4XP6H

X-ray structure of drosophila dopamine transporter bound to psychostimulant methamphetamine
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
219
Chain Sequence
EVQLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQSPEKRLEWVAEISSGGRYIYYSDTVTGRFTISRDNARNILHLEMSSLRSEDTAMYYCARGEVRQRGFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Tranport protein/inhibitor
molecule keywords Transporter
total genus 38
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp6H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp6H01
3JWNC 1SJXA 3HRZA 1C08A 1FLRH 4PRHB 3S8WA 3ZYIA 2I60H 4LAQH 3EO1A 1MIMH 2QTEA 3RZCD 1HWGB 1L0QA 5EOQL 2PW1A 4JKKA 1CK0H 3I6GA 5L7XH 1A1NB 5GJTH 1ND0A 1FNSH 5HI3D 2BCKA 3DVGB 4UT6H 3O9WC 4UDUA 5CJ5A 1LP9A 5TE4L 1TETH 1AD0A 4RQQB 4QRPA 4G43B 5FV1L 4G8GB 3QFJE 4WHYG 2I25N 3MROA 4MJ4A 5EU4B 5CAYB 5I19H 5T3XH 2I27N 3QWOA 5J3HD 1NGXA 4AM0A 3SDCD 1UJ3A 1ZS8A 5KVFL 4LCYA 5D5MF 5T3ZL 1G7LA 1N5AA 1NLBL 3RUGF 4X6CB 2ZWLT 2BMKA 5HPOA 1U8IA 4HEPG 3FB5A 4PJHE 4I2XE 2CK0H 2IH3A 4LHUD 1JP5A 2P5WA 3FL7A 4YQXL 2VSCA 4XP5L 4U1GB 4AENB 2VAJA 3GMOB 3GSNB 5CBAB 4YBQD 1AGEB 3U0PA 3MFGB 3QUXA 1A4KA 3VFPB 2OCFD 1FZOB 3DX6A 1H3UA 1JGDA 3FB7A 5ERWA 3I6LD 1ZLWK 3TBYB 3NCCB 4RBPH 5KZCB 4CVZB 1FGNH 3O6LL 2VLRA 5IGXL 4APQC 1ES0B 4CU6A 5C0AD 4OLZL 3V0VA 2VLJE 5DT1H 4XVTL 2DLIA 4M7JL 2XZQH 5F96L 3TYGH 1U8LA 1A6AA 1BD2A 5DGQA 4K3DL 1BVZA 3WDHA 4LPCA 5C0CB 3T0EB 3UPRB 4WY7L 5C0CE 1QQDA 2P24A 1F11B 1G1YA 4F8QA 1MLCB 3BIKB 3TJHD 4KH2A 4LSSL 2HMID 1EZVX 4JDZB 3KDMA 3B6SB 3MCKB 1FZJB 1ZTXH 2C1OB 2BDNL 3CFCL 1X3DA 4R7DB 4XP4L 5ICZA 1B4JL 3BPNC 1DLFH 4ODHL 5JQ6H 4UI2A 3H9SB 4PRIA 4RMRA 4DKFL 4G9DB 1S9YB 3AB0C 1A14L 4N0UB 3CVHH 2NR6D 2R1WB 1ED3A 4PJCE 1KIQA 3QJFA 1UCBH 1GXEA 3O2WL 1N8ZA 3P0GB 2VQ1A 1IVLA 3IF1A 2CMRH 3LAFA 3QCUH 5ALBH 1OVZA 3CVIH 1BFOB 1B0RA 4WEUD 3RGVC 1GOFA 5BXFA 4PJ7E 3DXAB 1SJHB 5F71A 5C3LD 4L4VB 3GIZL 1KJMA 2PO6A 5DJAB 2R0LL 5C09A 3STZA 2VLLB 4GBXB 4MJIB 5D1XB 3ARYA 1AXTL 4PJEF 5KN5A 1XF2B 4FFYH 4R26H 3MQIA 4DGYL 4O9HH 3B9DA 4QOKA 2X40A 1A22B 4X7FC 2FX7H 3RWEA 1CLOH 5DVKA 5JMRA 5ENWA 5IV2A 5D71L 2HJLB 3SKOB 3AS2A 4TPRH 5FUCE 4NFBA 2UV3A 3QDMB 4PGEB 1JPGA 2BRRH 2XXCB 4WJ5B 2CQVA 4XPFH 3TC9A 5FHAL 4NQCD 1CXHA 2EKSB 2XA8H 2GAZB 1D6EB 4TN9A 3QO0A 4RX4D 5DJCA 2HAZA 5HGHB 5DJZB 4MXWL 2B5IC 3ARFC 3CU1A 4AMKH 1KCLA 4Q9BA 3IFPA 3CNKA 3PWPE 4KHXL 4WO4C 1MQ8A 2VXQH 4W68A 3KPOA 3L5XL 4XVSH 3UJTL 1MCPH 1QOKA 1TJIH 1T03L 1CGUA 2APWA 4OLWL 4TUJA 4P2QB 4Y5YA 3BP5A 4LSPH 4HFUL 3TGXA 3MBEA 4OQTA 1A1OA 1LE5B 4YQXH 2JB5L 3H6JA 3MRNA 1W8OA 1RZKC 1MAJA 5C2UB 3SE8H 1QRNE 3UP1A 2AI0H 1S7TB 4IRSC 3D2UB 2YMXH 5ECJE 1X5IA 4PJXA 3VWJA 2HJFB 2EDWA 4LASL 1I8MA 4J1UA 1TTGA 1TZIA 1HHHA 4YHPA 1HKLH 2VYRE 5EZLA 5EZIL 5CP7A 5IHZA 3EOTL 1EHLL 4RDQG 5H2BA 2IBBA 4MD4B 4NPYB 2EDJA 3KPRB 4PGDA 3ZSTA 2FSEB 4QOKD 2HLFD 4ZQKA 1L6ZA 3QXDA 1M7DB 4G9FA 3ULUC 1RZ7L 4RAUA 3U9UB 3G9AB 3GMRB 1ZHBB 3H0TB 4NQCE 4EI5C 3OMZA 3WFEL 4HLJA 4F7MB 1EMTH 5E7BA 1QSFE 1CICC 1PZ5A 4XRCB 1HDMB 3SE3C 1AR2A 3BH8A 5FUCC 3S37H 2G5BB 4U1IB 1MFAL 4HLZH 4K7PY 4CMMA 5E7FA 5DVNA 1OTSD 1U36A 2ZUYA 5JOFB 2J4WL 4U1JB 1OARH 2D3VA 3OXSA 1DQQB 1U8KB 3LEXA 2VNCA 4HKJA 3ES6A 3FQWB 5DHYA 4NHUA 3MREA 4D9LL 1PD6A 3ARQA 3GKZA 3TBSB 1H3TA 1A6VH 4YHIB 1FSKB 3LZFH 5IEHA 1DN2A 5D7IE 5IMMB 3TESA 1QFUL 2H32A 1J1XL 5I1HH 1JI1A 3QEGH 4K23L 4N5EC 4OV5B 3CZJA 1OTUC 4JKMA 5LCVH 3AM8C 4X5WB 3MRPB 2JJTC 1FL6A 3H42L 3MBXL 4JFDE 1VADA 4MD5B 2B20A 1P2CA 5GSVA 3C5JB 3JUZA 3QHFH 2X4NA 4RIRA 1IGIH 1OF2A 4KKBD 3JWDH 4UOJA 1RZ8B 3O11A 4BK4A 3ULUH 2HKFL 5GSRA 3N1PC 5FUOH 3SGKC 5F7HA 1XZ0B 2ID5A 4KJQD 4AMKL 5EBWA 3CDYA 1G6RA 4F33A 1MIEL 4U0QB 3T2QA 4KHXH 2C1PA 2VDRL 5BZDA 1CVRA 5KSUA 4TVPH 3RPKA 4K8RH 2HFEB 1YN6A 3CFBB 4WEBL 3QA3B 1JPSH 3GSQB 5I1DB 1SJEA 1AC6A 4HZAA 1F6AA 1KB5L 2NW2B 3HE6B 3DWTA 3VFUA 3MRKB 1DUYA 3NIFE 2DWEB 4I13B 3HZKA 3VFNA 3B2VL 3O3AB 2YD6A 1MSPA 5DRZA 5E2VL 1HQRA 1CF8L 3P4OB 4DK6A 1TTUA 5DZLA 3PGDB 3KNBA 3IAGC 1A21A 3O6FA 1NFDF 2I07A 5I1GH 1RZJL 5DVMA 5GGVY 4ESKA 4JQIH 4XC3L 4TVPD 3BRDA 1L7IH 1UM4L 5E94A 5B3NA 4HAGA 3WHXB 4RMWA 1JZ3A 4OQTL 2HFFB 1E6OH 3CH1B 1J0ZA 1DBAH 4ZFGL 3QPQD 4WCYH 4JREC 3DROA 5L9DH 4UILH 2Z35A 4JQVC 2CLRB 5GHWH 4CVWA 3OJDB 1MCWM 1Q1JH 1EMTL 1UENA 1DR9A 3H7BB 3NZ8B 5I8OH 2V17H 5CHNA 4POZD 4PJ8B 2R4RH 1PKOA 4DVBA 1T21A 1RJCA 4IRSD 2W0PA 3L3HB 5EU6E 3W81A 2X4OA 1S7UB 2BVPB 1T2JA 3THMH 1DE4A 2VIRA 3CZFB 4YGVB 1YEDB 2XT1B 3AXLA 5IVXB 5EIIB 3QEHA 4JHZA 1FYTB 5DHVB 5BJTA 3Q5YA 3O2DL 4R4BB 4TUKH 4NO0D 1ZT7B 2AK4D 1QR4A 4YDVB 5IVZB 3GKWL 5BV7L 1J0HA 1OAQL 4JN2A 4IEFB 4UNVA 3M17A 4U6YB 4P46D 1FFQA 4PB9H 1IGYA 4WWKC 4OF5A 4NQDB 3V4UL 5FYLL 3WYRA 1HKFA 2CH8A 2V2TA 2CRYA 3IYLW 3N85H 4TNVF 1D9KA 2OZ4H 1ZVSA 1A7QH 2OTPA 2NY0B 3I85A 2R0KL 4UQ3A 4WHCA 4X4MA 2NX5A 1EGJH 3QB7C 2VLKB 3CFIC 3G08B 4WNQA 4FZEL 5E6IB 5GRZA 4I9WE 4BM7A 4PJAE 2NLJB 3PABA 1J9CT 1JHTA 1T6VN 4HJGA 5EFIB 4XNMB 3T4YA 3IJSB 3L6FA 2M26A 2QQLH 2Z91A 1IEBB 2R0ZH 3T2PA 3QIBC 4TOYH 3EFFA 4G5ZH 3GSOA 1QACA 4P2RB 3QG6B 3HMXA 4A6YB 2Y06L 4G7YH 4UT7L 4ZFFB 1INEH 2ZNXA 3DI3B 4U6VL 3QIUB 3ARBD 4L3EB 1SVCP 1UEMA 3FFCA 1RUPH 1FQ9C 5GZOC 3RWCA 5I1JH 1BF2A 1KJ2L 12E8H 4XXCC 4F3FA 2AVGA 3HE6C 5TE6L 1BD2D 4PR5B 5KJRL 3MV11 3JWDC 4IRJC 4QHNA 4MA1B 2Z4QA 1AO7D 3LSOB 4Y8AA 4HIHA 5KANG 4PJFE 4EQ3A 3IFLL 2DDQH 4WTWA 3MUJA 1GZPA 4G6AC 4MX7A 4NKQB 4LNRB 5KSAC 1DBAL 1G84A 5CWSB 3LQZB 4XCYA 3KXFE 4PJ9A 2DOCA 2E8ZA 1IM3B 3IU4H 5DSCB 4Q9CA 3AY4A 4GKZB 1HIML 1YQVL 4I9WD 3UROR 3CGTA 4Z77B 1VHPA 4APQD 4ORGA 1JGUH 5JPNB 3O8XD 1E4XL 3BXNB 5BW7C 5EOTA 3RWFA 4P5MA 5F89B 4G8FB 1AJ7L 1R3KA 3L3IB 1HILB 4K8RC 5T5NG 4MAYA 4I0PC 1YMMA 4NQVB 5HVGB 3U7YH 3EOBA 3KPRE 1HWHB 1CICB 3I02B 1T2QL 5GJSL 4NNYB 1CLOL 5KS9A 1PQZB 3VGHA 4GKSB 2F8VA 1XIWD 2PTTA 3RU8L 1ZAGA 4AIXA 4CJ0A 2EXWD 4OUUB 1PY9A 4WI4A 5F9WC 4ZPVA 1RZIA 2F5BH 2YHGA 3VDBA 2K9UA 4YBQC 3RWDA 3SDDC 1PG7W 1DDHB 1JGVL 3MCLH 1NEUA 2AEQL 2XWTB 1MCEA 4N0CD 2VWEE 2WBJC 3BN9C 3TJEH 1AGDA 4NRXA 1MFEH 3WUWB 3V5DB 3KPSE 1QRND 4S1SL 3RFZC 1Q72L 2HA1A 2R9HD 2IBZY 3LN5A 3L5XH 4XVSL 4KDTA 3DTXB 4LHJB 1IT9H 3KWWA 4NNXB 5GGUB 3S36L 4Y1AB 1FNAA 1SEBA 3PHQB 3EDEA 4OZIF 5F1KC 1F45A 4NN6B 5SWZE 4M7LT 1KIRA 4WI2A 4LARH 5ETUB 4HV8B 4K3EH 5I8EA 4OGYL 5GGRB 1ACYL 3QIWB 4TTDC 4YC2C 4JN1L 3MGAA 3JV5A 5T1MA 2ZKHH 4YHZL 4JO2L 1Q0XH 1BJ1H 3X17A 2Z93B 5D96C 4BZ1L 1BEYL 1Z3GL 3VG0L 4WI8A 1N6QH 4UOW0 2QQQA 1HYSC 2BSSA 2VMFA 4XP9H 1XF5A 4OV6F 1P9MA 4HKBB 1EXUB 4PJCB 4LSVH 1ZWIB 12E8L 1ZOXA 2F19L 5F1SA 4DN4H 4JFFE 4P4KC 1MHPH 1MREH 5AWNL 1AFVL 1J8HE 5E2WL 1R5WB 5C6WH 2VE6B 4JZNA 1FVDA 5FB8B 3KLSA 4ORZC 3VGDA 1W0VA 3ULUF 3PWPB 3PWPA 1JNHA 3SDXA 3UAJD 2E27H 5LGHL 4RSVA 1BZ7B 4OCYH 4Z5RB 2O61A 4QTHB 5KVFH 1R5WA 1QUNA 5FM4A 5T3ZH 4PJCA 2IAMB 4PGJA 4OQ1A 1LK3L 4H1LH 3QWRA 4U1HB 4KMQA 3MZGB 4PRDB 1GOGA 2OJEB 3DIFB 3H3PH 3R06A 5CEZL 2JF1A 3D0LA 5E5UB 1JPFA 4ZUVA 4UBDC 5GRWA 1K8DB 2MCPH 4QNPF 5ID0B 4I0PB 5B3JE 4F58H 1E4WH 3AREA 3O81A 1FVCA 3MNWA 3VRIB 1KLUA 1H15B 1JNNH 3TA3D 5D2NA 4HWEL 3V0AC 3IU3A 2BJMH 5D93B 3G04A 4Y19B 5D1ZD 4HS3B 3DTXA 3VXUA 5EDXA 1NJ9B 4OF6A 4F9PC 4HUWA 2RHEA 5C0GB 3DGGA 5JA8B 3SDDB 2NY6D 1XGYH 2YBRB 4M5YH 5KBNC 4CDHA 4XGZA 2QR0A 3LB6C 1JHLL 1YYMH 4IRZH 5CJBA 1KJ2B 1VACA 4M48L 4JQXC 1FHGA 4YWGH 3BEVA 3VXQB 5HJ3B 1IEAA 1K5NA 2DD8H 5B3JF 2PTTB 3GSUA 5GRUH 2VDLH 5GRJH 2J8HA 3P9LA 2JCCF 4G6JH 4BKLA 4WFFD 1A5FH 3FT4A 4I3GA 4GH7B 2ZSVB 1CLZL 1IKFL 4NN6C 4K7FB 2EH8H 2OL3L 3WFHA 1CFVL 3I02A 2OZ4A 1S78C 1N4XH 4EI5D 4FG6C 3SDAC 5AZ2H 3WNLA 3BHBA 3CU7A 3C60B 3GIZH 1S7WA 4XHJD 4PREA 1FZKB 1R3KB 3FO0L 3PL6C 4KU1A 5F1NB 1K9TA 3SE8L 5JZ7D 4LHUA 4YHKH 4U7SA 4NBZB 4DGYH 4KJQC 1V7NH 2Y36L 2HJKB 3VXRE 1P53A 4JFDB 4ONHB 3NH7L 2EICA 4JLRB 4PJBE 3WHE1 1IM3A 2DYPA 2W9LA 3ULVC 4OZIA 4XP9L 3WO4C 4PGBB 4Z78B 5ICXB 2FGWH 1HNFA 3RNKA 4WU5B 1JI2A 3RVWD 2OTUB 1UXWB 2NY0D 2FO1A 4XBPB 3DX7A 5IJKC 1YUHB 2OL3A 1DN0B 1XIWB 4NO2A 4YLQT 4OFIA 3RKPA 3KYAA 1W72A 1BBDL 4PR5A 4TSAL 2Q86A 5DA4A 1J05B 4LIQH 5DJ6B 3VWJD 4DGVL 1KXQE 4F3FB 1LNUB 1JNLL 4C56A 4BSWA 4X6EB 4D0BA 1Q94B 3LN4B 2P7TB 3NIDF 3PGCA 2N4IA 4NT6B 3HHRB 3RWCB 2C4FU 3MLXL 4WO4A 4KKNA 1LQSR 1QRNB 5D1XC 3VFRA 4XWGL 3O4LD 1VPOH 3QP3A 3VFWA 3LKQB 1GSMA 5D7IA 1JL8A 3KGRA 2SEBA 3MO1B 3L3JB 3DOSA 4PJ7A 3X3FL 5DO2D 1ZLVH 2R1YB 1MH5A 2R1XA 3FRPG 5E70A 5I15L 1JHTB 4HJGB 1P84K 2AXHA 4F15B 2OK0L 1VSCA 1MH5B 4GRLA 3L3JA 5JXED 1EHLH 4S11A 2JCCA 1WFNA 1VDGA 3S35H 5C07A 3LKQA 4K23H 1S9VB 1IJ9A 1ZVSB 3UDWA 4F57H 1JPST 2PO6C 1ZA3B 2ZUQB 4NQDA 1DBKL 4I8DA 2XI9A 2P7TA 1Q94A 1RMFH 1W0WA 2W60A 1RQ5A 3OPZH 4EUPG 4C56B 5F9WB 1EEZA 1I8LC 3LRHA 1W0YT 4LKCA 1KBGL 2PO6D 5C09D 4KKLD 3H9ZA 1VFBB 2EYSA 1RIHL 4R4BA 5HVWA 1NAKH 3R1GH 3MV7E 3VXPA 3RAJH 4E42A 5A43C 1DL7L 1DE4B 2VIRB 1WISA 4WW2F 2BSRB 5D7SH 1Z9SA 4OD3H 3ZT7A 3ARBB 2FL5B 3D85B 4L3ED 3F6LA 4YIQB 3QRGL 5C6PB 4XB7A 3ULVH 2CRZA 4Q6YA 1CLYL 3GI8L 3WBDA 2J6EH 1AGCA 3EHBC 1OB1A 1SHMA 3PL6B 4DCQB 3VD9A 4MJ6A 5DMGC 2F58H 4H8WC 3LKSB 3RTQD 1M1SA 4PREB 5LCVL 3VDCA 3EIFA 4MNGB 3VFVB 4NFCA 1A2YB 2AEPL 1RHHA 1TVHA 4TUOB 2NNAB 5GRYA 3UMTA 3IGAA 3HI1B 5ADPH 3GNMH 5HHXH 4BKLB 3ARTA 4CVXA 5D1QB 4G9FE 1T4KA 1TVBB 1U3ZA 4OZHF 1LEIB 3GSUB 4WCYL 2EYRA 3PGDA 3O2VH 2LAGB 3X14B 3BEVB 3PWLA 3VXQA 2WIIA 5DRZB 1T1WA 5ICYB 1VACB 3CVIL 2CUHA 2VLRD 5D6CA 4RMTA 2KPNA 4Q74A 3E3QC 3G5ZA 3SQOH 1XCTB 4JRXB 3OX8A 4IRJD 4S0SD 5FYKE 2CD0A 3DMMA 1EUTA 1FSKC 4RMSA 1KJ3L 3INUL 4X7CC 2X4RA 1K6QL 3EOYG 2MTPA 4Y4FD 1DBJH 1WICA 4ELKA 4LKXB 5DFVD 1VFMA 4NCC2 1KLUB 4F33B 1NDMA 3AREB 3EJZC 4OTXH 3SE4A 2PW2A 1VB9A 4JHAL 4XCNA 5F7LB 4GG6B 4LSSH 1MCOH 3HC0B 1CFQA 2GTWA 4ZSOB 5DJDA 1FDLH 2P5ED 4C54A 1RZ8A 2APXA 4HEME 3MLSH 2R56L 4NRYB 4P2RE 5EN2B 5K9JH 3R06B 4NQXB 4DTGH 1QBLH 4GBXD 2ORBL 1KB5A 2PXYC 3O8XA 5ELIA 5A3ID 5GSVB 3EDJA 4MD5A 5FM8A 2IPTH 4U1HA 1INQA 1HCVA 3O2WH 4LCWA 2R23B 5GHWL 4X7EC 4HJ0C 1I1YB 1KEMH 4KDVA 1QPXA 4HUXB 4DUWA 4LSPL 1A8JH 3FB8A 4X4YB 4Z7OE 4JFFD 3QUXD 2YD7A 2F53D 4PY8I 4P9ML 4Z0XA 2D4FA 3HC4L 1B2WL 1ZANH 4YHIA 3SDXB 4I0KA 1NUDA 3HNSH 5DMJB 3MUY1 5ISZA 1ITBB 3U0WH 1N7ML 4KZDL 4NHUB 1JVKA 5HBBA 2VE6A 3ES6B 3EJJX 3L3OB 2YUXA 2Y06H 3LEXB 1AQDB 3BESR 1CGWA 2FR4B 4MB4A 1G7IA 1QLFA 3QEQD 3JWOH 4K3HA 3I2CL 4U1IA 4JEGB 5GJTL 4ZFOB 4QRQA 1GZQB 4HUNB 3GMRA 2CSPA 3H0TA 4KKAC 1G7HB 3SDXE 3EAKA 3QXDB 2CIIA 5HYEA 5I19L 3HZMB 3KXFA 2R0KH 3NCYS 2ADIA 4KMTH 5IG7B 3FO2A 3MRCB 1HI6A 4S1RL 3SE4C 4TRPH 5D5MB 4G6AD 3BPCA 3C2SA 4P46A 3B9KD 4U6HB 3VMNA 4ELMA 3C6SA 4IDJH 3VGBA 1QRKA 2HRLA 1T0NB 4HC1H 3WUWA 2E9IA 4NZUH 4XHJC 5CINL 5F1IA 1BBJB 1DFBH 4N90D 5B8CC 4P4KD 2WLZA 1PYWA 2PCPA 1RJYB 4HWBA 1RJYA 1I8LA 4JKLA 3KR3H 4TUJB 4ZPVB 1IZJA 1IGCL 2RGSA 2C3GA 1ETZB 1NMBL 3SJVD 4N1HB 4M5ZL 4HMEA 3HKFA 4ELMB 2DMBA 1T04B 1YY8A 3O45A 2DQTH 5C07D 7FABL 1TJGH 5C71A 4GXUM 4ZTPH 3O2DA 5HVHC 5BVPH 1XGTB 3MRCA 2GAZA 3MACH 3MXWH 3UO1H 3D85D 3HR6A 2APTA 3UCRA 3GO1L 5DK0A 1HH6A 3KXFB 4GRLC 4XAWH 3HZMA 4EZMA 4KTEH 3TJEL 1MRCL 4OI7A 1I9JL 2DI9A 2IH1B 1R24A 3O6MH 2DQCH 5DHVH 4GKZA 2WMPA 4YDKL 4RISH 4HCRL 3VXRD 4LSTH 1HXMB 4QRQB 4CU7A 3IS0X 4XCYB 5EUKB 2LVCA 5ACMA 2OR9H 3OR7A 5SX4H 2J5LB 4OCMC 4FQJH 1NUNB 3TYFA 3C2AL 3CK0L 4MX7B 2VLLA 2V7HA 2J88H 4LGSB 2GFBB 4QHKI 4N90E 4OM0H 4LHUG 2GCYB 4L1DA 3BKCL 5HPMA 1B0RB 4F7TB 1BFOA 1Q9WA 5CKAA 3F7VB 4HFWA 2QHLA 4MAUH 4Q97A 2XZQL 3S96B 5IF0A 5ISZB 5SWZD 2VDOL 2VH5H 2C9AA 1IAOB 4GXUN 1CL7I 5F88A 3MNVA 4IRJB 1HSAA 4JRYD 3ILPA 5KANI 1V3JA 3JWOL 3FB8B 1X5XA 5DUPL 3RIAK 4KMLB 3QUMH 1P84J 3MCKA 1MFCH 4JPVH 3KPSB 3C9NB 2R23A 1JGVH 4LLVA 4OLVH 5HI5D 3KPNA 1FYTE 1V5JA 3BIKA 1MLCA 2Z31B 4Y1AE 5TQ2L 1PJ9A 4UOW1 2ITDB 3IB4A 2YKLH 2Y07L 4L4JA 4J23A 3F12B 2YPLE 4PJ5D 5D7LA 2FD6H 1NKRA 4HUMB 3T3MF 3SDAD 1L0YA 4NWTH 5DR5H 4M00A 4WUUE 4ODBD 3RDTD 4TULH 4ZSOA 3RA7L 1EAJA 4B50A 2FJHB 4W6XB 3UJTH 5CIPH 3HAEG 1T1XB 3HE7B 2PKDA 5T1KD 4QHKJ 2QSQA 1JHKL 4XPAL 4MNGE 2IMMA 1ZT4B 2DL2A 4DGIH 5ERWB 3TBYA 4R3SB 5DGRA 3L3DA 4ELKB 4M62L 4TTDD 2VO5A 3TJHC 2AJZB 3BYTA 1G9NH 4JQXA 2NZIA 4CKVX 5HHVL 4M43H 2A9MH 3B5TA 4JFFB 1CN4A 3SGDI 4LSRH 3OX8B 3A67L 5DXWA 1I4FB 1BJMA 1MREL 4MDIB 5AWNH 2APBA 5I30H 4F9PA 3ISWA 3X14A 4NOBA 5FCUL 4KQ4L 3SGJC 1IZKA 2BVPA 1J10A 3MROB 3ZYZA 5D1QA 4NOFA 1JYXA 4QRPB 4XNZB 4XXDB 2VR9A 1YC7A 4UDUB 4PJ5E 5CHNB 1NCCH 3CC5A 2JK5B 3LMJL 5CZXD 2DIAA 4H88L 1BJ8A 3H7BA 4LLMA 3S98A 3H9HB 5LVEA 3LKSA 4HH9B 2IBZX 5TDOB 3RVWC 3HB3C 1OB1B 3PL6A 4YZFE 4OI8A 3BKJL 1TZGL 3CUPB 1TJHL 4JFHD 2E8YA 2MFNA 3HUJB 3ARBA 1MY5A 2M8XA 1F4WH 2VZOA 4M1DH 4JDVB 1ZT1B 1A3LL 4JY6B 5K9QG 5KOVC 4LASH 4L3AA 2B39A 2APVA 1H3PL 5JW5A 1MRFH 1A6UH 4X99B 2VZ3A 2DWEA 4NM4L 2XWBA 2V17L 3VFUB 1A0QH 5DEFB 5EWIL 1SJEB 1D5XA 3G5VA 4LLUA 4Z7UA 5EA0L 4GRWF 1F3JB 3QIUD 1DBML 4DQOL 3DUUA 4PLKD 4P9HH 2CK0L 1GOHA 5EBLA 4KROC 4HIJB 2XY2A 4Y88A 3L5IA 1YYML 4IRZL 3A6BL 5EBWB 4RGMB 5B22A 2ZG3A 3U7AA 5C07B 5LAXA 4HKZB 4XTRD 4M7KH 4QXGH 2LV4A 1MCKA 2A77L 4HMCA 4WW1B 4FQCH 2D7PA 3D9AH 4WDIB 1AKJB 3WEXA 3DYOA 1LDSA 5BRZA 1OF2B 4RIRB 4L4TE 2BNQA 2WZPD 2D7TH 4YHNA 3RIFK 5SWSA 4OUOA 3MO1A 1XMWA 1JPSL 4MLIA 4HPOH 4X5WA 3UPAA 4EEEA 2DN7A 3VXRB 3UJIL 1ZV5A 4YUEL 5HXMA 5D93C 5EC2A 1NFIA 4OLXH 3REWB 5KTEH 3K1DA 5C07E 1JZ8A 5BMFH 3E8UH 3IRPX 1Q9KA 2DTSA 3WJJA 1ULVA 3VFGH 1MF2H 4WTZA 4PRHE 3MREB 2Q86B 1Q9OB 4XMLH 2UY6A 1ZGLA 5DHYB 5F7WC 4U1GC 2Q8AH 5C6TH 3GHEL 1SVZA 3UYRH 3OXSB 3BRGC 3E6HA 4WW2B 5DQDH 2HFGH 5E8NA 4AEIH 4LSQL 4AEFA 3PHOA 5TF0A 5JHDA 2QSCL 4XNZC 1CD1B 1QFWL 1PZ5B 4U3CA 4XRCA 4PGBA 1EHXA 4AQOA 2H6PA 4FMFA 3MV7A 4KRNA 3QNXA 4L4VE 1DQMH 5CCKH 4ONHA 3O9WD 4FTVA 2GW5A 3U6RA 4WI5A 4LF3B 1BQLH 5I76A 2CDFB 3RX8A 2D4DA 5ACZB 1FC2D 1A1MA 4J3XA 3RJQB 5IB5A 4Q9RH 2H2PC 2QKIB 1FZKA 3FT3B 3IFLH 4R90L 1RZKL 4WGWB 1X4ZA 5HI4C 5IBTL 1MFBL 5EZLB 4HJJH 2O5XL 2G75B 4WUUD 4KVNH 1OCWH 5CD5C 1U3HD 1KEGL 5J6HA 4K7FA 2ZSVA 5D7KD 5IMLB 3S5LB 3GK8H 5CGTA 4LCWD 3UTZB 5TDPB 4ZUUB 1ZA6B 3CMGA 1CXFA 2X7LA 2YA1A 3RGHA 1UA6H 4RBPK 3W2DL 1WWBX 3BP5B 1F90L 1IGJA 2F74B 3PIQB 2XTJB 5IHUH 2YBRA 3GJEB 3RGVB 3BUTA 1QFHA 3MV8E 4XXCA 3SDDA 4HUVA 5C0GA 5E2UH 1FC1A 3BAEH 1ORSA 5KSAD 1AY1H 4HXAL 4DW2H 2ZUWA 1D5ZA 2XNAA 3VI4E 4Y19A 1HHGB 5DD1L 1XF3A 15C8H 4PP2A 5DJZA 5FKAA 1OD9A 4E9LA 4PJFF 3QO0B 3RVTC 5C0BE 1EO5A 5FYJD 1FVCB 1J0JA 3OGCA 3I6KA 2I9TB 2IEPA 5ID0A 3NFNA 5FO7A 1KJ3H 4ZUVB 1VCAA 1JPFB 2OR7A 4NFDA 1WBZB 3A6CL 3SKOA 2HJLA 3OKDB 1X6NA 3RWEB 2OJEA 3DIFA 1IEHA 4ZTPL 1BFVH 1D9KD 3FRPA 4PRDA 4WI9A 1MCLA 4QOKB 3BO8A 4TSCH 4Q2ZA 5TE6H 2BRQA 5FYKD 4PRIE 4PJGB 5DJAA 4XPTL 4NQCB 3IDXH 3WSQL 2XY1A 3KHOA 3DXAA 4KTEL 3V6OC 1H3GA 4Z7NF 5F9AC 2VXUL 5SWQB 3OAYH 5GXBB 5MEOA 1BZ7A 1MELA 4Z5RA 2O61B 1N8ZB 2ZKHL 4NHCL 2LVEA 1YEIH 1EFXA 3P4LA 4KJYB 4DKAA 3MNZB 4FFWC 4RDQF 4MQXC 3MFFB 4X5LA 1IFHL 5I8CA 2R1WA 4KJWC 2GHWB 3CSYA 1R6VA 4K3GA 4M61B 1FH5H 5GGSY 3STBA 3CVHB 3MRDB 4R7DA 3WN5C 1ZWIA 4QOKE 2C1OA 3QQ9C 4KKAD 3GMMB 3CCHB 5T1LB 1CFNB 4OM1H 4HKBA 2DTML 4JDZA 5D2LA 3NABL 2OM5A 2RQ8A 1G6VK 4UNUA 4MS8D 2YZ8A 3BWAB 3CMOH 2P24B 3TCLB 3PG2A 5TFSH 5F7EL 3V95A 1HOCA 4PJ8D 4K94H 1KPRA 3CFJB 3K0WA 1IILE 4J3SA 3T0EA 2PYEE 4NN5C 1K4DB 5GGVL 3W82A 4PJAF 4P3WA 2HFTA 3UJJL 3CJJA 3QHFL 1T89A 5B39G 1U91B 3DV4B 4JQVA 3LQAH 5GGRA 1UVQA 2NXYD 5DURB 5CEYB 4YDLB 1DUZB 4D9QE 5JO5A 3QUZB 4AEHH 1VKXB 4QRRD 2ERJC 2NY6C 4NWUH 3VFOA 4Y5VB 1D5BA 1FGVL 1T0MB 3W9EA 4EOWH 2GKIA 1LD9B 4Y1AA 3ZSSA 2FO4B 4RGOL 3G6DL 4HKXB 5BVJA 2RCSL 4NZRH 2AK4A 5E1HB 4U4BA 3VGEA 4JZJA 2QV2A 3P3YA 3AS3A 2BOBA 2IC2A 2IH3B 3V5DA 1PEWA 3W2DH 4ZFZB 3MA7B 3P77A 4OAWA 4PS4L 1QZ1A 3LKNB 4L9LB 2XTJC 4KV5E 3DURB 4X6CA 3SJVE 1CIDA 1S7QB 4WEBH 3C5ZC 1DDHA 4ELME 1KTKE 3RTQB 3T77A 1NGXB 4AM0B 2WUCL 2X4TA 3BX7C 4NUJB 2X4SA 4L9DA 2ZSWA 3JSSA 2VAAB 4GKSA 3SQBA 25C8L 3UC0L 1FZMA 1LP9B 1JZ4A 4KZDH 1NQBA 3UZVB 4RAVA 4LU5L 3OV6A 1Q0YL 4PB0L 5GS0H 3D5OF 3EOBB 1X4YA 1M7IA 3JTTB 1FO0L 3BPOC 4DZBB 2FZ3B 3TPUA 2FZ3A 4P5MB 2GJZB 3BXNA 1T1YA 1M7IB 3T1FA 4D9QD 3SCMC 3DETD 4ZUWA 1WK0A 3S88H 5D7JA 4UIKH 4LSUH 1QSEA 2CLVB 5J56B 3MGTB 4LBEA 5C0FB 2FCBA 3NFSH 4Y4FB 2X4SB 4WUUB 4YO0A 4X8XA 5DD3L 6FABL 4EVNA 2JIXA 5IESL 3WXWL 4ZXBA 4OCYL 5BO1L 3O6FC 3OQ3B 4LPTA 3RTQA 1IAIL 3D39E 5JUEH 1R3IH 5I8KL 4P3DA 1F42A 3ZO0A 2Y36H 1QFOA 3RP1A 4O00A 4RA0C 3DGCR 4OJFL 3RHWF 5E0QA 5HI5C 1NMCC 4NJ9H 1A7RH 2ADGA 4MB5A 3MUHL 3DRTA 1I1CA 3IT8D 3MMEA 4FFZH 4PGCA 4Y2DD 1B6UA 5F7MC 4ZD3L 3F7PC 5BVJB 3SEPA 1CGXA 3GKWH 1LD9A 5E4EB 3WS6A 3FHQA 1VESA 1BX2A 1N6QL 4Y5VA 4I4WA 3S34L 3WNOA 3ZYJA 3QUZA 4ZFFA 5HGDB 3TWCH 4WFEE 3SE3A 2EDNA 4JREB 1WEJL 2XXMB 4HIIB 4NP4L 2B0SL 3U46B 4RGNB 4M7LH 4EI5A 5CBEA 1AE6H 1I7RA 2L7UA 2DQTL 2MKLC 3SCMD 3GMQA 3IJSA 2MCG1 1WIPA 3RQ3A 3GNML 4AYFA 5FO8A 1RUQH 5MEPB 1KPRB 3CFJA 4CU8A 1YEEL 1LE9B 1NAML 1T7ZA 5DC9B 4WNQB 3Q0HA 5F9DC 1P6AB 3BWAA 1XCQB 4FQXB 1MHHA 3OAZK 4ONFH 2ZNWA 2HTLC 4HW6A 4JR9L 1FBIH 4M8VA 4EOWL 3CCHA 2A0LD 4HBCL 2AJYL 2ZOLA 1JPTL 1NAKL 3NMEA 2B4CL 3HNTL 4MD0B 3KAAA 1YEHL 3JVGC 3WIHH 5JLZB 1PVHA 2CMRL 2HTLD 1FFNA 2D7MA 3GJFA 4L4TA 1KLFA 1P5UA 4KJYA 4OCNC 4GMTL 2X70A 4P48A 1KJ2H 2A9NH 5SX4I 3RTQC 1N26A 1I1AB 1JWMB 2JB6A 2YEZB 32C2A 4WWKB 1ZT7A 4QWWD 4TNWF 1UB6B 2H26B 4DN3L 1KPVA 3V6BR 1MCOL 1C16A 3QO1B 1ONQB 2CO7B 1NKOA 2X4OB 1A6WL 2V5SA 2VH5L 5DMKA 3B9KB 3G9VA 2OQJB 5CSZA 3VXSA 5DRWB 2JELH 3BPOB 4FXGB 4F8TA 4KI5D 3MV9D 2B2XL 5DJ0A 1HSBB 4XP1H 4WVRA 1T22A 1U8JB 3D3VB 1R3JA 1DBBH 3HPJA 3EYQD 3VI3F 1DEEB 4M5YL 2FX9L 1MCJA 4UIKL 5M95B 1I3RB 1AP2A 2BVOA 2GJ6B 5ESVA 5FKAB 5ITFA 5JIPA 2NY2C 4E41E 4GRMA 1F97A 5B39A 4YX2L 3MJ7B 1A3QA 3IFNL 4PY7A 1E27A 2F53A 3P2TA 4DKEH 5C9JA 1Y0LA 3RVVD 5I1EL 1MFDL 3PIQA 5CUSH 2F74A 4BSJA 1GAFL 3PQYA 4IOFD 1OL0A 4O4YH 4WUKH 4O5LL 3MRLA 1HZHL 1VENA 1QHOA 3MBEC 4HS8H 5L2JB 4MA1C 3RX5A 4JZJC 2DI7A 1YMHA 5GISL 5HYJD 5TDPA 3N9GL 3UTZA 3JXAA 2RR3A 3MJ9H 2ZOKA 3QA3A 1NEZA 4ZXBC 1OW0C 4M9PA 4FNLH 3RVVC 5IMLA 1L7TH 1RU9H 1YEJL 2F5AL 3MLSL 5J6HB 2NY5H 2DB8A 4PPTA 5CJXA 1MLBB 5FA4B 5BZDB 2P46B 3U36A 2KUTA 2YK1H 1WC7A 4R4ND 3ZE1F 4ZAKB 3ZKNC 3K74B 1G6RB 4PJAA 4MXQD 3K3QA 5IB5B 3SCMA 4Y1AD 1FG9C 3HZYA 1EBPA 1X5GA 3BJLA 1KELH 3MUGB 3WIHA 3TN0A 4F7EB 2BC4A 4NZJA 4M6NL 3O11B 3OKKA 4H1LG 1BWMA 2K3TA 1LO2H 5IW3A 4PRBB 1MCCA 4M3JA 1A7OL 1QSFA 5DZNA 1MCHA 4Z8FL 3MLVH 3RWJA 4HF5L 1JTTA 4H88H 2W65B 3AU1A 4FQQA 1FL6B 3AC0A 1NBZB 2FEEI 4ODTL 4C55A 5C0EB 2J12B 2ERJB 2NY6B 4KRPB 3WN5A 5BRZE 3A6BH 2BFVL 4JFZL 4HK3N 5A2IH 3MOBH 4GT7A 2OBGA 4R4NC 5CP3H 4ZSOE 3I3BA 2H32B 4KI5E 5MI0B 5FYJU 4PTUB 1HHKA 2YD8A 1EEUA 1XGQB 3TVMD 4XMKL 3I75B 4FA8A 1ZGLB 1Q9OA 5IIEB 5E8PA 3TBSA 2BXZA 1UXSB 2D7TL 2QLVB 1UXSA 3RY4A 1WCQA 2DBLL 1Q9KB 3AUVA 1TJGL 1BQHG 1XGQA 4LNVA 3EDFA 3IU4L 2BNRD 3NCJH 1KC5L 1AXTH 4QRUA 3SOBL 1TXKA 4XPGH 1NGYA 2Q76A 3C09B 5TF1L 2IF7A 5B21A 2DRUA 3QYCA 2EDXA 4GW1A 3BH8B 2GT9B 3O6ML 4Y8DC 5IJVA 1OAXL 5JDJA 3RZWA 5C70A 3RZCA 3HNSL 4C83A 2BNQB 4FQ2L 3RVUC 1T5WB 2J8UB 2VN7A 3DO3A 3B43A 1P4BH 4BH7B 2VC2L 3H9YA 1J1OL 4MQ7B 1O0VA 5C6TL 2FSEA 4ZQKB 4AH2A 3KPRA 5LAXB 5FGCE 4MD4A 4NPYA 2Z8SA 4LQFH 3SCMB 4ONGL 4ZAKA 5IHZB 3QT2A 1FE8H 1OSPH 3O4OB 4S2SB 4U1NB 4G7VL 1R5IA 4XPHL 2VLJA 3O3BB 2VDKH 3DUUB 4WIQA 3VWJB 3ESVF 2YUVA 4Z9KB 1JZ5A 3QG7L 1YECL 2NYYD 4FMKA 5I66B 2PTVA 2V5YA 4CGTA 4HQQH 3Q2CA 4HWBH 1V05A 4JO4H 4HPOL 4EUPH 1T1ZB 5HVFB 1LGVA 4R90H 4HHAB 4N1EA 4KFZC 4AEHL 1ZLSL 1FP5A 5D70H 5DFVC 5JQHC 4Y5YB 3BDBA 4P2QA 5D7KE 3V6OA 1Y0LB 2MMXA 5TGBA 1J11A 2F8XC 2AEWA 1NC4B 3T2NL 3ZDXE 4G42B 5IB2B 3P0YH 1S8DA 1TFHA 4LVHB 4QRRA 3MLRH 3MZTA 3WIIL 4YWGL 4CN1A 3GI9H 4KKLC 2A1WL 4K2UL 4R0LB 2O5YH 4BFBD 5I75C 4TVSa 1FFPA 5DD5L 4JG0H 4FQ1L 4EN3D 5JA9A 4O2CA 5K9KB 5FYKH 3SN6N 1AP2B 2BVOB 3DVIA 2DI8A 4N0UE 5ESVB 5ITFB 2WLYA 4OCXH 1CFBA 1D6EA 1I3RA 1JGLL 3DX9A 3RL1B 3TIEA 1DEEA 3H9HA 1SYVB 2NY7H 2AGJH 1KENH 1R3JB 3K8MA 1JPGB 2WUCH 1UYWL 3QCVL 4FFWD 3T09A 2DQJH 4XCCL 2XQYG 2DQDL 5CSZB 3U4EB 4RZCA 5DWUL 5IV2B 4ZXBD 1URLA 3FN0L 3MJ6A 5E5MA 3L3GB 4K9EC 2JJSC 1RJZA 3QO1A 2H1PL 1F2QA 3WXVL 2BNQE 1LO5B 3ARPA 1ADQL 5EBMA 1KJMB 3S37X 3RPIA 1GGCL 1JYWA 1UB6A 4D9RE 2IANE 3EW3B 4R97B 2YEZA 5I73B 1KNOB 4J4PA 3RDTB 3TT3H 3S3JA 1UJTA 2G5RA 2VQ1B 4PRPD 1CFSB 3NTCH 1MNUL 3QJFB 1S9WB 5D9SA 3BI9X 3RWGA 4WV1C 4TNWK 3S4SA 5F3BB 2YKLL 2DQGL 1FN4A 3FO9A 1AXIB 4G9DA 4MD0A 4QXTA 3T4AA 4P49A 4WW2C 5F93C 5IUSA 3QRFM 5IKCB 2VUYA 1AO7A 4LIQE 1C12A 1J5OL 3V4PH 4BZ2L 2PYFB 1U3HA 2AQ3A 1MHHB 1P4BL 3BW9B 1VGEH 2C3WA 4H0IA 2EYTA 3LDBC 5JW4N 2VDOH 3DJ9A 3GRWH 3WE6B 3MUZ1 4EN3C 1YQ2A 4LCCC 4KZEL 4GKNB 3BDYL 4PY8J 2ITDA 1A02N 2Z31A 4R2GD 5BV7B 3PWJA 3WO4B 1N0XH 1ES0A 2PYFA 4JHBA 1S7SA 5I74B 4XPHH 1C12B 1MRFL 2VLRB 1EEQA 1KJVA 5HYIA 4ACPA 5IKCA 4I4WB 1BX2B 4GAJH 3DX6B 2PYED 5J12B 2FHCA 4HQQL 4MGXA 3FO9B 5CGYC 3OKEB 4LOUC 1IAOA 2H45A 5F88B 3TP4A 4ELMF 3GMOA 3GSNA 3NCMA 5F3BA 1I1RA 4AENA 1DQJB 1H8SA 2AV1B 3ARGC 2DQUH 4Q9QL 2A38A 2NY1D 3EYSL 3FB5B 4HFWB 1IGTA 1KGCD 1Q9WB 4G6FD 2WSKA 4MSWB 3KHQA 3F8UB 4RFOH 3CFCH 3HTLX 1JF6A 2GFBA 2VXUH 3V7AE 4NWUL 1MHCB 1IAMA 1B4RA 1UKSA 4OZFA 4JFPB 4LVHC 2AEIT 3K8LA 4YO0B 4WUUA 1F5WA 3HC3L 4TRPL 2HWZH 2Y5EA 3MGTA 1M71B 4HIXH 4M6OL 3U4EA 5D7JB 5EPMB 3IVKB 1OTSC 4GAYA 3D0VA 1R0AH 1R24B 3NVQA 3EYFB 1IGML 2MNUA 3T3PE 2BNQD 1QG3A 3QQNA 4PYHA 4DZBA 4K3JL 3TIEB 3RL1A 4R26L 4ZG1A 1HXYB 4EBQL 1I7UB 2X5PA 1BFTA 3MJGX 3VCLB 2AK1L 5DFWH 1FFPB 2DQIH 1NBQA 1INDH 2VITB 4CAGA 4FZ8H 3SGJA 1PGRB 1I7TA 2OMNA 4OIBA 3T0XA 4DZ8B 1MI5B 5AG9A 2DYPD 1F4AA 1EBAA 4GXVL 5TGBB 5L2KD 3QHZH 3OAYK 4CADB 1R3HA 5D1QD 1SY6A 1ZHLA 5FCSH 1PYWB 3MV9B 2PUQT 4OZGF 5DO2C 4ODHH 3LKNA 5KSBF 4UMGA 4ZFZA 1MCFA 2QSVA 4MWFB 2AAVA 4U1MB 1JE6A 1C5DB 3C6SB 4RMUA 1QFPA 4LEXH 2Y07H 4U6HA 4IOIB 5CD3B 1NCUA 1H3PH 1WAAA 3LB6D 3LQMA 5DUBA 5BO1H 5DUML 3VFOB 2Z9TA 1A6UL 3BN9D 4ZS7L 1HQ4A 4DVRL 4K3DH 4Z7VA 1KCSH 5BRZD 1FCCA 5LXGL 4Z7NE 4EN3B 2IFGA 4AH2B 1B88A 2YMXL 3N9GH 4DJMA 4AQ1B 3ABZA 1K4DA 1IKNC 4JGUA 4EIGB 1RD6A 4JY5H 2VZVA 1T5WA 3H3BC 5E2TH 2IG2L 4O58L 1P69B 2E9JA 3TCLA 3WFCL 2GT9A 3ELAT 3HCVB 3T2OA 3MLTB 1MJ8L 2DLGA 2E6JA 3VRJB 5D2LB 3LVEA 4KTYA 4OCWL 3BPNB 5I1IH 1F6FB 3GMMA 4KRLB 3GHEH 3BQUD 4QRUB 3ZMRA 3DLQR 3DSFL 4YHOH 2G9HB 4EQ2A 1ZSDA 2R2HA 5TQ2H 1T80A 3VW3L 1WF5A 1U8QA 2AV7A 4JFXB 1CGSH 15C8L 1IAIH 4ZOBA 5JUEL 4HUXA 5DJ2A 3O6KH 4X80H 3GSRA 3TNNB 2FEDD 4LCWB 4UV7H 5C0EA 5EOQH 4GAFB 1INQB 3QZWG 2X4UB 3S9DB 1REIA 4ERSH 4G6KH 1MCQA 1RJLA 3OWEA 1Z0NA 2WW8A 5GQBA 1KN4H 4NRYA 4XCFL 5EN2A 5HYJA 4PRBA 2XTLA 2OJZL 2OTWA 2E9BA 5CEZE 4FP8L 2OXGA 1CFQB 4E41B 1LO3H 4QLRA 3HZYB 2PW2B 1MPAL 2E7MA 2BJML 3T0BA 1J8HA 2VZUA 1NDMB 4XVJH 1A7PL 2P8PA 4M02A 5D2NE 2Q3AA 4MQSB 3RVXC 1JRHH 2BNRB 4OBRA 3ZDYF 3I9GH 4QT5B 1MLBA 5FA4A 5JDSA 4YPGB 5EO0A 4KJPD 4AIOA 1CFTB 1WZKA 1JF1A 2XNAB 4WFGE 4PJ7F 2X4RB 4I18B 1RHFA 2EE2A 4ZS6C 3FQUA 5BZWB 3QUYB 4I3RH 2ZOKB 5IROC 1TIUA 1DBMH 2UVFA 4ZNCD 1Z9MA 2X1OA 3QH3B 1Z5LB 3GJEA 5IHBA 4J4PD 5EZJA 1XCTA 4HBCH 3RDTC 3WNPA 4K7PH 3RL2A 5GPRA 4KTDH 2KZ1B 3MV7D 4NQUA 4LEOB 2X7LB 4OLEA 5D1XD 3R4DA 2WIIB 1UG9A 5C9JB 3HZVB 1UGNA 1U42A 1AQKL 2F53B 5E4IA 4N9GB 3BKJH 4UB0L 4JKPL 2FB4L 2ZCKH 3QG7H 4KK9C 3G5YA 1ORQB 3FFDA 1I75A 4W4OC 2NNAA 5FF6A 4F7CB 4KAQH 1CD8A 4BFIB 4OT1H 2VOTA 3NA9L 4TSCL 3T0ED 3FT3A 4IJ3B 2VL4A 3GM0A 1BPVA 5ACZA 4XBEL 4EDXB 1HSBA 4JO1H 1KXVC 4ZO7A 2WWKT 4PJBA 2D03L 1M7XA 4FTVB 3VXSB 4NYLA 2H9GB 3CVHL 3OAZH 2WINA 3MLZL 1B2WH 3QCTH 4DQOH 1CD1A 2B1AH 5JTWA 4NKIL 1MCIA 1BVLA 3UTTD 5ADOL 1AGFB 1G1CA 3P4NB 5FUOL 4E42B 4OSUL 3LEVH 1MQKL 4WW2A 4YXHL 3E6HB 2XWJA 5C0NC 1VFBA 5L7XL 1QR1B 1D7FA 1T20A 4LKCB 4P5TA 3QBTB 5I1LA 3BD4A 1BVKB 5C08E 4M7KL 4L4TB 3B2UC 2ARJB 2P1YA 5B8CA 2R2BB 4L8BB 5KW9L 2PXYD 3SBWC 4J4PC 2EE6A 1ZLVK 1VFAA 1OAYH 4XNQA 1IAIM 4C58B 5GS0L 5DDHB 4O5LH 3SPVA 2DWDB 3IDXL 5CSBA 4HS8L 1BIIA 1UKQA 4FXKA 5EUOA 1S9VA 3VXRA 1N64H 1MAML 4PJFA 4PTTA 5J1SC 3V6OE 2BNUB 3D39B 4HMDA 1IBGH 3B9KC 3HI5L 2UWEE 1OP9A 5SWSB 4GRLB 2OI9C 5C86A 4YBHA 1YNKL 4GRWH 3NFPA 2UZXB 3KPLB 4FQHB 2P5WD 2ICCA 5C3TA 2WP3O 3GMQB 5BRZB 5E1AA 3VD7A 1FNHA 5JORB 2VXQL 3D48R 5DQ9A 2CGRH 2JCCE 5JNYB 5I16A 3SO5A 3U46A 2FD6L 5D7IB 4CW1A 5ESQA 1KYOJ 3VFRB 3KLDA 3B83A 3PUCA 4POZC 5IP4A 3RHWK 1NCDL 4I18C 3C5ZD 4GAGL 2GTZA 5D5ME 3QEQA 1FRGL 1CDIA 1Z9OA 1J86A 3OAUH 3D25B 4KZEH 5D7JD 3BDYH 5T3ZE 4HXAH 1AY1L 1FO0A 5DEFA 1K3IA 1W72B 3ZE2E 4M48H 2ZPKH 4W4NA 5F7DA 1GC1H 1DN0A 5D7LD 5JXEC 1Z2KA 2K7QA 4KKCC 1I9IL 4X99A 4XAKE 2I60L 1U2CA 5I2IB 2OTUA 4IRSB 4G7VH 2CLZB 4E5XB 2O93L 1A4JB 5HSFA 3ARZA 4A6YH 4W81A 4WU5A 1UFUA 5FFLA 5HHOB 5A40E 4GSDH 1A7BA 1G7MB 3BSZH 4UIMA 5C0FA 5CZKA 3VH8A 4J2XA 3K1KC 3HUJA 3QDGE 4OZIB 5DS8A 4XZUA 4RISL 5I17A 1EDQA 1NCWH 2DYPB 3CUPA 5KJRH 4ZAKC 5H8DA 2HT4D 5IM7B 1CG9B 5TF1H 1CLCA 1NL0L 5TDOA 2CDGA 5DYOA 2GJZA 4N8CL 1FBIL 4OLYL 4NKOB 5CJQH 4CDGC 4LLMB 1HN1A 1W72L 5HHPA 1NFKA 4GO6B 1NC2A 3O0RH 2V2WB 1CDYA 1YY9C 3FOLB 4WRLA 1YEFH 5CEZD 2DM3A 4D9LH 3L1OL 3ULSA 3G6JB 5HYQA 3ZDXF 4KY1H 4JFOA 1GL4B 1T3FA 3RI5F 5E6ID 3WS3B 5LGJA 5K93A 5DLMH 3DMMC 5D72L 2VISB 4FQPA 3DURA 3MLWH 1T0PB 1JRHI 4JFFA 5HGBB 2YUZA 4OAWB 3MA7A 3P77B 3ULVD 1RFDH 4JDTL 3DGGB 4TSBH 5F3HA 5FA3A 1U9KA 5I18H 4S1QL 2AJZA 3JZ7A 3UTSA 2FO4A 3BFOA 3C5SA 1QFWI 2B2XH 4R3SA 3L5JA 1UWGL 4XX1E 3SKMB 3T1WA 2JTDA 3HI6L 5JO5B 1DUZA 5CEYA 3HE7A 5IB4B 3D3VE 2ED7A 1QYGH 2KQNA 4Q6IA 2FJHA 1K8DA 2V9TA 1B4JH 3NZHL 2BDNH 5KS9F 4TTGA 3OXRB 3D0LB 2OXHA 4M62H 3UBXI 1HOCB 1G9ML 4TVPE 4M7ZB 4Y0GA 3CXHK 3PDOB 4OD2B 3OB0H 1BQHB 3O4OC 4MA3B 4M1GL 1T83C 2IAMA 2F8OA 3OZ9L 4XNXH 5KSBA 1GH7A 4QTIH 2DQJL 4UINL 5FHBL 4GMSH 5IFJA 4P99A 3DMMD 5DWUH 4QTHA 3CDGB 1Q0XL 4EUPB 5GGTL 1W0VB 1AC0A 1AIFB 3OR6B 3MNZA 5M94B 3BT2L 3WL9A 5FB8A 1WLHA 4CBPA 2F9BT 2ARJQ 4ONFL 5MEOB 4E41D 3F7VA 3GHBL 1YZZA 3TO4B 3QNZB 4F7TA 1RIVH 1LEGB 4U05A 2WWKO 1I8KB 2BSTA 1EXUA 1AGBB 2ESVA 4HWNA 4NQCA 4JGMA 4JM2F 2V7HB 4V1DD 2DMCA 3UDWC 2FX9H 1JMXA 2BSSB 5D1ZC 3OR7B 1RZ7H 3B5GA 3EOAB 3EFDL 3BZEA 1M05B 4LSQH 5ITBH 3G6DH 3MTRA 2W0FA 2RFXA 1TZGH 1I9EA 2QEJA 1TJHH 4PP1C 1FAIH 1QFWH 3NCFB 5JXAH 2A6JA 2RBLA 2ZUXA 3QIWA 4OB5L 3I6KB 2I9TA 1X7QA 5I8EB 2BOCA 1JZ6A 3FT2A 1NGWB 5IT2L 4BZ2H 1J88A 3NOIA 1RK0A 4UTAL 5T5NF 1H3WM 4ODUB 4X6BB 4ZYKB 2FX7L 1HHGA 3EJYC 4QXUH 3FTGA 4MB3A 2HVJA 4JFEB 1YY8B 3FO1B 3M8OH 3PDDA 2VDPL 5DEGB 5GGUA 3G6AB 5SX5H 2O5XH 4NO0B 3GBMH 3LS5L 1WBYB 2IFFH 1ETZA 1NCNA 2HTKD 4UUJB 4MMXC 4NIKB 3QIWD 4LU5H 4HWZB 5I73C 1V3KA 2X4QA 5TDNA 4WI3A 4Z0BL 3LEYH 4PV8A 1TZHB 3V52L 2D9QB 3AMKA 3BMVA 2FH6A 1LEKA 1BBJA 4FTVD 4OIIL 3RBSA 5F1IB 3VXSD 1N59B 4ZUUA 1EX0A 2VL5B 2W9DH 2X10A 3JVGA 1EVUA 5F7KC 3DVFA 2W91A 1RUAL 4I3RL 1QNZL 5D2NC 4X5XB 2YA0A 4PLNC 5IEKB 4YR6A 1HEZA 5KSVB 1H5BA 5IMKA 3K2UH 2MQ0A 2WK2A 1XGYL 2NY0C 3AREC 3ULUL 1YEEH 5HHOD 5DI8B 5CUSL 5IVXF 5DMYA 3FO2B 3WIFA 1FDLL 5IG7A 5C0AA 3B8SA 4U1LA 4X7DC 1HILA 5E6IC 5F89A 5T3XE 4KPHL 3TVMA 5FEBA 1G9EA 5I76B 4Z77A 3OKOA 3O4LE 3MLUL 3BMWA 3HAEB 2KDGA 2PXYB 2AJYH 5DSCA 2QHRL 3WJLA 3QNXB 5D96B 3GSWA 3MV7B 3SDAA 1MJJB 2FECI 2Y5TA 5BMFL 2IAMD 3LQZA 4S0TD 2IBGA 5I74C 4QGYA 2CR6A 4HPYH 2H2SD 4UILL 4XMLL 1GZPB 4DVRH 2CRIA 1QLFB 5E8NB 3GMLA 5FHAH 1RZJC 2A6KB 2NPLX 5E56A 1G7IB 3LSOA 2XA8L 3KYOB 2DLTA 3NCJL 3U7YL 3V2AR 2EXYC 4F7PB 4ODWB 3TN0D 4FZ8L 4F9LA 1INDL 2B0SH 1FNEB 5FOBA 1A3RL 2F54E 5TE7L 3V8OA 3HN3A 4OF8A 5FOJA 4UQ2A 2R8SL 4MDJA 3EO9H 5INDA 1UM5H 1CZ8L 3KLHC 3EDDA 1KB9J 2XKNA 3O2DH 3DI2B 1I1YA 1BZ9A 1UZ8A 3HUJF 5D1ZB 3D1MC 2LTQB 4DKDC 1K85A 4NQSB 3X12B 2Z91B 4YDIL 2XKUA 3BJ91 3O8XB 2MSPA 4YHNB 1WV7T 5D7JC 4GW5A 1S7VA 4OF7A 3CSPA 5DT1L 3BEWB 1DSFH 4NZTH 2L7JA 5HDQL 4Y5XC 3MLXH 1EJOH 4QO1A 4U1KB 3HC0A 1CE6B 3IFNH 5K9OA 1UKTA 2NXZC 2NY3B 3W11C 1HHJB 4R96B 4P23D 5HYJE 4TUKL 2P8MB 3V6ZA 2V2TB 5LBSH 1WZMA 3EDKA 3OF6A 5D70L 3FB6A 3WV0A 1OY3B 4E0RA 1Q9LB 3HFMH 1GPOL 5C0BB 1QSED 1F3JA 3G6JF 3V5KB 5E5RB 5DD0L 1D5XB 4LLUB 3LEYL 5IVNA 3BAEL 2VDQH 5FAAA 1NBYA 1X4XA 3DMMB 3KR3L 5KVMC 5F6IC 3M07A 1IGCH 3G5ZB 4UAOB 4GW4A 1INEL 1CWVA 3QR2A 5IGXH 4P4KA 5JW5B 4X0KB 1T1WB 3S3PA 3CZFA 4YGVA 1P9MC 1G6RH 4GBXC 1T2XA 1TVBA 3L3KA 3SJVB 1CXLA 3IGAB 5E8EA 5ANMA 4KQ3H 3BH9A 2LQRA 5IW6B 4PJ8A 4TUOA 1D5MB 4UV4L 5F9OL 4G6MH 5C0ND 4MNGA 1F3RB 1EPFA 3CX2A 4HH9A 4YC2B 3FMGH 3ZL4L 1LP9E 2Y4SA 2Z35B 3AY4C 1F4XL 4EXPX 1AQKH 5F70A 5J7CC 1P7KA 3T2NH 1PLGL 4YDLC 2JK5A 3DUSA 4OCSH 4DKFH 4CVUA 5IW6A 4QKXB 1WZ1L 1CYGA 4Y19D 2Q87A 1F3DJ 4YIQA 2C3XA 3ZTJH 5KSAA 4NHCH 4FNLL 3TEUA 4UZGA 5CZVL 1CBVL 2HLAA 3KNBB 2DBLH 5HI4D 5KZCD 1FORL 1E4XH 1Y6NR 1HQRB 3VXPB 1B90A 4NKMB 4PJHA 4EJ1C 3PWPD 3I9GL 4L9LC 4LSDA 1EJ6A 1JRHL 2E6PA 1KTLB 3VXME 2JE8A 2H2PD 3WCYA 3HE6A 2N1KA 4OGZA 2VRAA 5E9DA 3ALXA 4U0RB 1MJUH 4HFUH 3FJTA 5MENB 2YRZA 1KN2H 1YN6B 3CFBA 2CR3A 4U2YA 3PHSA 1W0WB 2XV6B 2EDKA 4E0RB 4U7MA 1OGAD 5DEZA 4OLVL 3L3DB 5ID1B 3SGDH 4PG9B 2X41A 5FYJE 5F8RC 3LD8B 1XZ0A 4N0RA 4EBQH 1PKQA 1TQCB 4MAYC 2B1HL 2PYEA 2JCCB 4NM8H 1UQSB 3DV6A 4MCYB 5DJYA 4MXWH 1RUPL 1OAQH 4PJIE 4B41A 4OLZH 1J8KA 2EH8L 3K8KA 2FWOB 3QFJB 4M7LL 4NZRL 3GSXA 1P2CB 2NXZB 4JANA 4L8SB 4K8RD 4NQSA 3VWKD 2N56A 3OF6D 4JHAH 2C26A 2F5BL 5IFAH 2XQBH 3KPSA 1JHLH 2EKJA 1EGJL 4OFDA 1ZHNA 3PXJA 5INCA 4WFGD 2KQMA 2QADC 4DUXA 1NAMB 2HRPH 4IRJA 1BFSA 4I5BB 1WTGT 2Y6SC 4D0BB 4BSWB 2V2XA 1XF4B 2Q8AL 1F58H 2P43B 2EDTA 2Z0BA 5FYLD 5ILTL 3S96A 4NCDA 1NMCB 5J06A 4NC2B 1J1OH 4JHWH 1N4XL 4U6XA 1LO4H 1U8KA 4EI6A 2GCYA 4KUCF 4BQBA 4PRPE 1IE5A 2OLDA 5JHDE 3U9PL 1MOEA 3U0TA 2XOTA 4H20H 3ALPA 3DECA 5HGAB 4FRWA 1CT8A 1BQLL 3UXFA 4YEFA 4F7MA 4DOHB 1CTOA 1HXMA 4L5FL 1MWAA 4ODVH 5KVGH 1X5YA 4JLRA 4YXLH 1I3GL 2HJKA 4IJ3C 3HMXL 2EDHA 5F97E 3TNMA 3BD3A 3QXVA 4OLWH 3MCG1 1S7WB 3C60A 2D0HA 1HHHB 3IXTB 2VXSL 2XZAL 2VKXA 2DKUA 1H5BB 3GBLA 4YR6B 3IJYA 2HJFA 2DL9A 1SMAA 3FT4B 4X5XA 1BOGB 4OGAC 2I9LA 4U7KA 1IT9L 4YK4B 4N5UA 3P30H 2OP4H 3VRLE 1IEAB 1K5NB 4OI9A 4H26A 2MCPL 3GIVA 3QIBD 1U6AH 6CGTA 1OOAA 5FK9A 3CD4A 5FK9B 2PCPB 4H0HB 4S1RH 1PY4A 3Q1SL 1OWWA 5TDNB 1JBJA 3GBNH 4HWZA 4H26B 1JFQH 3KS0H 3FFCD 2Q6WA 2CJUH 2R39A 4LCIL 5F9JB 4HUWB 1BQUA 4J12A 2HVJB 1OPGH 4V2CB 5KAQG 3MLPA 2D7QA 2GUOA 4JG1L 4ZYKA 4N0YL 4HDIB 2B1HH 1R3LA 1HI6B 1DP0A 2A77H 2ENYA 2ADIB 5C2BL 2XRAL 3VXUE 1P4IH 5HDOA 4OCWH 1QKZL 4QNPE 1U92A 4V2BA 4LCUB 4NJAH 2P44B 4XHQA 4KRMB 5AEAA 1G7HA 4JM4H 4OD3L 4TVPL 5JW4Q 1EHAA 3RBGA 1MWAB 4JPIA 1GZQA 3HNTH 4L4TD 2LU3A 1A47A 1KCVL 4X6DE 1U8PB 5FKPA 3LRSA 2WM0A 2IWGA 3UO1L 1GGIH 1A7OH 5T5FH 3BGMA 5BVPL 2I24N 4KVCH 1XGRB 3BKYL 1QBAA 2BY3A 1SJHA 1AGBA 2ESVB 3RVTD 4XAWL 1DQLL 1NGQH 3DPBA 4HCRA 4KPHH 3X13A 4EI6B 1LEGA 1Z9LA 3HNVH 3MODL 5ILTH 1YNTB 2VXTL 4WHTB 4WO4D 4MAYD 3A0OA 4AZ8A 5GRUL 3WL9B 4DEPC 5SWSD 3GMNB 1YMME 1RPQA 2V2XB 3F58H 4H8WH 4LGPB 4GOSA 5GGSB 4OZHB 1NAMA 3BP6B 4A2LA 5ICZB 5MEND 3MRMB 5ESAA 3FZUC 1VFOA 1XF5B 4XMPL 4YPJA 1BQHA 1UC6A 4XBEH 3ARBC 4N1CA 5L6YH 4GKOA 3NIDE 2ZCLH 3W9DA 1A7PH 3PXHA 1X5HA 5MHSE 3QFJA 3UPRA 4ZTOL 4LOUD 4NQXA 3WMSA 2DJUA 4V1DE 4JVPA 5C0CA 3Q6GH 4GQ9H 4FZEH 5DUPH 1EERB 4X6CF 1U8LB 3DV6B 4MCYA 4J7RA 1CZ8H 2MHAA 4Q6IB 3MXWL 1PKQB 3GGWA 4PRAA 3V5HB 1Q38A 5IB4A 1ZVYA 4PJBF 2JJTA 3SKMA 3QNYB 1AR1C 4XH2B 2ENSA 2B7DT 1NH6A 4G80B 4PJXF 3ROOB 4LQFL 4D94A 4LKXA 1CDBA 3SKJH 4HH8A 1SEBB 3PHQA 3ARDC 4HAFA 1S3KL 5CBAA 5GISH 2IGFL 1RVFH 5GS3A 3LH2L 4KI1A 1CL7L 1H8OA 4KROD 3CH8A 2V6HA 4ZODA 5DMGD 5E9DB 3GSNH 2JIXD 1ZMYA 2BMKB 1MCBA 2XWTA 2VISA 4JJHA 3WKNA 4F9LC 2XKSA 5ICYA 1UJ3B 4JM2D 3PWLB 1IRAY 3C09C 1LEIA 1N6VA 4NC1C 1OSZB 5KSAB 1OT2A 3EUUA 4XWOD 1N7MH 4RFNC 1XH3A 4JY5L 2VXVH 1CICA 1TITA 1TVHB 3V6FB 1SYSA 4HUUA 2R29L 3LD8C 3BIAX 5F6HJ 1P7KB 1YMMB 2PW1B 1MFCL 1RIHH 3HS0B 4G8FA 4NKOA 3TVMC 3NCBB 1C08B 4MJ6B 4WHDA 1G0DA 2KZWA 2YR3A 2EDLA 3P4MB 3NN8A 2D7NA 1MUJA 2D0FA 4TQEH 5E8EB 1GVIA 1UZ6E 3WXWH 3TH2T 3OG6B 3VJ6A 3C6LD 3L3KB 3SJVA 5I8KH 1A4JA 3VWJC 1IMHC 2CLZA 4E5XA 1SMOA 4IRSA 4U6TA 1HE7A 1HINL 3E6FB 2EYSB 4GW4B 1CI5A 4JE4B 5DA0B 2VLKD 4D2NA 4Q0XH 3T0AA 4CMHB 2Z92B 4Y5YC 3ULUD 1EEZB 1F2XK 4OZGE 1WUNT 5C0CD 3WDJA 4HGWA 3KYNA 3D25A 3QEQB 4LLYA 1YNKH 1I3VA 4I77H 4FQIL 1OQXA 4ZNEA 5JIKA 1D6VL 5H94B 1ZA3A 2VC2H 4LLAA 1A9BB 3FFCB 4MNQE 4K9EL 1TNNA 2P8MA 3A67H 2PTUA 4BH8B 2XICA 2G2RB 1HHJA 4G3YL 3SQOL 3QG6A 1CGVA 3MV8B 2EO1A 1NGPL 4JCLA 4M6MH 1RUQL 2W1NA 3LCYA 3TT1H 1DZBA 5CMAB 1IEBA 4LRIA 1MJ7H 4QEGA 3NIFF 4P4RB 1RZFH 1S78D 5I1JL 4IMKC 1KV3A 1BREA 3PABB 3NFPB 4FQHA 2R1XB 1S7VB 4JN1H 3L1OH 4GW5B 4Q6IC 4M9OA 4M6AA 4LP4A 3HE7C 4PJ7B 1U3JA 4XPAH 4YHZH 2BNUA 3D39A 5EU3A 4UT9H 1YYLH 2XFXA 4UQ3B 3SKJL 1BZ9B 3D2UD 4QHUA 4X9FA 1NANI 4X7SL 2FGZA 1QRNA 3MGOA 3SPVB 4M4RA 2HT2D 3VE0A 1YPZB 2FH8A 3LN4A 3UYPA 4YK4C 2ZUVA 2HKHL 1LVEA 5E95B 2ICEA 5E2WH 3ZYOA 1J05A 2CO6B 3BSZL 3VMOA 3CXDL 1OT1A 2DQEH 2R0LH 1T20B 4WV1B 3SE9L 5HYSA 4ODWA 2XG5A 3UJIH 2VUOA 5C0IA 1UCBL 1KEML 4XCEB 3KYOA 3QFJD 1EUUA 4C57C 4XBPA 3GMLB 5A2LH 1UXWA 5EIIA 4CRPA 3NA9H 3BZFB 5IQ7H 3AXLB 3WFBL 5IVXA 1QYGL 1JGEA 2DKSA 2BX5A 4BSVA 5IB3A 1CU4H 3L3HA 1PAMA 2JLLA 4Z78A 3KYMB 1T21B 1LMKA 3GSWB 4FFYL 2V5RA 4NYLB 3U30B 3IDYB 3LIZH 1DJSA 1S5HB 3L7EB 2XZCL 4KUZL 4PJBB 3C2AH 5IMOB 4LHUB 4CNIB 3CLFL 4HX1A 5F1NA 2EEAA 3QEQE 1KUMA 3HE7D 4YHLH 1CDUA 3FQTA 3BHBB 1I3UA 3BKCH 4APQA 3MRRB 2YD1A 4Q58C 1TCRB 5D72H 5D7SL 3KJ4C 2HH0H 3CH1A 5IEKA 5LWYL 3T0VA 4XP6L 5I1EH 3QUXC 2COQA 1RAMA 4OD1L 4QRPE 3EO0B 5TJWK 2AKRB 3O3DA 4NM4H 3GJFH 1KCKA 4AK1A 1KJ2A 5FGBA 4F2MB 1F00I 4OJFH 4XGZB 4PV8B 3MRKA 1N3NA 4GQPH 4CN4A 2NW2A 1Z5LA 4KK6D 5FECA 3D18A 1WBYA 1ACYH 2GK0A 3QJHA 4RNRB 2UUDH 3LHPH 3C60D 5HHXL 5SWZA 4YXKH 4LFHD 4I18A 2DLHA 3IFOB 1JF1B 4Y2DB 3FTGB 3G04B 1QBLL 1FORH 4YPGA 5EO0B 4JFEE 4JRYA 3IU3B 4ODUA 2BNRA 3ZKXC 4OZ4A 3F5WA 3O9WA 2ICWB 4IMLB 4YBLB 3S36H 3CDFA 1ACZA 1X7QB 3O8XC 2VLRE 1JHKH 2P45B 4E41A 4NQED 1U2HA 1T7XA 3BP7B 2O5ZL 5GS0C 4G8IB 3ECBB 2QSCH 3EOTH 5KVEH 4RGND 1XGPA 4WHYH 4DAGL 4GAGH 2X4NB 1S9XB 1F02I 1DBJL 3QUYD 1M05A 1V7NL 3GBML 4V1DB 4UV4H 1FLRL 2P8LB 5FYKU 1UWGH 1MIML 4OV5A 4QY8A 5B38G 4Y4HB 3FKUS 3GO1H 3LKOB 2YWYA 4PJHF 3VG0H 1I8KA 4XI5C 1P4LA 3QNZA 4ODXA 4KVNL 5I30L 2ZUSA 2EDBA 3RY6A 4U33A 5GRXG 4HCRH 3HI5H 3OR6A 3F7QA 1XGUB 1WCBA 1LK2A 2ED8A 2ILLA 4MHHI 4HG4K 4FABL 1FVDB 3CDGA 5ITBL 4NDMB 3O2VL 1RZGA 2XN9E 2OYPA 2AXJA 2FX8L 2WIMA 1P7QD 2N7AA 1A6VL 5D4QA 2QBWA 3MBXH 5JOFA 4LLWB 4XAKD 3MOQA 3U4BH 3L5WA 1YEIL 3ULUE 2EO9A 5C09E 3MLTA 3MC0A 5TH2A 3LPGA 1HDMA 1LP9F 3U30C 3IDYC 2XZCH 4KUZH 3QDGD 4LSTL 1ZHBA 4ODSL 4P9HL 1WGOA 3JV0A 4KWUA 1PG7H 1MI5E 3N1MC 3IKKA 4OZFH 4S1DD 3P11L 4PJDE 2H3NA 3VD3A 3OSKA 2IPUG 1QSFD 4XVTH 3QHZL 1IAKA 1HQ4B 5ETUA 4C59B 2NY2B 4NQTA 3T0DA 4DUVA 5CP7B 3HLAA 3WFDL 1KIRB 4U3XA 1B0WA 1MPAH 3U48A 2AEQH 2EH7H 2R0WL 1UEYA 3LN5B 2C3HA 4NGHL 3D2UA 1C5DA 5FA3B 5F3HB 5IK3B 1S7TA 5E6YA 1RMFL 3SBWA 4OB5H 3OPZL 5HGBA 1YJDL 5FIEA 3QUKA 2OL3H 3MV9A 5JQ6L 5JZ7C 1R3HB 1CE1L 3KPPB 5LGJB 1I8IA 4U0RC 2FATL 5IROA 2UZIH 1BM3L 4OUUA 4AL8H 1FL3B 3MLYH 3S5LG 4Y2DC 5JPMB 3W5NA 3ROLA 4FQCL 5F72S 4GRLD 1OGTB 4Z18A 2Y7QB 3SGEI 4HC1L 4XT1C 3QSKB 43C9A 2N7BA 5KS9B 4LLDA 5TQ0L 3FZUD 7CGTA 3VG9C 4BA8A 5HGHA 5FUZL 5HHPB 5I9QC 1YDPB 1BEYH 1HXYA 1UB5A 3C08L 3PQYD 1IC1A 1VFUA 3O41A 4BELD 3UTPE 1O7SA 5EOTB 1Y18B 4DOHE 5AZ2L 2W9EH 1CG9A 2HT3C 5IM7A 4PGEA 2X89D 2FIKB 3RKDC 3RWHB 2E7LC 4PLKC 3EYVB 4XZUB 3VH8B 1G9NL 1JIBA 2CUIA 2KL6A 1DANU 1JJUA 2YXMA 5KN5B 1G7JB 1XF2A 3BGAA 5D1XA 4JFPA 4N0FB 5C2BH 1GHFH 4OZFB 2GITB 3C6LA 2Z4QB 4L3CA 4Z76A 3GUTB 3ZE2F 1FGVH 3IF1B 1DL7H 4FABH 3FRUB 2LABA 3Q3GB 4NKDB 2YSSB 4WU7A 5HHMB 4YDIH 1X5JA 4N0UA 1WQVT 4YE4L 2AJ3A 1DCLA 1FGNL 1YN7A 3O6LH 3QEUA 5IJKA 1RIUL 3T8XA 3I84A 5AUMA 1AO7E 1KIPA 5I0ZA 3QIUA 1FZJA 4N0CC 1KJVB 1A64A 3KDMB 4L29A 5C08D 5TFSL 3AGVA 5IHUL 4MZ3A 1S7SB 2HN7A 4Q0XL 4CW1B 4R7NA 3KPQA 3EFFB 1Y6MR 5I16B 4UTAH 1A7RL 4GG6F 1PG7L 5IHLB 1QP1A 4JM2A 1AXSB 5CIPB 3QI9A 4XNMA 3T4YB 3WNMA 5ADPL 3MJ9A 3WE6A 5MEQA 2M2DA 1F4WL 3O3EB 2NLJA 4TNVK 4UU9B 3U1SL 1A6AB 1BD2B 2D0GA 3KLAB 4ZS6D 5K9JL 3KLHD 1U3HB 4PJFB 3MRFB 1FJ1B 3N1GC 4N5ED 4NQDE 5EIQA 1AO7B 1BWWA 4Z7UE 4LP5A 1IC4H 1JGDB 3ARWA 1B3JA 1A4KB 3T4AB 3VFPA 4UT6L 5AD0A 3CPLB 4WFHE 1AD9B 1IGYB 1RZFL 1BHGA 4P2OC 3QI9D 3INUH 3QULA 5FCUH 1S9WA 1X5LA 4OLUL 4XVUD 2OR9L 4GUPA 1CFSA 4OFPA 2GK2A 3C5ZB 1BVKA 5IVZA 4P5TB 3BKYH 1CLYH 3VDAA 1KNOA 1NGQL 1H0DA 2WUBH 4MNQD 2XWJB 2VXTH 2YRPA 3GB7B 1UWXH 1C5CL 2VQTA 4X6CE 1AGFA 2FJGA 3O3UN 3P4NA 1YEDA 3UC0H 1CVSC 3FHAA 1I9IH 1S7UA 4RX4A 1T7WA 3L7FA 4JG0L 3R1GL 5AZEL 4ENED 2R56H 5DJXB 4RQQA 1AD0B 4FFZL 2IALA 4WFHD 1WIOA 4DVBB 2BP3A 4HXBL 2OI9B 1FLTX 4XPFL 2DLFL 3BGFB 2W38A 3MRGB 4WTZG 4NSKA 3NGBB 2Y9RT 3NZ8A 3QQ4B 1IKNA 4EDXA 4X8JA 1CBVH 3OJDA 3RNQB 1C7SA 1HIMH 3AFLA 3WSQH 5MERB 2AERT 5DRXA 4PRHA 3HRZB 1CD9B 4BFIA 5IW1A 4HT1L 4KV5F 3UX9B 1BGXH 1F58L 2CDEB 4NWTL 1GHFL 5K59F 2QSTA 3TA3A 2I07B 1JK8B 4Y4HC 1NC4A 3SO3B 3JTSA 3MRQA 3V4VL 1K6QH 4XX1G 4JB9L 4OCRH 3HZKB 5CZXC 5C08A 3VFNB 1OP3H 1FIGH 3N0PB 3RL2B 3LV3A 3MXVL 4KC3B 1NFDB 4HJJL 2NXZD 5EZJB 3JV4A 4Z7UF 4YE4H 4PRPB 3FFCE 3WKMH 4XP6H 2IQAB 3GSQA 1EZVY 1MCSA 5DF0A 5A2KH 3PV7A 5B4MD 3MLWL 5BZWA 1NCBH 1RURL 1N2RB 1CFTA 5CGMA 4JPWH 3IDNB 2VLJB 1KCUH 1R5IB 4LAJH 3U2SB 1KG0B 3R8BB 4DTGL 4S2SA 2MWCA 4OZGA 2DF3A 3N1FC 1YJDC 1IM9D 2NW3A 3VXOA 5I1GL 4NRZA 3CLEH 4JJ5B 1U8HA 2X6MA 4LCCA 3EYUH 2J8UF 2AJUH 2AJVH 3C8DA 5LBSL 4BH7A 2P48B 5DK2B 4YZFF 1RJLB 2ATPA 4C83B 1U3HC 1IL1B 2DS4A 4Y7MA 3ILQD 1X6LA 4K9EH 4YNYB 35C8H 1H3XA 3UTQB 8FABA 1DFBL 5BS0B 4G3YH 1JUFA 3DHJA 4PJ5A 5KAQF 1KBGH 4MHHG 4JFQB 5HHQA 2AJXH 2PETA 3Q1SH 2ADFH 4HS6B 4P2OB 3MOAH 1DVFB 3WFEH 3ZZ1A 1E6JL 5IEHB 4DAGH 3A6CH 1G7QA 2J1KA 2ED9A 2AV7B 2ZCHH 3MLVL 4NQEB 1GRWA 1RK1B 3M45A 3KPSD 4IDLA 1BJ1J 1CD0A 1G7QB 2CKBH 3ARGA 5C0RL 4LK4A 1T7YA 5IESH 5EOCJ 1FPTH 4HKJB 1HINH 1QLEL 4JFYB 2FYYB 4JZOB 3W0WE 3MRIB 4U1JA 5LJYH 5FDWB 4JFQA 4PJ5B 3UYOD 4U49A 4CMMB 1P1ZA 4MMZC 3UTQA 3W5MA 4YNYA 3DRQB 4ALAH 5EB9A 4HBQA 4RFNB 1CTNA 1FVEA 3QDJA 4Y16C 5I1KL 4OGAD 5CJOH 4YDKH 1PSKL 1K2DA 3HR5B 5DRNA 5TE4H 3S7GA 3VXUD 5T1KB 5DK2A 4PJ9D 1T66C 2LU7A 4U2ZA 3N85L 1V3MA 4OKVB 5FDYA 4BJLA 5T5FL 2UZYB 4PGDB 3TZVA 3VD5A 5BW7A 5T33L 3P30L 4NO3B 2NW3B 4M7ZC 1W2KT 4Y2OA 2CXGA 4ZPTB 3LS4L 2YPVH 5AAMA 4YHPB 3P73A 1TZIB 4QCIA 4PJ9C 5JIIA 1I1FA 4RWYL 1I8MB 4GJTB 2L0DA 4IOIA 1QLRB 1QEWA 3SO3C 4OCRL 3ZTNH 1JNNL 1WBXA 2R2EB 1TTFA 4MWFA 3JUYA 2L4OA 4PRPA 5D6DA 3W11D 1YYLL 4M8QB 4GRWB 5GGRY 3MRJA 1KPUA 2IQ9H 1R5VA 2HG5A 2Q8BH 3MJ9L 4JPVL 3W39A 2NZ9D 4RRPG 1D5IL 2P49B 5I1CH 3ARFD 3G5XB 4P5TD 1L9MA 1MRDH 1N6UA 1JK8A 5GS1B 1PX3A 2ESVD 4I3SH 4NN7C 2VKWA 1M6OB 2X9YA 5B39B 1GJIA 4HWBL 4JO4L 3ZE0F 3FAXA 3ZKSD 3KS0J 3VFTA 3UTTA 2R69H 5FYJL 5IW1B 5DJCB 5EO1A 3GZKA 3GJFK 1U6AL 3UYRL 4YHKL 5DRXB 2EKSA 1OTTD 1BIHA 3QIBA 4ZO6A 3WLWC 5KVDH 1HYSD 4WJ5A 1S5IL 4JQIL 2WBJD 3TCXA 1V3LA 4K71C 5DJ0B 4NSKB 3NPSB 3QDMA 3QZWA 1SY6H 4KUCD 3IVKA 3FO0H 5AYUL 3HPLA 4OQTH 4KJWD 1MJUL 1NGZA 2WWMD 5DMKB 5DJXA 1SBSL 4IOSD 1JF5A 1JGUL 4ZDHA 1UT9A 5L8JB 2E7BA 3NIGE 3VXTB 1YNLL 1JZ7A 5EO9B 3STZB 3STLA 1MHCA 4L4VA 3PP3H 1LDPL 1BBDH 4OIAA 4PG2A 4YHMH 5IBTH 3IJHB 1UZ6F 2CK2A 4MSWA 4WWKA 1JWMA 2JB6B 2QL1A 1QFWM 4XNYL 1KLGB 1F6LL 4I0PD 5GIRA 1MAKA 2X70B 3DSNA 4JFED 3SKNB 1KIQB 3HMWL 4XNUL 1FFNB 1KC5H 1DQJA 2AV1A 2C5DC 2WBKA 3LKRB 1GGBL 1J1XH 5JLZA 4LLQA 2IPKB 1MCRA 1S9YA 5EWIH 2Y23A 1QVOB 4L5FH 1MAMH 1MHEA 2VZSA 3FAWA 3R0MA 3B5HA 5DD6B 3MV9E 5CJ8A 5F8QC 3K7UA 2YPLA 5C7XL 4Y16B 3KJ6H 1JZ2A 2XN9A 1XCQA 4FQXA 4OCLC 1F11A 4XP5H 5E8OA 2XG4A 1KTDB 2E3VA 3JWDL 4RGMC 5FO9A 4ISVA 3O3EA 2XZAH 2HRPL 2HKFH 5MEPA 1EGJA 5CIPA 4JM2B 2AABH 4B0MM 1XFPA 4ISVB 1I7RB 5CBEB 4ZFGH 2FX8H 3MV01 3BW9A 1EEYA 2DM2A 2WNGA 4TYUA 2A6DB 2VR4A 4H25B 2FEDC 3VGAB 4HUKB 1IQWH 5CJXC 1QO3B 5DD6A 2F15A 1MHEB 4Z7VE 4M6NH 4MA8H 5L8KB 1PFCA 3OJVC 3IAPA 1FZOA 1YECH 3QUYC 4Q7DA 1AGEA 4MS8C 1FN4B 2IPKA 3MMEB 4PGCB 1WITA 5ISZE 3LKRA 4W70A 3S4SB 2CJUL 2YSSA 4WU7B 1E4JA 4NKDA 1DANT 3SKNA 2FIRT 3THML 2OSLA 1UH2A 5GIRB 3PP3K 1U8IB 2BSED 3OHXA 2J3SA 4Z76B 1N5AB 3IJHA 1FO0H 3VD4A 3WFDH 4D0CA 1AR1D 4P2RD 3C6LB 4LCYB 5EBMB 3STLB 1ZS8B 1L7IL 1UM4H 4KHTH 3OJ2C 4ZXBB 3UBXB 1A14H 4YDJA 4Z7QE 3VXTA 1NGPH 4M6ML 3TT1L 3HE6D 3WDIA 1OAUL 1F3DH 5EU4A 2BVTA 5E5MB 2GY7B 1I9JH 3PJSA 2V9RA 4G8GA 3D87B 3B9VA 2CLVA 2VZTA 2HLFC 5C0AE 3ZKXB 4RZCB 3RWHA 4WFED 1GIGL 2FIKA 2BCKB 3DVGA 1ND0B 3ARSA 3QZWB 3ZE1E 1F13A 3I6GB 1FCGA 5H37G 3PWUB 3T1FB 4M93B 3MRHB 2GI7A 3BVNB 1SYVA 3QFDB 5EORH 4WI7A 3TPUB 5JW4R 3SDYH 4LPXA 3DX9B 2BNRE 2VDNL 3JTTA 1YDPA 1YEFL 2Z8RA 5EO1B 1DQLH 3PWNB 3HG1A 5K9KA 3VFTB 4RAVB 4P2YA 3ZHKA 2LAAA 4R0LA 4TPRL 2OS7A 5F7NC 4PJDB 3RUGE 3MV8D 3AM8A 1ZLUK 2YA2A 5GS1A 5DJ8B 5IB2A 4YHML 3P11H 1BD2E 4TOYL 5FUZH 2X4TB 2DIJA 5I1AA 3M1BA 3Q5TA 4QYOA 3MA9L 3T77B 2FLBT 3KPPA 3VGGA 3GFUA 2Y72A 2ZJSL 1RSFA 4LRNL 5CGYD 3QUML 3T08A 2FJFA 3TV3H 1W8NA 1T1ZA 4M8QA 1MCDA 3FONB 3DETC 2EIEA 3ORJA 4HK0A 2D9CA 1Y6KR 2AK4B 3C8KB 3NFSL 4HKXA 1MCPL 3ZT5A 1XF1A 2YC1A 3R0NA 2UYLB 1HH9B 3CFKB 4QCIB 1JV5B 1EO8H