4XP6H

X-ray structure of drosophila dopamine transporter bound to psychostimulant methamphetamine
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
219
Chain Sequence
b'EVQLVESGGGLVKPGGSLKLSCAASGFTFSSYAMSWVRQSPEKRLEWVAEISSGGRYIYYSDTVTGRFTISRDNARNILHLEMSSLRSEDTAMYYCARGEVRQRGFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transporter
publication title Neurotransmitter and psychostimulant recognition by the dopamine transporter.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Tranport protein/inhibitor
total genus 38
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2015-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp6H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xp6H01
3VFSA 4K7PX 4UBDC 3AB0B 3O3AB 3EKCA 1P4BL 3MV8D 2X4NB 1IAOB 3V5KA 5IVXA 2DMCA 1G7MA 4AYFA 4NP4L 1O5DT 1FNAA 4NO2B 4ZO6A 5HHVH 1F42A 2PETA 4NZUH 5EFIA 5MEND 3QQ3B 4P9ML 3QXWA 5GGQH 2C4FT 2VDPL 4J3UA 3OAZH 1PZ5A 1YPZE 4NUJA 1EGJL 1CFSB 3RY6C 3VXRA 4J3TA 3JWNC 3U9UA 2CJUH 4L29B 2V9RA 1CD9B 5GS3A 1CXFA 2NY7L 3BZDA 4ZDHB 3SDXE 5A2IH 5JIHA 5DD1L 1G0DA 4H25A 1VGKA 4NQSA 4XP6L 4NO0D 1CZ8H 4X9GA 2VDRH 5TQ0H 4HDIA 3RVWC 4BH7B 1S7VA 5SWZB 4K3GA 1F11A 2IPKA 5DD0H 4MSWA 5KSBF 4UNTA 5D71L 1KFAL 3MLTB 4G6ML 3T0ED 2VDNL 4OLEA 5JPNB 4XPHL 4WIQA 2AJXL 5D9SA 5K9JL 5B22A 1IMHC 2UUDK 2J8HA 1CCZA 4DGIH 3V6FB 4X80L 1RZJH 1LK3L 2GQHA 5HHOE 1GIGL 3D0LB 4GRLB 3BKJL 1UM6L 5E9DD 4MS8C 1ZLSH 1CICC 1EZVX 1IAOA 2ARJA 2X4NA 3S96B 3T09A 2AI0L 4OZHE 3EYQC 4G9FE 3N9GL 4WUUE 4JFFD 4NO2A 2BJML 2UWEF 4FOMA 1OGTB 1AFVL 3QQ3A 3I85A 1JBJA 3RVTC 1KLFA 2CK0L 1OAZH 3WFBL 2RFXB 4JJ5B 1CFSA 4YXLH 2NY6B 4L29A 4FFWC 2AJSH 3S3JA 4ZDHA 2J3SA 3U1SL 2K7QA 1LP9F 2BNRD 3SE3A 4ERSH 4Z5RB 2PF6A 4PRNB 1B0WA 4MAYC 1WBXB 2EC9U 2VZVA 2FH6A 4FFZH 5LBSL 5A2FA 3GM0A 1FAIL 2IAMB 1HSAB 4K8RL 1IARB 1NCNA 4BH7A 5SWZA 2X42A 5HY9B 3FOMB 3MA9H 4BZ2H 3HI5H 4F57L 3MLTA 1RIVL 1A6TB 3INUH 4HXAL 2D0FA 5JPNA 4GG6B 5EOQH 4Z6AT 4M61B 3EJZC 1FVEB 2C1OA 3RL2B 3K2UH 3MGAA 3V6FA 1A6UH 1ES0B 4ZPTB 5ESAB 3D0LA 3V79C 1OM3H 4GRLA 5E24E 4JFDD 2FEDD 3ZYIA 3S96A 1EO7A 3QIUC 1R3JB 4PTUB 1K6QH 5GGTL 5IIEB 4HMDA 4OM0L 2E9JA 2KQNA 4DFHA 2CMRL 4JRXD 4FQQB 1OGTA 3F6IA 2B1AH 2OJZH 3IDMB 3QIWD 5DT1L 1WIUA 4RGNC 2ZZUT 4HC1A 2EXWD 4HGKC 1GGYA 4YBLC 4F7MB 2LE9A 2RFXA 3WFDL 3ROOB 3NCYP 1L7TH 1G6RL 4LHUD 2BK8A 4WFFD 1T2QH 4Z5RA 4PRNA 1WBXA 4LNRB 3MV9B 2AEPL 4K94L 3MACH 1VFUA 5ECJE 3SY0B 2IAMA 1HSAA 4QXTB 1EMTL 3RZCC 2YRLA 1JNLH 3CDYA 3D1MC 3BUTA 5HY9A 4DGYL 3FOMA 2ZNWA 2PTTB 5L7XH 1FSKB 2ZUUA 1A6TA 4HUKB 5EUOF 2O5ZL 2OP4H 2ZOLB 4YE4L 4GG6A 3JUYA 4M61A 1VACB 1FVEA 1MSPA 2VQTA 4I3RH 3RL2A 4PJ8B 4D9RE 1JI2A 4GUPB 1ES0A 4ZPTA 4P5TD 5ESAA 4MXQD 4J3OC 1NCWH 5DJ0B 1BM3H 1T7YA 1R3JA 4PTUA 2X1QA 5IIEA 1PG7W 2ZJSH 3N1MC 1V8HA 3D85D 2FLRT 4XWOC 4P2OD 1BQHB 2J1KA 3IDMA 8FABB 2XQBL 1YEHH 4G5ZH 1YMMB 2A83B 5T33L 4JG1L 3B5HA 4KY1L 1FE8H 4XMKH 3VXUA 3LRHA 4F7MA 4NNYB 2FL5B 4R7DB 3ROOA 4KI5E 2VR9A 3LIZL 4X4ME 4K3EL 3OJMB 2EEBA 5FYJL 5JIPA 4EIGB 3OJDA 1JIBA 4BA8A 4LNRA 2QQQA 3MV9A 3FRUB 4JM4L 1KNOB 3V2AR 1T1WB 4RA3A 2FHFA 3SY0A 1GSMA 4QXTA 4D0BA 2ZCLL 3TP4A 3CDCA 3VFMB 2JCCE 5EZJB 1IAMA 1NCTA 2PTTA 1QPXA 1A0QH 2AJYH 3QEQE 2XXMB 3D6GA 2ZOLA 2YMXL 5C86A 3BZ4B 3IRPX 1U42A 1VACA 3L5IA 4N0CC 25C8L 2JLLA 4UT9H 4MGXA 4PJ8A 3EDFA 3MTRA 4GUPA 1T66D 3ARVA 4N90E 5ETUB 3WSQH 2KPNA 3WYRA 3UTSD 5DJ0A 2X41A 1K3ZA 4ONHB 1IEHA 1UWGL 3M8OL 1A7RH 3MXWH 1BQHA 3MLXH 4KJWC 1OD9A 8FABA 1DBMH 3H3BC 2A83A 4XPFH 4HLZG 2B0SH 5IF0B 1DUZB 2WWKO 3DETC 4HUUB 4NNYA 2FL5A 1YPZF 4R7DA 1I75A 4XNZC 1DSFL 1QKZH 1HQRB 1IC5H 1W8OA 3CFCH 4S10A 1HKLL 4MJIE 1A3QA 4DFIA 2C5DC 2DDQH 4Y5VB 4POZD 3FRUA 1DBJH 1KNOA 1Q0YH 1T1WA 4P9HH 2HTKC 3MLRL 2W0LA 4C56E 5E03A 3VFMA 5C0JA 4LPXA 5EO9B 5EZJA 1LEKB 1GRWA 1YEJL 2ICEB 1NBQA 4MWFB 4RMTA 5KVFH 4DVBB 1S78C 4JY5H 2GFBB 3BZ4A 3FCTB 2VN4A 3ZKXC 2EDBA 3V5DB 1NEZG 2V9QA 3HC3L 3QXVA 2OXHA 2IG2H 5ETUA 3UZVB 4KJQC 1U3ZA 1WQVT 3C2SA 4Y5XB 2ZCHL 4ONHA 1Q94B 2W60B 4P9MH 3GRWA 5GGUB 2VDPH 3KPSE 4Y16B 1RU9H 2YD7A 3MJGX 3W0WB 2W91A 3FN0H 3P0VL 1BP3B 2NY7H 3TIDB 5IF0A 1DUZA 5IFJB 4DUWA 4HUUA 1UG9A 4L5FL 1MCNA 1ACZA 3UXFA 2HT3C 2CKBL 3TBVB 1HQRA 2DBLL 1YA5A 1U8PB 4Y5VA 2ITDB 1INDL 2ENYA 5D71H 3NIDF 3FRPG 1OW0A 4OF5A 1E4JA 1VFOA 4G6MH 5EO9A 2VDNH 1LEKA 4X7SL 3UYPA 5K9JH 3WEXB 2BSRB 2ICEA 5CEXB 4MWFA 4DVBA 2IH1B 3HUJF 2GFBA 4X80H 3FCTA 2R0WH 1GIGH 3BKJH 1UM6H 3LKRB 4G6AD 3V5DA 1AD0B 5D6CB 1L4IA 4ZD3L 2AI0H 5M94B 3N9GH 1HOCB 2BJMH 5TDPB 2IQ9L 4NCC1 4Y5XA 1AFVH 1Q94A 2W60A 1S5IH 5GGUA 3BPOB 4Y16A 5MEQB 2VLRE 2X1XR 1ZEAL 4P23D 1NUNB 4HK3J 3V7AG 2CK0H 4M00A 1FNSL 3W0WA 3WFBH 5C0IB 3S5LB 2VLJE 3QUKB 4XXDB 1QOKA 4F58L 2IPTL 3V7MA 4PLJC 4PRHE 3TIDA 2VUYA 3U1SH 3B5TA 5IFJA 5LXGH 3ZZ1A 1A21A 1HHKB 4NZTL 3PP4L 3QI9D 4JQVA 2A38A 3TBVA 3HR6A 3LMJL 3W5NA 1FAIH 3KXFB 5ADOH 3NCBB 1U8PA 4C58B 2ITDA 3ARFB 1NGQL 2OL3B 5CGYC 3RUGE 5I1HL 4HCRL 3RVWD 3KPRB 2VZSA 4HXAH 1QLFB 4DKFL 1F5WA 1MFNA 1GPOL 2OK0L 3WEXA 2BSRA 3R8BB 3VXPB 5CEXA 4E42B 1RIHH 3REVA 2IH1A 2YPLB 3EO0B 3LKRA 1GOGA 4GQ9L 1AD0A 1ZLUK 5D6CA 2VMFA 1U92B 2R0LH 4ZNCD 1U8OB 4GSDL 1HOCA 1CICD 4OM0H 1G9ML 1NCAH 2E7CA 2D7TL 5TDPA 1X5GA 2J4WH 4DOHB 2VZUA 3EYQD 3O2DH 2OR8A 4F9LC 5DT1H 5MEQA 2NY5H 5TH2A 5GIRA 4HWBA 3S5LA 5C0IA 1QSED 4EN3B 3QUKA 4XXDA 2VTFA 3RVTD 1AHWB 3DXAD 5GXBB 2FX7L 3MV11 1HHKA 5HHNB 5IT2L 5I1DB 1I3UA 4FFWD 2IALA 2AEPH 4K94H 5CZKA 4Y7MA 4BUGA 4YXKL 3KXFA 1WBZB 5MEPB 1EMTH 2D7QA 3JTTB 4JGJA 3ARFA 1F4WL 3E3QC 5F9JB 1SY6L 2OL3A 4L4TE 2Q87A 3KPRA 3MGOB 4IEFB 1WK0A 5ALBL 3IRZA 4GRWE 1FG9C 1QLFA 3WNNA 3RDTB 1T83C 1FLRL 4U7KA 2EDFA 4E42A 5DMJB 5M7QA 1T21B 1ZT1B 1JGUH 3BQUB 2AK1L 2YPLA 3EO0A 5CEZE 3T4AB 3CH1B 2IFGA 4E41B 5IMLB 1OTSC 3WE6B 1U92A 1U8OA 4S2SB 3KLHD 4S1SL 2PYED 3QZWB 1RUPL 3EJJX 3QIUD 5FEBA 3QHZL 1IAII 3V52L 5DHYB 3ARBB 1EBAA 2XQBH 4JG1H 1EJ6A 3ZL4L 3HAEB 2AJVH 4KY1H 3SJVB 3ZSTA 3SEPA 3LIZH 4TTGA 4K3EH 1AHWA 4RGND 3MFFB 4PGZA 2ICCA 5BOZG 5LG1A 5HHNA 2HFGH 5I1DA 2XY2A 1PGRB 1DVFB 2R29L 3NCMA 4WDIB 1UKSA 5IW6B 1AR2A 5MP6L 4WFEE 3S36H 1XH3B 1WBZA 5MEPA 3TJHC 3JTTA 5TPWH 2RBLA 4ZMAT 3MGOA 5B4MC 3RZCD 1YECL 2RCSL 4N8VG 2YMXH 2C4FU 2MPAL 2GYSA 5GPRA 3RDTA 4D0DB 1XAUA 2DQFB 2YR3A 1T21A 2I07B 4LIQH 1ZT1A 1MJ8L 3BQUA 3T4AA 4P46B 4BUHA 4I0PB 3CH1A 4E41A 5IMLA 3MRNB 3P0YL 3WE6A 4WRLA 1QFWM 3HZYA 5L8KB 4S2SA 1IGMH 3QZWA 4QT5B 3M8OH 2YA2A 3D39D 3WBDA 4X83A 1DZBA 5DHYA 3ARBA 1IGCL 1ORSB 4KAQH 3D0VB 3HAEA 4P3CL 4RFNC 4BFIB 3GBNL 4L3CB 3SJVA 2FBOJ 4OQTA 4BQ6A 3VD4A 1DSFH 3MFFA 2YPKB 5F1IB 4LLDA 1B90A 1HKLH 2YKLH 1NC4A 3B4NA 5DTFB 4KI1A 2ADFH 1DVFA 3H9YA 4LVOC 2LU3A 4WDIA 4EI5C 5IW6A 1B9ZA 1XH3A 2YUVA 1N8ZB 5EZIL 4L3EB 1CLYL 3QULB 1VERA 3VXME 3OR7B 2EDQA 4KUCD 3N1FC 4J4PA 3H2WA 3QNYB 5CJXA 4XI5D 4D0DA 5D7LE 4WV1B 2DQFA 1MFDH 2E8YA 5C09E 2I07A 1KN2L 3HC3H 2CLZB 4PG2C 5JZ7D 4M7KL 1QSFE 2A6KB 3QH3A 3BJLA 4P46A 4I0PA 4NCC2 4X6CB 2EXYD 3MRNA 1B0RB 5GSRB 2ZCHH 4D3CL 5MI0B 3MCLH 4QT5A 1QQDB 3VFPA 1JPGB 3QEGL 3IDGB 4TSBL 5F9AC 1DQQB 3Q1SL 4TULH 1ORSA 1JJUA 1LNUB 4BFIA 3D0VA 3G6AB 4PJGB 1VDGA 1AKJD 1FZOB 3MODL 4L3CA 4PRPD 4KVNL 5T3ZE 5HHME 5FM8A 2P8MA 4PB9H 2CKBH 3O4LD 5FGSA 1GHFL 2YPKA 1UJTA 2DBLH 5F1IA 1QBLH 4YHYC 5DTFA 5HDOA 1XGUB 2HJFB 5CJQL 2AEIT 1INDH 5FDYA 1RPQA 3AREC 1KPUB 5HPMB 2R0ZH 2MHAB 1N8ZA 1UZ6E 5C6TH 3QULA 4LASL 4Y1AE 5H37G 2J8OA 3OR7A 2HTKD 4JDTL 4J1UB 5J12C 1TNNA 3QNYA 1GJIA 4JR9L 4Z7WB 5E8PB 5DSCB 1FZKB 5MHSE 2VE6A 2ZUVA 3OAZK 3QUYD 4F80A 3HR5B 4Z95H 3UPCA 3BRGC 3LEVL 3OQ3B 4LFHD 4WV1A 5T5FL 1S78D 3N1PC 2DN7A 2CLZA 4ZD3H 2A6KA 3QA3B 3L7FB 1NL0H 1QUNA 2VXSL 5CGTA 5CUSH 4X6CA 5JXEA 1B0RA 5TE6H 2JB6B 4FQXB 5GSRA 4HEME 4F7CB 4KJQD 1WZMA 3S6CA 3QQ9C 5I6XC 4OLYL 1E4WL 1F90L 1QQDA 1ZEAH 2FB4H 5KVEL 1IC7L 1JPGA 2AW2A 3IDGA 2A73A 3BIBX 1DQQA 2GSIB 3BP5B 1P6AB 1J9CT 4F58H 5JW3L 1LNUA 1YNLL 3WN5B 3G6AA 4PJGA 4PJAF 5EDXA 5F3HA 3V6OE 1FZOA 1EEQA 1FVCB 4NZTH 4HF5L 4KJYB 2A6JB 3O9WD 3KJ4B 1YJDC 3NBNA 3AB0C 2Z93B 3KYOB 3LMJH 4NM8H 4OI7A 3ZE0E 1U2HA 1VKXB 3OB0H 4KDTA 3A0OA 5CWSA 2HT3D 1XGUA 2HJFA 2JTDA 3MJ9L 3OKNB 1KPUA 5IHBA 5ILTL 5HPMA 1OP9A 2VWEE 4QHUB 5HYSG 2MHAA 1XGQB 1R3IL 2NTSP 1UEYA 1GPOH 2L4OA 4J1UA 4KUZL 1I8IB 2OK0H 4IJ3C 4Z7WA 2Y1VA 5E8PA 4Z7UE 5DSCA 3W5MA 1T2XA 3HR5A 1F00I 4JN2B 4LAJH 4GQ9H 4UV4L 4F8QA 2W59A 3SE3C 3QA3A 5I0ZA 5F9OL 1ZANL 3L7FA 3QWOB 3WXVL 1UXSB 2JB6A 4FQXA 1U8JB 5EOCL 3MRCB 4F7CA 1DCLA 2P8PB 5F44A 5IVOA 3VGBA 3DHMA 1DN0A 3VGFA 2GSIA 3BP5A 4ORGB 1PSKH 1CD8A 3WN5A 2JK5B 3HFMH 3BSZL 4JFQB 1FVCA 5IT2H 4CN6A 4KJYA 3H6JA 2QQKL 2A6JA 4PLJD 4H8WC 2Z93A 3KYOA 1KXVC 4YXKH 3SKNB 4GRLC 1FRGH 3MMEB 1RZIB 5DYOB 1VKXA 4EOWL 1WWCA 5IB4B 3B9DA 3MV7E 3OKNA 1LO0H 3IDYC 2BDNH 5ALBH 4Z7OE 4QHUA 1R3LB 1MI5B 4NWTL 1JNJA 5DJAB 1XGQA 5KVGH 4OCYL 5CGYD 2VDQL 5C0CB 1I8IA 4ZS7L 1WZ1L 4GO6B 4AEHL 1FYTE 3VH8G 2AK1H 4JN2A 2NXYD 2DYPB 2NY6C 5BS0E 4V1DB 4NT6B 3QWOA 2ORBL 1LVEA 1BOYA 4U2ZA 3OKDB 1UXSA 3CFBB 3QHZH 1CTNA 3V52H 3MRCA 3HC4L 3QUZD 2IAMC 3V95A 2VISB 2QKIB 2P8PA 3L95B 4WW1B 1BBJB 2DAVA 4OM1L 2NXZB 3NGBC 2XYCA 4X99B 4ORGA 4ELMB 3HG1E 3QEUA 4HWNA 2JK5A 4JFQA 2XZCL 3CMGA 4FHBD 2NY0B 5F7KC 3QPQC 4M8QB 5KVMC 4LEOB 1JE6A 4OLZL 3SKNA 2EDLA 5MP6H 1F4HA 5DYOA 3MMEA 5C07E 3I9GH 3G6JB 5J06A 4ZTPL 3GIZL 5IB4A 3OBAA 4ZUUB 1HXYB 1MCPH 1R3LA 1MI5A 1YECH 2RCSH 4IRZL 5DJAA 3IDXL 3MLYL 3ZKQD 1L0QA 5C0CA 1UXWB 4OQ1A 2LVCA 4TVPD 1MJ8H 1CFNB 5DVKA 4HFWB 5SV3A 1FFNB 2DYPA 3E8UH 5CEZL 4V1DA 1HINL 4DQOL 4LVHC 3TYGH 4NT6A 5FYLE 1WCQA 5IMOB 3OKDA 4UT7L 3UJJL 1OTSD 3CFBA 2YBRB 4NO3B 1QLEH 2NX5E 2VZOA 1D6VL 1IGCH 4KKNA 3T3MF 2VISA 2QKIA 4GKZB 2BERA 3L95A 2WLZA 4P3CH 2DQEL 4WW1A 5KS9F 4WFHE 1CR9L 2EE2A 1BBJA 1FSKC 4X99A 4ELMA 4ENEC 1NJ9B 1K4CB 1BQUA 5I1KH 1OT1A 4G6FB 4ZAKB 5C0FB 5CFHA 2ADIB 1YY9C 4M8QA 1AE6L 4LEOA 4GMSH 1ORQB 4JDVB 1AY1L 3G6JA 2PTVA 4LCWD 5EZIH 1CLYH 3KLSA 5TFSL 1A7QH 2GJ6D 5T1DH 4UINH 2CSPA 4ZUUA 5D7KD 1F58L 1HXYA 3TJHD 3FB5B 4W6YB 3TWCH 1ODAA 3ZHLA 5DI8B 5B4MD 4XPBL 2NW3B 1A47A 1CFNA 1I1AD 4HFWA 3C08L 2PNDA 5LGHH 1FFNA 5DQDH 4NQEE 1RZ7H 1EGJA 1Q9OB 1UENA 3TC9A 3C5ZB 4HIIB 5IMOA 4CBPA 3K8KA 2HFFB 1MFEL 3KYNB 2YBRA 4NO3A 1MREL 3QEGH 4TSBH 1J5OL 4F7TB 3Q1SH 4OJFL 4PJ7F 4GKZA 3VFRB 5E99L 3V0AC 4ZFZB 1NDGB 4KVNH 3IFPB 1NJ9A 1K4CA 1GHFH 1OAXL 2YHGA 4P2QD 2CLVA 3FO2B 4J3WA 2L7UA 4ZAKA 4KQ3L 1ZOXA 5C0FA 4YDJB 2ADIA 2ZCKL 5CJQH 4PJCB 1J1OL 1ORQA 4JDVA 4PJDB 2W92A 4RAUB 1Z9LA 5K93A 3MV01 3SKOB 1XR8B 2HWZL 1F8TL 1DQDL 3CMOL 3FB5A 2BRRH 1JFQL 4XPGH 4HUVB 4OZFB 4ODSL 3LEVH 5DI8A 3O3BB 3CXDL 4YFLF 4LGRB 5T5FH 1X4XA 1UM4H 2NW3A 4GAFB 4OFIA 3VW3L 3GHBL 3W9DB 2MQ0A 2VXSH 4Z77B 3CZFB 1Q9OA 1JL8A 3C5ZA 4HIIA 1G6RB 4ZUSB 4ZOEA 2HFFA 4Y5VC 4OLYH 1F90H 3KYNA 2OZ4A 1IC7H 1XIWC 3C60B 5AEAA 1OW0C 4F7TA 3FQWB 1Q9KA 2LVEA 1T80A 3VFRA 5JW3H 1YNLH 1CFBA 5EIVA 1NDGA 3LHPL 2WNGA 5A40E 2PO6B 4N9GB 4X6FB 2APTA 1QBML 3IFPA 3DOSA 3AAZB 4GJTB 5HDLA 5T3ZL 2VUOA 3FO2A 1IFHH 2W0KA 4NNPL 4YDJA 4MNQB 3MJ9H 1NKRA 5FHBH 2FD6L 4PJCA 3QWRA 4XC1H 4PJDA 5MERB 5ILTH 4RAUA 4NKIH 4NDMB 2XV6B 3SKOA 4UIKH 1XR8A 3PUCA 3ARED 2IJ0C 4WHTB 1R3IH 4KUZH 1HZHH 1PG7L 4W70A 4HUVA 5GGTA 1T7VA 4OZFA 2DLIA 3JWDL 4OCSH 1QA9B 3QDMD 3O3BA 5FKAA 4UV4H 2DLGA 4L1DA 3QPXL 1KEGL 2X9WA 5F9OH 3W9DA 1ZANH 3WXVH 4UNUA 4Z77A 3VD5A 3CZFA 4JQVC 1U3YA 4AM0B 1G6RA 1FORH 4ZUSA 1KTRL 1A7PH 4Q9QL 3S37H 4XPAL 4TOYH 3C60A 3VE0A 3QQ9D 4H1LH 3FQWA 2FO1A 2P5EE 1MIEL 3BSZH 4AIOA 2PO6A 4N9GA 4X6FA 1JYNA 3AAZA 2XY1A 5SWSD 1YNKL 3QBTB 4MNQA 3X11B 1CLZH 3EDDA 2XN9E 1A8JH 5MERA 3OKYA 4NDMA 2P48B 3BRDA 2AJZB 4PBWD 1ZVHA 4OCYH 4WHTA 5EWIH 3U9PH 1RJZB 4MJ2A 4ZS7H 3BPOC 5D70H 2D3VA 4XBGB 4AEHH 2VL4A 4C57C 5F8RC 3F58H 1P4LB 4JO2H 3WNKA 1QA9A 1S9WB 2AK4B 3S3SA 4Q9RH 5I15L 4JPVH 2BSED 3DWTA 1SEQL 2ORBH 3MBEB 1MAJA 4PP1D 4AM0A 1KC5L 1MCOH 4JO1L 3J8F7 4PJIE 1G7LB 1C1EH 4JKKA 4QNPF 1P2CB 4DZ8B 4U6YB 1MNUH 4Q9BA 4JFEB 4GRMB 1VA9A 2Q8AL 2VC2H 2ATKB 1CK0L 5SWZD 4LGPB 4O5LL 4XVJL 4F9PA 5FECB 4X7FC 3TLRA 2PXYD 4G3YL 3D9AL 1E4KA 4OLZH 3B8YA 4ZTPH 3X11A 3GIZH 3OKKB 4YDVB 5IESH 4MXVF 1XF5B 1UCBH 4QRRB 3KWWB 3BRFA 2AJZA 3V5HB 4IRZH 4Y8AA 1VFMA 3IJSB 4YBQC 3B2UD 3HZMB 3IDXH 4UDUB 1RJZA 1NMCB 3RX5A 3VFGH 1NMAL 4XBGA 3UJTL 1WZKA 1CL7H 1OSZB 2F74B 1P4LA 5D1QD 2AKRB 3D3VB 1S9WA 2AK4A 2LTQB 3SKJH 3GM8A 4MB4A 2BOCB 1V7ML 5FCSH 1AHWC 1HINH 2V2WB 4JFHE 4DQOH 1CDHA 3B3IB 2H2PD 3MBEA 3OB8A 4GXVL 2NY6D 4UT7H 3UJJH 3RKPA 2VXQL 3VXQB 2KBGA 4FNLL 2A9NH 1F45A 4LPTA 1G7LA 1D6VH 5FO9B 1P2CA 4KDWA 2E6JA 4DZ8A 1FZJB 4U6YA 3ME0A 2OJEB 5D5MB 4JFEA 4GRMA 2IAMD 5EU7E 2ATKA 2I25N 3QDGB 3UAJC 1J87A 3TO2B 5GS0C 3IS1X 1AE6H 2Y36H 4NOFA 5L2KE 4M43L 2WSKA 3QPQD 3OKKA 1CFVL 4IM8A 4YDVA 5TFSH 3VI4F 4X9HA 1XF5A 1A7BA 4QRRA 5C70A 1F58H 5FV1L 3KWWA 1OCWH 1HHIB 4PTTB 4YAQB 3V5HA 3IJSA 3NACL 3HZMA 4UDUA 3PQYD 1YEKL 4XPBH 3ARBC 1C16B 2YD4A 4PS4L 5GRVK 5GRXG 3SDCC 3RFZC 2R0KL 1YQ2A 1OSZA 2F74A 2AKRA 3C08H 3D3VA 1H0DB 3L3HB 1ND0B 1J10A 2BOCA 5I2IB 1IGIH 2V2WA 4FQCL 3B3IA 3VXUD 2VSDA 3M07A 3ZDYF 3S9DB 1DVFC 3GBMH 3VXQA 5FYLL 1MFEH 3U4BH 1MREH 2XKNB 5FO9A 4X5WB 4O2FB 2VH5L 3MV9D 5E99H 3ZTJH 1FZJA 4PLKC 2OJEA 5D5MA 5I8EB 3I84A 2DMBA 1LO3L 5I8OH 5GGRB 4MHHG 5CJXC 3QDGA 5BO1H 1EDQA 2DQJL 4HJ0C 3D87B 4JFXB 3BKYH 4JO4H 4KQ3H 1TVBB 2QSCL 2HH0L 4G8GE 3ESUF 5E5RB 3TO2A 4ENED 2ZCKH 5CBEB 1JRHI 1OGAD 1I4FB 1YYLL 4P46C 4I0PC 1BEYH 3UTTA 5BVPL 1YY9D 4ZFGH 2HWZH 1HQ4B 3BPLC 1F8TH 3I3BA 4PTTA 1DQDH 1HHIA 1MRDL 3CMOH 3DVIA 4YAQA 3T3PF 1RUKL 2W9LA 3V0WL 2GW5A 4OZHB 4ODSH 2QHRH 4JGUA 4G9FB 3FQUB 4OLUH 4OZ4B 3CXDH 3LCYA 3RTQC 1JP5A 3H9HB 4HUMB 3TM6A 1H8SA 4GKOA 5E7FA 3F7RA 2FATH 3GHBH 1H0DA 2DLEA 5BV7B 1Z5LB 3L3HA 4U2YA 5FYKE 1ND0A 1RIUL 5I2IA 4U31A 2ZPKL 2BNQD 3WDHA 2W9DL 4YLQT 1BJMA 4L4VE 3I6KB 4NO5B 4OGXH 5CLWA 2XKNA 4PJBE 4X5WA 4O2FA 4CADB 1TTUA 4ZTOH 4BZ1L 5I8EA 3EYSH 3LHPH 3O11A 4LPYA 4JFYB 1CTOA 5AYQA 3BP6A 4NYLB 5GGRA 4HCRA 2F8OA 1ZHLB 3PG2A 1Y6NR 5IGXL 2NZIA 5T3ZH 1HDMB 4JFXA 2KUTA 2D7NA 1IT9L 1TJHH 2FGWL 4WV1C 1TVBA 5JW5B 3C2AL 4YC2B 3ILQC 1I4FA 3BN9C 3NA4A 3C6LD 3HMWH 5F71A 3T1FB 4P99A 5JHLL 5JXEC 2Y9RT 5IM7B 1HQ4A 1GGCH 4JHAH 1TCRB 3DURB 4KKBC 5MI0C 1PG7H 5CP3H 5IB1B 3QFJB 2C3VB 4OZHA 4LP4A 3JV6A 5J4MA 4G9FA 3FQUA 4WUUA 4OZ4A 2KDGA 5FUZL 3QUXD 3E6FB 4TUJB 1X5LA 3H9HA 4IS6B 2G2RB 3GB7B 2PN5A 3A6OA 1Z5LA 1UZ8B 4F15C 4PGEB 3SBWA 1U3HB 2ID5A 3WKML 1Q72L 3RBSA 1QYGL 3OB0K 3I6KA 4Q9QH 1VENA 5DRWB 3DO7B 4HKZB 1F6FB 4NO5A 4PJHF 3BVNB 3K7UA 1NCDL 1MIML 3LKNB 4CADA 5L0QC 1G7IB 4D8PB 4NHCL 2X2YA 4PJIF 3L3GB 4HMCA 4MQXD 1AR1C 1XCTB 1WZLA 4JFYA 1AD9B 1AQDB 1XIWD 2Z8VC 4OKDA 3L5WB 1SY6A 4NYLA 1YMHB 1ZHLA 5L9DH 1HDMA 4LU5L 1YNKH 1FIGH 4A2LA 3D48R 5JW5A 3X17A 5E2UL 2VXTL 3VXRE 1MCQA 2XZQL 4WJ5B 5IM7A 5J13B 1TPXC 1TCRA 3DURA 4EEEA 5C08B 4YHPA 2OM5A 5IB1A 2C3VA 2X4RB 2FECL 3BUYB 1XGTB 3E6FA 4XCNB 4TUJA 2BVYA 4OT1L 5AYUH 4IS6A 2GHWB 2G2RA 3GB7A 1SEQH 3W0WD 5AZEL 3PXJA 1UZ8A 2MFNA 3MOAH 5D2NC 4B0MM 4PGEA 3KJ4C 1U3HA 5I30L 4ZUTB 1KC5H 4JO1H 4MNHB 4YXHH 1QRKA 5DRWA 5F88B 3DO7A 4HKZA 3BVNA 5I74B 5IBLC 2EDWA 3LKNA 1G7IA 1JF5A 4D8PA 3L3GA 1CK0H 1A6WH 1NFKA 1XCTA 4O5LH 4XVJH 1AD9A 1AQDA 3QQ4B 3BJ91 3L5WA 2DQTH 5FF6B 1YMHA 5EA0H 3RQ3A 2JCCB 3S98A 3P11L 1AJ7L 4LAQL 3D9AH 3QEQB 2ESVB 5F96H 4TNWK 3LKPB 3VGAB 4QRPD 5AAMA 1A2YB 4OD1L 4Z7NE 2LU4A 3PP3H 1IAIM 4OZGB 1A64A 5FDWB 1IM9B 2XOTA 4PY7B 4W4OA 3ZE1F 3WHE0 4B5EA 3G6DL 3QWQB 4YDKL 2X5PA 5DJ6B 1N4XH 1NMAH 2N7AA 5C08A 3VG0L 3UJTH 4WWID 4AL8H 2Y5EA 4XNMB 2X4RA 1R6VA 3BUYA 1XGTA 1SM3L 4XCNA 1MHEB 2BNRE 3TPUB 2FH8A 3P73B 4GXVH 2VXQH 3GMMB 1WISA 2YUZA 4M48H 1MAMH 4ZUTA 4GW5B 1DFBL 4MNHA 1HWGB 3OAUL 2R1WB 3ZE2F 1ACYH 4X4MA 1J1XH 5IFHH 4UIMB 4H26B 1D5IH 3KXFD 4XB8A 2FJGB 2QSQA 1BIIB 5ISZD 4WY7H 5DJ8B 3QQ4A 1ZSDB 5FF6A 3GJFH 2JCCA 2GAZB 2NMSA 4KKCC 5K9OB 1TMCB 2EIEA 3UC0L 3QAZB 1ZGLB 1GGTA 3QEQA 2ESVA 5I1IL 3CNKA 3LEYL 3QCTL 3LKPA 1A2YA 5FIEA 4JO3H 4XP4L 4OZGA 4BM7A 1LDPL 5FDWA 1IM9A 5ICYB 4PY7A 5H94B 4RDQF 3ULVC 3RHWF 5T1MB 1YEKH 2X6MA 4LSTL 4PS4H 5DJ6A 3RNQB 4HQQL 4HULB 3T2QA 1I3GH 3GI9L 4B7LA 1HWHB 4XNMA 1OPGL 5BRZD 1GC1L 4OF3A 4P9HC 3LQAC 4PRBB 4H1LG 2IEPA 4WFFE 2IADB 2Z8WC 4WO4B 1MHEA 1JZ5A 2FBJL 3L5JA 3TPUA 3P73A 5FK9B 5C3TA 2V7HB 2NY0C 4KK9C 1AQKL 3LQMA 4GG6E 5FYLH 3PV7A 1HKFA 4GW5A 4TVSa 3GMOB 1MHPH 1BVLB 2R1WA 1NAMB 1GGIH 1MRFH 4UIMA 4H26A 1BD2E 2FJGA 5T3XE 1BIIA 5IROA 1JZ3A 4Y4FB 3CX5K 4KTEL 2WK2A 4GLRH 3MRMB 5DJ8A 3JXAA 5GHWL 3IYLW 1ZSDA 43C9B 4ZPVB 4HKXB 2QSCH 3LPFA 2HH0H 1H8OA 2AQ2A 1RUML 2GAZA 5K9OA 3ARXA 1ZGLA 3UAJD 5BVPH 5GS0D 2NZ9C 4OKVB 3LV3B 5LQBL 3B43A 3KG5A 4KZEL 3VI3E 4E41D 4X4ZA 2HRPH 3MLSL 4OCMC 4JHWL 4LRNL 4ZSOB 1B3JA 1RUKH 5ICYA 4K9EL 5H94A 5EIIB 5T1MA 4TNVK 3RNQA 2EH7H 1G9NL 3VDAA 5CJ8A 3BEWB 3SDCD 4PRBA 1RIUH 2VLRB 5GSVB 2IADA 3WD5L 4Y89A 1NQBA 4WO4A 2ZPKH 4UUJB 4ZAKC 2V7HA 2VLJB 3SCMA 3Q0HA 5DJXB 4NCDA 3GMOA 1NC4D 4WI4A 1BVLA 3BO8B 4HK0B 2I26N 2DI8A 4KH2A 1NAMA 3S88L 5GRYA 2DLTA 4Y4FA 4KQ4L 1A3RH 5IGXH 3MRMA 5E00B 4ZPVA 4HKXA 5IVXF 3EBAA 3C2AH 2LQRA 2OR7A 4KTDH 3CK0L 3BGFB 1B4RA 4ZFOB 2V5SA 1UH2A 3BWAB 1MY5A 1YMME 1AGBB 4FQIL 1NLBH 4KXZH 3EO1B 4OKVA 4L9DA 3C5ZC 3EGSB 3LV3A 4ZXBC 1BHGA 4P46D 1I7RB 4K55A 4LHUG 4LVEA 4ZSOA 4MA1B 4EXKA 3MREB 5EIIA 3EW3B 5FUZH 1VEOA 1JNHB 1KIQB 4K8RC 4JQXC 3OPZL 1MCRA 3MUJA 3BEWA 5I1JH 3RTQD 4RMRA 2VLRA 5GSVA 3DVNB 2QV2A 3O81A 5FYKL 2Z31B 1Q72H 4UUJA 3OR6B 2VLJA 3TJEH 4FFYL 5DF0A 4RRPA 3QG7L 4XVTL 3GFUA 1UADC 1MIMH 3BO8A 1DTUA 1IGYB 4N0UB 4XCEA 3U82B 4OF7A 1CDIA 1OARL 3MOBL 3HE7B 1TVHB 4I18B 2H32B 4FQHB 3N0PB 4JY4B 5E00A 3CU1A 4L4TB 3ULUE 1MCJA 4KMLB 4LU5H 3FL7A 3RPIB 5LVEA 1KB9K 4GRWB 3NH7L 1LE9B 5DZOA 3DNKA 4ZFOA 4FXLA 4H0IA 3MRPA 5E2UH 3WXWH 4D9LL 3BWAA 1AGBA 4XRCB 3EO1A 5E2TL 3EGSA 4O9HL 3ILQD 5KAQF 2NY3C 3VRJB 1I7RA 3BD4A 4S11A 4YUEL 1L9NA 5JXED 1WWBX 3HC0B 4PUBL 3QRGH 5F6HJ 3MREA 4K94C 4KKBD 3C60C 3P9WB 1JNHA 1S7QB 3N85L 4OT1H 1KIQA 4RMSA 3ZTJG 1ZHNB 2I60L 2KQMA 5KBNC 3DVNA 1NANH 5I30H 2Z31A 1PG7X 1UH4A 3OR6A 3B9KB 1IGFL 2X9XA 3GSNL 3R8QA 1SYSB 2A2QT 1KTDB 1IGYA 4N0UA 3IKKA 2XPGB 3HE7A 3UJIH 1TVHA 2V5TA 2WQRA 3ZT7A 2MWCA 4I18A 5DFWH 2H32A 3TO4B 4FQHA 3P11H 4JY4A 1AR1D 1AJ7H 3QCUH 3FFCE 1IKNA 2CRIA 4L4TA 4UT6L 3RPIA 3T0DA 1LE9A 5IFAH 2QL1A 1VADB 1MFCH 3P3YA 4OD1H 4BFGA 3PL6B 1CYGA 1MF2L 1PY4A 5E2WH 4XRCA 2R4SL 3VRJA 4YGAB 3G6DH 1QZ1A 3OTTA 4OGYL 3VG0H 3HC0A 3O3EB 1KCSH 4PRAB 2DKSA 1SM3H 4J12A 3MRIB 1S7QA 4Z0BL 2XTLA 5GZOD 5JW4Q 1ZHNA 2VDLL 4EZMA 1HEZB 1R3KB 3B5GA 3TZVB 4FQJL 4I0KA 1E4KC 4RIRB 4U05A 4R4FL 3CSPA 4JVWA 3B9KA 3VFUB 1SYSA 4GG6F 1KTDA 1I8LA 4LCYB 2VZTA 2XPGA 1F4XL 4MVBC 2DQDL 4PJ9B 4BYHA 2B4CC 3TO4A 3VXMB 1U41A 2DM4A 1OAUL 2DMKA 3UC0H 4DCQB 5I1IH 3C5SB 3LEYH 1VADA 2M1KA 4XP4H 2WP3T 1BLNB 1QSFB 4QTHA 4AG4L 3UBXB 5I1GH 4LSTH 4HQQH 5LCVL 3J7HA 4KHTL 5HHQB 4DAGL 3O3EA 1OPGH 5D93B 1MQKL 4LHQB 2X70B 4K2UH 4PRAA 5J1SC 3QFDB 4FABL 4WNQB 2FBJH 1B0GB 3KPRE 5E94B 4I3SL 1D6EB 1RJYB 4KRPB 1HEZA 4YHMH 1R3KA 3LPWA 4BQ9A 3TZVA 3EYVB 1OTTC 1WT5A 4RIRA 4JZNB 3I6LD 3GSOB 5HHMB 1I9IL 5EZLB 4YWGL 4TTDC 3VFUA 4NGHL 2YPLE 4P3WA 4TPRH 2YWYA 1A4JA 4LCYA 4RAVB 3RIFK 3ARZA 4ODBD 1J0ZA 1S7XB 1NMCC 1N5YL 1MI5D 5HGGS 3VXMA 1TJGL 4Y1AB 1U95B 1EPFA 1C08A 1PQZB 4DCQA 1HNFA 4Y0GA 2ZKHL 6CGTA 1P7QD 3C5SA 2R2BB 1KIRB 3IETB 2HTLC 4KKCD 1DE4B 5E2VL 3ZO0A 3F8UB 2AXJA 3ZLQC 1BLNA 2VIRB 4HC1L 3ZSSA 5JPMB 4V1DD 3MLSH 4JHWH 2J5LB 3BOVA 4K9EH 1INQB 1QSFA 3UBXA 1NKOA 1NFDF 5HHQA 1N59B 1ROWA 4WWKC 4NBZB 3IXAB 4G7YH 2X70A 1FYHB 4OLWL 2NLJB 4KWUA 5D7IB 2XG5A 2D7MA 3QFDA 1N6QH 4WNQA 1I1RA 2CRZA 2CUMA 1B0GA 5E94A 3OXRB 2VR4A 1D6EA 1RJYA 3CX5J 4IHOB 3EYVA 4JZNA 5B21A 3GSOA 4KK9D 1J1PL 3I50L 2A6IA 3S88H 3P0GB 1DQJB 5BMFL 2X4SB 3ELAT 4RAVA 1WF5A 1KELH 3P40A 5T3XL 5HBBA 1S7XA 2HT4D 3DO3A 2A77H 4X8JB 4Y1AA 1U95A 4KKAC 1PQZA 5CP3A 5ICXA 3CGTA 5KSVB 1EHLL 2YRZA 1VFAB 4FQIH 2R2BA 1KIRA 3IETA 4Z7UB 3ULSB 3ZHKA 2BX5A 1DE4A 4L8DB 3JV4B 3ZYOA 2VIRA 5JPMA 1U91B 5BXFB 2NZ9D 4DN3L 1F02I 1INQA 2YS4A 1N64L 2AJ3B 1MAKA 5D1ZC 2WWMC 4GBXD 4OFYD 3IXAA 4RWYH 3WO4C 4CMHB 4BQBA 3RVUC 2B20A 5D7IA 3T08A 1RZKL 2Z4QB 5C9KA 5D7JC 2N56A 3FZUC 3BKMH 3OXRA 35C8L 1CGUA 4M6NL 4PR5B 4FFYH 2J6EL 4IHOA 5CEYB 3VD3A 1JYXA 3QG7H 5DDHB 2RGSA 4LMQI 4B41A 1BWMA 3P77B 5GQBA 1DQJA 4HWZB 2ICWB 3BMWA 1D7FA 2X4SA 1XR9B 1T22B 2FO4B 3MV7B 1G9MC 1UYWH 3OXSB 2Z91B 3NH7H 5A2LH 5DUMH 5HYJE 4X8JA 2GK0B 1F2XK 3VRIB 4QLRA 1EO5A 5HD8C 4WHCA 5KSVA 1LO5B 1NAKL 3C8KB 3DARA 1FYTB 1VFAA 3H8NA 4CN1A 4Z7UA 3ULSA 3SBWC 4O9HH 3OKMB 3NA9H 4LPVA 4L8DA 3VFVB 3JV4A 3RWHB 1OTUC 4YUEH 5BS0B 1U91A 5BXFA 3RU8L 1CVRA 4PUBH 3C5ZD 4ZXBD 3FN3A 1JZ6A 3H42L 2AJ3A 4E5XB 4NQXB 5ENWB 1NCBH 4YDLC 1HIML 2I60H 5D2LF 2R1XB 3MLZL 1BVZA 2AXFA 4B50A 4L3EE 4XCFH 4K8RD 3TBYB 2Z4QA 3IXTB 1MJ7L 5JIIA 3EYUL 4PR5A 5CEYA 3HG1B 3IAQA 4YC2C 3TNMB 3GSNH 4LLQB 1Q0XL 5DDHA 1MELA 3VRLF 1KB9J 3X13B 1CD0A 4NN6C 4PREB 5KSBB 4S0SD 5J1TC 1AGCB 3P77A 1MVUB 3QWRD 4U3XA 2G9HB 4ZO8A 5B3JE 5C07B 4HWZA 2ICWA 5GJTL 1XR9A 1U8NB 1DEDA 1T22A 2M26A 2FO4A 1F4AA 3MV7A 4LNVA 3OXSA 3MA7B 5EOCJ 4MA3B 4UOJA 2Z91A 1ZAGA 4RGMB 4Y2OA 3ULUL 2GK0A 3VRIA 1LK2B 1P5UA 1I9JL 1LO5A 3C8KA 1MF2H 1FYTA 4XVSH 4WTZA 1U3HC 3OKMA 5ELIA 1AH1A 3BD5A 3VFVA 2UWEB 3RWHA 5BS0A 2EE9A 2VDKL 5I18L 4LSPL 2NY3D 3ALXA 2QBWA 5I71B 4E5XA 1WC7B 4NQXA 5ENWA 4FFVD 3O0RH 2GSGB 3AS0A 2NX5B 2VERN 4K3HA 3U6RB 3C60D 3TPKA 5B3NA 2GEEA 2R1XA 4OSUL 2HT2D 5JHDD 1FV1B 2HN7B 3TBYA 3ZDZE 2COQA 5ESQB 3IXTA 3HG1A 3BZFB 4R6UA 4Z7WE 3AM8A 1NUGA 2P7TB 3TNMA 1P69B 4LLQA 3X13A 3JV5A 5L8LB 4YHOL 4PREA 1J8HB 5KSBA 3PP3K 3PWNB 1AGCA 1MVUA 4W4OC 2G9HA 4LOUC 4NQDD 5C07A 5J13C 2DQDH 4JHZA 1Q8MA 4HIHB 1U8NA 4DTGH 4R4ND 1OAUH 4Q9CA 5D72L 3MA7A 4JVPA 4MA3A 4H5SB 4DK3A 2FJFB 4UTBL 1LK2A 1S7WB 2ICES 4QOKE 5FCUH 2DJSA 5C0AE 4UB0H 1SBSL 3QSKB 1YNTB 5GS1B 5H35B 1FPTH 3SHSA 4KI5C 1H9VA 4NQEB 3KAAA 5AZ2L 1WC7A 5FYJD 4WUKH 2GSGA 4JN1H 4FABH 2NX5A 3U6RA 2MKLC 2E9IA 3BAEL 1IZKA 3NMEA 1KF9B 3Q5TA 4N5EC 1FV1A 1MRCL 5JQ6L 2HN7A 5ESQA 1QPPA 3BZFA 4YWGH 2QQNL 4NGHH 3VGAC 4G43B 2E7MA 3BYYA 1J8HA 3PWNA 4XC3H 3CLEL 2R2HB 2BZDA 1XF3B 3PGFL 3U2SB 4HIHA 2VABB 3TT3L 4XBPB 1EUTA 4D9QE 4PJ5B 4EVNB 4MVBD 1AI1L 2H1PH 4H5SA 1QRND 2ZKHH 2FJFA 5CJOH 4UQ3B 4XAWH 5INCB 1S7WA 5C7XL 1YEGL 2AK4D 5E2VH 5F1NB 2DQUH 4HC1H 4HWBL 1HK6A 4X8XA 1YNTA 1IC1A 2YD1A 5GS1A 5H35A 4NQEA 3MZGB 1C5CL 1WFOA 2YD6A 4MZ2A 3TVMC 1CGXA 4LSRL 4X6BB 5IROC 3AU1B 4FN0A 1PBYA 4UOW1 5CIPB 2ARWA 4NUGH 2OL3L 4LCUB 4XNXL 4MDIB 4OGZA 3O6LL 4YX2L 3QAZC 5C0CE 2KZ1B 4XP5L 1J1PH 3I50H 4XX1G 1HHHB 4G43A 1OTTD 3QEHB 1OAQL 4OD2B 3H9SB 4TTDD 4WGVB 5T3XH 1GH7A 1SBBA 2R2HA 1XF3A 3U2SA 4YDIL 1U6AH 3Q2CA 1H3GA 4R0LB 3DYPA 2VABA 2AS5M 4XBPA 5FM4A 3LN5B 4FRWA 4NZJA 3ULVE 4PJ5A 4EVNA 4ISVB 2Y6SC 1EHLH 1HXMB 3MXVH 4UQ3A 5INCA 4WO4C 2EDHA 4LPWA 3S35L 4K7PH 4JRYB 5F1NA 4MD0B 4QTIL 3SCMC 5IMKB 1TTFA 3U7YL 4ELME 2HTLD 4HJJH 3VD7A 1N64H 4IRSB 3IJHB 4M03A 1PDKA 4CGTA 4XB7A 3VXSD 2F53E 5DVMA 1CGTA 3HNVH 4GMTH 4HBCL 2WANA 4NKDB 4X6BA 3AU1A 4Y4FC 1RZKH 4WWKD 3UMTA 5CIPA 1FL3B 5TQ2H 2D31B 35C8H 3D25B 4M6NH 2IFFH 3QDGD 4LCUA 2EICA 1BOGA 2R69H 4MDIA 4DZBB 1VSCA 3Q6GH 4YPGB 15C8H 4WEBH 1UCTA 1HHHA 1AC0A 5I66B 2IC2A 3UTTD 3C8DA 4OD2A 3H9SA 4QXGL 5DVNA 3EIFA 4Q97A 4R0LA 3DIFB 2EDJA 5B3JF 3LN5A 2VO5A 5T1KB 4NJAL 1S9VB 3CSGA 4X6CF 1HXMA 4Z7VE 4M1CC 5IOPB 4AQ1B 3VMNA 1F2QA 4JRYA 1P1ZB 4MD0A 5IMKA 3RU8H 1TNMA 4FMKA 1OHQA 3QO0B 4IRSA 3IJHA 2OS7A 4TSAL 4PJGF 1WAAE 1HIMH 1XFPA 4U7SA 5D1ZD 2V6HA 3MLZH 3T8XB 4NKDA 2WWMD 5ADPH 2EYSB 1CT8B 4TUKH 2EDTA 3UTPE 3LOWA 1MJ7H 3EYUH 1Z6JT 2D31A 3D25A 3RVUD 5IUSA 4NNXB 1IM3B 3BGFC 4DZBA 1NGYB 5D7JD 3NIGE 1Q0XH 3FZUD 4YPGA 4Z0XB 5IEHB 4U33A 1W0VA 3MLUL 1W2KT 1XT5A 5I66A 5B8CC 2GKIA 1CL7I 4Z7WF 5GJTH 4XPTL 4QRQB 2XN9A 4MA1C 3HN3A 5HHOD 4APQB 4KVCL 4PG9B 5IBTH 3U4EB 4M7ZC 3DIFA 2FEEI 3ULUH 5E6IB 3GRWH 5T1KA 1S9VA 1CDUA 4WUUD 4ETQB 4BK5A 4J2XA 5IOPA 5LGKA 1WWAX 5HD8D 5KSAC 4XWGL 1P1ZA 4HIEB 5I1EL 5FGBA 1IKFH 1PZUB 5I18H 2PW1B 2P5WB 4XAKE 2NY2D 3QO0A 2P4AB 3RRQA 3BISA 4KK6C 4PJCE 2JJTA 2D4FA 1RHHB 3Q6FB 3HE7C 2ZWLT 1JHKH 3T8XA 3BN3B 4I18C 4HW6A 5F7MC 1CT8A 4UMGA 5IBUG 5F6IB 1IKNC 3OL2A 3HLAB 3WIHA 4YZFF 4NNXA 1IM3A 5EZOL 1NGYA 4Z0XA 4YHOH 5IEHA 4S1DC 1ZHKB 4PRID 1EX0A 3U7AA 4RDQG 4NC2B 4R8WL 3S34H 5DC9B 4QRQA 3RGVB 1KCUL 3K2MC 4APQA 1PKOA 2F8XC 3BDXA 3U4EA 3G5ZB 1X5ZA 5E6IA 2EECA 4PP2B 3LKQB 3T2NH 1FNGB 1NUFA 4ETQA 4I8DA 4X9FA 4M4PA 2FDBP 1FCGA 1SBSH 1V05A 2ZUSA 1KLGB 3DMMB 4G6JL 5KW9L 4HIEA 3CH8A 3R1GL 3G5XB 1KOAA 3RWDB 1OVZA 2PW1A 3B9KC 1WTLA 1L7IH 1U3HD 2P5WA 5AZ2H 5I76B 3DRQB 4NC0B 4ODVH 2IBGA 2OCFD 1I8LC 1ZV5A 1FNFA 1VPOH 4K3DL 2ICWJ 3DUSB 1I3VA 1RHHA 3Q6FA 1MCKA 3BAEH 2ZUYA 1FQ9C 3TO4C 2XT1B 1KJ2B 1MRCH 1RQ5A 5JQ6H 4IOSD 4W4NA 1KCVH 4ONGL 4PY8J 1C5BH 3HLAA 4FP8L 3BI9X 1HHGB 2EO9A 3CFDB 4YHZL 1YEEL 1ZHKA 2C4XA 4G8GB 3AUVA 3DI3B 2GK2A 3CLEH 2WLYA 1OP3H 1T03H 2XTJD 3WFEH 1OAKH 3RGVA 1KJMB 4D9RD 1DR9A 4MMZC 4LOUD 2LAGB 2F54D 1Y6MR 1AI1H 3UBXI 3WMSA 1VGEL 3G5ZA 5C0BE 5E08H 4PP2A 1CIDA 3VWKB 3LKQA 1YEGH 3LN4B 1FNGA 2WM0A 5E5MB 3MRGA 3VFTB 3ULVF 4HWBH 5DK0B 3TZVC 2XWJB 1KLGA 1KTKE 3DMMA 1WT5C 2E27H 4X7EC 2GY5A 3LB6C 3LQZB 5JR1L 1FGVL 3G5XA 3RWDA 1C5CH 5HGAB 5I76A 3DRQA 4ELMF 1ADQA 4L4VB 4Y4KB 2DWDB 4KI5D 3WUWG 4LSRH 3NFNB 4PJEE 4NM4L 3DUSA 3OMZA 4JFZL 2YXFA 4PJBB 4CU6A 2OL3H 3N1QC 1IRAY 3I2CL 3O6LH 4FA8A 4YX2H 3G6JF 3KPLB 2OTUA 2UYLB 5C0NC 4LVNB 4WI8A 1ONQB 5D1XB 3B2VL 1HHGA 3U7WL 3F5WB 4OTXH 3MRQB 1X5HA 1RUAL 4HGWB 5DEZA 4G8GA 1OAQH 5BQ7B 1XGPB 2DM2A 1MCWW 1NC2D 4C4KT 1II4E 4YDIH 4U1LB 3TH3T 1YY8B 1KJMA 4P2RE 4N90D 4QRUB 1A3LL 2X4TB 5D93C 4EXPX 5E70A 5J57B 3HB3C 4UZGA 3O2VL 1TFHA 3TYFB 4BSWB 2IANB 3VWKA 5IHZB 3S35H 3LN4A 1CF8L 2YEZB 4AEIL 5E5MA 4QTIH 5J7CC 1KCRH 1S9XB 2H6PB 2DD8H 4KRPC 3U7YH 3EYFB 3VFTA 2R9HC 2QR0B 2X89A 5DK0A 2XWJA 4XMLL 3ALWA 2F5AL 1JPST 3LQZA 1PFCA 4OFKA 3MRJA 5HGAA 2UZIL 2C1PB 4L4VA 4Y4KA 2DWDA 3NFNA 4X6DE 3NZHL 3QYCA 2E7LA 4QRRE 4MJID 4NIKB 1EBPA 1LD9B 2WQ8A 3JWOL 4JRWA 4PJBA 3TVMD 3ARDB 4PRDB 3KPLA 2YA1A 2R2EB 3PWPD 5I0DA 2UYLA 5IHLB 2O5XL 3JWDC 1ONQA 4C56D 5D1XA 2BRQA 4JB9L 5DQ9B 4ACPA 3F5WA 4QXUL 3MRQA 4YFLI 3QUMB 3D3VE 5KAQG 4HGWA 3RHWK 2N4IA 4H88L 5BQ7A 1XGPA 1JNNL 5EORL 4WCYL 3VMPA 3BT2H 1NFIB 1QR1B 1UM5L 4U1LA 4L8SB 2EDEA 1YY8A 4NJAH 5MENB 4QRUA 2X4TA 3ISWA 3D5OF 3SQOH 3ULVL 4BFEA 3Q48A 1A22B 3TYFA 4BSWA 2IANA 5D5ME 5IHZA 2CDGB 3KYAA 2YEZA 1EHNA 2Y6SD 3HAEH 3KPSD 5T1LA 1S9XA 2H6PA 3VJ6B 3EYFA 4LCCB 2QR0A 1RK0B 1MPAL 2N7BA 4WO4D 3V6OC 4NFCA 3TA3A 3ECBB 1WIOA 3CFIC 3SCMD 2VDML 4TSAH 3MSPA 3E2HB 4NO0B 4OCLC 4GAGL 2C1PA 4MB5A 4XZUB 2CDFB 4A6YB 1H15B 4OFVA 2VWEC 4I9WE 1LD9A 5HXMA 2ICWI 4PJCF 3ARDA 1CGSL 4PJDF 4Y4FD 5GJSL 3T0EB 2N1KA 4PRDA 5ITFB 3MX0A 2R2EA 1EO8L 3RX8A 5CKAA 3KDMB 3MLUH 3MUZ1 4LEXL 4KTYA 5DQ9A 4IDJL 4PY8I 3QUMA 3SKMB 1BZ7B 5E9DB 4XPTH 2E7HA 3U0WL 3M17B 3NPSB 3ARWA 1NFIA 5JORB 4KVCH 4HPOH 5CZVH 4KDVA 1QR1A 4JFFB 4L8SA 3BKCH 1SMAA 2BP3A 1WFTA 4XNYH 5MENA 3DX6B 5IWLC 4PLOB 1TVDA 4M9PA 5HDBE 2CDGA 3MRKB 2E5EA 5I1EH 2CUIA 3VJ6A 1J0IA 1M7XA 4M1CD 5JW4N 4LCCA 4P4KB 1RK0A 4X5XB 4RGOL 2BNRB 2FHBA 2APFA 5DRZB 3ECBA 3VDCA 5L88L 2CRMA 1JPTH 4HFUL 4M7JL 4PRHD 4S1RL 1KCLA 4HEPG 4NO0A 4Z8FL 4OLXL 3W82A 2F15A 4XZUA 4PJAB 2CDFA 4RX4A 5BJTB 3MJ8B 1B2WL 4A6YA 2YK1L 1H15A 1REIA 1Z0NA 3O3AA 1CXHA 1T0PB 3T0EA 5ITFA 2JE8A 2VYRE 4GXUN 7FABL 1JRHH 1ZMYA 4NZRL 3KDMA 1P6FA 1TZGL 2AXGB 4WFGE 3KPQB 3SKMA 1BZ7A 4LKXB 4OCWL 4JFDB 5AG9A 3AGVA 4AZ8A 1CBVL 4MX7B 5C92A 3M17A 3P9LB 4Q2ZB 5JORA 1RZFH 3T2OA 4JFFA 4CVWA 1HN1A 4JRXB 4OF0A 4XMPH 1NBZB 3GKWL 3BHBB 5KJRL 2OZ4L 3DX6A 3GKZA 4OUUB 5FGRA 4U7MA 5F7DB 4G6JH 1U0QA 3MRKA 2UY6A 4ODHH 1I9RL 4P4KA 5DWUL 4EUPB 2DQGL 4X5XA 5KSAD 1X5JA 2BNRA 4ETYA 5DRZA 4GLRI 1CDCA 5IV2B 5B38B 1DL7L 1A9EB 4WEMB 2VN7A 1EAPB 4PJAA 2YXMA 3MJ8A 1BD2B 4M7LT 1QFUH 4NN5B 4RGMC 2HJKB 4LSSL 3QFJE 4YHZH 1BAFL 4L4TD 1YEEH 4Q74A 4KPHL 5DURD 2B1HL 1Q38A 4M6OL 2AXGA 5F7WC 1BQHG 4P5TB 3KPQA 1PJ9A 4BKLB 4JKMA 4S1DD 4LKXA 1SVCP 3WKNA 4JFDA 3C9NB 1G0YR 5IQ7L 4MX7A 2FGZA 1ERNA 3P9LA 4Q2ZA 3QHFL 4XNUL 1ED3B 4M62H 4JJ5A 5I71C 5CD5C 1VGEH 1H3VA 3NFSL 4HSQA 4JRXA 1MWAL 4DVRL 1NBZA 3ZKSD 5J11B 3UYRL 4XXCC 3BHBA 5KZCB 3DPBA 3EHBC 4X5LA 1RZ8B 4OUUA 4QHMB 4MA7L 4U0RB 5F7DA 1DBBL 5EU6E 2A0LC 4Z18A 4OBSA 1FGVH 1KB5B 4EUPA 5E8DH 4R7NB 1DBKL 4XBEH 1EAJA 3KYMB 5IV2A 5B38A 4FXGB 1A9EA 3B9KD 5HHXL 4JFZH 5JO5B 5L2JB 1I7UB 5K9KB 1EAPA 3H3PL 4LF3B 3I2CH 3GNMH 2G60L 1BD2A 4WFED 4KXZI 1Z3GL 2Q86B 3TO4D 5C08E 2HJKA 4HD9A 1OQXA 1RUAH 4QRPE 4HT1L 4NPYB 4UTAL 1HH6B 2A1WH 2C3GA 4FQQA 1LO2L 4ZO7A 1JTPA 4P5TA 5GS1C 4BKLA 1Q1JH 1KJVB 3C9NA 4I2XE 3L5XH 1T1XB 3UTSB 1ED3A 3ES6B 1UB6B 5C0EB 5HVFB 3S3PA 3R0NA 5K59F 3O2VH 5CAYB 5DLML 3NAAH 4AEIH 1ZKAA 3V4VL 2V17H 1RZ8A 1DJSA 4QHMA 3BE1H 1Z0MA 2DIJA 3DSFH 2F5AH 3TV3H 5D5MF 1H3UA 1KB5A 5E4EB 3TZVD 4R7NA 2J6EA 3CC5B 4JFOB 1QNZH 2ESVE 1A6PA 2EDDA 4O2CB 3KYMA 1BQSA 4FXGA 5D7SH 1K3IA 3FB7B 1EJOH 3NZHH 3SGJC 5ISZE 1FLTX 2XWTB 5FAAA 1JYVA 3OKEB 3SDDC 5JO5A 5L2JA 1I7UA 2MCPL 4OZGE 5K9KA 5IJKA 4LF3A 4DWHA 1F3DH 4N8CH 1FNLA 1CS6A 2O5XH 2FZ3B 5E1AB 5F7EL 2Q86A 3VXMD 4JB9H 2EEAA 5JMRA 3CIQA 1HE7A 1T89A 2B4CL 5C0ND 2XZAL 4NPYA 4AQOA 1E4XL 2ATPB 4DUVA 3HMXL 1HH6A 2FECI 1JNNH 3VWJC 4ORZC 2ILLA 1NGPL 2R56L 3HI6L 4KK8C 5D7LD 4QWWC 1KJVA 5C09D 3DV4B 1YMMA 2WBJD 1T1XA 2LAAA 3HNSL 3UTSA 4RFEB 1FG2B 3ES6A 1UB6A 5BRZE 5C0EA 1NANI 3TT1L 3L3JB 4QRSB 3ULVH 3V7AE 3SDXF 3HB3D 3GMNB 2BY2A 1MPAH 1E6OH 3LQAH 3O2WL 4BSVB 2YRPA 3SGDH 4KRPD 2R9HD 3HE6C 2VQUA 4WENB 1JGLH 4K71B 4PJ7B 3CC5A 4GAGH 1IBGL 4JFOA 5T3ZD 5HHMD 3TFKC 4O2CA 3FB7A 5FB8B 3S35X 2I5YL 2EH8L 2XWTA 3OKEA 1P4BH 3DRTB 3AS3A 4OIIL 2IBZX 4NP4H 4NKOB 3FO1B 1EO8H 3KJ6L 2FZ3A 5E1AA 4LDEB 4LEXH 1WLHA 4IDJH 4Y1AD 1FO0B 4QGYA 1D9KC 5F97E 3FFCB 3S7GA 4A2MA 3V6BR 1RJLB 1MCDA 3BZEB 4OZHF 3U0WH 5MHSD 3S5LG 1XGYL 1EGJH 4P0DA 4IRSC 1LEIB 3DV4A 5EU4B 5F7YC 4RFEA 2G5RA 1FG2A 1Z9OA 1EZVY 5DD1H 5SWQB 4LPCA 1SHMA 3L3JA 4QRSA 4XP6H 2P42B 1QTYT 4OD3L 4P23B 3GMPB 1EUUA 1MJUL 1Y18B 2IWGA 1QVOB 1GGBL 3GMNA 1B88A 1EFXB 4WU7B 4RGOH 5C0DB 4S1QL 4BSVA 1KFAH 5L88H 3QI9B 2FNBA 4HFUH 4M7JH 2NPLX 4XPHH 4S1RH 5DRXB 5HI5D 2AJXH 2OI9B 3C87A 4PJ7A 5IMMB 1P4IL 1IQDB 1QFHA 1WEJL 4EDXB 5FB8A 1LK3H 1B4JL 5E7BA 2WUBL 3DRTA 4ZSOE 4PLNC 4UBDD 5IJVB 4NKOA 4I4WB 7FABH 1KYOJ 3FO1A 4NZRH 1T3FB 1S7UB 4TNWF 5F1SA 4NFDA 3FQNB 3LDBC 2DI7A 2JKXA 1FO0A 1TZGH 3FFCA 1RY7B 5IB2B 3DX7B 3P30L 2JJWA 4OCWH 1MCCA 1R5WB 3GSVB 5FGBC 1RJLA 3BZEA 3IF1B 1CBVH 3WNLA 5FOJA 4UV7L 4C59B 2Y25A 5ESVB 1CICB 1LEIA 1HCVA 5F7HA 2EE6A 2JJTC 5SWQA 3QG6B 4PFEA 3CVHB 1K8DB 2OZ4H 5LBSH 4MXWL 5HGBB 4IMKC 4P23A 3GMPA 4K8RH 1Y18A 5EULV 1QSEB 1QVOA 4Y8DC 1I9RH 3ROLB 1EFXA 3OGCB 5DWUH 2DQGH 3ARSA 4WU7A 2O61B 5C0DA 5GGSY 3DXAB 4F57H 4DKDC 4LSUL 1RIVH 4ZG1A 3RY6A 3QI9A 4XP1L 1DL7H 4OCRL 5DRXA 4QEGA 4P49A 3RY5A 1RUQL 5IMMA 4DN4L 3TBTB 2A74B 1LWRA 1IQDA 4EDXA 1G7PB 4APQC 2KKQA 2MSPA 3P4LA 4O02L 2D03L 2JF1A 2EEDA 1TJIL 5E6IC 2VLLB 3MV7D 5IJVA 5F3BB 5HI3C 1BAFH 4I4WA 2IBBA 5JOEA 5GGTH 1MLCB 3N50A 1T3FA 3QZWG 1K4DB 1S7UA 4MS8D 4OZFH 3FQNA 1GC1C 2CMRH 2B1HH 3BGMB 3ZT6A 3ZYZA 4M6OH 5CSGA 3THML 4Z76B 5IB2A 4GW4B 1T0NB 3DX7A 4I0CC 2P49B 1R5WA 2VL5B 3GSVA 1ZA6B 5KANG 5IQ7H 3HAEG 3IF1A 1FYTD 3T0XA 5BV7L 1HSBB 2VRAA 2O5YL 3MLPA 3VGHA 3FQTB 3WFDH 1TZIB 4BFBD 5ESVA 3GI8L 5BS0D 4CL7A 5I16B 2CD0A 1G6RH 3NFSH 1A9BB 5J89A 4Y88A 3QG6A 3CVHA 1K8DA 1RI8A 3QISA 4N0UE 5HGBA 1DBBH 4FQLL 4KI5F 4MAYD 5EU7C 1HH9B 3WCYA 1AGEB 1QSEA 1MLBB 1ZGLM 5GGVY 3OGCA 4DGYH 4RGNB 2O61A 1DBKH 3DXAA 3R06B 4ZO9A 2A9ML 4HUNB 2O5ZH 4YE4H 4GH7B 2HKFL 5HHXH 1EXUB 3EZJB 3TBSB 3TBTA 2JCCF 3VXPA 2A74A 3OF6A 3VA2C 1OP3K 3RGVC 4B7IA 1G7PA 4RMVA 4JLRB 3LD8B 5GZNC 4UU9B 1A6VL 4XH2B 5C07D 3EJZD 4K9EC 3T0BA 3BESR 1HCFX 1GYAA 2VLLA 5F3BA 1MLCA 1LEGB 2D0HA 1K4DA 3PHSA 1G9NC 4FZ8L 3QDJD 3I3DA 1CI5A 4RAHA 3BGMA 1LO2H 4Z76A 4GW4A 2VL5A 1ZA6A 2J7LA 3IFNL 5T33H 2Y06L 1HSBA 5CLTA 3FQTA 4O2EB 3IFLL 4TNVF 5DD3L 1TZIA 3F7QA 4EN3A 1F4YL 2HKHL 1I85A 4UILL 5A43C 4N9OB 5I16A 3WLWC 4JPIB 1A9BA 3D39B 4CW1B 2W1NA 5FYJH 3MNWB 1D5ZB 5FYLD 3VXTB 4QHLB 2VDOL 5CD5D 3BPNB 4F3FB 4JM4H 3UO1L 3IGAB 2NX5D 4GAJL 1HH9A 4G7VL 1AGEA 2ZCLH 1MLBA 4NQUA 5F9JA 3VDBA 4WFHD 5DC0A 3HKFA 3R06A 2FIRT 5CKGA 3WDJA 3VD9A 1EXUA 2VAJA 1KEML 3GMQB 3TBSA 1XF4B 1GOHA 3U36B 4GOSA 25C8H 1TQBC 3DVGB 1ITCA 4XP9L 4H0GA 2VZ1A 4JLRA 4UU9A 3K80A 4XH2A 2D2OA 1BJ8A 3H7LA 1FFPB 3VWKC 1J0JA 1BECA 2B4CH 1LEGA 3JTSB 1E4XH 4DKEL 4AT6B 2YD9A 5HYJB 1UWGH 2EDRA 1NGPH 2BXYA 3GZKA 3PWLB 4CAGA 4OIBA 4MLIA 5F7FA 2QADC 1AGFB 1UKTA 5AD0B 5TGBB 4ZODA 4O00A 4XWOD 1SEBB 4O2EA 3DJ9A 5CCKL 4Y4KC 4JPIA 4CW1A 2E7LC 5DR5L 1D5ZA 3PE9A 3X3FL 3VXTA 4QHLA 5EBMB 2G75B 3IGAA 3K74B 4HKJB 4N1CA 5DHVB 3O2WH 3MLRH 4LVNC 1AKJB 1X44A 4PRPB 5DK3A 5D1XC 5TDNB 1YEJH 4UAOC 1IBGH 1MCEA 5TE7L 3OG6B 4F2MB 5HVHB 5HVGB 3KLAB 3GMQA 4X4YB 1XF4A 1BIHA 3U36A 4NRZB 4GS7B 5FHAL 4OIIH 1DDHB 3DVGA 4PV8B 3SDDD 1ZVYA 1S8DB 3ZKNC 3LEXB 4N0CD 1LE5B 1FFPA 5J8OA 2JELL 1E6JL 3QUYB 2AERT 3JTSA 4AT6A 5HYJA 1QEWB 1H3WM 4CJ0A 4BJLA 3PWLA 3T65B 2YUWA 3TA3C 4QKXB 1L0XA 3P0VH 1AGFA 3VWJD 3DTXB 3PDOB 5AD0A 5TGBA 4KK8D 1SEBA 3F65A 4QWWD 4N0RA 4KJWD 4L5FH 2VLME 4Y2DB 3LSOB 4NQCD 1X3DA 3DETD 4OD3H 2GI7A 5EBMA 3ARDC 4AEEA 4JCLA 2G75A 4F7EB 4HKJA 5DHVA 1AKJA 4R2GB 4L3EA 5TDNA 2OTPA 5JNYB 1P9MA 3O9WB 4X7SH 4G8IB 5A16B 3RUGF 3HE6D 3OZ9L 4F2MA 1UWXH 3RPKA 1B4JH 5FO7B 3KLAA 4X4YA 2WUBH 2J8UE 4NRZA 5DGQA 2OBGA 3TFKD 3SO3B 3SE4A 3MROB 4PV8A 4QO1A 1OB1B 1S8DA 3LEXA 3AMLA 3NPZB 4HH8A 1LE5A 2WINB 2IQ9H 1OL0A 3QUYA 3VGDA 2XA3A 5F1KC 3ARTA 1KBGL 1QEWA 3L5HA 4LCCC 5D7IE 1D9KD 5LGJB 1FNSH 4QOKB 4N1HB 5C0AB 5HSFA 2IPTH 3PDOA 3E2HC 5FGCB 1NBVL 1T5XB 3PP4H 4Y2DA 1K9TA 3LSOA 2XI9A 4D2NA 1NAML 5BVJB 3ARRA 3ZKMC 4F7EA 1NGQH 5I1HH 4HCRH 4ESKA 3RIAF 4LQ1A 4LSUH 3WUZA 5IHUL 4XP1H 2P5ED 4DKFH 5JNYA 5M95B 3O9WA 4G8IA 1RUQH 5E5UB 4WI2A 4DN4H 4N0FB 5A16A 3NPSC 2NY1B 1FZKA 3SPVB 1BBDL 4HZLB 5FO7A 4GRWF 1OP5H 2VJXA 4MNGE 1TENA 2JJVA 4KRNA 4JQIL 1BQLL 2XN9D 3MROA 1PX3A 4AJ0A 1OB1A 4RISL 5E0QA 4GSDH 1QO3B 2W38A 5HHVL 4BH8B 1G9MH 5EC1B 3PGCB 2D7TH 3QJFB 2WINA 3W11C 3FHQA 5T1KD 2CR6A 3THMH 2NXYB 43CAB 4P4KC 5BV7H 5LGJA 4URTB 4QOKA 5C0AA 3GI8H 1DLFL 4POYA 4OZIE 2FX7H 1T5XA 3QUZB 2X4OB 2UVFA 4FQLH 1CZ8L 5JUEL 1EVTC 3V9FA 5BVJA 1W72B 5JTWA 2VLKE 5D96B 1F4WH 1FFRA 1SY6H 4MB3A 4IIQB 4JREB 1X9QA 4MQ7B 3NCJL 4LLYB 2HKFH 5F7UA 3KNBB 4U1JB 1FLRH 3RIFF 3ARYA 4N0FA 2Q7NA 4EDWL 4ZFOL 3U30B 3SPVA 1NGWB 1RZJL 4HZLA 5F21B 1A6VH 2Q8BL 2CK2A 1X7QB 1T7ZA 3LY6A 4APQD 5JOPE 4S1SH 4P59L 1QO3A 1G1CA 4FZ8H 4BH8A 5EC1A 1RUPH 3PGCA 4R9HA 5E6ID 3QJFA 2JIXB 2JB5L 4YPJA 5HI3D 1U8JA 3CUPB 2VB5A 1M05B 1JPSL 4LK4A 4M5ZL 43CAA 4P2CG 4LSQL 3ZL4H 3K8LA 4YIQB 1OAZL 3IFLH 5DD3H 5IR1B 1YDPB 2AJSL 5KN5B 4JFHD 4JKWA 2ED8A 4ERSL 4PIRF 4G8FB 3TESA 2FHCA 3MUGB 3QUZA 1AO7D 1QSZA 5KSBE 1BFSA 2MJWA 2X4OA 2F53B 2BHZA 2R29H 1RZIA 4GAJH 4G7VH 1W72A 4NN5C 1T0MB 1NUDA 4BZ2L 4IIQA 5HGHB 2LU7A 5B39B 4MQ7A 1UC6A 2MPAH 4LLYA 4F33B 3KNBA 4U1JA 1KEMH 2K1MA 3EOTL 1V3LA 2EKJA 2VOTA 3BDYL 4LCWB 2EIBA 2GJ6B 3K2UL 1NGWA 2HG5B 1A6UL 4AMKL 3RWIB 5L2KD 2UWEE 1T20B 1X7QA 4M3JA 1B6UA 3RGVD 4K7FB 3P0YH 1YEIL 3SDAB 2JIXA 3A6BL 4U0RC 4NSKB 2WBWB 3CUPA 1I1AB 1T83A 5EUKB 1RZKC 1M05A 2B1AL 1R5VB 1WCBB 4Z7VB 1DEEB 1LP9E 3PWJB 4YIQA 4D0CB 3GBNH 5IR1A 3ARPA 3K4ZA 1YDPA 4Z7QE 5CCKH 3ZDXE 1AXTL 5KN5A 4G42B 5DR5H 1T2QL 4G8FA 3X3FH 1J8HE 3MUGA 5C2BL 2F19L 3WLWD 2DQHL 5IJKC 2F53A 2X4UB 4PJ8C 3MACL 3C09B 1AIFB 3B9AA 1T0MA 4GFTB 1YZZA 4RFNB 5KSUB 5HGHA 4P2QB 5L7XL 5B39A 4RFOL 2BHUA 4OZFG 3WHXB 4F33A 1UZ6F 3FOLB 4LIQE 1T66C 1UXWA 12E8L 5FHAH 3W81A 4LCWA 1KN2H 4LVOB 3T77B 2GJ6A 2HG5A 4M7KH 4RA0C 2HVKB 3RWIA 3VGEA 1T20A 2YN3A 4NC1E 1V3KA 1NCWL 4K7FA 4NN7B 3O3UN 4I1NB 5GISL 5EC2B 4D3CH 4HJGB 3SDAA 4Q58C 1JZ2A 4YEEA 2ZJSL 3VWKD 4NSKA 5EO0B 1I1AA 1W0WB 5EUKA 3KHOA 1R5VA 1WCBA 4Z7VA 1DEEA 1KIUA 1EVUA 3PWJA 4D0CA 1FE8L 4XMKL 3MODH 5FYKD 2QADD 2AV7B 1UFUA 1FBIL 5DRNB 5I17B 5I73B 4G42A 3QRFM 1RK1B 4L4VD 4Y4KD 4EI6B 1WAAA 2BCKB 2X4UA 1AIFA 3D2UB 4MZ3A 5EUOE 3M45A 3SGKA 2V2XB 1E28B 4LASH 3ZE0F 2I9LB 1SJXA 5KSUA 4EI5D 3ULUC 4JDTH 4P2QA 4PJ5E 5GRUL 1BF2A 4EIZC 1A0QL 5GRZA 1CGYA 2H45A 4JR9H 3EFFB 3WHXA 3MOQA 1FL5B 5HI4C 3I02B 3FOLA 4YHYB 2P45B 3GK8L 3T77A 1CU4L 3H9ZA 5IVXB 2HVKA 3AREB 4FQ2L 4Z7UF 4NRYB 3O45B 1EFQA 1QD0A 1VB9A 5EC2A 3ZKND 3QDMB 1MWAB 4HJGA 4U1HB 1KBGH 2DI9A 2DBJA 2BVTA 4GW1B 1E4WH 5KVEH 1A7RL 3MXWL 2PUQT 1U93B 1H3PL 1W0WA 5EO0A 3U4AA 3MLXL 3AROA 5IEKB 5T1LD 4XPFL 4HS6B 4ZFZA 1M71B 4K71C 1NBVH 3TA3D 1OOAA 3T04D 2AV7A 1L9MA 4HF5H 3SQBA 5C2UB 1QKZL 5JDSB 5DRNA 4M6AA 5I17A 3CFCL 1RK1A 4M7LL 4ELKB 1NAMH 5IW1B 4EI6A 2DDQL 1X6LA 2BCKA 3H9SE 3IDUA 1DBJL 5DEFB 2EDXA 3D2UA 2GITB 1QSVA 2OSLB 1GXEA 5E4IA 2V2XA 4N1EA 1E28A 3EOBB 2I9LA 4Y5XC 3BMVA 4J3SA 2WP3O 3LAFA 1ETZB 4X0KB 5SWSB 4CUCA 1G84A 4Y16C 4JY5L 3EFFA 2ZG1A 4Z7OF 5C9JB 1BBDH 1FL5A 3I02A 4JRYE 2ARJB 5FO8B 4XNQB 3FMGL 4JQIH 1BQLH 5ITBL 4UI2A 3AREA 2IG2L 4RISH 3S4SB 3VXRD 4NRYA 3O45A 2H9GB 4P23C 2QEJA 5EOCH 1GAFL 3QDMA 1MWAA 2BC4B 4IJ3B 4U1HA 3PF2A 5C0BB 4GW1A 1RU9L 1U93A 2BHYA 1BX2B 4JM2B 5IEKA 1GGUA 2VQ1B 3IAPA 3FN0L 3QI9C 1DLFH 4HS6A 1M71A 2HFTA 1UGNA 2OI9C 3FJTA 2VNCA 2QQKH 5JDSA 4GKNB 1HYSC 5JUEH 2JJSA 4ELKA 4EOWH 5IW1A 2AABL 4RX4D 4PJEB 5DEFA 1NCCL 3QXAB 2GITA 2MQ3A 1YEFL 3RZWA 4OGAC 2OSLA 4NWTH 3LZFL 3ZKMD 1CLCA 3EOBA 2PXYB 3NCJH 4U1KB 3P4NB 4N68A 2VDQH 1JMZA 4JKLA 1ETZA 4X0KA 5SWSA 1O7VA 5BOPA 1WZ1H 4EDWH 2C1OB 4MCZB 1KULA 5C9JA 5LWYL 2R0WL 2Q8BH 2C9AA 5FO8A 4XNQA 3WJLA 1DN2A 4WHDA 1D5MB 2NQCA 3IDYB 2D0GA 4P59H 3S4SA 4YFEA 2H9GA 2JB5H 4P2RB 2DTML 5D1QB 1T6VN 3HC4H 1S5IL 2BC4A 4LP5A 1JPSH 3GSWB 4M5ZH 2HJLB 5C0BA 1LHZA 4LSQH 1T7XA 3IFOB 3ARFC 3W11D 1M1SA 4Y19E 2WBKA 3FT3B 1BX2A 4JM2A 4OM1H 3RWGB 2VQ1A 1U3JA 2GIYA 4P4KD 3BIKB 3VFWB 5D8JL 5LXGL 4M3KB 3UPAA 2XZCH 2BY1A 3IKCB 3CCHB 3NIDE 1PAMA 2EKSB 4GKNA 4Z7QF 1FFOB 3ZDXF 4CVXB 1VEPA 5ADOL 3MRHB 4X6DB 4PJEA 4HG4K 4R97B 5DHXB 3QXAA 3HUJE 2HA1A 4GRLD 2H32H 4LMQE 2Y5TB 1JHLL 3NGBB 3M1BB 3P2TA 3OGOE 2PXYA 4U1KA 3P4NA 4PRIE 1KGCE 4GRWH 5JDJA 3MLYH 2W07A 4JG0L 3EOTH 1RIHL 3BDYH 1CDJA 4FG6C 5C0GB 4MCZA 3P9MB 4AMKH 3HMXA 3KLHC 1DLHB 4EN3C 1I85C 5CEZH 5JXAL 4JANB 2OYPA 1A4KB 5KANI 2P5WE 2R0LL 2I27N 1D5MA 1YEIH 3PQYB 1NCAL 2MMXA 4P2RA 3A6BH 5FV2A 2J4WL 5D1QA 3O2DL 4M93B 5FA4B 2RB8A 3BD3A 3GSWA 1IAKB 2HJLA 2YN5A 3IFOA 2NY5L 2DQEH 3O41B 1EA9C 2X44D 3FT3A 2QQLL 1CR9H 3VXUB 3RWGA 1AXTH 3BIKA 3VFWA 3RDTC 4LVHB 3AY4A 5FECA 3OJDB 5C2BH 2F19H 2IGFL 3IKCA 2R39A 2DQHH 3CCHA 5I9QB 2CO7B 1BPVA 3BQUC 2EKSA 2EDYA 3GJEB 3LD8C 1FFOA 1AY1H 1JWMB 4FTVE 2EIDA 4CVXA 4D0BB 4XVUC 3MRHA 4X6DA 1BD2D 5T3XD 2Y5TA 3M1BA 4RFOH 5A1AA 1OGAB 1T7WA 1WIPA 4L8BB 12E8H 1I3RB 2XTJE 1J05B 3ILPB 5C0GA 5J3HC 1FDLL 1JGUL 3P9MA 5CSZB 2F54E 2E9WA 5FM5O 1DLHA 5H37H 4JANA 1A4KA 5GISH 1U8IB 3BPNC 3PQYA 1ZT4B 4LLAA 1IGTB 1JGDB 1X4YA 3BX7C 3CSBA 5HJ3B 1SMOA 5KZCD 1J5OH 5FA4A 4OJFH 4JZJB 1IAKA 4M6ML 3SGEI 1F3DJ 2AJVL 3O41A 1NFDB 3CJJA 2BNQB 4J4PC 3X3GL 5L8JB 2Z92B 4PGCB 5E8EB 2GJZB 1FBIH 1OAXH 2HLFC 2I24N 5F1OB 2HFGL 3QT2A 1J1OH 3GJEA 3UP1A 1CFQB 2CR3A 1JWMA 3S36L 1FZMB 5TPWL 4PJ8D 5C0JB 1E27B 3HCVB 4XI5C 1ZTXL 1X5KA 4XGZB 5GRUH 4IOFC 1XCQB 3FT4B 1JFQH 1WV7T 5CBAB 1OGAA 4HXBL 5JZ7C 3RVVC 2I9TB 2PYFB 4L8BA 4EQ3A 3C6LB 3O4OB 5CINL 5EU3B 1C16A 3LS4L 1I3RA 1J05A 3ILPA 2EXYC 3OSKA 3GK8H 1INEL 1CU4H 4LIQL 3VW3H 1JTOA 5CSZA 1RAMA 5GS2H 2QLVB 4FQ2H 1YMMD 1KJ3L 5DD6B 2X9YA 1OWRM 1U8IA 1IGML 5JIKA 5FYKU 1T5WB 1ZT4A 3QUXB 1IGTA 1JGDA 1QACA 4Q6IB 1H3PH 5HJ3A 5GRVL 1JK8B 3GSQB 5HYEA 4JZJA 1OF2B 1P9MC 4KAQL 1NFDA 3TGXA 2BNQA 4D94A 3MR9B 2Z92A 4PGCA 5AWNL 3AS1A 5E8EA 2GJZA 1QBMH 2YA0A 5HVHC 1T1ZB 1UWXK 1C8PA 1MFBL 2CXKA 2YKLL 4MMXC 4M7LH 3KS0H 3NIFE 4JDZB 4GS7C 4NNPH 5E2JA 5CBEA 2ADFL 3HI1B 2D7OA 2FD6H 3SE4C 3D69B 5GGSB 3WS6A 1CFQA 3PWPE 3G5VB 1QFPA 1XIWB 3UTQB 1FZMA 1WBYB 1E27A 3HCVA 1FP5A 1A1MB 3QUYC 4XGZA 1XCQA 3FT4A 3FO9B 5CBAA 2IANE 3JWDH 3ULUD 4RMWA 2I9TA 2PYFA 3C6LA 1C7TA 1G7QB 1MFDL 2W9EL 5EU3A 1KPVB 3FMGH 3QPXH 1KEGH 1KG0B 5ITBH 3FHAA 3REWB 5HI4D 1A1OB 1N26A 3QB7C 3KPPB 1D5BB 4Y2DC 2P1YA 1PKQE 5DD6A 4AY0A 2X1OA 1GAFH 4KDTC 9CGTA 1T5WA 3QUXA 3MCLL 2AQ1A 4XPAH 2GTZB 3BIAX 4Q6IA 1MQ8A 1JK8A 3GSQA 4TULL 4R2GC 1OF2A 1MIEH 3O9WC 4NQVB 4I5BB 5EU6B 3MR9A 2AAVA 1QBBA 5GGRY 4PB9L 5D2LB 3C5JB 4L3AA 5IK3B 5KVDL 1T1ZA 4PJXB 1QBLL 4KU1A 4JDZA 1OP5K 3MV8E 2AABH 3CU7A 3HI1A 3SO3C 4HIXL 3D69A 5GGSA 1NCCH 3G5VA 1BFVL 1YEFH 2R0ZL 1CG9B 1XIWA 1BZQK 3UTQA 3T1FA 1WBYA 3LZFH 5C6TL 4EKXA 2H3NB 3WV0A 4FQXC 1A1MA 1QHPA 5F9WB 5MENE 4FQPA 5DK2B 3REVB 2X10A 3FO9A 5CGMA 2Q1EA 2R23B 3QFJA 3FFCD 5LWYH 1NEUA 4QRPB 1ZVSB 4Z95L 2BVQB 1G7QA 4M1DL 5I15H 1KPVA 4Y16D 3O8XB 1KG0A 5I75B 1NEZB 3WN5C 3REWA 1A1OA 1NL0L 3KPPA 1D5BA 5CUSL 4I2XB 1I1CA 5TE6L 4R3SB 2DTMH 3HNTL 3X14B 3DSNA 4QY8B 2ENSA 1ZGLP 5TH2B 3PDGA 4DGVL 2GTZA 2FB4L 5GIRB 4Y4HB 2D9CA 2Q8AH 3T0EE 1EFXD 2BSTB 1S7TB 1JWSB 1NMBL 4NQVA 3OG4B 4I5BA 5D8JH 5EU6A 3CDGB 2Y07L 5J6GB 3RGHA 2IALB 3C5JA