4XP6H

X-ray structure of drosophila dopamine transporter bound to psychostimulant methamphetamine
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
219
Chain Sequence
EVQLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQSPEKRLEWVAEISSGGRYIYYSDTVTGRFTISRDNARNILHLEMSSLRSEDTAMYYCARGEVRQRGFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Tranport protein/inhibitor
total genus 38
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp6H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp6H01
1KEML 1YN6A 4ZD3H 2ZG1A 3HC4L 4NM8H 1DVFD 3EOBA 5ISZE 3IDXH 5ACLA 4XPTH 2NY2D 4JRXB 5IW3A 1UM5H 5B3NA 4P9HC 1GYAA 5IWLC 1HCFX 2OCFD 3MRDB 4JHZA 3RTQB 5ICXA 2AJUL 4I18A 4M6MH 2BNRD 1YECL 3F6LA 3LD8B 3QDGD 3ZT7A 2DMKA 5FAAA 4GJTB 2XY1A 1IAKA 2LQRA 4M6OH 5KVMC 2XTJD 3OKMB 2HRPH 3BDYH 4C83B 3JTSB 4HWZB 1DN2A 4FFWC 2XQYK 1MJJB 1LO4H 4HJ0C 4JY6A 1ZK9A 1J88A 1EUTA 4AL8H 4CADA 3SDAA 1G7LB 2W9EL 4YAQB 3QHZH 2WIIB 3ZE0F 2V5YA 4URTB 1FNEB 1NCWL 3WLWD 4YDIH 3FN0L 4IMKA 4OCLC 2CRMA 1UM6L 1MCBA 4Y4KA 5IM7B 5HVWA 3MA7B 4PJ8B 2CLVA 2EE9A 1WCBB 4IEFB 4NN6B 4BFIA 1HQRA 1AKJD 1XCQA 2BVUA 1K85A 1WVZA 3HNSH 3BH9A 3GHEL 3IFNL 1AHWA 2E8YA 3VDBA 3PWVA 2VSDA 3MV8A 5EO0A 4QTHA 1A4JB 3RBGA 2D0HA 3RVUD 3BESR 3UDWA 2X1WL 2Z91A 4MHHG 1FGVL 1RJLA 2W91A 3DLQR 3GJFA 1KCLA 1TVDA 4XWOD 5F89A 5T1MA 3T3PF 4LARL 5DMYA 1Z6JT 4LPWA 2MQCA 2DQEH 4PJHE 1FYTB 2GSGA 5SWZE 4HHAA 3N50A 2HG5B 1CDHA 4JZJC 3SOBL 5D70H 1X5ZA 2Z8WC 3QUZC 4JR9L 4G9DB 5DFWH 3O3EA 5B21A 3I3BA 5IKCA 3HR6A 1P5VA 1CFBA 4LKCA 5FM4A 1DQQA 4ELKB 2AJUH 2ZUYA 4IBLT 4C56A 1HHJB 4MJIA 2QTEA 5FYLD 2C1OA 3AB0C 3JVGA 3BP5A 4QWWC 4X8JA 4HGWB 4TOYH 1EO8H 4N9GA 5EIIA 4XP9H 4XVJH 4FP8H 4JM4L 4Y16C 2AGJH 1CFVH 4LNRB 3TV3H 5I30H 5T3XH 3UTOA 3ESVF 2FEEL 1QFWI 5C0NC 2ZJSH 5DJXB 1FIGL 4FNLH 2R39A 3ULUF 3MJ8A 1PZUB 1EAPA 5CP3A 4YX2L 1ZA6B 3W11D 5K9JL 5DJDA 1YEGL 4JPIA 5E9DB 4MJ5A 2BVEA 4GRLB 4JE4B 1XGPA 1KCKA 1HSAB 4IHOB 3PGDA 1NCWH 3FN0H 1BVLA 3KJ4C 3PHOB 5EO9A 2ESVA 1WEJL 3IDJA 1BIIA 1UM6H 5F96L 4WW2C 2QKIA 3MNVB 3HE7A 2A2QT 2JELH 5EC2A 4GRWE 5GRJH 2WINB 4YH6A 5B39B 1LNUA 1GGYA 4QRRD 2Y5TA 4X6CB 4ODSH 4XCFL 3OAUH 2VQTA 1ZEAH 1DUYB 4G8GB 2VAJA 2CO6B 2A6DB 2PO6D 3VFWA 2NY0B 3ZE2E 3MCLH 4TTDD 3LB6C 1DEDA 4FQJH 2HVKB 3O4LB 3LKRA 4G8EB 5F7WC 1KCSL 4XBEL 4JANB 4X4YB 5CSZB 3V0VB 4WJ5A 3BEVB 4MVBC 4MJ4A 1U8PB 3KAAA 2B20A 3RX5A 4P46D 4PJXB 1PX4A 3FFCE 3JWDH 3VXTB 4HIJB 2GJ6E 1ZAGA 4NYLA 3OX8A 3PNWB 4NHUB 4NN5B 5DHYA 3CJJA 4JO2H 4JR9H 1MJUH 1EPFA 4U1NB 3MXWH 2FB4H 3MV7D 1EFQA 4I9WE 4WFGE 3TNMA 4JFQA 5GHWL 1PD6A 4LCWA 2DD8L 1UWGL 3TFKC 3D85D 1A9EA 3ZL4H 1DFBL 5EZIH 3QNYA 4IRSA 4U3CA 2XZQL 1CU4H 2X44D 3HAEG 2DQDL 5JZ7C 2D7TL 1IGFH 5TE7L 4JM4H 4KROC 5D7JB 3MBXL 4Y1AE 5I9QC 4KRMB 4OZHE 3TO2A 1OD7A 1M7DB 1E27A 1RHHB 3AM8A 4Z7NE 4LP4A 1LO0H 5C0CB 5JOFB 4PJ9D 4AQ1B 1XR8A 2HYMA 4OBRA 4AIXA 2F5BH 4N8PA 1KJ3H 4PV8A 2ADIA 2D31A 5DHXB 1TVHB 4RZCA 5IOPA 2CLZA 1CLYL 4QHLA 4U0RB 5GGTL 2H9GB 1YY8A 5F96H 5IHLB 4L4TB 4P2YA 3DURB 3F7QA 1EBAA 2QJDA 3V6OA 3NCCB 2YPLA 4JDVA 5FHAL 3QXAA 5HGHB 1JL8A 5F7YC 3JWNC 1DSFL 4WI6A 3I02B 4HXBH 1YN7B 1QACA 3CFDB 2WBJC 3SY0A 4R8WL 1G9MH 5KVEH 1IEBB 3V79C 4MA1C 25C8H 1AQKH 5HI5D 1KCSH 4L4VD 4XBEH 4XPAL 1EHAA 1RIVL 5C0EA 1EZVX 2HTKC 3NA9H 5D2LA 4HFUL 4U7KA 2IMMA 4D8PB 1IM9D 4RAUA 2OX5A 2H2SC 5FGBA 4A2MA 3G9AB 4PJIB 3CSYB 3BPLC 4IM8A 4OFDA 3WXVL 2X40A 3RY5A 2E9BA 4EI6A 5D7IA 4A6YH 3HI6L 5F8RC 3VXSD 1X5JA 4XCNA 5HHNA 5D96B 1IE5A 1BOYA 3MOAH 4HD9A 5T33L 1BD2E 4PREB 5HYEA 1UWGH 3MRLA 3LQAC 4R96B 5ESQA 1BZ9A 2JB5H 1U8LA 1F4YH 5EOCL 2EDJA 5KOVC 4EDWL 4YHZH 3RVVC 2N4IA 5C3LD 4K23L 4QRTB 1VACB 2R0WL 1ZGLA 3VDAA 1WIOA 3PXJA 3VWJA 2JCCB 1IARB 3G6JE 1WZ1H 4L8SA 1BJMA 1MFEH 2IWGA 2AV7B 3BKMH 2GT9A 2CMRL 1J5OL 5CJQL 3S4SG 1LP9E 1O5DT 4PJCA 1HK6A 1CGXA 3KPNB 2RIKA 3EO1B 2YD9A 4I18C 1FNFA 1CLYH 5I8KH 4RISL 4DTGL 4K7PY 4MJ2A 2EXWD 3C5ZB 3O0RL 4GAJH 3HC3L 1XIWA 3QBTB 4GSDH 5F6IC 1RQ5A 1UB5B 3QPXH 3HCVB 3MRRB 5FYKD 4Z7QE 2WUBL 2Q86A 4PRID 5FHAH 3L3DA 2W92A 4ONGL 4P23D 4G3YL 5LWYL 1OD9A 1FO0A 3VWKC 1CF8L 1OAXL 4R8WH 5LG1A 4MXWH 3RDTD 2Z31D 1YMHA 3PWPA 4YUEL 4WFEE 1YUHB 4OGAD 2MQ3A 5ELIA 1RZ7L 4PGCB 4YC2B 5D8JL 1X5GA 4Q9CA 2X41A 2OQJB 4IMKC 1TQCC 4HFUH 4B7LA 4F80A 1EEQA 3FZUD 4R6UA 1NC4B 5J11C 3DXAA 1ZKAA 1INEH 1FVCB 2P5EE 2F53E 4QHUB 5CD3B 4LPXA 1VFUA 3GMQB 2VN4A 4J1UB 1I1FA 1RUPH 2F54E 1I7RA 1S9YB 4HZLB 5D2NE 4WEMB 3OXSA 3T0ED 4NKMB 4LLQB 2EYSB 3BT2H 2KBGA 2ENYA 3S35L 2GYSA 3RUGE 4WWKA 4XP4H 1OPGL 3L9RB 2P7TA 4XPHL 2ICCA 3UP1A 4CDGC 3JV6A 2HT2C 1WFTA 3ARVA 1ZMYA 3O3AB 4EDWH 1YEDB 4PLNC 5JHLH 4PRDB 2ZUSA 4JG0H 3UTQB 3QEQE 2VZ1A 3NABL 4UIMB 4HUWA 4Y5XA 3KJ6L 3TO4A 3C2SA 2EDBA 2QQKH 1QP1A 3MRIB 5TJWK 3EDEA 5DR5L 5IIEA 1DVFB 1AGBA 5TGBB 1T4KB 2NY2B 1A0QH 1J5OH 5IMOA 1PY4A 3BD3A 1CQYA 4L5FH 1TTGA 4FS0A 4LEXH 4OM0L 5F44A 4BQBA 2MHAB 2VAAA 3VXMA 4R3SB 3JVGC 5JHDE 2BNRB 1E4KA 1G6RL 3HC3H 5EUOF 3Q0HA 3QDGB 5ADPL 5DRXB 1EEZA 1B9ZA 5DMKB 2VDOL 4AQOA 4F3FB 1J0HA 4J2XA 2BXYA 1A7BA 4KPHH 5IG7B 1MHEA 4S11A 4BSWB 2XTJB 5CJXC 1U2CA 3U2SA 1OAYL 1G1YA 5BVJA 4G6ML 1NLDL 4Y0GA 5KVGH 1S8DB 4Z5RA 3WHXA 3ARGA 4YUEH 5DHVB 3LN5A 4WY7H 2AQ3A 1BGXH 3NIGE 4M1CD 3SGJA 4TYUA 3G6AA 4Y4HA 5INCA 1UWEH 3MRBA 4TVSa 4OBSA 4LPYA 5TF1L 4Z77A 3CLFL 4L3EE 1W0VB 4ETQA 1MH5B 5B3JF 4NNXA 1PYWB 4BH8A 4QRUB 1VPOL 3QUKB 4QHMA 5EOTA 2APTA 4PRHE 1AKJB 3F12A 4GMSL 3L3IB 4NKDB 5JTWA 3DVFA 2GKIA 4PJDF 1T3FB 3QXDB 4NO2A 3ILQD 3T08A 1P1ZB 5BOZG 4ZXBA 1OPGH 5H37H 2W65A 4K3JH 1F3JA 4D0BB 1G7MA 1XGTB 3LN4B 3LOWA 2ZPKL 1V3KA 1S9XB 2X4QB 4OCSL 5IMKB 2IFGA 1IGTB 3FB8A 3SPVB 1WV7T 4M03A 5FECB 1RJCA 5T3ZL 1H0DB 5EIVA 3ECBA 3NABH 3DROA 3X12A 2EIDA 4M9PA 4YHOH 2IH1B 1SJHA 2AQ1A 5E2UL 1DQTA 3AROA 1LO5B 1U8NB 1FC1A 5IVOA 5M95B 1UXSB 3VGDA 5EZJB 4F7EA 2DQJH 4GQ9H 4X6FB 4HPYH 5HHVL 3VD3A 4MS8D 5L9DL 1I8MA 4PB9H 2GSIB 4OM0H 2XZAH 4OCMC 5GS1B 3G08A 4XAKE 4MSWA 3D3VE 4UNUA 5E2WL 4IRSC 2O5ZL 2D7MA 4NJ9L 4OUUA 5FKPB 2OBGA 3J7HA 3O8XA 3H9SA 3BDBA 4AIZB 3DMMD 2DB8A 1HKLH 3C87A 3PABB 1W72L 4JO3L 1ND0A 3LQMA 4JFDE 4KJPC 1Q0XH 3AM8C 3C6SA 3T1FB 1BPVA 1S7RB 1Y18B 3E3QC 3UPRB 5SWZD 4LHQB 4X99A 1NLDH 1S7SA 5DRZA 1GAFH 4KHTL 2APVA 5T1KD 5L6YH 4I4WB 5KTEL 2NPLX 5IJKC 2UWEB 1YEFH 4G7YH 1GGCL 3VFUA 3MLXH 3JWDC 4DZ8A 4ORGB 1U3HA 1DANU 4MX7A 3LEVL 3HLAB 4DUVA 2H1PL 5CINH 3V6OC 5TF1H 1IEAA 5BCAA 2FWOB 4IIQC 4XXCA 1U9KA 1ZA3A 4O2CA 5I8OL 2BNQA 5D93B 2GIYA 2IQ9H 2W0FB 4B50A 4GMSH 1FLRL 1QHPA 3RL1B 4QRRB 2CO7B 3B3IB 4JRYA 4OI8A 4F2MA 2XKNA 2CLRB 2R2EB 4D0CA 1VFMA 4UB0L 5CUSH 5IBLC 1EV2E 2PO6B 1FN4B 3RQ3A 5DGRA 4PLJD 4M5ZL 4EVNB 1UJ3B 3UYRL 1H3XA 1AR2A 1VCAA 2NXZD 3QYCA 4JFFE 5CZKA 1F3DJ 3CIQA 4P46B 5GGRY 3QEGL 3QJFB 5FGBC 5HHOE 1FV1A 4U1IB 3DYPA 3NAAH 5T1LA 2GK0A 5E2UH 1EERB 4CVXB 1CBVL 3OJMB 4PJHF 4RFNC 2Z35A 5FDYA 2HN7B 1HOCA 2NR6D 1DJSA 2ADGA 3OKOB 4YXLL 3CXDL 4KVNL 1ACYL 3A6CL 3DECA 4NCC2 4G43B 4U1LA 3FTGB 3I6KB 1SYVB 3QULA 3PWJA 2GTZA 4JJ5B 3B2VL 1NMAH 1CR9L 5ESAA 3D85B 4DGIH 4JHAH 2O5ZH 5DK0A 4KKBD 2MKWA 4NJ9H 4UUJB 3E1F1 1BECA 4XC3L 2MMXA 4K8RH 5EBLA 1KPUB 4X6EA 3DSFL 4MAYA 4IS6A 5GRZA 5ALBL 3VWJC 2UZIH 4LGPB 4FXLA 1MUJA 3T2NL 4H20L 3ARZA 3KDMB 3V7MA 3VE0B 2X42A 3FFCD 4LRNL 4LCCA 4Y4FD 1G9MC 4MNGE 3DV6A 2GJ6D 1UB6A 4JFZL 1DCLA 4KHTH 4PJ9B 1T5XB 2ZSWA 2V17H 3GMNA 2ZG3A 1OGAA 1C5CH 1NBYA 3BKCL 2X2YA 3D5OF 1GGCH 1U0QA 3ET9F 4HUXA 5L2KA 4E0RB 3S3JA 1NLBL 4I9WD 5J3HD 4WFGD 1KTRL 1XIWC 1CQKA 2VXTH 3BZFA 2NZ9C 4WCYL 3ARPA 5IK3B 2AEQL 2W07A 2ZSVA 4XC1H 4XBGA 3ISWA 2QHLA 4U31A 4WHTB 4MB4A 1FCCA 5GGSY 5C0AA 4N0UB 1AIFB 3I85A 1S5HB 2DBLL 2MSPA 2AV1B 1FORL 3V7AG 4LQFH 4CVWA 3MNWB 2XWJB 4Y1AD 1PY9A 1B2WL 1EHXA 3CVHB 5HHPB 4I13B 3ALWA 2HTLC 2V6HA 3HMWL 4R4BB 3QQ4B 5MP6L 5IT2H 3HPLA 5CD5D 3D18B 4O9HL 4BH7B 3MC0A 3VD4A 4HBCL 4L4VB 5AUMA 2GUOB 3TEUA 3REWB 3UBXA 1FVEA 3ZE2F 2YUXA 4HWBA 3FT3B 4HIHB 5JA9A 1IM9B 2VXUL 3WV0A 3NFNB 5FV2A 4F37K 1HH9B 2WLYA 3S34H 4WDIB 4CJ1A 5IQ7L 4X8XA 3TJEL 4QRSB 1BJ1H 3VXSB 2FNBA 1ACYH 3A6CH 3FO9A 3WN5A 3BE1H 5J4MA 2P4AB 4WWKC 2BSED 2PW2A 4RA3A 2IPUK 3MLUL 3QDJE 1OP5H 1JRHI 1Q72L 5BZDB 3MRFB 3P9WB 1UXWB 4OLUL 1WZKA 2MPAL 3OR7B 2MCPH 4U1KB 3BKJL 3K46A 3MRDA 3RTQA 3QIUD 4U1GB 1UCBH 4JN2B 4Y5XC 1T7XA 3W39B 2J8UE 3T2NH 1I9RL 3FRPA 3PGFL 1R0AL 3FCTB 4ZOAA 2HMID 2BMKB 2R2BB 3AREB 2ZCHL 5GRVL 1ERNA 4HS8H 4FQCH 3OKMA 3HZKB 3SCMD 3VXOB 3MA9H 2OLDA 4C83A 3JTSA 4HWZA 1LD9B 4YDLC 1MJJA 2DQTH 3QEUB 1BFVH 1E4KC 1JPGB 1NLBH 4ODTH 1N6QH 1G7LA 3K2MC 4YAQA 4WGVB 2WIIA 4V2BA 4U1HB 1FNEA 2FSEB 4KJWC 3GSRB 2DBLH 1GIGH 5IM7A 4PRIB 3MA7A 4PJ8A 3IDYC 1NEUA 4IOFD 4P23B 1WCBA 4NM4L 1DUZB 3NGBC 3ARGC 3H7BB 3RDTB 4ELME 2Z31B 4JZOB 5MP6H 2DQUH 4NKIL 3SGJC 4OZIE 4Y4HC 3QWRA 1A3RL 4QHKJ 4PY7A 3LKQB 1PDKA 2MQ0A 3CGTA 1A4JA 3CX5K 4KRLB 5EUOB 3V5KB 3INUL 4NKQB 3TT1L 1YQVH 2R2HB 4XBPB 1OSPH 5CKAA 5IQ7H 1T7VA 3LS5H 5D5MF 3T0EB 1FYTA 3E0GA 2Y1VA 2VR5A 4LSSH 2HG5A 1T20B 4Q2ZB 3RAJH 4KJYB 2APFA 5DJ2B 3TCLB 1KTLB 2BY2A 4G9DA 1NBZB 2X4OB 4OLUH 5KVDL 2MPAH 4RX4A 4XP1L 4UOW0 4WFED 2YZ8A 3QUMB 1KLUB 3MRJB 2MKLC 4ELKA 2VH5L 1HHJA 4I2XB 3B5HA 2W9DH 2VDPL 1A1NB 5JO5B 1TCMA 4N0FB 1AR1C 3MROB 1NL0H 1RZJL 4HGWA 1I9RH 4C59B 4F7TB 3SKOB 2A9MH 1OVZA 2Z8SA 2P5ED 2F53D 1KIPB 3KLAB 2FDBP 2XWBB 4LNRA 1FGNL 4PJDB 2F54D 2RFXB 3G6JF 5JPMB 4Z95L 1J8HE 1ZLUK 1I7ZB 2HLFC 4FFZL 5BV7B 4DVRH 5K9KB 5DJXA 3U30C 4V1DE 5E1HB 1QKZH 1ZA6A 5I76B 4HUVB 2GFBB 5E9DA 2YD8A 3R8BB 4GRLA 1HSAA 1I9IL 4IHOA 3D39A 3PHOA 5BVPL 5CFHA 1CDYA 3SQOH 4ZNEE 3MNVA 3MV9A 2VXQL 4WO4D 5AYUH 4NOBA 3QEQD 4N5UA 2WINA 1TITA 3R06B 5B39A 1B0GB 2DQGH 1ZHKB 4W4OA 2CKBB 5EBGA 2IPTH 4NKIH 1AY1L 5E4EB 4X6CA 2BY0A 2DRUA 5GS3A 1DUYA 4G8GA 4XTRC 5ERWB 1S5IL 1U3HC 2A6DA 4OZFG 3FMGL 1KC5L 2V9QA 2HVKA 3O4LA 1H3PL 4G8EA 1BQHG 4XXCC 3ARDD 4JANA 3SDCD 4X4YA 5CSZA 3V0VA 3BEVA 3FJTA 1U8PA 2OXGA 2XYCA 4PJXA 1ZOXA 1L0XA 3PF2A 5MENE 2FBJH 3VXTA 1RV6X 4HIJA 1WSST 3ABZA 2EH8L 4CU6A 4UT6L 5AG8A 2WUCL 2AABL 2DIAA 3PNWA 4NHUA 4J3SA 5MEQB 1YY9C 4YHNB 1DTUA 1UACL 4FFVC 4M7KL 3VI4F 4JRWA 1OAKL 3VFPB 3HPJB 4U1NA 4XAWL 3CFKB 4AK1A 1E4JA 3RUGF 4AEIL 2O5XH 5EOQH 2VH5H 2DIBA 4LVOC 4RGOH 5D9SB 4TVPE 4YWGL 4RIRB 1UZ6E 4HIXH 4L3ED 2OR8A 5D7JA 4I8DA 1B6UA 4NP4L 4X7FC 5D1XD 3W9EB 1M7DA 1SJEB 1RHHA 5AAWA 4F7MB 5C0CA 5JOFA 3BSZL 1NCAH 4O4YH 1PLGH 2UY7A 5ENWA 2EXYD 5L8JB 5LXGL 1TVHA 4MAYC 4JCLA 1BLNB 3DJ9A 3DMMB 3ARUA 4GFTB 1JMZA 2H9GA 1ZVSB 4L4TA 3TWCL 3WJJA 3DURA 3MRPB 4LCCC 4NSKB 4PJHB 2VXVH 4M3JA 3RP1A 3BAEL 5SWZB 4F15C 3F6IA 5FKAB 1MIML 5F97E 4RGMC 5IBTL 5HGHA 4G5ZH 5T1KB 1FZKB 2DMBA 3ZKXC 1AY1H 2KPNA 4ZYKB 1RUKH 3I02A 2O61B 1YN7A 5BJTB 1MCKA 1C7SA 4U2ZA 1S5IH 3CFDA 1INDL 1K3IA 3GEWB 1IEBA 3GBNL 4YNYB 3FMGH 1KC5H 1CD1B 4R4FL 3U7WH 3ULVL 3VGHA 3TH3T 4EI5C 4RRPG 5C8JB 4XAKD 3TBTB 2X9YA 3D3VD 3R1GL 4I0CC 5I71B 1KENL 1JHKH 3WHE0 5LJYH 2F8OA 3UTTE 4D8PA 3NCBB 5FYJL 4PJIA 3WFEH 3CSYA 2C3WA 3HUJE 4JFDD 1IFHL 4JQIH 4O2EB 3S37H 4M7KH 3T2OA 5H2BB 2YC1B 1OAKH 4K8RC 1JZ5A 1I9JH 5BW7C 2IG2L 3OZ9L 1ZTXL 4YHML 3BMVA 3JWOH 4NWUH 3A6BH 4PREA 2NXZB 4WWID 1BIHA 3AFLA 1A4KB 2IBGA 1UJTA 4PS4L 4R96A 1BBJB 3FN9A 5I1EH 4MCYB 3F7RA 4LSPL 1ULVA 1AGEB 4LK4A 4FQIL 4QRTA 1VACA 3V5HB 4GRWB 3WFHB 3WN5C 3ZDYE 2JCCA 3KLHD 2IBZX 2WM0A 4FZEH 1M4KA 4YE4L 3TH4T 4O2FB 1II4E 1CICD 2AV7A 2QR0B 1J0KA 4L8DB 1RJZB 4CMHB 5LXGH 1LEGB 3RTQC 3KPNA 1MCFA 4NT6B 3EO1A 3GBLA 3LY6A 1ZXQA 5J7CC 2FD6H 5AWNH 1BBDL 2E8ZA 1ADQL 3C5ZA 5DVNA 4JFFD 5GS0L 3L3JB 4HEPG 1NH6A 4KUZL 2AI0L 3FFCB 2AQ2A 1UB5A 5HHOD 1MIMH 3SKMB 3F5WB 3HCVA 3MRRA 2GJ6B 4DN4L 2Y25A 1JGVH 4X80L 1I8IB 2BY1A 3GHBL 5I1HH 3BWUC 1T0MB 2ZUTA 5EA0L 4OFIA 4P2OD 1N5YL 1INDH 4MB3A 3GBNH 3ULVH 4R4FH 1YUHA 1S3KH 1WIUA 4JPWL 4PGCA 1WUNT 5T3XE 3FT2B 4WEBL 3VXQB 4AT6B 3OSKA 3QDMD 5EORH 2OQJA 4ODBD 3TJHC 1ZWIB 5SWQB 1KYOJ 4I0PC 4NZJA 4PJ8C 1G9NC 1NC4A 2G75B 5SWSE 3VGBA 1FVCA 4QHUA 3O81A 5CD3A 1JF6A 2H6PB 3GMQA 4NN6C 4J1UA 1MRFL 3L5WB 2YBRB 2DKUA 4ODWB 4OZFH 4XB7A 4Y1AB 3T0AA 4OZHB 4KY1L 1S9YA 4HZLA 5T1DH 3IAGC 3B8YA 4NKMA 1MCPH 4LLQA 4ZTOL 1MWAB 1WQVT 3CMOL 1ZTXH 2MOVA 4WTXA 4YHMH 5ANME 3HE6D 3CVIL 3QXUA 3L9RA 2ZUUA 5GQBA 4KFZC 4B5EA 3LEXB 5TF0A 5DHVH 1KFAL 4Z7UF 3O3AA 1T1WB 4PRPD 1YEDA 3MRCB 4QXTB 4PRDA 4KMTH 3UTQA 3CFCL 4NFDA 2VZTA 2FGZA 3MOBH 4PBWD 1A14L 4PD4K 4UIMA 3OG4B 4KC3B 4XP6H 3EHBC 1UGNA 2QQLL 3T0VA 1MHHB 3WEXB 3MRIA 2ADFL 1IGCH 1DVFA 2E7MA 5TGBA 3MUY1 1T4KA 1EVUA 4OGXL 4ORZC 4TSCL 1H9VA 5EWIL 3RVXD 4YBQC 3QRGL 3ULUH 1QD0A 2X1OA 4PJAF 2MHAA 5B38B 3QIUB 3RX7A 4R3SA 4QWWD 2BNRA 4BQCA 4RQQB 1WBZB 5MHSE 4TULH 3QDGA 1MCRA 2NW3B 2VLME 5DRXA 3QUYD 5DMKA 4F3FA 5FUOH 4P2RD 3V6ZB 5HDQH 1U58B 5IG7A 4LSRL 3GSOB 3H9ZA 4BSWA 4PTTB 2XG4A 1FC2D 4C54A 3D0LB 3SCMB 4UOJA 5FO9B 5EA0H 4NRZB 1N5YH 3RVWC 4JREC 2Z8RA 1S8DA 5DHVA 5D2LE 4GRLC 1I3VA 2CRZA 4JPWH 3QDJD 3DHJA 4KK5D 4WEBH 3O2WH 2CK0L 2IFFL 4AEHH 1IC4H 4YHPB 1N7MH 4WUKH 3TYGH 1FO0L 2DI9A 2P44B 4YZFE 4J23A 3ZHDA 1NCDH 2CRIA 1F97A 1FSKB 1MRFH 1W0VA 1MH5A 1PYWA 4KY1H 4OF7A 4QRUA 3QUKA 4KVCH 2HJLB 3G6JB 1AKJA 1EO5A 3IFPB 3V4VH 3L3IA 4NKDA 1CXFA 1T3FA 3QXDA 3CMOH 4LLAA 1P1ZA 3ZDXF 1DBAL 1A6WL 2E7BA 4LU5L 5DUPH 3P4LA 3MRMB 2V2WB 1XGTA 3LN4A 1R3KB 4GKZB 1S9XA 2X4QA 3OKKB 5IMKA 1Q94B 4Z7WE 2OYPA 2OR9L 1IGTA 3SPVA 1HIML 3U4BL 3PV7A 3V52L 5FECA 3SKJH 3CFCH 1H0DA 3P4OB 2DQIL 2VB5A 3WDHA 3BD4A 4NN5C 2IH1A 1F3RB 2DN7A 1S7QB 4PJCE 4YDVB 3ARXA 4ZMAT 4GKNB 1U8NA 4F58H 3JUYA 4HS6B 3HRZB 2E5EA 1UXSA 5EZJA 4BFGA 1YEJL 4X6FA 4NHCH 3EOTL 3R8QA 3FN3A 1HI6B 4LPVA 2YK1L 1NAMH 1SMOA 5E99L 5GS1A 2YSSB 4OFPA 2ADJB 4K3EL 4JGUA 2Q3ZA 4RBPH 2XPGB 2VN7A 3P3YA 1AH1A 3BN9D 5FKPA 1SY6A 4AIZA 3SKUD 1CTOA 4KKLC 2P5EB 3PABA 3OB8A 4KROD 2F53B 5HHXH 2J8UF 3C2AL 2F54B 3WDJA 4KU1A 5D2NB 3CXHK 3T4YB 5HPOA 3T1FA 1S7RA 1Y18A 4OQTA 3O6LL 5DO2C 1YDPB 5EOCJ 1FJ1B 4S1DD 1TJGL 4OZGF 3GUTB 3VG0L 3N1QC 3QG6B 3KYMB 4I4WA 1LDPL 3EGSB 3RUGB 1RZKH 2ZUQC 2UWEA 2FECL 3O45B 2A0LC 2IFFH 3EJYC 1CVSC 4ORGA 3WJJC 3K81A 3HLAA 3NCJH 1RFDH 3HG1E 2FWOA 4WO4B 7CGTA 3QEQB 1AP2B 4HW6A 3EKCA 1UM4H 3S97C 1HN1A 3UYOD 2W0FA 3SGEI 4HIEB 1KEGL 2BVOB 4OLZH 1G7QB 1FBIH 3RL1A 1KXQE 1Q38A 4PYHA 4QRRA 3B3IA 4X7CC 1MAJA 2WBJD 5JR1L 1HXMB 2CLRA 2R2EA 4YHKH 3MUGB 5FHBL 1J8HD 2AJXL 4XHJC 4ELMF 2BJML 2PO6A 1FN4A 3O6FD 3BKYH 4F8TA 3QQ9C 4HUNB 4V1DD 4LAJH 2OR9H 4EVNA 1UJ3A 2PUQT 1G7IB 1UADC 2HTKD 3ARDB 3P0YH 3SDCB 1HIMH 3U4BH 5BZWB 3IAPA 1I8LA 1EFXD 1ROWA 2E27H 3F7VB 3QA3A 3WE6B 3UJTL 1D6EA 4P46A 2Y06L 3QJFA 4ZUSB 2H2SD 4KK6C 1YEHL 2ZOKB 4NGHL 4U1IA 4NNPL 1OQXA 4CVXA 3CPLB 1WZLA 3L3HB 3TC9A 3DHMA 1HYRC 2W1NA 3ZKMC 3BRGC 3EO0B 2HN7A 4AEEA 3VXME 5SV4A 3OKOA 2FYYB 3N1MC 5I1JL 4WTWA 5D96C 5E8DL 1ZHNB 3EOTH 4G43A 4M48H 4NNYB 5KSBF 3FTGA 2YK1H 3MV7A 1SYVA 5DA0B 4P49A 4JJ5A 3CVHH 3MLTB 4UTBL 4DJMA 4R26L 3D85A 5IF0B 4U6TA 4PJFE 3FHAA 4UUJA 2Y5EA 2AK1L 1KPUA 3EIFA 2VXSL 3B83A 4OUOA 2YA0A 4L3EB 5ALCL 1KN2H 3H3PL 5CCKL 3MJ9L 5D1XB 1QBBA 3VE0A 3CZFB 3KDMA 3O6LH 5MEND 2Q8AL 3I6LE 4JZNB 1B4RA 4N5EC 3VG0H 4PJ9A 3DI3B 5DLML 1T5XA 5F3HB 1LDPH 3MRGB 4OD2B 4LIQL 1JYNA 3ZHKA 3QIWD 3A6OA 5DQ9B 4E0RA 3C5ZC 1PFCA 4B53A 5IK3A 3FQNB 1H3WM 4WHTA 3CX2A 1NCUA 5IUSA 4N0UA 1AIFA 1IAII 4HMEA 1S5HA 3IJHB 5IFHH 2AV1A 4TVPD 1CLZL 1TJHH 3IDUA 2QSCL 3JWOC 3EDKA 3VWKD 5I75B 3MNWA 2XWJA 5JR1H 2ITCB 5HHPA 1RURL 3C60D 4R4BA 3QQ4A 4HXAL 2ERJB 4Z7OE 4YC2C 4BKLB 3D18A 4BH7A 4L4VA 4KHXH 2JJWA 4PRBB 3D3VB 2GUOA 1MFBL 3REWA 4LDOB 3NFSH 5I1AB 1HXYB 3EOYG 3FT3A 2VSCA 4HIHA 3G5ZB 3S88L 3WNKA 3GMLB 4XNYH 4XX1G 4NGHH 3MBEC 1IM9A 4NNPH 3NFNA 3THMH 3OL2A 3BUYA 4JFDB 5EU4B 4PLKC 1HH9A 5AD0B 4WDIA 4QRSA 5FYKH 1D5ZA 3VXSA 5I1JH 1X5FA 1IRAY 1QFUL 4MXVE 1OTSD 1J05B 3GSNB 3VFRB 1IKFH 4WFFE 1GGBH 1N0LA 1YEIL 5BZDA 3MRFA 1UXWA 4PUBL 3WFZA 3K8LA 3OR7A 3VI3F 4U1KA 1CLOL 3LMJL 4XCYB 2AK1H 3CAFA 1SBBA 4JN2A 3W39A 5HYSG 5CCKH 1UA6H 5GXBB 1Q0YL 1XGYH 3HN3A 1BM3H 4M8VA 3UTTD 1N6UA 3FCTA 1KULA 2JIXD 4LBEB 2R2BA 2BMKA 1DVFC 1CICB 2R0LL 2ZCKH 5IVZB 5TE6L 1NCCH 2NY2C 4I0KA 4OB5H 3HZKA 3DVIA 1X9QA 4OGYL 3VXOA 1YEKH 2UUDH 1WWWX 2WWKT 1LD9A 3C8HA 4LIQH 3MLRH 2G60L 3QEUA 1JPGA 1IC5H 5FA4B 4PG2A 5I16B 2X1XR 4K9EL 1MY5A 4JFFB 3VGGA 4OZ4B 3C6LB 4U1HA 3RKDD 1NGPH 5FCSH 2FSEA 5LGHH 5HHOB 2ICEB 4LCIH 3GSRA 4MD5B 1C5BH 4Z7VF 5EN2B 3MYZA 4JM2D 4PRIA 3HI5L 4JVUA 2QSCH 4KH2A 3MXVH 2CRYA 4P23A 3MQIA 1DUZA 4N0YL 4P2OB 1ZVYA 3H7BA 3RDTA 2Z31A 4HXAH 2EKJA 3MPCA 4JZOA 1W0WB 4XZUB 1O0VA 1JTOA 2C1PB 5JIPA 1IQWL 5EG6C 4HF5L 4XMKL 3WLWC 2PYFB 3LKQA 3Q5TA 3QDMB 4OM1L 3LQZB 3P77B 1MAML 4LCUB 5EUOA 3V5KA 2XY2A 5CEXB 5JQ6L 3FB5B 2R4RL 3RNQB 1A9BB 1YYML 2R2HA 1OF2A 4TNVF 4XBPA 1T03L 4BZ1H 3PWLB 1G84A 5I17B 1XFPA 1ZT4B 4MNGB 3T0EA 4UINL 3ULUC 3HUJF 4K3DH 1T20A 5CEZH 5E24E 3FO1B 4FQHB 4Q2ZA 4J8RB 2V2TB 4KJYA 3HE6B 4ZO6A 1I3GL 5DJ2A 3TCLA 1KTLA 1CN4A 1CS6A 1NBZA 1P84K 1D6VH 2CKBH 2X4OA 1QLRB 5D1QB 1QRND 3QUMA 5T3XD 5I74B 1KLUA 4PRPB 3MRJA 1I75A 4AJ0A 4HGKC 4I2XA 4AZ8A 5D7SL 1A1NA 1JNLH 1WK0A 4J6RL 5JO5A 2VZSA 4N0FA 4JZJB 3MROA 4JM2F 2X4SB 4F7TA 3RZCB 3SKOA 1OGAE 2H2PC 5SWSD 2XT1B 4JY4B 4HWUA 3MCKB 1KIPA 3KLAA 5A16B 5T3ZE 3X3FL 3P30L 2XWBA 1WCQA 3ZDYF 4PJDA 5TE6H 4U6YB 2Y72A 2RFXA 5DVMA 1KB5L 4OGYH 5JPMA 2ATKB 1OM3H 3DETD 1I7ZA 4X4ZA 4OLEA 1RULL 5K9KA 1J0YA 4HQQH 2V2XB 4GG6E 2A38A 1WAAE 3MLVL 5BXFB 5I76A 1U92A 1OOAA 4HUVA 2GFBA 4PP2B 2OJZH 4U1SB 2BVQB 2AJSL 3QUYB 4TPRL 4OIBA 1FDLH 1F58L 2X4PB 5EU6E 4P2RB 1MCEA 4KJPD 1EGJA 1AGDB 1I1YB 3HI5H 1F8TH 4PJGE 3RWIB 1EJ6A 2B0SL 2ITDB 4L3AA 1T80A 4FFYH 1P2CB 1A47A 4EOWH 2YOCA 3R06A 1B0GA 4WV1B 1ZHKA 2CKBA 4BYHA 3QO1B 4OFYD 3QDJB 5B38G 32C2B 3TPKA 4MD4B 4HF5H 3EDJA 3KJ4B 4K94C 4OM1H 5ERWA 1TJIH 5FV1L 1ZLSL 3VFTB 2YD1A 2R4RH 4AMKH 4JQXC 5KS9F 3FQWB 5MHSD 2J8UB 5D93C 4C4KO 1QHOA 3S36H 2VLMD 3BX7C 2R4SL 3QQNA 2NX5E 4JRXE 5DMGD 1JPST 4WEUD 4OZGB 1UC6A 5MEQA 2QHRH 1FG9C 2LU7A 2F74B 2PO6C 2EIBA 2R29L 4YHNA 5DQDH 2DJUA 1F90L 1CXEA 1C5DA 2AJYH 3VFPA 2PW1B 1UJ3C 3Q48A 5JXEC 3HPJA 1K4DB 1C7TA 3CFKA 2ILLA 1LK3L 2VQUA 4EIGB 1I8LC 3V6FB 1JPSL 4P46C 4UT9H 3TF7C 4QKXB 4ZFOL 2RJMA 4XP5L 3QFJE 1J1OH 1BQSA 3D69B 4ZUTB 5IHZB 4UV4L 1JGDB 2FEEI 5D9SA 5JOEA 4RIRA 4ZO7A 1JZ7A 1RZKC 2YWYA 1CZ8H 5HDOA 4P57B 2LVEA 4L8CB 3W9EA 1BP3B 1KB5H 2IGFH 4D3CL 3PIQB 4D9LL 1SJEA 4ZG1A 4F7MA 2H32B 4ELMB 3CSBA 4N68A 4OZIB 2LE9A 4QOKE 1DL7H 3B43A 1RVFL 3SKNB 2AJSH 1CFTB 1MI5E 1KB9J 4QCIB 1BLNA 2VZVA 3DMMA 1F58H 2K1MA 4KROB 1ZVSA 2XNAB 3MRPA 3NA4A 4NSKA 2YD4A 2B0SH 4PJHA 5SWZA 5FKAA 4X5XB 4PJ9C 4UIKL 1UYWL 1GGIL 4XCCH 5I6XB 3MSPA 5T1KA 1FZKA 4ZYKA 1Y6NR 3LIZL 2O61A 5BJTA 3Q6GL 3BH8B 1L6ZA 3QG7L 3BVNB 5GGVL 5TFSL 4YNYA 1CD1A 3X17A 2NZ9D 4M5YL 1KLGB 2CUMA 3H3BC 1CD8A 3TBTA 3RNKB 5D7LE 3LKNB 3VRJB 5C8JA 3RWGB 3GIZH 5C9JB 4PBXA 3E6HB 3OJVC 4MHHI 4YZFF 2R4SH 3U9PH 3JUZA 5I1IL 1AJ7L 2B4CH 4TSAL 2WBJB 1DQML 4HUKB 4CGTA 1J8HB 3C08L 4O2EA 3CSGA 1KF9B 2R1XB 1H3GA 3O6FB 5H2BA 2YC1A 5J13C 3HA0A 5HI5C 3O9WC 3MGTB 2J5LC 4V1DB 3WNMA 2BC4B 3MZTA 4KV5E 4OF0A 2R2CA 5FOJA 1DZBA 1EFXB 3S5LG 3BD5A 1A4KA 4XP5H 3GM8A 1BBJA 4EN3D 1BQUA 2PYEE 4Z7WF 3A67L 1K5NB 1A8JH 3NCFB 4MCYA 2OP4L 4HCRH 1AGEA 3ZYJA 4QYOB 3HG1D 3UC0L 4ZFGH 3V5HA 4JPVL 1ZV5A 5GRYA 3WFHA 1NUDA 2FGWL 4UMGA 5E6ID 3UTPE 4O2FA 4XRCB 5E6YA 1T1XB 1U6AL 2QR0A 3QNXB 1N59B 3UJJL 2NYYD 3SE9L 3WS3B 5E2VL 3QQ3B 4LVNB 1RJYB 4L8DA 1RJZA 4R90H 3I2CH 2VLKE 1RVFH 3TA3D 1LEGA 1GZQB 3NZ8B 2GITB 4NT6A 5CAYB 4MZ2A 1NBVL 5FUCE 1MRDL 1CGTA 1SVZA 2LTQB 5I8CB 2VLLB 3L3JA 1N5AB 3FFCA 3B9EA 1CVRA 3O2DH 4Y4FA 5MENB 2ZG2A 4LPUA 1NGWB 3AREC 3F5WA 4UIKH 3SKMA 2GJ6A 4DKFL 4N8CL 1XF5B 1I8IA 3AAZB 4Y7MA 3L6FB 1T0MA 1BFOB 1ZLWK 3OF6D 2XN9B 3QIWB 4HS3B 4PG2C 2EXWC 1CDGA 3OPZH 2UY6A 2P46B 4M5YH 2L7UA 3CZJA 5AZ2H 3FT2A 1NGZB 4AT6A 3VXQA 1OAQL 5C6TL 1J8KA 5IR1B 3BIKB 5D6DC 4M3KB 1OQOA 1R5WB 4FN0A 1R24B 1ZWIA 5SWQA 1RMFL 1IC1A 4F9LA 4RWHA 2YN3A 2G75A 2FL5B 4P23C 5I1IH 1AJ7H 2H6PA 3QUXC 5IGXL 3VWKB 1CXHA 3EFDL 4CUCA 5GJTL 3L5WA 2YBRA 4ODWA 4Y1AA 4CW1A 4OZHA 1BEYL 3ME0A 3C08H 3RDTC 2Z31C 3QCTL 1E4XH 3I6LD 4NZUL 4OGAC 3C60B 3ZKND 2PTTB 2YHGA 1MWAA 5FB8B 2WQRA 3FB7B 1TQCB 3QWOB 2LAGB 5J11B 3LEXA 2FJHB 3GJEB 3O2DA 1T1WA 3MRCA 4Z7VB 3V7AE 4QXTA 5C0GB 4HKZB 4E9LA 3T0EC 3UTZB 5C0CE 2IALB 3LCYA 3UJIH 3TCXA 4AEFA 1CXLA 5B8CB 2FGWH 2PR4H 2ATPB 3KG5A 3RRQA 2FEDC 2EYTB 1MHHA 1U6AH 3WEXA 1N64L 1KV3A 2R1YB 4H1LG 4M02A 5I2IB 3S37X 4DAGL 2SEBB 3KPOB 1DQLH 4OCRH 4HUUB 3N85L 4LPCA 5JXAL 2HH0H 5TDNB 5F88B 1X5LA 2FLRT 3QIUA 4EEEA 1QSVA 3NMEA 3VXPB 4RQQA 1AR1D 1WBZA 4PJFF 3BJLA 4KDVA 2VWEE 4X7SL 3I9GL 4WI9A 3UTTB 5K59E 4HWEH 4GKOA 3V6ZA 2JIXB 3JTTB 3P2TA 1U58A 3GSOA 1JF1B 3HUJB 4PTTA 1MFAH 2EZ0D 5BV7C 3WXWL 3D0LA 2DICA 3EYVB 5FO9A 3SCMA 4NRZA 2VZ3A 4FG6D 3RWEB 1PSKL 1P7KB 1BAFL 3U79A 4KAQL 3NOIA 5F93C 1GXEA 4WFFD 4QTIH 1D9KD 1OAQH 2YPVH 4WI8A 4X9IA 4FZ8L 1EVTC 6CGTA 4LSQH 4YHPA 3BGMB 4S1QH 3WIHH 4PPTA 2F58H 3HZMB 4JM2B 4YPJA 3MACL 3QZWB 3NPZB 1T1ZB 3EFDH 2DWDB 5GJTH 4M93B 4OI9A 2HJLA 3BP7B 4ZPVB 1T21B 3G6JA 4QXGH 3L5XL 1SBSL 2IH3B 3IFPA 4NZUH 4OCWL 4M1CC 5E4EC 1Q8MA 3WFDL 4KZEH 4DFIA 5KG9B 5DT1L 1L7TH 3MRMA 2V2WA 4JPKH 4Z7OF 4Z9KB 1R3KA 4GKZA 1LE9B 3OKKA 2G9HB 4DGYL 1Q94A 4O00A 4R4ND 3PQYB 1IBGH 3DV4B 4MMZC 1D3CA 5IB5B 3P4OA 5GRWA 1JWUB 4FMKA 5I1KL 3E2HB 2DLFL 4P4RB 5C07E 4HV8B 4OV5B 5EO1B 4YXKH 3ILQC 3P9LB 4KKAC 2Y36L 3DUUB 1S7QA 4YDVA 1RZIB 1F11B 4GKNA 4M4PA 3BP4B 3LEYH 3HRZA 4HS6A 3DBXB 4MXVF 1NFDF 4GAFB 1NEZG 1HI6A 1QRNB 3WIHA 3RHWF 2YSSA 2ADJA 1RZ8B 5E03A 4OCNC 2VE6B 3B9KD 4OFVA 2XPGA 2ED9A 1FRGH 1WFUA 5KS9B 3PJSB 4X7SH 2AEPL 1BZQK 1FE8L 4HH9B 5BO1L 3I9GH 4TNWK 4BJLA 5LGKA 5SWSB 5C08E 2P5EA 3G04B 2F53A 4QNPF 1MIEH 3FHQA 1NDGB 2F54A 1N0XL 2AJ3B 5D2NA 3T4YA 4MS8C 3W5NA 3WIIH 3BPNB 2Q76A 1YDPA 1FJ1A 2JJSA 1PSKH 3GUTA 3VU2A 2HFGL 4U6HB 1CWVA 1EBPA 3QG6A 5ANMB 3EGSA 3RUGA 1SVCP 2JKXA 5L8LB 3OV6A 2BY3A 2H3NB 3O45A 1T1YA 5C71A 3VFMB 4OD1L 4NC0B 2YA2A 4HH8A 2KQNA 1TZIB 1WF5A 2AK4E 1PW3A 3LN9A 4ALAL 4I1NB 3S9DB 2NTSP 3OKNB 4WO4A 4H88H 5ILTL 1IEHA 3QEQA 5DK2B 1AP2A 1MFCH 4DUWA 2EDLA 4NN7B 1WZMA 1SBSH 4HIEA 4NC1E 2BVOA 4OCWH 3ZE0E 1G7QA 5T3ZD 1FAIH 1OT1A 3BQUB 5AG9A 3KPPB 2OL3L 1H5BB 1HXMA 3MUGA 3RGVB 3CLEL 1KIUA 4EI5D 2YD6A 4RNRB 2VABA 2FJGB 1FFNB 4GAYB 3KYKL 4IIQB 4TUKL 1G7IA 5I71C 3ARDA 3SDCA 4F57H 4AIOA 1J87A 5C1MB 5BZWA 2YMXL 4RSVA 3F7VA 3WE6A 4Z6AT 3ULVE 1KCUL 3FO0H 5I1KH 4ZUSA 5GGVY 5DD3L 3X14A 4F9PC 5EU6D 2ZOKA 4LSDA 4H8WL 2E6PA 2FX9L 1U95B 3CPLA 5DZNA 3L3HA 1RD6A 3EO0A 3PL6D 3WLBB 3MREA 4UU9B 2OTPA 4JKKA 4PLJC 4NJAH 2FYYA 2EDEA 1ZHNA 3C5JB 4NNYA 2NXZC 2BP3A 1E0OB 2J12B 4RMQA 3DGGB 3T77B 5I66B 5K9QG 4YDJB 3FOMB 2P43B 4K71B 4DEPB 3MLTA 1OCWL 2EH7L 5IF0A 1OARH 2NY5L 4ZUWB 5IFAL 4L3EA 4MJ6B 3VCLB 5HYFA 4S1SH 5D1XA 2VDQL 1N0XH 2L7JA 3CZFA 3PDDA 2R0KH 5GGUB 3T65B 1JNJA 4JZNA 4C58B 2NX5D 1JGEA 3VXRE 4JRXD 5FGCB 1SY6L 1E6OL 2AXGB 4G6JL 4CMHC 1ZGLP 3HNVH 5F3HA 3MRGA 1S7WB 1J0IA 4OD2A 4GG6F 3GBMH 1WAAF 4OD1H 5F72S 1M6OB 4JG1H 5DQ9A 4Z7WB 4OQTL 3GSNH 2B4CC 1IGMH 4ALAH 3O41B 3FQNA 3QFJD 1KOAA 3ULUE 2R56L 5IESL 2BFVH 3IJHA 4NWTL 4WHYG 4PJGF 3WBDA 4NPYB 1VESA 2E9IA 2ITCA 3IXAB 1AFVH 2C3GA 3KNBB 5J3HC 1KCVL 1EDQA 4P4KC 1LO3L 4BKLA 4WW1B 4QOKD 5KZCB 5DMIL 1TCRB 4PRBA 3D3VA 1LDSA 3TJHD 4A6YB 5C7XL 4WU7B 1CCZA 4I0PD 2UZYB 2XQBL 5I1AA 1HXYA 4K2UH 3G5ZA 4YHYB 1MI5D 3GMLA 5DD3H 4OD3L 1X5IA 3AS0A 4RGNC 3FRUB 1FPTL 2OZ4H 1T22B 4JFDA 1NFKA 5EU4A 5AD0A 5JIIA 1BQLL 2F8XC 2OTUB 3VGAC 5GSRB 1P9MC 3QB7C 4XMLH 3SE8H 2GY7B 1PG7L 3GSWB 1J05A 3MRQB 3GSNA 3VFRA 3ARFC 1P5UA 1T7YA 1RUML 4JGMA 1OCWH 4NO0D 4CRPA 4EN3B 3GI8L 1CLCA 3GSUB 1RK0B 2BSSB 3MLSH 2VYRE 4XCYA 3AMKA 1P4BH 5ADOL 5D7LD 1OAZH 3HG1B 5IFAH 1KCRH 1GL4B 2BRQA 2GHWB 4J3UA 4YQXH 1EJOL 4UTAH 4HKXB 1FAKT 1T66D 4W6YB 4RFEB 7FABL 5E6IB 1TNMA 3W9DB 2CXKA 1WGOA 4LBEA 5IVZA 1CICA 1E6OH 4G6JH 2ZP0T 4RCAA 4QXWA 5DD0L 3QCVH 1CE6B 1NCBL 2Z8VC 3EO9H 3TA3B 5IWLA 2KDGA 3RZWA 4XNXH 1OGTB 2ZUVA 5FA4A 5GGRB 2B8OT 5I16A 4YXHH 4RDQG 4JFFA 3U1SL 4OZ4A 3C6LA 4RMSA 2PYED 1KGCE 5L2JB 1JNNL 2HMIC 1U8QB 3GZKA 5HHOA 2ICEA 2PETA 4LLDB 4MD5A 5EN2A 5E56A 1BX2B 3SCMC 2C7UB 2P48B 5DRNA 1CGWA 4P9MH 1DBBH 3GMMB 4P2OA 4YIQB 4YK4B 5TPWH 1JBJA 3IAQA 3K80A 4E5XB 1KN4L 1KCVH 1F4XL 3UTPD 1W0WA 4ZS6C 4XZUA 5E5MB 2C1PA 4M7LL 4QRPE 2DYPD 2HLAB 2PYFA 3QDMA 3LQZA 3P77A 2VLKD 2DTMH 2XQBH 1MCQA 1NPUA 2EKSB 4LCUA 4PJFB 4O5LH 2Q8BH 5C2BL 1QQDB 5CEXA 3FB5A 3CK0L 1FSKC 4IOFC 3RNQA 1F3DH 1A9BA 3M8OL 1FNLA 3WKMH 43CAB 4M6NH 1ORQB 3PWLA 3GO1L 5I17A 1ZT4A 3VW3L 4MNGA 3UCRA 2BERA 3HI1B 5DD5L 5EIQA 2B1AH 4BQ8A 1BZ7B 4JDZB 1U8IB 3UZQA 3SHSA 3FO1A 2J88H 4FQHA 4J8RA 3U6RB 1I9EA 2V2TA 3HE6A 2NY1D 4HLZG 3QDAA 3QHFL 3O3UN 1QLRA 4KV5F 3HAEB 1EHLH 4PRPA 5KSAB 5ADOH 1G9EA 3OAZK 5HI4C 3SDYL 3VFGH 4ZS7L 1B4JH 3RX8A 1S9VB 2AJVL 4JZJA 1GOHA 1RIHH 2X4SA 5HYJE 4U49A 5L0QB 4JY4A 3KS0J 3MCKA 5A16A 2AKRB 3B9DA 4U6YA 5SX4H 2ATKA 1OB1B 4LVHC 5DYOB 5DFTA 4LHUG 3U7YL 5KANG 1MQKH 2V2XA 4B41A 1C12B 5BXFA 3ZYOA 4N0UE 5JUEL 5CJBA 4PP2A 4ZQKB 2XZCL 4Y8AA 4U1SA 1GGTA 2BVQA 4KKLD 4EXPX 3QUYA 4Z76A 2X4PA 1ZLVH 3T1WA 4P2RA 1RI8A 1AGDA 1S78C 3CDCA 1I1YA 5D2NC 5HSFA 2CR3A 4J4PD 2X89D 2ITDA 1XF2B 1KTDB 1UCTA 2CQVA 3MLZL 4L29B 1P2CA 3IGAB 4WV1A 3UMTA 3HFMH 3QO1A 1FL5B 2FRGP 2D03L 4LGSB 2A0LD 5K33A 3QDJA 4M7LH 32C2A 3HS0B 4MD4A 5CGTA 1D9KB 4ZSOE 4WHYH 4EXKA 2H32H 1R6VA 1ETZB 1AE6L 3PP3K 5C2BH 3VFTA 4Q9QH 4TQEL 4WO4C 5IB4A 2M8XA 1EK3A 2I27N 4MYWB 2DOCA 4DCQB 1EEYB 3FQWA 3M8OH 2J8UA 3ZZ1A 3BPOC 3VW3H 4LFHG 1H8NA 4OLWH 4LDEB 4JKMA 2D7NA 1PAMA 2XTLA 1HILB 1RU9L 4OZGA 4XHJD 4ERSH 4MAUL 3RIFK 2F74A 3TNNB 3CCHB 3QQ9D 2WANA 4U6VL 2EO9A 2PF6A 2PW1A 1YNKH 3ARDC 1K4DA 3SDCC 4YHLL 2DLIA 2RCSL 3K8MA 4MD0B 3V6FA 3IDIB 2APBA 1CFNB 3QZWG 1A5FH 4ODHL 4KK6D 3U0PB 1D7FA 3D69A 4ZUTA 5IHZA 1IAIM 1IGIL 1QO3A 1JGDA 2L4OA 4BK5A 5ID0B 3BUTA 3OHXB 5EZOL 2Q1EA 2NW2B 3OAYH 4HWNA 1OWRM 4NIKB 3QUML 4P57A 4L8CA 2E7CA 2BRRL 3PIQA 2C3VB 2H32A 1A6VH 4ELMA 1QYGH 1LK2B 4OZIA 1AGFB 3KLSA 1U42A 5FYKE 3B9KB 2ED7A 3SKNA 4X4ME 3V4PL 1MHPL 4BA8A 1CFTA 4QCIA 1MCNA 3AVEA 5D1XC 2I07B 4DW2H 4NBXB 5K59F 4N5ED 5HI3D 4TSBH 3O6KL 5C07D 3RA7L 5KJRL 5KN5A 2E6JA 4X5XA 5LBSL 4JLRB 3H8NA 1F4AA 2D03H 5DJ0B 4ESKA 4XNUL 3O2VH 4YHIB 1W8NA 3BH8A 3BVNA 2NXYD 5D72L 3OKEB 4I3SH 3ULSB 4JVWA 2DAVA 3CFIC 4J3WA 1KLGA 3VRJA 2A1WL 4GMTH 5DJAB 3RNKA 4FMFA 3RWGA 4LIQE 5C9JA 5GISL 1MJ7H 3E6HA 3S7GA 1CDUA 1L7IL 5C08D 5I75C 1F13A 4PJ7E 3LS4L 4MAUH 2WBJA 3SJVE 1J8HA 2Q3AA 2ERJC 2R1XA 2Z92B 1MCCA 3OJDB 3O6FA 1GCFA 4I2XE 4GG6B 2M2DA 3MGTA 4GW4B 4JKWA 4V1DA 3QWQB 4YHLH 4JJHA 2BC4A 4GLRH 1OWWA 4KTEL 2EE3A 1EFXA 3WD5L 1MVUB 3IJSB 3MUJA 3MBED 3D25B 4PY8J 5CJ5A 5EU5B 3RWFB 5EU6B 1K5NA 1MEXH 4D2NA 4HLZH 3CDGB 4PLKD 2CK2A 1IKNA 1NFIB 4ZNEA 2AK4D 5I15H 4QYOA 5JW5B 4L8BB 4I3RL 4PJGB 1K2DB 3PL6B 4NQUA 3S36X 3IVKB 1W72B 2BRRH 2NY7L 4TVPH 5JLZB 3P4NB 3N9GL 4R0LB 3HMXH 5TQ0H 4XRCA 1T1XA 3QNXA 1N59A 3VMNA 1J18A 3WS3A 4UILL 3QQ3A 1J1XL 1RJYA 3NCMA 3OGOE 2FBOJ 2YPKB 1GZQA 3NZ8A 5CEZE 5HHQB 2GITA 3CUPB 3IXTB 3P11L 1JPTL 2Q7YB 1AI1L 5I8CA 2VLLA 3ARTA 3KLHC 5JOPE 2HKFH 1N5AA 2VR4A 3ULVD 4K7PL 4D9RE 5MENA 5I8EB 1CICC 1NGWA 4HMDA 2NX5B 1MFDL 5FF6B 3LAFA 1XF5A 3AAZA 1CD0A 4MNQE 3L6FA 1KT2B 2KKQA 4XNUH 1BFOA 2CSPA 2HT3D 1K8DB 1A1OB 3QIWA 4HS3A 4P3WA 3UAJD 5CMAB 5DF0A 3C6LC 4TUJB 1NGZA 5IR1A 2V7NB 3BIKA 5GGQL 3QFJB 1R5WA 1R24A 3UPCA 1WJ3A 5IEHB 1CL7L 1L7IH 3NFPB 2FL5A 1IC7L 1KJ2L 1NDMB 3I50L 1A1MB 3HMXA 4FQXD 2VDNL 2EE6A 3VWKA 4MA7L 4P2OC 4D0DB 1DBJH 1VENA 3U0TB 4E42B 3L1OL 4B0MM 1KBGH 3C60A 4XWGH 3VXRD 2PTTA 4HKJB 4QOKB 3VD5A 5FB8A 3FB7A 3QWOA 2AEIT 4JHWH 4KTEH 4NUGL 1CG9B 4I0PB 3M45A 3RIAK 4NZRH 2FJHA 3L95B 1IZJA 1MI5B 5CGYC 3DX7B 1TPXB 5C86A 3GJEA 4KK9D 1GPOL 1U8JA 4GBXC 4Z7VA 2J4WH 5C0GA 4Q0XL 4HKZA 3ULVF 4I3RH 3UTZA 3VFNB 2IALA 3ULUD 1WISA 2BHYA 3KYOB 3L7FB 5B8CA 2ATPA 3PP4H 5GS0D 3HE6C 2EYTA 4LAQL 1Q9LB 2NMSA 2R1YA 4KQ3H 1U3JA 5I2IA 3EOAB 4UILH 4NO0B 1JZ2A 2XXCB 5D1QC 2W59A 2SEBA 1NGQL 3KPOA 4JKPL 3Q1SL 5CZXC 3CDFA 5I74C 3P11H 1B0WA 2EIEA 4HUUA 5TDNA 4XX1E 5F88A 3U0WL 2C4XA 5D7LB 3VXPA 1KEMH 5ETUB 5DVOA 2H2PD 3RZCC 1QSEE 3HC4H 4K7PH 2Q20A 2NZIA 3UTTA 3GI9L 4Q6IC 3DX9B 2JIXA 3JTTA 4UNVA 2CDFB 1JF1A 3HUJA 4YR6B 5TDOB 3RVXC 3EYVA 1DBKL 4CL7A 4HFWB 3GSVB 1YECH 3RWEA 1P7KA 2H8PB 2XRAL 1IZKA 1Z0NA 1AO7E 1X5HA 4P2QD 3QUYC 2ORBL 5IB1B 5GGQH 4C55A 2J1KA 2PYEB 1VADB 3BGMA 2MTPA 3HZMA 1WTGT 4JM2A 3GSXB 2XA3A 1E6JL 4KDWA 5CJXA 3QZWA 2X4RB 4K07A 3TYFB 1T1ZA 2VDNH 2DWDA 3W82A 5EBWB 4JREB 4N90E 5EC1B 4WV1C 2VDRL 4ZPVA 3BP7A 2W9EH 1T21A 5J56B 2IH3A 3U4EB 1F5WA 4GH7B 3WJLA 3S3PA 4KK5C 5KG9A 2DYPB 2DLGA 1XR9B 2VLKB 3KPLB 1BWMA 2X05A 1I3UA 2H26B 2P47B 1LE9A 2G9HA 2VQ1B 3AXLB 5FGSA 3DV4A 4FHBD 5FO8B 1ZGLM 3WIFB 2OI9B 2V5SA 4QY8B 4CU7A 5IB5A 1MSPA 1JWUA 1KGCD 1ITBB 1JF5A 1NBQA 3W2DL 3GHEH 4P4RA 3IFNH 4HV8A 4HBQA 5EO1A 4OV5A 3P9LA 5JMRA 3DUUA 4GAGL 3V8CA 2NLJB 4HKBB 1RZIA 1F11A 4RAHA 3BP4A 2NY1B 1B88A 5JXED 1FGVH 3L3KB 2ZKHL 4KKNA 5IROA 1S9WB 1WBXB 1QLEL 3FONB 5ACMA 3DBXA 5C3TA 1LHZA 4LARH 5DTFB 4P5MB 3ZTNL 5DVLA 1QRNA 4QRPD 1JRHL 5DWUL 1RZ8A 1GC1L 4TUOB 2VE6A 5KS9A 3GMOB 3SOBH 3PJSA 2EYRB 4HH9A 4ZDHB 2CDEB 3GKWL 3GI9H 5SWSA 3G04A 1UVQB 3IS0X 1QVOB 5ESVA 3WUWB 3VGFA 4LVEA 1NDGA 3DWTA 3W0WE 2AJ3A 4FQ2L 5IB2B 1DBKH 2BSTB 1UT9A 4WRLA 4ZODA 3MX0A 2XRAH 4NBYB 4U6HA 5A3ID 3EZJB 4Q6YA 2IF7A 5ANMA 5F7LB 2H3NA 3BN9C 2VDLL 1Z0MA 5FYJU 3MLWL 2Z4QB 1H15A 3VFMA 4RGNE 1CGYA 5A1AA 3MO1B 2WZPD 2Z0BA 1TZIA 4XPBL 1MELA 1FIGH 3OKNA 1REIA 3EYQD 4YX2H 5I6XC 4S1DC 5K9JH 5FGRA 1YEGH 5HYJD 3TT3L 1Q1JL 2ZUQB 5IJKA 4OFYA 3BQUA 3KHOA 3KPPA 1A6PA 3N0PB 4PP1D 4OIIL 1H5BA 1WEJH 4MQXD 4MLIA 3TBYB 3BZ4B 4GXVL 5ICZB 1JZ4A 4RNRA 5EU3B 2FJGA 3FT4B 1FFNA 1V7NL 1V8HA 3NACL 4GAYA 3BW9B 4IIQA 4DVBB 4ZOBA 1CK0L 2X10A 5DUBB 3IU3B 5HBBA 5C92A 3DOSA 4XCFH 1T89A 4YEFA 3RU8L 4GAGH 2ENSA 2HKHL 3WLBA 2ZNWA 3O6FC 4Y5YB 4D94A 3OQ3B 4UU9A 3O9WD 5I73B 3CX5J 1QLEH 2VJXA 3C5JA 3F7PC 3VH8G 1A7QL 3DGGA 3T77A 5I66A 3FOMA 5D5ME 4YPGB 1CIUA 2Y9RT 12E8L 1CGSL 1IKNC 1Q9WB 4KMQA 4ZUWA 1DR9A 2H45A 4MJ6A 2OMNA 3VCLA 2FECI 1HHIB 3WSQL 4X9BA 5GGUA 5GHWH 3CDYA 3T65A 2DD8H 4NRXB 4OLVL 3DRTB 5BRZE 2AXGA 1DFBH 4LVNC 5DS8B 2XZQH 5J57B 2DQDH 1S7WA 2D7TH 2VDLH 5TE7H 3MLWH 2B2XL 2VERN 3MBXH 1M6OA 4Z7WA 2LTQC 5C9KA 4XPBH 3TZVD 4TRPL 1UKSA 3ARED 4FQ1L 2Z93B 4FXGB 4DQOL 3QI9D 5C07B 2DQCL 3TT3H 4HK0B 1A7PL 3VMOA 2EDDA 1X6LA 2FIKB 4NPYA 2PKDA 5GGTH 3QIWC 1P7HL 3IXAA 3CFBA 3KNBA 4O02L 2NXYB 5K9OB 3AS3A 3MV11 4WW1A 3NACH 1MREL 2UVFA 4XNZB 1TCRA 3VDCA 4A6YA 3LV3B 4WU7A 3RVTD 3QNZB 1DSFH 1KSRA 3QUXD 5C08B 3STBA 5ITBL 5L88L 2D0FA 3FRUA 5HVHC 1T22A 1RUAL 2PN5A 1YYLL 2HKHH 2OTUA 3C60C 5IP4A 4P5KB 4Q7DA 5GSRA 5C09E 4XPAH 5A2FA 1RIVH 5EB9A 3ZLQC 1HYSD 5E5UB 3LSOB 3MRQA 1A7QH 4X7TB 3MBEB 4EN3A 12E8H 3GSUA 1RK0A 4QEGA 1CGSH 3WXVH 1V7ML 2BSSA 3EDDA 3G5XB 3WUZA 4U05A 3KWWB 4JFEE 4U7SA 2PXYD 1JNHA 3HI6H 2AK4B 5DQJB 5ACZB 3HG1A 3VI4E 1DLFL 2OR7A 4KZDL 5B8CC 3ALPA 2FEDD 4UAOC 4HKXA 5T33H 4M61B 1BF2A 4RFEA 1OTSC 5E6IA 3W9DA 3MJ8B 5JW4R 3DVNB 1FL6B 1H3VA 5CILL 3MZGB 3TN0D 3SJVD 4NRYB 4ZOEA 5EOCH 1CE6A 4KI1A 3TA3A 2B2XH 4K23H 5FDWB 3ELAT 2R0WH 1RHFA 4PJ5D 5JA8B 1OGTA 1X7QB 5GGRA 4PGEB 5F9AC 2EDYA 5L2JA 2WNGA 2FHBA 2N7AA 1U8QA 5L7XL 4LLDA 3HAEH 2DQCH 4GUPB 2CMRH 2GEEA 1BX2A 5CJQH 1QOKA 2EDRA 2C7UA 3ARBD 5FO7B 2IANE 1B3JA 5A2KH 4UT7L 1A3LL 4RISH 4DTGH 3GMMA 3FQUB 3OF6A 2KH2B 3O0RH 4YIQA 2YUVA 4JVPA 4O02H 2A77L 3NIDF 4E5XA 2IADB 1JP5A 4OZFB 4P5TC 5IMLB 3JV0A 5E5MA 1BQHB 1T5WB 3DRQB 3RKDC 2HLAA 2WUBH 2EKSA 1MCOL 4JM2C 1YPZF 1A7OL 4PJFA 5CEZD 2DI8A 1I1CA 1QQDA 4ONGH 4G3YH 3B6SB 1UWXK 1FFRA 5LWYH 1M71B 5ITBH 3HKFA 1CF8H 1OAXH 4M93C 3OB0H 5L88H 4FQXB 3KYNB 1J7VR 5JOPD 43CAA 2CPCA 1ORQA 3WJLC 1RZ7H 4D9RD 1VGEL 2J6EL 2OS7A 2EDQA 5D8JH 1ZHLB 3HI1A 3VXRB 2W0LA 4PJ7F 3IRPX 1BZ7A 4JDZA 1U8IA 2VOTA 3U6RA 4MNQD 1PEWA 3CFJB 3I3DA 4M8QB 4PGDB 1PKOA 4YBHA 3OKLB 1AC6A 3UTSE 3G6DL 1A7NL 1TQBC 3JV5A 1V7MH 3SE3C 3HAEA 3GDBA 1A7RL 2O26U 1DLFH 3E2HC 4L9LB 3T3MF 4KKAD 4HC1L 3S35H 1S9VA 1JE6A 4M7JL 5ID1B 1YJDL 3D9AL 1HINL 4XPHH 2D7OA 4P3DA 2AKRA 1P4IL 5CILH 2A6JB 5IROC 1SEQL 2QV2A 4OIAA 1OB1A 3IRZA 5DYOA 2V5MA 1TETL 1CYGA 2IQAB 3N1GC 1C12A 1Z3GL 2O5YL 3KJ6H 3Q2CA 1RAMA 4P99A 5DD1L 4PTUB 1FNGB 3EJZD 1N6VA 5DR5H 5DJZB 4DFHA 4P9HL 1Z9LA 4KRNA 1U8MB 3DETC 2AW2A 1XF2A 1KTDA 3BPNC 5C0BE 3K7UA 4KUCD 1A3LH 4L29A 4LLYB 5DUML 1G6RH 3IGAA 4LSVL 3GRWL 2HT4D 1FL5A 1AQDB 5ADPH 1AXTL 4R97C 2VDOH 5F7FA 1D9KA 4P2QB 3QH3B 1ETZA 4G9FE 4L4JA 4YDKL 5GRUL 1OLZA 2W9LA 2Y7QB 2MWCA 2X4TB 5DEFB 2FO4B 1OAYH 4G6MH 4DCQA 4RMVA 1EEYA 4NN7C 4DN3L 5EZLB 1QSED 1VGEH 5KW9L 3BQUC 3OMZA 2EIZB 1HILA 1S7UB 1R3LB 1H5BC 1QBML 4CKVX 1Q9OB 3RGVC 1B0RB 4N8VG 2AJZB 3BP6B 3CCHA 3TNNA 3IDNB 4EUPG 5CP7B 2VC2L 3CLFH 1ONQB 2C3HA 2WMPA 1VPOH 4XHQA 4MD0A 1AO7D 3IDIA 1A7RH 4RFOL 5I1LB 4DKEL 1CFNA 3U0PA 3WNLA 1NAMB 2BDNL 1T89C 5DMGC 5ID0A 3OHXA 1YJDH 4M7ZB 2NW2A 4AYFA 3AC0A 4MA8L 1OP5K 2VLJD 2ZPKH 4KUCF 4OCSH 4N90D 4JCMA 4Z7UE 3S96B 3U48A 1JGUL 2C3VA 3S4SA 1SEBB 5T3ZH 1LK2A 1Z9MA 4ZFFB 4DEPC 4K71C 2XG5A 1AGFA 1INQB 1PG7W 2KZ1B 2O5YH 4LLVB 4QRPB 4K3HA 4AM0B 2OSLB 4WTZG 4PD4J 3B9KA 4IRZL 4MQSB 1RSFA 5DJ6B 3V0WL 1M05B 2K7QA 3OBAA 2DDQL 4G6FD 4KTDL 2I07A 1JCKA 5HHVH 3MTRA 5L9DH 1JMXA 1U41A 3ARSA 4HGMA 4PJAE 1KPRB 2BOCB 3QDME 4JLRA 5E2WH 5E0QA 3TESA 3NBNA 2JJTA 1KIQB 3ZSTA 3K3QA 5DJ0A 1AXTH 5D1ZD 5J89A 5LGJB 1W72H 4YHIA 1Q9KB 4JO3H 4V2CB 5GRUH 3OKEA 4LLWB 1MCJA 3LZFL 3ULSA 4OAWB 4Z0XB 3TP4A 4F7CB 5DJAA 3VXUE 3WUWG 1EZVY 1R3IL 3NN8B 1TXKA 4PRNB 4ZAKD 1JFQL 5KTEH 1PVHA 5HYJB 1DLHB 1YNTB 2M26A 4AENB 3W0WD 4P4KD 3LEVH 4PRPE 2B1HL 1ZE3C 2H1PH 2Z92A 1OLLA 3OJDA 5AAMA 4EI5A 5C0FB 3BXNB 4GG6A 1IQDB 4GW4A 3K4ZA 1WAAA 5I8OH 4NQEE 4F33B 5CBEB 4YHYC 1FLRH 1MVUA 3IJSA 1QA9B 3D25A 5I19L 5EU5A 3RWFA 4RGND 3KR3L 5EU6A 4UB0H 3ZDXE 3CDGA 1NFIA 2FX7L 3DUSB 5JW5A 1XF4B 4L8BA 4R2GD 3AGVA 4HMCA 4PJGA 1K2DA 3PL6A 5J13B 4M5ZH 2DM2A 3IVKA 3O9WB 2J5LB 1CT8B 3UYRH 1C08B 1W72A 1V5JA 5BW7A 3P4NA 3OR6B 4R0LA 2CUIA 3ARFD 5A2LH 3QEGH 4NO5B 3JV4B 4N0CD 4EN3C 4P2RE 1WFOA 5IB3B 4ZSOB 1L0YA 1CBVH 2YPKA 5HHQA 2DJ4A 5FM5M 1BF8A 3CUPA 3IXTA 1HZHL 2DDQH 2Q7YA 2A9NL 2P24B 4YXLH 3CXDH 4KVNH 4MQ7B 1A21A 4ODVL 4S1RL 3SQBA 5E6IC 2FLBT 3B2VH 5BVJB 5I8EA 1CR9H 5GZND 2NX5A 2NYYC 2O93L 4JRXA 1QFHA 5FF6A 4NC2B 4XPGL 2I60L 4XC3H 1KT2A 3TA3C 2P42B 3DSFH 1ZANL 5DZOA 1K8DA 4JFPB 5ALBH 1A1OA 1J1PL 3N1PC 2N7BA 4H20H 3LZFH 4LRNH 5CMAA 5C0RL 4TUJA 1TLKA 3TZVB 2WP3O 3B8SA 3D0VB 3CXHJ 4JFZH 2V7NA 1R3IH 4HT1L 3QFJA 5GJSL 4OZGE 3TIDB 2KUTA 3QI9B 5KBNC 1E4XI 5IEHA 5IHUL 5DZLA 2FO1A 3BKCH 4GRMB 3NFPA 1NDMA 1A1MA 3BPCB 1XEDA 4FRWA 4YK4C 4D0DA 3WCYA 2AXHA 3U0TA 4E42A 4ZS6D 3O6ML 4G6AD 4WCYH 4NCDA 3U4AA 1HSBB 2AEQH 5BRZD 3OWEA 4HKJA 1FYHB 3UO1L 4QOKA 3VMPA 1PKQE 3R0NA 1FORH 2A6IB 1CG9A 4I0PA 4DZBB 4S0TD 4NZTL 3L95A 1MI5A 1B2WH 3DX7A 3QUXB 5FXCH 5C2UB 1LO2L 3SO3B 4B7IA 4JB9L 5D6CB 2F5AL 3HMWH 5E2TL 1TMCB 5CIPH 4UDTB 4J3XA 3VFNA 4O9HH 2DF3A 4HBCH 3ZKNC 3KYOA 3L7FA 1L0QA 2VTFA 5JORB 4X6CF 4LNVA 1ZSDB 3SGDH 1X5YA 1TNNA 3EOAA 3QFDB 3BWAB 2VXUH 4NO0A 4K7FB 4F37F 3D2UD 4OF8A 4OSUL 5KSAC 2ZOLB 1YPZB 3TJEH 5IBUG 1HZHH 1FFQA 4Z78B 2PXYB 5E94B 3SGKC 2E3VA 5HI4D 5HD8D 1MRCL 5D7LA 1NMBL 5JIKA 3T2PA 5ETUA 5EUKB 3LQAL 4ZUVB 5L0QC 4S2SB 5KSBE 4BFEA 3MLUH 3IU4L 1Q72H 2NY3D 1P69B 3DX9A 5DD6B 2CDFA 4XPGH 4M1DL 4PJ7B 4QHNB 4YR6A 3TN0B 3SJVB 3BKJH 5TDOA 2YRLA 5C09D 3DYOA 1HEZB 2APWA 4JO4L 3GSVA 2P8PB 2I5YL 1I4FB 5F21B 2H8PA 4PJ5B 3AUVA 4IOIB 4OLYL 3PGFH 1R0AH 3T8XB 1LWRA 5IB1A 3NZHL 2PYEA 2AAVA 2ZCHH 1VADA 1S78D 4POZD 1BHGA 3FQXB 1UEMA 1JGLL 3FB6B 5EPMB 5TDPB 4JFED 5DGQA 3GSXA 2EZ0C 3BRFA 2X4RA 3TYFA 3ARBB 5LVEA 3RI5K 5EBWA 1O7SA 4FG6C 5EC1A 4EKXA 5HHME 1IAIL 4X83A 3FKUS 3U4EA 1RUQL 4ETYA 5TE4L 3TLRA 1D9KC 3EYFB 5L8KB 4KXZH 4NQDE 3UO1H 2QADD 2DYPA 1XGUB 1XR9A 3GMPB 4IRJD 2VLKA 3KPQB 3KPLA 2C4FT 3BYYA 4JQVA 1VFAB 2H26A 2VQ1A 4NM4H 4LRIA 3EFFB 3AXLA 3L3GB 5FO8A 3WIFA 3NH7L 5ICYB 4QY8A 3MLYL 2YUZA 4M00A 1A3RH 1QPXA 4YGVB 1EIBA 3H0TB 3F58L 2NLJA 4HKBA 2IAND 4MNQB 3INUH 1C1EL 3IDXL 5ESAB 4XPTL 3L3KA 1S9WA 1WBXA 3FONA 4R4NC 3TT1H 1PQZB 5DTFA 5IFJB 3ZO0A 4P5MA 4KI5E 2E9JA 1O7VA 1NMBH 3OJ2C 4TUOA 3GMOA 5HYIA 4U4BA 3LQAH 2EYRA 4RMUA 4ZDHA 2CDEA 3IU4H 1NCNA 1UVQA 4M6OL 4PJEE 1QVOA 2XN9E 3WUWA 5KVDH 2LAAA 4M1DH 4XP1H 2HRPL 2W60B 3BDYL 3MOQA 3VI3E 4NUJB 6FABL 5IB2A 1TDQA 1XGRB 4R7NB 5J9PB 4JO4H 4QF1B 5B4MC 1LO4L 2BSTA 2VDPH 1RZJH 3QHZL 3B9KC 4MDJB 4OLYH 2DQHL 2A73B 2ZSVB 4XBGB 3MFGB 5T5NF 2EDFA 3UTSD 2Z4QA 5J8OA 2XQYG 4NFCA 1FGNH 43C9B 4Z95H 3MO1A 4FFZH 4W81A 5BQ7B 1FNSL 4J4PA 2X89A 3DX6B 3RJQB 2JJTC 3RL2B 4BK4A 5TH2B 2VIRB 5E7BA 1I9IH 3MODL 2BOBB 3HNSL 3WL9B 1W2KT 5BVPH 4UDUB 3TBYA 1A6AB 3BZ4A 1CD9B 5ICZA 4Z7VE 3O11B 5DC9B 5EU3A 2VXQH 4RMTA 4LF3B 3FT4A 4DVBA 3BW9A 4LGRB 2DQEL 4OF5A 5DUBA 3GIVB 1QSEB 3IU3A 4DGVL 3QHTC 1DQJB 1NAKL 2CGRL 5F1SA 5GIRB 5D70L 1FIEA 3F58H 2PW2B 3BGFB 2JB6B 1C1EH 4Y5YA 5C0BD 1H3PH 3KPSE 1X3DA 5J12C 1KB5B 3JBG7 1AO7B 3H42L 5IVNA 2EH8H 1N8ZB 4YPGA 4UT6H 2WUCH 5FOBB 2AABH 3F8UB 5HYSB 4TOYL 4G9FD 2V9RA 1EO8L 1OP3H 2IPKB 3GJFH 1Q9WA 4XP9L 4XVJL 1UACH 1R3JB 1HHKB 5H8DA 4E41E 4FP8L 3PL6C 2AGJL 1CFVL 2WBKA 3C8KB 4KGLA 2VLJB 4PBVC 3TV3L 4CMMB 5I30L 4XAWH 2BHZA 5T3XL 1YC7A 3HNTL 4AEIH 6FABH 4R0LC 1P84J 1HHIA 2ZJSL 4WUUE 3RWHB 4FNLL 4NRXA 3DRTA 1VFBB 1XMWA 3EUUA 5DS8A 3Q6FB 3L3OB 4HAFA 4MXQC 2DQHH 4YWGH 1MVFA 1IGYB 4J12A 5DMJB 4NP4H 4G6FB 4G6KL 4L9DA 4XNMB 4ODUB 2D2OA 2JELL 1FNSH 3CD4A 1Y6MR 5GRJL 1IAMA 3FQRB 2Z93A 4FXGA 3BSZH 5C07A 2HFEB 2BCKB 1OTTC 5F7MC 4HK0A 1D5MB 2DM4A 3MODH 4BELD 2NY4C 4ODSL 5D1ZB 5EULV 4PY7B 2FIKA 3OAUL 1ZEAL 3PQYE 4M6AA 3KXFE 3TWCH 3MCLL 4H0IA 4FQJL 3C6LD 5K9OA 5CP3H 1SMAA 1L9MA 3BAEH 5IBTH 2HP4A 3BHBB 3LV3A 3QNZA 4OF6A 3JWDL 1G7JB 4ZAKB 4Y19E 4J3VA 4DGVH 4G80B 5C08A 4Q9BA 1NAKH 2CGRH 4ZFOB 3LRGA 5JMOC 1L6XA 2X5PA 3W0WB 5E8NB 1QRNE 4JO2L 1F2QA 4P4KB 1MJUL 5FCUL 1Y0LB 4P5KA 3RPKA 3SDDD 3C09C 1FH5L 3Q3GB 3R1GH 3MXWL 1KENH 2FB4L 5KS9E 2DTSA 3LSOA 3H42H 4X7TA 1P7QD 3LKOB 4X7DC 5CGYD 3UEZA 1D5BB 3I6GB 1TPXC 5FYJH 3ZL4L 5EZIL 3MBEA 3NIFF 5CWSB 4RGNB 5D7KE 2BVYA 1QBAA 2I26N 1CU4L 4GBXD 1IFHH 4XGZB 3G5XA 3ZYIA 1X5KA 3KWWA 3X11B 1IGFL 4DK6A 1QFWM 3T4AB 2AK4A 3VGAB 3ORJA 5DQJA 4R2GB 5ACZA 3VXUD 5BOPA 2EYSA 2IG2H 3OZ9H 3HNTH 3DI2B 4M61A 5F9JB 1PZ5B 1JUFB 1LO0L 3ARFB 3DVNA 4PS4H 1FL6A 2XIDA 2F5BL 5D1QD 1KJ3L 3T0WA 2HFFB 4RBPK 4NRYA 4LSPH 5CZXD 3D39B 4FQIH 2A83B 5FDWA 4KKCD 4NQED 4P2CG 4G6KH 2LFGA 1X7QA 3MV9B 3RZCD 2BXZA 4NQXB 3NCEB 4YE4H 4PGEA 1T66C 2DJSA 1F42A 1FZOB 2YRZA 3S3SA 4GUPA 3RWJB 1J11A 3WS6A 4Y88A 1EAJA 1WT5C 5FO7A 1VB9A 4HXBL 3TVMD 4Y2OA 3FQUA 1BBDH 1G9ML 5KVEL 1ADQH 5GS0H 2IADA 5CJOL 25C8L 4KUZH 4OZFA 1AQKL 2AI0H 1PBYA 5IMLA 5GSVB 4LDLB 1BQHA 1T5WA 3DRQA 5DK3A 5D5MB 4DN4H 3NA9L 4X80H 3IB4A 3GHBH 4NO3B 1HE7A 1G7PB 3B6SA 5JW4Q 3MV01 1M71A 3E8UL 4NQCE 4FQXA 3KYNA 4WI2A 4X6DE 5FCUH 4A6YL 1I1AD 1ZHLA 1FH5H 3VXRA 5BRZB 4WVRA 2UWEF 3MOAL 4OCXL 1Z9SA 1NANH 3CFJA 2XWTB 4M8QA 4JQVC 4PGDA 4HG4K 1X4ZA 3OKLA 4LRIC 5FUCC 2QL1A 2JB5L 5K9QI 1F4YL 4POUB 4JFYB 2OI9C 1UFUA 4YHZL 2E9WA 4JN1L 3TPUB 4ZTOH 5IW1B 1S7XB 4L9LA 5FGCE 5SV3A 1NSNL 5SX4I 2HJKB 1HHHB 3CVIH 1IT9L 3JXAA 5ITFB 2HA1A 5ID1A 1WZ1L 2XXMB 1ADQA 1MOEA 1MFEL 2NY1C 4D0BA 3G5VB 2WBWB 1KFAH 3BKML 3UZVB 2A6JA 4LOUD 5ENWB 4U7MA 3N1FC 5I1CL 3D2UB 3MJ7B 5I8KL 1YNLL 1A14H 2IQAA 1JYWA 4GAJL 2IAMC 3W81A 4XXDB 5C6PB 4GSDL 4PTUA 2Y23A 2QQLH 1A3QA 1LO5A 1TZHB 4XVSL 1FNGA 4PJBE 3V4UL 2FZ3B 2ADFH 3DIFB 3QPXL 5DJZA 1ZT7B 2EDHA 4MA3B 2NY3B 4OGXH 4TSCH 1XGQB 3GGWB 5EWIH 1NGXB 1U8MA 2AERT 4LVHB 3QRGH 2GSIA 5B22A 1MCWM 1WBYB 5C09B 3F62A 4LLYA 4MXWL 2WAHA 3KHQA 1V05A 5CJOH 1MCDA 4KWUA 1AQDA 4RRPA 1CDCA 4P2QA 3QH3A 1UH3A 4LSRH 1CDJA 5H37G 2Y7QA 1INEL 1ED3B 4JFEB 3UPRA 4J4PC 3E8UH 2X4TA 5DEFA 2FO4A 1G0DA 5GZOC 1TTUA 1RUPL 1XAUA 3H9HB 3MCG1 1QEWB 5EZLA 3IDGB 2EEDA 4EDXB 3BT2L 2CK0H 2EIZA 1S7UA 1R3LA 4XCEB 4OCXH 1Q9OA 2QADB 4XP4L 1B0RA 1FO0H 5CKGA 5A2IH 1KELL 2X09A 2AJZA 3BP6A 4WIQA 3IDNA 4IRJB 5CP7A 3OTTA 3S5LB 2EO1A 2OMBA 3ARYA 1ONQA 4JQXA 5HGGS 3X3GL 2QEJA 2ICES 4M9OA 4UBDD 5JHLL 2VWEC 4FXKB 4JG0L 4JN1H 5I1LA 3BPOB 3ROLB 3IF1B 4BZYA 1NAMA 4OQ1A 1NSNH 1DBAH 3JZ7A 5E00B 1A6WH 1IT9H 4LU5H 2QQKL 4OV6F 2GK2A 3ZYZA 1RZJC 4Y5YC 4MNHB 2IANB 4PGZA 4BUHA 5I73C 5F3BB 5JXEA 1KG0B 1A0QL 5HHMD 5JNYB 3K4AA 2YA1A 3S96A 3V52H 4L5FL 3AU1B 1SEBA 5I1CH 4LEXL 4ZFFA 1RZGB 3PXHA 1YNLH 3DARA 2DQIH 4NQDD 4KRPD 2VL5B 1INQA 4QRPA 4LLVA 4X98B 1KTKE 3VRLE 4AM0A 1HH6B 2OSLA 3FFDB 3IYLW 5I0DA 3RWCB 3K2UL 4XVSH 3V4UH 5DJ6A 1M05A 2EC9T 1YEEL 1NUNB 3HB3C 4KPHL 1YEJH 4NFBA 1VERA 1EMTL 2UUDK 3I6KA 5E99H 3S35X 1FG2B 5KVGL 4K3EH 1KPRA 2BOCA 3LKSB 3KPTA 3SDAC 4QHKI 4WY7L 1KIQA 5JIHA 1BGXL 4Y2DD 3HRPA 5LGJA 2IBBA 1JHLL 1JK8B 4C4KT 2P8MB 2WIMA 3GSQB 1UWEL 3UTSB 1Q9KA 3C2AH 4Y4KC 1V3LA 4KI5D 4LLWA 4OAWA 4Z0XA 2MFNA 2YWZA 4F7CA 3I75B 5HI3C 1TJGH