5T1DL

Crystal structure of ebv ghgl/gp42/e1d1 complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
217
structure length
217
Chain Sequence
DIVITQTPLSLPVSLGDQASISCRSSQSLLHSNGNTYLHWYLQRPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLMINRVEAEDLGVYFCSQSIHVPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for Epstein-Barr virus host cell tropism mediated by gp42 and gHgL entry glycoproteins.
pubmed doi rcsb
source organism Epstein-barr virus (strain b95-8)
molecule tags Viral protein
molecule keywords Envelope glycoprotein H
total genus 38
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2016-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t1dL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5t1dL01
1W72A 4YX2H 2EDRA 4WFGD 3GMPA 1V3MA 3R8QA 2JB6B 4R96B 3VWKD 2WQ8A 1CFNA 4NZUH 2UYLB 4JFFB 4ETQA 4HEPG 1NGWB 2FYYA 1G9NH 3MNVB 4WEUD 4OIAA 4JPIA 4ZXBB 3VFUB 1S78D 4OLYH 6FABL 1FO0B 4CVZA 4PG9B 5AD0B 1EA9C 2VLRD 4LHUG 4LSVH 5D1QD 3DO7B 2AJXL 3IXAB 3BJ91 5F88A 2NX5B 3NIGF 3HPJB 3MMEA 2WSKA 3KPRD 1CICB 1FFRA 4NZRL 4HWEH 3P73A 2BVOA 3QXDA 1S7RB 4KUCF 1FVDA 4PJ9A 4LCUA 3OG4B 3P4MB 1EPFA 1YQ2A 2VB5A 3FN0L 1HNFA 1U8NA 4HH8A 1H3GA 2N1KA 5I1IL 3RGVC 1C5DA 1FNSH 1FZOB 3KPPA 4MJIE 5KJRL 1SJXA 2XNAA 5IG7B 4Z7WA 5FK9B 2VOTA 1T6WA 5LQBL 1CDCA 1F2QA 5KSVB 1LP9B 3G04B 5KW9L 3HI6L 5HSFA 5AUMA 3WL9B 1HQ4A 4M00A 4LOUD 2PW1B 1YNKL 1PGRB 3GSOA 1PVHA 4G8FA 5ID1A 4P23C 2W0FB 4W6WB 3CH1B 4ZTOL 3HNSL 1T7WA 1KIQA 2KQNA 3N06B 4MAUL 3OF6D 4JN1L 4KK9D 2CDFA 3RWDB 4OLYL 1WBXB 4PD4K 4KTYA 3EJZC 2CRZA 3PDGA 3UJJH 5A2JH 2X4TB 1ADQA 1OAUH 3ARGA 2ADFH 3EFFB 2H26A 4MQXD 3VE0A 1RJYA 5HVWA 3QUZC 2YUXA 1CE6B 4S10A 2VLJD 5A2LH 3GSQA 5IBLD 3HUJA 1NL0H 3MR9A 4GSDH 4NZDA 2QKIA 4GAJH 5GRZA 4MNQE 2V2XA 5D4QA 4M8QB 3QEUB 5BJTA 1HH9A 3UO1L 2Q7YA 4NO0A 1RAMA 4GMSL 3PHOA 5DD1L 4FXGA 5E2VL 1A14H 5E00A 4A6YL 1DVFB 5C0FB 1FFNA 4KDVA 5INCA 3ZTJG 2EYTA 4ONGH 3RA7L 2R8SH 5H35A 2R2EB 2IH1B 4NJAL 3NPSB 1UH2A 3AS2A 4R3SB 1RURH 3IDYC 4PD4J 2AS5M 4PREB 3BUYA 1EGJA 2EDLA 5JDJA 2YS4A 3PXHA 1CYGA 5FGBA 3BEVA 1I85A 3MJ6A 1JHLH 1KEGH 4JRWA 3K0WA 4OI8A 2DTML 3OB0K 1F8TL 3N50A 4E41E 5F7EH 5DD0L 1IC5L 3GEWB 5C9JB 5IHZB 4NNXB 4AJ0A 4HXAH 1V7ML 2C9AA 3MROA 1U92B 3QB7C 2Y07H 1MAMH 3ROOA 3GSNB 3RFZC 1WWAX 3HZVB 4OD3L 1GZQB 4YHMH 3DTXA 3GIVA 2QLVB 1G6RL 5F72S 1FVEA 1QBLL 1J7VR 4DN4L 4ZS6C 1P7QD 2XA8L 3V52L 3VFRB 2Q8AH 4IRSB 3GI8H 3WNNA 3QDJB 2PYEA 1X5GA 3KPNA 5EBLA 1J8HB 1P4IH 4WO4C 3KWWA 4MJ2A 1IAMA 3IJHB 4D3CL 5IVNA 3JV6B 2YMXL 5ELIA 4NP4L 4APQC 3BP6A 5KSBF 1IAOA 1FVCA 3F6LA 4U1LA 5DRWB 2Z35B 5JHDD 1J1PH 1BJ8A 3QXAA 3CFEA 1QLRB 5TDOB 5D1XD 2IAMC 3SJVB 3EUUA 3MREA 5DQ9A 5IW1A 3F12B 1AC0A 4LARH 4TULH 3RDTB 4UT6H 3ARGC 1ZLUK 5F7DB 2IMMA 3BGFB 3QPXL 4F9LA 1GGIH 4CJ0A 4K3DH 1N8ZA 4R4FL 5MEOB 4DQOL 5EOCH 2X4UA 1K9TA 4P3CH 4JO1L 3EOTH 1T83A 1KEMH 1JNLH 2NNAA 2HTLD 1GC1H 4OGYL 1EEUA 5F3HB 5C0CB 4GG8A 1PG7W 2NY4C 2H2PC 1JP5A 1FORH 4TN9A 4W6XB 2ED8A 4N0FA 2IQAB 3MCKA 5GJTH 2G5BA 2ZKHL 4LCYA 3QZWA 3DETC 1A4KA 1S5IL 2YD8A 3RGHA 4ETYA 4X5WA 2A73A 4RCAA 1NLDH 5D7LB 2J8UB 5IJKC 3EDFA 2IANA 3SKNA 4PJIE 4KK8D 3T0ED 2O26U 3QIBD 5HJ3A 3EIFA 4RDQF 4XXDB 1NAKH 4K3EL 3TA3C 4QO1A 1C12A 4OI9A 5DK0B 5EC1B 5B38G 5FHBL 4RMSA 4TVSa 2OJZH 1VFAB 4P9HL 1CFSA 4ZFGH 1G7PA 4NKIH 5C0AD 5F70A 2X9XA 5IK3B 1YJDH 3D2UD 3TF7C 1H0DB 1N5AA 1OAXH 5MERB 3IU3A 4CAGA 4P23D 3SEPA 1DN0B 4H88H 4ZQKB 4ZG1A 5GRJL 4O4YH 2AJ3A 3JXAA 3GJEA 5JHLH 2W0PA 2Y72A 3BP7B 3AFLA 3IDIA 2C3VB 1TNNA 4NT6A 3AY4A 4P2OD 3L3IB 5FYKE 5I75B 2UWEB 4M02A 3SDAC 3EJZD 5C08A 2XN9B 4HIEB 1R3HB 2V5TA 3O3EB 4LDEB 3BRFA 2QEJA 1IAKA 5GGUB 1U8JB 1VDGA 1D5BA 3KPMB 5TE6H 1I8KA 4J3WA 1NCNA 2J88L 1Q0XH 2XKNA 3QO0A 4LVNB 3ARVA 3TVMB 1IJ9A 1J1OH 2R2HB 4BYHA 2CLVA 4OJFH 1KTLB 4DWHA 3TBTA 1RJLA 1JHKL 2GITB 4ODUB 8CGTA 4U2YA 4HS3A 3QDJE 3RY6A 3BW9A 4KROC 5KSBE 4HIJB 4OI7A 2PO6C 1EO5A 2JIXB 5LGJB 5BQ7A 1VKXA 4MD5B 1PZUB 1FL5A 4HKXB 3SE4A 4JO3H 2K7PA 5C0GA 3DRQA 3MRBA 3RKPA 2VJXA 2VZ3A 3HUJE 2APFA 3MGOA 2GSGA 5D9SA 4PLKD 5BV7L 3TPUB 1BJ1H 1SM3L 5D2NA 3U7WL 1Y0LA 3GJFH 2EECA 3B3IB 3ULUE 3B9EA 5SWZE 5TGBB 3FN9A 1JWUB 4PJBA 3MACH 1KB5B 3E2HC 2ZUQC 2P7TA 1YEGL 1CICA 4XBEL 3QUXB 4R9HA 2CLVB 3L95B 3MO1B 5DSCB 1NAML 3MPCA 4PTTA 1U95B 1IGTB 5ECJE 1ZVHA 3U4BL 2GITA 4LPCA 4NQXB 3ULVE 1A7NH 1A7QL 1XCTB 4FQ2H 3TCXA 1SJHA 1I8IB 1NGXB 5MI0B 4ZPVA 5GGTL 1AXTH 1IGJA 5IROC 1QFWL 2XZZA 4OCLC 1CLZH 1QBAA 2F8VA 3U4EA 2QQNH 4PJAB 2YC1A 4APQD 1T1YB 3KPOA 1QTYT 2OK0L 2P45B 4KHXL 2P24A 5DJCB 5KVDL 3QR2A 4PJEA 2VUOA 5JW4Q 1UB5B 1P7QA 4KDTA 5DMKA 2VWEC 3IJYB 5JW4N 1DUYB 3EFDL 3SDXF 3FQUA 4P23A 5AWNH 5JW3H 2LAGB 2A6KA 4FZEL 5BVJA 1MLBB 4HX1A 1LDPH 1UJ3A 4KXZI 4ZUSB 3U83A 1EHAA 3IDXH 5IVZB 4JVPA 1OQXA 4LVEA 2ZG1A 4P48A 1MHEA 4RGOL 3MSPA 3V6ZB 5GGRY 3O9WD 2PTTB 3BPNC 4MD0B 1IGCL 1NCAH 1MFEH 1QHOA 1FE8H 2CSPA 4K94C 4RNRA 1O7SA 4QRPE 1YNLH 4HMCA 1IAIH 5EU6B 1BFTA 2MQ3A 5D6DC 3V9FA 5L0QB 3PHOB 3VRJA 4O58H 5EO1A 3HMWL 3WO4B 4C59B 1HI6B 3W0WB 4LASH 4CU8A 5HVHC 1F6LL 4MWFB 4LLDB 4RMWA 3MLPA 4PYGA 3ZKXC 5E5RB 3ZE2E 4X7CC 3PNWA 3TBSA 4NSKB 5FHAH 3PV6A 1NCCH 4Y89A 1TQBC 2P8PA 1DUZA 3CDFA 4U6VH 4DGYH 5JA8B 4LQFH 3HAEH 4KKAD 1G6VK 1DR9A 2OZ4H 4ZO9A 3DUUA 5E08H 1ZLSH 3BO8A 5K9OB 4UQ3B 1NDMB 2Z4QB 1A6AB 1KCVH 1P5VA 1GZPA 4XC3L 5IVXF 3RVUD 4OFYA 1MOEA 1I1FA 1G7QB 4Z76B 2Y7QB 3AS1A 1FLTX 3NFPB 4L4VD 5HHVH 4R26L 4A2LA 3BDBA 2Z31A 4F57L 1MFDH 3L3HB 3GJFK 1JGDB 3SJVD 1IL1A 2Q87A 4R2GB 5SWSE 4PJEF 3HE7C 1SQ2N 3NA9H 3A6BL 4R90H 4R7NB 3RWFB 4NC0B 1FLRL 4X0KB 3ORJA 4QRPB 4PJDB 3VFTB 5GGQH 1N6QH 3MJ8B 4M7ZB 1E6OL 4HWBL 1LO2L 3BP4B 2UZYB 4GAFB 2ICEB 2YUVA 4GRLD 5HHMB 4KVCL 3BKCH 4WHTA 2Y4SA 4MA7H 2WWMD 1KJ2A 4KHTH 3FQRB 3ARRA 1F4XL 2Z91A 5MHSD 2Z4QA 4DUWA 4L4VE 5BV7B 4OZHF 2J7LA 3L7EA 3T09A 1CLOL 2HT2D 4P3DA 4Z7OE 3MODL 1J0IA 3I02A 1KLUB 1WSST 4OB5H 5AZ2H 5J6GB 4LVHC 3FN3A 1X4YA 25C8L 5LBSL 4ELMB 5EPMB 4JDZA 4HCRA 5EFIB 4YUEL 4JHAL 4Z7VE 5ESVA 3LS4L 3LPWA 3VH8B 2W0LA 1NCDL 4MJ4A 1P4LA 1MCDA 2IWGA 1BVLA 3F7VB 3SDXE 1LEGB 3C60C 4XNQA 1ES0A 4QRQB 1MCNA 3R06A 4HV8B 1A6WH 5DJYA 4NGHL 3LKRA 4OQTA 4Z7WE 3U0WH 3DMMB 2PR4H 4YHPA 2R1WB 1CN4A 3MUY1 5E4EB 1HILB 3ZHDA 3IFOB 4PJ7E 1F6AA 1CGVA 1GOHA 3FAWA 1Q0YL 2DBLL 4G9FB 4PYHA 4GKNA 3PQYD 3SY0A 2HJLA 5IFHH 4YPGA 4OM1L 4XVUD 2BVPB 3G6JE 2QQNL 3D0LB 3NN8A 5E5UB 1F97A 1CLZL 1HHHB 1P4BL 2AXFB 4PP2A 4NQEE 3L1OL 3QHTC 5J89A 1IM3A 1YMMB 3GRWH 3V52H 1CL7H 1J88A 1FO0L 1YY8A 2A77L 3QQ3B 4H26B 4P2QA 4TUJB 3TP4A 1I1AA 1CFQA 3SPVB 2BNRE 4FP8H 1FFNB 5JMOC 4P5MB 2CXKA 2HG5A 3LB6D 2Y07L 4JN2B 4KUCD 3W0WE 2ZOKB 4WHCA 4RA0C 5LJYH 2C7UB 5HGHA 3IVKB 4XP4H 1F8TH 3I3EA 4PJAE 4QTIL 5ID0B 2Z31C 2AV7A 3MRKB 2EH7L 1MI5E 3LH2L 2ZSVB 1L6XA 2Z31D 3U7WH 5IBUG 1Z0MA 1WJ3A 4ZODA 1NAMB 2W60B 5DWUH 5FDWB 4N0YL 3MRNB 3OHXB 3T3MF 3T1FA 4PJHE 5I71C 5IB3A 4U6YA 4GRWE 4MJIB 5A2FA 1T0NA 4KZDH 5DJ0B 4NUJB 1FNHA 1NC2A 3SKJH 2EDHA 1Q9KA 2B5IC 1MQKL 4PGCA 5D71H 2G2RA 4QHKJ 3TVMC 4KQ4H 1OSZA 4FFYL 1F11A 2D3VA 3CPLA 4NN6B 5JXED 4MA3A 1UG9A 3E6HB 3WDHA 3PGDA 4I0PC 3L5XH 3P0GB 3KJ4B 5I1KL 2F19H 3HNVL 3BZEB 4JVWA 2ZOKA 4U7KA 1HYSC 1W0VB 2DN7A 3BZ4B 2HKHH 2QQKL 3DWTA 3X11A 5E99H 3TYFB 2FSEB 5ESAB 4M7KL 4WW2B 1FGNH 5GSVB 2FGZA 2R4RL 1GPOL 4GUPB 5GS0C 5IT2L 3IF1A 1B2WH 1AC6A 4HKXA 3HHRB 2D4DA 3SKJL 4Z7OF 5DEGB 4Y5XA 1XIWD 1QLEH 3FTGB 4LFHD 5IB3B 1WZ1H 1RJZB 3HNSH 2X1WL 2XWJB 1XMWA 3OKDB 1TNMA 2FZ3B 1CE1L 3L5WB 1SEBB 2WBJC 3CFCL 5E2TL 1U8QB 3L3OB 3MGTA 3MBEB 4HMEA 4U7MA 4ELME 5DFTA 3CPLB 3RVTC 4F7EB 3RAJL 4HUNB 3UTPE 1DL7H 2XTJC 5KW9H 4ONHA 4LU5H 4PJXB 4D8PA 2WMPA 1N64H 4JZNA 2DJ4A 4JHWL 3FN0H 4PV8B 4YHYC 5FHBH 5I2IA 5IV2A 3TCLA 4ZOCA 1MNUH 4G7VL 4O00A 4JPVH 1AGBA 5JOEA 5F21B 1WTGT 5D96C 2HFFA 3IDGA 4HIIA 3G6JF 5IF0B 1FL6B 3GRWL 3QIBA 4P0DA 1A7OL 3GKWL 5JLZB 4LLMB 1DQMH 5IMOA 3WNKA 4P5TD 1E6JH 2VITB 1C5BH 4FHBD 3O0RL 2DI7A 3VXMD 3ALPA 1H5BB 1AD9A 5IFAH 1LHZA 4R97C 5F1SA 3BQUA 5CWSA 2ZKHH 4RFNB 1ZOXA 4IRSD 3UXFA 5MEND 4X4YB 1A47A 4XHJD 2XWBA 5EWIH 1XGYH 1YYLH 1KN2L 4HUVB 3CLFL 4XVJH 4HIXH 3QWQB 1BD2A 4P4KA 1KEML 1XGTB 4NO0D 5KG9B 1LK2A 3WJLA 15C8H 2I9TB 2NY5C 3LHPL 1T03H 5FO9A 1KPRA 5E03A 2F53A 3T2NH 1OM3H 4G6JH 2XWTA 1D6VH 1OLZA 1X4ZA 1XR8A 3CFKB 1NBVL 4BUGA 3NZHH 1T04A 1FZOA 3KPPB 3ZZ1A 4WNQA 4GG6E 1Z6JT 2WK2A 1PY4A 4QT5B 3DX6B 5F7FA 3DO3A 5EBMB 4WRLA 5I30H 4B7LA 5I1EH 1FFPB 3LIZH 4JKWA 1BP3B 5TDNB 3SGJC 4WI7A 3KPMA 2HAZA 4GW5A 3ZDYE 5C1MB 2H3NB 3SKMA 3MLTA 5JOPE 3BH9A 3GSXA 2JJVA 3MFGB 3AVEA 3SGDH 3VXSB 4CMMB 1UA6L 3FT4B 4W6YB 4G3YL 2F5BL 3IDYB 3GI8L 1N6QL 3IDUA 5IW3A 4KI5D 1B0RA 3M1BA 5EULV 1OAYH 3RVVC 4YBHA 3X13A 4DN4H 2HT2C 1BQHB 3PABA 3T3PE 4PJ5E 1A9EB 3B2UC 4DZBA 3KS0H 4JFQA 5HDBE 4C56D 1GOGA 1QFOA 2XWTB 3BVNA 3EDJA 2VQ1B 1EHXA 5DLMH 3QIWC 4ZFZB 5I17B 7FABH 5HGBB 3T65A 4J3SA 5E1AA 1JPTH 2AJSH 3DX6A 4AZ8A 1H3WM 1JHLL 5JO5A 1IFHL 3VD4A 4J3OC 1WBXA 2EDBA 4ELMF 3T0EE 4WUKH 1GH7A 3F8UB 2ZCHH 3TV3H 1YECH 5DMIH 2YUZA 3SJVE 3MUJA 3ARFB 2LU3A 4TQEL 3UTTB 4Q2ZA 3MRGA 3TVMD 3FT4A 2OMNA 3QWOA 5CILH 5DF0A 3LN5A 4ONGL 5E8DH 5A1AA 3RWJA 1KB5L 5ICXB 2GTWA 4PJIA 5F89A 1OHQA 3S7GA 3BZFA 2QHRH 1FG2B 2BDNL 3JZ7A 4LIQH 4B5EA 1CD1A 3P11L 3R4DA 5D1QA 1IGJB 1G0XA 1FCGA 4OKDA 5L9DL 1QPXA 4HK0A 2W92A 4R0LB 3KPRE 5HYJA 3TN0B 5C0JB 1RI8A 3P3YA 3D9AL 1MUJA 5I6XB 1U58B 3GO1H 4PJEB 1GZQA 5EU4B 1KCUH 5JXEA 1M7XA 2B7DT 3OMZA 4LBEB 3S3PA 3UC0H 3G5YB 5KS9B 4WFED 3NVQA 4P23B 3LKRB 3QXWA 4GG6A 3VXUD 4UOJA 3RU8L 2HFTA 3O9WA 3IFPA 4WTZG 3DRTA 1YMHA 2EKSA 4WTZA 5CIPA 1HINL 4UU9B 2FWOA 4ODXA 1ZT4A 5BVPH 4U0RB 3MXWH 5CAYB 3FB8A 4XPBH 4YAQB 5DUMH 3VXRA 3STZA 4V1DD 2DQUL 4NQVA 4X6EA 1EJOH 4DFHA 4A2MA 2AW2A 3ESVF 3ZYOA 2VH5H 4JM2A 4PJ9D 3VWKC 5BZDA 4QWWD 4Z95H 5DT1H 3RWGB 3RIFF 4J1UA 4L29A 4JFFE 3B43A 2A1WH 4OZFH 4K8RC 1OT1A 1T80A 1RIVH 1IGFH 5IJVB 4QWWC 5GGTH 4O2CB 8FABB 3CVHA 3GGWB 1KCKA 2CJUL 3BSZL 3EOAA 3UJTL 1YPZE 4K8RD 4IOIB 1I3RA 3MRFB 3PP3H 2GSIA 1H3PH 2JF1A 5F7NC 4XBGA 3UPRB 1MCWW 1PG7X 3W11D 4WCYH 2FDBP 3MLXL 2YRPA 2CPCA 2WV3A 5ID0A 1MJUH 2VAAA 5GZOD 2AK4A 2B1HL 1RJCA 5TQ0H 4OCWH 5C6TH 4C56B 4NZTL 3FONA 1I7ZA 4IRSC 4Y4FB 4Y19B 4KVNL 4GLRH 1JFQH 1LP9E 2IFFH 3TEUA 1BQLH 4PRHB 4YQXH 3T04D 1WT5C 3WFEH 2KPNA 5HDBF 3SJVA 4OQ1A 3H3BC 1BFOA 5E7BA 4OZGF 2Y7QA 5B3JF 3CK0L 4PGCB 3DVGA 1J10A 1S7SB 4M62H 4ZNCD 4WU7B 1V3LA 4XNYH 1LWRA 2APBA 4XP6L 4QHLB 3WFDH 5F3HA 5C0CA 1TQCC 1OARL 4NJ9H 1ORSA 2AJUL 4M7ZC 5D7JD 1LQSR 3BDYL 1R5WA 1I3UA 4ESKA 4MYWB 3BT2H 5GISH 2UUDH 3LDBC 1BD2D 1MFCL 2AP2A 4J6RL 2E8ZA 3O3AA 4AM0B 2BC4A 2CIIA 1R0AL 4LLYB 1NMAL 1A6TA 5TE6L 3FONB 4CN1A 1QFUL 3IETB 2XZCH 2J8HA 2J8UA 5JIHA 1K3IA 3BEWB 4M6NL 1CICD 3AROA 4C58B 3RZCA 2HN7B 4MNHB 4P5KB 1LE9A 5IM7B 4KRPC 5C08B 3SE4C 1FBIH 1M71B 3DI3B 1R3JA 3FQTB 4ETQB 4WWKB 1BIIB 5H8DA 3MGTB 5ALCL 1A6ZA 4J4PC 1B9ZA 1H8NA 2E27L 3B9KC 1AY1L 5BV7C 5KVMC 5IESH 4TUOA 5I8OH 2NX5A 1M6OB 1MEXH 4OZ4A 4Z78A 5CCKL 3AXLB 3QI9B 4R7DA 3QDMA 1DBAH 5DJYB 3IAQA 4JANA 1O0VA 5DUBA 2E3VA 1MIEH 2JJWA 5DMGD 1YEDA 3IT8D 3L3JA 4KMTH 3MV01 4X9FA 2UWEA 1QLFA 1MCBA 2VLKE 3SDDD 3G6JB 4Y5VC 3WV0A 1KYOK 5EZOH 4HLZH 1N7ML 3L9RB 3IETA 3U6RB 1JK8A 5BQ7B 4G9DB 5IB2A 3BIBX 2YKLL 4QKXB 4RAVB 2LV4A 1R5VA 4H20H 1OF2B 5KVFH 1GHFH 5EOTA 1T66D 4ODSL 4ZPTA 3WSQL 4ERSH 3B8SA 4S11A 5J12B 5DQDH 4TTDD 4LRNH 3UTSD 2FB4L 4P2QB 4EDWH 4TUJA 4X4YA 5I1CH 4JDTL 1AGFA 3WKMH 1AR2A 1RK1A 5J3HD 4WWKA 2AKRB 2GK0A 2IBGA 4FZ8H 4P5MA 3KXFB 4NC1C 4OLUH 2DQIH 1U8HB 4GKSA 5HI3D 3HCVA 1DDHA 3VMPA 4PY7B 2WUBL 3VE0B 2J6EL 4QCIA 3U7YL 3GRWA 3GMRB 4JO1H 2AV7B 3H3PH 3OGOE 3T8XB 3ULSB 4I5BB 3JBG7 2B4CL 1WCBB 4KV5E 4DKFH 1GGIL 4MVBD 4O2EB 4JLRA 2AXJA 2CMRL 4HKBB 2YD5A 4EI5C 3DUSA 3ISWA 5AAMA 2ATKB 1F4YL 5EORH 5CJQL 2FB4H 5DDHA 2DL9A 4EDWL 3BAEL 1JGVH 5JTWA 2EDTA 2BHYA 1JYNA 2VDLL 1IKNC 4OTXH 3V5HA 1U3HB 1VGEH 3K81A 3I2CH 3DUHA 4XPGL 2Q20A 4PJAA 4M7LL 4S1DD 1DFBL 3CSYA 2XQYG 4JFZH 4WUUE 2BK8A 2P7TB 3C09B 5K93A 4PRDA 4QHMA 1DQQA 2DKMA 5EUOE 5IB4B 3E6HA 1HHJB 1XGRA 2AGJL 2M8XA 3ARBA 1K5NA 5INDA 3DVIA 2GK0B 4P4RB 4IEFB 5HHQA 3H9HA 3FQUB 1GGUA 3T2PA 2BXZA 4N8VB 2D7OA 4N8VG 2B1AL 4DVRH 2X9WA 5DURB 4XX1E 4OT1L 3VFGL 4GW1A 3D39E 3UP1A 1J18A 1MHEB 5GGSY 4XP1L 2AI0L 2ADIB 5T1KA 4N90E 4Q97A 2HYMA 2J2ZA 2GJ6A 1QEWA 4FXKA 3SDAB 4NBYB 1QSEB 3DX8A 4ZUUA 4MA8L 1RUPL 4PJCA 3MRHB 4RISH 1A3RL 3L6FA 4WU5A 5C2BL 1UB5A 5HXMA 5CGMA 3ES6A 4EIZC 4J8RA 3HAEG 4X6CB 4AEHL 4CW1B 3S35X 4U1GB 4FN0A 4G6MH 2GAZB 3QDMD 3OKYA 3PL6C 1I85C 2YKLH 1TZGH 3QP3A 1YEFL 3OKNB 1JTTA 4LVNC 1MRFH 3LOWA 3FFCE 2PYEB 1DQQB 4Q2ZB 3G9VA 3VXQA 5IMLA 4WFFD 5H94A 4JQVA 3HNTL 4ISVA 3X17A 4JZNB 4F9PA 1UWXK 2FATH 4RNRB 2WANA 5HGGS 1I8LC 4Q9BA 1INQB 2RB8A 2OR7A 4PS4H 1FG2A 3QI9C 2BFVL 2E7HA 5TE7H 4ODVH 4MJ5A 1PDKA 1R5IB 3VD7A 4P5TA 3QXAB 5T3ZH 1JWMB 4X9IA 2C26A 1IE5A 3QUMH 1G7IB 1PKQE 4YHOL 1RU9L 3W0WA 1FFOB 1LP9A 2R1XB 2A74B 1AY1H 2YD3A 3O3BB 4ODHH 4UIKL 4O9HL 4UINH 1A8JH 1DP0A 1NL0L 3JUYA 5GGRA 1AD9B 5DTFA 5T3XL 3MRDB 1X5JA 5T1DH 1GCFA 1UXSA 5D7JA 4UILL 1KIQB 5FDYA 1MLCA 2IADA 4A6YA 3PWUA 1KC5H 4HUVA 2R2BA 3X3GH 3C08H 5C0CE 1QR4A 5L2JB 2XQBH 4OUUB 1BQHG 3BP4A 5ENWA 3BIKB 2ZUXA 1I1FB 3B9KD 2E9WA 3TNMA 2BSSA 4X9HA 1TXKA 3HC0A 3VG9B 4X7EC 5FO9B 4LLWB 4X5WB 4YXKH 3Q0HA 2NY5L 4R2GC 3DBXB 2X6MA 3TT1H 3CZJA 5EU7C 4LNRB 1Y6NR 3CZFA 2PO6A 3WFDL 4L4TB 4M8QA 3MJ9A 3EGSA 4QRPD 3U2SB 1SY6L 1KN4L 2HH0H 4BKLA 5I1DA 4PRBA 5ITFB 4N0UA 2SEBA 4JY6B 4IM8A 2D03H 3WN5C 5CZVL 3SGEH 5GRUH 4UTAL 1AE6H 3JVGC 5EZJA 4JM4L 3CGTA 4NZRH 3UYRL 5E8EB 4K3GA 2E6JA 5AAWA 1GIGH 1XF4B 4JFDD 2EC9U 3N1FC 4FA8A 5BVPL 3PWUB 3Q6GH 1XGPA 5D6CA 5J11B 1CIDA 1G7LB 1OTUD 4WI8A 4EN3D 1RHHA 4HJGA 4U6XA 4Y5YC 3BD5A 1MCQA 1T0MB 4LCWB 3QJHB 4NZUL 4P49A 4Y2OA 5I76B 1CF8H 2OSLB 3O3EA 5C9JA 5IHZA 4HFWB 3EYVB 1H3TA 1JN6A 1Q9LA 2A0LD 4ZOEA 2CXGA 4XAWH 2HVKA 3VXMB 1T2QH 4PJIF 5GGUA 5C8JB 2ARWA 2AAVA 4MQTB 5JOPD 4EI5D 3GHBL 1IEAA 4WWKD 1RZ7H 3S4SA 4BZ2H 3TJEH 1MWAH 5IB5B 1Z2KA 1E4JA 4FQ1H 3MRJB 3TO2B 2VXVH 1A1NA 2HG5B 3O6KH 1KTRL 3FB6B 4M1CC 4G6AD 3QDJA 1MFBH 4JG1L 4UMGA 1F6AB 1T89A 1UM4L 1HSBB 4DN3L 4M5ZL 4NO2A 4PJHB 2NR6D 4TQEH 4LLYA 5J13B 35C8L 2NY4D 2R56L 3Q48A 3QCTH 3SY0B 2FH8A 2HJLB 3BW9B 4CRPA 5EBWB 4AK1A 3MRKA 3M8OL 2G60L 2EIEA 4KGJA 1WC7B 5CLTA 4JFOB 3MJ7A 3T1WA 5DHVA 1IFHH 3NCCB 5FA3A 3WNLA 4DKAA 2GY7B 4UNUA 4CVXB 1GGTA 5FUOH 2V6HA 1CG9B 3O2WH 1KCUL 5D2NB 4H0IA 1MCPL 1BD2E 1MCOL 3D0VB 5KN5A 3OJDB 3VCLB 3ALXA 4NPYB 3GNMH 1MH5A 2BVQB 3B5HA 4NOBA 3NPSC 4XCYA 1UH3A 3RZCC 3BESR 32C2B 4RAUA 1JF6A 4M6ML 3VFMB 2D7MA 3OR6A 4TUKL 3SBWC 3LY6A 3B9KA 2XTJB 4JANB 1VACB 4KTEH 1DBKL 3K80A 1HWHB 3FKUS 4B7IA 1MCOH 4NZJA 4N9GB 4Z7VA 1JIBA 2VXQL 2DLFL 1QSFD 5CILL 5E8DL 1D5IL 4D0DB 1L0QA 5MENA 5EBWA 1NGXA 4U6YB 2NY1D 3QEHA 3SQOL 4IJ3B 2ESVA 4G9DA 5IB2B 3PGFH 5DJ2A 5GS0H 4PJGE 4PLJD 4QOKD 4RFEA 1R5VB 2NLJA 1FCCA 5I30L 3PGFL 1A1OB 2KKQA 3V6OE 3HMXA 2V5SA 5M95B 8FABA 3JV4A 2PYFA 2ZCLL 3P9LA 3SO3C 1NFDF 1BOGA 5HHXH 5T3ZE 1IM9A 3BPLB 4TRPL 5CJOL 1OAQL 5EC1A 2FRGP 1W0VA 2ZP0T 1PG7L 2CKBL 2H2PD 3V4VL 1U93B 1U8QA 3L3OA 3G5ZB 3ZO0A 1KIRA 4ODWA 1FZJA 4NUGH 4U1NA 4NWUH 4MDJA 3ROLB 4MCZB 2VAAB 3T8XA 3ULSA 5E0QA 4P2QE 2APTA 2HFEA 5C7XL 4NRYB 4FQLL 5JUEH 4JDVB 3WCYA 4PJCF 4C83B 3VI3E 4H25A 4TVPH 1WICA 5TDPB 4Q9QL 3QEHB 5F9WC 4XVTH 2QSCH 2Z9TA 3HR5B 5C0RH 5FO8B 1G1CA 3ULUL 4HIIB 4HWNA 2V7HA 4F3FB 3SGEI 4HXBH 5L8JB 2IPTH 3VXUB 3UTSE 4KROD 1D9KB 4AIZB 2EE6A 1KLFA 4LSTL 4K3JL 1ZAGA 3GMMB 1A7RL 1U8JA 4NWTH 1N59A 4FOMA 3O2VL 3EYQC 2VLJB 4M3KB 4RMQA 4XZUA 2VZUA 3QEQA 4JM4H 1NFIB 4M5ZH 4PR5B 1PEWA 5EU6D 2NY2D 3V4UL 1AXSA 5JXAH 3ZKMC 4HPOL 4G6JL 1OM3L 5LXGL 3FJTA 3TT3L 1U2HA 2P5ED 2DQEL 1RJLB 2DKUA 1RZKC 5B39A 3SDAD 5IG7A 5M7QA 3MRLB 3ZYJA 4Q74A 1NBYB 4JM2C 4XVJL 2NY5H 5AUMB 4ZUUB 1A21A 1IGIH 1P69B 4Z6AT 3PIQB 5ICZA 4FTVA 4MQXC 3RZCB 1UQSB 3QUZD 4LGPB 4MHHG 4KUZL 1LEIA 1XGUA 2M2DA 3GUTA 1PKOA 3FHAA 3TFKD 2XQBL 2CLZB 2P5EE 4XBPA 3IDMA 4BSJA 3TPUA 3CX5K 3RWFA 5DRNB 1OP5K 1A6ZB 1DQML 4XI5D 3V4PH 1N59B 5IJKA 1INEH 5IWLC 1JMZA 4OF5A 2R4RH 1MJJB 5IMLB 3VA2C 4XNUL 3W2DL 1ZANL 5IEKA 4S1SL 1OL0A 2BJMH 1J0HA 3LKNA 3HG1A 5EUKB 2IF7A 5I1GL 3MO1A 4U1JB 1JNNH 1VPOL 3MJGX 1NDGB 2D0FA 5B39B 3S37L 5EOQH 4RX4A 4YZFE 2V2XB 2YZ1A 3I02B 1RUQH 3HMXL 1LO3H 2X2YA 4JFQB 4PRHE 3ARZA 1LVEA 1WBYA 1EUTA 1ZGLB 1JPGB 2YSSB 3GHEL 4ZNEA 4NKDB 2VC2L 4FABH 4L8CA 4PP1D 1J8HD 5INCB 3MRDA 5GPRA 3VXRD 3FOMB 1R3KA 2I07A 2X1XR 5DWUL 1OPGL 4L3ED 5ISZA 2FBJH 4JVUA 1HH6B 1QLEL 1P7QB 1C16B 4LSRH 1UACH 1T89C 4RFNC 4JFEB 3KXFA 3UZQA 2PW2B 4MNQA 3P4OA 1MLBA 4JZOB 1Z9LA 4BK5A 1GPOH 5DYOB 1FN4A 1YDPB 3HZYB 4XGZB 5L8KB 1OTTC 3UPAA 4KJWD 2F15A 4LLWA 4KK8C 5JPMB 2GTZB 1RUPH 3BVNB 4Z77B 3L3GA 5E8PA 3O4OB 1FNGB 2BCKA 3GMOB 3QUMA 3W39B 3QUML 1EFXA 1T1ZA 4JRYA 5FUZH 4YNYB 4KH2A 1WWBX 3ARBD 5B38B 4NIKB 1HI6A 2NY1C 4H0HB 3NOIA 4PS4L 1FNAA 3M17A 2ARJB 4MZ2A 2X41A 1GVIA 1S7WB 2IAND 3HNTH 5DRZB 5HD8C 4N0YH 5HGHB 3LN5B 4Z7WF 4N0UE 1CGXA 4RBPH 3U30B 3NIFE 4XPGH 4N8VA 2ATPB 5J8OA 5JZ7C 1VGEL 1C7TA 3U0WL 4OTXL 3GSWA 2H26B 4LCWA 3K8KA 5JZ7D 1HIMH 1A6AA 5CBAA 4AEHH 5GS2D 3MJ9L 3WYRA 3PDOA 4KKCC 3STZB 4M9PA 4ELKA 1OGTB 4JJ5B 1CR9H 2FH6A 3MR9B 4NRZA 2MCPL 3UCRA 1BEYL 3VXSE 1WFTA 3I6LE 5T5NF 1Z9OA 3GMNA 3SDYH 2R1YA 1AGEB 4P2OA 2WINB 3TBYA 2QQLH 2XTJE 5IMKB 1FDLL 5HGDA 1FGVL 4YNYA 4L9LB 1S9WA 2P1YA 5IB5A 3C2SA 2GFBB 1URLA 1C08A 4LAQH 3TA3D 3MBEC 1ZKAA 4PRIE 3OKMA 3S9DB 4F37F 2EZ0C 4MCYA 5DJZB 2O5ZH 2XTLA 4MLSA 2H9GA 1N0XL 4PGDA 5GGVH 3MJ8A 3BZ4A 3X11B 5MI0C 4ZUVB 5A2IH 3QA3B 5FGSA 4W70A 1CXHA 2AGJH 1CS6A 2K9UA 4PREA 1CLYH 4LEXH 4YHLH 1A0QL 4DAGH 2AK4B 4WEMB 1GYAA 4HHAA 4JFZL 2VDOL 4N68A 3VFVB 5FA3B 4MJ5B 1A6WL 3A6BH 1WIOA 1ZGLM 1R3LB 1AR1C 4X6BB 2CGRL 2JE8A 2A9MH 2MWCA 2UZIL 3O6FD 2NW2A 3QJFA 3MCLH 2Y6SC 1AO7A 4HUXB 3WBDA 1EZVX 1U6AL 4NPYA 2N7AA 4JHAH 5IR1B 5DTFB 1P5UA 3MTRA 4RAUB 1EUUA 4CGTA 4GAGH 4Y1AA 3ARXA 3VRLE 5BZWB 1EHLH 3QEQD 2DLHA 3KJ6L 1BPVA 3VXPA 4LKCB 2YWZA 2E27H 2NY7H 3OKMB 4KK5D 1JNHA 4QGTA 5IW6A 2ENSA 4LLUA 3CUPA 3C5ZB 4PV8A 3QEGL 4FZ8L 3A6CL 5ENWB 3IDIB 1CL7I 3WKML 4MHHI 4MGXA 2PO6D 4MDIA 3TN0C 2YXFA 3OR7B 3IKCA 4DK6A 2XKSA 4I0CC 5TQ2L 5DRWA 4L4VA 4MAYB 3CDGB 5E94B 5CD5D 1RIUH 3N0PB 1NSNL 4JGJA 1RZGA 3QO1A 1MJ7H 3P4NA 3R0NA 4L4TA 1NCTA 3QBTB 2BY0A 2YA2A 4J6RH 3H0TA 4ZXBD 1XCQB 3RDTA 3C60D 5FV1L 5I6XC 1SYSB 2FO4B 1I1YB 3E3QE 4G7YL 4PJ8A 5EC2A 4NM4L 4OZFB 4NQDA 2RCSH 1BM3H 5ALBL 3QFJB 1KBGH 1MCWM 3SDXA 2PYED 2BC4B 3EDDA 1HN1A 4FG6D 2P44B 4RGOH 5IROA 4NOFA 1BZ7B 5BXFA 1LK2B 2F53E 4UT9H 5IW6B 1K8IA 5FYKH 5BO1H 4NHUB 5ILTL 1A2YB 3O8XB 1F3JA 2CKBB 2P49B 4EEEA 1FL5B 3HN3A 4YHNB 5EH1A 1PYWB 1YZZA 5T33H 1T04B 4AL8H 5I1JH 1I7TB 4F3FA 5EA0H 1FV1A 3GBNL 4PJ5D 2EE2A 4WI4A 5EBMA 1UH4A 3KPSB 4DUVA 2AEIT 4WFHD 5J6HB 1YN6A 2WIIA 4KI5E 2ILLA 3HI1B 1AP2A 3WS3A 4JPWH 4HGMA 5EOTB 4TPRL 1I9RL 4U4BA 3VW3H 1YA5A 5AYUL 4ORGA 2D31B 3LN4A 1KXTB 3QUXA 4LK4A 4Q6YA 3BN9D 4YIQA 1KCLA 2G5RA 2IQ9H 3PWJA 3FB6A 3ARBC 2R39A 5F3BA 2E5EA 4KJQC 4TSBL 1HYRC 5CS7A 3KLHD 4NRXA 3IU3B 1IGFL 5JIIA 4PY7A 2YEZA 5E70A 1IQDB 4NQCD 4F2MB 5IIEA 5J9PA 4ODTH 1LEKA 3SBWA 2AK4D 5C0CD 4M62L 4PRNB 1H3VA 2BSTB 5GJSL 2PN5A 4HKBA 1DJSA 3F5WA 5AWNL 4GG6F 5JIKA 2CQVA 4X9GA 5HGBA 4K23H 1I7TA 5DEGA 5BCAA 1HKLL 3OF6A 4XPBL 3MV9B 1NGWA 4RMUA 4YQXL 4PJGB 4H8WH 3W11C 1G7MA 2VLME 1FO0A 3TBVA 3VMOA 1AP2B 5E8OB 4Z7UA 2J12B 5GS1B 4Z0BL 3KLSA 3VG0L 1TCMA 2J4WH 1HHKA 1WAAF 1YY9D 1GRWA 2VDQH 1VACA 4XT1C 4D8PB 4I13B 1P2CA 1TETL 4BH7A 5FCUL 2ARJQ 4NCC2 1J1OL 5L9DH 4PRIB 5F93C 1I9RH 1EGJH 4KKAC 4JY4A 2YBRB 1JPFB 1VKXB 2NX5D 2X42A 1ZGLA 1JRHL 3MACL 1V8HA 1I3GH 4CDGC 2ZUSA 2NZ9D 3SCMC 4JRXA 4NM8H 4UV4L 3KPQB 3VXOA 3D39A 1SM3H 4JFFD 1D5MA 4KK6D 4HCRL 3SDDA 1EAJA 1YECL 3QPQC 4E0RB 3GSNH 2GAZA 2J8OA 4J23A 4XCFH 4I0PA 2W91A 1DBMH 5TH2B 2Q8BL 3P9WB 3HFML 4L5FL 5EIQA 5DHXB 1YJDL 1UZ6E 4L9DA 3REVA 1F90H 1K6QH 2HTKC 4ZFGL 3WFHA 2VE6B 3T4YB 4NQEB 4Z76A 3VG9C 4OGZA 1EERB 1IC1A 1ZA6A 4KPHH 3MRHA 1KT2B 1UVQB 43CAB 5A16B 3ZE0E 1KIUA 3FB7A 5F7MC 5F9JA 2DJUA 3MLVH 4FFZH 5F9AC 1OAYL 4I9WE 5K9JH 4I3SL 1KELH 4JREB 2BDNH 3JTSA 5GGSA 4QT5A 5I0DA 4IOIA 4UT7H 2QHRL 1NQBA 4B50A 3VFSB 4G3YH 2JTDA 2IH1A 2L7JA 5D2LF 1IRAY 5HTSA 2X70B 4QRRB 2WP3T 3CMOH 3D5OF 4R3SA 2VXTH 3NTCH 3GZKA 1A9BB 2R23B 4NO5A 3DV4A 3IFNH 5D7JB 5SV4A 4WV1A 2DDQH 5FYKU 4ZXBC 4I0PB 4ZUSA 4LPTA 4WI2A 4H88L 2APWA 3BIKA 2YPVH 3CXDL 3L3DA 2VE6A 4O02L 4XB7A 3STBA 4CVWA 4V2CB 2ZG3A 4P9HH 5EUOB 3Q6FA 2Y25A 4K7PH 1X5ZA 2HLAA 4UT6L 4BA8A 5HY9B 4ZUTB 2P8LA 1WEJL 4IS6B 4OFVA 2A9ML 3O11B 4K3EH 5EU3B 1XFPA 3EDKA 3O6LH 2X1QA 1IEHA 3IGAA 4YXHL 1P4LB 2JJTA 2CRMA 2VZOA 4F58L 4RWYL 3D69A 4IRSA 2FYYB 3CLFH 5FM8A 3OB0H 4JKLA 5D1ZD 5IB1A 3KPNB 2G9HB 5EBLB 1QRNB 1XGYL 5FYJU 1YMMD 5EWIL 1FNEB 5BRZB 2ICWB 3LKPB 3KG5A 4YFEA 5EZJB 1N4XH 4KC3B 4D3CH 2HA1A 3RNKA 2DLGA 3TC9A 4OQTH 1PBYA 3K1DA 1N4XL 4MVBC 4Y16D 3KPRB 1N2RB 3BHBA 2DL2A 2O5ZL 3FO1A 4H5SB 2HT3C 2IH3B 3UAJD 5D1ZB 3TIEB 3V5KB 4HH9A 4Y2DC 2FIRT 2LAAA 3LQAH 4PP2B 4F58H 1T0MA 4OZGE 5E2WH 4ZDHA 3GDBA 4DQOH 3SDYL 1CZ8L 5F6HJ 2O5YH 4TVPE 2R0KH 3MRQB 4JHWH 4YO0A 1BIIA 2MCPH 3QPXH 4GRMB 4L8BA 3MA7A 5FYJH 3MJ9H 1S7XA 3P77B 3L5IA 2VL5B 3GJFB 3OV6A 1Z9SA 4K71B 3ARDA 3ECBA 3QAZC 4HZAA 1JZ8A 1MCEA 2DLEA 1A6VL 1DE4B 1YYLL 4PGZA 1CXIA 1MCLA 4RQQB 4PJFB 3WMSA 1A4JB 2J5LC 5C08D 4KQ3H 4R97B 3UTSA 5I76A 2HJKA 4WHTB 4MAYC 3S96A 4FXLA 5CEXB 2FL5B 5IFAL 3PF2A 2A73B 2IH3A 1YY9C 3RUGE 3U6RA 1JK8B 1Q9LB 3N85L 4XCNA 3NIDF 4JFOA 3NFSH 2OCFD 4XPFL 4FQXB 4UT7L 4BSWB 1VGKB 1QRKA 3CFBB 1KIPB 5CGYD 3VXNA 5CIPH 1GGCL 3OAUH 1TFHA 1SYSA 2FO4A 5E99L 5HYJE 3ZDZF 2ERJC 3ZL4H 3ARFC 3FFDB 1S7WA 1AGCA 3PWPE 3QIWA 3H8NA 3C87A 5H35B 4XBGB 3BFOA 4PJHA 4KJQD 3QNZA 3RPIB 4YR6A 1HSAA 3WD5H 2FSEA 5FUCC 2XI9A 5F7EL 2VDMH 5F7YC 5D7IB 3WUWG 3WJJC 3BRDA 5JIPA 1CFTA 3RGVA 3ULVD 1F4WL 4M03A 1N5YH 1AHWA 1RURL 1TQCB 4AIXA 1BVKA 3EYSL 3REWB 1FRGL 3AAZB 1FYTE 2EDXA 5D72H 4APQB 4Q0XH 2W07A 3HRZB 2DQCL 1NGYA 5GZND 5FFLA 1YMMA 3RVXC 1DEEA 3WIHH 5KSAA 3B9KB 4LSQL 1UM5H 3WD5L 1MREL 1KXQE 4YIQB 3TESA 1HXMA 5EN2A 1MSPA 4FQJH 5C0BE 2R4SL 3DX9B 1JNNL 3RIFK 3KPLA 1Y18A 5FCUH 3DURA 2L7UA 4PGDB 3LKQB 1HSAB 3EYFA 4N90D 1N3NA 3FFCD 1ITBB 3CX5J 4HIJA 3W2DH 3HAEB 1QVOA 2DYPB 1KGCD 2J4WL 4PRNA 3S36X 1MCKA 3I3DA 4GXUM 2AEWA 3DLQR 5E6IA 5DRXB 3R1GH 4HZLA 4DGIH 1WFUA 2YN3A 1DCLA 4PJCB 2E6QA 1I7RB 2DQFA 2WNGA 4ZFOB 3D6GA 3QDJD 5TPWL 5BOZG 1MJ8H 3S6CA 4J8RB 1BJ1J 1T7ZA 3EYOA 4HLJA 2PTUA 4YX2L 3ZYZA 3JWOL 3S5LG 5J11C 3O6MH 4IMKA 3BDXA 4Y1AB 4BM7A 5B8CC 5EUOF 1HHKB 5J06A 1ETZA 3ROLA 1KTDA 4I2XB 4XP4L 2AXGB 5L2KE 4EVNB 1NCDH 5KG9A 1PQZA 4PRPD 4JDVA 1JJUA 4TSBH 1ZA3A 5ACZB 4B41A 1INDL 3C5ZA 1OP5H 1JTOA 4ZFFA 2YPKA 4FP8L 2QADD 5EO9A 5AZ2L 3S98A 3VRIA 1NEZB 4P9ML 3BYTA 1EK3A 1MCRA 4KGLA 3VW3L 3FQXA 5EIIB 2J6EA 3IF1B 3LQAL 4NWTL 2DD8H 3MRLA 4M93B 3DGGB 3NIDE 1A7RH 1JMXA 2KL6A 1D3CA 2XFXB 3NCMA 3U4EB 4LDOB 2A74A 4AIZA 1X5FA 1CIUA 1FP5A 6FABH 5D2LB 1TENA 4FQCH 4PGEA 2NY6C 3KPQA 3ZKNC 2BXYA 2P24B 4FNLL 4J4PD 4BFIB 2BOCB 1RJZA 3GB7B 2QADB 2QSCL 1FFQA 2FEDD 1M05A 4AL8L 1TZHB 5T33L 1B0WA 1EXUB 1KJVA 4DGVL 1DVFD 3MRIA 5T5FL 3GSXB 4Y4HA 1I1YA 1E6OH 4XPTH 1QA9A 1H3XA 4M1CD 5GGQL 2C3HA 4DW2L 1G84A 2YA1A 3BPLC 1FLRH 2OQJA 3A6OA 1H0DA 3IDJB 4HQQL 2AXGA 5FYKL 5BO1L 4JRYD 1XF2A 3LVEA 4G6FB 5F7LB 4GJTB 2FJFA 4H8WC 1MFDL 4R8WL 4Z7NF 4R26H 1A3QA 4K7PL 3D85A 3PIQA 1G6RA 4X6FB 5D5MF 1AGBB 3GMPB 3W82A 1MY5A 2OP4H 1QBML 4F37K 2ZCLH 1C5DB 1BWMA 9CGTA 1OCWL 2BX5A 1N26A 5MEQB 3KYKL 5DRNA 5D2LA 1ZLSL 5I74C 4MAYD 3QDGE 3PJSA 2X40A 5J6HA 4LCWD 5GS0L 2JLLA 1MVUA 4WY7L 3GMQB 3IXAA 5F88B 4S0TD 3T2QA 1NCCL 2F58H 4Z8FH 5IB4A 2XWBB 2V2WA 1F3RB 2BVOB 3GBMH 3GSUB 4WV1B 3MRGB 4PJ5B 4FFWC 5HHQB 1DBBL 3H9HB 3KNBB 3P4MA 2UV3A 1BZ9B 1E4KC 3VXUE 4BH8B 3QHZL 1KELL 4JB9H 1N6UA 3HMWH 2ADGA 2VZVA 4R90L 2VN4A 2V9TA 5DYOA 3KJ6H 3L3DB 2W9DH 3UMTA 1XF5A 2IPUG 2FJFB 2OP4L 2XA3A 4MJID 3HUJB 3IU4L 1JN6B 2I25N 1MCPH 3NZ8B 3L5JA 5C0JA 5HYIA 3QFJD 3O2WL 1Z5LA 5CSZA 1R3KB 5C8JA 2I07B 1LNUB 4P2CG 4I48A 1OVZA 3TJHC 3D69B 4XCCL 3RIAF 3CX2A 4YXLH 1UC6A 1C16A 4G43B 1WT5A 1CT8A 3MLZH 5B38A 4E9LA 1GGBH 1VA9A 1FZMA 3EFFA 3MOBH 5LCVH 3BRGC 2R2EA 3LRHA 4NO2B 5ESQA 4RMVA 4DN3H 3LQZA 1BBDL 1T7VA 1V7NH 4PTTB 4BZ1L 3KNBA 4Z77A 1S3KH 3QDGB 1ZTXL 2VXVL 4FQ1L 2NCMA 3IXTA 3WJLC 4GH7B 5C0BB 4X7SH 4ZDHB 4P2QD 3QUKA 4P57B 4Z7UE 4Y88A 1FGVH 3JWDH 3H7BA 3VD9A 2ITDA 1HKFA 2R1XA 3B8YA 2GIYA 1NAMH 4NQED 1MFEL 5CINL 3EYUL 3OL2A 5D7IF 5KSAD 2YR3A 2IALA 3ZKMD 1JGEA 2K7QA 4KXZH 5AZEH 2VLKA 3K4ZA 1IKNA 4R4ND 2R1WA 2QQQA 2VISA 2AXHA 1CVRA 1NGZA 3QG6B 4OCSL 5C0AB 3I3BA 2R0WH 1UEYA 3EFDH 1J8HA 5JW3L 5L2JA 4M6OL 1MJ8L 3JV6A 4MD0A 5ACMA 4UTAH 1J8KA 3R1GL 2NPLX 5DR5L 1OP9A 4FQXA 1AGEA 2Z8VC 4LFHG 3DTXB 3ZHLA 3RNQA 5MP6L 3JWOC 1DQDL 1QFWH 1OTUC 4EN3C 4HULB 5DA0B 3RWHA 5I0ZA 2R9HC 1A7QH 3E0GA 4JFPA 2EYRA 1IGML 4OM0L 2NMSA 2EXYD 1RVFL 3FO2A 3UTOA 1MRCL 2RJMA 4WI9A 4PJ8C 4QXWA 5A3IC 5GHWL 1B3JA 1KYOJ 5F1NA 5I9QC 4MCZA 3KPSE 4RAHA 4EBQL 4OFYD 4LKCA 4HKZA 1Q72L 3BIAX 4PB0H 4YGVB 4HT1L 3O2DH 1MHPL 2FWOB 4WWKC 3UZVB 3B2VL 4F7TB 4LCCA 2DQCH 3NCFB 2W60A 4Q0XL 5I1JL 3AREA 5TF1L 5T3XH 3WKNA 4UINL 3W0WD 5EUOA 3VFOB 1FNLA 4XP9H 5JMRA 4L4JA 4N5ED 5KSBB 3RPKA 5I8EA 5E94A 1W8NA 2IANB 1CVSC 1T0PB 1RUQL 2IG2H 3BWUC 4PB9H 4TTDC 2DLTA 3ZT5A 3H9SA 2X10A 1CK0H 1TJHH 2RCSL 5J1AB 4LHJB 4PJ8B 1QRNA 5DR5H 1J1XH 4XP5H 2VIRA 1A1NB 1SVZA 1T66C 3VDCA 4MD4A 1NGQH 1N5AB 3OAUL 1L9MA 1GGCH 5CMAB 1NSNH 3MFFB 1N2RA 3BHBB 3OXRB 3MLSL 3SE9H 2VN7A 1OB1B 1VFBB 1DQJB 5E7FA 1OAKH 2P4AB 4RMTA 1RZGB 4ONFL 1AFVL 1OF2A 2HKFL 3BE1H 2AJVH 2F54E 2XWJA 3BISA 3DXAB 3U46A 4PLJC 1S7QB 3HPLA 4KUZH 3RBSA 5D7SL 5DK0A 1G9MC 1AGFB 3RQ3A 4WU7A 5T1LB 4QHNB 4NYLA 2AI0H 2AQ1A 3SKOB 3JWDL 4OBSA 1ORSB 4EOWH 1KCRL 2ORBL 5CSGA 1ES0B 4JFDA 4OAWA 4QRQA 3VFGH 3H42L 3HG1B 3GSRA 3TJHD 3TT3H 4I5BA 4X6DE 1X5YA 3KDMA 3N1GC 3T4AB 1S3KL 4LARL 5JXAL 4L3AA 1ITCA 1EO8H 1S9XB 1RK0A 4LF3B 4JLRB 3FZUC 3VRIB 4Y4FC 5DI8B 3GK8L 1HXYB 2UZIH 4WTWA 1NAKL 4GBXC 2XNAB 5CHNA 4NKQB 3P0YH 5HDQH 1R24B 3DETD 1YN7B 1UCTA 1A1MA 4LSTH 4UB0L 2AXFA 1HHIA 2DQDL 4TTGA 4NP4H 4WENB 4OZIF 3JV0A 2ADJA 3MYJA 2HN7A 4PRID 4GOSA 1I8KB 2PW1A 3ULUD 3AM8C 3CSYB 1MCFA 4XCCH 4GRLB 3BAEH 4JFYB 3ZT6A 1IEBA 4BQCA 1XEDA 2YK1L 3QDAA 2Q86B 3EZJB 5L0QC 4U6HA 4JZJA 1N0XH 5GGVL 3JTTA 2CMRH 4B0MM 5T1LA 5I74B 4M1GH 5CEZH 4LSDA 3VWKB 3RGVD 3TBVB 4LAQL 1BD2B 1KB5A 4LOUC 1ND0B 2CK0L 2XA8H 5LWYH 4R2GD 4AH2A 2HLFD 2NY2C 3GSRB 4NWUL 4YHML 4ZO8A 4ZO7A 1F4HA 4PUBH 5DUBB 1ZHBA 5KSAC 3PL6D 3RGVB 3D85B 1WEJH 5DSCA 3V0VA 1RK0B 4LF3A 2FCBA 1NC2D 4GW4A 5C0GB 5CJOH 2DJSA 5BS0E 1EH9A 3O4LE 4NN7C 2VXSH 4GS7C 2CD0A 3RY5A 1NMBL 3DPBA 4F7CA 2P5WB 5HYQB 3LRSB 4HG4J 1J1PL 4ZOBA 5HI4C 1S9KC 1HK6A 3CDYA 4JQXA 1D9KA 1ZSDA 2ARJA 4WI6A 1XGQB 3GMLB 3GI9H 5D70H 1E4XL 3TYGL 3F7RA 1KFAL 3NTCL 2VXTL 1FH5H 1RK1B 3PHSA 2YPLA 3OKKB 1D5IH 3LB6C 4OF6A 1ZK9A 3TIDA 1NFIA 2VXQH 1P2CB 1U8LA 1ZV5A 2GHWB 4BZYA 4DEPB 1NCWL 3BD4A 1X5IA 4LCWE 2X44D 1T1XA 3F7YB 2NYYC 3QQ4B 4GMTL 3WE6B 5FUZL 1I8IA 5C0BD 3RX5A 4OZGB 4F15C 3U9UB 4M4RA 2YPLE 3V0WL 5KOMC 5F1IA 4NBZB 4ZOAA 5HYSG 4DW2H 3INUH 1OP3K 1MAML 2W9EH 4F7PB 4X9BA 4XXCC 4IIQB 3WFCH 2ICES 3DYPA 4HXAL 3D39B 4P2OB 4O2FA 1G1YA 4HPYH 4XX1G 1ORQB 3PG2A 3GIVB 4XMLL 1UCBL 1BAFH 4YHIB 5K9KA 1OT2A 2RHEA 3A0OA 4Y5YA 4D2NA 1QR1A 2X9YA 2GI7A 3KLDA 1CFNB 3WLWC 1MHHB 1JPST 3KYNB 3NFNB 1TIUA 3GM8A 3V6BR 4ZSOA 4R4BA 2ICWI 3GMLA 2GY5A 5JR1L 1FSKB 1OW0C 3D2UB 5L88H 2FBJL 4PJ7B 3RTQC 3Q1SH 5HYEA 1AKJD 4P4RA 3NIFF 3HE7A 3QSKB 1DSFH 5E5MB 3LEYH 4OZIA 3C60B 5KVEH 3P73B 3BP6B 2EDNA 3TCLB 1BHGA 1KNOB 5ETUA 4BSVB 3WHXA 43CAA 3T0EB 1L7IL 4L3CA 1JRHH 3QUKB 4LEOB 4MJ6A 4G8EA 3D25B 1RZ7L 3CFDA 3IDGB 1R3LA 2DAVA 1LO5B 1QLRA 5K59E 2XZAL 4IRZH 5CJXC 4NQCA 3PWPA 3NIGE 5HYJB 1FPTH 5I1IH 3JV5A 5FECA 4PBXA 3VFSA 5KANG 1Z9MA 3KLAA 3Q6FB 1MRDH 1TETH 4PRBB 1MUJB 4GRWH 5JQ6L 3ARDD 3N1QC 4Y4HD 4HUUB 4G8GA 5FAAA 1CF8L 2HRLA 3KS0J 2ITCA 2AJXH 4LRIA 4I77L 4LSVL 2X4OA 1YNTA 4DZ8B 4HAFA 1QA9B 1RFDH 2A9NL 2CK2A 1U8IB 3FMGH 5C09E 1RFDL 2A9NH 3HUJF 1RZJH 3MXVL 4YAQA 4JN1H 5GIRB 4FMFA 4TSAL 3RNKB 3ULUF 1HEZA 5CD3A 3C60A 3VGBA 4JQXC 1YNKH 3KPRA 1MRDL 4HBCH 5C09D 3TWCH 2BVUA 4MAYA 3CDGA 4G6AC 2XV6B 1JNJA 1SY6H 1CD9B 2VLMD 4O2CA 4AEIH 1LO5A 3IGAB 5DJ8A 4JKMA 2D7TL 4X80L 3WIHL 3TH3T 4AEFA 5LQBH 1I3VA 1PAMA 1I3RB 1T5XA 3TT1L 4XWOC 5LAXA 3ULVF 1C12B 4YHYB 5E00B 3BI9X 1BBJB 2ZCKH 4EI5B 4HBCL 2BNQE 5EFIA 3LEYL 3RWEB 2WBJA 1CFSB 1SVCP 3MA7B 1TCRA 5F1KC 3BH9B 2DQTH 3CLEH 2MKLC 2X4OB 3JWDC 3MCG1 3MXWL 1JV5A 4PJ5A 5JOFA 1RIHL 3G5XB 1I7ZB 3N1MC 4Y19A 3Q2CA 4Y4FA 5I16B 1ZVYA 4D9QE 2BY3A 1PLGH 3ZMRA 1W72H 4UILH 3T2OA 3BEVB 4K9EL 5C0RL 4NT6B 5BRZE 4XMLH 3ARWA 3CIQA 3BPCB 4LCCC 2ZSWB 3PDOB 1R3HA 4OFIA 3D9AH 4OZHA 3BGMB 4MB3A 4UI2A 2N56A 4YPGB 4M4PA 3ZL4L 4S0SD 1U92A 3LEXA 5C7XH 1HHHA 3Q3GA 4QOKE 4KRLB 4IRZL 1BF8A 4FQIL 2ED7A 3SE3C 5T3XD 1EDQA 2A6IA 2AK4E 2BSED 4GMTH 5FEBA 1L7IH 3TVMA 1BM3L 4HEME 1OAQH 3HLAB 2BVYA 1XH3A 1T1WB 3K8MA 5CLWA 1KB9K 1HILA 3WEXA 2HTKD 1KFAH 3L7FA 3P9MB 4U31A 3NCJH 1IT9H 2NXYD 4XWGL 4DUXA 1RQ5A 1T2JA 4KKCD 5ICXA 2GTWB 1F58L 3NH7L 2YXMA 1LE5A 3EZ8A 1G7LA 2WWMC 4LQ1A 1CFTB 2NXYC 1TZGL 5DJ2B 5E9DD 1U8KB 5ABDE 5L2KB 2RR3A 2MKWA 2FECL 3DXAA 1A1OA 3U46B 5J56B 5T1MB 1NAMA 2R69H 5FUCE 1X3DA 5D96B 4G9FE 1IAII 2Y5EA 3A6CH 3C5ZD 1P1ZB 4OCNC 2VSDA 1I1RA 4RZCA 2HRPH 1JWUA 1WGOA 1CZ8H 1NKRA 4KTEL 5IVXE 4OD2A 4YR6B 5IR1A 2P8MA 1IZJA 1RMFL 1N8ZB 3I9GL 4L1DA 1TZIA 1DEEB 3G5ZA 4KKLD 1KIRB 2OYPA 4AMKH 4MA3B 1OWRM 2VR5A 3MV7A 4XC1L 4K9EC 1CBVL 2AVGA 1A7PH 1JNHB 4OD1H 5EZLB 3LZFL 1NCWH 3QXUA 4G42A 4HGWA 5I66A 3FB8B 1N6VA 5DQJA 1BGXL 4QXGH 5HDOA 3VXRB 3REWA 1AGDB 4RDQG 2C1OB 1SJHB 2OBGA 3T1FB 5KAQG 5TDPA 3HAEA 2CKNA 3TYGH 1S8DB 4YFLF 5FKPB 3OZ9H 2D7NA 3E6FA 3LEVL 1YC7A 1NC2B 3WIHA 3S37X 4M7JL 4I0PD 1H3UA 4HUWB 5FOBA 4L4VB 1P84J 2ZPKL 4S1QH 3B6SB 4RWYH 2VRAA 1A0QH 4JFYA 4Y5XB 1K4DB 1NMBH 5EBGA 1R3IH 4PJXF 2D7PA 3I75B 3PWNB 2I24N 5C92A 1P84K 3QDME 1WCQA 1S7UA 2DIBA 5CJQH 5SX5H 2D0HA 3LKOB 4OZHE 3ALWA 4PR5A 4Y0GA 2X89D 3HCVB 3TA3B 2PCPA 3EOBA 2O61A 2ICWJ 3H42H 5IVZA 3BMWA 2W9LA 1KULA 1D5XA 1CFVH 3VI4E 3EHBC 2J6EH 4HIXL 1RV6X 1PQZB 1XIWC 1EAPA 1F13A 3ARED 2ZOLB 4Z7VF 1KSRA 3H2WA 3KXFD 4XAWL 2DQIL 5E6IB 3FRPA 4KI1A 4M1GL 1FYHB 4Y5VB 1E4WL 1J86A 5A16A 3OKEA 4Q6IB 3K46A 2C3VA 2GK2A 4L9LC 1QFPA 3WDIA 3WSQH 4L8DA 2V9QA 1UKTA 4UOW0 5JLZA 4XNMA 3B6SA 3KPSA 5F8QC 2M26A 3EO1A 3DVNA 1NFKA 5F44A 4RBPK 2X4PB 4JAMA 2VDNH 4QRTB 4EVNA 2KUTA 4G5ZH 5KVGH 1X44A 4KAQH 5IEKB 4JPVL 1AE6L 3VJ6A 1ED3B 3U0PB 2DWDA 1RZFH 1OSPL 4TSCH 3C6LD 5SWQB 3ZDXE 3V79C 1KN4H 2HH0L 3HZKA 4OF8A 5EIVA 1X5LA 1ADQL 2FHFA 3DXAD 1UZ6F 2IG2L 5EIIA 2R29H 2MOVA 3HFMH 4JHBA 4NRXB 1KCRH 2ORBH 5JW5A 2A83B 2H32H 2W65B 3V6OC 4JREC 5ITBH 4MQ7A 3LCYA 1JPGA 1OGAE 2YSSA 3FAXA 3VGEA 4TOYL 2L4OA 4R0LC 5D7SH 4EQ3A 3BQUB 5B4MC 4Y5YB 1UYWL 2GSGB 5JNYA 2GT9B 4JEGB 3NFNA 1NCBL 2BZDA 4W81A 1J8HE 2QSQA 3EO1B 4PJGA 4HT1H 3T0WA 3LD8B 4J3XA 2H1PL 1MVUB 1F02I 3FQWA 2ICWA 2HWZL 5GS1A 4LSUL 2OTUA 5IKCA 4JFDB 1FN4B 4ZSOE 1AR1D 2HKHL 2QQKH 5JPMA 4BSVA 3VXSD 2BMKA 3UTPD 4Z0XB 4LNVA 2VC2H 2YUWA 1TPXC 1VEPA 5E8PB 4F33A 5I1LB 4I18B 3R8BB 3G6JA 4PRIA 1ONQA 2QV2A 4NNYB 3NMEA 3WNPA 1XF5B 2FX8H 3I6LD 2HMID 3BH8B 4TNVK 1T5WA 2DKSA 3BJLA 3X3FL 1EMTH 2CDEB 3DIFA 1DANT 1JZ3A 4JG0L 2YC1B 5TF0A 1UB6A 1HE7A 3VFPB 1HKLH 1XIWA 5TF1H 2HFGL 3MZGB 4I4WB 5FGCB 3VXOB 5JNYB 3NGBB 1S7XB 3P77A 3GSUA 2GCYB 5CJXA 2EH8L 5M94B 2A6KB 1TVHA 5BVJB 5DK3A 5E2JA 2EH7H 3D18B 1CTNA 5HPMA 1Q72H 3TZVA 4LSPH 3AB0B 4C54A 4PJ9B 4I18C 1IGMH 4OM0H 4O2EA 3IAPA 4HGKC 2IQ9L 4UNTA 3NZ8A 4WWID 1XR9A 5I8CB 4X4XA 4K2UH 2HVJB 1X5HA 5JW4R 3GSNA 3U1SH 1ONQB 3OAYK 3CFBA 4FTVD 5DEFB 3G6AA 4OFKA 5IMKA 2EE9A 4LIQE 1EHNA 5HHPA 4QYOA 5EO1B 5DT1L 4CADA 2H8PB 3TN0A 1CXLA 4KTDL 3HB3D 3ARPA 3QULB 1RZFL 2WQRA 4J4PA 2W0FA 1U58A 2I26N 1HHJA 1XGRB 2DBLH 5ESQB 2EDQA 2DM7A 2X70A 4ACPA 4OFDA 3HE6C 3BQUD 4WTXA 3MV7D 3HB3C 4PRAB 2CDFB 3HC3L 3O2VH 5I16A 1AQKH 1DFBH 3NCEB 4M7LH 1JZ4A 2VABB 4KK5C 4KJYA 1T1XB 2X4TA 4HHAB 2LABA 1EO7A 4WV1C 1FYTD 4NGHH 4RA3A 4WJ5A 3W9DB 1M7DB 2FEEL 2OXHA 4HWZA 2ZWLT 4X8XA 3RU8H 1YDPA 1QNZH 3HZYA 4XGZA 3ZE2F 1VFMA 3BPCA 1B6DA 4OZGA 3ULUH 3H9SD 1X6NA 2OSLA 5EORL 2BSRB 4U0RC 1LO4L 4HKJA 4TVPL 3UTTE 2NXZD 2DQJL 3G5VB 3EYUH 3VD5A 1H5BC 2ERJB 1QSEA 4YUEH 4X4XB 1KTKE 3G08A 5FF6B 5GS1C 3NFPA 2JK5A 4QEGA 1KLGA 1CXKA 5BZDB 3H3PL 2LVEA 4ZUTA 4LBEA 1JGDA 3GIZL 4YHIA 5K9KB 2YHGA 5IJVA 4D9QD 1KJ3H 1ZHLB 3O9WB 1AJ7L 4X7SL 4FQHA 3KYNA 5K9QI 2ZUUA 2EYTB 4NO3A 1QSEE 5L7XH 1F4XH 5E6ID 3DX9A 2DQGH 3QG6A 5C0AA 4OUOA 1A3LH 3W9EB 4JY5H 4M48L 3AS3A 4N0FB 2L0DA 4HK3J 2Z92A 4DKEH 4GBXB 5ESAA 2DQHL 3QZWB 1I9IL 3MRPB 4HWBH 2Q6WA 1EVTC 5ETUB 3CVHH 3OR7A 5JDSA 2CUIA 4KDWA 4K94L 3RNQB 2Q3ZA 3CFDB 3P0VL 1Z3GL 4XRCA 1SJEA 3T0VA 4I3GA 1CG9A 1QO3A 5GSRB 3EOAB 3VGHA 1W0WB 2C3WA 4GAGL 4EQ2A 3D0VA 5KN5B 4GXVL 3GFUA 1TMCB 1IZKA 2XY1A 3L5WA 3UDWC 1OTSD 1U6AH 2WWKT 1KG0A 3VFNB 3DVGB 3QH3B 1DBKH 5CCKH 3QFJA 4Q9CA 1OTSC 4OLXH 4AMKL 4TUKH 1H9VA 2XXMB 1LEGA 5B4MD 1KCVL 5HYSB 4QHUA 2RAMA 5EU6E 1P9MA 4POZD 4JGUA 1U9KA 2MFNA 3QCVH 3QHZH 3VFWA 1ZA3B 1J05A 2AABH 5J13C 2EYSB 4XXCA 4WFEE 1I9IH 2DQHH 3GBML 3KLHC 1PYWA 1S8DA 1HEZB 5DVMA 1SY6A 1UEMA 3S96B 2QSVA 1FL6A 4JY5L 2P47B 4M48H 4QXUL 1CU4H 5B8CA 2NLJB 5I1EL 3QIUB 3QDHA 1NFDB 1U8OA 1M7IB 1NMAH 4PRPB 4K7PY 3MOAL 5GSRA 3OQ3B 1R0AH 4DTGH 3GB7A 1WTLA 5F9OH 3NCJL 4UUJB 1IM3B 3GIZH 4PJ7F 3MLUL 5DQ9B 1DQLH 3MYZA 4EXPX 2F53D 4UQ2A 3TA3A 2PCPB 4NC1E 4E5XB 4YDJA 3FFDA 3DYOA 1D5XB 4HWUA 4BZ2L 1Q1JL 2D9QB 4TUOB 1XF4A 2V17H 3C2AH 3ARTA 1QSZA 1A6TB 3MC0A 3FRUA 1QNZL 3MLYH 4OAWB 4JRXE 4E42B 3QDMB 3CC5A 1J05B 4P5TC 1IC4H 3JWOH 3VA6A 1YEDB 4HJGB 4NQSB 2YD1A 4MNHA 5DI8A 3F5WB 5TPWH 2A2QT 1BQLL 2V7HB 5SV3A 1BJMA 4JFXB 1RPQA 3NBNA 4E41B 5C2UB 2V5RA 2HT4D 3HRZA 3RVWC 3SE8H 1HZHL 4LPYA 2PXYA 1V05A 4NZTH 3ARFD 5DHYB 2ZUWA 4Y2DA 1HHIB 4BQBA 1IARB 1YYMH 4UUJA 3DJ9A 4PV9B 4GW5B 1M6OA 5DMGC 1GSMA 1QG3A 2A6IB 2VERN 1ZVSB 4F9LC 4OFPA 2DM2A 3C8HA 2O5XH 2OL3B 4K2UL 5EC2B 4JFHD 1T2XA 3HLAA 4ZD3H 4G7VH 5CZVH 4EJ1C 4F7MB 3WUWA 1Q9WB 1IMHC 1U95A 3WS6C 1KPVA 1JI1A 4KKBD 2UY7A 4QXTA 4OIIH 5DHVH 5C07A 4X80H 1K8IB 5F7KC 3ARDB 4UBDD 4Y4HB 3PV7A 2EXWD 3STLA 1OAZH 2IJ0C 2OI9C 2YD7A 4ZFZA 3RRQA 1ZT1B 1RUMH 5T1MA 4HIEA 1JBJA 1JHTB 5DJCA 1I7RA 2DQFB 4U6HB 4YDKL 3LD8C 5FYLH 4U33A 3RY4A 4MNQD 4F7CB 4XTRD 1CT8B 2EXYC 1F4WH 3X3GL 2FZ3A 4X83A 4D9LH 4V2BA 4OD2B 1MJJA 1WZLA 1I1CA 3RKDD 3ZE1E 1ZS8B 3UBXG 5IT2H 4OSUL 3TO4C 5GRXG 4TYUA 3FO0L 5DJDB 3CSGA 4M7KH 5T1DL 3S37H 3BYYA 3LQZB 3VU2A 1JHKH 3VXRE 1JTPA 1KPVB 5FYKD 4GW4B 4K71C 1T22A 4IHOB 2P48B 4U7SA 5I1GH 4KFZC 3BZFB 4GS7B 4JQVC 2FX7L 3BKJL 1ZA6B 3KXFE 3QQ4A 4D0DA 5IBUB 2X05A 3L5XL 1RU9H 5J4MA 4S1SH 3G04A 2XZAH 5IHBA 2CLRA 5LGJA 5FKPA 4LIQL 5CFHA 3SE3A 5T3ZL 1HQRA 1CCZA 3WHE1 5IF0A 3V5HB 1U3HA 2BSTA 3VWJD 3S88H 3S34L 5C0NC 4IMLA 1ZT1A 4ENEC 1JGLL 1CQKA 5KVEL 4JKKA 2FO1A 5AYQA 5FO7A 3MGOB 5D9SB 3PNWB 3L6FB 3JV4B 2R2CA 1J0KA 2EDEA 4X6DB 2WAHA 1WAAA 3EJYD 1FRGH 1FZKA 2EEDA 3B3IA 1NGPH 4H1LH 3IS1X 5D8JL 1A6VH 4XH2B 1UJTA 3U48A 2VLKB 5E8OA 5JR1H 3IFPB 5GRJH 1WWCA 5HPMB 3EOBB 3D3VB 3MRCA 3N9GH 1K2DB 1NGZB 4JO2L 5F7UA 4KY1L 4Y1AE 1CDIA 1GZPB 1XF2B 2YD9A 3EJJX 4HPYL 2OR8A 3QFDB 1A3RH 5SWSA 1WISA 3AUVA 4C83A 5DLML 4N8CL 1GAFH 1IQWL 3O45B 2F53B 1OSPH 1KNOA 4P2RD 1VFOA 2BCKB 3W39A 4WHDA 4YJZL 3N1PC 1E28A 5DD3L 1WF5A 4Y4KC 5HHPB 1G9NC 3LPFA 5HHME 2VDNL 5C07E 5KTEL 1TJGL 2YWYA 5F96L 1C1EH 1UZ8A 4OT1H 1P4BH 1BFVH 3NFSL 4XPFH 2DM3A 3K1KC 1X7QA 4JFPB 3SE8L 5E6IC 3BXNA 3RL1B 2FIKB 4UDTA 5FV2A 3O41B 4LP5A 3RZWA 4G9FD 4XVTL 1AD0A 4KZEL 2VQTA 3VJ6B 1E4XH 5HHNB 1T7XA 1FJ1B 1KPUB 2UY6A 3W9DA 5JPNB 1HDMB 3FT3B 2NY2B 4G8IA 5HDLA 4L3CB 4LEOA 4MJ6B 2X4NA 1TJIL 4NC2B 2VDLH 4P2RE 1OGTA 3IDNA 3ZDYF 3MUZ1 3T0BA 2LTQC 1FFOA 3PABB 5CD3B 2XG5A 5EZIH 1PG7H 2CKBH 3PL6A 1JCKA 5I8KH 4U05A 4KROB 1KT2A 4TRPH 4YC2B 5EZIL 1UQSA 3U79A 2JB6A 15C8L 2OS7A 2H41A 2DI9A 2VQUA 3VXTB 1NANI 2CDGB 3MLUH 1MIMH 4I48B 1UZ8B 4JFFA 5EDXA 5F9OL 4DZ8A 3AGVA 4C57C 2F54A 4RRPG 2JIXD 3QYCA 4G43A 2XRAL 5DVNA 3EYQD 3RWEA 3MNWA 4D0BB 2WP3O 3MZTA 5C0IA 3IJHA 3HKFA 5D7KD 5FGCE 3TNMB 1A9BA 1BGXH 4QXGL 2GJZA 4RX4D 4XMPL 3T77A 4EUPB 1S7RA 2YPLD 4ODSH 4ERSL 3MFFA 2ZUQB 5D7LE 2XICA 3ARQA 3FT2B 2BMKB 5ANMA 1A7PL 2AQ3A 3DYMA 2BNUB 4U1IB 4ALAL 3SGDI 5LVEA 2OMBA 4U6XB 3FOLA 5C0BA 1L4IA 1JZ6A 4FFZL 4YXHH 1CD1B 3I9GH 1PD6A 3EGSB 3U2SA 1UM6H 1QFWI 2W1NA 5D7JC 5DVOA 3BH8A 4QRRD 5ISZE 4L3EA 1NBZB 1RHFA 4H26A 4LPXA 2HLAB 4PJBF 1EO8L 4IJ3C 3FQTA 4N0UB 1IQWH 2MMXA 4OLZH 2BNQD 1BLNA 1N64L 4HC1H 1K6QL 3VXTA 3K4AA 4OKVB 1BWWA 3RVXD 3Q3GB 5DD0H 2UZXB 3K7UA 4JO2H 3ARUA 1Z3GH 4JFEA 3S4SB 1QOKA 2QR0A 1S5HB 1RZKL 1L9NA 3CFCH 1NJ9A 1FNEA 4MX7A 3D18A 5E08L 1NLBH 3GSNL 2VLRB 1C7SA 1S9XA 1L7TH 1IT9L 4ODXB 3IFNL 1FBIL 35C8H 1G7JB 2AJVL 4MDIB 5E56A 5CHNB 4OZHB 5D2NC 3FT2A 3L9RA 3MV11 4ZTPH 1JGLH 4ONFH 1UENA 2Z91B 4ZUWA 3I85A 4MJIA 2VNCA 5F9DC 2K3TA 4U1IA 3FB5A 2KZWA 3TJEL 5DD1H 5E2VH 4HUKB 3SE9L 4GMSH 5HJ3B 3KPTA 5BJTB 2R0ZH 2ZNWA 5ERWB 3MLVL 1WITA 1YEEH 3ULVH 4JZJB 3MRQA 4YO0B 2H8PA 4YDJB 4DKDC 1J1XL 2EKJA 1QUNA 3WEXB 5SX4H 3U36A 2F19L 3HNVH 4J12A 1U8HA 2CIKA 3BDYH 4GKSB 5I1KH 1FYTA 3SCMB 1F90L 3FO0H 3RJQB 2AJUH 1MAKA 4QY8A 2MQ0A 4OSUH 1NUNB 4K7PX 4HV8A 4KRPB 1OLLA 3RP1A 4NHUA 1W72L 3BUYB 1NJ9B 1ZHNA 2AJ3B 3MJ7B 1WCBA 3K3QA 1ZWIA 3SDCC 3ARSA 1LDPL 3CK0H 4XP9L 5C09B 4DCQA 4FZEH 3JUZA 1FIGL 4OF0A 1MCCA 3HC3H 3SDCD 4U1KB 2E7BA 2Q3AA 1FV1B 4KDTC 1U41A 2DWEA 4JR9L 3THML 1HOCA 5GRUL 2D03L 3F65A 5EU7E 1OAZL 2ZCKL 5FKAA 3ROOB 4OZIE 4M5YL 1I3GL 2BVQA 3LH2H 2QADC 4XPAH 1F3DH 2ZUYA 3WIIH 4PB0L 2IPKB 2ENYA 3PE9A 5TQ0L 1FC1A 4WW2C 3VFMA 3OR6B 1RZ8A 1T3FA 4JFDE 4AEIL 1OGAB 4FQ2L 1DANU 2YPLB 3OKKA 1REIA 3PWJB 1WBZB 3O81A 5DJZA 4YXKL 3TZVC 1H3PL 5DFVD 2CIKB 4XMKL 3TH4T 2D2OA 3UDWA 3QA3A 3DV6A 4OF3A 5IEHB 1P7HL 4H1LA 2CJUH 3BZDA 4AT6A 2IAMD 1NEZA 4XBEH 4V1DE 4WEBL 3MOQA 4JRYE 2PF6A 4MD5A 5MP6H 3VG0H 4TNWK 5T1KB 3FMGL 2ZUTA 3PGCB 5D5MB 4Y19D 4Y4FD 3STLB 3WIIL 1GXEA 3V8CA 4M8VA 4LMQE 2QBWA 5I71B 1BVKB 2JCCA 3MRNA 4BFIA 4MXVE 4C55A 4V1DB 3MV9A 3KYMB 1ORQA 3QIUC 4U1HA 4PJBE 1D5ZB 5CUSL 1BOGB 5D93C 1M05B 3P30H 2V5YA 4O9HH 1MHHA 5F7DA 1IC4L 1R3JB 1I1AD 2MNUA 3MV8E 5ILTH 5BS0B 3UZEA 4JFHE 3X3FH 1FZJB 4ODTL 4U1NB 4X8JA 4P4KB 3L95A 5D1XA 2EZ0D 3OBAA 1BECA 2MTPA 1E27B 2XN9E 3GO1L 2NXYB 3VFWB 1IILE 3MV8B 3EOYG 1ZLVK 3EYFB 2EYSA 3V8OA 4LCYB 4G6KH 2V7NB 4P5TB 3Q1SL 1Q0XL 1MJ7L 1CLOH 4WNQB 4LSUH 2EEBA 3PGCA 3ZTJH 2FJGA 1YEFH 4MSWB 5DURD 5CEYB 3AM8A 3U9PL 4C56E 1ZTXH 5IQ9A 1KB5H 3VH8G 1NC4B 3P4NB 4M1DL 3UTTD 2IEPA 4MB4A 4U1HB 2OL3L 3QEQB 4ZPTB 1FHGA 2FX9L 3EYOB 1J0ZA 3W5NA 4HX1B 1YNTB 5SWQA 4WDIB 3L5HA 3MRCB 5JHLL 3MBEA 5C3TA 3QCVL 2J8UE 4YE4H 2G75B 4HS8L 3RL2B 2FR4B 1ERNA 3MNZB 4XP1H 3FQWB 1B0RB 1NMCB 3M1BB 4YXLL 4OLXL 2PTTA 1NBYA 2C3GA 3NCYS 3CC5B 1KBGL 5EOCJ 4CU7A 1ZHBB 5I73B 2VSCA 2YPKB 4NNPL 2OJZL 3O8XD 2FEEI 3QXTA 4GXVH 4JE4B 3C5JB 2V7NA 2LVCA 1LD9A 4XNXL 4I18A 4KAQL 2B39A 2W9DL 3QUXC 1QZ1A 5KSVA 4QRUA 1D9KC 3V7MA 3QUXD 1RIUL 4Y5XC 1MCHA 4KV5F 5HHOD 1S9VA 4Q58C 4FQXC 1UA6H 5CZXD 2P8PB 4N9OB 1P9MC 4DJMA 1FJ1A 5HHMD 2CUMA 2J1KA 1T21A 3QUYD 1NUGA 5LGHH 2E7LC 5FYJD 1I8MA 2XRAH 2G75A 3LIZL 1FORL 4ODUA 1MPAH 3IDNB 1WZMA 3LS5L 1RJYB 4GW1B 4PP1C 5LWYL 3QJHA 4P57A 1TVBB 1IAIL 1NBVH 3SKUD 4OLUL 5EU5B 2ITDB 3QWRA 2ZZUT 1FE8L 2Y06H 3AMKA 4MXVF 3L3GB 3DRQB 3MRBB 4TULL 5JQHC 1LD9B 1LO4H 5HHOE 3QNXA 1JHTA 4GO6B 5I1CL 3QUMB 1SEQL 4R7NA 1NANH 4PJCE 3ES6B 5LG1A 1TJIH 4OGAC 4P46C 2FD6L 4GQ9H 2X7LB 2MPAL 2PETA 2D7QA 2WUCH 5CBEA 4XPHL 3TNNA 1TVHB 1DVFA 2ZPKH 4S1QL 4PJBB 5T1LD 3GMQA 3MNWB 5C0IB 4D0BA 1GGYA 5CIPB 4NKMA 2OI9B 3OZ9L 3P0YL 4AQOA 4DGVH 1VB9A 5IVXA 5DRZA 4P4KD 5KVDH 3DSNA 3P9MA 1FAIL 2V2TA 1C5BL 5CJ8A 1MQ8A 2WBKA 4FNLH 4PG2A 3V5KA 4P4KC 1LE5B 4OD1L 5FYLD 1INQA 1S7VB 1ZE3C 2KZ1B 4WJ5B 5IOPB 5KSUA 1I7UB 1WV7T 1JGUL 1TJGH 4XC1H 4EOWL 4CVXA 1WVZA 1NBZA 4E41D 1S7TA 1SYVA 4ELKB 2EIZA 5I9QB 1GOFA 5EU5A 2GJJA 4WW1B 4YHKL 5DJAA 1FG9C 5HD8D 4JHZA 4YDVA 4GRMA 1GAFL 2GJ6D 3QULA 3QNXB 3S35L 3IRZA 3WXWL 4JQIH 5I1AB 1MH5B 3T65B 4X6DA 3MLWH 4LSPL 4MLIA 4XWOD 3MV7E 5A40E 4LU5L 4XNQB 2OR9H 1U8PA 4K8RL 4UTBH 1AFVH 4M6NH 2QR0B 2GFBA 4J3VA 1TTGA 1JZ2A 4KWUA 3CFJA 3ZKSD 2IFGA 4ONOA 1Z0NA 3NH7H 3LN9A 3NACL 2VXUL 5BV7H 1OY3B 1CDYA 1OPGH 1OGAD 3OG6B 1WUNT 2BSRA 2C1OA 4BFBD 1CGTA 4POUB 5F89B 3AREB 2Q6WB 1U8MA 5BOPA 3GMNB 3VFOA 3UBXB 3VXNB 4FRWA 1K4CB 4PGJA 2FX8L 1A14L 4A6YH 4YFDB 1OARH 3ARDC 4Y4HC 5E4IA 2Y36L 3IS0X 5KAQF 4HK3N 5DFWH 3UO1H 6CGTA 5HVHB 3SPVA 3PWNA 4FQHB 5F8RC 5HGAB 2NW3A 1CQYA 1A6UL 1V3KA 1L0YA 3W9EA 5DO2C 4GSDL 4RIRA 3RTQB 5ITFA 2H2SC 4YZFF 1KG0B 3KAAA 3VFNA 4CNIB 2BJML 5MEOA 3RVUC 2B4CC 3WFEL 2IALB 3S3JA 3AU1B 3E2HB 3RI5K 3HE7D 3VXPB 4X7FC 1INEL 4N1CA 4X7DC 1JV5B 3V4PL 3B2VH 5ADPH 1U91B 3WNMA 5CP7A 1NCBH 4P2OC 5C6TL 1OW0A 4LP4A 4LGRB 3MLRH 4LSSH 1EEZB 5GHWH 4XCEB 4BUHA 2ZNXA 3MLXH 4NQDE 1VEOA 3EYSH 4BELD 5FKAB 3PWPD 1DN2A 5I1HL 1JVKA 5F97E 3BGMA 4PY8I