5T1DL

Crystal structure of ebv ghgl/gp42/e1d1 complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
217
structure length
217
Chain Sequence
DIVITQTPLSLPVSLGDQASISCRSSQSLLHSNGNTYLHWYLQRPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLMINRVEAEDLGVYFCSQSIHVPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein H
publication title Structural basis for Epstein-Barr virus host cell tropism mediated by gp42 and gHgL entry glycoproteins.
pubmed doi rcsb
source organism Epstein-barr virus (strain b95-8)
molecule tags Viral protein
total genus 38
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2016-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t1dL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t1dL01
3ZKMD 1A8JH 3TV3L 4P48A 5EG6C 1T1WA 3V5HB 5I1IH 5KTEH 4P3DA 3REWA 5E99L 3AM8C 4OZIE 5I1LA 1B9ZA 1DE4A 1UWEH 4WWKC 2VLRA 4GW4A 5GPRA 4P5KA 5CD3B 1RZJC 1F4AA 1EHLL 2HTLD 3IDMA 5I76B 5D8JL 1PG7W 1OARL 4G9DB 4FMFA 4C56D 1T03H 1RZJL 1T1WB 1P84K 4KPHL 2GTWA 4F58L 5GIRB 2AEQH 5I1LB 3G5ZA 2R2EB 3KHQA 3B2UD 5DJDB 5AWNH 1DE4B 3P0VH 1QO3B 1N2RB 2CRMA 1GYAA 5D5MF 3L3IB 1SEBA 1WCBB 3O2WH 3IDMB 3X14A 4HULB 1E4XI 1ZHKB 1CF8H 2BJMH 2DQCL 1V7ML 4PGCA 4J6RL 3OR7A 1XGUA 3KLDA 1WT5A 2VDQH 2ICEA 3EBAA 5C9JB 1P7QA 3PJSB 3QISA 4EDXA 4XP6L 2W91A 1PW3A 1NCCL 3MUGA 5IQ7L 1A2YB 4HD9A 3GDBA 2FD6H 3BT2H 3HS0A 5TQ2H 4PJ9C 2B1HH 2D31A 2YD3A 4WCYH 5DEZA 5DLMH 1F58H 4ZPTA 3QIWD 4P9HC 4OT1L 5DO2D 3RVVD 2YK1L 4PJDE 4IRJD 2DQTL 5C8JB 4X6EA 3VFOB 1XGRB 4JDTH 4JFDB 1EUTA 3OR6B 1P7QB 2BVQB 4LAQL 4EDXB 5CJ5A 4AEIL 4RGNE 4ZS7H 4YHNB 2FGWH 3OKEA 5FHAL 5IM7A 3D25A 1DLFL 1ZAGA 3U9PH 1IT9H 2R69H 2D31B 2JIXB 4H26A 4K8RH 3WFHB 4ZPTB 1X5XA 1Z9SA 2MJWA 2IAMA 3KLAA 2X7LA 4OAWA 1NFDF 2GW5A 4X6EB 5IVOA 4DFIA 1YEKL 2X89D 5D70L 5CJBA 4YXLH 5I75C 3F6IA 5JHDE 4UB0L 1NBZA 5DS8B 5E8OA 5A43C 4ZDHB 3OPZH 4HDIB 1NBVL 3OKEB 4BQ8A 3FO9A 1IEBB 5BV7L 1KJ2B 4ZUVB 2C26A 1QFWL 2AJVH 3BPOC 3CVHH 4NZUL 5E08L 3S34H 3P77B 2ZSWA 4P2QB 2UUDK 2R2BA 1NGYB 1KTRL 5LBSH 1QLRB 2X7LB 3MRNB 3N1MC 2JLLA 4EI5C 5D2NE 2J88H 1MVFA 4LGPB 5E8OB 1D9KC 2P5EB 3F12A 1UWEL 1ITBB 3INUH 4LLMA 3QXDA 5I1AA 5EZLA 2IPUG 2A6KB 3SQBA 4F7PB 3O8XA 2ZSWB 3V6FA 4HT1H 3P2TA 2R2BB 3R0MA 4NHUB 5KSUA 8FABA 1A4KB 1T03L 1G7HB 4AT6B 4WW1A 5I2IA 4I3GA 3TVMD 3RA7H 2Z31D 5HYJE 3RTQC 3W11C 1KPVA 4LLQA 1I7UA 1A7NH 1UJ3B 3ZE2F 1KJ2H 2F74B 2UYLB 5AWNL 1TLKA 4XWOC 3P0VL 4G42B 5I1AB 3B4NA 1M7XA 4HJ0D 4G43A 4DW2H 4XB7A 2H2SC 1HXMA 4QT5A 3O2WL 3QA3A 4Y4HB 4EVNA 1CF8L 2BJML 4U6VH 1GCFA 3VWJA 1CI5A 5DXWA 1CFSA 4NBXB 1C7SA 4N68A 2VDQL 3QEUA 4P2OD 2GY5A 1F4HA 4XPBH 4YBLB 2Q8AH 1NUNB 4DK3A 3CU7A 1IILE 2FD6L 4I77H 1N5AA 3BT2L 1B6DA 5J57B 1AQKH 4UQ3B 5EUOF 5K33A 5TQ2L 5JW4R 3FCTB 3SKJH 1HXMB 2B1HL 2P24B 1G9MH 4WCYL 5DLML 2AV1A 1F58L 2VH5H 5FO8A 1CICA 1FJ1A 5ENWA 5GZND 3RKPA 3BESR 4JDTL 4BK5A 1KJVA 2C5DC 3UTSA 4QOKE 1B6UA 1EEUA 2BCKA 3RJQB 1ZT4B 4K8RC 5SWZA 4B7LA 2FGWL 4IBLT 1ORSA 2BSSA 4G8EB 4NQEB 2D9QB 1RJZB 3TM6A 3EOTH 1FFQA 1FFOB 1NCAH 3I2CH 5C07B 1IT9L 3IDIB 4K8RL 4LSSH 3Q1SL 1S9VA 1T20B 2WWKO 2B5IB 4JO2H 1CFNB 4BQBA 4YXLL 5MHSE 4PREA 3WFEH 2BCKB 3D18A 1KNOB 4U1MB 3OPZL 5CHNA 5BVPH 1MY7A 2HVJA 3NCYS 3WUZA 4PGBB 3GM8A 2FH8A 3FQNA 3RVUD 3GJEB 1RIHH 1KTDA 2UWEE 3UCRA 1TQBB 3QFDA 3S34L 4Z76B 3VWKA 3GSQB 2L7JA 3BE1H 4PJ8A 4GUPB 4IJ3C 5LBSL 2UV3A 2AXGA 2VLKE 5B4MD 5HHOD 4K3HA 2B39A 1WWBX 1GZPA 1AD0B 2J88L 1MAMH 5B38A 1WITA 4IIQB 2VZTA 1OD7A 3FQUA 3OGCB 2XQBH 4UMGA 1PDKA 5CP3H 3VWKB 2ZG3A 4XPAH 1WBZA 4PJ8B 3MBEC 5TE4H 3WKMH 4K94H 4F7CB 3RA7L 2AXGB 3CDGA 4M61A 4RDQF 5IP4A 4G8GD 2VE6A 4UV4H 2V2WA 1A7NL 1KJ2L 1J1XH 1HH6A 4MQTB 3T65B 5JOEA 4WFED 3FTGB 3LVEA 1MH5A 5DUMH 3UZQA 4DW2L 4RDQG 3NIGE 1ZWIA 3MRJA 4PG2C 3P4OB 2WQ8A 3I6KB 5JXAH 1AD9A 5BW7A 1ZGLM 4U6VL 2IADA 3VXMD 3SCMA 2VE6B 4XPBL 1G9MC 2DLTA 2Q8AL 5KANI 5K9QG 1CXIA 3WXVH 2FO4B 1I1AC 1IVLA 4I77L 1IAKA 4C54A 2R15A 1AQKL 4M9OA 1GZQB 1X5JA 4Z5RA 4R8WH 1MH5B 3SKJL 2YUZA 1WBYA 5CZXD 1ZWIB 5I71C 1G9ML 1SM3H 1TZHA 1UJ3C 2D7QA 2VH5L 3BVNA 3OX8B 4QRPA 4MJ5B 4CDHA 1FZKB 5EU7C 2QQKH 1BWMA 3P40A 3QZWA 3CXHK 1MNUH 4UTAH 2BY3A 3EO1A 4P4KA 4KK9C 5GS1A 4QXWA 1DQQA 1AO7A 3EOTL 4Z5RB 1NCAL 3I2CL 3ARFA 1M71A 2V7HA 4ZFFA 2VN7A 4MJIE 4UINH 3MRHB 1TZHB 4LSSL 4LCIH 4NN7C 4P3WA 4YHIA 2CIKB 1Q8MA 3MV9B 4QRPB 4JO2L 5J6HA 1OW0A 5E6ID 5IW1A 4Z9KB 2BNQE 2MQ3A 3WFEL 1ZLUK 3DV6A 5BVPL 1I85C 4ALAH 1BFSA 3OMZA 4OZHE 4ZUWA 5GS1B 1RIHL 4R26H 5L7XH 5GRJH 2HMIC 3IU3A 2GJ6A 3BE1L 5DVLA 2F58H 4JANA 4XX1E 3VI3F 4DJMA 1C1EL 3DMMA 4A6YA 1QOKA 1ETZA 1MAML 4HGMA 4J4PD 5F88A 3DV6B 3HZVB 2NMSA 4BKLA 4U7KA 4I5BA 4TULH 4CADA 3L3HA 4K94C 5HYSG 2XQBL 2AQ3A 2VLME 1JTOA 4E41A 4CU6A 4XPAL 4WW2B 4WFGE 5FFLA 3RVTC 2VLRE 5DD6A 1AP2A 3HZYB 5CILH 5GRZA 4K94L 4PJGF 2BNUA 5IB2A 3HHRB 4A6YB 1ETZB 4BSVA 4KKAC 1GGUA 1J1XL 1X6NA 3WLWC 1RZIB 2EO9A 2OTUB 4I5BB 5DUML 3TPUB 4Y16C 4E41B 4OCMC 2WW8A 3PWPB 1AP2B 2K7PA 4ELME 4PRPB 5J3HD 1BX2A 3T3PE 1HOCB 1O0VA 3FQTB 1WZLA 1ZE3C 1IAIH 3JBG7 4R8WL 3ULSA 1SM3L 5GRYA 1VFOA 5ESQA 4FNLH 3JTTA 1D5BB 5E7FA 2ED7A 5JDSB 4MVBC 2QQKL 1JHLH 5SX5H 3GMMA 3GGWA 1NDMA 3U82B 4ZXBA 1MNUL 3BSZH 2QADD 3BEWA 4UTAL 3PQYD 3MRIA 2V2XA 3SY0A 2E9WA 4CVZA 3L5JA 2XI9A 4FP8H 3UEZA 3ETBF 3BGFB 3HPJB 5ESQB 3RGVA 3WE6B 4PGEB 1FL3A 1QFWM 1MVUA 3GGWB 4WJ5A 2V2TA 1X7QA 3BEWB 3QT2A 1AXIB 1OP9A 5JO5B 5KN5A 1A4JA 3QDHA 4CVUA 2AEPH 3VXRD 4R26L 1UM5H 2BDNH 3X12A 5GRJL 1ZT1B 1CXFA 4KMLB 4FQ1H 4U6HB 4MA7H 2BSTA 4MNQE 4D9RE 2F58L 4EUPG 4GAJH 2ITDA 5I8CA 3STLA 2ADGA 4WJ5B 4HPYH 2BHZA 5GGVY 4GRWE 2CQVA 1K4CB 4TULL 4U2YA 3KPRA 3O3EA 3T0EE 4BH8B 3X12B 1J8KA 1IGIH 2AK1H 3S5LB 3V2AR 3CZJA 3GIVA 4XPGH 3DARA 3DIFA 2ADGB 4GFTB 3QDMB 2YD4A 1PJ9A 5EOQH 1M6OA 1T7VA 4PLJC 1YUHA 5F89B 3TN0A 2CMRH 4JHAH 2VJXA 2J8UF 4M8VA 3O3EB 1FVDB 3TBSA 1XIWC 5GSRB 5E6ZA 1U93A 1HI6A 3ES6A 2VERN 3T3ME 3GJFA 4TUOB 4J23A 3DV4B 5HHNA 1U8IB 3WXWH 1J5OH 2O5YH 5IW6A 3E3QE 3TFKD 4GKSB 3MGAA 5CGYC 2P7TA 1YUHB 3TN0B 1G7MB 4NOFA 1HXYA 3D6GA 3ZHKA 1S5HB 3E6HA 1JPFB 4FZ8H 3MV8A 5J4MA 3QQ3B 4FNLL 4TRPH 3B6SB 4KROD 4PRHA 1EFXD 1JHLL 2CLZB 5I1DB 3CLEH 2Y9RT 2ZUXA 4PYHA 2C9AA 1DBBH 2OZ4A 5IVZA 1R5IA 4M6OH 3N1PC 4I0PD 3UTSE 4FP8L 3FN3A 2C3WA 1HXYB 4HXBH 2Z8VC 3MLRH 1JYVA 5SWZE 1OQXA 2WIIB 4LKCB 3HE7C 1U3HA 4Y19D 4NO2A 1BAFL 2VWEE 2YPKA 5KAQF 2P49B 3WSQH 2VZSA 3BW9A 3CX5J 5I6XB 1J0HA 1KG0B 3U0TB 2JB6B 1KGCE 2D0GA 4XPTH 5KAQG 1JF6A 1C12B 2AEPL 4Y5VA 4FFWC 1CK0H 1T7XA 4LPUA 2COQA 5DRWA 4JVPA 1UM5L 2BDNL 3MNWB 3LS5H 3BD3A 5GGVL 1P5VA 5I19H 4GJTB 1FSKB 1RUKH 4NO5A 4FQ1L 4MA7L 3GSVA 5A2JH 3FAWA 2VRAA 4XCFH 1E27B 4GAJL 4XC1H 2YZ8A 2CKNA 5I8OH 5IT2H 3DVGB 3BGFC 3LRHA 1CWVA 4JFYB 4HPYL 5IKCB 1W0VA 3RY4A 1Q94A 2GK0B 3V5KA 3D0VA 4M7KH 5C0EA 4LHUG 3MRCB 3QUZA 3DPBA 3MRRB 3UZVB 2EH8H 1YYLH 4JVUA 1F02I 4NO5B 4EN3A 1QG3A 2AK1L 4PJHA 3FO0H 1U9KA 4XCYA 1KEGH 5DJAA 4GW5B 5I1CL 2C7UB 2LU4A 3HAEG 4XPGL 5EOQL 4PTUA 1Q94B 1T7WA 3V95A 1MCSA 4JHAL 5FO7A 4HC1H 4JZNA 1ZA6B 4L4VE 4UUJA 3SE9H 1M7DB 3OZ9H 4X4XB 4KI5E 5F6IB 2ARJA 3EOAA 1YEIH 4WO4A 1D5IH 3EGSA 1CDHA 5T1LB 1MOEA 3GI8H 4XCYB 3WXWL 1J5OL 1VPOH 5EULV 5DK0A 1RZ8B 2VDPH 2O5YL 1EUUA 4MD0B 3TBVB 2AP2A 4PTUB 5AG8A 3OJMB 4LSRL 1I9EA 2XG5A 3WIFB 5D1QB 4UUJB 5HYIA 5MP6H 3UTOA 4FZ8L 1KPRB 4NQDD 3QIUC 2FH6A 5BS0B 4M5YH 4TRPL 4R0LA 2BFVH 4Z7WF 4OD2B 5E8PA 4K2UH 3MRMA 3P3YA 3CLEL 3CK0H 3EIFA 3AAZA 5FGCE 3UO1H 1MFNA 5F7KC 1DBBL 3PHSA 1X5ZA 4OZ4B 1G7LA 2CDFB 4IRJC 4HXBL 5IJVA 3MLRL 1LO4H 3MGOB 5E2VH 4LSQH 4IHOB 2H2PD 5I30H 2R1WA 2DLFH 2UY7A 2E6QA 1LD9A 3WSQL 1AO7E 2DDQH 4AEFA 4QRTB 4L3CA 3RGHA 1JN6B 2C3VA 4XPTL 4KV5F 1QBLH 1UB5B 1CK0L 1G7LB 1ZKAA 3LS5L 1OGAA 3QXVA 4RX4A 5I19L 4BH7B 4LPYA 1RUKL 2ZUUA 5IIEA 1LD9B 3L7EA 4XNXH 1ZLVH 4XCFL 3S35X 4XC1L 1Q1JH 4N90D 5IT2L 5IBLD 1TTFA 2XN9B 2GJ6E 3NCBB 5I8EB 3UX9B 5FUCE 5EO9A 4M7KL 1BF8A 2NY4B 2B8OT 1B4RA 4WTZA 3W39A 3TBYA 2EH8L 3WIIH 1YYLL 3KPLB 1I3GH 3IKKA 3QFJE 5IK3A 5GGSA 3QUKA 5E2TL 3FO0L 1JGEA 5F97E 2W0PA 3I3BA 5I1JH 4PJXA 1KEGL 1GC1H 4JQVC 4OZGE 3ZE1F 5J13B 4X6CA 2E7BA 2K9UA 3W0WB 5EU4A 3WFDL 4IRZH 4QHNA 4HC1L 4R4NC 2NTFB 2GJZA 2ERJC 2WLZA 2QQQA 3HR5B 3OKLA 3OXRA 3OZ9L 2PYEA 2XICA 1INQA 1ZA3A 5KSBA 2Y7QB 4G9FB 4LK4A 3C60A 4H5SB 1LNUB 1YEIL 2NY2D 4TOYH 5GGSB 1D5IL 4FFZH 1JGEB 4MYWB 4ZFOA 4X9FA 4TUJA 1VPOL 3ALPA 4KKCC 4H0HB 2VDPL 5EBMB 1D6EB 2E3VA 3MNZB 2NY7H 3RFZC 1XGPB 4LKXB 5H37G 4XCCH 2HRLA 4YDLB 3VRJB 2A73B 5MP6L 3GJFK 3DVNA 3OXRB 2PYEB 4P2OC 2IQAA 3C60B 2IPTH 3LS4H 4M5YL 2X1PA 1S7XA 3B9KB 4M4RA 2BFVL 4PJEF 4I13B 1RZGB 4OCXH 3FFCE 3CK0L 5D5MA 3UO1L 3TLRA 3FN0H 5IV2A 3D85A 3ZKNC 5B8CA 4RFEA 3NCMA 4LARH 1KOAA 1DQMH 1S7SA 5ISZB 5I30L 2DLFL 2IQAB 2HFEA 5C7XH 3T8XA 2DDQL 4O2CB 3RY5A 5D1QC 1A6TA 2DQUH 3GSUA 3ET9F 3UYOD 2W07A 5D5MB 3CZFB 3TZVC 5EFIA 3ECBA 1U8JA 1QBLL 1FN4A 2CUHA 2YHGA 3N85L 3HG1D 4FG6D 4G7VH 1XF2A 2IEPA 1OHQA 2KL6A 2PW2A 3RDTA 3ARED 4JHBA 4XNXL 4JPWH 4Z8FH 1JTTA 4WTWA 1Q1JL 4K3DH 4XAWH 3LB6D 4LGRB 1RFDL 4AQ1B 4XXDA 5F9AC 4OB5H 4PRDA 1U8JB 3BO8B 2VN4A 1H0DA 4CRPA 2Y36H 4NKMA 4EJ1C 1GC1C 1QSFB 4ZFZB 3WIIL 3IXAA 1XEDA 1XF2B 2XKNA 1U36A 1I3GL 1KIQB 2DB8A 3EFFA 3O3DA 3AS1A 5I1JL 3KPRE 2J12B 3WS6C 2C1OB 3H3KA 3GSXA 1VB9A 3BPLB 2Q20A 3K3QA 1KXVC 5E7BA 4IRZL 3OAZK 3WNPA 4NKMB 4UDUA 3S3PA 3NFSH 5DRXA 3MGTB 1HYSD 1NFDB 2XKNB 2X4SB 4Q6IC 4TOYL 3F8UB 4U6TA 4FFZL 1CQKA 4L9LC 4GRLD 4KH2A 1IAII 5IFHH 3BQUA 4LF3B 5DJ8A 1RULH 3G6DH 2NY7L 4U1KA 2MNUA 4PJ5A 1JI1A 2AK4E 3HI1B 1H8NA 4XT1C 3UBXG 5DA0B 5C0BB 3CC5B 1XGTA 3MSPA 4RMUA 2DOCA 4XCCL 5DHXB 4NKQB 3RBSA 5DRXB 1JPGA 4IDJL 4WFFD 1FVCA 3L6FA 4NOBA 4HIHB 2IPTL 4QWWD 4J1UA 3WBDA 5CWSB 1FNSH 4YGAB 2VYRE 5C0NC 4CW1B 3IJHB 3IU4H 3MV8E 3J8F7 4OCXL 3KPNA 3PWVA 3BQUB 2LV4A 2VDOH 4JFZH 1IQWH 3FN0L 3SKNA 7CGTA 2EYSA 3MRBB 1HHJA 1NC2D 4Z7UF 4PRHE 2YRLA 5E5RB 2VLJA 4LARL 4NZRL 1DQML 3PE9A 4RGND 1ORQA 3UTTE 1JPGB 4TTGA 5C6PB 5DWUH 4LVNB 4NFBA 4OFYA 5C7XL 3CMOH 3QXTA 1VESA 2BVUA 3BZ4A 4P5TC 4YHKH 2DQUL 4NNYB 5T1MB 1INEH 1SJEB 5B39A 3KPNB 4KUZH 2VKXA 3HCVA 4YHYC 1DANT 1T5WB 1MJJA 4X4YB 1RU9H 4PJAF 2EIZA 3CH1A 4K9EH 4G7VL 4WGWB 3KVQA 2BY1A 2G75A 3TH3T 4LLDA 5F1OB 4Z8FL 4PJ9A 1ADQH 3EYSH 2O5XH 4K3DL 4XAWL 3FQXA 3LV3B 3PNWA 3HCVB 3SJVD 4OB5L 5JDJA 5C1MB 2Y36L 3OV6A 1XFPA 5IEHA 3CH1B 3GBNH 4R2GD 1CD0A 1ZVSB 2DF3A 4KC3B 3ULVF 2ZG1A 4DCQA 1QBMH 1XF5B 2NXYC 5D7JD 3FO2A 2E6PA 4OF8A 4LLDB 3EYOB 4S11A 4QY8B 5BVJA 2GEEA 5GSVB 4PJHE 3ZT6A 2Q86A 2HJKB 2VSDA 3UZEA 1TCRA 3IT8D 4NO0B 1HCFX 2NQCA 2KDGA 4S1DD 3H9SA 4GW1A 4B53A 4P23C 5HYJD 3OHXA 4NRYB 3LKRB 3NFSL 3PF2A 5CCKH 4G8FA 1J18A 1DQJA 1CT8B 4IOFD 1TZGH 5FA3A 3TWCH 1H8SA 5HGDB 1QR1A 3K2MC 1NGXA 5IFHL 1F8TH 4RMQA 3QEHA 1RULL 4OCLC 4XGZB 3G6DL 3SDAC 3WS3B 2I9TB 3KPSA 3BKJH 1DBML 4RAUA 2HYMA 4PJFE 3MQIA 3H9SB 1X4XA 4OJFH 4L8BA 1V3LA 1EAPA 1S9XB 1L9NA 1WWWX 5TQ0H 3WJJA 3L3JB 1FNSL 1EH9A 4EIGB 2HLAA 1FC1A 3MV7A 3P9MB 3QEHB 1NCUA 1JNNH 1LP9F 1IQWL 4JFZL 4Q9CA 1T21B 1PVHA 1ZLSH 5D7LA 3JTSA 4QOKD 4UT6H 3RTQA 3T0XA 2F5AH 3BDXA 5DJZB 4JM2F 3OAYK 3BH9A 2F54A 5DWUL 4F2MA 1TJGH 1EAPB 4OFPA 3ZL4H 1JZ3A 3CMOL 4DGYH 2EE6A 3C8KB 2WWKT 1UM4L 4K9EC 1INEL 3QG7H 3QJFA 3MV7B 3IJSB 3OKYA 3P0YH 1BJ8A 2CGRH 4YH6A 2A6DB 2D7PA 1RU9L 3BJLA 5D7LB 4K9EL 4MB5A 4RFOH 5T3XH 3TIDB 3BH9B 2ZZUT 1IM9D 1E0OB 4MNHB 4LEOA 1ADQL 3EYSL 3LCYA 2O5XL 1OGAE 4AQOA 1DCLA 4F3FB 4NKOB 2M2DA 3WO3B 1NFIB 1T0NA 2VLKD 1T4KA 2HN7A 4PY7A 4JFPB 5ID0B 4Y4FC 4BSWB 2CRYA 3F62A 3FT2A 3ZDYF 5C08A 1QBML 2DQGH 4I18B 1T80A 4IRSB 1NCNA 1G7IB 3QDJB 2CDEA 4XMPH 4F7EB 5HHPA 1B0GB 4HK0B 2VDRH 1MCRA 4YBHA 4MXVE 1CLYH 5HGBB 3CVHA 2HN7B 4PY7B 3ZE0E 2X4RB 1HH9A 3NCEB 5D72H 3IKCB 4X6CE 5CCKL 2G5BA 3W9DA 3FT2B 3BUYB 3FO1B 2DYPD 4QHKJ 4LCCC 1TZGL 1G1CA 2R56H 4U7SA 3TWCL 5FYJU 1ACZA 4HUMB 2F53D 2DM3A 5KSBE 4WEUD 5EZOH 4HJGB 4M7JH 4QHLA 5DHYA 5KVEH 1RI8A 1U8KB 2YWYA 1CQYA 3BKJL 2HLFC 4MCYA 1BQHA 4AMKH 4FQPA 5ICXB 2PNDA 1VFAA 3LIZH 1A1NA 4OJFL 4Z18A 1H5BB 3UAJC 3MJ9A 3MJ8A 5HYSB 2G9HA 4F8QA 4LLYB 3TFKC 5D1XA 4MCZA 1FYHB 1QKZH 3STZA 1JNNL 5E2WH 5F7UA 4MCYB 5BRZB 1BQHB 4UT6L 5E5MB 3HNVH 4JFFA 3W9EA 5F1NB 4PJGB 1TJGL 2G9HB 2VTFA 3ZL4L 1PG7L 4DGYL 5D1XB 4MCZB 4JREB 4MJID 1ODAA 2Q3AA 3O6FB 2D4DA 4ZS6C 3X11B 5IB1A 1I3VA 3P0YL 1DP0A 1X6LA 2LQRA 2CGRL 1YECL 4XP4H 5E70A 5JW4M 4TSCH 1IGJA 1FIEA 2BNQD 4XH2B 5T3XL 1FIGH 1X5YA 4X99A 4JG1H 1KCUH 2IANB 1I1AA 1CG9A 1BZ7B 1QTYT 4QTHA 3VXQA 2AABH 3DX6A 5IB1B 2ZCLH 5DVKA 4MDIA 4L4TB 1AGBB 1YPZA 2X4TB 3QHZH 3RKDC 4L8SB 1A47A 2EEDA 3NTCH 5IVXA 2YA2A 2DQGL 3QWOA 4PG9A 3QSKB 5DZLA 2VLMD 3SDDC 3VXQB 1CXHA 4XMPL 3GSNB 4WFGD 4KRMB 5I1EH 2VLRD 2YPLA 3D3VD 4LPXA 1CLYL 2NR6C 1S7VA 1QZ1A 2QSCH 1P7KA 3DROA 1YPZB 5D72L 3CFBA 1C5CH 2WBJB 3H7BA 4LHQB 5FYLE 3DX8A 1T5XB 3QWOB 4PG9B 2R56L 2J6EA 5C92A 5HGHA 5L0QB 2ZOKB 1I1FA 1WFOA 5EZOL 1J7VR 4M7JL 4EUPB 2VL5B 1DVFC 3HNTH 4LGSB 4N0UE 3G6JF 5KVEL 2BVPA 4R3SA 5E8DL 3P4LA 4AMKL 4C57C 4OF3A 1P7KB 3WHXA 1M4KA 3DURA 3V4UH 3LIZL 3CFBB 3SKMB 1UZ6E 3O45B 4JAMB 3H7BB 1UM6H 5ICZA 3AB0B 3ZTJG 1T66C 4JLRA 3U30B 5HGHB 3EOBA 4BZ1H 3MRKB 4NWTH 3WJLC 5E2WL 2BVPB 3BPNC 4AEEA 4U1NB 2V9QA 2WINA 1R3KA 4KRLB 5T3ZE 3MRQB 3WHXB 2LAAA 2DM7A 3DURB 3HNVL 2RCSH 1U2CA 4X9GA 2EDEA 1IAOA 2X4NA 2GITA 1GAFH 1UQSA 4UT9H 2A6IB 3ARPA 3GBMH 1P9MC 3LKQB 4N8VA 4V2BA 4Y16A 3L95A 1MQKH 1MHHB 3BPCB 4EUPH 1CGTA 1OSZA 1MHCB 2G2RA 3DRTA 4LSTH 2J8UB 1IGMH 2W1NA 4Q6YA 1QA9A 3DLQR 4XP4L 2WINB 4TSCL 4U3XA 1YN6A 2W9EH 5FECB 1OB1B 3RIFK 1FIGL 1V3JA 4KTEH 4JG1L 3KXFA 1PBYA 1WFTA 1KCUL 3KDMB 4HXAL 4NIKB 1G6RB 2GITB 4NZTH 4ISVA 1U8OB 3P4MA 1NKOA 1FFPA 3HNSH 3M8OH 2FEDC 4U4BA 4MD4A 4G5ZH 5EB9A 4RNRB 4MNQD 1OP5H 2AABL 4GAYB 2ZCLL 1MHEA 4LPCA 4YPGA 3F58H 1BLNB 5F9WC 3DSFH 1RSFA 1PLGH 1YN6B 1I8IA 3NTCL 4OV5A 3KXFB 2AJSH 2Q7YB 3C6LB 3D2UA 3T0ED 3LKPB 3ARUA 3QPXH 3L3DA 4KTDL 2EIDA 3HB3C 4WUKH 2FGZA 1JF1B 5I1EL 4OTXH 5DTFB 1OLLA 1MAKA 4YPGB 3VI4F 2QSCL 3L3KA 5HI4C 3S4SG 3VFNA 4MNGA 5CJXC 4WEBL 1C5CL 1G6RH 4S2SA 3LDBB 3KLSA 2PO6D 1JWSB 2I25N 3D39A 3ZO0A 1FV1A 1ND0A 4J8RB 1F4XH 4UZGA 2DAVA 3QO1A 3RUGF 1N8ZA 1OD9A 5JW4N 2FSEA 4L8SC 1UXWB 5CJQL 3QB7C 2BRQA 2H32B 3AY4C 3PDOA 1IZJA 3QUYB 3IS0X 3HNTL 4UNTA 4M1GH 4X4ZA 2NY2C 1OF2B 1RK1B 3O4LD 5LVEA 5MENE 4GS7C 3V4UL 3QXAB 3TJHC 2BRRH 4U1IA 3KPSE 1JK8B 3VWJD 2H26A 1EVUA 1J8HB 1UM6L 35C8H 1JVKA 1U8QA 4DK6A 1W0WB 1OPGH 5TGBA 3ARVA 3GSNL 4FQXD 4C83B 1NBQA 3HRZB 2DWEB 5CEYA 4BZ1L 4NWTL 3DO7B 3QUXB 4NQXA 5AZ2H 5ETUA 3JSSA 5FCUL 3E2HC 3VFPA 1IMHC 5FGRA 3UP1A 4HIXH 1F6LL 2HVKA 1CICD 2RCSL 3DVFA 4J3VA 2AJUH 5FK9A 4U1IB 5FCSH 4UIMB 4XVUD 5ERWB 3ULUF 1GAFL 3UTSD 1U8QB 3GBML 4K7FA 4N5UA 4PB9H 1F00I 1DSFH 1MQKL 5IQ9A 4LSTL 4YJZL 1IGML 3UROR 5E94B 2X05A 5DRZA 5MEQA 2LAGB 3MYJA 1CXKA 1HYRC 2W9EL 3RVXD 4KDTA 3ZKSD 1KGCD 1LHZA 4NFCA 3VXSA 2HJFA 1QYGL 5FK9B 3DHMA 3VFUB 15C8H 5CBAA 3U6RB 4NZTL 3K2UH 3JWOH 3HNSL 1U6AH 3M8OL 3HLAA 4G5ZL 2X9WA 3UJTH 3VDCA 3HAEH 4EZMA 2B2XL 1HNFA 1TCMA 3PL6D 2BNRB 3CPLB 3F58L 1SJXA 1U41A 4XHJC 3DSFL 5B22A 1PLGL 1R5WA 1TPXC 3DI2B 4QGYA 5KOMC 4Z7WB 3GB7A 2AJSL 1BBJB 3QAZC 4XBEH 4ETQB 4HS3B 3QPXL 4LVOB 5C08E 4WUKL 5DFWH 5K9OA 1QRNA 3VXOA 4OTXL 4M5ZH 4X6BB 3KPMB 3RWGB 3B5HA 4Q0XH 4NJAH 2NY1D 4ENED 3LQAH 2NY6D 1G6RL 4P99A 3S3SA 2HWZH 3GB7B 1F4XL 1G0YR 1MCOH 2DQIH 5DI8A 5K9KA 3MR9B 1F97A 4L4VD 3BDBA 5IEKA 4KI5D 4N5ED 1QRNB 2X5PA 1HYSC 4M1CC 5H2BB 4M1GL 3GMPA 4X8JB 1H3GA 4LLWB 1R5VA 1XGYH 4P46C 4R6UA 4DUVA 4KHXH 5FB8B 2BRRL 4RISH 1HSAB 1DEDA 35C8L 4Y7MA 4YFEA 3TBTA 1OPGL 5CKAA 3KWWA 5LAXA 2IBGA 1S7QB 3VA2C 1UKTA 5BJTA 5AZ2L 4MLSA 4Z78A 1P84J 1BOGA 2KBGA 5JMOC 4JRXD 3U0WH 3V6ZA 2ZPKH 2FX8H 1KFAH 1L7IH 2AJUL 3QUYC 4BZYA 1J0JA 2X4OA 5DGQA 1XCQA 4C56A 3EDKA 4PB9L 3L7FB 1DSFL 1ES0A 5LGKA 3KWWB 3BRFA 3K74B 3NFNA 1NC4D 2HG5A 5D1ZD 1E6JH 4XCEA 1AO7D 3ARFD 1UVQB 3JWOC 4IM8A 1D6VH 4XMKH 2X10A 4QRRA 2PYFA 4U2ZA 2X4OB 3K2UL 4C56B 3H3BC 4X98A 3LEXA 1U6AL 4QHKI 4APQC 4EBQH 3GSOA 1KENH 3DTXA 1KYOK 3NFNB 3UJTL 4DN3H 4YXHH 5FKPB 5EBLB 4ZUSB 2OYPA 1CIDA 4GOSA 4OF5A 4CJ0A 4OCRH 2AW2A 3ZKQD 4PIRF 1L4IA 2GJ6D 2YOCA 2UVEA 4PJEB 3BKCH 5EU7E 3QIWA 4IRJA 4XBEL 3DMMD 1J10A 3LEXB 3D0LA 2X4QA 3LN5B 1KIRB 1CCZA 5CLWA 3LQAC 3QFJD 4YHPA 4JY4A 4HGWA 1K8IB 1E28A 4M5ZL 1L0QA 1LO5A 5HDBF 3DYMA 4Q0XL 4NJAL 5AUMB 3LQAL 5KSAB 5H37H 3SEPA 3TYGH 3G5XB 3EYFA 2HWZL 4NDMB 1SYVB 3F5WA 4OZIF 1MCOL 2DQIL 3C5ZC 3E0GA 5DYOA 1VEPA 2VDLH 2X89A 3D0LB 3BIKA 3E6FA 1QPXA 2JK5B 3PXHA 1LO5B 4BELD 32C2B 3GMQA 3K4DA 3FB7A 4PJCE 1XZ0A 1V3KA 1XGYL 3JV4A 4XVJH 4KHXL 4MAUH 5CS7A 1ZS8B 5EU5B 3ARGC 1OAZH 4FQQB 3BJ91 1UKQA 3X13B 2R29L 3FJTA 3WO4B 1NCDH 5CBEA 5EC2B 3RHWF 1PKQA 1S8DB 4CN4A 4JQVA 3U0WL 5I16A 2ZPKL 1KB9J 2FX8L 3A67H 3FFCD 1KFAL 3FB7B 3MJ7B 4LVEA 4TPRH 1L7IL 3IAQA 3MLWH 5E5UB 3CFCH 3PHOA 1LMKA 3QPQD 3C2AL 4NSKB 4HAFA 1WAAA 3TVMA 4Z7NE 4RQQA 1KJMA 4M9PA 2EDRA 2Z31A 3T1FB 4ONHA 2R1XA 1FHGA 1E6JL 4QXTB 3CFKB 3QJHB 4F15C 1D6VL 4LCYB 1YZZA 2X09A 5I74B 4XMKL 3UBXB 3H0TA 4MLIA 1CDCA 1RJLA 3BP7A 5KJRH 3MRGB 4NT6A 5F1IB 3VFWA 1LE9A 4QRQB 1GGYA 3LN4B 4EBQL 3TVMB 4RQQB 4P2OA 3SGJC 2Z31B 1KENL 4ONHB 3O6LH 4YXHL 5SWQA 4DN3L 2V5RA 4Y2DC 5ID1A 1VA9A 4MQ7A 1Y18A 2H6PA 1EZVX 4OCRL 2DQJL 1F6FB 2YD9A 1RJLB 3BKCL 1VCAA 1FO0H 4DVBB 5SX5K 1I4FB 3VFWB 1MLCB 5HVWA 2IPKA 4OUUA 4PJ7F 5I9QC 4Z7UB 2HFGH 4PJAA 5SWQB 1F4WH 2O93L 1KLUA 2JKXA 3CVIH 4M8QB 1I9RL 2H6PB 4Z7OE 1WISA 2VIRB 4N8CH 4UNVA 5E1AA 1P2CA 3TZVA 3TYGL 2E7HA 1LE5B 1CFQA 4YGVA 4NPYB 4Y1AD 1Z6JT 4MNGE 2VDLL 2IPKB 4NC0B 4OQTH 4PJAB 2EDOA 3LAFA 1WC7A 3HI6H 5GZOD 2AJXH 2YEZA 1KLUB 4DAGH 5A40E 2H8PA 4HGKC 4FA8A 1S7UB 2CO7B 5CMAA 1UG9A 4XP1L 3BOVA 4XVJL 3OKMB 3P9LA 4MAUL 2AK4D 3BP4B 3I85A 3ARDB 4YGVB 4LLVA 3S97C 2E7LA 4S1QL 4MJ6A 5GJTH 4P9MH 2ARJQ 4BM7A 4YC2C 5KSAC 4NUJB 4YE4H 1NCDL 4E9LA 1Y6MR 3V6OC 3SGDH 1A7RH 1T1XA 1WC7B 3WS6A 4KVCL 2A9NH 3DNKA 2GTZB 4GKNA 1WF5A 3A67L 4TPRL 2OBGA 1G0XA 3MLWL 3CFCL 5KZCD 5JW5A 1IC5H 4PRHD 3UTQB 5TFSH 4JY5H 5EIIB 1IAMA 4MGXA 5HHOB 3UTTD 1S5IH 1YN7B 4G8GA 3O9WC 4Q6IA 4PGDA 4JGUA 1N64H 1E4KA 2XFXB 3HE6C 5DF0A 5F96L 3WO4C 1BIIB 5KG9A 4HUWB 3MRFB 3MZTA 2VLLA 4HQQH 2R8SH 4WHDA 2AKRA 2R9HD 1K9TA 2BMKB 5HVHB 3VXSE 2APXA 2Y23A 3VXMA 1UCTA 2XTJC 3O6LL 2EEBA 2OX5A 3FOLB 3U36B 4CVXA 3ULVH 5KS9A 5MEPB 1CFVH 5HDQH 3CX5K 1FNEB 1Q72L 2M1KA 3CXHJ 4G6JH 2FIKB 3PABA 4S10A 3RY6C 4JDVA 4NNXB 1GGCH 3KYOA 1FO0L 4N0CC 4HF5H 1AKJA 3VD5A 2AKRB 1W72B 3HFML 3WFZA 43CAA 2Z92A 3B43A 3VXMB 1LILA 1D7FA 4I3RH 1F4WL 3VE0B 3QUZD 5CEZD 4UDTB 4JM2B 5HYQB 5JLZB 3UPRA 3IGAB 1VFUA 5FYKU 4UBDD 4N8CL 3B2VH 3OKKA 3PABB 4OFKA 2EH7H 1JHTB 3VRIA 4XCNA 2A83A 1JZ2A 4GRMB 1I1RA 3BKYL 3V9FA 4OQTL 1MI5D 3L5IA 2AJXL 1I3RA 4P2RB 1A64A 2BOCA 3U1SH 4DAGL 2FZ3A 1UB6A 1UZ8A 4HIIB 3RZWA 1ED3A 4RIRB 3HUJA 3L5WB 5BMFH 1Z9OA 2GSIB 1W72H 3BP5A 3X3FH 3F7YA 1TNNA 3DETD 4P9ML 4PBXA 5GJTL 4L8DB 5I15H 5C0AE 3WNMA 4YIQA 5E6IB 3WNNA 4DVRL 1DBKH 3ZHLA 5IUSA 3CDFA 4J4PA 3H9HA 3NIGF 1A7RL 3VGAC 1EMTH 3LN9A 1VSCA 1P4LA 2HP4A 2A9NL 2FZ3B 5FM5O 1S9YA 1ZHBB 3HUJB 1RHHA 3F7VA 2CDGB 3OJ2C 1IC5L 1FNGA 1LO2H 2DIAA 5TFSL 1WIUA 4P23A 1I8KA 3MBXH 3X3GH 1S5IL 2FCBA 5F7LB 1MUJA 3ARDC 1N64L 4WHTA 3UC0H 5C0FA 1DN0B 2HT2C 3SDAA 3SN6N 5HI5D 1S9YB 1YQ2A 1J0YA 5L6YH 2XPGB 4HQQL 3ULVC 1QSEE 4H8WL 4YAQA 3ILQC 1I8KB 1MWAA 2Z8RA 4MS8D 4QRRE 4ZO8A 5L2KD 2Y25A 4W4OA 3VCLA 2GFBB 3ULVL 2X2YA 5HDQL 1OGAD 4BFIB 3QXWA 4G6JL 1T6WA 1A7QL 3VGDA 4Z7QE 3WKNA 5F44A 4PP2A 3B5TA 5F7HA 5C86A 2GJJA 3VD3A 4HF5L 4Y2OA 1MWAB 3MFFA 3NCYP 4KGLA 4XMLH 3VCLB 4HH9A 2MSPA 4I3RL 3BZEA 2P45B 5HVHC 2FJFA 1CYGA 2VO5A 1BMGA 3IDYB 2CUIA 4I0KA 5DMGD 2EH7L 3BGAA 3MCLH 4OGYH 3T77B 1U8PA 1FAIH 2BY0A 4JZJC 3MFFB 2WUCH 5CZVL 4XX1G 4OLVH 4HH9B 1HCVA 3PQYB 4AL8H 1BD2E 2Z4QA 3U1SL 2HA1A 3WL9A 3EJZC 2FJFB 4HX1B 4LBEA 4U1SA 5BMFL 4POZD 4Z0XB 1ZLVK 5J1AA 5TF1H 4JM2C 3DRQA 3TGXA 1W72L 3QEQA 3PG2A 3X3FL 4D2NA 5I15L 4MA8H 4GMSH 2C4FT 1DBKL 3FRUB 2GSGA 3HR6A 4XI5D 4U05A 1FC2D 1EMTL 2Z4QB 3S36H 4OD1L 4GXUM 3VXRB 2NPLX 1ZHNB 2OJEA 3MCKA 4TNWK 3HPLA 1PKQE 3DUHA 4ELMF 4FQXC 1HNGA 5J1AB 1JGLH 1LO2L 1MREH 2XTLA 4HFWA 1SEQH 3QQNA 1JYXA 3T3PF 4QRUB 4WU7A 5BZWA 2BOBA 4LCCA 4M7ZB 4X80H 5DDHB 1NFKA 1CLCA 1YEEH 1WAAE 3UC0L 2NY0C 4MSWB 4X7DC 2WZPD 5F9JB 2GQHA 5IJKC 2DQFA 3GMOA 2OJEB 4FQCL 4JZOA 4BQ6A 3GRWH 5L6YL 4NC1C 1MCNA 3RWDA 1YNTA 4IS6B 4B50A 1BGXH 4OBRA 2EZ0C 1S7RB 3G6JB 4G6FB 4WU7B 1UKSA 1CE6A 3VXNA 4OLYH 4P5MB 4PP1D 2EECA 1DZBA 4BUGA 2FO1A 3TPKA 4I8DA 3RBGA 4JZOB 1FRGH 1XR8B 5DQ9B 1P1ZA 3PL6C 4R96A 1EFXA 2JJSC 4L1HA 4WDIA 4XMLL 5D6DC 4XZUA 1CE6B 3V7AE 2I07A 2DQHH 1BHGA 4LRIC 4I0PA 4OSUH 1WJ3A 5EBGA 2Y72A 4HFUH 1RUQH 1YMHA 3EDJA 3T09A 3KS0J 3MCLL 1K8DB 4MZ2A 1A9BA 2X70A 4OGYL 4KROB 4RZCB 3CFEB 1FAIL 4ZQKB 4GRWF 4R96B 4ODXA 2WUCL 2R4RH 5FYLD 4OLVL 4GBXD 3PP3H 3W5MA 2R2HA 1I1YB 4KXZH 1A1MB 3MA9H 2NNAB 5E8EB 5J11C 1YMHB 3O11A 4GQPH 5TF1L 4Y19B 1PY9A 4GKZA 2EDTA 1EA9C 4MA8L 4K3JH 2BVOA 3BDYH 2D4FA 1AIFB 3SDDA 3S36L 1OT2A 4EXPX 1ZGLP 1J1PL 4WWKD 3VXUD 3FB5A 5CP7A 4FXGB 1U3ZA 1S7WB 3S4SB 4K3GA 1MREL 2DWDB 4OLZH 1SEQL 2XWBB 5T3ZD 2XG4A 1JTPA 2PW1B 4MWFB 1NLDH 3VFRB 5C09A 2QV2A 2A6JB 3ZDXE 5EOTA 4X80L 4NKDA 1YEEL 4YO0B 3VMPA 3X17A 1G6VK 4ZAKB 4O00A 1DVFA 3WN5C 1A6AA 1MF2H 2DLHA 3RUGB 3S6CA 2H3NA 2ICWB 1ZK9A 2Z93A 4I4WA 4U6YA 3GRWL 4JFEE 2EDJA 5D1ZC 3AXLB 1T04A 4G80B 1BGXL 1A22B 3CDYA 1CDGA 1XCTB 3TNMA 3K81A 5E4EC 4L3EA 1BFTA 3MV01 4GSDH 4NKDB 4OLYL 5TDNB 5JIIA 2ED8A 4LNRB 2D03L 3W0WE 3PWJA 3G6AB 1J0IA 2BXZA 2XWJB 1JMZA 4NQDA 2Z93B 5KS9E 1FRGL 2FR4A 4LCWE 2OI9B 1DQLH 1T04B 4G9FE 3QIBC 4GXUN 4LFHD 3ELAT 5HPMA 3TNMB 3RWJB 3SDXE 2ED9A 1B90A 2WBKA 2DQHL 5ACZA 4UOJA 3KPPB 1F6AB 4D94A 1RMFH 4XNZB 2PTUA 3MROB 4OSUL 5C0IB 3PWJB 2A0LC 4XNQB 1I8LC 5GGRA 3BHBA 2YZ1A 4HFUL 1RUQL 4I9WD 1OTTC 4NQDB 1I7RA 4PJBA 2FR4B 4ODUB 4BFBD 2P8LA 3GK8H 3W5NA 4XPHH 3KJ4C 2NZ9C 2R4RL 5HPMB 5EOCJ 1NGZA 1CBVH 4CN1A 43C9B 2HKFH 3UYRH 3OG6B 4X6FA 3BD4A 2GYSA 3MA9L 2IPUK 5CGMA 3WFCH 4PR5A 3TCLB 1GIGH 4Y88A 1NEZA 4JRYB 5FUZH 3SGDI 3PGDB 5B38G 5MEND 4MXQC 2HJLA 2VXVH 3QNXA 4CMHC 4U1LA 3FONA 4PRIE 2WM0A 4K3JL 2CIIA 3U7WH 2W65A 3VXPA 1BQLH 1NGZB 4EI5D 3BDYL 1A9EB 4KI5F 1D9KD 3ULUH 4PRNA 1LEIA 4X6FB 2VABA 2H41A 4NNPH 2HRPH 2Z8SA 3QQ4B 1EAJA 2PR4H 4UQ2A 5E9DB 4OLZL 3WLBA 5SV3A 1NLDL 5I1HH 4JDZB 3WDIA 4NC2B 3PGCA 4F7TA 3RTQD 3W11D 3VFTA 2V6HA 3RWCA 4PRNB 1T0MA 3AY4A 4QXUH 5DEGB 2ESVB 2H2SD 1QSFE 4U0RB 1A3RH 4XXCC 1MRCH 2I9LB 2P8PA 4UQ2B 3ZDZF 4ZPVA 1FPTH 4YFLF 2A2QT 1D5MB 4GSDL 4ZUUA 2ZJSH 2NW2A 2GI7A 5IFAL 1FLRH 5IHZA 1FYTB 3QZWG 3TO4B 4NZJA 4JKWA 1GVIA 1DQLL 2P8PB 2OXGA 4FRWA 4L29A 3O6MH 3RWEA 3UTZA 3IDNA 1SBSH 3B5GA 3SO3C 1R3LA 4K8RD 1RMFL 2JJVA 4CN6A 2NW2B 5FIEA 5IHZB 5C08D 4R4BB 3V52H 3VGEA 3WNKA 5C2UB 1I7TA 3QNYB 5C0BE 2Q1EA 1SJHA 3GMNA 3KLHC 4XVSH 2YA1A 3R06A 5MEOB 1DN2A 3GK8L 1JGDB 2VR5A 4XPHL 3OJDA 4EKXA 3MMEA 3Q6FB 2D7TH 1CBVL 3RWEB 2ZKHL 2OI9C 2HKFL 3NGBB 3UYRL 2X40A 4HKBA 3H42H 4JFDD 3HG1A 3WFCL 1I7TB 4AENB 1GIGL 2IG2H 1TVHB 5EIVA 3CSBA 5FUZL 3AREA 4XNZC 5IGXH 1MAJA 3FAXA 4M93B 2VXVL 1R0AH 3RZCC 4XP9H 3ULUC 3OJDB 1IEAA 3U7WL 2APTA 3A0OA 1KEMH 4D0BA 1BQLL 5E2UH 3ZE2E 2JIXD 3QEQE 4S0TD 1S9WB 4LOUC 5GS2H 4WNQA 3ULUL 4NNPL 3VD9A 2HRPL 2X9XA 4YEEA 3QI9B 1W0YT 4F33B 3JUZA 2PR4L 2PCPA 2FJGA 4LDLB 1OAQH 5AD0B 5I1HL 1S7TA 4UOW1 3MBED 2ZNWA 2LVCA 1CDBA 1AHWC 3QH3B 1KF9B 4P2QD 2IBZY 2IJ0C 5EUOE 3MREB 4WNQB 1OGTA 3MNVA 2LVEA 4QXUL 3TIEB 4OZIB 1KT2B 4Y4KB 1A3RL 2PCPB 1MRCL 2P5ED 4GRLA 4P46A 4Y8AA 5FDWA 1FPTL 4HUVB 3KR3L 1SY6A 4GMTH 3MJ6A 1MFCH 3MCG1 2QR0B 2ZJSL 1I1AD 1MCCA 4Q2ZB 4I3SH 1NLBH 3MNVB 2EDXA 1YMMA 4TN9A 1EO5A 1V8HA 3HC0A 1MIMH 1Q9OB 4GRLB 3RU8H 5FDWB 3IFOA 2OP4H 2VAAA 3O6ML 2J4WH 4PJDA 1SBSL 1NC2A 3I02B 4JFXB 4KK9D 4GKOA 3V52L 4OQ1A 3PWLA 4XVSL 5DK3A 4U6XB 5T3XE 2OTWB 1LDSA 4TSAH 4XP5H 3GHBH 2GCYA 1PSKL 5I66A 1PQZA 2C3HA 3ZTNH 4CDGC 2D7TL 4M3JA 5IW3A 3TO4C 3O41A 2DI9A 1URLA 3V5DA 1LO3H 1K3ZA 1KC5H 4DEPB 4KTYA 5JA9A 3H42L 2WP3T 4HPOH 5DMIH 3FT4A 4RGNB 4ZYKB 5C3LD 3E8UL 2IG2L 1H3UA 2CKBA 3IDJB 2HMID 1IKNC 3PWLB 1Z5LA 2CK0H 5IGXL 4OM1L 4AY0A 4JFHE 1KLGB 1KCLA 3VXTB 1RUAH 1QVOA 4J3OC 4Z77B 3BYYA 1KEML 2J5LC 5C07D 5E2UL 1X4YA 4WVRA 3SJVA 3O41B 1NSNH 2DQDH 3GMLA 1D5XB 3CU1A 2BC4B 2FJHA 4E42B 4QNPF 3V0VA 4M02A 1UA6H 5FGBA 1WZMA 5JHDB 3Q3GA 3G04A 4WU5A 3FT4B 1GOGA 2AJ3A 2CKBB 5D7JA 4AM0A 3KG5A 3MXWH 1OAQL 1YEGH 3RVTD 5HPOA 1QVOB 4QCIA 3VJ6B 1L0YA 3C5ZA 5DJXB 3BIBX 4M93C 1LEKA 1AGCA 4HMCA 1F3RB 4LSDA 4KKAD 5C09E 1IGYA 3WLWD 5D2NB 4R2GB 3G04B 4F37K 4HWNA 1ZTXL 5EZJB 2ITCA 3RNKA 4N0YH 5ADPH 3I6GB 1QACA 5EUKA 1U91A 4BQ9A 4ONOA 3QI9C 4LP4A 3ARGA 3KPOA 3MLSL 4GMTL 3Q5OA 4QTIH 1MFCL 1VACA 2MTPA 4QGTA 5HYJB 4L3EE 5DGRA 3IF1A 2E7MA 1NLBL 3C6SB 3DBXB 3MO1A 5MERA 3EO0A 3DI3B 1MCIA 1MIML 3LD8C 3RU8L 4MJ2A 1EV2E 1U91B 3N9GH 3RL2B 2F9BT 3A6BH 4XNMA 1MCKA 2OP4L 4YLQT 4MVBD 4Y4KC 3TYFB 3MTRA 4YDJA 2VQTA 3TC9A 1NEUA 3KYMA 1II4E 4QOKA 3C5JA 1LK2A 3TT1H 5C70A 3DYOA 3LEVH 2VZ1A 5IG7B 1MELA 1G7QB 3EHBC 4KXZI 4XRCA 1X4ZA 4TSAL 4XP5L 3RPIA 4H88H 3GHBL 2X4UB 4E5XA 1VGEH 4XNMB 3ZTNL 3T4AB 5HXMA 3NAAH 4PJBE 3JVGC 3BWAA 2ZSVB 4JHZA 2KZWA 4OKVA 1MRFH 1OAYH 1LO3L 4HLJA 1A5FH 4ZODA 2EDDA 4QOKB 5BRZE 3TA3B 4HPOL 4Y2DA 5DMIL 1VADA 1IM9A 5TJWK 2CK0L 3HMXH 4PJHF 3BEVB 2UWEA 2OK0L 1OP5K 2K3TA 3WEXB 2OLDA 5FGSA 4MX7B 2RFXA 4IOIA 1HDMB 3BWAB 1NSNL 2DQDL 3O2DA 4JFOA 4QHUA 2VLKA 2NY3B 1UA6L 2ZNXA 1A6ZB 5T5NF 3B8YA 1VADB 5HY9A 3N50A 1IM9B 3MXWL 4DEPC 5I73C 1YEGL 2YN3A 3U4AA 2JF1A 1N3NA 5T5NG 1A6UH 2ATPB 5DJ0B 3WNLA 4U3CA 3GMRB 4PLJD 1RUML 1KSRA 2ADIA 3HZKA 3KJ6H 2FLBT 3BRGC 1F3DJ 2DYPA 1XIWD 2B7DT 4N0YL 3PHQA 5ABDE 4OCWH 5ADPL 3VH8A 2F53A 3BISA 1Q0YH 4MAYC 2PUQT 1DEEA 1RK0B 3QQ9C 3NZ8B 4QTIL 4UAOB 1AGEA 2DLIA 1DL7H 3AU1A 5CGYD 1IM3A 3V6OA 3AS2A 4AIZB 4OGAC 1YEDA 3Q48A 2QHRH 5FYJH 2FIRT 5EN2A 2Q6WA 2AXHA 4XP6H 3N9GL 3A6BL 4AIOA 1OLZA 2H9GA 2JELH 1VKXB 2ENYA 5M94B 4F7MB 2CJUL 4XNUH 3O9WA 3PWPD 3TT1L 4R97C 2EKSA 4LVHB 4Y8DC 1TQCC 5JNYA 3T0DA 4YHZH 4PRPD 2DQTH 1JJUA 3VFSB 1WBXB 2GAZB 3LEVL 5JORB 1L7TH 3HE7D 1T7YA 1J0KA 1MFAH 3ZLQC 3DWTA 1JYWA 3GEWB 2FL5A 4H88L 4MJIA 1VGEL 2VZUA 1KB5A 4YUEH 3RWIA 3H8NA 3W82A 2H9GB 4X7SH 5HD8C 5JTWA 3LEYH 1OAYL 2O61A 5D9SA 1A5FL 3G5YA 4H25B 1C5DB 4M1DL 2BHUA 4HS6B 4FFWD 1DUZA 4YXKH 2W9DH 3ZT7A 5D70H 4OZHA 1CLZL 1DLHA 5BZDA 5JOFB 3HG1E 3MRPB 4FXKA 4MXVF 3RY6A 4PJXF 3ROOB 4FHBD 2ORBH 1HHIB 4FTVE 3BZFA 4PS4H 3SDCC 4MJIB 3TO2B 2Y4SA 3ZE0F 4WTZG 3GBLA 5DC0A 5K93A 4X6CF 3RI5F 4NZUH 5C0AD 3BRDA 1QLEH 2BNQB 3GHEH 4HKZA 4YR6A 3MA7A 3J7HA 4KVNH 5IB5B 1FFRA 1F11A 1JGUH 2VITA 1I9JH 5KSBF 1HZHH 2VR9A 2MCG1 1L6XA 3MXVH 4OQTA 1FDLL 1TJHH 2MHAB 3BZFB 1A6UL 1NMCB 1FG2A 4QF1B 3HA0A 3D3VA 5BQ7B 1AFVH 4YK4B 3WIHA 1HSBA 1A0QH 4DOHE 1ZT7B 5LGJA 4HIEA 4PRBB 1U8LA 3HKFA 3U9UA 3KJ6L 4XAKD 3QNZA 5FV2A 5HYFA 4TSBL 5CZKA 4P3DB 2OR7A 3REWB 2G5RA 2ZUQB 4OCWL 1Y0LA 1INDL 2NY3C 3V4VH 3EYQC 1Q0YL 5DJYA 3NA4A 2WWMC 1FL6A 4EQ2A 4B0MM 1FG2B 3M45A 1QSED 2VLRB 4GW4B 4P5KB 1T6VN 4G8IA 1DL7L 1BVLA 4QRRD 4ELMA 1H15A 3RNQA 4N1HB 3EDDA 4HIEB 2EYRA 3ARBC 5D6CA 1U8LB 5IR1A 5JPMA 3RWFA 4X6DA 4KDVA 2QHRL 4M43L 3QDMD 2WAHA 5FYJL 2GTWB 3QIUD 5GRWA 3TJEH 1Y0LB 3NN8A 3G5ZB 1YMME 4WFFE 4U1GC 2JELL 1S9KC 2BY2A 1SEBB 3MFGB 4XNUL 4ELMB 3X14B 2CH8A 2GUOA 2W0FA 3S88L 4OLXL 3RWFB 5CFHA 1X5AA 4YHZL 5IROC 3B3IA 2VDKH 2DLEA 4O02H 4PGCB 3VG0L 3OR7B 4G6KH 1XGUB 1U95A 3QDAA 1L7TL 2ICEB 1MFAL 1NANH 4Y5XC 3MUGB 4YUEL 1XAUA 5KANG 4V1DE 4X7SL 3HS0B 3LEYL 3OL2A 3Q1SH 1EEZA 2GUOB 5L88H 2PXYC 4YXKL 2W9DL 1BD2D 4JO4H 1JPSL 2XT1B 5BV7C 4OZFA 4O51A 4UOW0 1BJ1H 1B0WA 1XMWA 1XH3A 3L3OA 4PS4L 2ORBL 4KAQH 3NA9H 4MNQA 5J12C 5IM7B 5GS3A 3D25B 2QSTA 1Z3GH 5J89A 5INCA 3OWEA 3C5SA 2CXGA 4H26B 1QLEL 3GHEL 3THMH 5JUEH 4YX2H 2ATKA 2IAMB 3K8MA 3KLAB 4KVNL 3SJVE 4OAWB 1OTSD 4N9OB 5GQBA 1JGUL 1I9JL 3BUTA 4PBWD 3MUHL 1HZHL 5ADOH 4OLUH 3T0EA 1NBZB 2NX5E 3MXVL 4ODHH 3TT3H 2X9YA 1TJHL 4HS8H 1HHGA 4LSPH 4XB8A 3FO9B 2DJSA 4MNQB 3T0BA 1AFVL 3SBWA 4GO6B 2IH1A 4JZJA 1A0QL 2BK8A 4WI9A 2BNRE 4U1JA 3P9WB 1WTGT 2PO6A 3S96A 1KXTB 2ATKB 4R4ND 5INDA 1XT5A 1X5IA 4GRWB 5GS0H 3P4NA 1KB9K 3T0EB 3V4VL 3IDUA 1F2XK 3CNKA 3F12B 4I48A 4KKCD 3MRLA 3JWNC 4GQ9H 3H9ZA 3QXDB 4LLMB 1C16A 5EZLB 5B3JE 3RL1A 1J05A 3DX9A 3BP6A 3O4LA 3NIFE 3MLZH 3O8XB 3V6FB 3LKSA 4LASL 8FABB 5KSUB 4HLZH 5GGUA 1B0RA 3K4ZA 4WW1B 5I2IB 5INDB 1YEHH 3TJEL 4F9LC 2QTEA 4HKJA 1KPVB 1OAKH 2NLJA 1I7UB 4LLQB 3SGEH 4FQXA 3QBTB 4I48B 2HT4C 4K71B 4CNIA 4G43B 1C16B 2DMCA 4QT5B 3QA3B 5T1LD 1J05B 3ZKND 3DX9B 5LG1A 5SWSA 4EVNB 3LQMA 3QDGA 2JJTA 2VDKL 4O02L 3VWJB 5B39G 3PUCA 1UH3A 1B0RB 4G6KL 5IJKA 5F7FA 1CFSB 5TDOA 3QEUB 4X5XA 5D1QD 4NCDA 3CAFA 1N5AB 3K1DA 5IBUG 3TZVD 5BS0D 1E6OH 2AV1B 5L88L 5FO8B 1CICB 3G5VA 3GO1H 1FJ1B 5ENWB 5JA8B 4JO4L 1AC6A 5IBTH 1KJVB 2VXQH 4LFHG 3UTSB 3TP4A 4M4PA 1JBJA 1R3IH 4KAQL 1MJ7H 5SWZB 2A9MH 1ORSB 2BSSB 4L5FH 3NA9L 1C7TA 1Z3GL 1WT5C 3PL6A 2JJSA 3O3BA 1IGTA 3THML 5JUEL 4YX2L 4LRIA 1S9VB 4OBSA 4HZLA 1EHNA 1JFQH 1DDHA 4YNYA 5HJ3A 1C1EH 5D93B 5ADOL 4OLUL 2N7BA 2APFA 4PREB 4ODHL 3TT3L 3D18B 5CHNB 4HS8L 1NDGA 2HVJB 5BOZG 4LSPL 4W6WB 3FQNB 4FOMA 5GS0C 1KTDB 3QO0A 5AAMA 2D2OA 3QFDB 5MI0B 1U8NA 1IGTB 2OS7A 5DZNA 1A6VH 1HHHA 4EDWH 2EYTA 3HMWL 4X5WA 5EBWA 4HZLB 5GS0L 4PJEE 1CXLA 5CGTA 1FCGA 1GZPB 1BFVH 4L4VA 5B38B 4OCYH 3NFPA 2IAMC 3EOYG 3FOMA 4JFED 1M05A 3H9YA 4GQ9L 1FP5A 2I5YH 2AQ1A 3FQUB 2NCMA 3QO0B 2F53E 2X1WL 3D87B 3IXTA 5F1KC 5A3ID 4HBQA 2EDNA 3O4OB 3MLZL 5IB4A 4ODTH 2XQYG 4WTXA 2NY1B 2NY6B 1WBZB 3SE4A 4R7DA 1TMCB 3CFJA 2OR9H 5EBWB 4M48H 3W0WD 3CDGB 4M61B 2C3GA 1YEHL 3V6OE 2V2WB 4L4VB 1OAKL 4U3HA 3M07A 2FHCA 5IMOA 4C59B 1I8MA 3K80A 5C0ND 1HH6B 5DK2A 4LCWD 2NZIA 4G9FD 4RSVA 4JRXA 3LQZA 3MRJB 3SO5A 4S1SH 1AD9B 5C6TL 1AKJD 5F7NC 3L9RA 2IADB 1KV3A 4Y4HC 3SCMB 4QHMA 3WN5A 3O8XC 5CEXA 4ZSOA 5IMOB 4P5TD 1NC4A 5D1ZA 3D69A 1IAKB 5CD5C 1DJSA 1WBYB 4YBLC 4GG8A 1KYOJ 1E6OL 5FGCB 4L8CA 3BVNB 3GO1L 4K71C 1A6WH 1MCWW 5IBTL 3S7GA 2VXQL 3QZWB 4QXGH 2XTJE 3EO1B 1R3IL 4OCSH 1MJ7L 4P4KB 2A9ML 4L5FL 1OAUH 1JHKH 3CIQA 1VGKA 3QIBA 1DQQB 3CCHA 1AO7B 4KK5D 1CR9H 3EW3B 4PRID 3ARFB 1M71B 1QPPA 2V7HB 3QUMA 4GG8B 4ZFFB 4K7PX 3ISWA 4HWBA 1UXSA 5FF6A 4YHIB 2LE9A 2W0LA 1JFQL 3NACH 5J6HB 3NABH 4JVWA 1F13A 1I8LA 2C1PA 1U8HA 2NXYD 5IW1B 1T0PB 5JHLH 1G9EA 4XBPA 3OKDA 4GXVH 3QFJA 2B5IC 3ESUF 4ZUWB 1JUFA 5IHBA 2DIJA 4OZGA 3IU3B 4NP4H 2GJ6B 3PIQA 1A6VL 3D3VE 1UXSB 4P23D 5FF6B 2ZWLT 5AYQA 4EDWL 4JANB 1PX4A 1L0XA 1TQBC 1FNHA 3FQRA 1UYWH 1YY9C 3DMMB 1T7ZA 1BQHG 1BFVL 5F88B 4OCYL 4HMDA 1QSFD 3ZZ1A 4BKLB 1B3JA 1I75A 3T1WA 2I5YL 4CADB 3L3HB 1GOFA 4Z7UE 3UJJH 4U7MA 3SDAD 1JUFB 3R8QA 1EXUA 1NGWA 4IIQC 4ODTL 4GLRH 1P4IH 5F8RC 1GGBH 5DD6B 2OR9L 5C9KA 1T1YA 4LPVA 4M48L 1VERA 2BNUB 5IB2B 3VWKC 5FUOH 5IMLA 4X6DE 4BSVB 4PJ8C 4ZUTA 3BI9X 1QEWA 4JM4H 3ZKXB 4FFVC 4CMMA 1YC8A 3BX7C 4S1SL 3FFCA 2R0ZH 1WQVT 1Q9WA 2P5WA 1T1YB 2E9JA 4A6YH 3O4OC 1BX2B 5C0BD 1K3IA 1V05A 4YFDB 2AEIT 4XXCA 4KJPC 1QEWB 1U92A 4ODSL 4CMMB 1RHFA 3LY6A 1K6QH 4JQXA 3ULSB 5JPNA 3T0AA 1IC4H 3BXNA 1YPZF 4RRPA 3NCJH 3FFCB 1T2XA 3REVA 3ZYZA 5C0CA 5JQHC 3ULVE 1BAFH 3H7LA 2E9BA 2FWOA 5IVXF 3IYLW 1A6WL 3JTTB 4Z6AT 1P7HL 1QFWI 2JCCA 1Y6KR 2XXMB 1EK3A 3GMMB 4QXGL 1NDMB 4ZXBB 1NAMA 2EXYD 3MRIB 4OCSL 1CD1A 5F70A 3Q2CA 1OAUL 1JHKL 2V2XB 5GRUH 3SY0B 4C55A 4CVZB 5BOPA 1YEJH 2V7NA 1W2KT 1CR9L 2Y5TA 5GGVH 5ESAA 3PDDA 2LTQB 3BXNB 3FB8A 4RGMB 2XNAA 3QEQD 3RGVB 4Y4FD 3NACL 3NABL 4N1CA 1FL3B 1MVUB 3BKMH 4PUBH 4WEMB 5JHLL 2V2TB 1NAMB 3DGCR 5DRNA 3V0WH 1X7QB 4GXVL 3VGFA 1OVZA 1EGJA 5KN5B 1A4JB 1H8OA 3QXUA 2BVTA 1K4DA 2LU7A 4I2XE 4P4KC 1F3JA 1JV5A 4NP4L 2BSTB 1WGOA 2P47B 3FB8B 4Y5YA 3EYVA 3EZJB 5GS1C 3MACH 4Y1AA 5I1CH 1UYWL 2ITDB 5I8CB 3STLB 5DHVA 1OWRM 3CMGA 5DFVC 2J2ZA 2JE8A 1LP9E 4KFZC 4TVSa 3RZCA 3UJJL 3KPRB 1PZUB 4TVPH 1X3DA 2HLFD 3SHSA 4PTTA 1P4IL 3GSWA 4Z7NF 4K3EH 3EYVB 3AVEA 2AK4A 1GGBL 4BSJA 2IF7A 3O4LE 3GIVB 3UAJD 3DIFB 5FUOL 4WW2C 1I3UA 3SE3A 1T2QH 1M6OB 1FZOA 4JM4L 3QULA 4LSRH 4ONFL 1XR9A 3TBSB 1AHWA 1P4BL 1U93B 1HI6B 3ES6B 4N8VG 3GJFB 2R0ZL 1NANI 2JTDA 4X9HA 3GSWB 5HHNB 2UZIH 2AK4B 2XY1A 3EDEA 3MLVH 4Z7VA 1G7PA 2NW3A 4A6YL 5SWSE 3VGHA 5IW6B 3GKZA 3QDGE 1GL4B 3IRPX 1F45A 3DO3A 3UTTA 2P7TB 1MIEH 1FZOB 3WCYA 5T3XD 1I1CA 4ZS6D 2V5YA 5HHQA 3LRSA 3RRQA 4U31A 1K6QL 3BAEH 3E6HB 3O3AA 3MV8B 1IC4L 3NCJL 5ICYA 4NC1E 5DMKA 5LJYH 5KZCB 3U4BH 4PRHB 2OL3A 2J3SA 5F7DA 4U1HA 3UTTB 4HG4K 4WUUE 1JWMA 4Z7OF 4HUXA 4X7TA 1R5IB 5GRUL 5IVZB 5JXED 1YEJL 5HHQB 4JFHD 1U3HB 2IWGA 4NO2B 2YPKB 5DMKB 3RKDD 1BWWA 3ROLA 3HRPA 3BW9B 2IFGA 2BVYA 5T5FL 3EUUA 4NM4L 2SEBA 3MRDA 4PJIA 3BKML 4PUBL 2DQEH 2JJWA 3RVWC 1AH1A 4UU9A 3V0WL 1BZQK 4LEXH 4KMQA 4M62L 3SDDD 2Y6SC 1GHFL 1K2DA 1Z9LA 4KJYA 2JJUA 4Y5VB 3VMNA 5DRWB 4ZXBC 5IOPA 2NR6D 2XIDA 5CUSH 4N8PA 3TH4T 3GSVB 5E2TH 5DD3H 3BZDA 4E0RA 3ROLB 3MACL 5ANMA 5C09D 2SEBB 5I1KH 2OZ4H 3PP3K 4RGMC 2EKJA 3WFDH 3OXSA 3RGVC 1W0VB 4HUUA 4LCUA 5DSCA 3V5KB 3TESA 3D0VB 5CSBA 1MI5A 5C0EB 2XA8H 1K2DB 3QUZB 1DVFD 4TVPL 5FYKH 5L8KB 2OCFD 1NKRA 4D0CA 3C87A 3SGEI 4EN3B 4PJHB 3QDJD 4K3EL 4IMLA 5DJAB 1E4XH 3G9VA 4PJFA 4EXKA 3GNMH 4L3ED 3ZMRA 1KLFA 5AG9A 1T2QL 5DSCB 1T66D 3FB6A 5FO7B 2HFFA 3QEGH 4JZNB 3KPTA 5TE6H 2ARJB 3EOAB 2IH3A 1IGFL 5AAWA 4WO4B 3EGSB 2EICA 2UZIL 4IMLB 3MLVL 4JRXE 2VAJA 4PGZA 5DK0B 4KKNA 4TQEH 1HQ4A 4P57A 1MIEL 2AV7A 4FFYH 1CXEA 4MA3A 1EO8H 4L9DA 4ZSOE 3BAEL 1TTUA 3I3EA 5D96B 3TN0C 3HZMA 2YKLH 3U4BL 2K7QA 4R0LB 4NQSA 5C0DA 1MFDH 5E8PB 4OUOA 3MRMB 5LKNA 5BRZD 4FMKA 2P42B 3AAZB 5L2KA 3R8BB 1WFNA 2FEDD 4IMKC 3N85H 3BN3B 3A6CL 5IJVB 2ADJA 3KNBA 1EHXA 2QKIA 2R1WB 3GM0A 4KWUA 3HZMB 3O6FD 5EU6E 5KVDL 4L3CB 4POYA 1Q9KA 3FQWA 4S0SD 1NCWH 2DQEL 2C3VB 3T08A 1B4JH 1RFDH 2IBBA 4LEXL 5I6XC 3HB3D 2IAND 5FA4A 2NXZB 1OTSC 1OGAB 3JWDL 4JGJA 5CUSL 2QKIB 5DA4A 3DYPA 5IIEB 1KIPA 3JVGA 1DANU 5DD3L 5HI4D 3M1BA 5A16A 2D3VA 3L7EB 1FBIL 3CFDA 1WICA 5CLTA 1IC1A 1RURH 1DQTA 1FSKC 5EA0H 1U3HC 3P73A 2OZ4L 5I1KL 1FLTX 5EO9B 2XA8L 5E2JA 5FA4B 5FYKL 3W39B 3TBYB 5IK3B 3QUKB 1IZKA 4PJXB 5H35A 3TJHD 1E4XL 4KJQD 3GNML 3ILPA 4NYLA 5JW3H 4X6CB 5EU4B 4U0QB 1G7JA 4YDVA 2WBJD 4QHNB 3QEGL 2CXKA 1IL1A 1BFOA 2MKLC 5EC1A 1CZ8H 2GJZB 1I7ZA 3OKLB 5TE6L 4IDJH 1INQB 1ZA3B 5KSBB 3VD4A 2Z91A 5I17A 4ZFOB 5IWLA 1F5WA 4TUJB 5H35B 3NBNA 1SMAA 1NMAH 1JNLH 2X1XR 1T1ZA 5DC4B 2FBJH 5F6IC 4EN3C 4H1LA 4NYLB 4TQEL 3TBWA 2P5WE 1AGFA 1ZLWH 2VQ1A 5EO0A 4FFYL 1G7JB 4YDVB 4Z7QF 1ZV5A 1EO8L 4MAYA 4NZRH 2ZG2A 3IJYA 1TNMA 4MD5A 3DVNB 3WDJA 2YKLL 3BWUC 4EQ3A 1S7XB 1MFDL 4ZNEE 1FVEA 3C09B 5DJ6A 1T1ZB 1ZGLA 5J9PA 5C0CE 2D7OA 1LEGA 4H1LB 5IV2B 3D85B 4F57H 5GGSY 2JCCE 5B8CB 4RFEB 4WV1A 3FN9A 1S7SB 3IJYB 4FTVD 2HT3C 2J1KA 4XHJD 4O2FA 5CIPA 2HFEB 4ZO7A 2HFTA 3T8XB 4M7LT 1T83A 4PLOB 3RUGE 2FDBP 1A6TB 2R1YA 5DJ6B 3GSUB 5DJ2A 1NCWL 1HIML 1B4JL 5D96C 1HWGB 2IALA 5A2IH 1LEGB 5EFIB 3ECBB 1CU4H 4QRSA 1FN4B 4YFLI 2ZUWA 4ZMAT 3U46A 4ERSL 2PW2B 3RDTB 1JZ8A 2RBLA 3HMXA 4RWYH 2IFFH 4NCC2 1RURL 2F15A 3L1OH 5AEAA 5EA0L 3LRGA 4JJ5A 5DJ2B 4XXDB 4GLRI 2IALB 4XC3H 5FOBA 2ADFL 4PRDB 4YHLL 4Y1AE 4TUKH 1H0DB 4GBXA 3NPSB 3SDCA 3IXAB 4M1CD 5KBNC 5DVOA 3EFFB 3O3DB 4N0UA 1TJIH 2NY4C 4OKDA 4FQJH 4P46D 2NXZC 3MUJA 1JP5A 3GSXB 1WAAF 1GGTA 3QWRD 5JW3L 4WRLA 3IFLH 1DBMH 5A3IC 3OKOA 3P11H 5T1KD 4PV8A 3VFMA 3AM8A 2O26U 4UDUB 3SPVA 1CZ8L 5J13C 1CDUA 1SYSA 1YMMD 4WWKA 1YNLH 3VXUA 2HAZA 3T4YA 3GUTA 4ZFGH 1LK3L 2EDQA 1UWXK 4NCC1 3QUYD 1NMAL 1JNLL 2XOTA 3R1GH 4KQ3H 2FBJL 4JRYE 5DJ8B 4U1KB 4PJ5B 1Q0XH 4Z7VE 4MXWH 4KJWC 4LHUD 1XGTB 2ARWA 3VFMB 4D9LH 1QNZH 4DZBA 2QJDA 4O9HH 1CGSL 1FVCB 3L6FB 5F3HA 2CLRA 4V1DD 3GUTB 4J1UB 1EEYA 4YDLC 2NYYD 3QHFL 1UM4H 2GT9A 1KCVH 2A77H 1QSZA 4HKXA 1X5KA 3PWVB 4X7EC 5AYUL 3C60C 5E9DE 3SKNB 1R3JA 2EYSB 3B9KC 2N1KA 4APQD 4F57L 1HHJB 4N1EA 1VFBA 1LVEA 2VLJB 5IMKA 3V7AG 4NRXA 4HWZA 4KK6D 4X7FC 1ORQB 1N26A 2J8HA 1CGYA 2DBLH 3ARRA 5SX4H 2JB5H 4MDJA 5HSFA 3I75A 3RX7A 3BZ4B 5B39B 1BIHA 4KK5C 3JV6A 1CU4L 1MJJB 1CVSC 3C09C 3C9NA 2EIZB 1VFBB 4PJIE 2NX5D 2BSRA 4Y5XA 2WQRA 2WBWB 2G75B 4NRXB 1HQRA 5IBUB 5J8OA 1IGCH 1NJ9A 5B8CC 5CEZE 4PJ9B 3I75B 4RWYL 2IFFL 3VU2A 3L1OL 2BNRD 3FQXB 1HEZA 2PXYA 2VXTH 3PNWB 4Q9RL 3C5ZD 5CSZA 3TNNA 4XC3L 1AR1C 4TUKL 5ANME 1A02N 1T22A 4OI9A 5IEHB 2OSLA 5DURB 4WY7H 4DCQB 1HQRB 3RHWK 3FO2B 1MI5E 1TJIL 4W4NA 4FQJL 1HILA 4R7NA 3DHJA 5HI3D 5BVJB 5MENA 1VEOA 4UI2A 3U2SA 3ARGD 1OOAA 4B5EA 2C3XA 3RDTC 1GXEA 3QRFM 3IFLL 2Q86B 5D7IE 3DUSA 1TCRB 4WI4A 5I75B 3P11L 4XTRC 4EI5A 4GW1B 3OHXB 1RPQA 3BPLC 1D9KA 2OSLB 4G8FB 1YNLL 1DQJB 2WIMA 5FA3B 3BPOB 4ZFGL 2F8OA 1QR1B 4PRAA 4N9GA 3R1GL 3T2QA 5MENB 1NGXB 5D2LA 1V7NH 4KQ3L 5IF0A 3DUUA 1MLBA 3KPSB 1Q0XL 4RAUB 2FEEL 4MXWL 3IETA 4EI5B 1EJOH 3DXAA 4X4ME 4D9LL 5KS9F 1D9KB 2WSKA 1QNZL 1H3XA 1TXKA 4L8BB 3V5HA 1F2QA 4O9HL 2LFGA 1PG7H 4YZFF 3QP3A 4KRPB 5F21B 2XACC 1KCVL 2A77L 2HLAB 3SDXF 1OTUD 5DVMA 1O5DT 1CGWA 3B83A 5CD3A 1MLBB 1YECH 5I76A 5E24E 1LO0H 3JTSB 3RTQB 2IMNA 4G9DA 3BQUC 3I3DA 4Y2DD 5L2KE 2F54B 4ELKA 4F2MB 2DBLL 1SVCP 2EXYC 4G6ML 2JB5L 1HWHB 5GIRA 1GPOH 1QBAA 2R2EA 4RMSA 5DJDA 4LVNC 1AXTH 1QO3A 1N2RA 3QJFB 3NOIA 1UC6A 3L3IA 1WCBA 1ZHKA 2DIBA 1K5NA 4ELKB 1IGCL 5C9JA 3HUJF 3PJSA 4UNUA 4LEOB 5T3ZL 1A2YA 2YMXH 2VXTL 4GG6E 3PGFL 7FABL 5KW9H 1EDQA 2CRIA 1UJTA 3JV5A 1T0NB 5J1SC 1T4KB 4WI7A 2YXMA 1QLFA 2F5BH 1K5NB 4WY7L 5C8JA 2AGJH 4XPFH 3VFOA 1XGRA 4JFDA 3OR6A 5C08B 2L7UA 4RWHA 2BVQA 4I1NB 2OMNA 4YHNA 5IMMA 3V0AC 2CDEB 5HHPB 2ICCA 4XVTH 5E8DH 3OF6D 5KSAD 3CVHB 4DKEH 2JIXA 1G9NH 3WFHA 1HH9B 1CDYA 1QLFB 3BYTA 1RIUL 2G5BB 3W9DB 4ESKA 5FV1L 5C0JA 5DS8A 2NY5H 4ZDHA 1P5UA 5IMMB 4P9HL 4HDIA 1YC7A 2AERT 1V7NL 1IEBA 1KJ2A 4ZUVA 3VRLE 4IJ3B 4QHLB 5DHYB 3MBEA 5TH2A 1X5LA 4HEPG 1U3JA 2BX5A 1KN2H 3P77A 3O9WD 4P2QA 1RZ7H 1EJOL 1VFAB 4OCNC 2WV3A 1NGYA 3RX5A 3NVQA 4JR9H 3I6LE 1A1NB 3HE6D 1QLRA 3MJ8B 3MRNA 4J3UA 1EERB 4IOSD 5C0JB 4PG2A 4HWEH 2P5EA 5IHUH 3DOSA 4PJ7E 4JEGB 3STZB 4Q7DA 3MBEB 4YPJA 5TH2B 4YQXH 2A6KA 1LO0L 4F7PA 2XTJD 3L5HA 1TETH 4NHUA 3MLYH 4JFFB 1A4KA 4HXAH 1G7HA 4NQCE 3W9EB 4AT6A 4CKVX 5KTEL 5I1IL 2HKHH 2P48B 3EZ8A 1IJ9A 1RZKH 3AGVA 4OV6F 4QEGA 1GPOL 1UJ3A 5JXEC 2F74A 3N0PB 2UYLA 1AXTL 4N0CD 4KRNA 4G42A 2EDFA 4P2CG 5HHME 3WJJC 2DI8A 2YD1A 3BMVA 4KRPC 4Y4HA 1IGJB 3MJGX 4X99B 3MJ9H 1CS6A 1I1AB 1PFCA 1NMBH 2EEAA 1CG9B 3OB8A 5KOVC 4FQIH 2AEQL 3DVIA 5I71B 4QTHB 1J12A 4KTDH 2YMXL 1W8OA 1SHMA 3DX6B 4UQ3A 5KW9L 3FCTA 2P24A 4MDIB 3EJYD 4WEBH 2F5BL 5IVXB 1I85A 4F80A 2AGJL 4XPFL 2AXJA 5EORH 3K0WA 2YRZA 3F7QA 1ZT4A 1G9NC 5CJQH 4NQEA 4G8EA 4PJCA 4NN7B 1RJZA 4I18C 2YPLB 3MOQA 4XVTL 4IRSC 1FFOA 2ZUSA 4PB0H 5C07A 1S7VB 3IDIA 4DKEL 3DROB 1G9NL 2NY5C 2CR6A 5CP3A 5J56B 1T20A 1UWGH 1CFNA 2I26N 3DX8B 1GJIA 1BREA 2NY5L 1KNOA 2AEWA 2DTMH 4U1MA 4NQUA 4ZS7L 3GSNH 1AR2A 4PGBA 4PJCB 3VXUE 1I1FB 3GJEA 3T2OA 4R3SB 5FCUH 3LPWA 3U9PL 4Z76A 1KN2L 2R69L 3GSQA 1RZ7L 3ARDD 4JR9L 4GUPA 5EH1A 1X44A 4LQ1A 4GAFB 2N4IA 5ICZB 2HT2D 5LWYH 1AD0A 4HWEL 1RAMA 1CDIA 3ARYA 4JLRB 3DX7A 4IIQA 1ZANH 2YPVH 5IHUL 1H5BC 3ULVD 3EOBB 3OGCA 2AJVL 3CVHL 3ILQD 5FYJE 5C71A 4YQXL 2BP3A 3UPCA 1RZKC 3EJJX 1R3KB 4ODVH 1TETL 3MLYL 1DFBH 2APBA 1QYGH 2OR8A 1IAOB 1KIUA 2X4NB 4F7CA 2HKHL 1UQSB 1CN4A 1RZKL 4KHTH 2J6EH 3IS1X 4N8VB 4Y16B 3L95B 3DX7B 4HH8A 1OSZB 3T65A 2G2RB 3DRTB 3INUL 2AAVA 4J3SA 3FTGA 2OJZH 3JXAA 1JNJA 2B2XH 5D1XC 2AI0H 1CE1H 1QA9B 3P4OA 4JREC 4RBPH 3I6KA 2VOTA 4GH7B 3O6FC 4C58B 2R0LH 4HT1L 2R0KH 3MJ9L 3U7YH 1NMBL 5HTSA 4ISVB 3P4MB 3NZHH 1FFPB 5DC9B 4FQIL 4LDOB 1QBBA 2DRUA 4MD4B 2FO4A 2UZXB 4OF6A 5AZEH 2LABA 4I9WE 1GZQA 1MHEB 5J0BA 4MQXC 3ARWA 3CXDH 4HK3J 1I8IB 1XF4A 4OV5B 3OX8A 3S37H 4MJ5A 1FZKA 3EJZD 3MOAH 3S9DB 5EORL 2D0HA 1PZ5A 3D2UB 2XA3A 3L3DB 1Z0NA 4JM2D 1JPST 4PB0L 3NMEA 3MRHA 3L3KB 3AS3A 3VFNB 4MNGB 3C8HA 5EZIH 4O2EA 4S2SB 1XF4B 3IDXH 2CIKA 4KJQC 3MV9A 1G0DA 3D39B 1UWGL 1FV1B 1ND0B 5ALCH 1ZXQA 3QO1B 1VDGA 1MEXH 1PZ5B 1N8ZB 2FEEI 2DTML 2FSEB 2WBJC 2ZUYA 4P2RD 3RX8A 2RIKA 3PDOB 1PX3A 3CDCA 5L0QC 5SWSD 5D2LE 1KUMA 3QDGD 4N0RA 4O2EB 2NY0D 2H26B 3MLUH 5LWYL 3DXAE 3EAKA 1XIWA 2VUYA 2H32H 5TGBB 2R0WH 1ZANL 2YPVL 3HZVA 1C5BH 1MFEH 5CEYB 3AB0C 1A7OH 4NQXB 2EZ0D 5ETUB 5SX4I 3VFPB 2FHBA 3U30C 3IVKA 4ODVL 2HVKB 4WW2A 2P44B 1DFBL 2WK2A 3HZYA 4WUUD 1JNHA 2EXWC 1WIOA 4KHTL 2Q7NA 2J6EL 4K7FB 3BN9C 1XIWB 2HH0H 4PJBF 5IQ9B 1RZIA 2OTUA 2OJZL 3TPUA 5DRZB 2AI0L 1CE1L 4YBQC 5HHVH 5MEQB 3MYJB 3IVKB 2R0LL 1GSMA 2R0KL 3VXSB 3SGKC 3U7YL 2HJFB 3PWPA 5TE4L 3WKML 3S36X 5CBAB 4PRPA 1JNHB 3GSRA 3NZHL 4UV4L 4D9QE 3HE7A 3HLAB 1HOCA 1H3PH 5AZEL 3FQTA 2EC8A 5F1SA 4OM0H 3RIAF 2F19H 5JXAL 3JV0A 1NEZG 3D48R 3CXDL 1R5WB 4W6XB 3LZFH 2DMBA 5KSVA 3S37L 1D5BA 2EE9A 5JDSA 4MMXC 3MOAL 3QR2A 2FECL 3O81A 3GSRB 4F37F 1P69B 3HE7B 3WXVL 4JFDE 4KZEH 4PY8I 3OJVC 4X9BA 5K9OB 3C6LC 3VXOB 4WFHE 1R3HA 1PEZA 1JWUA 2MWCA 5M95B 2D7MA 2AJYH 3GFUA 3HPJA 1A3LH 5EZIL 5C0AA 3WE6A 3FZUC 4PGEA 3IDXL 5KSVB 1A21A 1CFBA 1E4WH 5ALCL 12E8H 5I1GH 5DI8B 1MEXL 5K9KB 2WMPA 2R29H 3LDBC 5IEKB 2CSPA 5JO5A 3PWNA 2H45A 2GIYA 4OIAA 2XZAH 3OKNA 4DWHA 3FRPG 1R3HB 1ZT1A 1JWUB 3GMPB 2BXYA 4OD3H 4U6HA 4UINL 1R5VB 5FKAA 5FM8A 5C0AB 4LCIL 4LMQI 3GKWH 3EDFA 3FL7A 2WANA 3C2AH 3MLUL 1P6AB 4KK8C 4P2QE 5DD5H 3TBTB 4P49A