5BB 1KPVA 2Q8AL 1QR4A 5KS9B 2GJ6D 1FL3A 2VDLL 4NYLB 1PQZB 1EO7A 2H9GB 1YJDH 5DEGA 3TJEL 1S7VA 3WMSA 5FDWA 3FFCA 3MA9H 4BQ6A 4LBEA 1JNHA 4IMLA 4X7TB 5C0BB 1K8DA 2CUIA 2PF6A 1FBIL 4AEEA 5J6GA 2R0KL 1S5IH 4XB8A 5H8DA 4LU5H 4YDKH 2ZPKL 3DTXA 4P2QE 1KBGL 2ICEB 4H26B 4WFHE 1B4JL 4G5ZL 5FK9A 2NPLX 1CDHA 5IESH 1ZLWK 2EDQA 2B7DT 2QSTA 1Y18A 1CLCA 1WBXB 4GW4B 4WY7L 2J8UF 3VRLE 3MRCA 1OAXL 1A7NH 1T21A 5D4QA 2QADC 3FRUA 3FO1B 3QQ9C 3QIBD 3DBXB 4Z0BL 1YMMB 1DN0A 2XWBA 1DLFL 1BZ9A 3IJYA 2ID5A 4NZTH 4YIQB 3JV4A 2XA3A 3OX8A 3I3DA 5DUML 5EO9A 3V0VA 3LZFH 4A6YL 5I1GH 4HIEA 1FNGB 2N7BA 3O3EA 3QCTL 1TPXB 3EIFA 4P2QD 4WFHD 3QQNA 5K9QG 3MRJB 1GZPA 1PY9A 4HFWA 5DO2C 4L3EE 1WUNT 4XH2A 1G6RH 4NFCA 3PF2A 3LB6C 1VACB 1FN4B 1MIML 3MXVL 3T0EB 2YR3A 2PCPB 4ETQA 2UWEA 4MA3B 4WO4A 4DZ8A 1S9XA 1T2JA 5DJ8A 1X4YA 2OJEA 5C7XL 1CQYA 4MAUH 4QY8A 5TDNA 3ZHDA 2R2CA 3VXQA 2AP2A 4L8BB 4UDUB 2HJFA 3VFPA 3S96B 3X17A 1X7QA 2ZUTA 4PRID 1HSBA 1SEQL 1QBLH 4XZUB 3RKDD 1I4FA 5D5MF 4K7PX 3UYPA 4JG1H 4UIKL 4MWFA 1F58L 4GT7A 4LL9A 2DAVA 3O8XD 4PP2B 3HPLA 1JGEB 4L8DB 1JPFB 4YEFA 4U1SA 3GI9L 3OKDA 1ZTXL 5DQ9B 5J1AB 1S9VB 3DECA 1DQDL 1VFBB 4HUXA 3B5GA 2YKLL 4F8QA 4YHML 4RQQA 3I02B 1EVUA 1R5VA 4KK8D 1FVDA 3TCLB 5AZEH 1TPXC 3F62A 4M48H 3MV7A 1A21A 4M7LH 1JGUL 1EHLH 3L7EB 4PRPE 4OLZL 3HE6D 2L7UA 3GM8A 4ZUUB 1GIGH 5F7HA 2R1XA 3GMPB 4JM2C 4P2RB 4NQED 5HI4D 4JQIL 3VFNB 3W39A 3WLWC 4X80L 1MJJB 3MGTB 3EOAA 1GAFL 2OJZH 3T1FB 3T0EC 3QDJE 1A6AA 1PY4A 1RUKL 5KSAA 1HYSD 1NQBA 1U8NA 2ICWB 4GG8A 5DSCB 1O7SA 2EDWA 1D5IL 4P9HL 1IQWL 4Z7WB 5E2TL 1XGPB 1CG9A 1I1CA 1PKQE 4O4YL 4PRPD 3X11A 2JCCA 1EMTH 2A38A 2QJDA 5DMIH 1JRHH 5ITFB 1P84K 2HFEA 3P77B 4KUCD 2XV6B 3HNVL 1AKJA 4DFIA 4XP9H 3OJ2C 2VDNH 5EU6E 4E42A 5JPNA 4IRSD 5CZVL 3B9EA 1KJ2B 1KN4H 2RGSA 3QDJD 3ZT5A 5TGBA 5JW5A 4QXTB 2D03H 1MCOH 1HIMH 3H9SE 5E00A 1QRNE 3CVHL 4Z5RA 1XCQA 5CUSH 2FO4A 2NTSP 2PW2A 4ZQKB 4NGHL 3KLHD 5FGRA 1B0WA 4GSDL 5FKPB 3P0YL 1ZS8A 1EHNA 4Z7OF 4G6JL 5IGXH 3BWUC 5FO8A 3VMNA 2H8PB 1N0XH 5FYJH 1FFOA 2V5SA 2EDBA 5EPMB 3REVA 5MEPB 4GG6A 4X6FA 1UWXH 4CJ0A 5EU6D 4AMKH 2HFGH 1BVLA 3HG1B 1XGQA 2HT2D 2UZYB 5F7DA 3D0VA 3H9SD 1QRND 3H3KA 4WFEE 1L9MA 5C0DA 4X6CE 2DTML 2KH2B 4C55A 3IXAA 3MGAA 1CE1L 3NN8B 3IRPX 3AFLA 3CFDB 4QHMB 1QR1A 1TTGA 1KC5L 3MRRB 4H25B 1WBYB 1N59A 4MHHG 4HWBH 4ZTOL 1LO2L 4KDWA 2GFBB 4PJ7F 1RU9L 5E2VL 1PEZA 4XWOC 4KHTH 3I3BA 5FIEA 4XBPB 4YHPB 4Z9KB 2F53E 2NY3D 4P4KC 4TSAH 5CS7A 1DLHB 3ZLQC 2WQRA 3O11B 3RWGB 1FYHB 4ZNCD 4FTVE 2DQGH 1RIVL 4Z76B 4WFED 3SGDI 5KG9A 5DWUH 1A9EA 5I15H 2EO1A 2MKWA 3DV6B 4ZYKB 1SYVB 5I30L 4Z7UE 1AD0A 5HGDB 1JF5A 3TBYB 1JGLH 2EO9A 3MUGB 1JNJA 1F02I 1CU4L 4PJGA 1A7BA 5A2IH 4Y1AB 4KJQC 2F53D 4U6XA 1NUFA 1QOKA 4YLQT 1BVZA 3WN5B 1JHLH 4G9FE 2H2PC 2J7LA 3O2DH 3G5VA 4GMTL 4RGOL 4ZFOA 1WQVT 4GLRH 1FYTA 5IVXE 4L3AA 2XFXB 4OCSL 2KKQA 2XIDA 2OSLA 4LDLB 1RZGB 2ATKB 5LGKA 1CI5A 2PO6B 1WK0A 3PHOA 3T2NL 2WWKT 1JYNA 4JAMB 1WFNA 4M61A 4MSWB 3IU3A 3MACH 4P99A 3LKSB 3KPNB 3L95B 4D0CA 4D0DA 4NHUA 4ZUVB 3HUJF 4L29B 3EYVB 5GISL 4G9FD 1S7SB 4GAYB 1JPTL 3KPLA 5L9DL 4PD4K 3HRPA 4K94H 3P9MB 2F5BH 3L9RA 3WBDA 2G5BA 1E4XI 3VXMB 1WFTA 1EUUA 1A47A 5D93B 1T7WA 5CGTA 3F6LA 1PZUB 3Q5YA 1PQZA 2H9GA 4XPAL 5TPWH 2AXFB 2XKSA 4UT9L 3KLAB 5C0IB 3DOSA 2HFFB 4OZFH 1DBJL 4OCRH 2O5YH 5BQ7B 4V2CB 1MWAH 4X7TA 3TBTB 4B7LA 2CK2A 2HKHH 5C0BA 1J0JA 2WP3O 1LE9B 1JZ4A 3IAGC 3K7UA 5I16B 1C16B 2ICEA 4H26A 1LO0L 2PETA 2NX5B 5JW4M 3TP4A 2XN9E 4M7LT 1EEQA 1JNLH 3TZVB 1OP3H 1UXSA 1OB1B 2WK2A 1AXSB 3IFLL 5E4EC 3VE0B 1WBXA 4GW4A 1QPPA 4EI5B 1J8HE 1K5NB 4HS8H 3FO1A 1G9EA 2PO6C 3OKKB 4PGZA 2LABA 3DBXA 1YMMA 2B2XH 1G6RB 4GAGL 4TUJB 5ACZB 3RGHA 1R3LB 4YIQA 4XCYB 1FNGA 1MCRA 2HG5B 1YJDC 5FM8A 4DGYH 5T1LB 5J13B 1ZT1B 4JO3H 3WNNA 3MRJA 2XN9D 4Z7VB 3DVGB 4J3WA 3G9VA 3HE7B 3MOAH 3NIGE 5L6YH 4UNUA 3WIIL 1OARL 2CR3A 4QRQB 4PRAB 1VACA 1FN4A 4K3DL 3T0EA 5D93C 1J8HD 1CD1B 2W0FB 2PCPA 1QSFD 4MA3A 4OCNC 3ZKND 4MVBC 3D3VB 4F80A 3CIQA 3FFDB 5SV3A 1V3KA 4PJEB 5FYKL 4L8BA 4UDUA 4KK9C 4O51B 1PG7L 1GOHA 3S96A 2CRYA 4KAQH 1T03L 5CP7B 2EDDA 4JRWA 4LEXL 4XZUA 4JFXB 3BX7C 5I1EH 4PGJA 2R1YB 2EYRB 5HJ3B 2IGFH 1I3RB 1NSNH 3TZVC 4FP8H 3N85L 4J4PC 1QACA 1TZIB 4PP2A 1JGEA 2QEJA 1JPFA 4L8DA 4EI5C 2XA8H 5IUSA 5DQ9A 3KPSE 4LHQB 5J1AA 1S9VA 4AQOA 1VFBA 4WI7A 4YNYB 1MCBA 3WFDH 2JB5H 1MRFH 3I02A 4I77L 3C87A 1JHTB 2CPCA 5KAQG 5DT1L 3TCLA 3AM8C 1PDKA 1QUNA 2VDKL 3BZFB 2AK4E 3U1SH 5J13C 2GCYB 3L7EA 2ZOKB 3QUMH 4XCCH 4OLEA 1XCTB 4ZUUA 3HE7C 5I66B 4R7DB 2EDYA 3GMPA 4P2RA 3VFNA 1I7TB 4U7SA 1F2QA 1MJJA 5T1DL 3MGTA 1II4E 2DDQH 3NAAH 3RPKA 3G9AB 3T1FA 2EE2A 4XB7A 3KPSD 5EUOF 1U3JA 3GSWB 4TQEH 3PWJB 3DMMD 4N5EC 1CGYA 5TQ0H 2ICWA 5DSCA 2A74B 5DA4A 1GHFL 5I1LB 2AK4D 4Z7WA 4FZEH 3FQWB 1XGPA 3VFWB 3UZVB 1Q0YL 5KVFH 1WBZB 1BJ1J 1JTTA 2MPAL 3UTQB 1T1YB 5ITFA 2P45B 3QCVH 3P77A 4XC1L 4OD1L 4MLSA 4HH8A 5DJAB 4TPRL 5EU7C 1KJ2A 4K3EH 3MLPA 3JWNC 4QXTA 1ITBB 1RZJH 3ILQD 4HK0B 4MA1B 3CMGA 3WDJA 5DEZA 4ZQKA 2IH1B 35C8L 4I2XE 4P59L 5FKPA 3IGAB 3BDYH 2IPUK 2H8PA 2BSSB 4MXWH 5EPMA 4DVRH 4AY0A 5MEPA 2QBWA 2AXJA 2BNRB 5LG1A 4OCXL 3U6RB 3CD4A 3HG1A 4F3FB 3LMJL 4X6DB 3FONB 4PPTA 5EIQA 1F00I 5CLTA 5F3HB 3T2OA 4UTAL 4JCMA 2ENYA 4ZDHB 1GYAA 3NN8A 3CFDA 4QHMA 4OQTH 5JIIA 3MRRA 4H25A 1WBYA 4G7VH 2DLIA 2GFBA 5HHVL 2IBBA 2CKNA 3GBNH 1DEDA 1OGTB 2DD8L 3MJ6A 4XBPA 4YHPA 1I3GL 3LKOB 2IF7A 4PJ5D 2ORBH 4YXKL 5KBNC 4FFZH 4KJPC 4POUB 1DLHA 1YEIL 3IDIB 2UZIH 4KVCH 3CX2A 3O11A 4WCYH 25C8H 3RWGA 3TF7C 3GMRB 2HTKD 4Z76A 3RKPA 4QHUB 3VDCA 2DLHA 4MA1C 3DV6A 2AEWA 1ROWA 4ZYKA 1SYVA 4OQ1A 2UZXB 3QXDB 1FH5L 5HGDA 2FGWH 3TBYA 4FQ2L 4TOYH 1TVHB 3KPPB 3KNBB 2EH8L 3MUGA 2IANE 1MY5A 3T1WA 4LSUL 4Y1AA 4ELMB 3WN5A 5TQ2L 4G9DB 4NP4H 4Z78B 3KXFD 1ERNA 1HINL 4ZODA 3RDTD 1ZAGA 1EBAA 2XFXA 1MRCH 2Y06L 5C0GA 3SQOL 3KPMB 5K9JH 1AGCB 4GFTB 1VPOL 1RZGA 2ATKA 1MJ8L 2EDFA 3VGAB 4U6YB 1EPFA 1HNFA 2PO6A 3GJFK 1V3MA 2BNQA 1RK0B 3R1GH 4KGJA 4M6NH 2G9HB 1K85A 4JAMA 3VWJD 4MSWA 2ITCB 1VGEL 3S98A 1NFDE 3LKSA 3V6BR 3KPNA 3L95A 1H3PL 3MLTB 4OZFB 4ZS7L 4ZUVA 3WFCL 2P43B 3EYVA 4L29A 1S7SA 4GAYA 3HC0B 2PUQT 1MWAB 4DKFH 1WISA 5I1JL 3P9MA 4XRCB 5EBWB 1JZ7A 3VXMA 1JIBA 5FYKE 1IZJA 3KPTA 4ZPTA 4C57C 4X0KB 4Y16D 2AXFA 5C0IA 3KLAA 2HFFA 4NCC2 3OF6D 1HYRC 1TQBB 5BQ7A 2NR6D 2X42A 4QRRB 3QDGD 1INEH 2JTDA 3TBTA 4BZYA 1LE9A 3VRIB 5DC9B 1QG3A 4K3GA 2R4RH 3LRGA 5I16A 1C16A 2C26A 1W72H 2NX5A 2R56L 3C6SB 3V8OA 4X4YB 4NHCH 3QPQC 1KJMB 2YMXL 1N7MH 3TZVA 5IWLC 4XNXL 1OB1A 5FYKD 5IBLC 1AXSA 3CX5J 4CMMB 3VE0A 4J4PA 2HJKB 3HZYB 5KVEL 4EI5A 4ZXBB 4HUMB 5CILH 2X1QA 3FFCE 2Y6SC 4WUKH 1K5NA 4QWWD 3VGAC 4J8RB 1DL7L 2E8YA 5CZXD 3OKKA 4HMCA 4K94C 2GTZB 1G6RA 3U9PH 4TUJA 3U4BH 4KI1A 3VGGA 1R3LA 5T3XH 1MPAH 3ZL4H 4MJIB 4XCYA 1CGSL 4Y19B 2HG5A 3GKZA 3AM8A 3BIKB 3RRQA 1BQLL 5HD8D 5DDHB 5T1LA 2X5PA 1QLRB 5D8JH 1ZT1A 3DI3B 4M8VA 3RZWA 3QNXB 5I1AB 3L5XL 4MNQB 4Z7VA 3PP3H 4M5YH 2ICWJ 3HE7A 1X4ZA 2CR6A 4X9IA 2F15A 2XTJE 1UKSA 4PJXB 4QRQA 4PRAA 2C4FU 1AXIB 5ILTL 3FFCD 2A6JB 1IAIM 3EW3B 1CD1A 2W0FA 3MCLH 4ZFOL 5M7QA 3DVIA 4EUPH 4XVTH 3F7YA 3VWKB 2ARJB 3D3VA 1TQBC 2XZCH 1IKNA 1C08B 4PJEA 3HC3H 3EYSH 2BDNH 4O51A 3EHBD 5TF1H 1U8IB 5CP7A 4JFXA 2VSCA 2OMNA 3SJVA 1GJIA 4OZHF 2R1YA 1JBJA 4PV8B 2EYRA 5HJ3A 1I3RA 4DW2H 2XTJD 2ARWA 2UWEE 3FZUD 4OCLC 1TZIA 3RUGB 5JUEH 3QUMB 4ZXBC 2JELH 3THMH 3RY6A 4P3DB 3D85B 4XBEL 4NKMB 2RFXB 4FQ1L 4I3SH 1CL7H 3SY0B 1NCBH 32C2B 1JHTA 1IE5A 1RULL 3BZFA 2E9BA 2GCYA 3HB3C 2ZOKA 5D96B 1JUFB 1XCTA 3MOQA 5I66A 4R7DA 1P4BH 2R69L 1I7TA 1NC4D 4P49A 4WO4D 3PUCA 5GGQH 4HXAL 2PTVA 1MAKA 2Q7NA 3GSWA 2A6IB 2VXVL 1Z2KA 1UM6H 4KPHH 1O7VA 3K4ZA 5CZKA 3PWJA 4DN4H 3VWKC 7FABH 4HJGB 3ZDYF 2AJXH 3O2VL 1RUML 3MV7E 2A74A 1A7QH 1DBAL 2JIXB 1H3TA 1Q94B 1QSZA 2B4CC 5I1LA 3DV4B 1N6QH 1WFUA 2L7JA 4NPYB 3FQWA 1PD6A 3VFWA 2ZG2A 2FATH 1WBZA 4HX1B 1AY1H 1TJIL 3UTQA 4DOHB 1T1YA 1ZGLP 3TBVB 5CEXB 5DJAA 5DJCB 5MEOB 4X7FC 3L5JA 2DQHH 2VDQH 3X3FL 1LO5B 1JHKH 5HPMB 3TA3B 4HK0A 4OZFG 2N1KA 4LSTL 2C5DC 4O02L 3VW3L 5F96H 3SDXB 3MV7D 5GJSL 1N64H 4NRZB 2IH1A 5JW4R 4G6AD 2BVQB 3IGAA 2JCCE 2WSKA 3IXTB 5BVJB 5DZNA 1HNGA 2BSSA 2O5ZH 4G6FB 4DVBB 5D96C 5E8EB 2VC2H 1V7ML 2BNRA 1IAIH 1NAKH 1T1ZB 4S1QH 3U6RA 1B90A 2LTQB 4YQXL 1BBDH 4HWBA 5H37H 4F3FA 5KSAD 3ULVE 4X6DA 1B0RB 3FONA 1RZ8B 4M1DL 1HH9B 5F3HA 1XF3B 5L8LB 4KHXH 3X14B 1R6VA 3EO0B 4JRXB 1ZGLA 4L4VE 3EJYD 1C5CL 4G8IB 2WQ8A 4HV8B 2R0WL 3EDKA 6CGTA 3TM6A 5TE6H 1RZJC 2BVPB 3TYGL 3LN4B 1J5OL 4GG6E 1AKJD 1OGTA 2A1WH 4GO6B 5KZCD 3LKOA 4PYHA 1NCNA 3BRGC 3ULVD 1BECA 1G1CA 2VZSA 3IDIA 2FEDC 4FFYH 4R4ND 3LY6A 3ZTNL 3C2SA 3GMRA 3KJ6H 3LKNB 1RK1A 4QHUA 3V4VL 3TA3C 4K8RD 3HR6A 1OSPL 4ODUB 2EXYC 3O2DA 4XTRC 3OR6B 1Q72H 4X6EA 5GHWH 3NFNB 1UWEH 3LIZH 2NY6B 3VH8G 3GKWH 4BSWB 1LP9B 4RISH 1U3ZA 2RB8A 1TVHA 2VUOA 3KPPA 3L3OB 1MHEB 2G2RB 3KNBA 1WAAE 5TE7H 5FM5M 4DGIL 1AD9A 4HIIB 4ELMA 3CSPA 5CCKH 4HXBH 4Z78A 4G9DA 5L8KB 1JPSL 4NZJA 2LTQC 4XCFL 3DSFH 5C0RL 5DD5L 2P8PB 5IWLA 5F7UA 5K9KB 4JQVC 1NMAH 3NFSL 1IBGL 2DQIL 3R0MA 3KPMA 1KV3A 1AGCA 4JDTH 1KJ2L 4U6YA 2ZUWA 1J0ZA 4FQCL 3TIEB 4R7NB 2G9HA 1TJHH 5KSUB 1FNEB 3MLVL 4PJGE 2ITCA 1DBML 4PLKD 2XWJB 3MLTA 4OZFA 4NDMB 2I25N 3HC0A 1MWAA 2QQNL 3VRLF 1FYTE 5E5RB 3L5IA 1S8DB 4XRCA 5EBWA 1VCAA 3ULSB 1UQSB 3WS6A 1G7QB 4YHIB 2RQ8A 2IALB 1FPTL 1W72B 1DBBH 1TZHB 5EC2B 4QRRA 2ICCA 1I1YB 2NY6C 4C4KO 2YA1A 4UDTB 2QSCL 1CDIA 3VXUB 3VRIA 4KI5E 5C08E 1XMWA 4TULH 2CXGA 3BW9B 4HK3J 5HYSB 1FAIL 4NKIL 2EIDA 4KY1H 4OT1L 1OCWL 1FYTD 3S88L 3QEQB 5E8OA 4PRNB 3C6SA 4N8VG 5H2BB 4X4YA 1INQB 5KS9E 5IQ7H 1KJMA 1FLRL 2QADD 4QCIB 3MLYH 5FHAL 3QQ9D 1N4XH 4J3OC 1FZJB 1QO3B 2HJKA 3ARFB 3HZYA 2V2XB 4J1UB 3EYFB 4ZXBA 2UYLB 2N7AA 3K4DA 1C5BL 4PRDA 4J8RA 4OSUL 1YY8B 2F8OA 3DURB 1SYSB 1UH3A 2GTZA 2WBKA 3R0NA 4M7KH 3N1PC 3VI3E 4CADB 5IFAL 3QUZC 1NDMB 1YZZA 4KKCC 3PABB 4KI5D 3SE8L 2NYYC 4MJIA 4Y19A 3BIKA 4X6BB 4EUPB 5IVZB 3F58H 5DDHA 4HQQH 5DO2D 5J89A 1KPUB 1QLRA 2AEIT 2D4DA 3S9DB 4OUUB 3LB6D 5I1AA 4MNQA 4XNQB 3OAUH 4OGXH 2DLFL 1OAQL 3TO2B 1L7IL 2RCSH 2IQ9H 3ARBB 2CKBH 4OFPA 5HPOA 3D2UB 4QNPE 3RPIB 4PJXA 3KS0H 3KWWB 1GGBH 2EEDA 3BD4A 2A2QT 5FV2A 2A6JA 3T2QA 1YNLL 3VWKA 4PJBB 2ARJA 2V7NB 4ZTPL 3BAEL 1C08A 3KAAA 4JDVB 4HIJB 5JIHA 1XGUB 3ZTJH 4JO4L 3GK8L 1U8IA 2VR5A 3C60B 4KUCF 1OQOA 3LPGA 4G80B 1BWMA 5JXEC 4LQFH 3F65A 1J1PL 1YJDL 3BE1H 4PV8A 5IBUB 3MCKB 1AE6L 1CF8H 3DRQB 1VFMA 2BVOB 3I3EA 3MA9L 4M6AA 1MCDA 3ARFC 3RUGA 3QUMA 1UEMA 1P4IL 5F9AC 1S5IL 1S9YB 2J2ZA 4LU5L 4P3DA 4YDKL 2BOCB 3ZSTA 4PLOB 3D85A 3BGFC 4NKMA 3BXNB 2RFXA 3W9DB 4MCZB 3SY0A 1T5XB 4CVUA 3MV11 32C2A 5CINH 4Y0GA 5IESL 1JWUB 3WLWD 5EOQH 1OP5K 2QR0B 1A7NL 3WFEH 3I6LE 1JUFA 1FFPB 3T0ED 4LKCB 1P6AB 2R0LH 4J7RA 3ARBC 4HJ0D 4HMDA 4NZTL 5D2LB 3ZE0E 1EERB 3H0TB 1X5KA 3LEYL 5I1GL 2V6HA 5D2NE 3T09A 2PYEB 4M9OA 1PAMA 2D9CA 5ISZB 4HJGA 2YK1H 3V0WH 2R9HC 2G5RA 1HQ4B 1P7QB 2JIXA 1Q94A 2NXYC 1OAYH 3ARWA 5DMKB 1G6RL 3MNZB 3DV4A 3M8OH 1R3JB 3C60C 4NPYA 4RDQF 5HHQB 1JL8A 4LVOB 4HX1A 4OCWH 1FAKT 5CKAA 1QZ1A 3LSOB 4ZOBA 1ZLUK 1CDGA 4N0UB 3TBVA 5CEXA 5DJCA 4W68A 4X6CF 5MEOA 3PDDA 3ZE2E 1EO5A 1U58B 4JQXC 2OTUB 1LO5A 1RJYB 5FXCH 3H9YA 5IW6B 3TA3A 4RAUB 3PL6B 1SMOA 3S5LB 1QBLL 2VQUA 4YWGH 3SDXA 4NRZA 5E2UL 2BVQA 1I9JH 3STBA 5K9OB 4JG1L 1R5IB 3VFUB 3IXTA 5BVJA 3A6BL 4LCWB 4OLUH 2PR4H 1U8JB 1KTLB 4I0KA 5LBSH 5E8EA 4OQTA 3VI4E 5JOFB 5EUKB 1T1ZA 5E4IA 3N0PB 3DYOA 3AROA 5GZOC 2FEEL 2HVJB 4JQVA 1B0RA 3OQ3B 3QAZB 5GGTH 1RZ8A 2C3GA 1HH9A 4Z7UF 1XF3A 1NLDH 4BA8A 5HYSG 1IGIH 4M48L 3X14A 3OKEB 3FO0H 1UZ8B 4M7LL 3EO0A 1EHLL 4IHOB 4JRXA 4NWUL 2AJVH 3X12B 5J11C 4XWOD 1GIGL 4G8IA 4HV8A 1TTFA 3WV0A 2BVPA 2H3NB 5TDOB 2OJZL 4LGRB 5L88H 1XF5B 4LVOC 4DEPB 3U9UB 5IVXF 3HG1E 1SJXA 4NFDA 3DWTA 3T0AA 3QRGH 1P9MC 1MCEA 3LKNA 4ODHH 3PL6C 1UB5B 4ODUA 1J8KA 5EG6C 4TNWK 5CEZH 3NMEA 1EMTL 3OR6A 2BY0A 4AIOA 5DMIL 1JRHL 1KEMH 4NNPH 3NFNA 2C3XA 4KJQD 2XZAH 4BSWA 1LP9A 4UUJB 3L3OA 1ZT7B 2H2PD 4RFEB 3U30B 1MHEA 2G2RA 1KN4L 2OP4H 4W70A 2D03L 3HG1D 4HIIA 1J1XH 1HIML 3OB0H 5CUSL 4R97B 2PW1B 2P8PA 5K9KA 1S7XB 3QAZC 4FHBD 1OWWA 2FEEI 2EH7L 2RIKA 5IGXL 3T3ME 5EOTA 1N0XL 5FYJL 5IBUG 4P23B 3B5TA 3BEWB 4R7NA 4JFYB 3SCMB 2VXUL 2F5AH 3TIEA 5KSUA 5MEQB 1FNEA 4AMKL 2HFGL 4Y1AE 1CE6B 4WNQB 5JZ7C 2XWJA 2VLKB 3VG9B 4DEPC 4NDMA 1FORH 5AAWA 3HNTH 5L2JB 1JN6B 1RZIB 5F1KC 5KSBB 1S8DA 3L3JB 5ERWB 4OI8A 3GNML 3OWEA 2YZ1A 3ULSA 1MVFA 1UQSA 1ZE3C 1G7QA 5F70A 2XZZA 4YHIA 4HWBL 2VZOA 2IALA 5D7IB 4HC1H 5CP3H 1NCDH 1W72A 1P4LB 2N4IA 4KHTL 1LE5A 1FNSL 1TZHA 1BQHB 1P6FA 5EC2A 2BVEA 1I1YA 4Y1AD 4UILH 4TSAL 4UDTA 3TJHC 1LEIB 2D7QA 3VXUA 4Q9RL 4OLYH 3U30C 3NIGF 4KDVA 3BW9A 1V7NH 2DQGL 5HYSA 5JXEA 4YBLB 5DWUL 4AENB 3VXME 3QEQA 4M93B 5I15L 4PRNA 3W5NA 1Q38A 5H2BA 1INQA 1NL0H 4R97C 4BK4A 4QCIA 4KV5F 4QTIH 3U48A 3RL2B 2BRRH 4XVSH 2PO6D 4QLRA 1FZJA 3KPOB 1QO3A 5JQ6H 3ARFA 4O2CB 4ZG1A 2V2XA 4J1UA 3EYFA 2UYLA 4NC1E 1JGLL 1YY8A 3PWLB 2CKBB 4O2FB 2ZUVA 3DURA 1SYSA 3DROB 2UUDK 4P23C 4G6MH 4HCRH 1JHLL 5F6HJ 4B0MM 2EECA 3V6FB 1WCBB 4CADA 1NDMA 4IJ3B 4RGNC 5I1IH 3WO4B 1CVSC 3O2DL 4TSBH 1ZHLB 1M71B 2VWEC 4X6BA 4CVXB 2NX5E 5IVZA 4EUPA 3ULUH 1FG9C 3VG9C 1KPUA 1RJZB 1PJ9A 4OUUA 3VXMD 4OFVA 4XNQA 3CJJA 4YHKH 4KROC 3TO2A 3ARBA 2GYSA 2XZQH 3D2UA 2ZNWA 3RPIA 3KWWA 4MVBD 4LLUB 2WWMC 2EE6A 3MACL 4LLDB 5E5UB 5EIVA 5C71A 4KK9D 1P7KB 4PJBA 2V7NA 3CZFA 1PSKH 1FCGA 5C07B 1UKQA 4AIXA 3VXTA 3ABZA 1MCPH 2KL6A 4JDVA 3CU1A 4HIJA 1XGUA 4ENEC 1N6VA 4K94L 2F5BL 1Q9OB 2NX5D 3CXDH 3WNKA 4E41B 4Z7VE 2R29H 3C60A 3WD5L 3TZVD 3LDBB 3ZKSD 4G80A 4YBLC 1QFUH 1YC7A 4J4PD 4KK6C 4M93C 2BVYA 4EI5D 3MCKA 4Y2DB 2FB4H 3NIFE 3DRQA 4U05A 3NCBB 4OCRL 2BVOA 2O5YL 3VXRB 1A22B 3CX5K 1MWAL 3JWDH 5EO0B 1ZWIB 3SGJC 3TVMB 4JQXA 2HKHL 1WFOA 5GGSY 5FF6B 3BP4B 1S9YA 2BOCA 1AFVH 1R24B 2W59A 2DI7A 5ADOH 3BXNA 5T1LD 3W9DA 4MCZA 1T5XA 1MCHA 4XVJH 4IJ3C 3UX9B 3WO4C 1F4YH 3F12A 2OYPA 1JNLL 1CDBA 3VGBA 3V4PH 1JWUA 3G6DL 3HE7D 2D7NA 5ICXB 4P4RB 3V7MA 1FC1A 2QR0A 1ETZB 4NM4H 1RZ7L 4FFWC 4OF0A 3JUYA 4HS8L 1J1OH 5C9JB 4I3RL 1FFPA 3FAWA 4LKCA 4UINH 5ELIA 3WUWB 5JORB 3FRPG 2CK0L 1ODAA 2B2XL 2B8OT 4KKAC 5J3HC 2QQKH 3D3VD 2DQFA 4N5ED 5D2LA 4JE4B 3H0TA 2PYEA 4DGYL 5ISZA 3GFUA 2E8ZA 2R2EB 1IRAY 4RFNB 3B8YA 4JO3L 2APBA 1HQ4A 4OFDA 1P7QA 3UYRH 1UGNA 4MAYB 5L6YL 3AAZB 5DMKA 3MNZA 1W8NA 1A5FL 1R3JA 1NDGB 5HHQA 3LDBC 5JMOC 4UU9B 4IDJL 4IRJC 3HFML 3LSOA 3FB5B 3GHBH 4N0UA 4Y2DC 5JIPA 2CLVB 3AMLA 1CLOH 3DI2B 4FQJH 5JOPE 1P9MA 1U58A 3LS4H 1CGTA 3TVMC 3QP3A 2OTUA 5IJKC 3QJFB 1RJYA 2DQTH 3QEHB 3BKJH 3EBAA 4WEMB 5IW6A 4KAQL 2HAZA 2XXMB 3PL6A 3S5LA 2ERJB 2VN7A 5I1EL 5JOEA 2QHRH 2BCKB 1ZXQA 1ZSDB 2IGFL 1NSNL 5K9OA 3VFUA 1R5IA 4P2YA 4FP8L 2D9QB 5DVNA 4LCWA 3PWVB 3EYUH 4AQ1B 2DQCL 2JK5B 3LRSB 1U8JA 1KTLA 2YA2A 3O4OC 4Y4HB 2XA8L 3MBEB 4WENB 4HEME 2B4CL 5I18H 5JOFA 1BQHG 5EUKA 3NZHH 5DVKA 2W38A 5JOPD 1J10A 1FJ1B 2HVJA 4I13B 1QSVA 2CGRH 4Y5YB 4NM8L 4MDJB 4O2EB 1MJ7H 3OKEA 4MA7H 1UZ8A 3U1SL 4RFNC 4IHOA 1OWRM 3T8XB 3ZSSA 2RBLA 3X12A 3ESVF 5IQ9B 5M94B 1NKRA 3OKNB 3LN9A 2W9EL 1B4RA 3MGOB 2H3NA 4G7YH 2DDQL 5KOMC 5TDOA 1T04B 4JFOB 3NAAL 4E5XB 3GSVB 1XF5A 4KJPD 4F7CB 3VDBA 3QQ3B 4TQEL 5CBAB 4X6DE 3UAJD 5FGBC 5A43C 5TQ0L 1KIUA 3GDBA 5BRZE 1GCFA 4G8FB 5K93A 3CXHJ 1KACB 2QKIB 2J12B 1E28B 3F7RA 4FZEL 1UB5A 5KVFL 2ERJC 2F74B 5DC0A 4CKVX 1NFDF 4AEHH 1T7YA 1BLNB 1BM3H 3FRPA 3QCVL 4I1NB 2ENSA 3RZCC 2BNRD 3C2AH 2VLRB 2HTLC 1O5DT 4UUJA 4RFEA 5BOZG 4K3EL 4Y4HC 3IDYB 3MBEC 4BSJA 1RZJL 1F8TL 1ND0B 1KPRB 3B9VA 2A73B 2PW1A 1KBGH 5IHLB 1S7XA 1V05A 3B9KB 3EJZC 3D69B 1FG2B 4Y5YC 1OAKH 4LLWB 3VFMB 4H0HB 2KPNA 1XGRB 4MXWL 3QG6B 4DVRL 4P23A 1OTUC 3BEWA 4JFYA 2X89A 3SCMA 1DFBL 5MEQA 4Z0BH 1DLFH 2AQ2A 1IGMH 1CE6A 4ELME 4WNQA 4WVRA 5A16B 2VLKA 2OQJB 5L2JA 1JN6A 2ZKHL 4OFIA 1RZIA 1Z9LA 5KSBA 2Y9RT 1I8LC 3L3JA 5ERWA 5GIRB 2C7UB 3BESR 3AS2A 4PJAB 1BQSA 3BVNB 3ETBF 5D7IA 5L7XH 2X4RB 1MIMH 1P4LA 4NO2B 3GBNL 1UEYA 4LVEA 3RAJL 3V0AC 5KANG 15C8H 1BQHA 1A6UH 3WUWG 2JLLA 2VAJA 2ORBL 4DGVH 5FM5O 1LEIA 2AKRB 4FFZL 3U46B 4KVCL 1R3IH 2UZIL 4WCYL 25C8L 1A3QA 3QPQD 3IDYC 5T1KB 4YK4B 5C6PB 5IBLD 2DMCA 3UTTB 3IJHB 4AENA 2XRAL 2E9IA 1SEQH 2Y6SD 1MCCA 1WGOA 1M7DB 4PV9B 3KPOA 5C0FB 2FGWL 4O2CA 4TOYL 1F58H 5IIEB 1X44A 3CCHA 3PWLA 2CKBA 4O2FA 3DROA 5FUCC 3V6FA 1WCBA 4LLMB 1IGJB 1ZHLA 1M71A 3BIAX 4CVXA 4WHTB 4LIQE 2E7HA 2NY0B 1MRCL 1RJZA 2UWEF 5HDOA 5K9JL 3H42H 2D7MA 2A77H 3R1GL 2R39A 4M6NL 1L7TH 5JTWA 3MNWB 1EV2E 4QRRD 5GSVB 3S4SB 1YNKH 5A3IC 4DKDC 2R8SH 4LLDA 1P7KA 2P5WB 4MJIE 1FIGH 4Y19E 1TZGH 5C07A 1RUKH 4DKFL 4HIXL 3MRNB 1K9TA 2ESVB 4QTHB 1Q9OA 5CBEB 4E41A 1D6EB 2BHYA 4I18B 1X5YA 4WWID 4K71B 3DX6B 3GSNL 4PJXE 5CLWA 4ZD3H 5DXWA 4KTEH 4ZXBD 4Y2DA 4BFGA 4R4FH 3VXRA 1U2CA 3LOWA 1INEL 5EO0A 1ZWIA 3ECBB 3TVMA 5IJKA 3SGDH 5FF6A 2J8UE 3BP4A 1YEEL 5CZVH 4ZNEA 5IHZB 4MJID 4PG2C 4Y19D 1R24A 5K9QI 2R4RL 4PGCB 3TFKC 4TTGA 1W72L 2J5LB 1C8PA 2XWTB 1N7ML 3ILPB 4MNQD 2HP4A 1HKLH 4NGHH 5ICXA 3NACH 4P57B 4P4RA 3RVUC 1ETZA 4P5TD 4AJ0A 5CILL 1HI6B 4WUKL 5C9JA 1BREA 2B0SH 2BY1A 1RUQH 1SJEB 2NZIA 3L3HB 3RUGE 3WLBB 5JORA 4JFEE 2HMIC 2DJ4A 4HKBB 3U9PL 3DUUB 3VWKD 3U4BL 3U79A 5T3XL 1MPAL 1Y0LB 4YFDB 5GS2H 5E03A 1IEBB 3QIUB 2JCCF 5KW9H 2R2EA 5D8JL 1JCKA 3JWDC 4UB0H 4M5YL 1M6OB 1LD9B 4MAYA 1A7RH 3AAZA 4LF3B 5F7NC 1NDGA 1YEJH 4QXWA 5A2JH 4K71C 1UWXK 3UTZB 4UU9A 3MCLL 3UO1H 3ULVF 3FB5A 4ODSH 5TH2B 4XVTL 4OJFL 5FGBA 2CLVA 4OZIB 2XZCL 1MEXH 5BOPA 1E4XH 4QRUB 2COQA 3HC3L 3EYSL 3QJFA 2BDNL 3DYMA 4M4PA 5TF1L 1VFOA 1FFNA 5GRXG 2E5EA 4IEFB 4YDIL 5JQHC 3ELAT 4GG6F 2D7OA 2J5LC 2KUTA 1ZSDA 4U1MB 5MENB 5GGTA 2EDEA 1TLKA 4DW2L 4QT5B 4DOHE 5I8OH 1QKZH 3ALPA 2BK8A 3PWVA 3LRSA 2JK5A 4EDXB 4K07A 1AO7E 4Y4HA 2GEEA 5JUEL 3BJLA 3MBEA 2JELL 3THML 4AK1A 3HZMB 5FGSA 5C6WH 1CU4H 1U8PB 4Q9CA 4UZGA 1U93B 4URTB 4PRHB 2DMKA 4I3SL 1U6AH 5HI3C 1CL7L 4APQB 5GJTH 5FGCE 1QLEH 4Y5YA 3SDXE 1E27B 2JIXD 3PJSB 4MDJA 4O2EA 4TYUA 3RIFK 3ZT6A 3QIUC 3HPJB 1IEAB 2J6EL 3EDDA 2IMMA 3T8XA 4ZAKB 1WAAF 4OF5A 3HNSL 2X1OA 5CSGA 5IQ9A 1P4BL 3OKNA 4OIIL 3MGOA 1TCRB 1T04A 4JFOA 5GGQL 4E5XA 4JZJB 4RAVB 2FEDD 2JE8A 4F7CA 3QQ3A 1UM6L 1A64A 2Y07H 4LFHG 1K3IA 4DN4L 5CBAA 1N5YH 3BI9X 7FABL 2AJXL 3P73B 5GISH 3RA7L 3TA3D 1YQVL 1I8LA 5HGAB 4NJAH 3EZJB 4G8FA 2Q20A 1A7QL 2EXYD 4XNYH 4RMSA 4XTRD 2QKIA 1A14H 1N6QL 1E28A 4PJGF 1IAKB 2FATL 5K59F 3DRTA 4TNWF 5KVDH 1AY1L 1BLNA 1HZHH 1XFPA 2NMSA 4G6FD 1DBJH 2VLRA 4PB9L 5EORH 4L4TB 4NZRH 3S4SG 2DQHL 2VDQL 2GJJA 1JHKL 3OR7B 1ND0A 5C09B 1KPRA 2A73A 4LKXB 4U3XA 3KS0J 4HUUB 2D0GA 4JB9H 5F96L 2GI7A 4APQC 1N64L 4JRXD 3D69A 1FG2A 4B7IA 2GIYA 4Y7MA 3DUHA 4LLWA 3RGVB 1CL7I 3OGCB 1F6LL 3IFLH 1LEKB 3VFMA 1CXEA 5ACLA 3HMXH 1JYWA 2O5ZL 1XGRA 3MROB 4KI5F 3FMGH 4ZAKC 1RSFA 2VC2L 3QG6A 2V9RA 3RU8L 3OPZH 2OK0H 1IAIL 1NAKL 1G84A 1SJVA 2IC2A 2V2TB 4S1QL 1DZBA 1BBDL 4HC1A 5CP3A 4H0GA 3LQMA 3U82B 5KS9F 5A16A 4JZJC 1UACL 2NY2C 2OQJA 3MRFB 2WMPA 4KHXL 2YD7A 1WTGT 1MCWW 1KB5H 1OP3K 1F42A 1CK0H 4JRYB 4X8JB 3UCRA 1OY3B 3IRZA 5GIRA 4JFHE 2C7UA 4PJAA 5GPRA 1T66C 3BVNA 5TE6L 3VI3F 3QUXD 2NY6D 2X4RA 3BPNB 3CPLB 1KT2B 4NO2A 1G1YA 2Z92B 2A1WL 2CUHA 5D72H 2J88H 5EIIB 1HHHB 3Q1SH 1AJ7L 4HWUA 1EFXB 4YGVB 4B50A 2AKRA 1HHGB 3U46A 5IB5B 1OQXA 4FFYL 4QNPF 5T1KA 3KJ6L 1JYVA 2VE6A 2FJHB 2GK2A 3IJHA 4HCRA 3UTTA 4NKQB 1MQ8A 1DJSA 5ADPL 2IAMB 3BQUB 5F9WB 5ID0B 1Q72L 4LCCB 1M7DA 4PV9A 1UWEL 3LIZL 5GHWL 5C0FA 4OD3H 3GKWL 1A6ZB 2D7TH 3RGVC 2P24B 3JV5A 4N0FB 4Y5VB 5TE7L 5IIEA 4KKCD 4LHUB 5DHVH 2NYYD 4PG2A 3BGAA 3VXUE 3V52H 3W9EB 1F90H 3CH8A 4HF5H 5IV2B 2F58H 4HXBL 5CCKL 4LLMA 5DD6B 1IGJA 3WE6B 1Z5LB 4EN3B 1IAII 4WHTA 5T3XE 2HT4D 1BJMA 3O45B 4UV7L 3C9NB 2QHLA 5C0CB 2PNDA 1G7HB 1TJHL 3MNWA 2NY4B 1A4KB 1UYWH 2CLRB 1JTPA 1UWGH 5GSVA 3S4SA 5EC1B 4GS7B 3BPNC 3KJ4B 3VXUD 3FQUB 4P5MA 2P5WA 1JWSB 3MX0A 4PS4L 4KZEH 4RDQG 1A6PA 1WEJH 2X2YA 5JXED 3MRNA 4PJFB 3K46A 2APVA 2ESVA 4QTHA 1JNNH 1Q8MA 3QEQD 4JFQB 5CBEA 5T3XD 4G8EB 2CJUL 1QBAA 3DX6A 3ZE0F 3ARFD 1DBBL 4MXQC 1G7PB 3ZKXB 1Q0YH 4EVNB 3U2SB 2IAMC 3BQUC 5F9WC 1WJ3A 2MPAH 4LCCC 4AYFA 1G7LB 3ECBA 4PJBE 5LKNA 1URLA 4LLYB 2YUZA 4TULL 5IHZA 2E7CA 3ISWA 3TGXA 5FFLA 5KVGH 1A3RH 4KY1L 4PGCA 4WU5B 4OLWH 2IPUG 5ECJE 2C3VB 1IGFH 5HSFA 3O6MH 3H3PL 2YWZA 5I73B 4EN3C 2XWTA 5IQ7L 3GSOB 3MXWL 1KF9B 2OX5A 3ILPA 3MLYL 1N4XL 3ARBD 5B4MC 4P57A 3LKPB 2YXFA 3ZE2F 1HI6A 1OL0A 4N0RA 1SJEA 3L3HA 3WLBA 4HKBA 4M7KL 3DUUA 2NY4C 4OCXH 2R9HD 1KIQB 1Y0LA 5H35B 4Z7WF 3F7QA 3MV8B 3SDYL 4GS7C 1IEBA 2JJWA 3KJ4C 3F58L 3QIUA 2YC1B 2O5XH 1MCLA 4JHWH 4OZ4B 3C60D 4MNGB 5LQBH 5HDLA 4FA8A 4AH2B 3OAUL 4OGXL 5IJVB 1M6OA 2FIKB 1LD9A 2RCSL 2IQ9L 1CXKA 2CKBL 1MFCH 1MVUB 4LF3A 1B6DA 1GGBL 5DJ0B 1RY7B 1WCQA 4U6HB 3UTZA 4XVUC 5DJYB 2Q87A 2HJLB 5TH2A 3ZKXC 5D2LE 1RQ5A 1IARB 4KKLC 4HLZH 3U7WL 4OZIA 4X83A 1S5HB 4QRUA 1I3UA 4Q9QH 5F9OL 5ISZE 4XP6H 1T7XA 1UG9A 3TIDB 5E56A 2RJMA 1TENA 1CGUA 3ARPA 1VSCA 4LQFL 5I1DB 2PN5A 4U1MA 5ESQB 5MENA 1CF8L 5I73C 3WCYA 4OD2B 1U3YA 2X4UB 4KJYB 3AS3A 2AEQH 3IFNH 4EDXA 5GZOD 2EC9U 4NQSB 4QHKJ 2VDRL 1XR8B 1U8PA 1U93A 4PRHA 5ISZD 4HBCL 4APQA 3Q0HA 5CINL 3K2MC 5B21A 3VD3A 1P7QD 1E27A 3PJSA 4Y8DC 4WTXA 5EOQL 5GZNC 3HPJA 5L2KE 2KQNA 4ZAKA 3WFEL 1FV1B 3PHSA 4LCWE 3I2CH 4QXGH 1JV5B 5KAQF 1RFDH 1TCRA 3WL9B 5LGJB 4JZJA 4RRPG 4RAVA 3TPKA 1BJ8A 1T83C 4LSDA 4MD4B 4LQ1A 3W2DL 3X3GL 4WUUE 4X4ZA 2YK1L 3V0WL 1KELH 3P73A 3S6CA 5HGAA 3TH4T 3PL6D 5DD3H 1DVFB 4WRLA 3D39B 5DRZB 1FDLL 2AJUH 3V6OC 1JK8B 3G5ZB 1FZOB 5E6IB 2L0DA 5L2KD 1IAKA 1I9EA 4LCWD 1UT9A 2X4OB 4OCWL 3KYKL 5FCUH 5E94A 4R6UA 4YDLB 1UCBH 4F9LC 4L4TA 2Y36L 5IG7B 4S1DC 4KWUA 5F1NB 3SDDD 3OR7A 3WO3B 2O61B 4TNVK 5C09A 4I9WE 4LKXA 4HUUA 4YWGL 3SO5A 3D18B 4FQIH 3RX7A 4K7PY 4NBYB 4HGMA 1I9JL 1X5ZA 1TVDA 4PJIB 3RGVA 3OGCA 4HDIB 4B41A 1LEKA 1KB5B 2PR4L 2XY2A 5LBSL 3E2HB 3MROA 1JZ3A 3UTSB 1U3HB 5JZ7D 3WJLC 1B2WH 2IFGA 1NCWH 1KCKA 3EOBB 2V2TA 3FOLB 3VGDA 2W1NA 1NJ9B 2Q1EA 5GGTL 3SDAB 1CDUA 1CGSH 3MRFA 5DFWH 1NLDL 1IGIL 4I9WD 3FO0L 3NFPB 4JRYA 4X8JA 4PP1C 5DK0B 4ZUTB 4S0TD 2AJVL 3HAEH 1DVFC 1UH2A 4P46B 2DJSA 3ZKQD 3PG2A 5E6IC 3CPLA 1KT2A 5L88L 4JFFB 4JY6B 2Z92A 2A83B 2E27L 3OAZH 5EIIA 3BWAB 4YDLC 4AEIH 1HHHA 3MUHL 2V2WB 1EFXA 3L1OH 3QRGL 4YGVA 2LFGA 1QFWI 2EEAA 1HHGA 5IB5A 2B1HH 5DHVB 1MFAH 2WW8A 3PP3K 3MCG1 4R2GB 4ODHL 2FJHA 1MOEA 3RVXC 4R9HA 2P1YA 5CEZL 2IAMA 3BQUA 2VZTA 5D7IE 5ID0A 1KEML 4LCCA 4NNPL 2XY1A 2PTTB 2XZAL 4P23D 1A6ZA 2X89D 3SCMD 2NCMA 3MJ9H 5INDB 2P24A 1YEFH 4N0FA 2OP4L 2ADJB 4Y5VA 4LHUA 3UJJH 3E2HC 1JFQH 3W9EA 1U3HC 4Z7VF 5IV2A 5A2KH 5DD6A 3NIDE 3WE6A 1Z5LA 4EN3A 3T2PA 1NBVH 1UVQB 3NIFF 1UM5H 1FHGA 3SDAC 2XG5A 3O45A 4JHBA 1M05B 5I1CH 3R06B 4X8XA 4WW1B 3C9NA 5F89B 2EDXA 5C0CA 2F5AL 2R15A 3PIQB 1NAMH 2ZUQB 4P46C 1FNFA 1A4KA 5F7YC 2CLRA 4P3WA 5EC1A 1EAPB 4OGZA 3KHOA 2XPGB 4ENED 3FQUA 5EO9B 4Q9BA 4N8CH 1FORL 1X5XA 3T77B 1E4KA 1JWSA 4EBQH 4YC2B 2WANA 3NVQA 1ORSB 1FNAA 2VITB 4PJFA 2WNGA 4RBPH 5DVLA 1NUNB 1RUMH 4KK6D 4DKAA 4JFQA 1I1AB 5FM4A 5AZ2L 4G8EA 3HUJA 1DBAH 4XNUH 4FXLA 2DN7A 1IM9B 5EBMB 4R2GC 4HC1L 5DHYB 1NCDL 2HT3D 5CSZB 4UQ3B 3K3QA 1G7PA 1YN6B 4EVNA 3U2SA 3O3UN 4K55A 3KYOB 4GH7B 4JKPH 1Y6MR 1PG7X 1G7LA 3S37H 4UILL 3L3DB 1DQTA 4OLYL 4LLYA 3VXNB 3RJDA 3DVNB 1V7NL 5C70A 4OM1L 5T33H 5J6HB 4WU5A 2C3VA 5EOCL 1FE8H 1HSBB 1NL0L 4FFWD 4XCNB 4H88H 3GSOA 3VDAA 4QTIL 3EKCA 2BRRL 1HDMB 4UV4L 5JQ6L 1AR1C 2BERA 4BUGA 3KDMB 3LKPA 4KKAD 1U42A 1A0QL 3QFJE 2XACC 1TQCB 5J3HD 3RWDB 4J2XA 1X5JA 1BAFH 3STLB 4RMUA 3RWIB 5SWQB 4G6ML 4GRLB 1HCVA 4OV5B 4ZNEE 2ZUQC 5MI0B 4XBGB 5I1IL 1KIQA 5H35A 4DK3A 5C07D 3MV8A 1Z0MA 3VFGH 4TVSa 4PG9B 1YPZB 2YC1A 3N9GH 4M1DH 4E41D 4G8GA 4YC2C 4MNGA 3TBSB 2OI9B 4AH2A 4YHKL 5IJVA 2FIKA 4YX2L 2WBWB 4MD5B 4XMPL 2XZQL 2Z8WC 1I1AC 1MVUA 4Y2DD 1BGXH 1C5CH 3OAYH 3WHE0 5DJ0A 2DM4A 4U6HA 3VXRD 4WEBH 5DJYA 3DPBA 3TVMD 2HJLA 1T83A 3K74B 4Q6IB 2YN3A 4OZHE 4AEFA 1PSKL 1S5HA 4L1DA 3BH9B 5E8DH 1FSKB 5IFJB 1MCPL 4C56B 1LO3L 3TIDA 3V6OA 2R29L 2LU4A 3FOMB 1KYOJ 3V4VH 4XXCC 1QFUL 3V6ZB 5ESQA 2FB4L 1H15A 1WSST 4OD2A 1D5MB 4X6DF 4F9LA 4F9PC 2X4UA 3GZKA 4KJYA 3PHQB 1D3CA 3JWDL 4ZO9A 3O9WB 1T22B 3V5KB 4OTXH 1TQCC 5E08L 4NQSA 1ZLVK 3VFTB 1L9NA 4N0YH 5AYQA 3MV9B 1XR8A 1AFVL 3PXJA 2YRLA 5ADOL 4GRLC 5HVWA 4XVJL 5MI0C 3EGSB 3TCXA 5C0RH 4N68A 4CDHA 4YBQC 3F7VB 4X99B 3V4PL 4MAYD 4OLXH 4ZOAA 3RIFF 1WICA 3NFSH 2DBLH 4KTDH 2DTSA 4NM4L 2DQIH 3QUKB 1J1OL 4S10A 1FV1A 3WJLA 2OI9C 4UINL 3FO9B 3RIAK 1CBVH 1RMFL 2JKXA 3KVQA 1JV5A 2XQYK 5FYLE 2EDLA 2X1XR 3WL9A 5HYQB 1T80A 1OD7A 5LGJA 2K9UA 2XOTA 3DXAB 5D7LB 4WI5A 1BOGB 1DBMH 5DFVC 4PJHB 4MD4A 3CVIL 4Q6IC 4MDIB 2PYFB 4NZDA 5D6DC 3MODH 1MCSA 2QQNH 1DVFA 1FSKC 5SWSB 4D9QE 3D39A 5DRZA 2VISB 3QXAB 1JK8A 3G5ZA 3VXPB 3A67H 1FZOA 3FN0H 5E6IA 2CMRH 2HTLD 4ELMF 4KRMB 5TJWK 2X4OA 4JO2H 2EKSB 1FPTH 4QHLB 5I1HH 1NFKA 2ZUYA 3LV3B 4Y4HD 3GHBL 5FYLD 3C5ZC 2H45A 1YNTB 2M1KA 3I75B 4FQJL 3QZWA 3LS4L 2LQRA 3O9WC 3HMXA 5IG7A 2DQTL 3BKJL 2QLVB 5F1NA 5C0AE 3EJZD 2O61A 2ITDB 5TF0A 4HS6B 3HC4H 4OKDA 4NKIH 1WTLA 4OT1H 4NSKA 5CJQH 1OCWH 1MI5B 3D18A 4D9QD 2QHRL 4PGDB 5HGGS 2DQUH 1KCUH 2EC9T 4PJIA 5B22A 1U8LB 2VDMH 2BSRB 4HDIA 3BKCH 3FQRB 3EYUL 1KB5A 3UTSA 2I26N 2VLRE 1U3HA 3HAEB 5I18L 2HLFC 5J57B 3EOBA 1ONQB 3FOLA 3NZHL 4EIGB 4LPUA 5J7CC 5GRZA 5IFAH 4B53A 1JZ2A 4HW6A 5C9KA 5CD5C 3SDAA 3P4NB 3MYZA 1LDPH 1MJ7L 4MA7L 4YHZH 3NFPA 5DK0A 4ZUTA 3VFVB 5EBGA 4WTZA 3GM0A 4P46A 4TRPH 1KIPB 3JV6B 5E99H 2XKUA 4G7YL 2Q7YB 5FUCE 3S34H 1YEHH 4JFFA 2VLRD 4JY6A 1L4IA 2A83A 4ZSOB 3BWAA 4WW2B 2V2WA 1NGWB 1EAJA 3BRFA 4NO5B 5DHVA 3GHEH 3KHQA 2IJ0C 2OXGA 3GK8H 3B9KD 4PJAE 4JGUA 1E6OH 1T7ZA 2GJ6B 1OD9A 3QT2A 1TNMA 2P48B 3S35H 4V1DB 5IEKB 3AVEA 4AEHL 1BM3L 1J1PH 4LMQI 4ESKA 1AE6H 2PTTA 3TPUB 1KN2H 1ACYH 2KQMA 4FS0A 3C2AL 5INDA 2ADJA 3HI1B 3V79C 5B3JE 1P4IH 1A1MB 3GJEB 1NAMB 4HK3N 1E4WH 8FABB 2G75B 4PJXF 1UVQA 2VLJB 3UTTE 4RX4A 1MELA 2J4WL 2X09A 4AZ8A 1F11B 2MQCA 1OAKL 1UXSB 2DIJA 1TDQA 3I85A 1OF2B 1X9QA 2KZ1B 3DHMA 3ULUE 3MZGB 1S9KC 3WDIA 1M05A 3R06A 5F1OB 4WW1A 4OCMC 5F89A 5HGBB 5EDXA 3PIQA 1G9MC 4KXZH 1IGML 1EAPA 2VQTA 2XPGA 3LEYH 1RIUL 2CIIB 3AGVA 3G08B 4OF6A 3T77A 1J0KA 4WW2C 1ORSA 2FECL 2JB6B 3ARVA 5T1KD 2VITA 3UTTD 4PRIE 1O0VA 1EJ6A 1LK3H 3RUGF 1I1AA 3BP6B 2GITB 3CSYB 1IM9A 3LVEA 2E6PA 2FHBA 2FHFA 4JM2B 4KTYA 4MQXD 3IT8D 5EBMA 3ULUD 5DHYA 2Q6WA 2I9LB 5CSZA 5L7XL 3MRHB 4UQ3A 3GJFH 1YN6A 1NC2B 1QEWB 3TBWB 15C8L 3KYOA 2A0LC 2FL5B 4KMLB 1A6UL 4MJ2A 3E0GA 4LFHD 5GXBB 4U49A 4HWNA 2Q8BL 3L3DA 4DGVL 2LU3A 2P5WE 5ID1B 3VXNA 1R3IL 4RZCB 1ZEAH 3DVNA 5JHDB 2H2SD 4HGKC 4XNMB 5J6HA 4XXCA 3RVUD 2NY0D 5CSBA 1WITA 4XCNA 5TE4H 4L3EB 4F9PA 4HPOH 1HDMA 5E2UH 5H94B 4J23A 3KDMA 2HMID 4NQEE 2X4QB 3RWDA 3A6BH 2DIBA 3STLA 5FECB 2Z8SA 4IOFC 1VFAB 2EXWC 3RWIA 5SWQA 4GRLA 1ZGLM 3FO2B 3GSRB 3HLAB 1OTSC 4OV5A 2P5WD 2N56A 4XBGA 1UM4H 1GVIA 3LH2H 5BW7C 2W9DL 4PG9A 1YPZA 1NCUA 2VMFA 2ESVD 3TN0D 1N2RB 1QP1A 4EJ1C 2AI0H 3H42L 4NN5B 3TBSA 2A77L 4KUZL 4MD5A 4NWUH 1L7TL 1F4HA 4NZUL 2FECI 4KRPB 3MRQB 1EJOH 1YNKL 1NUGA 2R8SL 4Q6IA 3SDXF 1AC0A 3HAEG 1FIGL 1Z9OA 5D6DA 3RNKB 1TZGL 3BH9A 4JY4B 3RP1A 2XICA 5IFJA 4C56A 3CNKA 1U8QB 4HZAA 3R8QA 4ZMAT 3FOMA 5CFHA 1TVBA 2QSQA 2X70B 4BJLA 4ZD3L 4KTEL 3V6ZA 4R4FL 2ZUSA 1D5MA 2R2BB 1CFSB 4HULB 2BOBB 3PHQA 4GXUN 4P4KB 3O9WA 1T22A 3V5KA 3AC0A 1KG0B 4OZIE 1S7TB 5HI3D 4UMGA 5F7EH 2EE3A 3VFTA 3VD9A 2VDOH 1E4JA 3MV9A 5DS8B 3VCLB 3RL1B 3RVWC 1BVKB 3MLZH 1WWCA 3QIUD 1GPOH 1QD0A 3EGSA 3PGDB 5FYKU 4NNYB 2OR7A 3F7VA 1HKLL 1RHHB 4KK8C 4X99A 3NACL 5MENE 2L4OA 2D4FA 3QUKA 2EH7H 3PGCB 2B0SL 4NN5C 2VJXA 1RUQL 4Y4KB 3FO9A 5GGSB 4CW1A 4JO1H 4M00A 3ROLB 2VXUH 4KRPC 5HYQA 3QDME 3DXAA 5D7LA 4EZMA 1YC8A 1BOGA 3OB0K 4PRHE 4PJHA 2MCG1 3MLUH 5KW9L 1KLGB 4MDIA 2PYFA 1C1EH 3T4YB 3QXTA 4UB0L 5SWSA 1LP9F 4K3HA 4ZO8A 3O3DB 5CD3A 1A7RL 1CGVA 5I71B 1WWWX 2VISA 1MF2H 3QXAA 3VXPA 3GNMH 5MEND 4U1GB 1YEJL 5CEYB 2X4SB 3CH1B 1GXEA 5FOBB 5F97E 2EYTB 3WFZA 3UO1L 2EYSB 2EKSA 4QHLA 4PRBB 3QNYB 3LV3A 4ODSL 3WJJC 1FNSH 5IP4A 1YNTA 3QDMD 4NNXB 1MEXL 3QEGH 3I75A 1E4XL 1Z6JT 1PYWB 3MLWH 4IRSC 4CJ1A 4PRHD 3WS3B 4Q9RH 2XQBH 3PDOB 3LS5H 5DQDH 5JNYB 2ITDA 4TNVF 4HS6A 4KKNA 4P48A 5T3ZH 1MI5A 1T6VN 2BVUA 1WZ1H 4PGDA 4ALAH 4HJJL 4ZAKD 2FBOJ 3KLHC 1PKOA 3EYQC 1U8LA 2BSRA 1QKZL 3OKMB 3FQRA 5I8OL 4KU1A 1J0IA 2UVFA 3FB8B 4ZPVB 3DJ9A 3HAEA 2W9LA 8CGTA 4Y4KC 1XGTB 1ONQA 2YUWA 3WDHA 1OPGH 4KDTC 5ALCH 1U6AL 1TTUA 4UAOB 4YJZL 3SDCB 5B38B 1GOGA 1I7UB 1N26A 1WIOA 5GJTL 2QSVA 5BZWB 4O5LH 1QLEL 4FTVB 3P4NA 2W91A 5E4EB 1VFUA 1KIRB 5JA9A 5C0GB 3QWOB 1RZFH 5DK3A 4GXVH 3VFVA 5DHXB 1KIPA 2BNQB 3JV6A 5I71C 3G04B 2Q7YA 4GBXD 4U1GC 4ZS6D 4U1LB 1D7FA 1NANI 3I84A 4L4TD 5LXGH 4ZSOA 2Y07L 1N5YL 4WW2A 4LPTA 1U95B 1NGWA 3MJ9A 3QO1B 5C09D 3REWB 4NJAL 4NO5A 4JRYE 4XNYL 2FNBA 1UC6A 1V8HA 5IVXB 3TESA 1A14L 2OXHA 2A9NH 2GJ6A 5IEKA 3WD5H 4V1DA 3RGVD 3HZKB 4ZPTB 5KVDL 2CIKB 5DMJB 4J3TA 1HZHL 3MYJB 3RVTC 3TPUA 3QI9B 5EORL 4J3UA 1F6AB 2MHAB 3HI1A 4NZRL 3MLXH 2Q3ZA 1A1MA 4NCC1 3GJEA 1NAMA 1BP3B 8FABA 2G75A 4JB9L 4WI4A 2VLJA 4UAOC 4JRYD 3SDCC 3LPWA 1VKXB 1CIUA 1F11A 2QTEA 3ALWA 5EB9A 5GS0H 4U0QB 5MERB 3G6DH 5I0ZA 1OF2A 2X4PB 1MQKL 4PJBF 3BZ4B 4X4XB 3HMXL 1RZ7H 5BZDB 2D31B 3FMGL 3IDNB 4G3YH 2X7LB 3O2WH 5HGBA 5JW3L 4I3RH 3OPZL 4JFPB 1QSFE 2OK0L 4NQUA 1NGPH 2CK0H 4ONGH 5KJRH 1HOCB 2AV7B 4Q6YA 1EFXD 4MQSB 3GJFB 1BEYH 3UPCA 2CIIA 1H9VA 3G08A 4JN2B 3T0BA 2JB6A 1KB5L 1IZKA 1TNNA 1CK0L 3BSZH 1XZ0B 1LWRA 1OHQA 2W0PA 4P5KB 3BP6A 2IAMD 2GITA 3BQUD 3CSYA 4JM2A 3O6KH 1H3VA 1W2KT 2OTWB 2I9LA 1A5FH 1J8HB 3MRHA 3UBXI 1NC2A 1D5ZB 1QEWA 3TBWA 3S3JA 5EBLB 4IDJH 2FL5A 3HFMH 2J88L 5D72L 1CDCA 3Q1SL 4KV5E 3F7YB 1HQRB 3X13A 4NQCE 3QI9C 2BXZA 4KKBD 3GRWH 5ID1A 2UY7A 4RZCA 2P5EB 1EH9A 4EN3D 5JHDA 4LK4A 3O6FB 4BH7B 3MJ8B 4XNMA 5E2JA 5B4MD 3QFDA 1XEDA 5IW1B 5FB8B 3OV6A 4L3EA 5D2LF 3SJVB 1CFNB 5IBTL 5H94A 4OD3L 3ALXA 2D7TL 5C0CD 2X4QA 3B2VH 2NY4D 4AG4H 2DQCH 5FECA 2AERT 2VR9A 4U6VL 1VFAA 3K8KA 1DEEB 3V52L 1FFRA 1F90L 2B4CH 2ICES 4HF5L 1CTNA 2F58L 3FO2A 3GSRA 3HLAA 5FUOH 4NQCD 1GC1H 2X10A 1LQSR 1MNUL 2ZSVB 1JVKA 1TXKA 1XGYH 4OCYH 4FABH 4PJ8B 4Y8AA 3S8WA 5FOJA 4NM8H 1N2RA 3H2WA 3OJDB 1R3KB 4NFBA 3BDXA 5D7KE 2CXKA 3DHJA 4XVUD 2HA1A 1MFBH 1SMAA 3MRQA 4KKLD 2VKWA 1UYWL 3HHRB 3QHZH 2W9EH 4K7FB 3IETB 1UWGL 3EDJA 3ARQA 5I6XB 1U8MB 1IC4H 1U2HA 4WGVB 4KQ3L 1AGBB 3TC9A 4GW1B 3IFOB 2WAHA 4PJCE 3RNKA 4KZEL 1FL6B 1HHJB 1WEJL 4JY4A 1FCCA 3T04D 1NUDA 3H7LA 4WHCA 5B38G 1U8QA 1AC6A 1JNNL 3DIFB 4MNGE 2G60H 4TTDD 5GS2D 5IKCB 3O6FC 1RD6A 3MPCA 2X70A 5D7KD 1S9WB 3WJJA 1J7VR 3ARXA 2YHGA 2R2BA 1CFSA 3KG5A 2BOBA 4LEOB 4U6TA 2CQVA 3I50H 1WZMA 4P4KA 2LE9A 4CVWA 4LAQH 1KG0A 1S7TA 2EDRA 3ARDB 3QDJA 4NBZB 5KVGL 2XXCB 3MV8D 5DS8A 1EZVY 1A3RL 3VCLA 3RL1A 3UEZA 1BVKA 4OLWL 1F8TH 2YD6A 3V6OE 1IGFL 2H32H 1IMHC 3TO4B 5GZND 1NEZB 3GMQB 3O6ML 3PGDA 4NNYA 3B8SA 1RHHA 3V9FA 4PJ8C 2YPLB 3PGCA 3AXLB 5DD0L 1VHPA 1HH6B 1N5AB 2ED8A 4Y4KA 5GGSA 1CD8A 3RIAF 5GQBA 4X9FA 2EC8A 1ZOXA 2R1WB 1KOAA 3ROLA 2ILLA 2FIRT 2FLBT 4KDTA 4OB5H 1JYXA 1DFBH 4TVPH 5IK3B 3W11C 4PJ5E 3A0OA 3AUVA 5I6XC 1QNZH 4P2CG 2O5XL 1KLGA 4JHWL 3T4YA 2ZWLT 5LQBL 2ZKHH 3O3DA 3T65B 1ZGLB 2XNAB 4I2XB 2M8XA 1MFCL 2AJZB 2OZ4L 1RIHH 1QFPA 5C3LD 1A02N 1KYOK 5CEYA 2X4SA 3CH1A 5FOBA 2EYTA 2EYSA 3QO0B 4ZO6A 4MB5A 4PRBA 3QNYA 3RAJH 1NGQH 1UA6H 2NY1B 5M95B 4NNXA 4Q9QL 4JVPA 1PYWA 4XP6L 3WS3A 3ARUA 3KXFE 5LVEA 4M5ZH 3GBMH 3ARDC 1RI8A 3PDOA 5JNYA 4XCEB 1SY6L 1S3KL 3D39E 4JM4H 1TETH 1RK1B 3CZJA 3BZDA 3TO4C 2XRAH 4XPGH 2AK1H 2C1PB 5HHXH 1G0DA 5BJTB 4X6EB 3OKMA 1DR9A 2BJMH 2AEQL 3ULVH 3IFNL 3C5JA 3FB8A 2BVTA 4ZPVA 1H3WM 3ARGB 5HHNB 1XGTA 2CRZA 3L3KB 3LHPH 3HMWH 1AD9B 4K8RH 3TT1H 2ADGB 2YPKB 3SDCA 5B38A 4PP1D 1A6TB 1I7UA 1IM3B 5D7IF 5BZWA 1I1FB 4FTVA 3EO9H 1DVFD 1CFBA 1VESA 3D39D 4L3CB 1KIRA 4JEGB 3QWOA 1SM3H 4GRWE 5E6ID 1C12B 3QB7C 1Q9KB 4HWZB 3I2CL 3HRZB 4QXGL 3B4NA 5DJZB 3UTSE 5B8CB 4JVUA 1RFDL 3G04A 5DMGC 3EZ8A 2AVGA 3NIDF 4U1LA 1NFIB 1UZ6E 3QDGE 2IANB 3KYNB 5IMKB 1U95A 1HE7A 2EDJA 1KELL 4ODBD 2NY1C 3QO1A 3REWA 2MMXA 3DSNA 4X9BA 5DD3L 3RVXD 1ZMYA 4HIXH 1PFCA